data_1YI2
# 
_entry.id   1YI2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1YI2         pdb_00001yi2 10.2210/pdb1yi2/pdb 
NDB   RR0113       ?            ?                   
RCSB  RCSB031535   ?            ?                   
WWPDB D_1000031535 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YI2 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tu, D.'       1 
'Blaha, G.'    2 
'Moore, P.B.'  3 
'Steitz, T.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            121 
_citation.page_first                257 
_citation.page_last                 270 
_citation.year                      2005 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15851032 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2005.02.005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tu, D.'       1 ? 
primary 'Blaha, G.'    2 ? 
primary 'Moore, P.B.'  3 ? 
primary 'Steitz, T.A.' 4 ? 
# 
_cell.entry_id           1YI2 
_cell.length_a           212.435 
_cell.length_b           299.989 
_cell.length_c           574.176 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1YI2 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S Ribosomal RNA'                   946141.375 1    ? G2099A ? 'encoded by rrnA operon' 
2  polymer     nat '5S Ribosomal RNA'                    39303.402  1    ? ?      ? ?                        
3  polymer     nat '50S ribosomal protein L2P'           25354.688  1    ? ?      ? ?                        
4  polymer     nat '50S ribosomal protein L3P'           37396.395  1    ? ?      ? ?                        
5  polymer     nat '50S ribosomal protein L4E'           26442.098  1    ? ?      ? ?                        
6  polymer     nat '50S ribosomal protein L5P'           19551.693  1    ? ?      ? ?                        
7  polymer     nat '50S ribosomal protein L6P'           19961.719  1    ? ?      ? ?                        
8  polymer     nat '50S ribosomal protein L7AE'          12791.941  1    ? ?      ? ?                        
9  polymer     nat 'ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG' 37213.805  1    ? ?      ? ?                        
10 polymer     nat '50S RIBOSOMAL PROTEIN L10E'          19942.734  1    ? ?      ? ?                        
11 polymer     nat '50S RIBOSOMAL PROTEIN L11P'          17097.547  1    ? ?      ? ?                        
12 polymer     nat '50S ribosomal protein L13P'          16249.214  1    ? ?      ? ?                        
13 polymer     nat '50S ribosomal protein L14P'          14191.243  1    ? ?      ? ?                        
14 polymer     nat '50S ribosomal protein L15P'          18005.367  1    ? ?      ? ?                        
15 polymer     nat '50S Ribosomal Protein L15E'          22275.055  1    ? ?      ? ?                        
16 polymer     nat '50S ribosomal protein L18P'          20640.939  1    ? ?      ? ?                        
17 polymer     nat '50S ribosomal protein L18e'          12438.915  1    ? ?      ? ?                        
18 polymer     nat '50S ribosomal protein L19E'          16796.514  1    ? ?      ? ?                        
19 polymer     nat '50S ribosomal protein L21e'          10567.801  1    ? ?      ? ?                        
20 polymer     nat '50S ribosomal protein L22P'          16966.945  1    ? ?      ? ?                        
21 polymer     nat '50S ribosomal protein L23P'          9612.537   1    ? ?      ? ?                        
22 polymer     nat '50S ribosomal protein L24P'          13670.955  1    ? ?      ? ?                        
23 polymer     nat '50S ribosomal protein L24E'          7233.720   1    ? ?      ? ?                        
24 polymer     nat '50S ribosomal protein L29P'          7889.863   1    ? ?      ? ?                        
25 polymer     nat '50S ribosomal protein L30P'          17062.885  1    ? ?      ? ?                        
26 polymer     nat '50S ribosomal protein L31e'          10384.613  1    ? ?      ? ?                        
27 polymer     nat '50S ribosomal protein L32E'          26455.727  1    ? ?      ? ?                        
28 polymer     nat '50S ribosomal protein L37Ae'         9409.338   1    ? ?      ? ?                        
29 polymer     nat '50S ribosomal protein L37e'          6330.203   1    ? ?      ? ?                        
30 polymer     nat '50S ribosomal protein L39e'          6133.090   1    ? ?      ? ?                        
31 polymer     nat '50S ribosomal protein L44E'          10815.245  1    ? ?      ? ?                        
32 non-polymer syn 'ERYTHROMYCIN A'                      733.927    1    ? ?      ? ?                        
33 non-polymer syn 'MAGNESIUM ION'                       24.305     116  ? ?      ? ?                        
34 non-polymer syn 'POTASSIUM ION'                       39.098     2    ? ?      ? ?                        
35 non-polymer syn 'SODIUM ION'                          22.990     86   ? ?      ? ?                        
36 non-polymer syn 'CHLORIDE ION'                        35.453     22   ? ?      ? ?                        
37 non-polymer syn 'CADMIUM ION'                         112.411    5    ? ?      ? ?                        
38 water       nat water                                 18.015     7808 ? ?      ? ?                        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no yes 
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUG(1MA)AAAACGAG
CCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUG
CCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGA
AGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAA
GGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAG
AGCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCG
GGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUU
AAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGC
GUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACU
CAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAA
AAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUC
AGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAU
CAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGU
AAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCG
UACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAG
UUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUA
GUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUC
GUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGU
AGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGU
CUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAG
CAUAGGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGC
GACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCG
CCCUAUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAAC
GAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACC
CUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCC
UGCCCGUGCAGAAGCGGGCAAGGGUGAGGU(OMU)(OMG)UUCGCCUAUUAAAGGAGGUCGUGAGCUGGG(UR3)U
(PSU)AGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACG
AGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAA
GAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGA
CUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAG
GGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCG
AGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCG
UGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCC
CAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCG
ACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGA
UUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGU
GUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAA
CAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUA
CUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUC
CUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCU
GAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUG
CAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUG
GCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACC
GAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAG
UCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAA
CAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUAC
AAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCG
GCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGG
AGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUA
GGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACU
CUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCU
AUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGG
AACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAG
GGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCC
CGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGU
CGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCAC
UGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAA
ACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAA
CGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
0 ? 
2  polyribonucleotide no no  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
9 ? 
3  'polypeptide(L)'   no no  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
4  'polypeptide(L)'   no no  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
B ? 
5  'polypeptide(L)'   no no  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
6  'polypeptide(L)'   no no  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
D ? 
7  'polypeptide(L)'   no no  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
E ? 
8  'polypeptide(L)'   no no  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
F ? 
9  'polypeptide(L)'   no no  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
10 'polypeptide(L)'   no no  
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
H ? 
11 'polypeptide(L)'   no no  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
I ? 
12 'polypeptide(L)'   no no  
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
J ? 
13 'polypeptide(L)'   no no  
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
K ? 
14 'polypeptide(L)'   no no  
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
L ? 
15 'polypeptide(L)'   no no  
;MARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG
;
;MARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG
;
M ? 
16 'polypeptide(L)'   no no  
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
N ? 
17 'polypeptide(L)'   no no  
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
O ? 
18 'polypeptide(L)'   no no  
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
P ? 
19 'polypeptide(L)'   no no  
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
Q ? 
20 'polypeptide(L)'   no no  
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
R ? 
21 'polypeptide(L)'   no no  
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
S ? 
22 'polypeptide(L)'   no no  
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
T ? 
23 'polypeptide(L)'   no no  PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA U ? 
24 'polypeptide(L)'   no no  MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE V ? 
25 'polypeptide(L)'   no no  
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
W ? 
26 'polypeptide(L)'   no no  
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
X ? 
27 'polypeptide(L)'   no no  
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
Y ? 
28 'polypeptide(L)'   no no  
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
Z ? 
29 'polypeptide(L)'   no no  MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1 ? 
30 'polypeptide(L)'   no no  MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 
2 ? 
31 'polypeptide(L)'   no no  
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
3 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    G   n 
1  2    U   n 
1  3    U   n 
1  4    G   n 
1  5    G   n 
1  6    C   n 
1  7    U   n 
1  8    A   n 
1  9    C   n 
1  10   U   n 
1  11   A   n 
1  12   U   n 
1  13   G   n 
1  14   C   n 
1  15   C   n 
1  16   A   n 
1  17   G   n 
1  18   C   n 
1  19   U   n 
1  20   G   n 
1  21   G   n 
1  22   U   n 
1  23   G   n 
1  24   G   n 
1  25   A   n 
1  26   U   n 
1  27   U   n 
1  28   G   n 
1  29   C   n 
1  30   U   n 
1  31   C   n 
1  32   G   n 
1  33   G   n 
1  34   C   n 
1  35   U   n 
1  36   C   n 
1  37   A   n 
1  38   G   n 
1  39   G   n 
1  40   C   n 
1  41   G   n 
1  42   C   n 
1  43   U   n 
1  44   G   n 
1  45   A   n 
1  46   U   n 
1  47   G   n 
1  48   A   n 
1  49   A   n 
1  50   G   n 
1  51   G   n 
1  52   A   n 
1  53   C   n 
1  54   G   n 
1  55   U   n 
1  56   G   n 
1  57   C   n 
1  58   C   n 
1  59   A   n 
1  60   A   n 
1  61   G   n 
1  62   C   n 
1  63   U   n 
1  64   G   n 
1  65   C   n 
1  66   G   n 
1  67   A   n 
1  68   U   n 
1  69   A   n 
1  70   A   n 
1  71   G   n 
1  72   C   n 
1  73   U   n 
1  74   G   n 
1  75   U   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   G   n 
1  80   A   n 
1  81   G   n 
1  82   C   n 
1  83   C   n 
1  84   G   n 
1  85   C   n 
1  86   A   n 
1  87   C   n 
1  88   G   n 
1  89   G   n 
1  90   A   n 
1  91   G   n 
1  92   G   n 
1  93   C   n 
1  94   G   n 
1  95   A   n 
1  96   A   n 
1  97   G   n 
1  98   A   n 
1  99   A   n 
1  100  C   n 
1  101  C   n 
1  102  A   n 
1  103  C   n 
1  104  A   n 
1  105  G   n 
1  106  A   n 
1  107  U   n 
1  108  U   n 
1  109  U   n 
1  110  C   n 
1  111  C   n 
1  112  G   n 
1  113  A   n 
1  114  A   n 
1  115  U   n 
1  116  G   n 
1  117  A   n 
1  118  G   n 
1  119  A   n 
1  120  A   n 
1  121  U   n 
1  122  C   n 
1  123  U   n 
1  124  C   n 
1  125  U   n 
1  126  C   n 
1  127  U   n 
1  128  A   n 
1  129  A   n 
1  130  C   n 
1  131  A   n 
1  132  A   n 
1  133  U   n 
1  134  U   n 
1  135  G   n 
1  136  C   n 
1  137  U   n 
1  138  U   n 
1  139  C   n 
1  140  G   n 
1  141  C   n 
1  142  G   n 
1  143  C   n 
1  144  A   n 
1  145  A   n 
1  146  U   n 
1  147  G   n 
1  148  A   n 
1  149  G   n 
1  150  G   n 
1  151  A   n 
1  152  A   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  C   n 
1  157  G   n 
1  158  A   n 
1  159  G   n 
1  160  A   n 
1  161  A   n 
1  162  C   n 
1  163  U   n 
1  164  G   n 
1  165  A   n 
1  166  A   n 
1  167  A   n 
1  168  C   n 
1  169  A   n 
1  170  U   n 
1  171  C   n 
1  172  U   n 
1  173  C   n 
1  174  A   n 
1  175  G   n 
1  176  U   n 
1  177  A   n 
1  178  U   n 
1  179  C   n 
1  180  G   n 
1  181  G   n 
1  182  G   n 
1  183  A   n 
1  184  G   n 
1  185  G   n 
1  186  A   n 
1  187  A   n 
1  188  C   n 
1  189  A   n 
1  190  G   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  A   n 
1  195  C   n 
1  196  G   n 
1  197  C   n 
1  198  A   n 
1  199  A   n 
1  200  C   n 
1  201  G   n 
1  202  U   n 
1  203  G   n 
1  204  A   n 
1  205  U   n 
1  206  G   n 
1  207  U   n 
1  208  C   n 
1  209  G   n 
1  210  U   n 
1  211  U   n 
1  212  A   n 
1  213  G   n 
1  214  U   n 
1  215  A   n 
1  216  A   n 
1  217  C   n 
1  218  C   n 
1  219  G   n 
1  220  C   n 
1  221  G   n 
1  222  A   n 
1  223  G   n 
1  224  U   n 
1  225  G   n 
1  226  A   n 
1  227  A   n 
1  228  C   n 
1  229  G   n 
1  230  C   n 
1  231  G   n 
1  232  A   n 
1  233  U   n 
1  234  A   n 
1  235  C   n 
1  236  A   n 
1  237  G   n 
1  238  C   n 
1  239  C   n 
1  240  C   n 
1  241  A   n 
1  242  A   n 
1  243  A   n 
1  244  C   n 
1  245  C   n 
1  246  G   n 
1  247  A   n 
1  248  A   n 
1  249  G   n 
1  250  C   n 
1  251  C   n 
1  252  C   n 
1  253  U   n 
1  254  C   n 
1  255  A   n 
1  256  C   n 
1  257  G   n 
1  258  G   n 
1  259  G   n 
1  260  C   n 
1  261  A   n 
1  262  A   n 
1  263  U   n 
1  264  G   n 
1  265  U   n 
1  266  G   n 
1  267  G   n 
1  268  U   n 
1  269  G   n 
1  270  U   n 
1  271  C   n 
1  272  A   n 
1  273  G   n 
1  274  G   n 
1  275  G   n 
1  276  C   n 
1  277  U   n 
1  278  A   n 
1  279  C   n 
1  280  C   n 
1  281  U   n 
1  282  C   n 
1  283  U   n 
1  284  C   n 
1  285  A   n 
1  286  U   n 
1  287  C   n 
1  288  A   n 
1  289  G   n 
1  290  C   n 
1  291  C   n 
1  292  G   n 
1  293  A   n 
1  294  C   n 
1  295  C   n 
1  296  G   n 
1  297  U   n 
1  298  C   n 
1  299  U   n 
1  300  U   n 
1  301  C   n 
1  302  A   n 
1  303  C   n 
1  304  G   n 
1  305  A   n 
1  306  A   n 
1  307  G   n 
1  308  U   n 
1  309  C   n 
1  310  U   n 
1  311  C   n 
1  312  U   n 
1  313  U   n 
1  314  G   n 
1  315  G   n 
1  316  A   n 
1  317  A   n 
1  318  U   n 
1  319  A   n 
1  320  G   n 
1  321  A   n 
1  322  G   n 
1  323  C   n 
1  324  G   n 
1  325  U   n 
1  326  G   n 
1  327  A   n 
1  328  U   n 
1  329  A   n 
1  330  C   n 
1  331  A   n 
1  332  G   n 
1  333  G   n 
1  334  G   n 
1  335  U   n 
1  336  G   n 
1  337  A   n 
1  338  C   n 
1  339  A   n 
1  340  A   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  C   n 
1  345  G   n 
1  346  U   n 
1  347  A   n 
1  348  C   n 
1  349  U   n 
1  350  G   n 
1  351  A   n 
1  352  A   n 
1  353  G   n 
1  354  A   n 
1  355  C   n 
1  356  C   n 
1  357  A   n 
1  358  G   n 
1  359  U   n 
1  360  A   n 
1  361  C   n 
1  362  G   n 
1  363  C   n 
1  364  U   n 
1  365  G   n 
1  366  U   n 
1  367  G   n 
1  368  C   n 
1  369  G   n 
1  370  G   n 
1  371  U   n 
1  372  A   n 
1  373  G   n 
1  374  U   n 
1  375  G   n 
1  376  C   n 
1  377  C   n 
1  378  A   n 
1  379  G   n 
1  380  A   n 
1  381  G   n 
1  382  U   n 
1  383  A   n 
1  384  G   n 
1  385  C   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  G   n 
1  391  U   n 
1  392  U   n 
1  393  G   n 
1  394  G   n 
1  395  A   n 
1  396  U   n 
1  397  A   n 
1  398  U   n 
1  399  C   n 
1  400  C   n 
1  401  C   n 
1  402  U   n 
1  403  C   n 
1  404  G   n 
1  405  C   n 
1  406  G   n 
1  407  A   n 
1  408  A   n 
1  409  U   n 
1  410  A   n 
1  411  A   n 
1  412  C   n 
1  413  G   n 
1  414  C   n 
1  415  A   n 
1  416  G   n 
1  417  G   n 
1  418  C   n 
1  419  A   n 
1  420  U   n 
1  421  C   n 
1  422  G   n 
1  423  A   n 
1  424  C   n 
1  425  U   n 
1  426  G   n 
1  427  C   n 
1  428  G   n 
1  429  A   n 
1  430  A   n 
1  431  G   n 
1  432  G   n 
1  433  C   n 
1  434  U   n 
1  435  A   n 
1  436  A   n 
1  437  A   n 
1  438  C   n 
1  439  A   n 
1  440  C   n 
1  441  A   n 
1  442  A   n 
1  443  C   n 
1  444  C   n 
1  445  U   n 
1  446  G   n 
1  447  A   n 
1  448  G   n 
1  449  A   n 
1  450  C   n 
1  451  C   n 
1  452  G   n 
1  453  A   n 
1  454  U   n 
1  455  A   n 
1  456  G   n 
1  457  U   n 
1  458  G   n 
1  459  A   n 
1  460  A   n 
1  461  C   n 
1  462  A   n 
1  463  A   n 
1  464  G   n 
1  465  U   n 
1  466  A   n 
1  467  G   n 
1  468  U   n 
1  469  G   n 
1  470  U   n 
1  471  G   n 
1  472  A   n 
1  473  A   n 
1  474  C   n 
1  475  G   n 
1  476  A   n 
1  477  A   n 
1  478  C   n 
1  479  G   n 
1  480  C   n 
1  481  U   n 
1  482  G   n 
1  483  C   n 
1  484  A   n 
1  485  A   n 
1  486  A   n 
1  487  G   n 
1  488  U   n 
1  489  A   n 
1  490  C   n 
1  491  C   n 
1  492  C   n 
1  493  U   n 
1  494  C   n 
1  495  A   n 
1  496  G   n 
1  497  A   n 
1  498  A   n 
1  499  G   n 
1  500  G   n 
1  501  G   n 
1  502  A   n 
1  503  G   n 
1  504  G   n 
1  505  C   n 
1  506  G   n 
1  507  A   n 
1  508  A   n 
1  509  A   n 
1  510  U   n 
1  511  A   n 
1  512  G   n 
1  513  A   n 
1  514  G   n 
1  515  C   n 
1  516  A   n 
1  517  U   n 
1  518  G   n 
1  519  A   n 
1  520  A   n 
1  521  A   n 
1  522  U   n 
1  523  C   n 
1  524  A   n 
1  525  G   n 
1  526  U   n 
1  527  U   n 
1  528  G   n 
1  529  G   n 
1  530  C   n 
1  531  G   n 
1  532  A   n 
1  533  U   n 
1  534  C   n 
1  535  G   n 
1  536  A   n 
1  537  G   n 
1  538  C   n 
1  539  G   n 
1  540  A   n 
1  541  C   n 
1  542  A   n 
1  543  G   n 
1  544  G   n 
1  545  G   n 
1  546  C   n 
1  547  A   n 
1  548  U   n 
1  549  A   n 
1  550  C   n 
1  551  A   n 
1  552  A   n 
1  553  G   n 
1  554  G   n 
1  555  U   n 
1  556  C   n 
1  557  C   n 
1  558  C   n 
1  559  U   n 
1  560  U   n 
1  561  G   n 
1  562  A   n 
1  563  C   n 
1  564  G   n 
1  565  A   n 
1  566  A   n 
1  567  U   n 
1  568  G   n 
1  569  A   n 
1  570  C   n 
1  571  C   n 
1  572  G   n 
1  573  A   n 
1  574  G   n 
1  575  A   n 
1  576  C   n 
1  577  G   n 
1  578  C   n 
1  579  G   n 
1  580  A   n 
1  581  G   n 
1  582  U   n 
1  583  C   n 
1  584  U   n 
1  585  C   n 
1  586  C   n 
1  587  A   n 
1  588  G   n 
1  589  U   n 
1  590  A   n 
1  591  A   n 
1  592  G   n 
1  593  A   n 
1  594  C   n 
1  595  U   n 
1  596  C   n 
1  597  A   n 
1  598  C   n 
1  599  G   n 
1  600  G   n 
1  601  G   n 
1  602  A   n 
1  603  A   n 
1  604  G   n 
1  605  C   n 
1  606  C   n 
1  607  G   n 
1  608  A   n 
1  609  U   n 
1  610  G   n 
1  611  U   n 
1  612  U   n 
1  613  C   n 
1  614  U   n 
1  615  G   n 
1  616  U   n 
1  617  C   n 
1  618  G   n 
1  619  U   n 
1  620  A   n 
1  621  C   n 
1  622  G   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  U   n 
1  627  G   n 
1  628  1MA n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  A   n 
1  633  C   n 
1  634  G   n 
1  635  A   n 
1  636  G   n 
1  637  C   n 
1  638  C   n 
1  639  A   n 
1  640  G   n 
1  641  G   n 
1  642  G   n 
1  643  A   n 
1  644  G   n 
1  645  U   n 
1  646  G   n 
1  647  U   n 
1  648  G   n 
1  649  U   n 
1  650  C   n 
1  651  U   n 
1  652  G   n 
1  653  U   n 
1  654  A   n 
1  655  U   n 
1  656  G   n 
1  657  G   n 
1  658  C   n 
1  659  A   n 
1  660  A   n 
1  661  G   n 
1  662  U   n 
1  663  C   n 
1  664  U   n 
1  665  A   n 
1  666  A   n 
1  667  C   n 
1  668  C   n 
1  669  G   n 
1  670  G   n 
1  671  A   n 
1  672  G   n 
1  673  U   n 
1  674  A   n 
1  675  U   n 
1  676  C   n 
1  677  C   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  G   n 
1  682  A   n 
1  683  G   n 
1  684  G   n 
1  685  C   n 
1  686  A   n 
1  687  C   n 
1  688  A   n 
1  689  G   n 
1  690  G   n 
1  691  G   n 
1  692  A   n 
1  693  A   n 
1  694  A   n 
1  695  C   n 
1  696  C   n 
1  697  G   n 
1  698  A   n 
1  699  C   n 
1  700  A   n 
1  701  U   n 
1  702  G   n 
1  703  G   n 
1  704  C   n 
1  705  C   n 
1  706  G   n 
1  707  C   n 
1  708  A   n 
1  709  G   n 
1  710  G   n 
1  711  G   n 
1  712  C   n 
1  713  U   n 
1  714  U   n 
1  715  U   n 
1  716  G   n 
1  717  C   n 
1  718  C   n 
1  719  C   n 
1  720  G   n 
1  721  A   n 
1  722  G   n 
1  723  G   n 
1  724  G   n 
1  725  C   n 
1  726  C   n 
1  727  G   n 
1  728  C   n 
1  729  C   n 
1  730  G   n 
1  731  U   n 
1  732  C   n 
1  733  U   n 
1  734  U   n 
1  735  C   n 
1  736  A   n 
1  737  A   n 
1  738  G   n 
1  739  G   n 
1  740  G   n 
1  741  C   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  G   n 
1  746  A   n 
1  747  G   n 
1  748  C   n 
1  749  C   n 
1  750  A   n 
1  751  U   n 
1  752  G   n 
1  753  U   n 
1  754  G   n 
1  755  G   n 
1  756  A   n 
1  757  C   n 
1  758  A   n 
1  759  C   n 
1  760  G   n 
1  761  A   n 
1  762  C   n 
1  763  C   n 
1  764  C   n 
1  765  G   n 
1  766  A   n 
1  767  A   n 
1  768  U   n 
1  769  C   n 
1  770  C   n 
1  771  G   n 
1  772  G   n 
1  773  A   n 
1  774  C   n 
1  775  G   n 
1  776  A   n 
1  777  U   n 
1  778  C   n 
1  779  U   n 
1  780  A   n 
1  781  C   n 
1  782  G   n 
1  783  C   n 
1  784  A   n 
1  785  U   n 
1  786  G   n 
1  787  G   n 
1  788  A   n 
1  789  C   n 
1  790  A   n 
1  791  A   n 
1  792  G   n 
1  793  A   n 
1  794  U   n 
1  795  G   n 
1  796  A   n 
1  797  A   n 
1  798  G   n 
1  799  C   n 
1  800  G   n 
1  801  U   n 
1  802  G   n 
1  803  C   n 
1  804  C   n 
1  805  G   n 
1  806  A   n 
1  807  A   n 
1  808  A   n 
1  809  G   n 
1  810  G   n 
1  811  C   n 
1  812  A   n 
1  813  C   n 
1  814  G   n 
1  815  U   n 
1  816  G   n 
1  817  G   n 
1  818  A   n 
1  819  A   n 
1  820  G   n 
1  821  U   n 
1  822  C   n 
1  823  U   n 
1  824  G   n 
1  825  U   n 
1  826  U   n 
1  827  A   n 
1  828  G   n 
1  829  A   n 
1  830  G   n 
1  831  U   n 
1  832  U   n 
1  833  G   n 
1  834  G   n 
1  835  U   n 
1  836  G   n 
1  837  U   n 
1  838  C   n 
1  839  C   n 
1  840  U   n 
1  841  A   n 
1  842  C   n 
1  843  A   n 
1  844  A   n 
1  845  U   n 
1  846  A   n 
1  847  C   n 
1  848  C   n 
1  849  C   n 
1  850  U   n 
1  851  C   n 
1  852  U   n 
1  853  C   n 
1  854  G   n 
1  855  U   n 
1  856  G   n 
1  857  A   n 
1  858  U   n 
1  859  C   n 
1  860  U   n 
1  861  A   n 
1  862  U   n 
1  863  G   n 
1  864  U   n 
1  865  G   n 
1  866  U   n 
1  867  A   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  G   n 
1  872  U   n 
1  873  G   n 
1  874  A   n 
1  875  A   n 
1  876  A   n 
1  877  G   n 
1  878  G   n 
1  879  C   n 
1  880  C   n 
1  881  C   n 
1  882  A   n 
1  883  U   n 
1  884  C   n 
1  885  G   n 
1  886  A   n 
1  887  G   n 
1  888  U   n 
1  889  C   n 
1  890  C   n 
1  891  G   n 
1  892  G   n 
1  893  C   n 
1  894  A   n 
1  895  A   n 
1  896  C   n 
1  897  A   n 
1  898  G   n 
1  899  C   n 
1  900  U   n 
1  901  G   n 
1  902  G   n 
1  903  U   n 
1  904  U   n 
1  905  C   n 
1  906  C   n 
1  907  A   n 
1  908  A   n 
1  909  U   n 
1  910  C   n 
1  911  G   n 
1  912  A   n 
1  913  A   n 
1  914  A   n 
1  915  C   n 
1  916  A   n 
1  917  U   n 
1  918  G   n 
1  919  U   n 
1  920  C   n 
1  921  G   n 
1  922  A   n 
1  923  A   n 
1  924  G   n 
1  925  C   n 
1  926  A   n 
1  927  U   n 
1  928  G   n 
1  929  A   n 
1  930  C   n 
1  931  C   n 
1  932  U   n 
1  933  C   n 
1  934  C   n 
1  935  G   n 
1  936  C   n 
1  937  C   n 
1  938  G   n 
1  939  A   n 
1  940  G   n 
1  941  G   n 
1  942  U   n 
1  943  A   n 
1  944  G   n 
1  945  U   n 
1  946  C   n 
1  947  U   n 
1  948  G   n 
1  949  U   n 
1  950  G   n 
1  951  A   n 
1  952  G   n 
1  953  G   n 
1  954  U   n 
1  955  A   n 
1  956  G   n 
1  957  A   n 
1  958  G   n 
1  959  C   n 
1  960  G   n 
1  961  A   n 
1  962  C   n 
1  963  C   n 
1  964  G   n 
1  965  A   n 
1  966  U   n 
1  967  U   n 
1  968  G   n 
1  969  G   n 
1  970  U   n 
1  971  G   n 
1  972  U   n 
1  973  G   n 
1  974  U   n 
1  975  C   n 
1  976  C   n 
1  977  G   n 
1  978  C   n 
1  979  C   n 
1  980  U   n 
1  981  C   n 
1  982  C   n 
1  983  G   n 
1  984  A   n 
1  985  G   n 
1  986  A   n 
1  987  G   n 
1  988  G   n 
1  989  A   n 
1  990  G   n 
1  991  U   n 
1  992  C   n 
1  993  G   n 
1  994  G   n 
1  995  C   n 
1  996  A   n 
1  997  C   n 
1  998  A   n 
1  999  C   n 
1  1000 C   n 
1  1001 U   n 
1  1002 G   n 
1  1003 U   n 
1  1004 C   n 
1  1005 A   n 
1  1006 A   n 
1  1007 A   n 
1  1008 C   n 
1  1009 U   n 
1  1010 C   n 
1  1011 C   n 
1  1012 A   n 
1  1013 A   n 
1  1014 A   n 
1  1015 C   n 
1  1016 U   n 
1  1017 U   n 
1  1018 A   n 
1  1019 C   n 
1  1020 A   n 
1  1021 G   n 
1  1022 A   n 
1  1023 C   n 
1  1024 G   n 
1  1025 C   n 
1  1026 U   n 
1  1027 G   n 
1  1028 U   n 
1  1029 U   n 
1  1030 U   n 
1  1031 G   n 
1  1032 A   n 
1  1033 C   n 
1  1034 G   n 
1  1035 C   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 G   n 
1  1040 A   n 
1  1041 U   n 
1  1042 U   n 
1  1043 C   n 
1  1044 C   n 
1  1045 G   n 
1  1046 G   n 
1  1047 U   n 
1  1048 G   n 
1  1049 C   n 
1  1050 G   n 
1  1051 C   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 G   n 
1  1056 U   n 
1  1057 A   n 
1  1058 A   n 
1  1059 G   n 
1  1060 C   n 
1  1061 C   n 
1  1062 U   n 
1  1063 G   n 
1  1064 U   n 
1  1065 G   n 
1  1066 U   n 
1  1067 A   n 
1  1068 C   n 
1  1069 C   n 
1  1070 A   n 
1  1071 G   n 
1  1072 G   n 
1  1073 A   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 G   n 
1  1078 A   n 
1  1079 A   n 
1  1080 C   n 
1  1081 A   n 
1  1082 A   n 
1  1083 C   n 
1  1084 C   n 
1  1085 C   n 
1  1086 A   n 
1  1087 G   n 
1  1088 A   n 
1  1089 G   n 
1  1090 A   n 
1  1091 U   n 
1  1092 A   n 
1  1093 G   n 
1  1094 G   n 
1  1095 U   n 
1  1096 U   n 
1  1097 A   n 
1  1098 A   n 
1  1099 G   n 
1  1100 G   n 
1  1101 U   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 C   n 
1  1106 A   n 
1  1107 A   n 
1  1108 G   n 
1  1109 U   n 
1  1110 G   n 
1  1111 U   n 
1  1112 G   n 
1  1113 G   n 
1  1114 A   n 
1  1115 U   n 
1  1116 U   n 
1  1117 A   n 
1  1118 A   n 
1  1119 G   n 
1  1120 U   n 
1  1121 G   n 
1  1122 U   n 
1  1123 A   n 
1  1124 A   n 
1  1125 U   n 
1  1126 C   n 
1  1127 C   n 
1  1128 U   n 
1  1129 C   n 
1  1130 U   n 
1  1131 G   n 
1  1132 A   n 
1  1133 A   n 
1  1134 G   n 
1  1135 G   n 
1  1136 U   n 
1  1137 G   n 
1  1138 G   n 
1  1139 U   n 
1  1140 C   n 
1  1141 U   n 
1  1142 C   n 
1  1143 G   n 
1  1144 A   n 
1  1145 G   n 
1  1146 C   n 
1  1147 C   n 
1  1148 C   n 
1  1149 U   n 
1  1150 A   n 
1  1151 G   n 
1  1152 A   n 
1  1153 C   n 
1  1154 A   n 
1  1155 G   n 
1  1156 C   n 
1  1157 C   n 
1  1158 G   n 
1  1159 G   n 
1  1160 G   n 
1  1161 A   n 
1  1162 G   n 
1  1163 G   n 
1  1164 U   n 
1  1165 G   n 
1  1166 A   n 
1  1167 G   n 
1  1168 C   n 
1  1169 U   n 
1  1170 U   n 
1  1171 A   n 
1  1172 G   n 
1  1173 A   n 
1  1174 A   n 
1  1175 G   n 
1  1176 C   n 
1  1177 A   n 
1  1178 G   n 
1  1179 C   n 
1  1180 U   n 
1  1181 A   n 
1  1182 C   n 
1  1183 C   n 
1  1184 C   n 
1  1185 U   n 
1  1186 C   n 
1  1187 U   n 
1  1188 A   n 
1  1189 A   n 
1  1190 G   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 A   n 
1  1195 G   n 
1  1196 C   n 
1  1197 G   n 
1  1198 U   n 
1  1199 A   n 
1  1200 A   n 
1  1201 C   n 
1  1202 A   n 
1  1203 G   n 
1  1204 C   n 
1  1205 U   n 
1  1206 U   n 
1  1207 A   n 
1  1208 C   n 
1  1209 C   n 
1  1210 G   n 
1  1211 G   n 
1  1212 C   n 
1  1213 C   n 
1  1214 G   n 
1  1215 A   n 
1  1216 G   n 
1  1217 G   n 
1  1218 U   n 
1  1219 U   n 
1  1220 U   n 
1  1221 G   n 
1  1222 A   n 
1  1223 G   n 
1  1224 G   n 
1  1225 C   n 
1  1226 G   n 
1  1227 C   n 
1  1228 C   n 
1  1229 C   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 A   n 
1  1234 U   n 
1  1235 G   n 
1  1236 A   n 
1  1237 U   n 
1  1238 C   n 
1  1239 G   n 
1  1240 G   n 
1  1241 G   n 
1  1242 A   n 
1  1243 C   n 
1  1244 U   n 
1  1245 C   n 
1  1246 A   n 
1  1247 A   n 
1  1248 A   n 
1  1249 U   n 
1  1250 C   n 
1  1251 C   n 
1  1252 A   n 
1  1253 C   n 
1  1254 C   n 
1  1255 A   n 
1  1256 C   n 
1  1257 C   n 
1  1258 G   n 
1  1259 A   n 
1  1260 G   n 
1  1261 A   n 
1  1262 C   n 
1  1263 C   n 
1  1264 U   n 
1  1265 G   n 
1  1266 U   n 
1  1267 C   n 
1  1268 C   n 
1  1269 G   n 
1  1270 U   n 
1  1271 A   n 
1  1272 C   n 
1  1273 C   n 
1  1274 A   n 
1  1275 C   n 
1  1276 U   n 
1  1277 C   n 
1  1278 A   n 
1  1279 U   n 
1  1280 A   n 
1  1281 C   n 
1  1282 U   n 
1  1283 G   n 
1  1284 G   n 
1  1285 U   n 
1  1286 A   n 
1  1287 A   n 
1  1288 U   n 
1  1289 C   n 
1  1290 G   n 
1  1291 A   n 
1  1292 G   n 
1  1293 U   n 
1  1294 A   n 
1  1295 G   n 
1  1296 A   n 
1  1297 U   n 
1  1298 U   n 
1  1299 G   n 
1  1300 G   n 
1  1301 C   n 
1  1302 G   n 
1  1303 C   n 
1  1304 U   n 
1  1305 C   n 
1  1306 U   n 
1  1307 A   n 
1  1308 A   n 
1  1309 U   n 
1  1310 U   n 
1  1311 G   n 
1  1312 G   n 
1  1313 A   n 
1  1314 U   n 
1  1315 G   n 
1  1316 G   n 
1  1317 A   n 
1  1318 A   n 
1  1319 G   n 
1  1320 C   n 
1  1321 A   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 G   n 
1  1326 C   n 
1  1327 G   n 
1  1328 A   n 
1  1329 G   n 
1  1330 A   n 
1  1331 G   n 
1  1332 C   n 
1  1333 U   n 
1  1334 C   n 
1  1335 C   n 
1  1336 U   n 
1  1337 G   n 
1  1338 U   n 
1  1339 G   n 
1  1340 G   n 
1  1341 A   n 
1  1342 C   n 
1  1343 C   n 
1  1344 G   n 
1  1345 A   n 
1  1346 U   n 
1  1347 U   n 
1  1348 A   n 
1  1349 G   n 
1  1350 U   n 
1  1351 G   n 
1  1352 A   n 
1  1353 C   n 
1  1354 G   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 A   n 
1  1359 U   n 
1  1360 C   n 
1  1361 C   n 
1  1362 U   n 
1  1363 G   n 
1  1364 G   n 
1  1365 C   n 
1  1366 C   n 
1  1367 A   n 
1  1368 U   n 
1  1369 A   n 
1  1370 G   n 
1  1371 U   n 
1  1372 A   n 
1  1373 G   n 
1  1374 C   n 
1  1375 A   n 
1  1376 G   n 
1  1377 C   n 
1  1378 G   n 
1  1379 A   n 
1  1380 U   n 
1  1381 A   n 
1  1382 G   n 
1  1383 U   n 
1  1384 C   n 
1  1385 G   n 
1  1386 G   n 
1  1387 G   n 
1  1388 U   n 
1  1389 G   n 
1  1390 A   n 
1  1391 G   n 
1  1392 A   n 
1  1393 A   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 C   n 
1  1398 G   n 
1  1399 A   n 
1  1400 C   n 
1  1401 G   n 
1  1402 G   n 
1  1403 C   n 
1  1404 C   n 
1  1405 U   n 
1  1406 A   n 
1  1407 A   n 
1  1408 U   n 
1  1409 G   n 
1  1410 G   n 
1  1411 A   n 
1  1412 U   n 
1  1413 A   n 
1  1414 A   n 
1  1415 G   n 
1  1416 G   n 
1  1417 G   n 
1  1418 U   n 
1  1419 U   n 
1  1420 C   n 
1  1421 C   n 
1  1422 U   n 
1  1423 C   n 
1  1424 A   n 
1  1425 G   n 
1  1426 C   n 
1  1427 A   n 
1  1428 C   n 
1  1429 U   n 
1  1430 G   n 
1  1431 C   n 
1  1432 U   n 
1  1433 G   n 
1  1434 A   n 
1  1435 U   n 
1  1436 C   n 
1  1437 A   n 
1  1438 G   n 
1  1439 C   n 
1  1440 U   n 
1  1441 G   n 
1  1442 A   n 
1  1443 G   n 
1  1444 G   n 
1  1445 G   n 
1  1446 U   n 
1  1447 U   n 
1  1448 A   n 
1  1449 G   n 
1  1450 C   n 
1  1451 C   n 
1  1452 G   n 
1  1453 G   n 
1  1454 U   n 
1  1455 C   n 
1  1456 C   n 
1  1457 U   n 
1  1458 A   n 
1  1459 A   n 
1  1460 G   n 
1  1461 U   n 
1  1462 C   n 
1  1463 U   n 
1  1464 C   n 
1  1465 A   n 
1  1466 C   n 
1  1467 C   n 
1  1468 G   n 
1  1469 C   n 
1  1470 A   n 
1  1471 A   n 
1  1472 C   n 
1  1473 U   n 
1  1474 C   n 
1  1475 G   n 
1  1476 A   n 
1  1477 C   n 
1  1478 U   n 
1  1479 G   n 
1  1480 A   n 
1  1481 G   n 
1  1482 A   n 
1  1483 C   n 
1  1484 G   n 
1  1485 A   n 
1  1486 A   n 
1  1487 A   n 
1  1488 U   n 
1  1489 G   n 
1  1490 G   n 
1  1491 G   n 
1  1492 A   n 
1  1493 A   n 
1  1494 A   n 
1  1495 C   n 
1  1496 A   n 
1  1497 G   n 
1  1498 G   n 
1  1499 U   n 
1  1500 U   n 
1  1501 A   n 
1  1502 A   n 
1  1503 U   n 
1  1504 A   n 
1  1505 U   n 
1  1506 U   n 
1  1507 C   n 
1  1508 C   n 
1  1509 U   n 
1  1510 G   n 
1  1511 U   n 
1  1512 G   n 
1  1513 C   n 
1  1514 C   n 
1  1515 A   n 
1  1516 U   n 
1  1517 C   n 
1  1518 A   n 
1  1519 U   n 
1  1520 G   n 
1  1521 C   n 
1  1522 A   n 
1  1523 G   n 
1  1524 U   n 
1  1525 G   n 
1  1526 A   n 
1  1527 A   n 
1  1528 A   n 
1  1529 G   n 
1  1530 U   n 
1  1531 U   n 
1  1532 G   n 
1  1533 A   n 
1  1534 C   n 
1  1535 G   n 
1  1536 C   n 
1  1537 C   n 
1  1538 C   n 
1  1539 U   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 G   n 
1  1544 U   n 
1  1545 C   n 
1  1546 G   n 
1  1547 A   n 
1  1548 U   n 
1  1549 C   n 
1  1550 A   n 
1  1551 C   n 
1  1552 G   n 
1  1553 C   n 
1  1554 C   n 
1  1555 G   n 
1  1556 G   n 
1  1557 G   n 
1  1558 C   n 
1  1559 A   n 
1  1560 U   n 
1  1561 U   n 
1  1562 C   n 
1  1563 G   n 
1  1564 C   n 
1  1565 C   n 
1  1566 C   n 
1  1567 G   n 
1  1568 G   n 
1  1569 U   n 
1  1570 C   n 
1  1571 G   n 
1  1572 A   n 
1  1573 A   n 
1  1574 C   n 
1  1575 C   n 
1  1576 G   n 
1  1577 U   n 
1  1578 C   n 
1  1579 C   n 
1  1580 A   n 
1  1581 A   n 
1  1582 C   n 
1  1583 U   n 
1  1584 C   n 
1  1585 C   n 
1  1586 G   n 
1  1587 U   n 
1  1588 G   n 
1  1589 G   n 
1  1590 A   n 
1  1591 A   n 
1  1592 G   n 
1  1593 C   n 
1  1594 C   n 
1  1595 G   n 
1  1596 U   n 
1  1597 A   n 
1  1598 A   n 
1  1599 U   n 
1  1600 G   n 
1  1601 G   n 
1  1602 C   n 
1  1603 A   n 
1  1604 G   n 
1  1605 G   n 
1  1606 A   n 
1  1607 A   n 
1  1608 G   n 
1  1609 C   n 
1  1610 G   n 
1  1611 G   n 
1  1612 A   n 
1  1613 C   n 
1  1614 G   n 
1  1615 A   n 
1  1616 A   n 
1  1617 C   n 
1  1618 G   n 
1  1619 G   n 
1  1620 C   n 
1  1621 G   n 
1  1622 G   n 
1  1623 C   n 
1  1624 A   n 
1  1625 U   n 
1  1626 A   n 
1  1627 G   n 
1  1628 G   n 
1  1629 G   n 
1  1630 A   n 
1  1631 A   n 
1  1632 A   n 
1  1633 C   n 
1  1634 G   n 
1  1635 U   n 
1  1636 G   n 
1  1637 A   n 
1  1638 U   n 
1  1639 U   n 
1  1640 C   n 
1  1641 A   n 
1  1642 A   n 
1  1643 C   n 
1  1644 C   n 
1  1645 U   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 G   n 
1  1650 C   n 
1  1651 C   n 
1  1652 C   n 
1  1653 A   n 
1  1654 U   n 
1  1655 G   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 A   n 
1  1660 G   n 
1  1661 A   n 
1  1662 C   n 
1  1663 G   n 
1  1664 A   n 
1  1665 G   n 
1  1666 C   n 
1  1667 A   n 
1  1668 U   n 
1  1669 G   n 
1  1670 A   n 
1  1671 U   n 
1  1672 G   n 
1  1673 U   n 
1  1674 C   n 
1  1675 C   n 
1  1676 G   n 
1  1677 U   n 
1  1678 A   n 
1  1679 C   n 
1  1680 C   n 
1  1681 G   n 
1  1682 A   n 
1  1683 G   n 
1  1684 A   n 
1  1685 A   n 
1  1686 C   n 
1  1687 C   n 
1  1688 G   n 
1  1689 A   n 
1  1690 C   n 
1  1691 A   n 
1  1692 C   n 
1  1693 A   n 
1  1694 G   n 
1  1695 G   n 
1  1696 U   n 
1  1697 G   n 
1  1698 U   n 
1  1699 C   n 
1  1700 C   n 
1  1701 A   n 
1  1702 U   n 
1  1703 G   n 
1  1704 G   n 
1  1705 C   n 
1  1706 G   n 
1  1707 G   n 
1  1708 C   n 
1  1709 G   n 
1  1710 A   n 
1  1711 A   n 
1  1712 A   n 
1  1713 G   n 
1  1714 C   n 
1  1715 C   n 
1  1716 A   n 
1  1717 A   n 
1  1718 G   n 
1  1719 G   n 
1  1720 C   n 
1  1721 C   n 
1  1722 U   n 
1  1723 G   n 
1  1724 U   n 
1  1725 C   n 
1  1726 G   n 
1  1727 G   n 
1  1728 G   n 
1  1729 A   n 
1  1730 G   n 
1  1731 C   n 
1  1732 A   n 
1  1733 A   n 
1  1734 C   n 
1  1735 C   n 
1  1736 A   n 
1  1737 A   n 
1  1738 C   n 
1  1739 G   n 
1  1740 U   n 
1  1741 U   n 
1  1742 A   n 
1  1743 G   n 
1  1744 G   n 
1  1745 G   n 
1  1746 A   n 
1  1747 A   n 
1  1748 U   n 
1  1749 U   n 
1  1750 C   n 
1  1751 G   n 
1  1752 G   n 
1  1753 C   n 
1  1754 A   n 
1  1755 A   n 
1  1756 G   n 
1  1757 U   n 
1  1758 U   n 
1  1759 A   n 
1  1760 G   n 
1  1761 U   n 
1  1762 C   n 
1  1763 C   n 
1  1764 C   n 
1  1765 G   n 
1  1766 U   n 
1  1767 A   n 
1  1768 C   n 
1  1769 C   n 
1  1770 U   n 
1  1771 U   n 
1  1772 C   n 
1  1773 G   n 
1  1774 G   n 
1  1775 A   n 
1  1776 A   n 
1  1777 G   n 
1  1778 A   n 
1  1779 A   n 
1  1780 G   n 
1  1781 G   n 
1  1782 G   n 
1  1783 A   n 
1  1784 U   n 
1  1785 G   n 
1  1786 C   n 
1  1787 C   n 
1  1788 U   n 
1  1789 G   n 
1  1790 C   n 
1  1791 U   n 
1  1792 C   n 
1  1793 C   n 
1  1794 G   n 
1  1795 G   n 
1  1796 A   n 
1  1797 A   n 
1  1798 C   n 
1  1799 G   n 
1  1800 G   n 
1  1801 A   n 
1  1802 G   n 
1  1803 C   n 
1  1804 A   n 
1  1805 G   n 
1  1806 G   n 
1  1807 U   n 
1  1808 C   n 
1  1809 G   n 
1  1810 C   n 
1  1811 A   n 
1  1812 G   n 
1  1813 U   n 
1  1814 G   n 
1  1815 A   n 
1  1816 C   n 
1  1817 U   n 
1  1818 C   n 
1  1819 G   n 
1  1820 G   n 
1  1821 A   n 
1  1822 A   n 
1  1823 G   n 
1  1824 C   n 
1  1825 U   n 
1  1826 C   n 
1  1827 G   n 
1  1828 G   n 
1  1829 A   n 
1  1830 C   n 
1  1831 U   n 
1  1832 G   n 
1  1833 U   n 
1  1834 C   n 
1  1835 U   n 
1  1836 A   n 
1  1837 G   n 
1  1838 U   n 
1  1839 A   n 
1  1840 A   n 
1  1841 C   n 
1  1842 A   n 
1  1843 A   n 
1  1844 C   n 
1  1845 A   n 
1  1846 U   n 
1  1847 A   n 
1  1848 G   n 
1  1849 G   n 
1  1850 U   n 
1  1851 G   n 
1  1852 A   n 
1  1853 C   n 
1  1854 C   n 
1  1855 G   n 
1  1856 C   n 
1  1857 A   n 
1  1858 A   n 
1  1859 A   n 
1  1860 U   n 
1  1861 C   n 
1  1862 C   n 
1  1863 G   n 
1  1864 C   n 
1  1865 A   n 
1  1866 A   n 
1  1867 G   n 
1  1868 G   n 
1  1869 A   n 
1  1870 C   n 
1  1871 U   n 
1  1872 C   n 
1  1873 G   n 
1  1874 U   n 
1  1875 A   n 
1  1876 C   n 
1  1877 G   n 
1  1878 G   n 
1  1879 U   n 
1  1880 C   n 
1  1881 A   n 
1  1882 C   n 
1  1883 U   n 
1  1884 G   n 
1  1885 A   n 
1  1886 A   n 
1  1887 U   n 
1  1888 C   n 
1  1889 C   n 
1  1890 U   n 
1  1891 G   n 
1  1892 C   n 
1  1893 C   n 
1  1894 C   n 
1  1895 A   n 
1  1896 G   n 
1  1897 U   n 
1  1898 G   n 
1  1899 C   n 
1  1900 A   n 
1  1901 G   n 
1  1902 G   n 
1  1903 U   n 
1  1904 A   n 
1  1905 U   n 
1  1906 C   n 
1  1907 U   n 
1  1908 G   n 
1  1909 A   n 
1  1910 A   n 
1  1911 C   n 
1  1912 A   n 
1  1913 C   n 
1  1914 C   n 
1  1915 U   n 
1  1916 C   n 
1  1917 G   n 
1  1918 U   n 
1  1919 A   n 
1  1920 C   n 
1  1921 A   n 
1  1922 A   n 
1  1923 G   n 
1  1924 A   n 
1  1925 G   n 
1  1926 G   n 
1  1927 A   n 
1  1928 C   n 
1  1929 G   n 
1  1930 A   n 
1  1931 A   n 
1  1932 G   n 
1  1933 G   n 
1  1934 A   n 
1  1935 C   n 
1  1936 C   n 
1  1937 U   n 
1  1938 G   n 
1  1939 U   n 
1  1940 C   n 
1  1941 A   n 
1  1942 A   n 
1  1943 C   n 
1  1944 G   n 
1  1945 G   n 
1  1946 C   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 G   n 
1  1952 U   n 
1  1953 A   n 
1  1954 A   n 
1  1955 C   n 
1  1956 U   n 
1  1957 A   n 
1  1958 U   n 
1  1959 G   n 
1  1960 A   n 
1  1961 C   n 
1  1962 C   n 
1  1963 C   n 
1  1964 U   n 
1  1965 C   n 
1  1966 U   n 
1  1967 U   n 
1  1968 A   n 
1  1969 A   n 
1  1970 G   n 
1  1971 G   n 
1  1972 U   n 
1  1973 A   n 
1  1974 G   n 
1  1975 C   n 
1  1976 G   n 
1  1977 U   n 
1  1978 A   n 
1  1979 G   n 
1  1980 U   n 
1  1981 A   n 
1  1982 C   n 
1  1983 C   n 
1  1984 U   n 
1  1985 U   n 
1  1986 G   n 
1  1987 C   n 
1  1988 C   n 
1  1989 G   n 
1  1990 C   n 
1  1991 A   n 
1  1992 U   n 
1  1993 C   n 
1  1994 A   n 
1  1995 G   n 
1  1996 U   n 
1  1997 A   n 
1  1998 G   n 
1  1999 C   n 
1  2000 G   n 
1  2001 G   n 
1  2002 C   n 
1  2003 U   n 
1  2004 U   n 
1  2005 G   n 
1  2006 C   n 
1  2007 A   n 
1  2008 U   n 
1  2009 G   n 
1  2010 A   n 
1  2011 A   n 
1  2012 U   n 
1  2013 G   n 
1  2014 G   n 
1  2015 A   n 
1  2016 U   n 
1  2017 U   n 
1  2018 A   n 
1  2019 A   n 
1  2020 C   n 
1  2021 C   n 
1  2022 A   n 
1  2023 G   n 
1  2024 A   n 
1  2025 G   n 
1  2026 C   n 
1  2027 U   n 
1  2028 U   n 
1  2029 C   n 
1  2030 A   n 
1  2031 C   n 
1  2032 U   n 
1  2033 G   n 
1  2034 U   n 
1  2035 C   n 
1  2036 C   n 
1  2037 C   n 
1  2038 A   n 
1  2039 A   n 
1  2040 C   n 
1  2041 G   n 
1  2042 U   n 
1  2043 U   n 
1  2044 G   n 
1  2045 G   n 
1  2046 G   n 
1  2047 C   n 
1  2048 C   n 
1  2049 C   n 
1  2050 G   n 
1  2051 G   n 
1  2052 U   n 
1  2053 G   n 
1  2054 A   n 
1  2055 A   n 
1  2056 C   n 
1  2057 U   n 
1  2058 G   n 
1  2059 U   n 
1  2060 A   n 
1  2061 C   n 
1  2062 A   n 
1  2063 U   n 
1  2064 U   n 
1  2065 C   n 
1  2066 C   n 
1  2067 A   n 
1  2068 G   n 
1  2069 U   n 
1  2070 G   n 
1  2071 C   n 
1  2072 G   n 
1  2073 G   n 
1  2074 A   n 
1  2075 G   n 
1  2076 U   n 
1  2077 C   n 
1  2078 U   n 
1  2079 G   n 
1  2080 G   n 
1  2081 A   n 
1  2082 G   n 
1  2083 A   n 
1  2084 C   n 
1  2085 A   n 
1  2086 C   n 
1  2087 C   n 
1  2088 C   n 
1  2089 A   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 G   n 
1  2095 A   n 
1  2096 A   n 
1  2097 G   n 
1  2098 C   n 
1  2099 A   n 
1  2100 A   n 
1  2101 A   n 
1  2102 G   n 
1  2103 A   n 
1  2104 C   n 
1  2105 C   n 
1  2106 C   n 
1  2107 U   n 
1  2108 A   n 
1  2109 U   n 
1  2110 G   n 
1  2111 G   n 
1  2112 A   n 
1  2113 G   n 
1  2114 C   n 
1  2115 U   n 
1  2116 U   n 
1  2117 U   n 
1  2118 A   n 
1  2119 C   n 
1  2120 U   n 
1  2121 G   n 
1  2122 C   n 
1  2123 A   n 
1  2124 G   n 
1  2125 G   n 
1  2126 C   n 
1  2127 U   n 
1  2128 G   n 
1  2129 U   n 
1  2130 C   n 
1  2131 G   n 
1  2132 C   n 
1  2133 U   n 
1  2134 G   n 
1  2135 A   n 
1  2136 G   n 
1  2137 A   n 
1  2138 C   n 
1  2139 G   n 
1  2140 U   n 
1  2141 G   n 
1  2142 G   n 
1  2143 U   n 
1  2144 C   n 
1  2145 G   n 
1  2146 C   n 
1  2147 C   n 
1  2148 G   n 
1  2149 A   n 
1  2150 U   n 
1  2151 G   n 
1  2152 U   n 
1  2153 G   n 
1  2154 C   n 
1  2155 A   n 
1  2156 G   n 
1  2157 C   n 
1  2158 A   n 
1  2159 U   n 
1  2160 A   n 
1  2161 G   n 
1  2162 G   n 
1  2163 U   n 
1  2164 A   n 
1  2165 G   n 
1  2166 G   n 
1  2167 A   n 
1  2168 G   n 
1  2169 U   n 
1  2170 C   n 
1  2171 G   n 
1  2172 U   n 
1  2173 U   n 
1  2174 A   n 
1  2175 C   n 
1  2176 A   n 
1  2177 G   n 
1  2178 A   n 
1  2179 G   n 
1  2180 G   n 
1  2181 U   n 
1  2182 A   n 
1  2183 C   n 
1  2184 C   n 
1  2185 C   n 
1  2186 G   n 
1  2187 C   n 
1  2188 G   n 
1  2189 C   n 
1  2190 U   n 
1  2191 A   n 
1  2192 G   n 
1  2193 C   n 
1  2194 G   n 
1  2195 G   n 
1  2196 G   n 
1  2197 C   n 
1  2198 C   n 
1  2199 A   n 
1  2200 C   n 
1  2201 C   n 
1  2202 C   n 
1  2203 A   n 
1  2204 G   n 
1  2205 A   n 
1  2206 C   n 
1  2207 A   n 
1  2208 A   n 
1  2209 C   n 
1  2210 A   n 
1  2211 G   n 
1  2212 U   n 
1  2213 G   n 
1  2214 A   n 
1  2215 A   n 
1  2216 A   n 
1  2217 U   n 
1  2218 A   n 
1  2219 C   n 
1  2220 U   n 
1  2221 A   n 
1  2222 C   n 
1  2223 C   n 
1  2224 C   n 
1  2225 G   n 
1  2226 U   n 
1  2227 C   n 
1  2228 G   n 
1  2229 G   n 
1  2230 U   n 
1  2231 G   n 
1  2232 A   n 
1  2233 C   n 
1  2234 U   n 
1  2235 G   n 
1  2236 C   n 
1  2237 G   n 
1  2238 A   n 
1  2239 C   n 
1  2240 U   n 
1  2241 C   n 
1  2242 U   n 
1  2243 C   n 
1  2244 A   n 
1  2245 C   n 
1  2246 U   n 
1  2247 C   n 
1  2248 C   n 
1  2249 G   n 
1  2250 G   n 
1  2251 G   n 
1  2252 A   n 
1  2253 G   n 
1  2254 G   n 
1  2255 A   n 
1  2256 G   n 
1  2257 G   n 
1  2258 A   n 
1  2259 C   n 
1  2260 A   n 
1  2261 C   n 
1  2262 C   n 
1  2263 G   n 
1  2264 A   n 
1  2265 U   n 
1  2266 A   n 
1  2267 G   n 
1  2268 C   n 
1  2269 C   n 
1  2270 G   n 
1  2271 G   n 
1  2272 G   n 
1  2273 C   n 
1  2274 A   n 
1  2275 G   n 
1  2276 U   n 
1  2277 U   n 
1  2278 U   n 
1  2279 G   n 
1  2280 A   n 
1  2281 C   n 
1  2282 U   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 G   n 
1  2287 C   n 
1  2288 G   n 
1  2289 G   n 
1  2290 U   n 
1  2291 A   n 
1  2292 C   n 
1  2293 G   n 
1  2294 C   n 
1  2295 G   n 
1  2296 C   n 
1  2297 U   n 
1  2298 C   n 
1  2299 G   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 A   n 
1  2304 G   n 
1  2305 A   n 
1  2306 U   n 
1  2307 A   n 
1  2308 U   n 
1  2309 C   n 
1  2310 G   n 
1  2311 A   n 
1  2312 G   n 
1  2313 C   n 
1  2314 G   n 
1  2315 C   n 
1  2316 G   n 
1  2317 C   n 
1  2318 C   n 
1  2319 C   n 
1  2320 U   n 
1  2321 A   n 
1  2322 U   n 
1  2323 G   n 
1  2324 G   n 
1  2325 U   n 
1  2326 C   n 
1  2327 A   n 
1  2328 U   n 
1  2329 C   n 
1  2330 U   n 
1  2331 C   n 
1  2332 A   n 
1  2333 G   n 
1  2334 C   n 
1  2335 C   n 
1  2336 G   n 
1  2337 G   n 
1  2338 G   n 
1  2339 A   n 
1  2340 C   n 
1  2341 A   n 
1  2342 G   n 
1  2343 A   n 
1  2344 G   n 
1  2345 A   n 
1  2346 C   n 
1  2347 C   n 
1  2348 C   n 
1  2349 G   n 
1  2350 G   n 
1  2351 C   n 
1  2352 G   n 
1  2353 A   n 
1  2354 A   n 
1  2355 G   n 
1  2356 A   n 
1  2357 G   n 
1  2358 U   n 
1  2359 G   n 
1  2360 C   n 
1  2361 A   n 
1  2362 A   n 
1  2363 G   n 
1  2364 A   n 
1  2365 G   n 
1  2366 C   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 A   n 
1  2371 G   n 
1  2372 A   n 
1  2373 U   n 
1  2374 G   n 
1  2375 A   n 
1  2376 C   n 
1  2377 U   n 
1  2378 U   n 
1  2379 G   n 
1  2380 A   n 
1  2381 C   n 
1  2382 A   n 
1  2383 G   n 
1  2384 U   n 
1  2385 G   n 
1  2386 U   n 
1  2387 U   n 
1  2388 C   n 
1  2389 U   n 
1  2390 U   n 
1  2391 C   n 
1  2392 C   n 
1  2393 C   n 
1  2394 A   n 
1  2395 A   n 
1  2396 C   n 
1  2397 G   n 
1  2398 A   n 
1  2399 G   n 
1  2400 G   n 
1  2401 A   n 
1  2402 A   n 
1  2403 C   n 
1  2404 G   n 
1  2405 C   n 
1  2406 U   n 
1  2407 G   n 
1  2408 A   n 
1  2409 C   n 
1  2410 G   n 
1  2411 C   n 
1  2412 G   n 
1  2413 A   n 
1  2414 A   n 
1  2415 A   n 
1  2416 G   n 
1  2417 C   n 
1  2418 G   n 
1  2419 U   n 
1  2420 G   n 
1  2421 G   n 
1  2422 U   n 
1  2423 C   n 
1  2424 U   n 
1  2425 A   n 
1  2426 G   n 
1  2427 C   n 
1  2428 G   n 
1  2429 A   n 
1  2430 A   n 
1  2431 C   n 
1  2432 C   n 
1  2433 A   n 
1  2434 A   n 
1  2435 U   n 
1  2436 U   n 
1  2437 A   n 
1  2438 G   n 
1  2439 C   n 
1  2440 C   n 
1  2441 U   n 
1  2442 G   n 
1  2443 C   n 
1  2444 U   n 
1  2445 U   n 
1  2446 G   n 
1  2447 A   n 
1  2448 U   n 
1  2449 G   n 
1  2450 C   n 
1  2451 G   n 
1  2452 G   n 
1  2453 G   n 
1  2454 C   n 
1  2455 A   n 
1  2456 A   n 
1  2457 U   n 
1  2458 U   n 
1  2459 G   n 
1  2460 A   n 
1  2461 U   n 
1  2462 G   n 
1  2463 A   n 
1  2464 C   n 
1  2465 A   n 
1  2466 G   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 A   n 
1  2471 G   n 
1  2472 C   n 
1  2473 U   n 
1  2474 A   n 
1  2475 C   n 
1  2476 C   n 
1  2477 C   n 
1  2478 U   n 
1  2479 A   n 
1  2480 G   n 
1  2481 G   n 
1  2482 G   n 
1  2483 A   n 
1  2484 U   n 
1  2485 A   n 
1  2486 A   n 
1  2487 C   n 
1  2488 A   n 
1  2489 G   n 
1  2490 A   n 
1  2491 G   n 
1  2492 U   n 
1  2493 C   n 
1  2494 G   n 
1  2495 U   n 
1  2496 C   n 
1  2497 A   n 
1  2498 C   n 
1  2499 U   n 
1  2500 C   n 
1  2501 G   n 
1  2502 C   n 
1  2503 A   n 
1  2504 A   n 
1  2505 G   n 
1  2506 A   n 
1  2507 G   n 
1  2508 C   n 
1  2509 A   n 
1  2510 C   n 
1  2511 A   n 
1  2512 U   n 
1  2513 A   n 
1  2514 U   n 
1  2515 C   n 
1  2516 G   n 
1  2517 A   n 
1  2518 C   n 
1  2519 C   n 
1  2520 G   n 
1  2521 A   n 
1  2522 G   n 
1  2523 U   n 
1  2524 G   n 
1  2525 G   n 
1  2526 C   n 
1  2527 U   n 
1  2528 U   n 
1  2529 G   n 
1  2530 C   n 
1  2531 U   n 
1  2532 A   n 
1  2533 C   n 
1  2534 C   n 
1  2535 U   n 
1  2536 C   n 
1  2537 G   n 
1  2538 A   n 
1  2539 U   n 
1  2540 G   n 
1  2541 U   n 
1  2542 C   n 
1  2543 G   n 
1  2544 G   n 
1  2545 U   n 
1  2546 U   n 
1  2547 C   n 
1  2548 C   n 
1  2549 C   n 
1  2550 U   n 
1  2551 C   n 
1  2552 C   n 
1  2553 A   n 
1  2554 U   n 
1  2555 C   n 
1  2556 C   n 
1  2557 U   n 
1  2558 G   n 
1  2559 C   n 
1  2560 C   n 
1  2561 C   n 
1  2562 G   n 
1  2563 U   n 
1  2564 G   n 
1  2565 C   n 
1  2566 A   n 
1  2567 G   n 
1  2568 A   n 
1  2569 A   n 
1  2570 G   n 
1  2571 C   n 
1  2572 G   n 
1  2573 G   n 
1  2574 G   n 
1  2575 C   n 
1  2576 A   n 
1  2577 A   n 
1  2578 G   n 
1  2579 G   n 
1  2580 G   n 
1  2581 U   n 
1  2582 G   n 
1  2583 A   n 
1  2584 G   n 
1  2585 G   n 
1  2586 U   n 
1  2587 OMU n 
1  2588 OMG n 
1  2589 U   n 
1  2590 U   n 
1  2591 C   n 
1  2592 G   n 
1  2593 C   n 
1  2594 C   n 
1  2595 U   n 
1  2596 A   n 
1  2597 U   n 
1  2598 U   n 
1  2599 A   n 
1  2600 A   n 
1  2601 A   n 
1  2602 G   n 
1  2603 G   n 
1  2604 A   n 
1  2605 G   n 
1  2606 G   n 
1  2607 U   n 
1  2608 C   n 
1  2609 G   n 
1  2610 U   n 
1  2611 G   n 
1  2612 A   n 
1  2613 G   n 
1  2614 C   n 
1  2615 U   n 
1  2616 G   n 
1  2617 G   n 
1  2618 G   n 
1  2619 UR3 n 
1  2620 U   n 
1  2621 PSU n 
1  2622 A   n 
1  2623 G   n 
1  2624 A   n 
1  2625 C   n 
1  2626 C   n 
1  2627 G   n 
1  2628 U   n 
1  2629 C   n 
1  2630 G   n 
1  2631 U   n 
1  2632 G   n 
1  2633 A   n 
1  2634 G   n 
1  2635 A   n 
1  2636 C   n 
1  2637 A   n 
1  2638 G   n 
1  2639 G   n 
1  2640 U   n 
1  2641 C   n 
1  2642 G   n 
1  2643 G   n 
1  2644 C   n 
1  2645 U   n 
1  2646 G   n 
1  2647 C   n 
1  2648 U   n 
1  2649 A   n 
1  2650 U   n 
1  2651 C   n 
1  2652 U   n 
1  2653 A   n 
1  2654 C   n 
1  2655 U   n 
1  2656 G   n 
1  2657 G   n 
1  2658 G   n 
1  2659 U   n 
1  2660 G   n 
1  2661 U   n 
1  2662 G   n 
1  2663 U   n 
1  2664 A   n 
1  2665 A   n 
1  2666 U   n 
1  2667 G   n 
1  2668 G   n 
1  2669 U   n 
1  2670 G   n 
1  2671 U   n 
1  2672 C   n 
1  2673 U   n 
1  2674 G   n 
1  2675 A   n 
1  2676 C   n 
1  2677 A   n 
1  2678 A   n 
1  2679 G   n 
1  2680 A   n 
1  2681 A   n 
1  2682 C   n 
1  2683 G   n 
1  2684 A   n 
1  2685 C   n 
1  2686 C   n 
1  2687 G   n 
1  2688 U   n 
1  2689 A   n 
1  2690 U   n 
1  2691 A   n 
1  2692 G   n 
1  2693 U   n 
1  2694 A   n 
1  2695 C   n 
1  2696 G   n 
1  2697 A   n 
1  2698 G   n 
1  2699 A   n 
1  2700 G   n 
1  2701 G   n 
1  2702 A   n 
1  2703 A   n 
1  2704 C   n 
1  2705 U   n 
1  2706 A   n 
1  2707 C   n 
1  2708 G   n 
1  2709 G   n 
1  2710 U   n 
1  2711 U   n 
1  2712 G   n 
1  2713 G   n 
1  2714 U   n 
1  2715 G   n 
1  2716 G   n 
1  2717 C   n 
1  2718 C   n 
1  2719 A   n 
1  2720 C   n 
1  2721 U   n 
1  2722 G   n 
1  2723 G   n 
1  2724 U   n 
1  2725 G   n 
1  2726 U   n 
1  2727 A   n 
1  2728 C   n 
1  2729 C   n 
1  2730 G   n 
1  2731 G   n 
1  2732 U   n 
1  2733 U   n 
1  2734 G   n 
1  2735 U   n 
1  2736 U   n 
1  2737 C   n 
1  2738 G   n 
1  2739 A   n 
1  2740 G   n 
1  2741 A   n 
1  2742 G   n 
1  2743 A   n 
1  2744 G   n 
1  2745 C   n 
1  2746 A   n 
1  2747 C   n 
1  2748 G   n 
1  2749 U   n 
1  2750 G   n 
1  2751 C   n 
1  2752 C   n 
1  2753 G   n 
1  2754 G   n 
1  2755 G   n 
1  2756 U   n 
1  2757 A   n 
1  2758 G   n 
1  2759 C   n 
1  2760 C   n 
1  2761 A   n 
1  2762 C   n 
1  2763 G   n 
1  2764 C   n 
1  2765 C   n 
1  2766 A   n 
1  2767 C   n 
1  2768 A   n 
1  2769 C   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 G   n 
1  2774 U   n 
1  2775 A   n 
1  2776 A   n 
1  2777 G   n 
1  2778 A   n 
1  2779 G   n 
1  2780 C   n 
1  2781 U   n 
1  2782 G   n 
1  2783 A   n 
1  2784 A   n 
1  2785 C   n 
1  2786 G   n 
1  2787 C   n 
1  2788 A   n 
1  2789 U   n 
1  2790 C   n 
1  2791 U   n 
1  2792 A   n 
1  2793 A   n 
1  2794 G   n 
1  2795 C   n 
1  2796 U   n 
1  2797 C   n 
1  2798 G   n 
1  2799 A   n 
1  2800 A   n 
1  2801 A   n 
1  2802 C   n 
1  2803 C   n 
1  2804 C   n 
1  2805 A   n 
1  2806 C   n 
1  2807 U   n 
1  2808 U   n 
1  2809 G   n 
1  2810 G   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 A   n 
1  2815 G   n 
1  2816 A   n 
1  2817 G   n 
1  2818 A   n 
1  2819 C   n 
1  2820 A   n 
1  2821 C   n 
1  2822 C   n 
1  2823 G   n 
1  2824 C   n 
1  2825 C   n 
1  2826 G   n 
1  2827 A   n 
1  2828 G   n 
1  2829 G   n 
1  2830 U   n 
1  2831 C   n 
1  2832 C   n 
1  2833 C   n 
1  2834 G   n 
1  2835 C   n 
1  2836 G   n 
1  2837 U   n 
1  2838 A   n 
1  2839 C   n 
1  2840 A   n 
1  2841 A   n 
1  2842 G   n 
1  2843 A   n 
1  2844 C   n 
1  2845 G   n 
1  2846 C   n 
1  2847 G   n 
1  2848 G   n 
1  2849 U   n 
1  2850 C   n 
1  2851 G   n 
1  2852 A   n 
1  2853 U   n 
1  2854 A   n 
1  2855 G   n 
1  2856 A   n 
1  2857 C   n 
1  2858 U   n 
1  2859 C   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 G   n 
1  2864 U   n 
1  2865 G   n 
1  2866 U   n 
1  2867 G   n 
1  2868 C   n 
1  2869 G   n 
1  2870 C   n 
1  2871 G   n 
1  2872 U   n 
1  2873 C   n 
1  2874 G   n 
1  2875 A   n 
1  2876 G   n 
1  2877 G   n 
1  2878 U   n 
1  2879 A   n 
1  2880 A   n 
1  2881 C   n 
1  2882 G   n 
1  2883 A   n 
1  2884 G   n 
1  2885 A   n 
1  2886 C   n 
1  2887 G   n 
1  2888 U   n 
1  2889 U   n 
1  2890 A   n 
1  2891 A   n 
1  2892 G   n 
1  2893 C   n 
1  2894 C   n 
1  2895 C   n 
1  2896 A   n 
1  2897 C   n 
1  2898 G   n 
1  2899 A   n 
1  2900 G   n 
1  2901 C   n 
1  2902 A   n 
1  2903 C   n 
1  2904 U   n 
1  2905 A   n 
1  2906 A   n 
1  2907 C   n 
1  2908 A   n 
1  2909 G   n 
1  2910 A   n 
1  2911 C   n 
1  2912 C   n 
1  2913 A   n 
1  2914 A   n 
1  2915 A   n 
1  2916 G   n 
1  2917 C   n 
1  2918 C   n 
1  2919 A   n 
1  2920 U   n 
1  2921 C   n 
1  2922 A   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   A   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  U   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    MET n 
3  2    GLY n 
3  3    ARG n 
3  4    ARG n 
3  5    ILE n 
3  6    GLN n 
3  7    GLY n 
3  8    GLN n 
3  9    ARG n 
3  10   ARG n 
3  11   GLY n 
3  12   ARG n 
3  13   GLY n 
3  14   THR n 
3  15   SER n 
3  16   THR n 
3  17   PHE n 
3  18   ARG n 
3  19   ALA n 
3  20   PRO n 
3  21   SER n 
3  22   HIS n 
3  23   ARG n 
3  24   TYR n 
3  25   LYS n 
3  26   ALA n 
3  27   ASP n 
3  28   LEU n 
3  29   GLU n 
3  30   HIS n 
3  31   ARG n 
3  32   LYS n 
3  33   VAL n 
3  34   GLU n 
3  35   ASP n 
3  36   GLY n 
3  37   ASP n 
3  38   VAL n 
3  39   ILE n 
3  40   ALA n 
3  41   GLY n 
3  42   THR n 
3  43   VAL n 
3  44   VAL n 
3  45   ASP n 
3  46   ILE n 
3  47   GLU n 
3  48   HIS n 
3  49   ASP n 
3  50   PRO n 
3  51   ALA n 
3  52   ARG n 
3  53   SER n 
3  54   ALA n 
3  55   PRO n 
3  56   VAL n 
3  57   ALA n 
3  58   ALA n 
3  59   VAL n 
3  60   GLU n 
3  61   PHE n 
3  62   GLU n 
3  63   ASP n 
3  64   GLY n 
3  65   ASP n 
3  66   ARG n 
3  67   ARG n 
3  68   LEU n 
3  69   ILE n 
3  70   LEU n 
3  71   ALA n 
3  72   PRO n 
3  73   GLU n 
3  74   GLY n 
3  75   VAL n 
3  76   GLY n 
3  77   VAL n 
3  78   GLY n 
3  79   ASP n 
3  80   GLU n 
3  81   LEU n 
3  82   GLN n 
3  83   VAL n 
3  84   GLY n 
3  85   VAL n 
3  86   SER n 
3  87   ALA n 
3  88   GLU n 
3  89   ILE n 
3  90   ALA n 
3  91   PRO n 
3  92   GLY n 
3  93   ASN n 
3  94   THR n 
3  95   LEU n 
3  96   PRO n 
3  97   LEU n 
3  98   ALA n 
3  99   GLU n 
3  100  ILE n 
3  101  PRO n 
3  102  GLU n 
3  103  GLY n 
3  104  VAL n 
3  105  PRO n 
3  106  VAL n 
3  107  CYS n 
3  108  ASN n 
3  109  VAL n 
3  110  GLU n 
3  111  SER n 
3  112  SER n 
3  113  PRO n 
3  114  GLY n 
3  115  ASP n 
3  116  GLY n 
3  117  GLY n 
3  118  LYS n 
3  119  PHE n 
3  120  ALA n 
3  121  ARG n 
3  122  ALA n 
3  123  SER n 
3  124  GLY n 
3  125  VAL n 
3  126  ASN n 
3  127  ALA n 
3  128  GLN n 
3  129  LEU n 
3  130  LEU n 
3  131  THR n 
3  132  HIS n 
3  133  ASP n 
3  134  ARG n 
3  135  ASN n 
3  136  VAL n 
3  137  ALA n 
3  138  VAL n 
3  139  VAL n 
3  140  LYS n 
3  141  LEU n 
3  142  PRO n 
3  143  SER n 
3  144  GLY n 
3  145  GLU n 
3  146  MET n 
3  147  LYS n 
3  148  ARG n 
3  149  LEU n 
3  150  ASP n 
3  151  PRO n 
3  152  GLN n 
3  153  CYS n 
3  154  ARG n 
3  155  ALA n 
3  156  THR n 
3  157  ILE n 
3  158  GLY n 
3  159  VAL n 
3  160  VAL n 
3  161  ALA n 
3  162  GLY n 
3  163  GLY n 
3  164  GLY n 
3  165  ARG n 
3  166  THR n 
3  167  ASP n 
3  168  LYS n 
3  169  PRO n 
3  170  PHE n 
3  171  VAL n 
3  172  LYS n 
3  173  ALA n 
3  174  GLY n 
3  175  ASN n 
3  176  LYS n 
3  177  HIS n 
3  178  HIS n 
3  179  LYS n 
3  180  MET n 
3  181  LYS n 
3  182  ALA n 
3  183  ARG n 
3  184  GLY n 
3  185  THR n 
3  186  LYS n 
3  187  TRP n 
3  188  PRO n 
3  189  ASN n 
3  190  VAL n 
3  191  ARG n 
3  192  GLY n 
3  193  VAL n 
3  194  ALA n 
3  195  MET n 
3  196  ASN n 
3  197  ALA n 
3  198  VAL n 
3  199  ASP n 
3  200  HIS n 
3  201  PRO n 
3  202  PHE n 
3  203  GLY n 
3  204  GLY n 
3  205  GLY n 
3  206  GLY n 
3  207  ARG n 
3  208  GLN n 
3  209  HIS n 
3  210  PRO n 
3  211  GLY n 
3  212  LYS n 
3  213  PRO n 
3  214  LYS n 
3  215  SER n 
3  216  ILE n 
3  217  SER n 
3  218  ARG n 
3  219  ASN n 
3  220  ALA n 
3  221  PRO n 
3  222  PRO n 
3  223  GLY n 
3  224  ARG n 
3  225  LYS n 
3  226  VAL n 
3  227  GLY n 
3  228  ASP n 
3  229  ILE n 
3  230  ALA n 
3  231  SER n 
3  232  LYS n 
3  233  ARG n 
3  234  THR n 
3  235  GLY n 
3  236  ARG n 
3  237  GLY n 
3  238  GLY n 
3  239  ASN n 
3  240  GLU n 
4  1    MET n 
4  2    PRO n 
4  3    GLN n 
4  4    PRO n 
4  5    SER n 
4  6    ARG n 
4  7    PRO n 
4  8    ARG n 
4  9    LYS n 
4  10   GLY n 
4  11   SER n 
4  12   LEU n 
4  13   GLY n 
4  14   PHE n 
4  15   GLY n 
4  16   PRO n 
4  17   ARG n 
4  18   LYS n 
4  19   ARG n 
4  20   SER n 
4  21   THR n 
4  22   SER n 
4  23   GLU n 
4  24   THR n 
4  25   PRO n 
4  26   ARG n 
4  27   PHE n 
4  28   ASN n 
4  29   SER n 
4  30   TRP n 
4  31   PRO n 
4  32   SER n 
4  33   ASP n 
4  34   ASP n 
4  35   GLY n 
4  36   GLN n 
4  37   PRO n 
4  38   GLY n 
4  39   VAL n 
4  40   GLN n 
4  41   GLY n 
4  42   PHE n 
4  43   ALA n 
4  44   GLY n 
4  45   TYR n 
4  46   LYS n 
4  47   ALA n 
4  48   GLY n 
4  49   MET n 
4  50   THR n 
4  51   HIS n 
4  52   VAL n 
4  53   VAL n 
4  54   LEU n 
4  55   VAL n 
4  56   ASN n 
4  57   ASP n 
4  58   GLU n 
4  59   PRO n 
4  60   ASN n 
4  61   SER n 
4  62   PRO n 
4  63   ARG n 
4  64   GLU n 
4  65   GLY n 
4  66   MET n 
4  67   GLU n 
4  68   GLU n 
4  69   THR n 
4  70   VAL n 
4  71   PRO n 
4  72   VAL n 
4  73   THR n 
4  74   VAL n 
4  75   ILE n 
4  76   GLU n 
4  77   THR n 
4  78   PRO n 
4  79   PRO n 
4  80   MET n 
4  81   ARG n 
4  82   ALA n 
4  83   VAL n 
4  84   ALA n 
4  85   LEU n 
4  86   ARG n 
4  87   ALA n 
4  88   TYR n 
4  89   GLU n 
4  90   ASP n 
4  91   THR n 
4  92   PRO n 
4  93   TYR n 
4  94   GLY n 
4  95   GLN n 
4  96   ARG n 
4  97   PRO n 
4  98   LEU n 
4  99   THR n 
4  100  GLU n 
4  101  VAL n 
4  102  TRP n 
4  103  THR n 
4  104  ASP n 
4  105  GLU n 
4  106  PHE n 
4  107  HIS n 
4  108  SER n 
4  109  GLU n 
4  110  LEU n 
4  111  ASP n 
4  112  ARG n 
4  113  THR n 
4  114  LEU n 
4  115  ASP n 
4  116  VAL n 
4  117  PRO n 
4  118  GLU n 
4  119  ASP n 
4  120  HIS n 
4  121  ASP n 
4  122  PRO n 
4  123  ASP n 
4  124  ALA n 
4  125  ALA n 
4  126  GLU n 
4  127  GLU n 
4  128  GLN n 
4  129  ILE n 
4  130  ARG n 
4  131  ASP n 
4  132  ALA n 
4  133  HIS n 
4  134  GLU n 
4  135  ALA n 
4  136  GLY n 
4  137  ASP n 
4  138  LEU n 
4  139  GLY n 
4  140  ASP n 
4  141  LEU n 
4  142  ARG n 
4  143  LEU n 
4  144  ILE n 
4  145  THR n 
4  146  HIS n 
4  147  THR n 
4  148  VAL n 
4  149  PRO n 
4  150  ASP n 
4  151  ALA n 
4  152  VAL n 
4  153  PRO n 
4  154  SER n 
4  155  VAL n 
4  156  PRO n 
4  157  LYS n 
4  158  LYS n 
4  159  LYS n 
4  160  PRO n 
4  161  ASP n 
4  162  VAL n 
4  163  MET n 
4  164  GLU n 
4  165  THR n 
4  166  ARG n 
4  167  VAL n 
4  168  GLY n 
4  169  GLY n 
4  170  GLY n 
4  171  SER n 
4  172  VAL n 
4  173  SER n 
4  174  ASP n 
4  175  ARG n 
4  176  LEU n 
4  177  ASP n 
4  178  HIS n 
4  179  ALA n 
4  180  LEU n 
4  181  ASP n 
4  182  ILE n 
4  183  VAL n 
4  184  GLU n 
4  185  ASP n 
4  186  GLY n 
4  187  GLY n 
4  188  GLU n 
4  189  HIS n 
4  190  ALA n 
4  191  MET n 
4  192  ASN n 
4  193  ASP n 
4  194  ILE n 
4  195  PHE n 
4  196  ARG n 
4  197  ALA n 
4  198  GLY n 
4  199  GLU n 
4  200  TYR n 
4  201  ALA n 
4  202  ASP n 
4  203  VAL n 
4  204  ALA n 
4  205  GLY n 
4  206  VAL n 
4  207  THR n 
4  208  LYS n 
4  209  GLY n 
4  210  LYS n 
4  211  GLY n 
4  212  THR n 
4  213  GLN n 
4  214  GLY n 
4  215  PRO n 
4  216  VAL n 
4  217  LYS n 
4  218  ARG n 
4  219  TRP n 
4  220  GLY n 
4  221  VAL n 
4  222  GLN n 
4  223  LYS n 
4  224  ARG n 
4  225  LYS n 
4  226  GLY n 
4  227  LYS n 
4  228  HIS n 
4  229  ALA n 
4  230  ARG n 
4  231  GLN n 
4  232  GLY n 
4  233  TRP n 
4  234  ARG n 
4  235  ARG n 
4  236  ARG n 
4  237  ILE n 
4  238  GLY n 
4  239  ASN n 
4  240  LEU n 
4  241  GLY n 
4  242  PRO n 
4  243  TRP n 
4  244  ASN n 
4  245  PRO n 
4  246  SER n 
4  247  ARG n 
4  248  VAL n 
4  249  ARG n 
4  250  SER n 
4  251  THR n 
4  252  VAL n 
4  253  PRO n 
4  254  GLN n 
4  255  GLN n 
4  256  GLY n 
4  257  GLN n 
4  258  THR n 
4  259  GLY n 
4  260  TYR n 
4  261  HIS n 
4  262  GLN n 
4  263  ARG n 
4  264  THR n 
4  265  GLU n 
4  266  LEU n 
4  267  ASN n 
4  268  LYS n 
4  269  ARG n 
4  270  LEU n 
4  271  ILE n 
4  272  ASP n 
4  273  ILE n 
4  274  GLY n 
4  275  GLU n 
4  276  GLY n 
4  277  ASP n 
4  278  GLU n 
4  279  PRO n 
4  280  THR n 
4  281  VAL n 
4  282  ASP n 
4  283  GLY n 
4  284  GLY n 
4  285  PHE n 
4  286  VAL n 
4  287  ASN n 
4  288  TYR n 
4  289  GLY n 
4  290  GLU n 
4  291  VAL n 
4  292  ASP n 
4  293  GLY n 
4  294  PRO n 
4  295  TYR n 
4  296  THR n 
4  297  LEU n 
4  298  VAL n 
4  299  LYS n 
4  300  GLY n 
4  301  SER n 
4  302  VAL n 
4  303  PRO n 
4  304  GLY n 
4  305  PRO n 
4  306  ASP n 
4  307  LYS n 
4  308  ARG n 
4  309  LEU n 
4  310  VAL n 
4  311  ARG n 
4  312  PHE n 
4  313  ARG n 
4  314  PRO n 
4  315  ALA n 
4  316  VAL n 
4  317  ARG n 
4  318  PRO n 
4  319  ASN n 
4  320  ASP n 
4  321  GLN n 
4  322  PRO n 
4  323  ARG n 
4  324  LEU n 
4  325  ASP n 
4  326  PRO n 
4  327  GLU n 
4  328  VAL n 
4  329  ARG n 
4  330  TYR n 
4  331  VAL n 
4  332  SER n 
4  333  ASN n 
4  334  GLU n 
4  335  SER n 
4  336  ASN n 
4  337  GLN n 
4  338  GLY n 
5  1    MET n 
5  2    GLN n 
5  3    ALA n 
5  4    THR n 
5  5    ILE n 
5  6    TYR n 
5  7    ASP n 
5  8    LEU n 
5  9    ASP n 
5  10   GLY n 
5  11   ASN n 
5  12   THR n 
5  13   ASP n 
5  14   GLY n 
5  15   GLU n 
5  16   VAL n 
5  17   ASP n 
5  18   LEU n 
5  19   PRO n 
5  20   ASP n 
5  21   VAL n 
5  22   PHE n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   VAL n 
5  27   ARG n 
5  28   SER n 
5  29   ASP n 
5  30   LEU n 
5  31   ILE n 
5  32   GLY n 
5  33   LYS n 
5  34   ALA n 
5  35   VAL n 
5  36   ARG n 
5  37   ALA n 
5  38   ALA n 
5  39   GLN n 
5  40   ALA n 
5  41   ASN n 
5  42   ARG n 
5  43   LYS n 
5  44   GLN n 
5  45   ASP n 
5  46   TYR n 
5  47   GLY n 
5  48   SER n 
5  49   ASP n 
5  50   GLU n 
5  51   TYR n 
5  52   ALA n 
5  53   GLY n 
5  54   LEU n 
5  55   ARG n 
5  56   THR n 
5  57   PRO n 
5  58   ALA n 
5  59   GLU n 
5  60   SER n 
5  61   PHE n 
5  62   GLY n 
5  63   SER n 
5  64   GLY n 
5  65   ARG n 
5  66   GLY n 
5  67   GLN n 
5  68   ALA n 
5  69   HIS n 
5  70   VAL n 
5  71   PRO n 
5  72   LYS n 
5  73   LEU n 
5  74   ASP n 
5  75   GLY n 
5  76   ARG n 
5  77   ALA n 
5  78   ARG n 
5  79   ARG n 
5  80   VAL n 
5  81   PRO n 
5  82   GLN n 
5  83   ALA n 
5  84   VAL n 
5  85   LYS n 
5  86   GLY n 
5  87   ARG n 
5  88   SER n 
5  89   ALA n 
5  90   HIS n 
5  91   PRO n 
5  92   PRO n 
5  93   LYS n 
5  94   THR n 
5  95   GLU n 
5  96   LYS n 
5  97   ASP n 
5  98   ARG n 
5  99   SER n 
5  100  LEU n 
5  101  ASP n 
5  102  LEU n 
5  103  ASN n 
5  104  ASP n 
5  105  LYS n 
5  106  GLU n 
5  107  ARG n 
5  108  GLN n 
5  109  LEU n 
5  110  ALA n 
5  111  VAL n 
5  112  ARG n 
5  113  SER n 
5  114  ALA n 
5  115  LEU n 
5  116  ALA n 
5  117  ALA n 
5  118  THR n 
5  119  ALA n 
5  120  ASP n 
5  121  ALA n 
5  122  ASP n 
5  123  LEU n 
5  124  VAL n 
5  125  ALA n 
5  126  ASP n 
5  127  ARG n 
5  128  GLY n 
5  129  HIS n 
5  130  GLU n 
5  131  PHE n 
5  132  ASP n 
5  133  ARG n 
5  134  ASP n 
5  135  GLU n 
5  136  VAL n 
5  137  PRO n 
5  138  VAL n 
5  139  VAL n 
5  140  VAL n 
5  141  SER n 
5  142  ASP n 
5  143  ASP n 
5  144  PHE n 
5  145  GLU n 
5  146  ASP n 
5  147  LEU n 
5  148  VAL n 
5  149  LYS n 
5  150  THR n 
5  151  GLN n 
5  152  GLU n 
5  153  VAL n 
5  154  VAL n 
5  155  SER n 
5  156  LEU n 
5  157  LEU n 
5  158  GLU n 
5  159  ALA n 
5  160  LEU n 
5  161  ASP n 
5  162  VAL n 
5  163  HIS n 
5  164  ALA n 
5  165  ASP n 
5  166  ILE n 
5  167  ASP n 
5  168  ARG n 
5  169  ALA n 
5  170  ASP n 
5  171  GLU n 
5  172  THR n 
5  173  LYS n 
5  174  ILE n 
5  175  LYS n 
5  176  ALA n 
5  177  GLY n 
5  178  GLN n 
5  179  GLY n 
5  180  SER n 
5  181  ALA n 
5  182  ARG n 
5  183  GLY n 
5  184  ARG n 
5  185  LYS n 
5  186  TYR n 
5  187  ARG n 
5  188  ARG n 
5  189  PRO n 
5  190  ALA n 
5  191  SER n 
5  192  ILE n 
5  193  LEU n 
5  194  PHE n 
5  195  VAL n 
5  196  THR n 
5  197  SER n 
5  198  ASP n 
5  199  GLU n 
5  200  PRO n 
5  201  SER n 
5  202  THR n 
5  203  ALA n 
5  204  ALA n 
5  205  ARG n 
5  206  ASN n 
5  207  LEU n 
5  208  ALA n 
5  209  GLY n 
5  210  ALA n 
5  211  ASP n 
5  212  VAL n 
5  213  ALA n 
5  214  THR n 
5  215  ALA n 
5  216  SER n 
5  217  GLU n 
5  218  VAL n 
5  219  ASN n 
5  220  THR n 
5  221  GLU n 
5  222  ASP n 
5  223  LEU n 
5  224  ALA n 
5  225  PRO n 
5  226  GLY n 
5  227  GLY n 
5  228  ALA n 
5  229  PRO n 
5  230  GLY n 
5  231  ARG n 
5  232  LEU n 
5  233  THR n 
5  234  VAL n 
5  235  PHE n 
5  236  THR n 
5  237  GLU n 
5  238  SER n 
5  239  ALA n 
5  240  LEU n 
5  241  ALA n 
5  242  GLU n 
5  243  VAL n 
5  244  ALA n 
5  245  GLU n 
5  246  ARG n 
6  1    MET n 
6  2    SER n 
6  3    SER n 
6  4    GLU n 
6  5    SER n 
6  6    GLU n 
6  7    SER n 
6  8    GLY n 
6  9    GLY n 
6  10   ASP n 
6  11   PHE n 
6  12   HIS n 
6  13   GLU n 
6  14   MET n 
6  15   ARG n 
6  16   GLU n 
6  17   PRO n 
6  18   ARG n 
6  19   ILE n 
6  20   GLU n 
6  21   LYS n 
6  22   VAL n 
6  23   VAL n 
6  24   VAL n 
6  25   HIS n 
6  26   MET n 
6  27   GLY n 
6  28   ILE n 
6  29   GLY n 
6  30   HIS n 
6  31   GLY n 
6  32   GLY n 
6  33   ARG n 
6  34   ASP n 
6  35   LEU n 
6  36   ALA n 
6  37   ASN n 
6  38   ALA n 
6  39   GLU n 
6  40   ASP n 
6  41   ILE n 
6  42   LEU n 
6  43   GLY n 
6  44   GLU n 
6  45   ILE n 
6  46   THR n 
6  47   GLY n 
6  48   GLN n 
6  49   MET n 
6  50   PRO n 
6  51   VAL n 
6  52   ARG n 
6  53   THR n 
6  54   LYS n 
6  55   ALA n 
6  56   LYS n 
6  57   ARG n 
6  58   THR n 
6  59   VAL n 
6  60   GLY n 
6  61   GLU n 
6  62   PHE n 
6  63   ASP n 
6  64   ILE n 
6  65   ARG n 
6  66   GLU n 
6  67   GLY n 
6  68   ASP n 
6  69   PRO n 
6  70   ILE n 
6  71   GLY n 
6  72   ALA n 
6  73   LYS n 
6  74   VAL n 
6  75   THR n 
6  76   LEU n 
6  77   ARG n 
6  78   ASP n 
6  79   GLU n 
6  80   MET n 
6  81   ALA n 
6  82   GLU n 
6  83   GLU n 
6  84   PHE n 
6  85   LEU n 
6  86   GLN n 
6  87   THR n 
6  88   ALA n 
6  89   LEU n 
6  90   PRO n 
6  91   LEU n 
6  92   ALA n 
6  93   GLU n 
6  94   LEU n 
6  95   ALA n 
6  96   THR n 
6  97   SER n 
6  98   GLN n 
6  99   PHE n 
6  100  ASP n 
6  101  ASP n 
6  102  THR n 
6  103  GLY n 
6  104  ASN n 
6  105  PHE n 
6  106  SER n 
6  107  PHE n 
6  108  GLY n 
6  109  VAL n 
6  110  GLU n 
6  111  GLU n 
6  112  HIS n 
6  113  THR n 
6  114  GLU n 
6  115  PHE n 
6  116  PRO n 
6  117  SER n 
6  118  GLN n 
6  119  GLU n 
6  120  TYR n 
6  121  ASP n 
6  122  PRO n 
6  123  SER n 
6  124  ILE n 
6  125  GLY n 
6  126  ILE n 
6  127  TYR n 
6  128  GLY n 
6  129  LEU n 
6  130  ASP n 
6  131  VAL n 
6  132  THR n 
6  133  VAL n 
6  134  ASN n 
6  135  LEU n 
6  136  VAL n 
6  137  ARG n 
6  138  PRO n 
6  139  GLY n 
6  140  TYR n 
6  141  ARG n 
6  142  VAL n 
6  143  ALA n 
6  144  LYS n 
6  145  ARG n 
6  146  ASP n 
6  147  LYS n 
6  148  ALA n 
6  149  SER n 
6  150  ARG n 
6  151  SER n 
6  152  ILE n 
6  153  PRO n 
6  154  THR n 
6  155  LYS n 
6  156  HIS n 
6  157  ARG n 
6  158  LEU n 
6  159  ASN n 
6  160  PRO n 
6  161  ALA n 
6  162  ASP n 
6  163  ALA n 
6  164  VAL n 
6  165  ALA n 
6  166  PHE n 
6  167  ILE n 
6  168  GLU n 
6  169  SER n 
6  170  THR n 
6  171  TYR n 
6  172  ASP n 
6  173  VAL n 
6  174  GLU n 
6  175  VAL n 
6  176  SER n 
6  177  GLU n 
7  1    MET n 
7  2    PRO n 
7  3    ARG n 
7  4    VAL n 
7  5    GLU n 
7  6    LEU n 
7  7    GLU n 
7  8    ILE n 
7  9    PRO n 
7  10   GLU n 
7  11   ASP n 
7  12   VAL n 
7  13   ASP n 
7  14   ALA n 
7  15   GLU n 
7  16   GLN n 
7  17   ASP n 
7  18   HIS n 
7  19   LEU n 
7  20   ASP n 
7  21   ILE n 
7  22   THR n 
7  23   VAL n 
7  24   GLU n 
7  25   GLY n 
7  26   ASP n 
7  27   ASN n 
7  28   GLY n 
7  29   SER n 
7  30   VAL n 
7  31   THR n 
7  32   ARG n 
7  33   ARG n 
7  34   LEU n 
7  35   TRP n 
7  36   TYR n 
7  37   PRO n 
7  38   ASP n 
7  39   ILE n 
7  40   ASP n 
7  41   VAL n 
7  42   SER n 
7  43   VAL n 
7  44   ASP n 
7  45   GLY n 
7  46   ASP n 
7  47   THR n 
7  48   VAL n 
7  49   VAL n 
7  50   ILE n 
7  51   GLU n 
7  52   SER n 
7  53   ASP n 
7  54   GLU n 
7  55   ASP n 
7  56   ASN n 
7  57   ALA n 
7  58   LYS n 
7  59   THR n 
7  60   MET n 
7  61   SER n 
7  62   THR n 
7  63   ILE n 
7  64   GLY n 
7  65   THR n 
7  66   PHE n 
7  67   GLN n 
7  68   SER n 
7  69   HIS n 
7  70   ILE n 
7  71   GLU n 
7  72   ASN n 
7  73   MET n 
7  74   PHE n 
7  75   HIS n 
7  76   GLY n 
7  77   VAL n 
7  78   THR n 
7  79   GLU n 
7  80   GLY n 
7  81   TRP n 
7  82   GLU n 
7  83   TYR n 
7  84   GLY n 
7  85   MET n 
7  86   GLU n 
7  87   VAL n 
7  88   PHE n 
7  89   TYR n 
7  90   SER n 
7  91   HIS n 
7  92   PHE n 
7  93   PRO n 
7  94   MET n 
7  95   GLN n 
7  96   VAL n 
7  97   ASN n 
7  98   VAL n 
7  99   GLU n 
7  100  GLY n 
7  101  ASP n 
7  102  GLU n 
7  103  VAL n 
7  104  VAL n 
7  105  ILE n 
7  106  GLU n 
7  107  ASN n 
7  108  PHE n 
7  109  LEU n 
7  110  GLY n 
7  111  GLU n 
7  112  LYS n 
7  113  ALA n 
7  114  PRO n 
7  115  ARG n 
7  116  ARG n 
7  117  THR n 
7  118  THR n 
7  119  ILE n 
7  120  HIS n 
7  121  GLY n 
7  122  ASP n 
7  123  THR n 
7  124  ASP n 
7  125  VAL n 
7  126  GLU n 
7  127  ILE n 
7  128  ASP n 
7  129  GLY n 
7  130  GLU n 
7  131  GLU n 
7  132  LEU n 
7  133  THR n 
7  134  VAL n 
7  135  SER n 
7  136  GLY n 
7  137  PRO n 
7  138  ASP n 
7  139  ILE n 
7  140  GLU n 
7  141  ALA n 
7  142  VAL n 
7  143  GLY n 
7  144  GLN n 
7  145  THR n 
7  146  ALA n 
7  147  ALA n 
7  148  ASP n 
7  149  ILE n 
7  150  GLU n 
7  151  GLN n 
7  152  LEU n 
7  153  THR n 
7  154  ARG n 
7  155  ILE n 
7  156  ASN n 
7  157  ASP n 
7  158  LYS n 
7  159  ASP n 
7  160  VAL n 
7  161  ARG n 
7  162  VAL n 
7  163  PHE n 
7  164  GLN n 
7  165  ASP n 
7  166  GLY n 
7  167  VAL n 
7  168  TYR n 
7  169  ILE n 
7  170  THR n 
7  171  ARG n 
7  172  LYS n 
7  173  PRO n 
7  174  ASN n 
7  175  ARG n 
7  176  GLY n 
7  177  ASP n 
7  178  ALA n 
8  1    MET n 
8  2    PRO n 
8  3    VAL n 
8  4    TYR n 
8  5    VAL n 
8  6    ASP n 
8  7    PHE n 
8  8    ASP n 
8  9    VAL n 
8  10   PRO n 
8  11   ALA n 
8  12   ASP n 
8  13   LEU n 
8  14   GLU n 
8  15   ASP n 
8  16   ASP n 
8  17   ALA n 
8  18   LEU n 
8  19   GLU n 
8  20   ALA n 
8  21   LEU n 
8  22   GLU n 
8  23   VAL n 
8  24   ALA n 
8  25   ARG n 
8  26   ASP n 
8  27   THR n 
8  28   GLY n 
8  29   ALA n 
8  30   VAL n 
8  31   LYS n 
8  32   LYS n 
8  33   GLY n 
8  34   THR n 
8  35   ASN n 
8  36   GLU n 
8  37   THR n 
8  38   THR n 
8  39   LYS n 
8  40   SER n 
8  41   ILE n 
8  42   GLU n 
8  43   ARG n 
8  44   GLY n 
8  45   SER n 
8  46   ALA n 
8  47   GLU n 
8  48   LEU n 
8  49   VAL n 
8  50   PHE n 
8  51   VAL n 
8  52   ALA n 
8  53   GLU n 
8  54   ASP n 
8  55   VAL n 
8  56   GLN n 
8  57   PRO n 
8  58   GLU n 
8  59   GLU n 
8  60   ILE n 
8  61   VAL n 
8  62   MET n 
8  63   HIS n 
8  64   ILE n 
8  65   PRO n 
8  66   GLU n 
8  67   LEU n 
8  68   ALA n 
8  69   ASP n 
8  70   GLU n 
8  71   LYS n 
8  72   GLY n 
8  73   VAL n 
8  74   PRO n 
8  75   PHE n 
8  76   ILE n 
8  77   PHE n 
8  78   VAL n 
8  79   GLU n 
8  80   GLN n 
8  81   GLN n 
8  82   ASP n 
8  83   ASP n 
8  84   LEU n 
8  85   GLY n 
8  86   HIS n 
8  87   ALA n 
8  88   ALA n 
8  89   GLY n 
8  90   LEU n 
8  91   GLU n 
8  92   VAL n 
8  93   GLY n 
8  94   SER n 
8  95   ALA n 
8  96   ALA n 
8  97   ALA n 
8  98   ALA n 
8  99   VAL n 
8  100  THR n 
8  101  ASP n 
8  102  ALA n 
8  103  GLY n 
8  104  GLU n 
8  105  ALA n 
8  106  ASP n 
8  107  ALA n 
8  108  ASP n 
8  109  VAL n 
8  110  GLU n 
8  111  ASP n 
8  112  ILE n 
8  113  ALA n 
8  114  ASP n 
8  115  LYS n 
8  116  VAL n 
8  117  GLU n 
8  118  GLU n 
8  119  LEU n 
8  120  ARG n 
9  1    MET n 
9  2    SER n 
9  3    ALA n 
9  4    GLU n 
9  5    SER n 
9  6    GLU n 
9  7    ARG n 
9  8    LYS n 
9  9    THR n 
9  10   GLU n 
9  11   THR n 
9  12   ILE n 
9  13   PRO n 
9  14   GLU n 
9  15   TRP n 
9  16   LYS n 
9  17   GLN n 
9  18   GLU n 
9  19   GLU n 
9  20   VAL n 
9  21   ASP n 
9  22   ALA n 
9  23   ILE n 
9  24   VAL n 
9  25   GLU n 
9  26   MET n 
9  27   ILE n 
9  28   GLU n 
9  29   SER n 
9  30   TYR n 
9  31   GLU n 
9  32   SER n 
9  33   VAL n 
9  34   GLY n 
9  35   VAL n 
9  36   VAL n 
9  37   ASN n 
9  38   ILE n 
9  39   ALA n 
9  40   GLY n 
9  41   ILE n 
9  42   PRO n 
9  43   SER n 
9  44   ARG n 
9  45   GLN n 
9  46   LEU n 
9  47   GLN n 
9  48   ASP n 
9  49   MET n 
9  50   ARG n 
9  51   ARG n 
9  52   ASP n 
9  53   LEU n 
9  54   HIS n 
9  55   GLY n 
9  56   THR n 
9  57   ALA n 
9  58   GLU n 
9  59   LEU n 
9  60   ARG n 
9  61   VAL n 
9  62   SER n 
9  63   ARG n 
9  64   ASN n 
9  65   THR n 
9  66   LEU n 
9  67   LEU n 
9  68   GLU n 
9  69   ARG n 
9  70   ALA n 
9  71   LEU n 
9  72   ASP n 
9  73   ASP n 
9  74   VAL n 
9  75   ASP n 
9  76   ASP n 
9  77   GLY n 
9  78   LEU n 
9  79   GLU n 
9  80   ASP n 
9  81   LEU n 
9  82   ASN n 
9  83   GLY n 
9  84   TYR n 
9  85   ILE n 
9  86   THR n 
9  87   GLY n 
9  88   GLN n 
9  89   VAL n 
9  90   GLY n 
9  91   LEU n 
9  92   ILE n 
9  93   GLY n 
9  94   THR n 
9  95   ASP n 
9  96   ASP n 
9  97   ASN n 
9  98   PRO n 
9  99   PHE n 
9  100  SER n 
9  101  LEU n 
9  102  PHE n 
9  103  GLN n 
9  104  GLU n 
9  105  LEU n 
9  106  GLU n 
9  107  ALA n 
9  108  SER n 
9  109  LYS n 
9  110  THR n 
9  111  PRO n 
9  112  ALA n 
9  113  PRO n 
9  114  ILE n 
9  115  GLY n 
9  116  ALA n 
9  117  GLY n 
9  118  GLU n 
9  119  VAL n 
9  120  ALA n 
9  121  PRO n 
9  122  ASN n 
9  123  ASP n 
9  124  ILE n 
9  125  VAL n 
9  126  ILE n 
9  127  PRO n 
9  128  GLU n 
9  129  GLY n 
9  130  ASP n 
9  131  THR n 
9  132  GLY n 
9  133  VAL n 
9  134  ASP n 
9  135  PRO n 
9  136  GLY n 
9  137  PRO n 
9  138  PHE n 
9  139  VAL n 
9  140  GLY n 
9  141  GLU n 
9  142  LEU n 
9  143  GLN n 
9  144  SER n 
9  145  VAL n 
9  146  GLY n 
9  147  ALA n 
9  148  ASP n 
9  149  ALA n 
9  150  ARG n 
9  151  ILE n 
9  152  GLN n 
9  153  GLU n 
9  154  GLY n 
9  155  SER n 
9  156  ILE n 
9  157  GLN n 
9  158  VAL n 
9  159  LEU n 
9  160  SER n 
9  161  ASP n 
9  162  SER n 
9  163  THR n 
9  164  VAL n 
9  165  LEU n 
9  166  ASP n 
9  167  THR n 
9  168  GLY n 
9  169  GLU n 
9  170  GLU n 
9  171  VAL n 
9  172  SER n 
9  173  GLN n 
9  174  GLU n 
9  175  LEU n 
9  176  SER n 
9  177  ASN n 
9  178  VAL n 
9  179  LEU n 
9  180  ASN n 
9  181  GLU n 
9  182  LEU n 
9  183  GLY n 
9  184  ILE n 
9  185  GLU n 
9  186  PRO n 
9  187  LYS n 
9  188  GLU n 
9  189  VAL n 
9  190  GLY n 
9  191  LEU n 
9  192  ASP n 
9  193  LEU n 
9  194  ARG n 
9  195  ALA n 
9  196  VAL n 
9  197  PHE n 
9  198  ALA n 
9  199  ASP n 
9  200  GLY n 
9  201  VAL n 
9  202  LEU n 
9  203  PHE n 
9  204  GLU n 
9  205  PRO n 
9  206  GLU n 
9  207  GLU n 
9  208  LEU n 
9  209  GLU n 
9  210  LEU n 
9  211  ASP n 
9  212  ILE n 
9  213  ASP n 
9  214  GLU n 
9  215  TYR n 
9  216  ARG n 
9  217  SER n 
9  218  ASP n 
9  219  ILE n 
9  220  GLN n 
9  221  ALA n 
9  222  ALA n 
9  223  ALA n 
9  224  GLY n 
9  225  ARG n 
9  226  ALA n 
9  227  PHE n 
9  228  ASN n 
9  229  LEU n 
9  230  SER n 
9  231  VAL n 
9  232  ASN n 
9  233  ALA n 
9  234  ASP n 
9  235  TYR n 
9  236  PRO n 
9  237  THR n 
9  238  ALA n 
9  239  THR n 
9  240  THR n 
9  241  ALA n 
9  242  PRO n 
9  243  THR n 
9  244  MET n 
9  245  LEU n 
9  246  GLN n 
9  247  SER n 
9  248  ASP n 
9  249  ARG n 
9  250  GLY n 
9  251  ASN n 
9  252  ALA n 
9  253  LYS n 
9  254  SER n 
9  255  LEU n 
9  256  ALA n 
9  257  LEU n 
9  258  GLN n 
9  259  ALA n 
9  260  ALA n 
9  261  ILE n 
9  262  GLU n 
9  263  ASP n 
9  264  PRO n 
9  265  GLU n 
9  266  VAL n 
9  267  VAL n 
9  268  PRO n 
9  269  ASP n 
9  270  LEU n 
9  271  VAL n 
9  272  SER n 
9  273  LYS n 
9  274  ALA n 
9  275  ASP n 
9  276  ALA n 
9  277  GLN n 
9  278  VAL n 
9  279  ARG n 
9  280  ALA n 
9  281  LEU n 
9  282  ALA n 
9  283  SER n 
9  284  GLN n 
9  285  ILE n 
9  286  ASP n 
9  287  ASP n 
9  288  GLU n 
9  289  GLU n 
9  290  ALA n 
9  291  LEU n 
9  292  PRO n 
9  293  GLU n 
9  294  GLU n 
9  295  LEU n 
9  296  GLN n 
9  297  GLY n 
9  298  VAL n 
9  299  GLU n 
9  300  ALA n 
9  301  ASP n 
9  302  VAL n 
9  303  ALA n 
9  304  THR n 
9  305  GLU n 
9  306  GLU n 
9  307  PRO n 
9  308  THR n 
9  309  ASP n 
9  310  ASP n 
9  311  GLN n 
9  312  ASP n 
9  313  ASP n 
9  314  ASP n 
9  315  THR n 
9  316  ALA n 
9  317  SER n 
9  318  GLU n 
9  319  ASP n 
9  320  ASP n 
9  321  ALA n 
9  322  ASP n 
9  323  ALA n 
9  324  ASP n 
9  325  ASP n 
9  326  ALA n 
9  327  ALA n 
9  328  GLU n 
9  329  GLU n 
9  330  ALA n 
9  331  ASP n 
9  332  ASP n 
9  333  ASP n 
9  334  ASP n 
9  335  ASP n 
9  336  ASP n 
9  337  ASP n 
9  338  GLU n 
9  339  ASP n 
9  340  ALA n 
9  341  GLY n 
9  342  ASP n 
9  343  ALA n 
9  344  LEU n 
9  345  GLY n 
9  346  ALA n 
9  347  MET n 
9  348  PHE n 
10 1    MET n 
10 2    SER n 
10 3    ASP n 
10 4    LYS n 
10 5    PRO n 
10 6    ALA n 
10 7    SER n 
10 8    MET n 
10 9    TYR n 
10 10   ARG n 
10 11   ASP n 
10 12   ILE n 
10 13   ASP n 
10 14   LYS n 
10 15   PRO n 
10 16   ALA n 
10 17   TYR n 
10 18   THR n 
10 19   ARG n 
10 20   ARG n 
10 21   GLU n 
10 22   TYR n 
10 23   ILE n 
10 24   THR n 
10 25   GLY n 
10 26   ILE n 
10 27   PRO n 
10 28   GLY n 
10 29   SER n 
10 30   LYS n 
10 31   ILE n 
10 32   ALA n 
10 33   GLN n 
10 34   HIS n 
10 35   LYS n 
10 36   MET n 
10 37   GLY n 
10 38   ARG n 
10 39   LYS n 
10 40   GLN n 
10 41   LYS n 
10 42   ASP n 
10 43   ALA n 
10 44   ASP n 
10 45   ASP n 
10 46   TYR n 
10 47   PRO n 
10 48   VAL n 
10 49   GLN n 
10 50   ILE n 
10 51   SER n 
10 52   LEU n 
10 53   ILE n 
10 54   VAL n 
10 55   GLU n 
10 56   GLU n 
10 57   THR n 
10 58   VAL n 
10 59   GLN n 
10 60   LEU n 
10 61   ARG n 
10 62   HIS n 
10 63   GLY n 
10 64   SER n 
10 65   LEU n 
10 66   GLU n 
10 67   ALA n 
10 68   SER n 
10 69   ARG n 
10 70   LEU n 
10 71   SER n 
10 72   ALA n 
10 73   ASN n 
10 74   ARG n 
10 75   HIS n 
10 76   LEU n 
10 77   ILE n 
10 78   LYS n 
10 79   GLU n 
10 80   LEU n 
10 81   GLY n 
10 82   GLU n 
10 83   GLU n 
10 84   GLY n 
10 85   ASP n 
10 86   TYR n 
10 87   LYS n 
10 88   MET n 
10 89   THR n 
10 90   LEU n 
10 91   ARG n 
10 92   LYS n 
10 93   PHE n 
10 94   PRO n 
10 95   HIS n 
10 96   GLN n 
10 97   VAL n 
10 98   LEU n 
10 99   ARG n 
10 100  GLU n 
10 101  ASN n 
10 102  LYS n 
10 103  GLN n 
10 104  ALA n 
10 105  THR n 
10 106  GLY n 
10 107  ALA n 
10 108  GLY n 
10 109  ALA n 
10 110  ASP n 
10 111  ARG n 
10 112  VAL n 
10 113  SER n 
10 114  ASP n 
10 115  GLY n 
10 116  MET n 
10 117  ARG n 
10 118  ALA n 
10 119  ALA n 
10 120  PHE n 
10 121  GLY n 
10 122  LYS n 
10 123  ILE n 
10 124  VAL n 
10 125  GLY n 
10 126  THR n 
10 127  ALA n 
10 128  ALA n 
10 129  ARG n 
10 130  VAL n 
10 131  GLN n 
10 132  ALA n 
10 133  GLY n 
10 134  GLU n 
10 135  GLN n 
10 136  LEU n 
10 137  PHE n 
10 138  THR n 
10 139  ALA n 
10 140  TYR n 
10 141  CYS n 
10 142  ASN n 
10 143  VAL n 
10 144  GLU n 
10 145  ASP n 
10 146  ALA n 
10 147  GLU n 
10 148  HIS n 
10 149  VAL n 
10 150  LYS n 
10 151  GLU n 
10 152  ALA n 
10 153  PHE n 
10 154  ARG n 
10 155  ARG n 
10 156  ALA n 
10 157  TYR n 
10 158  ASN n 
10 159  LYS n 
10 160  ILE n 
10 161  THR n 
10 162  PRO n 
10 163  SER n 
10 164  CYS n 
10 165  ARG n 
10 166  ILE n 
10 167  LYS n 
10 168  VAL n 
10 169  GLU n 
10 170  ARG n 
10 171  GLY n 
10 172  GLU n 
10 173  GLU n 
10 174  LEU n 
10 175  LEU n 
10 176  ILE n 
10 177  ALA n 
11 1    MET n 
11 2    ALA n 
11 3    GLY n 
11 4    THR n 
11 5    ILE n 
11 6    GLU n 
11 7    VAL n 
11 8    LEU n 
11 9    VAL n 
11 10   PRO n 
11 11   GLY n 
11 12   GLY n 
11 13   GLU n 
11 14   ALA n 
11 15   ASN n 
11 16   PRO n 
11 17   GLY n 
11 18   PRO n 
11 19   PRO n 
11 20   LEU n 
11 21   GLY n 
11 22   PRO n 
11 23   GLU n 
11 24   LEU n 
11 25   GLY n 
11 26   PRO n 
11 27   THR n 
11 28   PRO n 
11 29   VAL n 
11 30   ASP n 
11 31   VAL n 
11 32   GLN n 
11 33   ALA n 
11 34   VAL n 
11 35   VAL n 
11 36   GLN n 
11 37   GLU n 
11 38   ILE n 
11 39   ASN n 
11 40   ASP n 
11 41   GLN n 
11 42   THR n 
11 43   ALA n 
11 44   ALA n 
11 45   PHE n 
11 46   ASP n 
11 47   GLY n 
11 48   THR n 
11 49   GLU n 
11 50   VAL n 
11 51   PRO n 
11 52   VAL n 
11 53   THR n 
11 54   VAL n 
11 55   LYS n 
11 56   TYR n 
11 57   ASP n 
11 58   ASP n 
11 59   ASP n 
11 60   GLY n 
11 61   SER n 
11 62   PHE n 
11 63   GLU n 
11 64   ILE n 
11 65   GLU n 
11 66   VAL n 
11 67   GLY n 
11 68   VAL n 
11 69   PRO n 
11 70   PRO n 
11 71   THR n 
11 72   ALA n 
11 73   GLU n 
11 74   LEU n 
11 75   ILE n 
11 76   LYS n 
11 77   ASP n 
11 78   GLU n 
11 79   ALA n 
11 80   GLY n 
11 81   PHE n 
11 82   GLU n 
11 83   THR n 
11 84   GLY n 
11 85   SER n 
11 86   GLY n 
11 87   GLU n 
11 88   PRO n 
11 89   GLN n 
11 90   GLU n 
11 91   ASP n 
11 92   PHE n 
11 93   VAL n 
11 94   ALA n 
11 95   ASP n 
11 96   LEU n 
11 97   SER n 
11 98   VAL n 
11 99   ASP n 
11 100  GLN n 
11 101  VAL n 
11 102  LYS n 
11 103  GLN n 
11 104  ILE n 
11 105  ALA n 
11 106  GLU n 
11 107  GLN n 
11 108  LYS n 
11 109  HIS n 
11 110  PRO n 
11 111  ASP n 
11 112  LEU n 
11 113  LEU n 
11 114  SER n 
11 115  TYR n 
11 116  ASP n 
11 117  LEU n 
11 118  THR n 
11 119  ASN n 
11 120  ALA n 
11 121  ALA n 
11 122  LYS n 
11 123  GLU n 
11 124  VAL n 
11 125  VAL n 
11 126  GLY n 
11 127  THR n 
11 128  CYS n 
11 129  THR n 
11 130  SER n 
11 131  LEU n 
11 132  GLY n 
11 133  VAL n 
11 134  THR n 
11 135  ILE n 
11 136  GLU n 
11 137  GLY n 
11 138  GLU n 
11 139  ASN n 
11 140  PRO n 
11 141  ARG n 
11 142  GLU n 
11 143  PHE n 
11 144  LYS n 
11 145  GLU n 
11 146  ARG n 
11 147  ILE n 
11 148  ASP n 
11 149  ALA n 
11 150  GLY n 
11 151  GLU n 
11 152  TYR n 
11 153  ASP n 
11 154  ASP n 
11 155  VAL n 
11 156  PHE n 
11 157  ALA n 
11 158  ALA n 
11 159  GLU n 
11 160  ALA n 
11 161  GLN n 
11 162  ALA n 
12 1    MET n 
12 2    SER n 
12 3    VAL n 
12 4    ALA n 
12 5    GLU n 
12 6    PHE n 
12 7    ASP n 
12 8    ALA n 
12 9    ASP n 
12 10   VAL n 
12 11   ILE n 
12 12   VAL n 
12 13   ASP n 
12 14   ALA n 
12 15   ARG n 
12 16   ASP n 
12 17   CYS n 
12 18   ILE n 
12 19   MET n 
12 20   GLY n 
12 21   ARG n 
12 22   VAL n 
12 23   ALA n 
12 24   SER n 
12 25   GLN n 
12 26   VAL n 
12 27   ALA n 
12 28   GLU n 
12 29   GLN n 
12 30   ALA n 
12 31   LEU n 
12 32   ASP n 
12 33   GLY n 
12 34   GLU n 
12 35   THR n 
12 36   VAL n 
12 37   ALA n 
12 38   VAL n 
12 39   VAL n 
12 40   ASN n 
12 41   ALA n 
12 42   GLU n 
12 43   ARG n 
12 44   ALA n 
12 45   VAL n 
12 46   ILE n 
12 47   THR n 
12 48   GLY n 
12 49   ARG n 
12 50   GLU n 
12 51   GLU n 
12 52   GLN n 
12 53   ILE n 
12 54   VAL n 
12 55   GLU n 
12 56   LYS n 
12 57   TYR n 
12 58   GLU n 
12 59   LYS n 
12 60   ARG n 
12 61   VAL n 
12 62   ASP n 
12 63   ILE n 
12 64   GLY n 
12 65   ASN n 
12 66   ASP n 
12 67   ASN n 
12 68   GLY n 
12 69   TYR n 
12 70   PHE n 
12 71   TYR n 
12 72   PRO n 
12 73   LYS n 
12 74   ARG n 
12 75   PRO n 
12 76   ASP n 
12 77   GLY n 
12 78   ILE n 
12 79   PHE n 
12 80   LYS n 
12 81   ARG n 
12 82   THR n 
12 83   ILE n 
12 84   ARG n 
12 85   GLY n 
12 86   MET n 
12 87   LEU n 
12 88   PRO n 
12 89   HIS n 
12 90   LYS n 
12 91   LYS n 
12 92   GLN n 
12 93   ARG n 
12 94   GLY n 
12 95   ARG n 
12 96   GLU n 
12 97   ALA n 
12 98   PHE n 
12 99   GLU n 
12 100  SER n 
12 101  VAL n 
12 102  ARG n 
12 103  VAL n 
12 104  TYR n 
12 105  LEU n 
12 106  GLY n 
12 107  ASN n 
12 108  PRO n 
12 109  TYR n 
12 110  ASP n 
12 111  GLU n 
12 112  ASP n 
12 113  GLY n 
12 114  GLU n 
12 115  VAL n 
12 116  LEU n 
12 117  ASP n 
12 118  GLY n 
12 119  THR n 
12 120  SER n 
12 121  LEU n 
12 122  ASP n 
12 123  ARG n 
12 124  LEU n 
12 125  SER n 
12 126  ASN n 
12 127  ILE n 
12 128  LYS n 
12 129  PHE n 
12 130  VAL n 
12 131  THR n 
12 132  LEU n 
12 133  GLY n 
12 134  GLU n 
12 135  ILE n 
12 136  SER n 
12 137  GLU n 
12 138  THR n 
12 139  LEU n 
12 140  GLY n 
12 141  ALA n 
12 142  ASN n 
12 143  LYS n 
12 144  THR n 
12 145  TRP n 
13 1    MET n 
13 2    GLU n 
13 3    ALA n 
13 4    LEU n 
13 5    GLY n 
13 6    ALA n 
13 7    ASP n 
13 8    VAL n 
13 9    THR n 
13 10   GLN n 
13 11   GLY n 
13 12   LEU n 
13 13   GLU n 
13 14   LYS n 
13 15   GLY n 
13 16   SER n 
13 17   LEU n 
13 18   ILE n 
13 19   THR n 
13 20   CYS n 
13 21   ALA n 
13 22   ASP n 
13 23   ASN n 
13 24   THR n 
13 25   GLY n 
13 26   ALA n 
13 27   ARG n 
13 28   GLU n 
13 29   LEU n 
13 30   LYS n 
13 31   VAL n 
13 32   ILE n 
13 33   SER n 
13 34   VAL n 
13 35   HIS n 
13 36   GLY n 
13 37   TYR n 
13 38   SER n 
13 39   GLY n 
13 40   THR n 
13 41   LYS n 
13 42   ASN n 
13 43   ARG n 
13 44   LEU n 
13 45   PRO n 
13 46   LYS n 
13 47   ALA n 
13 48   GLY n 
13 49   LEU n 
13 50   GLY n 
13 51   ASP n 
13 52   LYS n 
13 53   ILE n 
13 54   THR n 
13 55   VAL n 
13 56   SER n 
13 57   VAL n 
13 58   THR n 
13 59   LYS n 
13 60   GLY n 
13 61   THR n 
13 62   PRO n 
13 63   GLU n 
13 64   MET n 
13 65   ARG n 
13 66   ARG n 
13 67   GLN n 
13 68   VAL n 
13 69   LEU n 
13 70   GLU n 
13 71   ALA n 
13 72   VAL n 
13 73   VAL n 
13 74   VAL n 
13 75   ARG n 
13 76   GLN n 
13 77   ARG n 
13 78   LYS n 
13 79   PRO n 
13 80   ILE n 
13 81   ARG n 
13 82   ARG n 
13 83   PRO n 
13 84   ASP n 
13 85   GLY n 
13 86   THR n 
13 87   ARG n 
13 88   VAL n 
13 89   LYS n 
13 90   PHE n 
13 91   GLU n 
13 92   ASP n 
13 93   ASN n 
13 94   ALA n 
13 95   ALA n 
13 96   VAL n 
13 97   ILE n 
13 98   VAL n 
13 99   ASP n 
13 100  GLU n 
13 101  ASN n 
13 102  GLU n 
13 103  ASP n 
13 104  PRO n 
13 105  ARG n 
13 106  GLY n 
13 107  THR n 
13 108  GLU n 
13 109  LEU n 
13 110  LYS n 
13 111  GLY n 
13 112  PRO n 
13 113  ILE n 
13 114  ALA n 
13 115  ARG n 
13 116  GLU n 
13 117  VAL n 
13 118  ALA n 
13 119  GLN n 
13 120  ARG n 
13 121  PHE n 
13 122  GLY n 
13 123  SER n 
13 124  VAL n 
13 125  ALA n 
13 126  SER n 
13 127  ALA n 
13 128  ALA n 
13 129  THR n 
13 130  MET n 
13 131  ILE n 
13 132  VAL n 
14 1    MET n 
14 2    THR n 
14 3    SER n 
14 4    LYS n 
14 5    LYS n 
14 6    LYS n 
14 7    ARG n 
14 8    GLN n 
14 9    ARG n 
14 10   GLY n 
14 11   SER n 
14 12   ARG n 
14 13   THR n 
14 14   HIS n 
14 15   GLY n 
14 16   GLY n 
14 17   GLY n 
14 18   SER n 
14 19   HIS n 
14 20   LYS n 
14 21   ASN n 
14 22   ARG n 
14 23   ARG n 
14 24   GLY n 
14 25   ALA n 
14 26   GLY n 
14 27   HIS n 
14 28   ARG n 
14 29   GLY n 
14 30   GLY n 
14 31   ARG n 
14 32   GLY n 
14 33   ASP n 
14 34   ALA n 
14 35   GLY n 
14 36   ARG n 
14 37   ASP n 
14 38   LYS n 
14 39   HIS n 
14 40   GLU n 
14 41   PHE n 
14 42   HIS n 
14 43   ASN n 
14 44   HIS n 
14 45   GLU n 
14 46   PRO n 
14 47   LEU n 
14 48   GLY n 
14 49   LYS n 
14 50   SER n 
14 51   GLY n 
14 52   PHE n 
14 53   LYS n 
14 54   ARG n 
14 55   PRO n 
14 56   GLN n 
14 57   LYS n 
14 58   VAL n 
14 59   GLN n 
14 60   GLU n 
14 61   GLU n 
14 62   ALA n 
14 63   ALA n 
14 64   THR n 
14 65   ILE n 
14 66   ASP n 
14 67   VAL n 
14 68   ARG n 
14 69   GLU n 
14 70   ILE n 
14 71   ASP n 
14 72   GLU n 
14 73   ASN n 
14 74   VAL n 
14 75   THR n 
14 76   LEU n 
14 77   LEU n 
14 78   ALA n 
14 79   ALA n 
14 80   ASP n 
14 81   ASP n 
14 82   VAL n 
14 83   ALA n 
14 84   GLU n 
14 85   VAL n 
14 86   GLU n 
14 87   ASP n 
14 88   GLY n 
14 89   GLY n 
14 90   PHE n 
14 91   ARG n 
14 92   VAL n 
14 93   ASP n 
14 94   VAL n 
14 95   ARG n 
14 96   ASP n 
14 97   VAL n 
14 98   VAL n 
14 99   GLU n 
14 100  GLU n 
14 101  ALA n 
14 102  ASP n 
14 103  ASP n 
14 104  ALA n 
14 105  ASP n 
14 106  TYR n 
14 107  VAL n 
14 108  LYS n 
14 109  VAL n 
14 110  LEU n 
14 111  GLY n 
14 112  ALA n 
14 113  GLY n 
14 114  GLN n 
14 115  VAL n 
14 116  ARG n 
14 117  HIS n 
14 118  GLU n 
14 119  LEU n 
14 120  THR n 
14 121  LEU n 
14 122  ILE n 
14 123  ALA n 
14 124  ASP n 
14 125  ASP n 
14 126  PHE n 
14 127  SER n 
14 128  GLU n 
14 129  GLY n 
14 130  ALA n 
14 131  ARG n 
14 132  GLU n 
14 133  LYS n 
14 134  VAL n 
14 135  GLU n 
14 136  GLY n 
14 137  ALA n 
14 138  GLY n 
14 139  GLY n 
14 140  SER n 
14 141  VAL n 
14 142  GLU n 
14 143  LEU n 
14 144  THR n 
14 145  ASP n 
14 146  LEU n 
14 147  GLY n 
14 148  GLU n 
14 149  GLU n 
14 150  ARG n 
14 151  GLN n 
14 152  ALA n 
14 153  GLU n 
14 154  ALA n 
14 155  GLU n 
14 156  GLU n 
14 157  THR n 
14 158  GLU n 
14 159  ASP n 
14 160  ALA n 
14 161  ASP n 
14 162  ALA n 
14 163  ASP n 
14 164  GLU n 
14 165  GLU n 
15 1    MET n 
15 2    ALA n 
15 3    ARG n 
15 4    SER n 
15 5    ALA n 
15 6    TYR n 
15 7    SER n 
15 8    TYR n 
15 9    ILE n 
15 10   ARG n 
15 11   ASP n 
15 12   ALA n 
15 13   TRP n 
15 14   GLU n 
15 15   ASN n 
15 16   PRO n 
15 17   GLY n 
15 18   ASP n 
15 19   GLY n 
15 20   GLN n 
15 21   LEU n 
15 22   ALA n 
15 23   GLU n 
15 24   LEU n 
15 25   GLN n 
15 26   TRP n 
15 27   GLN n 
15 28   ARG n 
15 29   GLN n 
15 30   GLN n 
15 31   GLU n 
15 32   TRP n 
15 33   ARG n 
15 34   ASN n 
15 35   GLU n 
15 36   GLY n 
15 37   ALA n 
15 38   VAL n 
15 39   GLU n 
15 40   ARG n 
15 41   ILE n 
15 42   GLU n 
15 43   ARG n 
15 44   PRO n 
15 45   THR n 
15 46   ARG n 
15 47   LEU n 
15 48   ASP n 
15 49   LYS n 
15 50   ALA n 
15 51   ARG n 
15 52   SER n 
15 53   GLN n 
15 54   GLY n 
15 55   TYR n 
15 56   LYS n 
15 57   ALA n 
15 58   LYS n 
15 59   GLN n 
15 60   GLY n 
15 61   VAL n 
15 62   ILE n 
15 63   VAL n 
15 64   ALA n 
15 65   ARG n 
15 66   VAL n 
15 67   SER n 
15 68   VAL n 
15 69   ARG n 
15 70   LYS n 
15 71   GLY n 
15 72   SER n 
15 73   ALA n 
15 74   ARG n 
15 75   LYS n 
15 76   ARG n 
15 77   ARG n 
15 78   HIS n 
15 79   LYS n 
15 80   ALA n 
15 81   GLY n 
15 82   ARG n 
15 83   ARG n 
15 84   SER n 
15 85   LYS n 
15 86   ARG n 
15 87   GLN n 
15 88   GLY n 
15 89   VAL n 
15 90   THR n 
15 91   ARG n 
15 92   ILE n 
15 93   THR n 
15 94   ARG n 
15 95   ARG n 
15 96   LYS n 
15 97   ASP n 
15 98   ILE n 
15 99   GLN n 
15 100  ARG n 
15 101  VAL n 
15 102  ALA n 
15 103  GLU n 
15 104  GLU n 
15 105  ARG n 
15 106  ALA n 
15 107  SER n 
15 108  ARG n 
15 109  THR n 
15 110  PHE n 
15 111  PRO n 
15 112  ASN n 
15 113  LEU n 
15 114  ARG n 
15 115  VAL n 
15 116  LEU n 
15 117  ASN n 
15 118  SER n 
15 119  TYR n 
15 120  SER n 
15 121  VAL n 
15 122  GLY n 
15 123  GLN n 
15 124  ASP n 
15 125  GLY n 
15 126  ARG n 
15 127  GLN n 
15 128  LYS n 
15 129  TRP n 
15 130  HIS n 
15 131  GLU n 
15 132  VAL n 
15 133  ILE n 
15 134  LEU n 
15 135  ILE n 
15 136  ASP n 
15 137  PRO n 
15 138  ASN n 
15 139  HIS n 
15 140  PRO n 
15 141  ALA n 
15 142  ILE n 
15 143  GLN n 
15 144  ASN n 
15 145  ASP n 
15 146  ASP n 
15 147  ASP n 
15 148  LEU n 
15 149  SER n 
15 150  TRP n 
15 151  ILE n 
15 152  CYS n 
15 153  ALA n 
15 154  ASP n 
15 155  ASP n 
15 156  GLN n 
15 157  ALA n 
15 158  ASP n 
15 159  ARG n 
15 160  VAL n 
15 161  PHE n 
15 162  ARG n 
15 163  GLY n 
15 164  LEU n 
15 165  THR n 
15 166  GLY n 
15 167  ALA n 
15 168  GLY n 
15 169  ARG n 
15 170  ARG n 
15 171  ASN n 
15 172  ARG n 
15 173  GLY n 
15 174  LEU n 
15 175  SER n 
15 176  GLY n 
15 177  LYS n 
15 178  GLY n 
15 179  LYS n 
15 180  GLY n 
15 181  SER n 
15 182  GLU n 
15 183  LYS n 
15 184  THR n 
15 185  ARG n 
15 186  PRO n 
15 187  SER n 
15 188  LEU n 
15 189  ARG n 
15 190  SER n 
15 191  ASN n 
15 192  GLY n 
15 193  GLY n 
15 194  LYS n 
15 195  GLY n 
16 1    MET n 
16 2    ALA n 
16 3    THR n 
16 4    GLY n 
16 5    PRO n 
16 6    ARG n 
16 7    TYR n 
16 8    LYS n 
16 9    VAL n 
16 10   PRO n 
16 11   MET n 
16 12   ARG n 
16 13   ARG n 
16 14   ARG n 
16 15   ARG n 
16 16   GLU n 
16 17   ALA n 
16 18   ARG n 
16 19   THR n 
16 20   ASP n 
16 21   TYR n 
16 22   HIS n 
16 23   GLN n 
16 24   ARG n 
16 25   LEU n 
16 26   ARG n 
16 27   LEU n 
16 28   LEU n 
16 29   LYS n 
16 30   SER n 
16 31   GLY n 
16 32   LYS n 
16 33   PRO n 
16 34   ARG n 
16 35   LEU n 
16 36   VAL n 
16 37   ALA n 
16 38   ARG n 
16 39   LYS n 
16 40   SER n 
16 41   ASN n 
16 42   LYS n 
16 43   HIS n 
16 44   VAL n 
16 45   ARG n 
16 46   ALA n 
16 47   GLN n 
16 48   LEU n 
16 49   VAL n 
16 50   THR n 
16 51   LEU n 
16 52   GLY n 
16 53   PRO n 
16 54   ASN n 
16 55   GLY n 
16 56   ASP n 
16 57   ASP n 
16 58   THR n 
16 59   LEU n 
16 60   ALA n 
16 61   SER n 
16 62   ALA n 
16 63   HIS n 
16 64   SER n 
16 65   SER n 
16 66   ASP n 
16 67   LEU n 
16 68   ALA n 
16 69   GLU n 
16 70   TYR n 
16 71   GLY n 
16 72   TRP n 
16 73   GLU n 
16 74   ALA n 
16 75   PRO n 
16 76   THR n 
16 77   GLY n 
16 78   ASN n 
16 79   MET n 
16 80   PRO n 
16 81   SER n 
16 82   ALA n 
16 83   TYR n 
16 84   LEU n 
16 85   THR n 
16 86   GLY n 
16 87   LEU n 
16 88   LEU n 
16 89   ALA n 
16 90   GLY n 
16 91   LEU n 
16 92   ARG n 
16 93   ALA n 
16 94   GLN n 
16 95   GLU n 
16 96   ALA n 
16 97   GLY n 
16 98   VAL n 
16 99   GLU n 
16 100  GLU n 
16 101  ALA n 
16 102  VAL n 
16 103  LEU n 
16 104  ASP n 
16 105  ILE n 
16 106  GLY n 
16 107  LEU n 
16 108  ASN n 
16 109  SER n 
16 110  PRO n 
16 111  THR n 
16 112  PRO n 
16 113  GLY n 
16 114  SER n 
16 115  LYS n 
16 116  VAL n 
16 117  PHE n 
16 118  ALA n 
16 119  ILE n 
16 120  GLN n 
16 121  GLU n 
16 122  GLY n 
16 123  ALA n 
16 124  ILE n 
16 125  ASP n 
16 126  ALA n 
16 127  GLY n 
16 128  LEU n 
16 129  ASP n 
16 130  ILE n 
16 131  PRO n 
16 132  HIS n 
16 133  ASN n 
16 134  ASP n 
16 135  ASP n 
16 136  VAL n 
16 137  LEU n 
16 138  ALA n 
16 139  ASP n 
16 140  TRP n 
16 141  GLN n 
16 142  ARG n 
16 143  THR n 
16 144  ARG n 
16 145  GLY n 
16 146  ALA n 
16 147  HIS n 
16 148  ILE n 
16 149  ALA n 
16 150  GLU n 
16 151  TYR n 
16 152  ASP n 
16 153  GLU n 
16 154  GLN n 
16 155  LEU n 
16 156  GLU n 
16 157  GLU n 
16 158  PRO n 
16 159  LEU n 
16 160  TYR n 
16 161  SER n 
16 162  GLY n 
16 163  ASP n 
16 164  PHE n 
16 165  ASP n 
16 166  ALA n 
16 167  ALA n 
16 168  ASP n 
16 169  LEU n 
16 170  PRO n 
16 171  GLU n 
16 172  HIS n 
16 173  PHE n 
16 174  ASP n 
16 175  GLU n 
16 176  LEU n 
16 177  ARG n 
16 178  GLU n 
16 179  THR n 
16 180  LEU n 
16 181  LEU n 
16 182  ASP n 
16 183  GLY n 
16 184  ASP n 
16 185  ILE n 
16 186  GLU n 
16 187  LEU n 
17 1    MET n 
17 2    SER n 
17 3    LYS n 
17 4    THR n 
17 5    ASN n 
17 6    PRO n 
17 7    ARG n 
17 8    LEU n 
17 9    SER n 
17 10   SER n 
17 11   LEU n 
17 12   ILE n 
17 13   ALA n 
17 14   ASP n 
17 15   LEU n 
17 16   LYS n 
17 17   SER n 
17 18   ALA n 
17 19   ALA n 
17 20   ARG n 
17 21   SER n 
17 22   SER n 
17 23   GLY n 
17 24   GLY n 
17 25   ALA n 
17 26   VAL n 
17 27   TRP n 
17 28   GLY n 
17 29   ASP n 
17 30   VAL n 
17 31   ALA n 
17 32   GLU n 
17 33   ARG n 
17 34   LEU n 
17 35   GLU n 
17 36   LYS n 
17 37   PRO n 
17 38   ARG n 
17 39   ARG n 
17 40   THR n 
17 41   HIS n 
17 42   ALA n 
17 43   GLU n 
17 44   VAL n 
17 45   ASN n 
17 46   LEU n 
17 47   GLY n 
17 48   ARG n 
17 49   ILE n 
17 50   GLU n 
17 51   ARG n 
17 52   TYR n 
17 53   ALA n 
17 54   GLN n 
17 55   GLU n 
17 56   ASP n 
17 57   GLU n 
17 58   THR n 
17 59   VAL n 
17 60   VAL n 
17 61   VAL n 
17 62   PRO n 
17 63   GLY n 
17 64   LYS n 
17 65   VAL n 
17 66   LEU n 
17 67   GLY n 
17 68   SER n 
17 69   GLY n 
17 70   VAL n 
17 71   LEU n 
17 72   GLN n 
17 73   LYS n 
17 74   ASP n 
17 75   VAL n 
17 76   THR n 
17 77   VAL n 
17 78   ALA n 
17 79   ALA n 
17 80   VAL n 
17 81   ASP n 
17 82   PHE n 
17 83   SER n 
17 84   GLY n 
17 85   THR n 
17 86   ALA n 
17 87   GLU n 
17 88   THR n 
17 89   LYS n 
17 90   ILE n 
17 91   ASP n 
17 92   GLN n 
17 93   VAL n 
17 94   GLY n 
17 95   GLU n 
17 96   ALA n 
17 97   VAL n 
17 98   SER n 
17 99   LEU n 
17 100  GLU n 
17 101  GLN n 
17 102  ALA n 
17 103  ILE n 
17 104  GLU n 
17 105  ASN n 
17 106  ASN n 
17 107  PRO n 
17 108  GLU n 
17 109  GLY n 
17 110  SER n 
17 111  HIS n 
17 112  VAL n 
17 113  ARG n 
17 114  VAL n 
17 115  ILE n 
17 116  ARG n 
18 1    MET n 
18 2    THR n 
18 3    ASP n 
18 4    LEU n 
18 5    SER n 
18 6    ALA n 
18 7    GLN n 
18 8    LYS n 
18 9    ARG n 
18 10   LEU n 
18 11   ALA n 
18 12   ALA n 
18 13   ASP n 
18 14   VAL n 
18 15   LEU n 
18 16   ASP n 
18 17   VAL n 
18 18   GLY n 
18 19   LYS n 
18 20   ASN n 
18 21   ARG n 
18 22   VAL n 
18 23   TRP n 
18 24   PHE n 
18 25   ASN n 
18 26   PRO n 
18 27   GLU n 
18 28   ARG n 
18 29   GLN n 
18 30   GLY n 
18 31   ASP n 
18 32   ILE n 
18 33   ALA n 
18 34   ASP n 
18 35   ALA n 
18 36   ILE n 
18 37   THR n 
18 38   ARG n 
18 39   GLU n 
18 40   ASP n 
18 41   VAL n 
18 42   ARG n 
18 43   GLU n 
18 44   LEU n 
18 45   VAL n 
18 46   ASP n 
18 47   GLU n 
18 48   GLY n 
18 49   ALA n 
18 50   ILE n 
18 51   GLN n 
18 52   ALA n 
18 53   LYS n 
18 54   ASP n 
18 55   LYS n 
18 56   LYS n 
18 57   GLY n 
18 58   ASN n 
18 59   SER n 
18 60   ARG n 
18 61   GLY n 
18 62   ARG n 
18 63   ALA n 
18 64   ARG n 
18 65   GLU n 
18 66   ARG n 
18 67   GLN n 
18 68   LYS n 
18 69   LYS n 
18 70   ARG n 
18 71   ALA n 
18 72   TYR n 
18 73   GLY n 
18 74   HIS n 
18 75   GLN n 
18 76   LYS n 
18 77   GLY n 
18 78   ALA n 
18 79   GLY n 
18 80   SER n 
18 81   ARG n 
18 82   LYS n 
18 83   GLY n 
18 84   LYS n 
18 85   ALA n 
18 86   GLY n 
18 87   ALA n 
18 88   ARG n 
18 89   GLN n 
18 90   ASN n 
18 91   SER n 
18 92   LYS n 
18 93   GLU n 
18 94   ASP n 
18 95   TRP n 
18 96   GLU n 
18 97   SER n 
18 98   ARG n 
18 99   ILE n 
18 100  ARG n 
18 101  ALA n 
18 102  GLN n 
18 103  ARG n 
18 104  THR n 
18 105  LYS n 
18 106  LEU n 
18 107  ARG n 
18 108  GLU n 
18 109  LEU n 
18 110  ARG n 
18 111  ASP n 
18 112  GLU n 
18 113  GLY n 
18 114  THR n 
18 115  LEU n 
18 116  SER n 
18 117  SER n 
18 118  SER n 
18 119  GLN n 
18 120  TYR n 
18 121  ARG n 
18 122  ASP n 
18 123  LEU n 
18 124  TYR n 
18 125  ASP n 
18 126  LYS n 
18 127  ALA n 
18 128  GLY n 
18 129  GLY n 
18 130  GLY n 
18 131  GLU n 
18 132  PHE n 
18 133  ASP n 
18 134  SER n 
18 135  VAL n 
18 136  ALA n 
18 137  ASP n 
18 138  LEU n 
18 139  GLU n 
18 140  ARG n 
18 141  TYR n 
18 142  ILE n 
18 143  ASP n 
18 144  ALA n 
18 145  ASN n 
18 146  HIS n 
18 147  GLY n 
18 148  ASP n 
18 149  ALA n 
19 1    MET n 
19 2    PRO n 
19 3    SER n 
19 4    SER n 
19 5    ASN n 
19 6    GLY n 
19 7    PRO n 
19 8    LEU n 
19 9    GLU n 
19 10   GLY n 
19 11   THR n 
19 12   ARG n 
19 13   GLY n 
19 14   LYS n 
19 15   LEU n 
19 16   LYS n 
19 17   ASN n 
19 18   LYS n 
19 19   PRO n 
19 20   ARG n 
19 21   ASP n 
19 22   ARG n 
19 23   GLY n 
19 24   THR n 
19 25   SER n 
19 26   PRO n 
19 27   PRO n 
19 28   GLN n 
19 29   ARG n 
19 30   ALA n 
19 31   VAL n 
19 32   GLU n 
19 33   GLU n 
19 34   PHE n 
19 35   ASP n 
19 36   ASP n 
19 37   GLY n 
19 38   GLU n 
19 39   LYS n 
19 40   VAL n 
19 41   HIS n 
19 42   LEU n 
19 43   LYS n 
19 44   ILE n 
19 45   ASP n 
19 46   PRO n 
19 47   SER n 
19 48   VAL n 
19 49   PRO n 
19 50   ASN n 
19 51   GLY n 
19 52   ARG n 
19 53   PHE n 
19 54   HIS n 
19 55   PRO n 
19 56   ARG n 
19 57   PHE n 
19 58   ASP n 
19 59   GLY n 
19 60   GLN n 
19 61   THR n 
19 62   GLY n 
19 63   THR n 
19 64   VAL n 
19 65   GLU n 
19 66   GLY n 
19 67   LYS n 
19 68   GLN n 
19 69   GLY n 
19 70   ASP n 
19 71   ALA n 
19 72   TYR n 
19 73   LYS n 
19 74   VAL n 
19 75   ASP n 
19 76   ILE n 
19 77   VAL n 
19 78   ASP n 
19 79   GLY n 
19 80   GLY n 
19 81   LYS n 
19 82   GLU n 
19 83   LYS n 
19 84   THR n 
19 85   ILE n 
19 86   ILE n 
19 87   VAL n 
19 88   THR n 
19 89   ALA n 
19 90   ALA n 
19 91   HIS n 
19 92   LEU n 
19 93   ARG n 
19 94   ARG n 
19 95   GLN n 
19 96   GLU n 
20 1    MET n 
20 2    GLY n 
20 3    ILE n 
20 4    SER n 
20 5    TYR n 
20 6    SER n 
20 7    VAL n 
20 8    GLU n 
20 9    ALA n 
20 10   ASP n 
20 11   PRO n 
20 12   ASP n 
20 13   THR n 
20 14   THR n 
20 15   ALA n 
20 16   LYS n 
20 17   ALA n 
20 18   MET n 
20 19   LEU n 
20 20   ARG n 
20 21   GLU n 
20 22   ARG n 
20 23   GLN n 
20 24   MET n 
20 25   SER n 
20 26   PHE n 
20 27   LYS n 
20 28   HIS n 
20 29   SER n 
20 30   LYS n 
20 31   ALA n 
20 32   ILE n 
20 33   ALA n 
20 34   ARG n 
20 35   GLU n 
20 36   ILE n 
20 37   LYS n 
20 38   GLY n 
20 39   LYS n 
20 40   THR n 
20 41   ALA n 
20 42   GLY n 
20 43   GLU n 
20 44   ALA n 
20 45   VAL n 
20 46   ASP n 
20 47   TYR n 
20 48   LEU n 
20 49   GLU n 
20 50   ALA n 
20 51   VAL n 
20 52   ILE n 
20 53   GLU n 
20 54   GLY n 
20 55   ASP n 
20 56   GLN n 
20 57   PRO n 
20 58   VAL n 
20 59   PRO n 
20 60   PHE n 
20 61   LYS n 
20 62   GLN n 
20 63   HIS n 
20 64   ASN n 
20 65   SER n 
20 66   GLY n 
20 67   VAL n 
20 68   GLY n 
20 69   HIS n 
20 70   LYS n 
20 71   SER n 
20 72   LYS n 
20 73   VAL n 
20 74   ASP n 
20 75   GLY n 
20 76   TRP n 
20 77   ASP n 
20 78   ALA n 
20 79   GLY n 
20 80   ARG n 
20 81   TYR n 
20 82   PRO n 
20 83   GLU n 
20 84   LYS n 
20 85   ALA n 
20 86   SER n 
20 87   LYS n 
20 88   ALA n 
20 89   PHE n 
20 90   LEU n 
20 91   ASP n 
20 92   LEU n 
20 93   LEU n 
20 94   GLU n 
20 95   ASN n 
20 96   ALA n 
20 97   VAL n 
20 98   GLY n 
20 99   ASN n 
20 100  ALA n 
20 101  ASP n 
20 102  HIS n 
20 103  GLN n 
20 104  GLY n 
20 105  PHE n 
20 106  ASP n 
20 107  GLY n 
20 108  GLU n 
20 109  ALA n 
20 110  MET n 
20 111  THR n 
20 112  ILE n 
20 113  LYS n 
20 114  HIS n 
20 115  VAL n 
20 116  ALA n 
20 117  ALA n 
20 118  HIS n 
20 119  LYS n 
20 120  VAL n 
20 121  GLY n 
20 122  GLU n 
20 123  GLN n 
20 124  GLN n 
20 125  GLY n 
20 126  ARG n 
20 127  LYS n 
20 128  PRO n 
20 129  ARG n 
20 130  ALA n 
20 131  MET n 
20 132  GLY n 
20 133  ARG n 
20 134  ALA n 
20 135  SER n 
20 136  ALA n 
20 137  TRP n 
20 138  ASN n 
20 139  SER n 
20 140  PRO n 
20 141  GLN n 
20 142  VAL n 
20 143  ASP n 
20 144  VAL n 
20 145  GLU n 
20 146  LEU n 
20 147  ILE n 
20 148  LEU n 
20 149  GLU n 
20 150  GLU n 
20 151  PRO n 
20 152  GLU n 
20 153  VAL n 
20 154  GLU n 
20 155  ASP n 
21 1    MET n 
21 2    SER n 
21 3    TRP n 
21 4    ASP n 
21 5    VAL n 
21 6    ILE n 
21 7    LYS n 
21 8    HIS n 
21 9    PRO n 
21 10   HIS n 
21 11   VAL n 
21 12   THR n 
21 13   GLU n 
21 14   LYS n 
21 15   ALA n 
21 16   MET n 
21 17   ASN n 
21 18   ASP n 
21 19   MET n 
21 20   ASP n 
21 21   PHE n 
21 22   GLN n 
21 23   ASN n 
21 24   LYS n 
21 25   LEU n 
21 26   GLN n 
21 27   PHE n 
21 28   ALA n 
21 29   VAL n 
21 30   ASP n 
21 31   ASP n 
21 32   ARG n 
21 33   ALA n 
21 34   SER n 
21 35   LYS n 
21 36   GLY n 
21 37   GLU n 
21 38   VAL n 
21 39   ALA n 
21 40   ASP n 
21 41   ALA n 
21 42   VAL n 
21 43   GLU n 
21 44   GLU n 
21 45   GLN n 
21 46   TYR n 
21 47   ASP n 
21 48   VAL n 
21 49   THR n 
21 50   VAL n 
21 51   GLU n 
21 52   GLN n 
21 53   VAL n 
21 54   ASN n 
21 55   THR n 
21 56   GLN n 
21 57   ASN n 
21 58   THR n 
21 59   MET n 
21 60   ASP n 
21 61   GLY n 
21 62   GLU n 
21 63   LYS n 
21 64   LYS n 
21 65   ALA n 
21 66   VAL n 
21 67   VAL n 
21 68   ARG n 
21 69   LEU n 
21 70   SER n 
21 71   GLU n 
21 72   ASP n 
21 73   ASP n 
21 74   ASP n 
21 75   ALA n 
21 76   GLN n 
21 77   GLU n 
21 78   VAL n 
21 79   ALA n 
21 80   SER n 
21 81   ARG n 
21 82   ILE n 
21 83   GLY n 
21 84   VAL n 
21 85   PHE n 
22 1    MET n 
22 2    SER n 
22 3    LYS n 
22 4    GLN n 
22 5    PRO n 
22 6    ASP n 
22 7    LYS n 
22 8    GLN n 
22 9    ARG n 
22 10   LYS n 
22 11   SER n 
22 12   GLN n 
22 13   ARG n 
22 14   ARG n 
22 15   ALA n 
22 16   PRO n 
22 17   LEU n 
22 18   HIS n 
22 19   GLU n 
22 20   ARG n 
22 21   HIS n 
22 22   LYS n 
22 23   GLN n 
22 24   VAL n 
22 25   ARG n 
22 26   ALA n 
22 27   THR n 
22 28   LEU n 
22 29   SER n 
22 30   ALA n 
22 31   ASP n 
22 32   LEU n 
22 33   ARG n 
22 34   GLU n 
22 35   GLU n 
22 36   TYR n 
22 37   GLY n 
22 38   GLN n 
22 39   ARG n 
22 40   ASN n 
22 41   VAL n 
22 42   ARG n 
22 43   VAL n 
22 44   ASN n 
22 45   ALA n 
22 46   GLY n 
22 47   ASP n 
22 48   THR n 
22 49   VAL n 
22 50   GLU n 
22 51   VAL n 
22 52   LEU n 
22 53   ARG n 
22 54   GLY n 
22 55   ASP n 
22 56   PHE n 
22 57   ALA n 
22 58   GLY n 
22 59   GLU n 
22 60   GLU n 
22 61   GLY n 
22 62   GLU n 
22 63   VAL n 
22 64   ILE n 
22 65   ASN n 
22 66   VAL n 
22 67   ASP n 
22 68   LEU n 
22 69   ASP n 
22 70   LYS n 
22 71   ALA n 
22 72   VAL n 
22 73   ILE n 
22 74   HIS n 
22 75   VAL n 
22 76   GLU n 
22 77   ASP n 
22 78   VAL n 
22 79   THR n 
22 80   LEU n 
22 81   GLU n 
22 82   LYS n 
22 83   THR n 
22 84   ASP n 
22 85   GLY n 
22 86   GLU n 
22 87   GLU n 
22 88   VAL n 
22 89   PRO n 
22 90   ARG n 
22 91   PRO n 
22 92   LEU n 
22 93   ASP n 
22 94   THR n 
22 95   SER n 
22 96   ASN n 
22 97   VAL n 
22 98   ARG n 
22 99   VAL n 
22 100  THR n 
22 101  ASP n 
22 102  LEU n 
22 103  ASP n 
22 104  LEU n 
22 105  GLU n 
22 106  ASP n 
22 107  GLU n 
22 108  LYS n 
22 109  ARG n 
22 110  GLU n 
22 111  ALA n 
22 112  ARG n 
22 113  LEU n 
22 114  GLU n 
22 115  SER n 
22 116  GLU n 
22 117  ASP n 
22 118  ASP n 
22 119  SER n 
22 120  ALA n 
23 1    PRO n 
23 2    ARG n 
23 3    THR n 
23 4    ARG n 
23 5    GLU n 
23 6    CYS n 
23 7    ASP n 
23 8    TYR n 
23 9    CYS n 
23 10   GLY n 
23 11   THR n 
23 12   ASP n 
23 13   ILE n 
23 14   GLU n 
23 15   PRO n 
23 16   GLY n 
23 17   THR n 
23 18   GLY n 
23 19   THR n 
23 20   MET n 
23 21   PHE n 
23 22   VAL n 
23 23   HIS n 
23 24   LYS n 
23 25   ASP n 
23 26   GLY n 
23 27   ALA n 
23 28   THR n 
23 29   THR n 
23 30   HIS n 
23 31   PHE n 
23 32   CYS n 
23 33   SER n 
23 34   SER n 
23 35   LYS n 
23 36   CYS n 
23 37   GLU n 
23 38   ASN n 
23 39   ASN n 
23 40   ALA n 
23 41   ASP n 
23 42   LEU n 
23 43   GLY n 
23 44   ARG n 
23 45   GLU n 
23 46   ALA n 
23 47   ARG n 
23 48   ASN n 
23 49   LEU n 
23 50   GLU n 
23 51   TRP n 
23 52   THR n 
23 53   ASP n 
23 54   THR n 
23 55   ALA n 
23 56   ARG n 
23 57   GLY n 
23 58   GLU n 
23 59   ALA n 
23 60   GLY n 
23 61   GLU n 
23 62   ALA n 
23 63   GLU n 
23 64   ASP n 
23 65   GLU n 
23 66   ALA n 
24 1    MET n 
24 2    THR n 
24 3    VAL n 
24 4    LEU n 
24 5    HIS n 
24 6    VAL n 
24 7    GLN n 
24 8    GLU n 
24 9    ILE n 
24 10   ARG n 
24 11   ASP n 
24 12   MET n 
24 13   THR n 
24 14   PRO n 
24 15   ALA n 
24 16   GLU n 
24 17   ARG n 
24 18   GLU n 
24 19   ALA n 
24 20   GLU n 
24 21   LEU n 
24 22   ASP n 
24 23   ASP n 
24 24   LEU n 
24 25   LYS n 
24 26   THR n 
24 27   GLU n 
24 28   LEU n 
24 29   LEU n 
24 30   ASN n 
24 31   ALA n 
24 32   ARG n 
24 33   ALA n 
24 34   VAL n 
24 35   GLN n 
24 36   ALA n 
24 37   ALA n 
24 38   GLY n 
24 39   GLY n 
24 40   ALA n 
24 41   PRO n 
24 42   GLU n 
24 43   ASN n 
24 44   PRO n 
24 45   GLY n 
24 46   ARG n 
24 47   ILE n 
24 48   LYS n 
24 49   GLU n 
24 50   LEU n 
24 51   ARG n 
24 52   LYS n 
24 53   ALA n 
24 54   ILE n 
24 55   ALA n 
24 56   ARG n 
24 57   ILE n 
24 58   LYS n 
24 59   THR n 
24 60   ILE n 
24 61   GLN n 
24 62   GLY n 
24 63   GLU n 
24 64   GLU n 
24 65   GLY n 
24 66   ASP n 
24 67   LEU n 
24 68   GLN n 
24 69   GLU n 
24 70   ASN n 
24 71   GLU n 
25 1    MET n 
25 2    HIS n 
25 3    ALA n 
25 4    LEU n 
25 5    VAL n 
25 6    GLN n 
25 7    LEU n 
25 8    ARG n 
25 9    GLY n 
25 10   GLU n 
25 11   VAL n 
25 12   ASN n 
25 13   MET n 
25 14   HIS n 
25 15   THR n 
25 16   ASP n 
25 17   ILE n 
25 18   GLN n 
25 19   ASP n 
25 20   THR n 
25 21   LEU n 
25 22   GLU n 
25 23   MET n 
25 24   LEU n 
25 25   ASN n 
25 26   ILE n 
25 27   HIS n 
25 28   HIS n 
25 29   VAL n 
25 30   ASN n 
25 31   HIS n 
25 32   CYS n 
25 33   THR n 
25 34   LEU n 
25 35   VAL n 
25 36   PRO n 
25 37   GLU n 
25 38   THR n 
25 39   ASP n 
25 40   ALA n 
25 41   TYR n 
25 42   ARG n 
25 43   GLY n 
25 44   MET n 
25 45   VAL n 
25 46   ALA n 
25 47   LYS n 
25 48   VAL n 
25 49   ASN n 
25 50   ASP n 
25 51   PHE n 
25 52   VAL n 
25 53   ALA n 
25 54   PHE n 
25 55   GLY n 
25 56   GLU n 
25 57   PRO n 
25 58   SER n 
25 59   GLN n 
25 60   GLU n 
25 61   THR n 
25 62   LEU n 
25 63   GLU n 
25 64   THR n 
25 65   VAL n 
25 66   LEU n 
25 67   ALA n 
25 68   THR n 
25 69   ARG n 
25 70   ALA n 
25 71   GLU n 
25 72   PRO n 
25 73   LEU n 
25 74   GLU n 
25 75   GLY n 
25 76   ASP n 
25 77   ALA n 
25 78   ASP n 
25 79   VAL n 
25 80   ASP n 
25 81   ASP n 
25 82   GLU n 
25 83   TRP n 
25 84   VAL n 
25 85   ALA n 
25 86   GLU n 
25 87   HIS n 
25 88   THR n 
25 89   ASP n 
25 90   TYR n 
25 91   ASP n 
25 92   ASP n 
25 93   ILE n 
25 94   SER n 
25 95   GLY n 
25 96   LEU n 
25 97   ALA n 
25 98   PHE n 
25 99   ALA n 
25 100  LEU n 
25 101  LEU n 
25 102  SER n 
25 103  GLU n 
25 104  GLU n 
25 105  THR n 
25 106  THR n 
25 107  LEU n 
25 108  ARG n 
25 109  GLU n 
25 110  GLN n 
25 111  GLY n 
25 112  LEU n 
25 113  SER n 
25 114  PRO n 
25 115  THR n 
25 116  LEU n 
25 117  ARG n 
25 118  LEU n 
25 119  HIS n 
25 120  PRO n 
25 121  PRO n 
25 122  ARG n 
25 123  GLY n 
25 124  GLY n 
25 125  HIS n 
25 126  ASP n 
25 127  GLY n 
25 128  VAL n 
25 129  LYS n 
25 130  HIS n 
25 131  PRO n 
25 132  VAL n 
25 133  LYS n 
25 134  GLU n 
25 135  GLY n 
25 136  GLY n 
25 137  GLN n 
25 138  LEU n 
25 139  GLY n 
25 140  LYS n 
25 141  HIS n 
25 142  ASP n 
25 143  THR n 
25 144  GLU n 
25 145  GLY n 
25 146  ILE n 
25 147  ASP n 
25 148  ASP n 
25 149  LEU n 
25 150  LEU n 
25 151  GLU n 
25 152  ALA n 
25 153  MET n 
25 154  ARG n 
26 1    MET n 
26 2    SER n 
26 3    ALA n 
26 4    SER n 
26 5    ASP n 
26 6    PHE n 
26 7    GLU n 
26 8    GLU n 
26 9    ARG n 
26 10   VAL n 
26 11   VAL n 
26 12   THR n 
26 13   ILE n 
26 14   PRO n 
26 15   LEU n 
26 16   ARG n 
26 17   ASP n 
26 18   ALA n 
26 19   ARG n 
26 20   ALA n 
26 21   GLU n 
26 22   PRO n 
26 23   ASN n 
26 24   HIS n 
26 25   LYS n 
26 26   ARG n 
26 27   ALA n 
26 28   ASP n 
26 29   LYS n 
26 30   ALA n 
26 31   MET n 
26 32   ILE n 
26 33   LEU n 
26 34   ILE n 
26 35   ARG n 
26 36   GLU n 
26 37   HIS n 
26 38   LEU n 
26 39   ALA n 
26 40   LYS n 
26 41   HIS n 
26 42   PHE n 
26 43   SER n 
26 44   VAL n 
26 45   ASP n 
26 46   GLU n 
26 47   ASP n 
26 48   ALA n 
26 49   VAL n 
26 50   ARG n 
26 51   LEU n 
26 52   ASP n 
26 53   PRO n 
26 54   SER n 
26 55   ILE n 
26 56   ASN n 
26 57   GLU n 
26 58   ALA n 
26 59   ALA n 
26 60   TRP n 
26 61   ALA n 
26 62   ARG n 
26 63   GLY n 
26 64   ARG n 
26 65   ALA n 
26 66   ASN n 
26 67   THR n 
26 68   PRO n 
26 69   SER n 
26 70   LYS n 
26 71   ILE n 
26 72   ARG n 
26 73   VAL n 
26 74   ARG n 
26 75   ALA n 
26 76   ALA n 
26 77   ARG n 
26 78   PHE n 
26 79   GLU n 
26 80   GLU n 
26 81   GLU n 
26 82   GLY n 
26 83   GLU n 
26 84   ALA n 
26 85   ILE n 
26 86   VAL n 
26 87   GLU n 
26 88   ALA n 
26 89   GLU n 
26 90   THR n 
26 91   ALA n 
26 92   GLU n 
27 1    MET n 
27 2    ALA n 
27 3    ASP n 
27 4    ASN n 
27 5    GLU n 
27 6    GLU n 
27 7    ASP n 
27 8    VAL n 
27 9    GLU n 
27 10   ALA n 
27 11   GLU n 
27 12   GLU n 
27 13   GLU n 
27 14   TYR n 
27 15   THR n 
27 16   GLU n 
27 17   LEU n 
27 18   THR n 
27 19   ASP n 
27 20   ILE n 
27 21   SER n 
27 22   GLY n 
27 23   VAL n 
27 24   GLY n 
27 25   PRO n 
27 26   SER n 
27 27   LYS n 
27 28   ALA n 
27 29   GLU n 
27 30   SER n 
27 31   LEU n 
27 32   ARG n 
27 33   GLU n 
27 34   ALA n 
27 35   GLY n 
27 36   PHE n 
27 37   GLU n 
27 38   SER n 
27 39   VAL n 
27 40   GLU n 
27 41   ASP n 
27 42   VAL n 
27 43   ARG n 
27 44   GLY n 
27 45   ALA n 
27 46   ASP n 
27 47   GLN n 
27 48   SER n 
27 49   ALA n 
27 50   LEU n 
27 51   ALA n 
27 52   ASP n 
27 53   VAL n 
27 54   SER n 
27 55   GLY n 
27 56   ILE n 
27 57   GLY n 
27 58   ASN n 
27 59   ALA n 
27 60   LEU n 
27 61   ALA n 
27 62   ALA n 
27 63   ARG n 
27 64   ILE n 
27 65   LYS n 
27 66   ALA n 
27 67   ASP n 
27 68   VAL n 
27 69   GLY n 
27 70   GLY n 
27 71   LEU n 
27 72   GLU n 
27 73   VAL n 
27 74   GLU n 
27 75   SER n 
27 76   GLU n 
27 77   THR n 
27 78   GLU n 
27 79   ALA n 
27 80   GLU n 
27 81   VAL n 
27 82   GLU n 
27 83   GLU n 
27 84   GLU n 
27 85   GLY n 
27 86   GLY n 
27 87   GLU n 
27 88   GLU n 
27 89   ALA n 
27 90   PRO n 
27 91   ASP n 
27 92   GLU n 
27 93   ASP n 
27 94   VAL n 
27 95   GLU n 
27 96   THR n 
27 97   GLU n 
27 98   LEU n 
27 99   GLN n 
27 100  ALA n 
27 101  ARG n 
27 102  GLY n 
27 103  LEU n 
27 104  THR n 
27 105  GLU n 
27 106  LYS n 
27 107  THR n 
27 108  PRO n 
27 109  ASP n 
27 110  LEU n 
27 111  SER n 
27 112  ASP n 
27 113  GLU n 
27 114  ASP n 
27 115  ALA n 
27 116  ARG n 
27 117  LEU n 
27 118  LEU n 
27 119  THR n 
27 120  GLN n 
27 121  ARG n 
27 122  HIS n 
27 123  ARG n 
27 124  VAL n 
27 125  GLY n 
27 126  LYS n 
27 127  PRO n 
27 128  GLN n 
27 129  PHE n 
27 130  ASN n 
27 131  ARG n 
27 132  GLN n 
27 133  ASP n 
27 134  HIS n 
27 135  HIS n 
27 136  LYS n 
27 137  LYS n 
27 138  LYS n 
27 139  ARG n 
27 140  VAL n 
27 141  SER n 
27 142  THR n 
27 143  SER n 
27 144  TRP n 
27 145  ARG n 
27 146  LYS n 
27 147  PRO n 
27 148  ARG n 
27 149  GLY n 
27 150  GLN n 
27 151  LEU n 
27 152  SER n 
27 153  LYS n 
27 154  GLN n 
27 155  ARG n 
27 156  ARG n 
27 157  GLY n 
27 158  ILE n 
27 159  LYS n 
27 160  GLY n 
27 161  LYS n 
27 162  GLY n 
27 163  ASP n 
27 164  THR n 
27 165  VAL n 
27 166  GLU n 
27 167  ALA n 
27 168  GLY n 
27 169  PHE n 
27 170  ARG n 
27 171  SER n 
27 172  PRO n 
27 173  THR n 
27 174  ALA n 
27 175  VAL n 
27 176  ARG n 
27 177  GLY n 
27 178  LYS n 
27 179  HIS n 
27 180  PRO n 
27 181  SER n 
27 182  GLY n 
27 183  PHE n 
27 184  GLU n 
27 185  GLU n 
27 186  VAL n 
27 187  ARG n 
27 188  VAL n 
27 189  HIS n 
27 190  ASN n 
27 191  VAL n 
27 192  ASP n 
27 193  ASP n 
27 194  LEU n 
27 195  GLU n 
27 196  GLY n 
27 197  VAL n 
27 198  ASP n 
27 199  GLY n 
27 200  ASP n 
27 201  THR n 
27 202  GLU n 
27 203  ALA n 
27 204  VAL n 
27 205  ARG n 
27 206  ILE n 
27 207  ALA n 
27 208  SER n 
27 209  LYS n 
27 210  VAL n 
27 211  GLY n 
27 212  ALA n 
27 213  ARG n 
27 214  LYS n 
27 215  ARG n 
27 216  GLU n 
27 217  ARG n 
27 218  ILE n 
27 219  GLU n 
27 220  GLU n 
27 221  GLU n 
27 222  ALA n 
27 223  GLU n 
27 224  ASP n 
27 225  ALA n 
27 226  GLY n 
27 227  ILE n 
27 228  ARG n 
27 229  VAL n 
27 230  LEU n 
27 231  ASN n 
27 232  PRO n 
27 233  THR n 
27 234  TYR n 
27 235  VAL n 
27 236  GLU n 
27 237  VAL n 
27 238  GLU n 
27 239  VAL n 
27 240  SER n 
27 241  GLU n 
28 1    ARG n 
28 2    SER n 
28 3    GLY n 
28 4    ARG n 
28 5    PHE n 
28 6    GLY n 
28 7    ALA n 
28 8    ARG n 
28 9    TYR n 
28 10   GLY n 
28 11   ARG n 
28 12   VAL n 
28 13   SER n 
28 14   ARG n 
28 15   ARG n 
28 16   ARG n 
28 17   VAL n 
28 18   ALA n 
28 19   GLU n 
28 20   ILE n 
28 21   GLU n 
28 22   SER n 
28 23   GLU n 
28 24   MET n 
28 25   ASN n 
28 26   GLU n 
28 27   ASP n 
28 28   HIS n 
28 29   ALA n 
28 30   CYS n 
28 31   PRO n 
28 32   ASN n 
28 33   CYS n 
28 34   GLY n 
28 35   GLU n 
28 36   ASP n 
28 37   ARG n 
28 38   VAL n 
28 39   ASP n 
28 40   ARG n 
28 41   GLN n 
28 42   GLY n 
28 43   THR n 
28 44   GLY n 
28 45   ILE n 
28 46   TRP n 
28 47   GLN n 
28 48   CYS n 
28 49   SER n 
28 50   TYR n 
28 51   CYS n 
28 52   ASP n 
28 53   TYR n 
28 54   LYS n 
28 55   PHE n 
28 56   THR n 
28 57   GLY n 
28 58   GLY n 
28 59   SER n 
28 60   TYR n 
28 61   LYS n 
28 62   PRO n 
28 63   GLU n 
28 64   THR n 
28 65   PRO n 
28 66   GLY n 
28 67   GLY n 
28 68   LYS n 
28 69   THR n 
28 70   VAL n 
28 71   ARG n 
28 72   ARG n 
28 73   SER n 
28 74   ILE n 
28 75   ARG n 
28 76   ALA n 
28 77   ALA n 
28 78   LEU n 
28 79   SER n 
28 80   GLU n 
28 81   ASP n 
28 82   GLU n 
28 83   GLU n 
29 1    MET n 
29 2    THR n 
29 3    GLY n 
29 4    ALA n 
29 5    GLY n 
29 6    THR n 
29 7    PRO n 
29 8    SER n 
29 9    GLN n 
29 10   GLY n 
29 11   LYS n 
29 12   LYS n 
29 13   ASN n 
29 14   THR n 
29 15   THR n 
29 16   THR n 
29 17   HIS n 
29 18   THR n 
29 19   LYS n 
29 20   CYS n 
29 21   ARG n 
29 22   ARG n 
29 23   CYS n 
29 24   GLY n 
29 25   GLU n 
29 26   LYS n 
29 27   SER n 
29 28   TYR n 
29 29   HIS n 
29 30   THR n 
29 31   LYS n 
29 32   LYS n 
29 33   LYS n 
29 34   VAL n 
29 35   CYS n 
29 36   SER n 
29 37   SER n 
29 38   CYS n 
29 39   GLY n 
29 40   PHE n 
29 41   GLY n 
29 42   LYS n 
29 43   SER n 
29 44   ALA n 
29 45   LYS n 
29 46   ARG n 
29 47   ARG n 
29 48   ASP n 
29 49   TYR n 
29 50   GLU n 
29 51   TRP n 
29 52   GLN n 
29 53   SER n 
29 54   LYS n 
29 55   ALA n 
29 56   GLY n 
29 57   GLU n 
30 1    MET n 
30 2    GLY n 
30 3    LYS n 
30 4    LYS n 
30 5    SER n 
30 6    LYS n 
30 7    ALA n 
30 8    THR n 
30 9    LYS n 
30 10   LYS n 
30 11   ARG n 
30 12   LEU n 
30 13   ALA n 
30 14   LYS n 
30 15   LEU n 
30 16   ASP n 
30 17   ASN n 
30 18   GLN n 
30 19   ASN n 
30 20   SER n 
30 21   ARG n 
30 22   VAL n 
30 23   PRO n 
30 24   ALA n 
30 25   TRP n 
30 26   VAL n 
30 27   MET n 
30 28   LEU n 
30 29   LYS n 
30 30   THR n 
30 31   ASP n 
30 32   ARG n 
30 33   GLU n 
30 34   VAL n 
30 35   GLN n 
30 36   ARG n 
30 37   ASN n 
30 38   HIS n 
30 39   LYS n 
30 40   ARG n 
30 41   ARG n 
30 42   HIS n 
30 43   TRP n 
30 44   ARG n 
30 45   ARG n 
30 46   ASN n 
30 47   ASP n 
30 48   THR n 
30 49   ASP n 
30 50   GLU n 
31 1    MET n 
31 2    GLN n 
31 3    MET n 
31 4    PRO n 
31 5    ARG n 
31 6    ARG n 
31 7    PHE n 
31 8    ASN n 
31 9    THR n 
31 10   TYR n 
31 11   CYS n 
31 12   PRO n 
31 13   HIS n 
31 14   CYS n 
31 15   ASN n 
31 16   GLU n 
31 17   HIS n 
31 18   GLN n 
31 19   GLU n 
31 20   HIS n 
31 21   GLU n 
31 22   VAL n 
31 23   GLU n 
31 24   LYS n 
31 25   VAL n 
31 26   ARG n 
31 27   SER n 
31 28   GLY n 
31 29   ARG n 
31 30   GLN n 
31 31   THR n 
31 32   GLY n 
31 33   MET n 
31 34   LYS n 
31 35   TRP n 
31 36   ILE n 
31 37   ASP n 
31 38   ARG n 
31 39   GLN n 
31 40   ARG n 
31 41   GLU n 
31 42   ARG n 
31 43   ASN n 
31 44   SER n 
31 45   GLY n 
31 46   ILE n 
31 47   GLY n 
31 48   ASN n 
31 49   ASP n 
31 50   GLY n 
31 51   LYS n 
31 52   PHE n 
31 53   SER n 
31 54   LYS n 
31 55   VAL n 
31 56   PRO n 
31 57   GLY n 
31 58   GLY n 
31 59   ASP n 
31 60   LYS n 
31 61   PRO n 
31 62   THR n 
31 63   LYS n 
31 64   LYS n 
31 65   THR n 
31 66   ASP n 
31 67   LEU n 
31 68   LYS n 
31 69   TYR n 
31 70   ARG n 
31 71   CYS n 
31 72   GLY n 
31 73   GLU n 
31 74   CYS n 
31 75   GLY n 
31 76   LYS n 
31 77   ALA n 
31 78   HIS n 
31 79   LEU n 
31 80   ARG n 
31 81   GLU n 
31 82   GLY n 
31 83   TRP n 
31 84   ARG n 
31 85   ALA n 
31 86   GLY n 
31 87   ARG n 
31 88   LEU n 
31 89   GLU n 
31 90   PHE n 
31 91   GLN n 
31 92   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? DT38 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  GB  AY596297   55229667 1  
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAG
GGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCG
AGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCG
UGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCC
CAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCG
ACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGA
UUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGU
GUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAA
CAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUA
CUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUC
CUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCU
GAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUG
CAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUG
GCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACC
GAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAG
UCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAA
CAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUAC
AAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCG
GCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGG
AGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUA
GGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACU
CUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCU
AUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGG
AACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAG
GGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCC
CGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGU
CGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCAC
UGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAA
ACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAA
CGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
0    ? 
2  GB  AF034619   3377778  2  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
5581 ? 
3  UNP RL2_HALMA  P20276   3  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

;
0    ? 
4  GB  YP_136234  55378384 4  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
1    ? 
5  UNP RL4_HALMA  P12735   5  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
1    ? 
6  UNP RL5_HALMA  P14124   6  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
0    ? 
7  UNP RL6_HALMA  P14135   7  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
0    ? 
8  UNP RL7A_HALMA P12743   8  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
0    ? 
9  UNP RLA0_HALMA P15825   9  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
1    ? 
10 GB  AAV47175   55231756 10 
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
1    ? 
11 GB  P14122     132647   11 
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
1    ? 
12 UNP RL13_HALMA P29198   12 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
1    ? 
13 UNP RL14_HALMA P22450   13 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
1    ? 
14 UNP RL15_HALMA P12737   14 
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
0    ? 
15 GB  AAV46920   55231501 15 
;MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK
;
1    ? 
16 UNP RL18_HALMA P14123   16 
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
0    ? 
17 UNP R18E_HALMA P12733   17 
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
0    ? 
18 UNP RL19_HALMA P14119   18 
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
0    ? 
19 UNP RL21_HALMA P12734   19 
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
0    ? 
20 UNP RL22_HALMA P10970   20 
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
0    ? 
21 UNP RL23_HALMA P12732   21 
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
0    ? 
22 UNP RL24_HALMA P10972   22 
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
0    ? 
23 UNP R24E_HALMA P14116   23 PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 1    ? 
24 UNP RL29_HALMA P10971   24 MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 1    ? 
25 UNP RL30_HALMA P14121   25 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
1    ? 
26 UNP RL31_HALMA P18138   26 
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
0    ? 
27 UNP RL32_HALMA P12736   27 
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
0    ? 
28 GB  AAV46581   55231162 28 
;SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
34   ? 
29 UNP RL37_HALMA P32410   29 MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 0    ? 
30 UNP RL39_HALMA P22452   30 MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 0    ? 
31 UNP RL44_HALMA P32411   31 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
1    ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1YI2 0 1 ? 2922 ? 55229667 0    ? 2921 ? 1  2922 
2  2  1YI2 9 1 ? 122  ? 3377778  5581 ? 5702 ? 1  122  
3  3  1YI2 A 1 ? 240  ? P20276   0    ? 239  ? 0  239  
4  4  1YI2 B 1 ? 338  ? 55378384 1    ? 338  ? 0  337  
5  5  1YI2 C 1 ? 246  ? P12735   1    ? 246  ? 1  246  
6  6  1YI2 D 1 ? 177  ? P14124   0    ? 176  ? 0  176  
7  7  1YI2 E 1 ? 178  ? P14135   0    ? 177  ? 0  177  
8  8  1YI2 F 1 ? 120  ? P12743   0    ? 119  ? 0  119  
9  9  1YI2 G 1 ? 348  ? P15825   1    ? 348  ? 1  348  
10 10 1YI2 H 1 ? 177  ? 55231756 1    ? 177  ? 1  177  
11 11 1YI2 I 1 ? 162  ? 132647   1    ? 162  ? 0  161  
12 12 1YI2 J 1 ? 145  ? P29198   1    ? 145  ? 1  145  
13 13 1YI2 K 1 ? 132  ? P22450   1    ? 132  ? 1  132  
14 14 1YI2 L 1 ? 165  ? P12737   0    ? 164  ? 0  164  
15 15 1YI2 M 1 ? 195  ? 55231501 1    ? 195  ? 0  194  
16 16 1YI2 N 1 ? 187  ? P14123   0    ? 186  ? 0  186  
17 17 1YI2 O 1 ? 116  ? P12733   0    ? 115  ? 0  115  
18 18 1YI2 P 1 ? 149  ? P14119   0    ? 148  ? 0  148  
19 19 1YI2 Q 1 ? 96   ? P12734   0    ? 95   ? 0  95   
20 20 1YI2 R 1 ? 155  ? P10970   0    ? 154  ? 0  154  
21 21 1YI2 S 1 ? 85   ? P12732   0    ? 84   ? 0  84   
22 22 1YI2 T 1 ? 120  ? P10972   0    ? 119  ? 0  119  
23 23 1YI2 U 1 ? 66   ? P14116   1    ? 66   ? 1  66   
24 24 1YI2 V 1 ? 71   ? P10971   1    ? 71   ? 0  70   
25 25 1YI2 W 1 ? 154  ? P14121   1    ? 154  ? 1  154  
26 26 1YI2 X 1 ? 92   ? P18138   0    ? 91   ? 0  91   
27 27 1YI2 Y 1 ? 241  ? P12736   0    ? 240  ? 0  240  
28 28 1YI2 Z 1 ? 83   ? 55231162 34   ? 116  ? 10 92   
29 29 1YI2 1 1 ? 57   ? P32410   0    ? 56   ? 0  56   
30 30 1YI2 2 1 ? 50   ? P22452   0    ? 49   ? 0  49   
31 31 1YI2 3 1 ? 92   ? P32411   1    ? 92   ? 1  92   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1YI2 1MA 0 628  ? GB  55229667 A   627  'modified residue'    628  1 
1  1YI2 A   0 2099 ? GB  55229667 G   2098 'engineered mutation' 2099 2 
1  1YI2 OMU 0 2587 ? GB  55229667 U   2586 'modified residue'    2587 3 
1  1YI2 OMG 0 2588 ? GB  55229667 G   2587 'modified residue'    2588 4 
1  1YI2 UR3 0 2619 ? GB  55229667 U   2618 'modified residue'    2619 5 
1  1YI2 PSU 0 2621 ? GB  55229667 U   2620 'modified residue'    2621 6 
13 1YI2 LEU K 44   ? UNP P22450   HIS 44   conflict              44   7 
15 1YI2 GLU M 14   ? GB  55231501 LYS 14   conflict              13   8 
28 1YI2 ARG Z 1    ? GB  55231162 SER 34   conflict              10   9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1MA 'RNA linking'       n "6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE" ? 'C11 H16 N5 O7 P' 361.248 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                  ? 'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                                ? 'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'                               ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'    121.158 
ERY non-polymer         . 'ERYTHROMYCIN A'                             ? 'C37 H67 N O13'   733.927 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                              ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                                 ? 'Na 1'            22.990  
OMG 'RNA linking'       n "O2'-METHYLGUANOSINE-5'-MONOPHOSPHATE"       ? 'C11 H16 N5 O8 P' 377.247 
OMU 'RNA linking'       n 
;O2'-METHYLURIDINE 5'-MONOPHOSPHATE
;
? 'C10 H15 N2 O9 P' 338.208 
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'      115.130 
PSU 'RNA linking'       n "PSEUDOURIDINE-5'-MONOPHOSPHATE"             ? 'C9 H13 N2 O9 P'  324.181 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                   ? 'C9 H13 N2 O9 P'  324.181 
UR3 'RNA linking'       n "3-METHYLURIDINE-5'-MONOPHOSHATE"            ? 'C10 H15 N2 O9 P' 338.208 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1YI2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.1 
_exptl_crystal.density_percent_sol   60.0 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    
'PEG 6000, KCl, NH4Cl, MgCl2, Kacetate, pH 5.8, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 'PEG 6000' ? ? ? 
1 2  1 KCl        ? ? ? 
1 3  1 NH4Cl      ? ? ? 
1 4  1 MgCl2      ? ? ? 
1 5  1 Kacetate   ? ? ? 
1 6  1 H2O        ? ? ? 
1 7  2 'PEG 6000' ? ? ? 
1 8  2 KCl        ? ? ? 
1 9  2 NH4Cl      ? ? ? 
1 10 2 MgCl2      ? ? ? 
1 11 2 Kacetate   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-06-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.10 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.10 
# 
_reflns.entry_id                     1YI2 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.65 
_reflns.number_obs                   522011 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.4 
_reflns.B_iso_Wilson_estimate        66.8 
_reflns.pdbx_redundancy              6.3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   94.0 
_reflns_shell.Rmerge_I_obs           0.709 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      49175 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1YI2 
_refine.ls_number_reflns_obs                     495528 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               321406.22 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    94.4 
_refine.ls_R_factor_obs                          0.176 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.176 
_refine.ls_R_factor_R_free                       0.214 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.0 
_refine.ls_number_reflns_R_free                  4878 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               57.6 
_refine.aniso_B[1][1]                            7.19 
_refine.aniso_B[2][2]                            -3.15 
_refine.aniso_B[3][3]                            -4.04 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.309794 
_refine.solvent_model_param_bsol                 34.3174 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1YI2 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.44 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.35 
_refine_analyze.Luzzati_sigma_a_free            0.50 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29377 
_refine_hist.pdbx_number_atoms_nucleic_acid   61619 
_refine_hist.pdbx_number_atoms_ligand         282 
_refine_hist.number_atoms_solvent             7808 
_refine_hist.number_atoms_total               99086 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.0   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      15.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.35  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.14  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.98  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.53  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.31  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.65 
_refine_ls_shell.d_res_low                        2.82 
_refine_ls_shell.number_reflns_R_work             71331 
_refine_ls_shell.R_factor_R_work                  0.326 
_refine_ls_shell.percent_reflns_obs               82.9 
_refine_ls_shell.R_factor_R_free                  0.366 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            1.0 
_refine_ls_shell.number_reflns_R_free             709 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM     PROTEIN.TOP             'X-RAY DIFFRACTION' 
2 RNA_RIBO_MODNTS.PARAM RNA_RIBO_MODNTS_DRUGS.T 'X-RAY DIFFRACTION' 
3 ION.PARAM             ION.TOP                 'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM       WATER.TOP               'X-RAY DIFFRACTION' 
5 N                     N                       'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1YI2 
_struct.title                     
'Crystal Structure Of Erythromycin Bound To The G2099A Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YI2 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            'erythromycin, antibiotic complexes, mutated 50S subunits, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 33 ? 
HA N N 33 ? 
IA N N 33 ? 
JA N N 33 ? 
KA N N 33 ? 
LA N N 33 ? 
MA N N 33 ? 
NA N N 33 ? 
OA N N 33 ? 
PA N N 33 ? 
QA N N 33 ? 
RA N N 33 ? 
SA N N 33 ? 
TA N N 33 ? 
UA N N 33 ? 
VA N N 33 ? 
WA N N 33 ? 
XA N N 33 ? 
YA N N 33 ? 
ZA N N 33 ? 
AB N N 33 ? 
BB N N 33 ? 
CB N N 33 ? 
DB N N 33 ? 
EB N N 33 ? 
FB N N 33 ? 
GB N N 33 ? 
HB N N 33 ? 
IB N N 33 ? 
JB N N 33 ? 
KB N N 33 ? 
LB N N 33 ? 
MB N N 33 ? 
NB N N 33 ? 
OB N N 33 ? 
PB N N 33 ? 
QB N N 33 ? 
RB N N 33 ? 
SB N N 33 ? 
TB N N 33 ? 
UB N N 33 ? 
VB N N 33 ? 
WB N N 33 ? 
XB N N 33 ? 
YB N N 33 ? 
ZB N N 33 ? 
AC N N 33 ? 
BC N N 33 ? 
CC N N 33 ? 
DC N N 33 ? 
EC N N 33 ? 
FC N N 33 ? 
GC N N 33 ? 
HC N N 33 ? 
IC N N 33 ? 
JC N N 33 ? 
KC N N 33 ? 
LC N N 33 ? 
MC N N 33 ? 
NC N N 33 ? 
OC N N 33 ? 
PC N N 33 ? 
QC N N 33 ? 
RC N N 33 ? 
SC N N 33 ? 
TC N N 33 ? 
UC N N 33 ? 
VC N N 33 ? 
WC N N 33 ? 
XC N N 33 ? 
YC N N 33 ? 
ZC N N 33 ? 
AD N N 33 ? 
BD N N 33 ? 
CD N N 33 ? 
DD N N 33 ? 
ED N N 33 ? 
FD N N 33 ? 
GD N N 33 ? 
HD N N 33 ? 
ID N N 33 ? 
JD N N 33 ? 
KD N N 33 ? 
LD N N 33 ? 
MD N N 33 ? 
ND N N 33 ? 
OD N N 33 ? 
PD N N 33 ? 
QD N N 33 ? 
RD N N 33 ? 
SD N N 33 ? 
TD N N 33 ? 
UD N N 33 ? 
VD N N 33 ? 
WD N N 33 ? 
XD N N 33 ? 
YD N N 33 ? 
ZD N N 33 ? 
AE N N 33 ? 
BE N N 33 ? 
CE N N 33 ? 
DE N N 33 ? 
EE N N 33 ? 
FE N N 33 ? 
GE N N 33 ? 
HE N N 33 ? 
IE N N 33 ? 
JE N N 33 ? 
KE N N 34 ? 
LE N N 34 ? 
ME N N 35 ? 
NE N N 35 ? 
OE N N 35 ? 
PE N N 35 ? 
QE N N 35 ? 
RE N N 35 ? 
SE N N 35 ? 
TE N N 35 ? 
UE N N 35 ? 
VE N N 35 ? 
WE N N 35 ? 
XE N N 35 ? 
YE N N 35 ? 
ZE N N 35 ? 
AF N N 35 ? 
BF N N 35 ? 
CF N N 35 ? 
DF N N 35 ? 
EF N N 35 ? 
FF N N 35 ? 
GF N N 35 ? 
HF N N 35 ? 
IF N N 35 ? 
JF N N 35 ? 
KF N N 35 ? 
LF N N 35 ? 
MF N N 35 ? 
NF N N 35 ? 
OF N N 35 ? 
PF N N 35 ? 
QF N N 35 ? 
RF N N 35 ? 
SF N N 35 ? 
TF N N 35 ? 
UF N N 35 ? 
VF N N 35 ? 
WF N N 35 ? 
XF N N 35 ? 
YF N N 35 ? 
ZF N N 35 ? 
AG N N 35 ? 
BG N N 35 ? 
CG N N 35 ? 
DG N N 35 ? 
EG N N 35 ? 
FG N N 35 ? 
GG N N 35 ? 
HG N N 35 ? 
IG N N 35 ? 
JG N N 35 ? 
KG N N 35 ? 
LG N N 35 ? 
MG N N 35 ? 
NG N N 35 ? 
OG N N 35 ? 
PG N N 35 ? 
QG N N 35 ? 
RG N N 35 ? 
SG N N 35 ? 
TG N N 35 ? 
UG N N 35 ? 
VG N N 35 ? 
WG N N 35 ? 
XG N N 35 ? 
YG N N 35 ? 
ZG N N 35 ? 
AH N N 35 ? 
BH N N 35 ? 
CH N N 35 ? 
DH N N 35 ? 
EH N N 35 ? 
FH N N 36 ? 
GH N N 36 ? 
HH N N 36 ? 
IH N N 36 ? 
JH N N 36 ? 
KH N N 36 ? 
LH N N 36 ? 
MH N N 36 ? 
NH N N 36 ? 
OH N N 36 ? 
PH N N 33 ? 
QH N N 35 ? 
RH N N 35 ? 
SH N N 33 ? 
TH N N 35 ? 
UH N N 36 ? 
VH N N 33 ? 
WH N N 36 ? 
XH N N 35 ? 
YH N N 35 ? 
ZH N N 35 ? 
AI N N 35 ? 
BI N N 36 ? 
CI N N 36 ? 
DI N N 36 ? 
EI N N 33 ? 
FI N N 35 ? 
GI N N 36 ? 
HI N N 35 ? 
II N N 36 ? 
JI N N 36 ? 
KI N N 37 ? 
LI N N 36 ? 
MI N N 35 ? 
NI N N 35 ? 
OI N N 35 ? 
PI N N 35 ? 
QI N N 36 ? 
RI N N 35 ? 
SI N N 33 ? 
TI N N 35 ? 
UI N N 37 ? 
VI N N 33 ? 
WI N N 36 ? 
XI N N 37 ? 
YI N N 37 ? 
ZI N N 33 ? 
AJ N N 33 ? 
BJ N N 37 ? 
CJ N N 36 ? 
DJ N N 38 ? 
EJ N N 38 ? 
FJ N N 38 ? 
GJ N N 38 ? 
HJ N N 38 ? 
IJ N N 38 ? 
JJ N N 38 ? 
KJ N N 38 ? 
LJ N N 38 ? 
MJ N N 38 ? 
NJ N N 38 ? 
OJ N N 38 ? 
PJ N N 38 ? 
QJ N N 38 ? 
RJ N N 38 ? 
SJ N N 38 ? 
TJ N N 38 ? 
UJ N N 38 ? 
VJ N N 38 ? 
WJ N N 38 ? 
XJ N N 38 ? 
YJ N N 38 ? 
ZJ N N 38 ? 
AK N N 38 ? 
BK N N 38 ? 
CK N N 38 ? 
DK N N 38 ? 
EK N N 38 ? 
FK N N 38 ? 
GK N N 38 ? 
HK N N 38 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE C  5   ? ARG C  12  ? ILE A 4   ARG A 11  1 ? 8  
HELX_P HELX_P2   2   GLY C  13  ? ARG C  18  ? GLY A 12  ARG A 17  5 ? 6  
HELX_P HELX_P3   3   PRO C  20  ? TYR C  24  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P4   4   ALA C  98  ? ILE C  100 ? ALA A 97  ILE A 99  5 ? 3  
HELX_P HELX_P5   5   GLY C  164 ? LYS C  168 ? GLY A 163 LYS A 167 5 ? 5  
HELX_P HELX_P6   6   LYS C  172 ? LYS C  181 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P7   7   ARG C  191 ? MET C  195 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P8   8   ASN C  196 ? HIS C  200 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P9   9   GLU D  109 ? THR D  113 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P10  10  ASP D  121 ? GLY D  136 ? ASP B 120 GLY B 135 1 ? 16 
HELX_P HELX_P11  11  VAL D  148 ? VAL D  152 ? VAL B 147 VAL B 151 5 ? 5  
HELX_P HELX_P12  12  SER D  171 ? GLY D  186 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P13  13  ALA D  190 ? PHE D  195 ? ALA B 189 PHE B 194 1 ? 6  
HELX_P HELX_P14  14  GLY D  214 ? GLY D  220 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P15  15  LYS D  225 ? GLN D  231 ? LYS B 224 GLN B 230 5 ? 7  
HELX_P HELX_P16  16  PRO E  19  ? THR E  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P17  17  ARG E  27  ? ASN E  41  ? ARG C 27  ASN C 41  1 ? 15 
HELX_P HELX_P18  18  ASN E  103 ? ALA E  117 ? ASN C 103 ALA C 117 1 ? 15 
HELX_P HELX_P19  19  ASP E  120 ? GLY E  128 ? ASP C 120 GLY C 128 1 ? 9  
HELX_P HELX_P20  20  ASP E  142 ? LEU E  147 ? ASP C 142 LEU C 147 5 ? 6  
HELX_P HELX_P21  21  LYS E  149 ? LEU E  160 ? LYS C 149 LEU C 160 1 ? 12 
HELX_P HELX_P22  22  HIS E  163 ? ALA E  169 ? HIS C 163 ALA C 169 1 ? 7  
HELX_P HELX_P23  23  GLY E  177 ? GLY E  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P24  24  SER E  201 ? ASN E  206 ? SER C 201 ASN C 206 1 ? 6  
HELX_P HELX_P25  25  ASN E  219 ? ALA E  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P26  26  PRO E  225 ? ALA E  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P27  27  GLU E  237 ? ALA E  244 ? GLU C 237 ALA C 244 1 ? 8  
HELX_P HELX_P28  28  ALA F  38  ? GLY F  47  ? ALA D 37  GLY D 46  1 ? 10 
HELX_P HELX_P29  29  ASP F  78  ? LEU F  89  ? ASP D 77  LEU D 88  1 ? 12 
HELX_P HELX_P30  30  PRO F  90  ? ALA F  92  ? PRO D 89  ALA D 91  5 ? 3  
HELX_P HELX_P31  31  GLY F  139 ? LYS F  144 ? GLY D 138 LYS D 143 5 ? 6  
HELX_P HELX_P32  32  PRO F  153 ? ARG F  157 ? PRO D 152 ARG D 156 5 ? 5  
HELX_P HELX_P33  33  ASN F  159 ? SER F  169 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P34  34  ASN G  56  ? THR G  78  ? ASN E 55  THR E 77  1 ? 23 
HELX_P HELX_P35  35  ASN G  107 ? GLU G  111 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P36  36  ASP G  138 ? THR G  153 ? ASP E 137 THR E 152 1 ? 16 
HELX_P HELX_P37  37  PRO H  10  ? GLY H  28  ? PRO F 9   GLY F 27  1 ? 19 
HELX_P HELX_P38  38  GLY H  33  ? GLY H  44  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P39  39  GLU H  58  ? HIS H  63  ? GLU F 57  HIS F 62  1 ? 6  
HELX_P HELX_P40  40  HIS H  63  ? GLU H  70  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P41  41  GLN H  80  ? ALA H  88  ? GLN F 79  ALA F 87  1 ? 9  
HELX_P HELX_P42  42  ALA H  105 ? LEU H  119 ? ALA F 104 LEU F 118 1 ? 15 
HELX_P HELX_P43  43  PRO I  13  ? SER I  29  ? PRO G 13  SER G 29  1 ? 17 
HELX_P HELX_P44  44  ARG I  63  ? ASP I  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P45  45  PRO J  5   ? TYR J  9   ? PRO H 5   TYR H 9   5 ? 5  
HELX_P HELX_P46  46  ASP J  42  ? TYR J  46  ? ASP H 42  TYR H 46  5 ? 5  
HELX_P HELX_P47  47  HIS J  62  ? GLY J  81  ? HIS H 62  GLY H 81  1 ? 20 
HELX_P HELX_P48  48  ASP J  145 ? TYR J  157 ? ASP H 145 TYR H 157 1 ? 13 
HELX_P HELX_P49  49  PRO K  70  ? ALA K  79  ? PRO I 69  ALA I 78  1 ? 10 
HELX_P HELX_P50  50  SER K  97  ? LYS K  108 ? SER I 96  LYS I 107 1 ? 12 
HELX_P HELX_P51  51  ASP K  116 ? VAL K  125 ? ASP I 115 VAL I 124 1 ? 10 
HELX_P HELX_P52  52  ILE L  18  ? LEU L  31  ? ILE J 18  LEU J 31  1 ? 14 
HELX_P HELX_P53  53  ASN L  40  ? ARG L  43  ? ASN J 40  ARG J 43  5 ? 4  
HELX_P HELX_P54  54  ARG L  49  ? ILE L  63  ? ARG J 49  ILE J 63  1 ? 15 
HELX_P HELX_P55  55  ARG L  74  ? GLY L  85  ? ARG J 74  GLY J 85  1 ? 12 
HELX_P HELX_P56  56  LYS L  91  ? SER L  100 ? LYS J 91  SER J 100 1 ? 10 
HELX_P HELX_P57  57  ASP L  122 ? ASN L  126 ? ASP J 122 ASN J 126 5 ? 5  
HELX_P HELX_P58  58  LEU L  132 ? GLY L  140 ? LEU J 132 GLY J 140 1 ? 9  
HELX_P HELX_P59  59  ALA M  114 ? ALA M  118 ? ALA K 114 ALA K 118 5 ? 5  
HELX_P HELX_P60  60  PHE M  121 ? SER M  126 ? PHE K 121 SER K 126 1 ? 6  
HELX_P HELX_P61  61  LYS N  4   ? GLN N  8   ? LYS L 3   GLN L 7   5 ? 5  
HELX_P HELX_P62  62  GLY N  24  ? GLY N  29  ? GLY L 23  GLY L 28  5 ? 6  
HELX_P HELX_P63  63  PRO N  55  ? GLN N  59  ? PRO L 54  GLN L 58  5 ? 5  
HELX_P HELX_P64  64  VAL N  67  ? ASN N  73  ? VAL L 66  ASN L 72  1 ? 7  
HELX_P HELX_P65  65  VAL N  94  ? VAL N  98  ? VAL L 93  VAL L 97  1 ? 5  
HELX_P HELX_P66  66  SER N  127 ? ALA N  137 ? SER L 126 ALA L 136 1 ? 11 
HELX_P HELX_P67  67  SER O  4   ? GLU O  14  ? SER M 3   GLU M 13  1 ? 11 
HELX_P HELX_P68  68  ASP O  18  ? ARG O  33  ? ASP M 17  ARG M 32  1 ? 16 
HELX_P HELX_P69  69  ARG O  46  ? GLN O  53  ? ARG M 45  GLN M 52  1 ? 8  
HELX_P HELX_P70  70  ARG O  83  ? GLN O  87  ? ARG M 82  GLN M 86  5 ? 5  
HELX_P HELX_P71  71  ASP O  97  ? PHE O  110 ? ASP M 96  PHE M 109 1 ? 14 
HELX_P HELX_P72  72  HIS O  139 ? ASN O  144 ? HIS M 138 ASN M 143 1 ? 6  
HELX_P HELX_P73  73  LEU O  148 ? ALA O  157 ? LEU M 147 ALA M 156 5 ? 10 
HELX_P HELX_P74  74  ASP O  158 ? GLY O  163 ? ASP M 157 GLY M 162 5 ? 6  
HELX_P HELX_P75  75  THR O  165 ? ARG O  172 ? THR M 164 ARG M 171 1 ? 8  
HELX_P HELX_P76  76  LEU O  188 ? GLY O  192 ? LEU M 187 GLY M 191 5 ? 5  
HELX_P HELX_P77  77  MET P  11  ? GLU P  16  ? MET N 10  GLU N 15  1 ? 6  
HELX_P HELX_P78  78  ASP P  20  ? SER P  30  ? ASP N 19  SER N 29  1 ? 11 
HELX_P HELX_P79  79  SER P  65  ? GLY P  71  ? SER N 64  GLY N 70  5 ? 7  
HELX_P HELX_P80  80  ASN P  78  ? ALA P  96  ? ASN N 77  ALA N 95  1 ? 19 
HELX_P HELX_P81  81  SER P  114 ? ALA P  126 ? SER N 113 ALA N 125 1 ? 13 
HELX_P HELX_P82  82  ASN P  133 ? LEU P  137 ? ASN N 132 LEU N 136 5 ? 5  
HELX_P HELX_P83  83  ASP P  139 ? GLY P  145 ? ASP N 138 GLY N 144 1 ? 7  
HELX_P HELX_P84  84  GLY P  145 ? GLU P  153 ? GLY N 144 GLU N 152 1 ? 9  
HELX_P HELX_P85  85  LEU P  169 ? LEU P  181 ? LEU N 168 LEU N 180 1 ? 13 
HELX_P HELX_P86  86  ASN Q  5   ? SER Q  22  ? ASN O 4   SER O 21  1 ? 18 
HELX_P HELX_P87  87  ALA Q  25  ? LYS Q  36  ? ALA O 24  LYS O 35  1 ? 12 
HELX_P HELX_P88  88  PRO Q  37  ? HIS Q  41  ? PRO O 36  HIS O 40  5 ? 5  
HELX_P HELX_P89  89  LEU Q  46  ? ALA Q  53  ? LEU O 45  ALA O 52  1 ? 8  
HELX_P HELX_P90  90  SER Q  83  ? GLN Q  92  ? SER O 82  GLN O 91  1 ? 10 
HELX_P HELX_P91  91  LEU Q  99  ? ASN Q  106 ? LEU O 98  ASN O 105 1 ? 8  
HELX_P HELX_P92  92  LEU R  4   ? LEU R  15  ? LEU P 3   LEU P 14  1 ? 12 
HELX_P HELX_P93  93  GLY R  18  ? ASN R  20  ? GLY P 17  ASN P 19  5 ? 3  
HELX_P HELX_P94  94  ARG R  28  ? ALA R  35  ? ARG P 27  ALA P 34  1 ? 8  
HELX_P HELX_P95  95  THR R  37  ? GLU R  47  ? THR P 36  GLU P 46  1 ? 11 
HELX_P HELX_P96  96  ARG R  60  ? TYR R  72  ? ARG P 59  TYR P 71  1 ? 13 
HELX_P HELX_P97  97  GLY R  77  ? ARG R  81  ? GLY P 76  ARG P 80  5 ? 5  
HELX_P HELX_P98  98  LYS R  84  ? GLN R  89  ? LYS P 83  GLN P 88  1 ? 6  
HELX_P HELX_P99  99  ASN R  90  ? GLU R  112 ? ASN P 89  GLU P 111 1 ? 23 
HELX_P HELX_P100 100 SER R  118 ? GLY R  128 ? SER P 117 GLY P 127 1 ? 11 
HELX_P HELX_P101 101 SER R  134 ? ASP R  143 ? SER P 133 ASP P 142 1 ? 10 
HELX_P HELX_P102 102 LYS S  18  ? ARG S  22  ? LYS Q 17  ARG Q 21  5 ? 5  
HELX_P HELX_P103 103 PRO S  27  ? VAL S  31  ? PRO Q 26  VAL Q 30  5 ? 5  
HELX_P HELX_P104 104 HIS S  54  ? ASP S  58  ? HIS Q 53  ASP Q 57  5 ? 5  
HELX_P HELX_P105 105 THR S  88  ? ALA S  90  ? THR Q 87  ALA Q 89  5 ? 3  
HELX_P HELX_P106 106 ASP T  10  ? ASP T  12  ? ASP R 9   ASP R 11  5 ? 3  
HELX_P HELX_P107 107 SER T  25  ? LYS T  37  ? SER R 24  LYS R 36  1 ? 13 
HELX_P HELX_P108 108 THR T  40  ? GLU T  53  ? THR R 39  GLU R 52  1 ? 14 
HELX_P HELX_P109 109 PRO T  82  ? HIS T  102 ? PRO R 81  HIS R 101 1 ? 21 
HELX_P HELX_P110 110 ASP T  106 ? MET T  110 ? ASP R 105 MET R 109 5 ? 5  
HELX_P HELX_P111 111 ALA T  130 ? GLY T  132 ? ALA R 129 GLY R 131 5 ? 3  
HELX_P HELX_P112 112 THR U  12  ? ASN U  23  ? THR S 11  ASN S 22  1 ? 12 
HELX_P HELX_P113 113 SER U  34  ? ASP U  47  ? SER S 33  ASP S 46  1 ? 14 
HELX_P HELX_P114 114 ASP U  74  ? ARG U  81  ? ASP S 73  ARG S 80  1 ? 8  
HELX_P HELX_P115 115 GLN V  4   ? ARG V  14  ? GLN T 3   ARG T 13  1 ? 11 
HELX_P HELX_P116 116 PRO V  16  ? GLN V  23  ? PRO T 15  GLN T 22  5 ? 8  
HELX_P HELX_P117 117 SER V  29  ? GLY V  37  ? SER T 28  GLY T 36  1 ? 9  
HELX_P HELX_P118 118 ASP V  93  ? SER V  95  ? ASP T 92  SER T 94  5 ? 3  
HELX_P HELX_P119 119 ASP V  106 ? SER V  115 ? ASP T 105 SER T 114 1 ? 10 
HELX_P HELX_P120 120 SER W  33  ? LEU W  42  ? SER U 33  LEU U 42  1 ? 10 
HELX_P HELX_P121 121 GLU W  45  ? LEU W  49  ? GLU U 45  LEU U 49  5 ? 5  
HELX_P HELX_P122 122 HIS X  5   ? ASP X  11  ? HIS V 4   ASP V 10  1 ? 7  
HELX_P HELX_P123 123 THR X  13  ? ALA X  37  ? THR V 12  ALA V 36  1 ? 25 
HELX_P HELX_P124 124 ASN X  43  ? GLY X  65  ? ASN V 42  GLY V 64  1 ? 23 
HELX_P HELX_P125 125 HIS Y  14  ? LEU Y  24  ? HIS W 14  LEU W 24  1 ? 11 
HELX_P HELX_P126 126 THR Y  38  ? ASN Y  49  ? THR W 38  ASN W 49  1 ? 12 
HELX_P HELX_P127 127 SER Y  58  ? ALA Y  70  ? SER W 58  ALA W 70  1 ? 13 
HELX_P HELX_P128 128 ASP Y  80  ? THR Y  88  ? ASP W 80  THR W 88  1 ? 9  
HELX_P HELX_P129 129 ASP Y  92  ? SER Y  102 ? ASP W 92  SER W 102 1 ? 11 
HELX_P HELX_P130 130 PRO Y  131 ? GLY Y  135 ? PRO W 131 GLY W 135 5 ? 5  
HELX_P HELX_P131 131 ASP Y  142 ? MET Y  153 ? ASP W 142 MET W 153 1 ? 12 
HELX_P HELX_P132 132 ARG Z  16  ? GLU Z  21  ? ARG X 15  GLU X 20  5 ? 6  
HELX_P HELX_P133 133 PRO Z  22  ? HIS Z  24  ? PRO X 21  HIS X 23  5 ? 3  
HELX_P HELX_P134 134 LYS Z  25  ? PHE Z  42  ? LYS X 24  PHE X 41  1 ? 18 
HELX_P HELX_P135 135 ASP Z  45  ? ASP Z  47  ? ASP X 44  ASP X 46  5 ? 3  
HELX_P HELX_P136 136 ASP Z  52  ? ALA Z  61  ? ASP X 51  ALA X 60  1 ? 10 
HELX_P HELX_P137 137 SER AA 111 ? GLY AA 125 ? SER Y 110 GLY Y 124 1 ? 15 
HELX_P HELX_P138 138 GLU AA 166 ? ARG AA 170 ? GLU Y 165 ARG Y 169 5 ? 5  
HELX_P HELX_P139 139 VAL AA 191 ? GLU AA 195 ? VAL Y 190 GLU Y 194 5 ? 5  
HELX_P HELX_P140 140 GLY AA 211 ? ALA AA 225 ? GLY Y 210 ALA Y 224 1 ? 15 
HELX_P HELX_P141 141 ARG BA 1   ? GLY BA 6   ? ARG Z 10  GLY Z 15  5 ? 6  
HELX_P HELX_P142 142 GLY BA 10  ? GLU BA 26  ? GLY Z 19  GLU Z 35  1 ? 17 
HELX_P HELX_P143 143 THR BA 64  ? ARG BA 72  ? THR Z 73  ARG Z 81  1 ? 9  
HELX_P HELX_P144 144 GLY CA 5   ? GLY CA 10  ? GLY 1 4   GLY 1 9   5 ? 6  
HELX_P HELX_P145 145 TYR CA 49  ? SER CA 53  ? TYR 1 48  SER 1 52  5 ? 5  
HELX_P HELX_P146 146 SER DA 5   ? ASN DA 19  ? SER 2 4   ASN 2 18  1 ? 15 
HELX_P HELX_P147 147 PRO DA 23  ? THR DA 30  ? PRO 2 22  THR 2 29  1 ? 8  
HELX_P HELX_P148 148 LYS EA 34  ? SER EA 44  ? LYS 3 34  SER 3 44  1 ? 11 
HELX_P HELX_P149 149 ASP EA 49  ? LYS EA 54  ? ASP 3 49  LYS 3 54  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1    covale both ? A  G   627  "O3'" ? ? ? 1_555 A  1MA 628  P   ? ? 0 G   627  0 1MA 628  1_555 ? ? ? ? ? ? ? 1.607 ? ? 
covale2    covale both ? A  1MA 628  "O3'" ? ? ? 1_555 A  A   629  P   ? ? 0 1MA 628  0 A   629  1_555 ? ? ? ? ? ? ? 1.607 ? ? 
covale3    covale both ? A  U   2586 "O3'" ? ? ? 1_555 A  OMU 2587 P   ? ? 0 U   2586 0 OMU 2587 1_555 ? ? ? ? ? ? ? 1.609 ? ? 
covale4    covale both ? A  OMU 2587 "O3'" ? ? ? 1_555 A  OMG 2588 P   ? ? 0 OMU 2587 0 OMG 2588 1_555 ? ? ? ? ? ? ? 1.608 ? ? 
covale5    covale both ? A  OMG 2588 "O3'" ? ? ? 1_555 A  U   2589 P   ? ? 0 OMG 2588 0 U   2589 1_555 ? ? ? ? ? ? ? 1.611 ? ? 
covale6    covale both ? A  G   2618 "O3'" ? ? ? 1_555 A  UR3 2619 P   ? ? 0 G   2618 0 UR3 2619 1_555 ? ? ? ? ? ? ? 1.606 ? ? 
covale7    covale both ? A  UR3 2619 "O3'" ? ? ? 1_555 A  U   2620 P   ? ? 0 UR3 2619 0 U   2620 1_555 ? ? ? ? ? ? ? 1.598 ? ? 
covale8    covale both ? A  U   2620 "O3'" ? ? ? 1_555 A  PSU 2621 P   ? ? 0 U   2620 0 PSU 2621 1_555 ? ? ? ? ? ? ? 1.599 ? ? 
covale9    covale both ? A  PSU 2621 "O3'" ? ? ? 1_555 A  A   2622 P   ? ? 0 PSU 2621 0 A   2622 1_555 ? ? ? ? ? ? ? 1.607 ? ? 
metalc1    metalc ?    ? A  G   28   OP1   ? ? ? 1_555 RA MG  .    MG  ? ? 0 G   28   0 MG  8012 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc2    metalc ?    ? A  C   40   O2    ? ? ? 1_555 RE NA  .    NA  ? ? 0 C   40   0 NA  8507 1_555 ? ? ? ? ? ? ? 2.509 ? ? 
metalc3    metalc ?    ? A  C   40   "O2'" ? ? ? 1_555 RE NA  .    NA  ? ? 0 C   40   0 NA  8507 1_555 ? ? ? ? ? ? ? 2.893 ? ? 
metalc4    metalc ?    ? A  G   41   "O4'" ? ? ? 1_555 RE NA  .    NA  ? ? 0 G   41   0 NA  8507 1_555 ? ? ? ? ? ? ? 2.913 ? ? 
metalc5    metalc ?    ? A  G   56   O6    ? ? ? 1_555 JF NA  .    NA  ? ? 0 G   56   0 NA  8528 1_555 ? ? ? ? ? ? ? 2.854 ? ? 
metalc6    metalc ?    ? A  G   61   N7    ? ? ? 1_555 JF NA  .    NA  ? ? 0 G   61   0 NA  8528 1_555 ? ? ? ? ? ? ? 2.785 ? ? 
metalc7    metalc ?    ? A  U   107  O4    ? ? ? 1_555 KF NA  .    NA  ? ? 0 U   107  0 NA  8529 1_555 ? ? ? ? ? ? ? 2.840 ? ? 
metalc8    metalc ?    ? A  U   108  O2    ? ? ? 1_555 KF NA  .    NA  ? ? 0 U   108  0 NA  8529 1_555 ? ? ? ? ? ? ? 2.674 ? ? 
metalc9    metalc ?    ? A  U   115  OP2   ? ? ? 1_555 SB MG  .    MG  ? ? 0 U   115  0 MG  8039 1_555 ? ? ? ? ? ? ? 1.993 ? ? 
metalc10   metalc ?    ? A  C   141  "O4'" ? ? ? 1_555 LF NA  .    NA  ? ? 0 C   141  0 NA  8530 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc11   metalc ?    ? A  C   141  O2    ? ? ? 1_555 LF NA  .    NA  ? ? 0 C   141  0 NA  8530 1_555 ? ? ? ? ? ? ? 2.689 ? ? 
metalc12   metalc ?    ? A  G   142  N7    ? ? ? 1_555 LF NA  .    NA  ? ? 0 G   142  0 NA  8530 1_555 ? ? ? ? ? ? ? 2.955 ? ? 
metalc13   metalc ?    ? A  U   146  O4    ? ? ? 1_555 FF NA  .    NA  ? ? 0 U   146  0 NA  8524 1_555 ? ? ? ? ? ? ? 2.743 ? ? 
metalc14   metalc ?    ? A  C   162  OP1   ? ? ? 1_555 HC MG  .    MG  ? ? 0 C   162  0 MG  8054 1_555 ? ? ? ? ? ? ? 2.052 ? ? 
metalc15   metalc ?    ? A  C   162  OP2   ? ? ? 1_555 LE K   .    K   ? ? 0 C   162  0 K   8402 1_555 ? ? ? ? ? ? ? 3.168 ? ? 
metalc16   metalc ?    ? A  U   163  O4    ? ? ? 1_555 LE K   .    K   ? ? 0 U   163  0 K   8402 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc17   metalc ?    ? A  A   165  N7    ? ? ? 1_555 AD MG  .    MG  ? ? 0 A   165  0 MG  8079 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc18   metalc ?    ? A  A   165  OP2   ? ? ? 1_555 XE NA  .    NA  ? ? 0 A   165  0 NA  8515 1_555 ? ? ? ? ? ? ? 2.683 ? ? 
metalc19   metalc ?    ? A  A   166  OP1   ? ? ? 1_555 UC MG  .    MG  ? ? 0 A   166  0 MG  8070 1_555 ? ? ? ? ? ? ? 2.108 ? ? 
metalc20   metalc ?    ? A  A   166  "O3'" ? ? ? 1_555 XE NA  .    NA  ? ? 0 A   166  0 NA  8515 1_555 ? ? ? ? ? ? ? 2.708 ? ? 
metalc21   metalc ?    ? A  A   166  "O2'" ? ? ? 1_555 XE NA  .    NA  ? ? 0 A   166  0 NA  8515 1_555 ? ? ? ? ? ? ? 2.897 ? ? 
metalc22   metalc ?    ? A  A   167  OP1   ? ? ? 1_555 AD MG  .    MG  ? ? 0 A   167  0 MG  8079 1_555 ? ? ? ? ? ? ? 1.877 ? ? 
metalc23   metalc ?    ? A  C   168  OP2   ? ? ? 1_555 AD MG  .    MG  ? ? 0 C   168  0 MG  8079 1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc24   metalc ?    ? A  U   170  O2    ? ? ? 1_555 MF NA  .    NA  ? ? 0 U   170  0 NA  8531 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc25   metalc ?    ? A  U   172  O4    ? ? ? 1_555 LE K   .    K   ? ? 0 U   172  0 K   8402 1_555 ? ? ? ? ? ? ? 2.961 ? ? 
metalc26   metalc ?    ? A  G   175  OP2   ? ? ? 1_555 MC MG  .    MG  ? ? 0 G   175  0 MG  8060 1_555 ? ? ? ? ? ? ? 2.693 ? ? 
metalc27   metalc ?    ? A  A   187  N1    ? ? ? 1_555 EE MG  .    MG  ? ? 0 A   187  0 MG  8111 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc28   metalc ?    ? A  G   196  OP1   ? ? ? 1_555 UB MG  .    MG  ? ? 0 G   196  0 MG  8041 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc29   metalc ?    ? A  G   196  N7    ? ? ? 1_555 VG NA  .    NA  ? ? 0 G   196  0 NA  8574 1_555 ? ? ? ? ? ? ? 2.782 ? ? 
metalc30   metalc ?    ? A  C   197  N3    ? ? ? 1_555 DH NA  .    NA  ? ? 0 C   197  0 NA  8584 1_555 ? ? ? ? ? ? ? 2.684 ? ? 
metalc31   metalc ?    ? A  C   218  "O2'" ? ? ? 1_555 MF NA  .    NA  ? ? 0 C   218  0 NA  8531 1_555 ? ? ? ? ? ? ? 2.646 ? ? 
metalc32   metalc ?    ? A  G   219  O6    ? ? ? 1_555 UC MG  .    MG  ? ? 0 G   219  0 MG  8070 1_555 ? ? ? ? ? ? ? 2.534 ? ? 
metalc33   metalc ?    ? A  G   221  O6    ? ? ? 1_555 MF NA  .    NA  ? ? 0 G   221  0 NA  8531 1_555 ? ? ? ? ? ? ? 2.924 ? ? 
metalc34   metalc ?    ? A  A   227  "O2'" ? ? ? 1_555 UB MG  .    MG  ? ? 0 A   227  0 MG  8041 1_555 ? ? ? ? ? ? ? 2.742 ? ? 
metalc35   metalc ?    ? A  C   228  "O4'" ? ? ? 1_555 UB MG  .    MG  ? ? 0 C   228  0 MG  8041 1_555 ? ? ? ? ? ? ? 2.259 ? ? 
metalc36   metalc ?    ? A  C   240  OP1   ? ? ? 1_555 GB MG  .    MG  ? ? 0 C   240  0 MG  8027 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
metalc37   metalc ?    ? A  G   269  O6    ? ? ? 1_555 GB MG  .    MG  ? ? 0 G   269  0 MG  8027 1_555 ? ? ? ? ? ? ? 2.115 ? ? 
metalc38   metalc ?    ? A  U   308  O4    ? ? ? 1_555 TI NA  .    NA  ? ? 0 U   308  T NA  8543 1_555 ? ? ? ? ? ? ? 2.802 ? ? 
metalc39   metalc ?    ? A  C   342  O2    ? ? ? 1_555 TI NA  .    NA  ? ? 0 C   342  T NA  8543 1_555 ? ? ? ? ? ? ? 2.777 ? ? 
metalc40   metalc ?    ? A  G   387  O6    ? ? ? 1_555 NF NA  .    NA  ? ? 0 G   387  0 NA  8532 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc41   metalc ?    ? A  U   391  "O2'" ? ? ? 1_555 MG NA  .    NA  ? ? 0 U   391  0 NA  8565 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc42   metalc ?    ? A  U   392  OP2   ? ? ? 1_555 TB MG  .    MG  ? ? 0 U   392  0 MG  8040 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc43   metalc ?    ? A  U   402  O4    ? ? ? 1_555 NF NA  .    NA  ? ? 0 U   402  0 NA  8532 1_555 ? ? ? ? ? ? ? 2.839 ? ? 
metalc44   metalc ?    ? A  G   416  "O4'" ? ? ? 1_555 VG NA  .    NA  ? ? 0 G   416  0 NA  8574 1_555 ? ? ? ? ? ? ? 2.919 ? ? 
metalc45   metalc ?    ? A  A   442  N1    ? ? ? 1_555 RE NA  .    NA  ? ? 0 A   442  0 NA  8507 1_555 ? ? ? ? ? ? ? 2.814 ? ? 
metalc46   metalc ?    ? A  C   443  O2    ? ? ? 1_555 RE NA  .    NA  ? ? 0 C   443  0 NA  8507 1_555 ? ? ? ? ? ? ? 2.958 ? ? 
metalc47   metalc ?    ? A  A   453  "O2'" ? ? ? 1_555 HG NA  .    NA  ? ? 0 A   453  0 NA  8560 1_555 ? ? ? ? ? ? ? 2.880 ? ? 
metalc48   metalc ?    ? A  G   456  O6    ? ? ? 1_555 JA MG  .    MG  ? ? 0 G   456  0 MG  8004 1_555 ? ? ? ? ? ? ? 2.014 ? ? 
metalc49   metalc ?    ? A  G   456  OP2   ? ? ? 1_555 WA MG  .    MG  ? ? 0 G   456  0 MG  8017 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc50   metalc ?    ? A  A   459  OP1   ? ? ? 1_555 JA MG  .    MG  ? ? 0 A   459  0 MG  8004 1_555 ? ? ? ? ? ? ? 1.786 ? ? 
metalc51   metalc ?    ? A  G   464  O6    ? ? ? 1_555 OG NA  .    NA  ? ? 0 G   464  0 NA  8567 1_555 ? ? ? ? ? ? ? 2.825 ? ? 
metalc52   metalc ?    ? A  G   471  O6    ? ? ? 1_555 GC MG  .    MG  ? ? 0 G   471  0 MG  8053 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc53   metalc ?    ? A  G   475  OP2   ? ? ? 1_555 OG NA  .    NA  ? ? 0 G   475  0 NA  8567 1_555 ? ? ? ? ? ? ? 2.841 ? ? 
metalc54   metalc ?    ? A  G   479  OP2   ? ? ? 1_555 HG NA  .    NA  ? ? 0 G   479  0 NA  8560 1_555 ? ? ? ? ? ? ? 2.988 ? ? 
metalc55   metalc ?    ? A  C   515  "O3'" ? ? ? 1_555 KD MG  .    MG  ? ? 0 C   515  0 MG  8089 1_555 ? ? ? ? ? ? ? 3.072 ? ? 
metalc56   metalc ?    ? A  A   516  OP1   ? ? ? 1_555 KD MG  .    MG  ? ? 0 A   516  0 MG  8089 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
metalc57   metalc ?    ? A  U   517  OP2   ? ? ? 1_555 KD MG  .    MG  ? ? 0 U   517  0 MG  8089 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc58   metalc ?    ? A  G   518  N7    ? ? ? 1_555 KD MG  .    MG  ? ? 0 G   518  0 MG  8089 1_555 ? ? ? ? ? ? ? 2.897 ? ? 
metalc59   metalc ?    ? A  A   532  OP1   ? ? ? 1_555 HD MG  .    MG  ? ? 0 A   532  0 MG  8086 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc60   metalc ?    ? A  U   533  OP1   ? ? ? 1_555 HD MG  .    MG  ? ? 0 U   533  0 MG  8086 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc61   metalc ?    ? A  G   544  O6    ? ? ? 1_555 NG NA  .    NA  ? ? 0 G   544  0 NA  8566 1_555 ? ? ? ? ? ? ? 2.770 ? ? 
metalc62   metalc ?    ? A  G   545  O6    ? ? ? 1_555 NG NA  .    NA  ? ? 0 G   545  0 NA  8566 1_555 ? ? ? ? ? ? ? 2.577 ? ? 
metalc63   metalc ?    ? A  G   622  O6    ? ? ? 1_555 QF NA  .    NA  ? ? 0 G   622  0 NA  8535 1_555 ? ? ? ? ? ? ? 2.964 ? ? 
metalc64   metalc ?    ? A  U   623  O4    ? ? ? 1_555 QF NA  .    NA  ? ? 0 U   623  0 NA  8535 1_555 ? ? ? ? ? ? ? 2.738 ? ? 
metalc65   metalc ?    ? A  U   623  "O2'" ? ? ? 1_555 YF NA  .    NA  ? ? 0 U   623  0 NA  8550 1_555 ? ? ? ? ? ? ? 2.790 ? ? 
metalc66   metalc ?    ? A  G   627  O6    ? ? ? 1_555 HA MG  .    MG  ? ? 0 G   627  0 MG  8002 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc67   metalc ?    ? A  A   630  "O2'" ? ? ? 1_555 PE NA  .    NA  ? ? 0 A   630  0 NA  8505 1_555 ? ? ? ? ? ? ? 2.838 ? ? 
metalc68   metalc ?    ? A  A   630  N3    ? ? ? 1_555 PE NA  .    NA  ? ? 0 A   630  0 NA  8505 1_555 ? ? ? ? ? ? ? 2.698 ? ? 
metalc69   metalc ?    ? A  A   631  "O2'" ? ? ? 1_555 PE NA  .    NA  ? ? 0 A   631  0 NA  8505 1_555 ? ? ? ? ? ? ? 2.801 ? ? 
metalc70   metalc ?    ? A  C   633  OP1   ? ? ? 1_555 XG NA  .    NA  ? ? 0 C   633  0 NA  8576 1_555 ? ? ? ? ? ? ? 2.658 ? ? 
metalc71   metalc ?    ? A  G   641  OP2   ? ? ? 1_555 EC MG  .    MG  ? ? 0 G   641  0 MG  8051 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
metalc72   metalc ?    ? A  G   681  "O3'" ? ? ? 1_555 UF NA  .    NA  ? ? 0 G   681  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.917 ? ? 
metalc73   metalc ?    ? A  A   682  OP2   ? ? ? 1_555 ID MG  .    MG  ? ? 0 A   682  0 MG  8087 1_555 ? ? ? ? ? ? ? 2.155 ? ? 
metalc74   metalc ?    ? A  G   683  OP2   ? ? ? 1_555 ID MG  .    MG  ? ? 0 G   683  0 MG  8087 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc75   metalc ?    ? A  G   683  N7    ? ? ? 1_555 UF NA  .    NA  ? ? 0 G   683  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc76   metalc ?    ? A  G   683  O6    ? ? ? 1_555 UF NA  .    NA  ? ? 0 G   683  0 NA  8541 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc77   metalc ?    ? A  A   776  "O3'" ? ? ? 1_555 GF NA  .    NA  ? ? 0 A   776  0 NA  8525 1_555 ? ? ? ? ? ? ? 2.536 ? ? 
metalc78   metalc ?    ? A  A   776  "O2'" ? ? ? 1_555 GF NA  .    NA  ? ? 0 A   776  0 NA  8525 1_555 ? ? ? ? ? ? ? 2.505 ? ? 
metalc79   metalc ?    ? A  U   777  OP2   ? ? ? 1_555 KB MG  .    MG  ? ? 0 U   777  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.056 ? ? 
metalc80   metalc ?    ? A  C   778  OP2   ? ? ? 1_555 KB MG  .    MG  ? ? 0 C   778  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.350 ? ? 
metalc81   metalc ?    ? A  U   779  O4    ? ? ? 1_555 GF NA  .    NA  ? ? 0 U   779  0 NA  8525 1_555 ? ? ? ? ? ? ? 2.497 ? ? 
metalc82   metalc ?    ? A  G   798  O6    ? ? ? 1_555 PG NA  .    NA  ? ? 0 G   798  0 NA  8568 1_555 ? ? ? ? ? ? ? 2.776 ? ? 
metalc83   metalc ?    ? A  G   814  O6    ? ? ? 1_555 PG NA  .    NA  ? ? 0 G   814  0 NA  8568 1_555 ? ? ? ? ? ? ? 2.956 ? ? 
metalc84   metalc ?    ? A  U   815  O4    ? ? ? 1_555 PG NA  .    NA  ? ? 0 U   815  0 NA  8568 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc85   metalc ?    ? A  G   816  O6    ? ? ? 1_555 WB MG  .    MG  ? ? 0 G   816  0 MG  8043 1_555 ? ? ? ? ? ? ? 2.633 ? ? 
metalc86   metalc ?    ? A  G   817  O6    ? ? ? 1_555 WB MG  .    MG  ? ? 0 G   817  0 MG  8043 1_555 ? ? ? ? ? ? ? 2.521 ? ? 
metalc87   metalc ?    ? A  G   817  O6    ? ? ? 1_555 ZD MG  .    MG  ? ? 0 G   817  0 MG  8105 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc88   metalc ?    ? A  U   821  OP2   ? ? ? 1_555 LA MG  .    MG  ? ? 0 U   821  0 MG  8006 1_555 ? ? ? ? ? ? ? 1.974 ? ? 
metalc89   metalc ?    ? A  C   822  OP2   ? ? ? 1_555 LA MG  .    MG  ? ? 0 C   822  0 MG  8006 1_555 ? ? ? ? ? ? ? 1.883 ? ? 
metalc90   metalc ?    ? A  G   824  N7    ? ? ? 1_555 QA MG  .    MG  ? ? 0 G   824  0 MG  8011 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc91   metalc ?    ? A  U   832  OP2   ? ? ? 1_555 MA MG  .    MG  ? ? 0 U   832  0 MG  8007 1_555 ? ? ? ? ? ? ? 1.888 ? ? 
metalc92   metalc ?    ? A  G   836  OP1   ? ? ? 1_555 PA MG  .    MG  ? ? 0 G   836  0 MG  8010 1_555 ? ? ? ? ? ? ? 1.978 ? ? 
metalc93   metalc ?    ? A  G   836  "O3'" ? ? ? 1_555 DF NA  .    NA  ? ? 0 G   836  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.728 ? ? 
metalc94   metalc ?    ? A  U   837  OP1   ? ? ? 1_555 DF NA  .    NA  ? ? 0 U   837  0 NA  8521 1_555 ? ? ? ? ? ? ? 2.902 ? ? 
metalc95   metalc ?    ? A  A   844  OP1   ? ? ? 1_555 UA MG  .    MG  ? ? 0 A   844  0 MG  8015 1_555 ? ? ? ? ? ? ? 1.889 ? ? 
metalc96   metalc ?    ? A  C   853  "O3'" ? ? ? 1_555 IF NA  .    NA  ? ? 0 C   853  0 NA  8527 1_555 ? ? ? ? ? ? ? 2.946 ? ? 
metalc97   metalc ?    ? A  G   854  OP1   ? ? ? 1_555 LA MG  .    MG  ? ? 0 G   854  0 MG  8006 1_555 ? ? ? ? ? ? ? 2.076 ? ? 
metalc98   metalc ?    ? A  G   854  N7    ? ? ? 1_555 QA MG  .    MG  ? ? 0 G   854  0 MG  8011 1_555 ? ? ? ? ? ? ? 2.124 ? ? 
metalc99   metalc ?    ? A  G   854  OP1   ? ? ? 1_555 IF NA  .    NA  ? ? 0 G   854  0 NA  8527 1_555 ? ? ? ? ? ? ? 2.729 ? ? 
metalc100  metalc ?    ? A  G   863  O6    ? ? ? 1_555 RD MG  .    MG  ? ? 0 G   863  0 MG  8097 1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc101  metalc ?    ? A  U   864  O4    ? ? ? 1_555 RD MG  .    MG  ? ? 0 U   864  0 MG  8097 1_555 ? ? ? ? ? ? ? 2.567 ? ? 
metalc102  metalc ?    ? A  A   876  OP2   ? ? ? 1_555 IA MG  .    MG  ? ? 0 A   876  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.244 ? ? 
metalc103  metalc ?    ? A  G   877  OP2   ? ? ? 1_555 IA MG  .    MG  ? ? 0 G   877  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.025 ? ? 
metalc104  metalc ?    ? A  G   877  OP1   ? ? ? 1_555 SA MG  .    MG  ? ? 0 G   877  0 MG  8013 1_555 ? ? ? ? ? ? ? 1.921 ? ? 
metalc105  metalc ?    ? A  C   880  OP1   ? ? ? 1_555 ZC MG  .    MG  ? ? 0 C   880  0 MG  8077 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc106  metalc ?    ? A  U   883  OP2   ? ? ? 1_555 ZC MG  .    MG  ? ? 0 U   883  0 MG  8077 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc107  metalc ?    ? A  G   887  OP2   ? ? ? 1_555 WG NA  .    NA  ? ? 0 G   887  0 NA  8575 1_555 ? ? ? ? ? ? ? 2.914 ? ? 
metalc108  metalc ?    ? A  G   892  N7    ? ? ? 1_555 VF NA  .    NA  ? ? 0 G   892  0 NA  8542 1_555 ? ? ? ? ? ? ? 2.921 ? ? 
metalc109  metalc ?    ? A  C   896  "O2'" ? ? ? 1_555 YE NA  .    NA  ? ? 0 C   896  0 NA  8516 1_555 ? ? ? ? ? ? ? 2.912 ? ? 
metalc110  metalc ?    ? A  C   896  O2    ? ? ? 1_555 YE NA  .    NA  ? ? 0 C   896  0 NA  8516 1_555 ? ? ? ? ? ? ? 2.698 ? ? 
metalc111  metalc ?    ? A  A   897  "O4'" ? ? ? 1_555 YE NA  .    NA  ? ? 0 A   897  0 NA  8516 1_555 ? ? ? ? ? ? ? 2.959 ? ? 
metalc112  metalc ?    ? A  G   901  OP1   ? ? ? 1_555 YF NA  .    NA  ? ? 0 G   901  0 NA  8550 1_555 ? ? ? ? ? ? ? 2.780 ? ? 
metalc113  metalc ?    ? A  G   902  O6    ? ? ? 1_555 ZG NA  .    NA  ? ? 0 G   902  0 NA  8578 1_555 ? ? ? ? ? ? ? 2.826 ? ? 
metalc114  metalc ?    ? A  U   903  OP1   ? ? ? 1_555 CE MG  .    MG  ? ? 0 U   903  0 MG  8109 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc115  metalc ?    ? A  U   903  O4    ? ? ? 1_555 ZG NA  .    NA  ? ? 0 U   903  0 NA  8578 1_555 ? ? ? ? ? ? ? 2.883 ? ? 
metalc116  metalc ?    ? A  A   907  "O2'" ? ? ? 1_555 YC MG  .    MG  ? ? 0 A   907  0 MG  8075 1_555 ? ? ? ? ? ? ? 2.543 ? ? 
metalc117  metalc ?    ? A  A   907  N7    ? ? ? 1_555 SD MG  .    MG  ? ? 0 A   907  0 MG  8098 1_555 ? ? ? ? ? ? ? 2.702 ? ? 
metalc118  metalc ?    ? A  A   908  "O4'" ? ? ? 1_555 YC MG  .    MG  ? ? 0 A   908  0 MG  8075 1_555 ? ? ? ? ? ? ? 2.399 ? ? 
metalc119  metalc ?    ? A  A   914  "O3'" ? ? ? 1_555 XF NA  .    NA  ? ? 0 A   914  0 NA  8549 1_555 ? ? ? ? ? ? ? 2.571 ? ? 
metalc120  metalc ?    ? A  A   914  "O2'" ? ? ? 1_555 XF NA  .    NA  ? ? 0 A   914  0 NA  8549 1_555 ? ? ? ? ? ? ? 2.928 ? ? 
metalc121  metalc ?    ? A  C   915  OP2   ? ? ? 1_555 XF NA  .    NA  ? ? 0 C   915  0 NA  8549 1_555 ? ? ? ? ? ? ? 2.887 ? ? 
metalc122  metalc ?    ? A  G   918  OP1   ? ? ? 1_555 MD MG  .    MG  ? ? 0 G   918  0 MG  8091 1_555 ? ? ? ? ? ? ? 2.122 ? ? 
metalc123  metalc ?    ? A  U   919  OP1   ? ? ? 1_555 NA MG  .    MG  ? ? 0 U   919  0 MG  8008 1_555 ? ? ? ? ? ? ? 1.868 ? ? 
metalc124  metalc ?    ? A  C   920  N3    ? ? ? 1_555 DG NA  .    NA  ? ? 0 C   920  0 NA  8556 1_555 ? ? ? ? ? ? ? 2.877 ? ? 
metalc125  metalc ?    ? A  A   922  OP1   ? ? ? 1_555 GG NA  .    NA  ? ? 0 A   922  0 NA  8559 1_555 ? ? ? ? ? ? ? 2.706 ? ? 
metalc126  metalc ?    ? A  G   941  O6    ? ? ? 1_555 EG NA  .    NA  ? ? 0 G   941  0 NA  8557 1_555 ? ? ? ? ? ? ? 2.716 ? ? 
metalc127  metalc ?    ? A  U   942  O4    ? ? ? 1_555 EG NA  .    NA  ? ? 0 U   942  0 NA  8557 1_555 ? ? ? ? ? ? ? 2.505 ? ? 
metalc128  metalc ?    ? A  U   954  OP1   ? ? ? 1_555 WC MG  .    MG  ? ? 0 U   954  0 MG  8072 1_555 ? ? ? ? ? ? ? 2.635 ? ? 
metalc129  metalc ?    ? A  A   955  "O2'" ? ? ? 1_555 ZF NA  .    NA  ? ? 0 A   955  0 NA  8552 1_555 ? ? ? ? ? ? ? 2.880 ? ? 
metalc130  metalc ?    ? A  G   956  OP2   ? ? ? 1_555 PB MG  .    MG  ? ? 0 G   956  0 MG  8036 1_555 ? ? ? ? ? ? ? 1.861 ? ? 
metalc131  metalc ?    ? A  G   1024 O6    ? ? ? 1_555 EG NA  .    NA  ? ? 0 G   1024 0 NA  8557 1_555 ? ? ? ? ? ? ? 2.569 ? ? 
metalc132  metalc ?    ? A  A   1040 "O2'" ? ? ? 1_555 AG NA  .    NA  ? ? 0 A   1040 0 NA  8553 1_555 ? ? ? ? ? ? ? 2.862 ? ? 
metalc133  metalc ?    ? A  G   1045 OP2   ? ? ? 1_555 XF NA  .    NA  ? ? 0 G   1045 0 NA  8549 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc134  metalc ?    ? A  C   1069 OP2   ? ? ? 1_555 ME NA  .    NA  ? ? 0 C   1069 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.251 ? ? 
metalc135  metalc ?    ? A  A   1070 "O2'" ? ? ? 1_555 OD MG  .    MG  ? ? 0 A   1070 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.798 ? ? 
metalc136  metalc ?    ? A  G   1071 OP1   ? ? ? 1_555 OD MG  .    MG  ? ? 0 G   1071 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc137  metalc ?    ? A  G   1072 N7    ? ? ? 1_555 ME NA  .    NA  ? ? 0 G   1072 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.447 ? ? 
metalc138  metalc ?    ? A  G   1077 N7    ? ? ? 1_555 EH NA  .    NA  ? ? 0 G   1077 0 NA  8585 1_555 ? ? ? ? ? ? ? 2.679 ? ? 
metalc139  metalc ?    ? A  A   1079 OP1   ? ? ? 1_555 EH NA  .    NA  ? ? 0 A   1079 0 NA  8585 1_555 ? ? ? ? ? ? ? 2.609 ? ? 
metalc140  metalc ?    ? A  U   1096 OP2   ? ? ? 1_555 PD MG  .    MG  ? ? 0 U   1096 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.170 ? ? 
metalc141  metalc ?    ? A  A   1098 OP2   ? ? ? 1_555 AC MG  .    MG  ? ? 0 A   1098 0 MG  8047 1_555 ? ? ? ? ? ? ? 2.206 ? ? 
metalc142  metalc ?    ? A  A   1106 "O5'" ? ? ? 1_555 AE MG  .    MG  ? ? 0 A   1106 0 MG  8106 1_555 ? ? ? ? ? ? ? 3.121 ? ? 
metalc143  metalc ?    ? A  A   1106 OP2   ? ? ? 1_555 AE MG  .    MG  ? ? 0 A   1106 0 MG  8106 1_555 ? ? ? ? ? ? ? 2.231 ? ? 
metalc144  metalc ?    ? A  A   1107 OP2   ? ? ? 1_555 AE MG  .    MG  ? ? 0 A   1107 0 MG  8106 1_555 ? ? ? ? ? ? ? 1.872 ? ? 
metalc145  metalc ?    ? A  G   1119 "O2'" ? ? ? 1_555 NE NA  .    NA  ? ? 0 G   1119 0 NA  8502 1_555 ? ? ? ? ? ? ? 2.613 ? ? 
metalc146  metalc ?    ? A  U   1120 OP2   ? ? ? 1_555 EB MG  .    MG  ? ? 0 U   1120 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc147  metalc ?    ? A  G   1121 OP2   ? ? ? 1_555 EB MG  .    MG  ? ? 0 G   1121 0 MG  8025 1_555 ? ? ? ? ? ? ? 1.928 ? ? 
metalc148  metalc ?    ? A  G   1121 O6    ? ? ? 1_555 NE NA  .    NA  ? ? 0 G   1121 0 NA  8502 1_555 ? ? ? ? ? ? ? 2.913 ? ? 
metalc149  metalc ?    ? A  U   1125 OP1   ? ? ? 1_555 FC MG  .    MG  ? ? 0 U   1125 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.172 ? ? 
metalc150  metalc ?    ? A  A   1133 "O3'" ? ? ? 1_555 YH NA  .    NA  ? ? 0 A   1133 H NA  8509 1_555 ? ? ? ? ? ? ? 2.781 ? ? 
metalc151  metalc ?    ? A  G   1134 OP1   ? ? ? 1_555 YH NA  .    NA  ? ? 0 G   1134 H NA  8509 1_555 ? ? ? ? ? ? ? 2.983 ? ? 
metalc152  metalc ?    ? A  C   1243 OP2   ? ? ? 1_555 CG NA  .    NA  ? ? 0 C   1243 0 NA  8555 1_555 ? ? ? ? ? ? ? 2.995 ? ? 
metalc153  metalc ?    ? A  C   1257 OP2   ? ? ? 1_555 PD MG  .    MG  ? ? 0 C   1257 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc154  metalc ?    ? A  A   1286 OP1   ? ? ? 1_555 XC MG  .    MG  ? ? 0 A   1286 0 MG  8074 1_555 ? ? ? ? ? ? ? 1.877 ? ? 
metalc155  metalc ?    ? A  A   1287 OP1   ? ? ? 1_555 XC MG  .    MG  ? ? 0 A   1287 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc156  metalc ?    ? A  A   1291 OP1   ? ? ? 1_555 XA MG  .    MG  ? ? 0 A   1291 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc157  metalc ?    ? A  G   1292 OP2   ? ? ? 1_555 XA MG  .    MG  ? ? 0 G   1292 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc158  metalc ?    ? A  U   1293 OP2   ? ? ? 1_555 YG NA  .    NA  ? ? 0 U   1293 0 NA  8577 1_555 ? ? ? ? ? ? ? 2.534 ? ? 
metalc159  metalc ?    ? A  G   1295 O6    ? ? ? 1_555 YG NA  .    NA  ? ? 0 G   1295 0 NA  8577 1_555 ? ? ? ? ? ? ? 2.906 ? ? 
metalc160  metalc ?    ? A  A   1296 OP1   ? ? ? 1_555 AG NA  .    NA  ? ? 0 A   1296 0 NA  8553 1_555 ? ? ? ? ? ? ? 2.651 ? ? 
metalc161  metalc ?    ? A  U   1309 O2    ? ? ? 1_555 VB MG  .    MG  ? ? 0 U   1309 0 MG  8042 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc162  metalc ?    ? A  U   1346 O2    ? ? ? 1_555 VB MG  .    MG  ? ? 0 U   1346 0 MG  8042 1_555 ? ? ? ? ? ? ? 2.519 ? ? 
metalc163  metalc ?    ? A  G   1354 OP1   ? ? ? 1_555 OE NA  .    NA  ? ? 0 G   1354 0 NA  8503 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc164  metalc ?    ? A  A   1357 N7    ? ? ? 1_555 CE MG  .    MG  ? ? 0 A   1357 0 MG  8109 1_555 ? ? ? ? ? ? ? 2.443 ? ? 
metalc165  metalc ?    ? A  C   1360 OP1   ? ? ? 1_555 KG NA  .    NA  ? ? 0 C   1360 0 NA  8563 1_555 ? ? ? ? ? ? ? 2.603 ? ? 
metalc166  metalc ?    ? A  A   1369 OP2   ? ? ? 1_555 NC MG  .    MG  ? ? 0 A   1369 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc167  metalc ?    ? A  A   1381 N7    ? ? ? 1_555 DB MG  .    MG  ? ? 0 A   1381 0 MG  8024 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc168  metalc ?    ? A  C   1394 O2    ? ? ? 1_555 SE NA  .    NA  ? ? 0 C   1394 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc169  metalc ?    ? A  G   1416 "O3'" ? ? ? 1_555 ZE NA  .    NA  ? ? 0 G   1416 0 NA  8517 1_555 ? ? ? ? ? ? ? 2.615 ? ? 
metalc170  metalc ?    ? A  G   1417 OP1   ? ? ? 1_555 ZE NA  .    NA  ? ? 0 G   1417 0 NA  8517 1_555 ? ? ? ? ? ? ? 2.808 ? ? 
metalc171  metalc ?    ? A  C   1420 OP1   ? ? ? 1_555 CD MG  .    MG  ? ? 0 C   1420 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc172  metalc ?    ? A  C   1421 OP2   ? ? ? 1_555 CD MG  .    MG  ? ? 0 C   1421 0 MG  8081 1_555 ? ? ? ? ? ? ? 1.959 ? ? 
metalc173  metalc ?    ? A  U   1432 O4    ? ? ? 1_555 SE NA  .    NA  ? ? 0 U   1432 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc174  metalc ?    ? A  A   1437 OP2   ? ? ? 1_555 DD MG  .    MG  ? ? 0 A   1437 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.902 ? ? 
metalc175  metalc ?    ? A  G   1438 OP1   ? ? ? 1_555 CD MG  .    MG  ? ? 0 G   1438 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.197 ? ? 
metalc176  metalc ?    ? A  A   1448 OP2   ? ? ? 1_555 HB MG  .    MG  ? ? 0 A   1448 0 MG  8028 1_555 ? ? ? ? ? ? ? 1.999 ? ? 
metalc177  metalc ?    ? A  G   1484 OP2   ? ? ? 1_555 OB MG  .    MG  ? ? 0 G   1484 0 MG  8035 1_555 ? ? ? ? ? ? ? 1.943 ? ? 
metalc178  metalc ?    ? A  G   1489 OP2   ? ? ? 1_555 OC MG  .    MG  ? ? 0 G   1489 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.462 ? ? 
metalc179  metalc ?    ? A  G   1491 O6    ? ? ? 1_555 OC MG  .    MG  ? ? 0 G   1491 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc180  metalc ?    ? A  U   1503 OP1   ? ? ? 1_555 IB MG  .    MG  ? ? 0 U   1503 0 MG  8029 1_555 ? ? ? ? ? ? ? 1.905 ? ? 
metalc181  metalc ?    ? A  A   1504 OP1   ? ? ? 1_555 VA MG  .    MG  ? ? 0 A   1504 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.243 ? ? 
metalc182  metalc ?    ? A  G   1576 O6    ? ? ? 1_555 UG NA  .    NA  ? ? 0 G   1576 0 NA  8573 1_555 ? ? ? ? ? ? ? 2.896 ? ? 
metalc183  metalc ?    ? A  G   1619 O6    ? ? ? 1_555 UG NA  .    NA  ? ? 0 G   1619 0 NA  8573 1_555 ? ? ? ? ? ? ? 2.651 ? ? 
metalc184  metalc ?    ? A  U   1677 O4    ? ? ? 1_555 HB MG  .    MG  ? ? 0 U   1677 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc185  metalc ?    ? A  A   1678 OP1   ? ? ? 1_555 VA MG  .    MG  ? ? 0 A   1678 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.205 ? ? 
metalc186  metalc ?    ? A  C   1679 OP2   ? ? ? 1_555 VA MG  .    MG  ? ? 0 C   1679 0 MG  8016 1_555 ? ? ? ? ? ? ? 1.910 ? ? 
metalc187  metalc ?    ? A  C   1679 OP1   ? ? ? 1_555 IB MG  .    MG  ? ? 0 C   1679 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc188  metalc ?    ? A  A   1684 OP2   ? ? ? 1_555 BD MG  .    MG  ? ? 0 A   1684 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.172 ? ? 
metalc189  metalc ?    ? A  A   1689 OP1   ? ? ? 1_555 UA MG  .    MG  ? ? 0 A   1689 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.140 ? ? 
metalc190  metalc ?    ? A  G   1706 O6    ? ? ? 1_555 RF NA  .    NA  ? ? 0 G   1706 0 NA  8536 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc191  metalc ?    ? A  G   1707 O6    ? ? ? 1_555 RF NA  .    NA  ? ? 0 G   1707 0 NA  8536 1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc192  metalc ?    ? A  U   1724 OP2   ? ? ? 1_555 BD MG  .    MG  ? ? 0 U   1724 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc193  metalc ?    ? A  U   1724 O2    ? ? ? 1_555 SE NA  .    NA  ? ? 0 U   1724 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.186 ? ? 
metalc194  metalc ?    ? A  A   1736 OP1   ? ? ? 1_555 DF NA  .    NA  ? ? 0 A   1736 0 NA  8521 1_555 ? ? ? ? ? ? ? 2.955 ? ? 
metalc195  metalc ?    ? A  U   1740 O4    ? ? ? 1_555 TF NA  .    NA  ? ? 0 U   1740 0 NA  8540 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc196  metalc ?    ? A  U   1741 O4    ? ? ? 1_555 TF NA  .    NA  ? ? 0 U   1741 0 NA  8540 1_555 ? ? ? ? ? ? ? 2.939 ? ? 
metalc197  metalc ?    ? A  A   1742 OP2   ? ? ? 1_555 FD MG  .    MG  ? ? 0 A   1742 0 MG  8084 1_555 ? ? ? ? ? ? ? 2.079 ? ? 
metalc198  metalc ?    ? A  A   1747 OP2   ? ? ? 1_555 MB MG  .    MG  ? ? 0 A   1747 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.061 ? ? 
metalc199  metalc ?    ? A  U   1748 OP1   ? ? ? 1_555 JB MG  .    MG  ? ? 0 U   1748 0 MG  8030 1_555 ? ? ? ? ? ? ? 1.978 ? ? 
metalc200  metalc ?    ? A  U   1748 OP2   ? ? ? 1_555 MB MG  .    MG  ? ? 0 U   1748 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.101 ? ? 
metalc201  metalc ?    ? A  U   1749 OP2   ? ? ? 1_555 JB MG  .    MG  ? ? 0 U   1749 0 MG  8030 1_555 ? ? ? ? ? ? ? 1.965 ? ? 
metalc202  metalc ?    ? A  U   1749 O4    ? ? ? 1_555 MB MG  .    MG  ? ? 0 U   1749 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.119 ? ? 
metalc203  metalc ?    ? A  A   1754 OP2   ? ? ? 1_555 ED MG  .    MG  ? ? 0 A   1754 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc204  metalc ?    ? A  G   1794 N7    ? ? ? 1_555 ZB MG  .    MG  ? ? 0 G   1794 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.695 ? ? 
metalc205  metalc ?    ? A  C   1830 OP1   ? ? ? 1_555 ZA MG  .    MG  ? ? 0 C   1830 0 MG  8020 1_555 ? ? ? ? ? ? ? 1.920 ? ? 
metalc206  metalc ?    ? A  U   1831 "O2'" ? ? ? 1_555 IF NA  .    NA  ? ? 0 U   1831 0 NA  8527 1_555 ? ? ? ? ? ? ? 2.722 ? ? 
metalc207  metalc ?    ? A  G   1832 OP2   ? ? ? 1_555 RG NA  .    NA  ? ? 0 G   1832 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.653 ? ? 
metalc208  metalc ?    ? A  A   1836 OP1   ? ? ? 1_555 KA MG  .    MG  ? ? 0 A   1836 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.094 ? ? 
metalc209  metalc ?    ? A  U   1838 OP1   ? ? ? 1_555 KA MG  .    MG  ? ? 0 U   1838 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc210  metalc ?    ? A  A   1839 OP2   ? ? ? 1_555 KA MG  .    MG  ? ? 0 A   1839 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.959 ? ? 
metalc211  metalc ?    ? A  A   1839 OP1   ? ? ? 1_555 MA MG  .    MG  ? ? 0 A   1839 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.093 ? ? 
metalc212  metalc ?    ? A  A   1840 OP2   ? ? ? 1_555 MA MG  .    MG  ? ? 0 A   1840 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.090 ? ? 
metalc213  metalc ?    ? A  A   1840 "O2'" ? ? ? 1_555 JE MG  .    MG  ? ? 0 A   1840 0 MG  8116 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc214  metalc ?    ? A  A   1840 "O3'" ? ? ? 1_555 JE MG  .    MG  ? ? 0 A   1840 0 MG  8116 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc215  metalc ?    ? A  C   1841 OP2   ? ? ? 1_555 JE MG  .    MG  ? ? 0 C   1841 0 MG  8116 1_555 ? ? ? ? ? ? ? 2.968 ? ? 
metalc216  metalc ?    ? A  C   1844 OP2   ? ? ? 1_555 ND MG  .    MG  ? ? 0 C   1844 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc217  metalc ?    ? A  A   1845 OP1   ? ? ? 1_555 SC MG  .    MG  ? ? 0 A   1845 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.587 ? ? 
metalc218  metalc ?    ? A  U   1846 OP2   ? ? ? 1_555 SC MG  .    MG  ? ? 0 U   1846 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc219  metalc ?    ? A  G   1848 O6    ? ? ? 1_555 QD MG  .    MG  ? ? 0 G   1848 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc220  metalc ?    ? A  G   1849 O6    ? ? ? 1_555 QD MG  .    MG  ? ? 0 G   1849 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.272 ? ? 
metalc221  metalc ?    ? A  U   1850 O4    ? ? ? 1_555 IE MG  .    MG  ? ? 0 U   1850 0 MG  8115 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc222  metalc ?    ? A  C   1872 "O4'" ? ? ? 1_555 RC MG  .    MG  ? ? 0 C   1872 0 MG  8066 1_555 ? ? ? ? ? ? ? 3.088 ? ? 
metalc223  metalc ?    ? A  C   1872 "O3'" ? ? ? 1_555 RC MG  .    MG  ? ? 0 C   1872 0 MG  8066 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
metalc224  metalc ?    ? A  G   1873 OP2   ? ? ? 1_555 RC MG  .    MG  ? ? 0 G   1873 0 MG  8066 1_555 ? ? ? ? ? ? ? 1.872 ? ? 
metalc225  metalc ?    ? A  U   1883 OP1   ? ? ? 1_555 JC MG  .    MG  ? ? 0 U   1883 0 MG  8057 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc226  metalc ?    ? A  G   1884 O6    ? ? ? 1_555 SC MG  .    MG  ? ? 0 G   1884 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.125 ? ? 
metalc227  metalc ?    ? A  C   1894 O2    ? ? ? 1_555 OF NA  .    NA  ? ? 0 C   1894 0 NA  8533 1_555 ? ? ? ? ? ? ? 2.581 ? ? 
metalc228  metalc ?    ? A  C   1894 O2    ? ? ? 1_555 PF NA  .    NA  ? ? 0 C   1894 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.736 ? ? 
metalc229  metalc ?    ? A  G   1896 N7    ? ? ? 1_555 PF NA  .    NA  ? ? 0 G   1896 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.898 ? ? 
metalc230  metalc ?    ? A  G   1896 O6    ? ? ? 1_555 PF NA  .    NA  ? ? 0 G   1896 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.743 ? ? 
metalc231  metalc ?    ? A  U   1897 O4    ? ? ? 1_555 OF NA  .    NA  ? ? 0 U   1897 0 NA  8533 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc232  metalc ?    ? A  G   1898 O6    ? ? ? 1_555 OF NA  .    NA  ? ? 0 G   1898 0 NA  8533 1_555 ? ? ? ? ? ? ? 2.676 ? ? 
metalc233  metalc ?    ? A  U   1939 O4    ? ? ? 1_555 OF NA  .    NA  ? ? 0 U   1939 0 NA  8533 1_555 ? ? ? ? ? ? ? 2.889 ? ? 
metalc234  metalc ?    ? A  G   1979 OP2   ? ? ? 1_555 YB MG  .    MG  ? ? 0 G   1979 0 MG  8045 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc235  metalc ?    ? A  A   2010 OP2   ? ? ? 1_555 HF NA  .    NA  ? ? 0 A   2010 0 NA  8526 1_555 ? ? ? ? ? ? ? 2.855 ? ? 
metalc236  metalc ?    ? A  A   2011 OP1   ? ? ? 1_555 YA MG  .    MG  ? ? 0 A   2011 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.708 ? ? 
metalc237  metalc ?    ? A  A   2011 OP2   ? ? ? 1_555 YA MG  .    MG  ? ? 0 A   2011 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.374 ? ? 
metalc238  metalc ?    ? A  U   2012 "O2'" ? ? ? 1_555 JC MG  .    MG  ? ? 0 U   2012 0 MG  8057 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc239  metalc ?    ? A  U   2012 "O3'" ? ? ? 1_555 JC MG  .    MG  ? ? 0 U   2012 0 MG  8057 1_555 ? ? ? ? ? ? ? 3.064 ? ? 
metalc240  metalc ?    ? A  U   2012 O4    ? ? ? 1_555 HF NA  .    NA  ? ? 0 U   2012 0 NA  8526 1_555 ? ? ? ? ? ? ? 2.479 ? ? 
metalc241  metalc ?    ? A  G   2013 OP2   ? ? ? 1_555 JC MG  .    MG  ? ? 0 G   2013 0 MG  8057 1_555 ? ? ? ? ? ? ? 3.096 ? ? 
metalc242  metalc ?    ? A  G   2013 OP2   ? ? ? 1_555 KC MG  .    MG  ? ? 0 G   2013 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.083 ? ? 
metalc243  metalc ?    ? A  A   2022 N7    ? ? ? 1_555 JE MG  .    MG  ? ? 0 A   2022 0 MG  8116 1_555 ? ? ? ? ? ? ? 2.497 ? ? 
metalc244  metalc ?    ? A  C   2048 OP1   ? ? ? 1_555 XB MG  .    MG  ? ? 0 C   2048 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc245  metalc ?    ? A  G   2058 O6    ? ? ? 1_555 LG NA  .    NA  ? ? 0 G   2058 0 NA  8564 1_555 ? ? ? ? ? ? ? 2.706 ? ? 
metalc246  metalc ?    ? A  A   2089 OP1   ? ? ? 1_555 XB MG  .    MG  ? ? 0 A   2089 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc247  metalc ?    ? A  G   2094 N7    ? ? ? 1_555 QE NA  .    NA  ? ? 0 G   2094 0 NA  8506 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc248  metalc ?    ? A  G   2097 OP2   ? ? ? 1_555 BB MG  .    MG  ? ? 0 G   2097 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
metalc249  metalc ?    ? A  G   2102 OP2   ? ? ? 1_555 TA MG  .    MG  ? ? 0 G   2102 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc250  metalc ?    ? A  G   2102 "O5'" ? ? ? 1_555 TA MG  .    MG  ? ? 0 G   2102 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.921 ? ? 
metalc251  metalc ?    ? A  G   2102 N7    ? ? ? 1_555 KE K   .    K   ? ? 0 G   2102 0 K   8401 1_555 ? ? ? ? ? ? ? 3.577 ? ? 
metalc252  metalc ?    ? A  G   2102 O6    ? ? ? 1_555 KE K   .    K   ? ? 0 G   2102 0 K   8401 1_555 ? ? ? ? ? ? ? 2.761 ? ? 
metalc253  metalc ?    ? A  A   2103 OP1   ? ? ? 1_555 LD MG  .    MG  ? ? 0 A   2103 0 MG  8090 1_555 ? ? ? ? ? ? ? 2.941 ? ? 
metalc254  metalc ?    ? A  A   2103 OP2   ? ? ? 1_555 LD MG  .    MG  ? ? 0 A   2103 0 MG  8090 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc255  metalc ?    ? A  C   2104 OP1   ? ? ? 1_555 YD MG  .    MG  ? ? 0 C   2104 0 MG  8104 1_555 ? ? ? ? ? ? ? 2.518 ? ? 
metalc256  metalc ?    ? A  C   2105 OP2   ? ? ? 1_555 YD MG  .    MG  ? ? 0 C   2105 0 MG  8104 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc257  metalc ?    ? A  U   2109 OP2   ? ? ? 1_555 GG NA  .    NA  ? ? 0 U   2109 0 NA  8559 1_555 ? ? ? ? ? ? ? 2.671 ? ? 
metalc258  metalc ?    ? A  G   2110 OP2   ? ? ? 1_555 JG NA  .    NA  ? ? 0 G   2110 0 NA  8562 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc259  metalc ?    ? A  A   2112 N7    ? ? ? 1_555 FE MG  .    MG  ? ? 0 A   2112 0 MG  8112 1_555 ? ? ? ? ? ? ? 2.590 ? ? 
metalc260  metalc ?    ? A  A   2112 N3    ? ? ? 1_555 EF NA  .    NA  ? ? 0 A   2112 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.729 ? ? 
metalc261  metalc ?    ? A  U   2115 OP1   ? ? ? 1_555 LB MG  .    MG  ? ? 0 U   2115 0 MG  8032 1_555 ? ? ? ? ? ? ? 1.882 ? ? 
metalc262  metalc ?    ? A  C   2248 OP1   ? ? ? 1_555 DC MG  .    MG  ? ? 0 C   2248 0 MG  8050 1_555 ? ? ? ? ? ? ? 3.094 ? ? 
metalc263  metalc ?    ? A  C   2248 OP2   ? ? ? 1_555 DC MG  .    MG  ? ? 0 C   2248 0 MG  8050 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc264  metalc ?    ? A  U   2276 OP1   ? ? ? 1_555 HC MG  .    MG  ? ? 0 U   2276 0 MG  8054 1_555 ? ? ? ? ? ? ? 2.099 ? ? 
metalc265  metalc ?    ? A  U   2277 O4    ? ? ? 1_555 QC MG  .    MG  ? ? 0 U   2277 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.832 ? ? 
metalc266  metalc ?    ? A  U   2277 OP1   ? ? ? 1_555 JG NA  .    NA  ? ? 0 U   2277 0 NA  8562 1_555 ? ? ? ? ? ? ? 2.837 ? ? 
metalc267  metalc ?    ? A  U   2278 O4    ? ? ? 1_555 QC MG  .    MG  ? ? 0 U   2278 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.710 ? ? 
metalc268  metalc ?    ? A  U   2278 OP1   ? ? ? 1_555 DG NA  .    NA  ? ? 0 U   2278 0 NA  8556 1_555 ? ? ? ? ? ? ? 2.783 ? ? 
metalc269  metalc ?    ? A  C   2281 OP2   ? ? ? 1_555 VD MG  .    MG  ? ? 0 C   2281 0 MG  8101 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc270  metalc ?    ? A  U   2282 O4    ? ? ? 1_555 VD MG  .    MG  ? ? 0 U   2282 0 MG  8101 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc271  metalc ?    ? A  A   2302 OP1   ? ? ? 1_555 NB MG  .    MG  ? ? 0 A   2302 0 MG  8034 1_555 ? ? ? ? ? ? ? 1.947 ? ? 
metalc272  metalc ?    ? A  A   2303 OP1   ? ? ? 1_555 NB MG  .    MG  ? ? 0 A   2303 0 MG  8034 1_555 ? ? ? ? ? ? ? 1.958 ? ? 
metalc273  metalc ?    ? A  G   2304 OP2   ? ? ? 1_555 AB MG  .    MG  ? ? 0 G   2304 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc274  metalc ?    ? A  G   2399 O6    ? ? ? 1_555 VE NA  .    NA  ? ? 0 G   2399 0 NA  8513 1_555 ? ? ? ? ? ? ? 2.478 ? ? 
metalc275  metalc ?    ? A  G   2421 OP1   ? ? ? 1_555 CC MG  .    MG  ? ? 0 G   2421 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.218 ? ? 
metalc276  metalc ?    ? A  C   2423 OP1   ? ? ? 1_555 CC MG  .    MG  ? ? 0 C   2423 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.993 ? ? 
metalc277  metalc ?    ? A  A   2430 N1    ? ? ? 1_555 GE MG  .    MG  ? ? 0 A   2430 0 MG  8113 1_555 ? ? ? ? ? ? ? 2.707 ? ? 
metalc278  metalc ?    ? A  A   2434 N3    ? ? ? 1_555 WD MG  .    MG  ? ? 0 A   2434 0 MG  8102 1_555 ? ? ? ? ? ? ? 2.513 ? ? 
metalc279  metalc ?    ? A  U   2458 O2    ? ? ? 1_555 WD MG  .    MG  ? ? 0 U   2458 0 MG  8102 1_555 ? ? ? ? ? ? ? 2.764 ? ? 
metalc280  metalc ?    ? A  C   2464 OP1   ? ? ? 1_555 NA MG  .    MG  ? ? 0 C   2464 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc281  metalc ?    ? A  A   2465 OP1   ? ? ? 1_555 NA MG  .    MG  ? ? 0 A   2465 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc282  metalc ?    ? A  A   2465 "O3'" ? ? ? 1_555 BF NA  .    NA  ? ? 0 A   2465 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.977 ? ? 
metalc283  metalc ?    ? A  G   2466 OP2   ? ? ? 1_555 BF NA  .    NA  ? ? 0 G   2466 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc284  metalc ?    ? A  G   2471 O6    ? ? ? 1_555 QC MG  .    MG  ? ? 0 G   2471 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.865 ? ? 
metalc285  metalc ?    ? A  C   2475 N4    ? ? ? 1_555 EF NA  .    NA  ? ? 0 C   2475 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc286  metalc ?    ? A  G   2482 O6    ? ? ? 1_555 KE K   .    K   ? ? 0 G   2482 0 K   8401 1_555 ? ? ? ? ? ? ? 2.765 ? ? 
metalc287  metalc ?    ? A  G   2482 N7    ? ? ? 1_555 KE K   .    K   ? ? 0 G   2482 0 K   8401 1_555 ? ? ? ? ? ? ? 2.924 ? ? 
metalc288  metalc ?    ? A  A   2483 OP2   ? ? ? 1_555 GA MG  .    MG  ? ? 0 A   2483 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.158 ? ? 
metalc289  metalc ?    ? A  A   2483 OP1   ? ? ? 1_555 HA MG  .    MG  ? ? 0 A   2483 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.957 ? ? 
metalc290  metalc ?    ? A  U   2492 O4    ? ? ? 1_555 SG NA  .    NA  ? ? 0 U   2492 0 NA  8571 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc291  metalc ?    ? A  G   2524 N7    ? ? ? 1_555 UE NA  .    NA  ? ? 0 G   2524 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.765 ? ? 
metalc292  metalc ?    ? A  G   2525 O6    ? ? ? 1_555 UE NA  .    NA  ? ? 0 G   2525 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc293  metalc ?    ? A  G   2529 O6    ? ? ? 1_555 SG NA  .    NA  ? ? 0 G   2529 0 NA  8571 1_555 ? ? ? ? ? ? ? 2.531 ? ? 
metalc294  metalc ?    ? A  C   2533 OP2   ? ? ? 1_555 GA MG  .    MG  ? ? 0 C   2533 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.057 ? ? 
metalc295  metalc ?    ? A  C   2534 OP2   ? ? ? 1_555 GA MG  .    MG  ? ? 0 C   2534 0 MG  8001 1_555 ? ? ? ? ? ? ? 1.985 ? ? 
metalc296  metalc ?    ? A  C   2534 OP1   ? ? ? 1_555 HA MG  .    MG  ? ? 0 C   2534 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc297  metalc ?    ? A  C   2536 O2    ? ? ? 1_555 KE K   .    K   ? ? 0 C   2536 0 K   8401 1_555 ? ? ? ? ? ? ? 3.139 ? ? 
metalc298  metalc ?    ? A  C   2536 "O4'" ? ? ? 1_555 KE K   .    K   ? ? 0 C   2536 0 K   8401 1_555 ? ? ? ? ? ? ? 3.324 ? ? 
metalc299  metalc ?    ? A  G   2537 OP2   ? ? ? 1_555 TA MG  .    MG  ? ? 0 G   2537 0 MG  8014 1_555 ? ? ? ? ? ? ? 1.890 ? ? 
metalc300  metalc ?    ? A  U   2539 OP2   ? ? ? 1_555 XG NA  .    NA  ? ? 0 U   2539 0 NA  8576 1_555 ? ? ? ? ? ? ? 2.892 ? ? 
metalc301  metalc ?    ? A  G   2540 OP1   ? ? ? 1_555 BB MG  .    MG  ? ? 0 G   2540 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc302  metalc ?    ? A  G   2540 O6    ? ? ? 1_555 JD MG  .    MG  ? ? 0 G   2540 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.555 ? ? 
metalc303  metalc ?    ? A  G   2540 O6    ? ? ? 1_555 SF NA  .    NA  ? ? 0 G   2540 0 NA  8539 1_555 ? ? ? ? ? ? ? 2.796 ? ? 
metalc304  metalc ?    ? A  G   2543 O6    ? ? ? 1_555 CF NA  .    NA  ? ? 0 G   2543 0 NA  8520 1_555 ? ? ? ? ? ? ? 2.917 ? ? 
metalc305  metalc ?    ? A  A   2553 OP2   ? ? ? 1_555 QB MG  .    MG  ? ? 0 A   2553 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc306  metalc ?    ? A  A   2568 OP2   ? ? ? 1_555 TC MG  .    MG  ? ? 0 A   2568 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc307  metalc ?    ? A  G   2578 OP2   ? ? ? 1_555 XD MG  .    MG  ? ? 0 G   2578 0 MG  8103 1_555 ? ? ? ? ? ? ? 2.286 ? ? 
metalc308  metalc ?    ? A  G   2579 OP2   ? ? ? 1_555 XD MG  .    MG  ? ? 0 G   2579 0 MG  8103 1_555 ? ? ? ? ? ? ? 2.860 ? ? 
metalc309  metalc ?    ? A  G   2579 O6    ? ? ? 1_555 TE NA  .    NA  ? ? 0 G   2579 0 NA  8510 1_555 ? ? ? ? ? ? ? 2.812 ? ? 
metalc310  metalc ?    ? A  G   2585 OP1   ? ? ? 1_555 MB MG  .    MG  ? ? 0 G   2585 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.163 ? ? 
metalc311  metalc ?    ? A  G   2585 O6    ? ? ? 1_555 BH NA  .    NA  ? ? 0 G   2585 0 NA  8581 1_555 ? ? ? ? ? ? ? 2.922 ? ? 
metalc312  metalc ?    ? A  U   2586 O4    ? ? ? 1_555 BH NA  .    NA  ? ? 0 U   2586 0 NA  8581 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc313  metalc ?    ? A  G   2592 O6    ? ? ? 1_555 BH NA  .    NA  ? ? 0 G   2592 0 NA  8581 1_555 ? ? ? ? ? ? ? 2.675 ? ? 
metalc314  metalc ?    ? A  U   2607 "O2'" ? ? ? 1_555 WE NA  .    NA  ? ? 0 U   2607 0 NA  8514 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc315  metalc ?    ? A  U   2607 O2    ? ? ? 1_555 WE NA  .    NA  ? ? 0 U   2607 0 NA  8514 1_555 ? ? ? ? ? ? ? 2.714 ? ? 
metalc316  metalc ?    ? A  C   2608 OP1   ? ? ? 1_555 FB MG  .    MG  ? ? 0 C   2608 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc317  metalc ?    ? A  G   2609 OP1   ? ? ? 1_555 FB MG  .    MG  ? ? 0 G   2609 0 MG  8026 1_555 ? ? ? ? ? ? ? 1.838 ? ? 
metalc318  metalc ?    ? A  G   2609 N7    ? ? ? 1_555 DE MG  .    MG  ? ? 0 G   2609 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.430 ? ? 
metalc319  metalc ?    ? A  U   2610 OP2   ? ? ? 1_555 FB MG  .    MG  ? ? 0 U   2610 0 MG  8026 1_555 ? ? ? ? ? ? ? 1.878 ? ? 
metalc320  metalc ?    ? A  G   2611 OP1   ? ? ? 1_555 OA MG  .    MG  ? ? 0 G   2611 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.980 ? ? 
metalc321  metalc ?    ? A  G   2611 "O2'" ? ? ? 1_555 JD MG  .    MG  ? ? 0 G   2611 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc322  metalc ?    ? A  G   2611 OP1   ? ? ? 1_555 FG NA  .    NA  ? ? 0 G   2611 0 NA  8558 1_555 ? ? ? ? ? ? ? 2.663 ? ? 
metalc323  metalc ?    ? A  A   2612 OP1   ? ? ? 1_555 OA MG  .    MG  ? ? 0 A   2612 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.975 ? ? 
metalc324  metalc ?    ? A  A   2612 "O3'" ? ? ? 1_555 TD MG  .    MG  ? ? 0 A   2612 0 MG  8099 1_555 ? ? ? ? ? ? ? 3.110 ? ? 
metalc325  metalc ?    ? A  A   2612 "O2'" ? ? ? 1_555 TD MG  .    MG  ? ? 0 A   2612 0 MG  8099 1_555 ? ? ? ? ? ? ? 2.546 ? ? 
metalc326  metalc ?    ? A  U   2615 OP1   ? ? ? 1_555 PA MG  .    MG  ? ? 0 U   2615 0 MG  8010 1_555 ? ? ? ? ? ? ? 1.997 ? ? 
metalc327  metalc ?    ? A  U   2615 O4    ? ? ? 1_555 CF NA  .    NA  ? ? 0 U   2615 0 NA  8520 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc328  metalc ?    ? A  G   2617 OP2   ? ? ? 1_555 CB MG  .    MG  ? ? 0 G   2617 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.119 ? ? 
metalc329  metalc ?    ? A  G   2617 "O3'" ? ? ? 1_555 GD MG  .    MG  ? ? 0 G   2617 0 MG  8085 1_555 ? ? ? ? ? ? ? 3.149 ? ? 
metalc330  metalc ?    ? A  G   2618 OP2   ? ? ? 1_555 CB MG  .    MG  ? ? 0 G   2618 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.053 ? ? 
metalc331  metalc ?    ? A  G   2618 OP1   ? ? ? 1_555 LC MG  .    MG  ? ? 0 G   2618 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc332  metalc ?    ? A  G   2618 OP1   ? ? ? 1_555 GD MG  .    MG  ? ? 0 G   2618 0 MG  8085 1_555 ? ? ? ? ? ? ? 2.573 ? ? 
metalc333  metalc ?    ? A  G   2623 OP1   ? ? ? 1_555 SA MG  .    MG  ? ? 0 G   2623 0 MG  8013 1_555 ? ? ? ? ? ? ? 1.923 ? ? 
metalc334  metalc ?    ? A  A   2624 OP1   ? ? ? 1_555 IA MG  .    MG  ? ? 0 A   2624 0 MG  8003 1_555 ? ? ? ? ? ? ? 1.964 ? ? 
metalc335  metalc ?    ? A  U   2645 "O2'" ? ? ? 1_555 SF NA  .    NA  ? ? 0 U   2645 0 NA  8539 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc336  metalc ?    ? A  U   2645 O2    ? ? ? 1_555 SF NA  .    NA  ? ? 0 U   2645 0 NA  8539 1_555 ? ? ? ? ? ? ? 2.829 ? ? 
metalc337  metalc ?    ? A  A   2649 N1    ? ? ? 1_555 QE NA  .    NA  ? ? 0 A   2649 0 NA  8506 1_555 ? ? ? ? ? ? ? 2.952 ? ? 
metalc338  metalc ?    ? A  U   2650 OP1   ? ? ? 1_555 NC MG  .    MG  ? ? 0 U   2650 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.007 ? ? 
metalc339  metalc ?    ? A  U   2659 "O3'" ? ? ? 1_555 OI NA  .    NA  ? ? 0 U   2659 R NA  8538 1_555 ? ? ? ? ? ? ? 2.376 ? ? 
metalc340  metalc ?    ? A  G   2660 OP1   ? ? ? 1_555 OI NA  .    NA  ? ? 0 G   2660 R NA  8538 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc341  metalc ?    ? A  U   2663 O2    ? ? ? 1_555 WF NA  .    NA  ? ? 0 U   2663 0 NA  8544 1_555 ? ? ? ? ? ? ? 2.690 ? ? 
metalc342  metalc ?    ? A  A   2746 OP2   ? ? ? 1_555 BC MG  .    MG  ? ? 0 A   2746 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc343  metalc ?    ? A  G   2750 OP2   ? ? ? 1_555 BC MG  .    MG  ? ? 0 G   2750 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.093 ? ? 
metalc344  metalc ?    ? A  A   2757 OP1   ? ? ? 1_555 IC MG  .    MG  ? ? 0 A   2757 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.066 ? ? 
metalc345  metalc ?    ? A  G   2772 O6    ? ? ? 1_555 CH NA  .    NA  ? ? 0 G   2772 0 NA  8582 1_555 ? ? ? ? ? ? ? 2.601 ? ? 
metalc346  metalc ?    ? A  G   2773 O6    ? ? ? 1_555 CH NA  .    NA  ? ? 0 G   2773 0 NA  8582 1_555 ? ? ? ? ? ? ? 2.500 ? ? 
metalc347  metalc ?    ? A  A   2811 "O3'" ? ? ? 1_555 WF NA  .    NA  ? ? 0 A   2811 0 NA  8544 1_555 ? ? ? ? ? ? ? 2.681 ? ? 
metalc348  metalc ?    ? A  A   2811 "O2'" ? ? ? 1_555 WF NA  .    NA  ? ? 0 A   2811 0 NA  8544 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc349  metalc ?    ? A  A   2816 "O2'" ? ? ? 1_555 WF NA  .    NA  ? ? 0 A   2816 0 NA  8544 1_555 ? ? ? ? ? ? ? 2.635 ? ? 
metalc350  metalc ?    ? A  G   2817 OP2   ? ? ? 1_555 WF NA  .    NA  ? ? 0 G   2817 0 NA  8544 1_555 ? ? ? ? ? ? ? 2.829 ? ? 
metalc351  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SF NA  .    NA  ? ? 0 HOH 3033 0 NA  8539 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc352  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QB MG  .    MG  ? ? 0 HOH 3138 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.078 ? ? 
metalc353  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ME NA  .    NA  ? ? 0 HOH 3172 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc354  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IF NA  .    NA  ? ? 0 HOH 3207 0 NA  8527 1_555 ? ? ? ? ? ? ? 2.792 ? ? 
metalc355  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZG NA  .    NA  ? ? 0 HOH 3211 0 NA  8578 1_555 ? ? ? ? ? ? ? 2.898 ? ? 
metalc356  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QB MG  .    MG  ? ? 0 HOH 3213 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.465 ? ? 
metalc357  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 XA MG  .    MG  ? ? 0 HOH 3223 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.187 ? ? 
metalc358  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 3234 0 MG  8072 1_555 ? ? ? ? ? ? ? 1.913 ? ? 
metalc359  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KB MG  .    MG  ? ? 0 HOH 3278 0 MG  8031 1_555 ? ? ? ? ? ? ? 2.225 ? ? 
metalc360  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GF NA  .    NA  ? ? 0 HOH 3278 0 NA  8525 1_555 ? ? ? ? ? ? ? 2.731 ? ? 
metalc361  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DE MG  .    MG  ? ? 0 HOH 3301 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.127 ? ? 
metalc362  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 MD MG  .    MG  ? ? 0 HOH 3325 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.163 ? ? 
metalc363  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 MA MG  .    MG  ? ? 0 HOH 3358 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.064 ? ? 
metalc364  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SE NA  .    NA  ? ? 0 HOH 3409 0 NA  8508 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc365  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AF NA  .    NA  ? ? 0 HOH 3462 0 NA  8518 1_555 ? ? ? ? ? ? ? 2.807 ? ? 
metalc366  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KG NA  .    NA  ? ? 0 HOH 3475 0 NA  8563 1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc367  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 UE NA  .    NA  ? ? 0 HOH 3571 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc368  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZD MG  .    MG  ? ? 0 HOH 3597 0 MG  8105 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc369  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AD MG  .    MG  ? ? 0 HOH 3608 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.103 ? ? 
metalc370  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KA MG  .    MG  ? ? 0 HOH 3609 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.989 ? ? 
metalc371  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 XA MG  .    MG  ? ? 0 HOH 3611 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.202 ? ? 
metalc372  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 LD MG  .    MG  ? ? 0 HOH 3612 0 MG  8090 1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc373  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GA MG  .    MG  ? ? 0 HOH 3613 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc374  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AD MG  .    MG  ? ? 0 HOH 3614 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc375  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 LA MG  .    MG  ? ? 0 HOH 3615 0 MG  8006 1_555 ? ? ? ? ? ? ? 2.090 ? ? 
metalc376  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 UA MG  .    MG  ? ? 0 HOH 3619 0 MG  8015 1_555 ? ? ? ? ? ? ? 1.875 ? ? 
metalc377  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZC MG  .    MG  ? ? 0 HOH 3620 0 MG  8077 1_555 ? ? ? ? ? ? ? 2.101 ? ? 
metalc378  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FC MG  .    MG  ? ? 0 HOH 3621 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.103 ? ? 
metalc379  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RB MG  .    MG  ? ? 0 HOH 3623 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc380  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 CB MG  .    MG  ? ? 0 HOH 3625 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
metalc381  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AD MG  .    MG  ? ? 0 HOH 3626 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc382  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NA MG  .    MG  ? ? 0 HOH 3627 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.151 ? ? 
metalc383  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OC MG  .    MG  ? ? 0 HOH 3630 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.226 ? ? 
metalc384  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FD MG  .    MG  ? ? 0 HOH 3632 0 MG  8084 1_555 ? ? ? ? ? ? ? 1.986 ? ? 
metalc385  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YC MG  .    MG  ? ? 0 HOH 3634 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.211 ? ? 
metalc386  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 3635 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc387  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 3636 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc388  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 JB MG  .    MG  ? ? 0 HOH 3637 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.190 ? ? 
metalc389  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SA MG  .    MG  ? ? 0 HOH 3639 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.136 ? ? 
metalc390  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NB MG  .    MG  ? ? 0 HOH 3640 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.099 ? ? 
metalc391  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ND MG  .    MG  ? ? 0 HOH 3642 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc392  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 XG NA  .    NA  ? ? 0 HOH 3644 0 NA  8576 1_555 ? ? ? ? ? ? ? 2.771 ? ? 
metalc393  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QB MG  .    MG  ? ? 0 HOH 3646 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.008 ? ? 
metalc394  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RB MG  .    MG  ? ? 0 HOH 3647 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.010 ? ? 
metalc395  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OD MG  .    MG  ? ? 0 HOH 3648 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc396  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SA MG  .    MG  ? ? 0 HOH 3652 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.090 ? ? 
metalc397  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TA MG  .    MG  ? ? 0 HOH 3656 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.216 ? ? 
metalc398  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ND MG  .    MG  ? ? 0 HOH 3657 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.376 ? ? 
metalc399  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QD MG  .    MG  ? ? 0 HOH 3660 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc400  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IE MG  .    MG  ? ? 0 HOH 3660 0 MG  8115 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
metalc401  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IA MG  .    MG  ? ? 0 HOH 3663 0 MG  8003 1_555 ? ? ? ? ? ? ? 2.256 ? ? 
metalc402  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IC MG  .    MG  ? ? 0 HOH 3665 0 MG  8056 1_555 ? ? ? ? ? ? ? 1.957 ? ? 
metalc403  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 3667 0 MG  8036 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc404  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RB MG  .    MG  ? ? 0 HOH 3668 0 MG  8038 1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc405  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RD MG  .    MG  ? ? 0 HOH 3669 0 MG  8097 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc406  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RB MG  .    MG  ? ? 0 HOH 3670 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc407  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RD MG  .    MG  ? ? 0 HOH 3673 0 MG  8097 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc408  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 3675 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.268 ? ? 
metalc409  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TD MG  .    MG  ? ? 0 HOH 3676 0 MG  8099 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc410  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 UG NA  .    NA  ? ? 0 HOH 3677 0 NA  8573 1_555 ? ? ? ? ? ? ? 2.522 ? ? 
metalc411  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OD MG  .    MG  ? ? 0 HOH 3679 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.206 ? ? 
metalc412  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BH NA  .    NA  ? ? 0 HOH 3688 0 NA  8581 1_555 ? ? ? ? ? ? ? 2.542 ? ? 
metalc413  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DE MG  .    MG  ? ? 0 HOH 3694 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.463 ? ? 
metalc414  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 3696 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.144 ? ? 
metalc415  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QD MG  .    MG  ? ? 0 HOH 3697 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc416  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ED MG  .    MG  ? ? 0 HOH 3704 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
metalc417  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 3708 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.201 ? ? 
metalc418  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AH NA  .    NA  ? ? 0 HOH 3711 0 NA  8579 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc419  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OB MG  .    MG  ? ? 0 HOH 3713 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc420  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DE MG  .    MG  ? ? 0 HOH 3718 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.142 ? ? 
metalc421  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 LC MG  .    MG  ? ? 0 HOH 3719 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.202 ? ? 
metalc422  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OD MG  .    MG  ? ? 0 HOH 3720 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc423  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EE MG  .    MG  ? ? 0 HOH 3724 0 MG  8111 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc424  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HD MG  .    MG  ? ? 0 HOH 3730 0 MG  8086 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc425  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OA MG  .    MG  ? ? 0 HOH 3736 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc426  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VA MG  .    MG  ? ? 0 HOH 3743 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc427  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SD MG  .    MG  ? ? 0 HOH 3745 0 MG  8098 1_555 ? ? ? ? ? ? ? 2.155 ? ? 
metalc428  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TC MG  .    MG  ? ? 0 HOH 3749 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc429  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VH MG  .    MG  ? ? 0 HOH 3755 B MG  8055 1_555 ? ? ? ? ? ? ? 1.979 ? ? 
metalc430  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KC MG  .    MG  ? ? 0 HOH 3761 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc431  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EE MG  .    MG  ? ? 0 HOH 3765 0 MG  8111 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc432  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NB MG  .    MG  ? ? 0 HOH 3767 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
metalc433  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 JA MG  .    MG  ? ? 0 HOH 3780 0 MG  8004 1_555 ? ? ? ? ? ? ? 1.946 ? ? 
metalc434  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GD MG  .    MG  ? ? 0 HOH 3785 0 MG  8085 1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc435  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 LB MG  .    MG  ? ? 0 HOH 3786 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.191 ? ? 
metalc436  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TB MG  .    MG  ? ? 0 HOH 3787 0 MG  8040 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc437  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 LD MG  .    MG  ? ? 0 HOH 3794 0 MG  8090 1_555 ? ? ? ? ? ? ? 2.060 ? ? 
metalc438  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 MB MG  .    MG  ? ? 0 HOH 3814 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc439  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 CB MG  .    MG  ? ? 0 HOH 3819 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.056 ? ? 
metalc440  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QD MG  .    MG  ? ? 0 HOH 3833 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.380 ? ? 
metalc441  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VE NA  .    NA  ? ? 0 HOH 3834 0 NA  8513 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc442  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PA MG  .    MG  ? ? 0 HOH 3837 0 MG  8010 1_555 ? ? ? ? ? ? ? 1.919 ? ? 
metalc443  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IE MG  .    MG  ? ? 0 HOH 3862 0 MG  8115 1_555 ? ? ? ? ? ? ? 2.477 ? ? 
metalc444  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BB MG  .    MG  ? ? 0 HOH 3867 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc445  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 3870 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc446  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NG NA  .    NA  ? ? 0 HOH 3878 0 NA  8566 1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc447  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PG NA  .    NA  ? ? 0 HOH 3882 0 NA  8568 1_555 ? ? ? ? ? ? ? 2.768 ? ? 
metalc448  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YC MG  .    MG  ? ? 0 HOH 3913 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc449  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FE MG  .    MG  ? ? 0 HOH 3921 0 MG  8112 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc450  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 CE MG  .    MG  ? ? 0 HOH 3923 0 MG  8109 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc451  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AF NA  .    NA  ? ? 0 HOH 3927 0 NA  8518 1_555 ? ? ? ? ? ? ? 2.496 ? ? 
metalc452  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WA MG  .    MG  ? ? 0 HOH 3941 0 MG  8017 1_555 ? ? ? ? ? ? ? 2.025 ? ? 
metalc453  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OC MG  .    MG  ? ? 0 HOH 3955 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.173 ? ? 
metalc454  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SB MG  .    MG  ? ? 0 HOH 3962 0 MG  8039 1_555 ? ? ? ? ? ? ? 2.110 ? ? 
metalc455  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SH MG  .    MG  ? ? 0 HOH 3966 A MG  8065 1_555 ? ? ? ? ? ? ? 1.766 ? ? 
metalc456  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IC MG  .    MG  ? ? 0 HOH 3971 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.042 ? ? 
metalc457  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HD MG  .    MG  ? ? 0 HOH 3972 0 MG  8086 1_555 ? ? ? ? ? ? ? 2.165 ? ? 
metalc458  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 3993 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc459  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 4011 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.046 ? ? 
metalc460  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 LC MG  .    MG  ? ? 0 HOH 4048 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc461  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PE NA  .    NA  ? ? 0 HOH 4085 0 NA  8505 1_555 ? ? ? ? ? ? ? 2.599 ? ? 
metalc462  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 CD MG  .    MG  ? ? 0 HOH 4094 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.177 ? ? 
metalc463  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RG NA  .    NA  ? ? 0 HOH 4098 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.512 ? ? 
metalc464  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 UB MG  .    MG  ? ? 0 HOH 4103 0 MG  8041 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc465  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 4108 0 MG  8071 1_555 ? ? ? ? ? ? ? 1.957 ? ? 
metalc466  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 4146 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.240 ? ? 
metalc467  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ED MG  .    MG  ? ? 0 HOH 4147 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.061 ? ? 
metalc468  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 4151 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.088 ? ? 
metalc469  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TA MG  .    MG  ? ? 0 HOH 4159 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc470  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EB MG  .    MG  ? ? 0 HOH 4164 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.168 ? ? 
metalc471  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PC MG  .    MG  ? ? 0 HOH 4176 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.166 ? ? 
metalc472  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 LB MG  .    MG  ? ? 0 HOH 4185 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
metalc473  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 UB MG  .    MG  ? ? 0 HOH 4196 0 MG  8041 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc474  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BD MG  .    MG  ? ? 0 HOH 4201 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.281 ? ? 
metalc475  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EI MG  .    MG  ? ? 0 HOH 4237 K MG  8069 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc476  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 UD MG  .    MG  ? ? 0 HOH 4247 0 MG  8100 1_555 ? ? ? ? ? ? ? 2.356 ? ? 
metalc477  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BF NA  .    NA  ? ? 0 HOH 4257 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc478  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HE MG  .    MG  ? ? 0 HOH 4282 0 MG  8114 1_555 ? ? ? ? ? ? ? 1.845 ? ? 
metalc479  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QA MG  .    MG  ? ? 0 HOH 4286 0 MG  8011 1_555 ? ? ? ? ? ? ? 1.841 ? ? 
metalc480  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HE MG  .    MG  ? ? 0 HOH 4299 0 MG  8114 1_555 ? ? ? ? ? ? ? 2.432 ? ? 
metalc481  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HA MG  .    MG  ? ? 0 HOH 4320 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.858 ? ? 
metalc482  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GD MG  .    MG  ? ? 0 HOH 4354 0 MG  8085 1_555 ? ? ? ? ? ? ? 2.478 ? ? 
metalc483  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 CH NA  .    NA  ? ? 0 HOH 4365 0 NA  8582 1_555 ? ? ? ? ? ? ? 2.832 ? ? 
metalc484  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QA MG  .    MG  ? ? 0 HOH 4419 0 MG  8011 1_555 ? ? ? ? ? ? ? 2.054 ? ? 
metalc485  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AH NA  .    NA  ? ? 0 HOH 4423 0 NA  8579 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc486  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OG NA  .    NA  ? ? 0 HOH 4474 0 NA  8567 1_555 ? ? ? ? ? ? ? 2.894 ? ? 
metalc487  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EF NA  .    NA  ? ? 0 HOH 4475 0 NA  8523 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc488  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TE NA  .    NA  ? ? 0 HOH 4500 0 NA  8510 1_555 ? ? ? ? ? ? ? 2.750 ? ? 
metalc489  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QA MG  .    MG  ? ? 0 HOH 4522 0 MG  8011 1_555 ? ? ? ? ? ? ? 1.977 ? ? 
metalc490  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NE NA  .    NA  ? ? 0 HOH 4541 0 NA  8502 1_555 ? ? ? ? ? ? ? 2.973 ? ? 
metalc491  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OG NA  .    NA  ? ? 0 HOH 4596 0 NA  8567 1_555 ? ? ? ? ? ? ? 2.931 ? ? 
metalc492  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VD MG  .    MG  ? ? 0 HOH 4614 0 MG  8101 1_555 ? ? ? ? ? ? ? 2.380 ? ? 
metalc493  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TB MG  .    MG  ? ? 0 HOH 4636 0 MG  8040 1_555 ? ? ? ? ? ? ? 2.217 ? ? 
metalc494  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 UE NA  .    NA  ? ? 0 HOH 4646 0 NA  8511 1_555 ? ? ? ? ? ? ? 2.621 ? ? 
metalc495  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PE NA  .    NA  ? ? 0 HOH 4694 0 NA  8505 1_555 ? ? ? ? ? ? ? 2.513 ? ? 
metalc496  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GE MG  .    MG  ? ? 0 HOH 4807 0 MG  8113 1_555 ? ? ? ? ? ? ? 2.472 ? ? 
metalc497  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BG NA  .    NA  ? ? 0 HOH 4808 0 NA  8554 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc498  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TC MG  .    MG  ? ? 0 HOH 4811 0 MG  8068 1_555 ? ? ? ? ? ? ? 1.988 ? ? 
metalc499  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 XG NA  .    NA  ? ? 0 HOH 4846 0 NA  8576 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
metalc500  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NB MG  .    MG  ? ? 0 HOH 4857 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.149 ? ? 
metalc501  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AG NA  .    NA  ? ? 0 HOH 4865 0 NA  8553 1_555 ? ? ? ? ? ? ? 2.662 ? ? 
metalc502  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IG NA  .    NA  ? ? 0 HOH 4894 0 NA  8561 1_555 ? ? ? ? ? ? ? 2.472 ? ? 
metalc503  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YC MG  .    MG  ? ? 0 HOH 4926 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc504  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ME NA  .    NA  ? ? 0 HOH 4959 0 NA  8501 1_555 ? ? ? ? ? ? ? 2.200 ? ? 
metalc505  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DH NA  .    NA  ? ? 0 HOH 5008 0 NA  8584 1_555 ? ? ? ? ? ? ? 2.997 ? ? 
metalc506  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VE NA  .    NA  ? ? 0 HOH 5058 0 NA  8513 1_555 ? ? ? ? ? ? ? 2.727 ? ? 
metalc507  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VE NA  .    NA  ? ? 0 HOH 5104 0 NA  8513 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc508  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DB MG  .    MG  ? ? 0 HOH 5107 0 MG  8024 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc509  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 JF NA  .    NA  ? ? 0 HOH 5200 0 NA  8528 1_555 ? ? ? ? ? ? ? 2.587 ? ? 
metalc510  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DD MG  .    MG  ? ? 0 HOH 5230 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc511  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PF NA  .    NA  ? ? 0 HOH 5236 0 NA  8534 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc512  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DH NA  .    NA  ? ? 0 HOH 5240 0 NA  8584 1_555 ? ? ? ? ? ? ? 2.978 ? ? 
metalc513  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RF NA  .    NA  ? ? 0 HOH 5323 0 NA  8536 1_555 ? ? ? ? ? ? ? 2.227 ? ? 
metalc514  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 CE MG  .    MG  ? ? 0 HOH 5385 0 MG  8109 1_555 ? ? ? ? ? ? ? 2.130 ? ? 
metalc515  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 UD MG  .    MG  ? ? 0 HOH 5491 0 MG  8100 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc516  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GC MG  .    MG  ? ? 0 HOH 5600 0 MG  8053 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc517  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DE MG  .    MG  ? ? 0 HOH 5733 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc518  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AI NA  .    NA  ? ? 0 HOH 5742 J NA  8546 1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc519  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PE NA  .    NA  ? ? 0 HOH 5767 0 NA  8505 1_555 ? ? ? ? ? ? ? 2.772 ? ? 
metalc520  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BC MG  .    MG  ? ? 0 HOH 5861 0 MG  8048 1_555 ? ? ? ? ? ? ? 1.923 ? ? 
metalc521  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NI NA  .    NA  ? ? 0 HOH 5902 R NA  8537 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc522  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HG NA  .    NA  ? ? 0 HOH 5941 0 NA  8560 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc523  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 CE MG  .    MG  ? ? 0 HOH 6014 0 MG  8109 1_555 ? ? ? ? ? ? ? 2.063 ? ? 
metalc524  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EI MG  .    MG  ? ? 0 HOH 6027 K MG  8069 1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc525  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BF NA  .    NA  ? ? 0 HOH 6029 0 NA  8519 1_555 ? ? ? ? ? ? ? 2.384 ? ? 
metalc526  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 6035 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.020 ? ? 
metalc527  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FE MG  .    MG  ? ? 0 HOH 6113 0 MG  8112 1_555 ? ? ? ? ? ? ? 2.437 ? ? 
metalc528  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OC MG  .    MG  ? ? 0 HOH 6157 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.485 ? ? 
metalc529  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TC MG  .    MG  ? ? 0 HOH 6208 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc530  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BC MG  .    MG  ? ? 0 HOH 6247 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.209 ? ? 
metalc531  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VF NA  .    NA  ? ? 0 HOH 6253 0 NA  8542 1_555 ? ? ? ? ? ? ? 2.883 ? ? 
metalc532  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AC MG  .    MG  ? ? 0 HOH 6255 0 MG  8047 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
metalc533  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EG NA  .    NA  ? ? 0 HOH 6259 0 NA  8557 1_555 ? ? ? ? ? ? ? 2.472 ? ? 
metalc534  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YE NA  .    NA  ? ? 0 HOH 6298 0 NA  8516 1_555 ? ? ? ? ? ? ? 2.171 ? ? 
metalc535  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YG NA  .    NA  ? ? 0 HOH 6327 0 NA  8577 1_555 ? ? ? ? ? ? ? 2.435 ? ? 
metalc536  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ED MG  .    MG  ? ? 0 HOH 6340 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
metalc537  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 JF NA  .    NA  ? ? 0 HOH 6460 0 NA  8528 1_555 ? ? ? ? ? ? ? 2.766 ? ? 
metalc538  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 MD MG  .    MG  ? ? 0 HOH 6465 0 MG  8091 1_555 ? ? ? ? ? ? ? 1.844 ? ? 
metalc539  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QG NA  .    NA  ? ? 0 HOH 6554 0 NA  8569 1_555 ? ? ? ? ? ? ? 2.897 ? ? 
metalc540  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KF NA  .    NA  ? ? 0 HOH 6559 0 NA  8529 1_555 ? ? ? ? ? ? ? 2.787 ? ? 
metalc541  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RG NA  .    NA  ? ? 0 HOH 6573 0 NA  8570 1_555 ? ? ? ? ? ? ? 2.924 ? ? 
metalc542  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HE MG  .    MG  ? ? 0 HOH 6583 0 MG  8114 1_555 ? ? ? ? ? ? ? 2.202 ? ? 
metalc543  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YF NA  .    NA  ? ? 0 HOH 6933 0 NA  8550 1_555 ? ? ? ? ? ? ? 2.639 ? ? 
metalc544  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PC MG  .    MG  ? ? 0 HOH 6982 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.010 ? ? 
metalc545  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NF NA  .    NA  ? ? 0 HOH 7049 0 NA  8532 1_555 ? ? ? ? ? ? ? 2.913 ? ? 
metalc546  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BH NA  .    NA  ? ? 0 HOH 7051 0 NA  8581 1_555 ? ? ? ? ? ? ? 2.823 ? ? 
metalc547  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 7211 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.060 ? ? 
metalc548  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DC MG  .    MG  ? ? 0 HOH 7295 0 MG  8050 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc549  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IG NA  .    NA  ? ? 0 HOH 7312 0 NA  8561 1_555 ? ? ? ? ? ? ? 2.686 ? ? 
metalc550  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RF NA  .    NA  ? ? 0 HOH 7323 0 NA  8536 1_555 ? ? ? ? ? ? ? 2.464 ? ? 
metalc551  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WA MG  .    MG  ? ? 0 HOH 7364 0 MG  8017 1_555 ? ? ? ? ? ? ? 1.870 ? ? 
metalc552  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 7387 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc553  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WB MG  .    MG  ? ? 0 HOH 7388 0 MG  8043 1_555 ? ? ? ? ? ? ? 2.157 ? ? 
metalc554  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 7392 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.111 ? ? 
metalc555  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OA MG  .    MG  ? ? 0 HOH 7398 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.918 ? ? 
metalc556  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FG NA  .    NA  ? ? 0 HOH 7398 0 NA  8558 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc557  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PC MG  .    MG  ? ? 0 HOH 7405 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.110 ? ? 
metalc558  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 XA MG  .    MG  ? ? 0 HOH 7434 0 MG  8018 1_555 ? ? ? ? ? ? ? 1.956 ? ? 
metalc559  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BE MG  .    MG  ? ? 0 HOH 7462 0 MG  8107 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc560  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 7524 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc561  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GF NA  .    NA  ? ? 0 HOH 7629 0 NA  8525 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc562  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EH NA  .    NA  ? ? 0 HOH 7649 0 NA  8585 1_555 ? ? ? ? ? ? ? 2.806 ? ? 
metalc563  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RF NA  .    NA  ? ? 0 HOH 7656 0 NA  8536 1_555 ? ? ? ? ? ? ? 2.812 ? ? 
metalc564  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VH MG  .    MG  ? ? 0 HOH 7680 B MG  8055 1_555 ? ? ? ? ? ? ? 2.169 ? ? 
metalc565  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TA MG  .    MG  ? ? 0 HOH 7713 0 MG  8014 1_555 ? ? ? ? ? ? ? 1.926 ? ? 
metalc566  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HA MG  .    MG  ? ? 0 HOH 7715 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.014 ? ? 
metalc567  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HA MG  .    MG  ? ? 0 HOH 7716 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.186 ? ? 
metalc568  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YD MG  .    MG  ? ? 0 HOH 7718 0 MG  8104 1_555 ? ? ? ? ? ? ? 2.395 ? ? 
metalc569  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PC MG  .    MG  ? ? 0 HOH 7721 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc570  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 JA MG  .    MG  ? ? 0 HOH 7722 0 MG  8004 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc571  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WA MG  .    MG  ? ? 0 HOH 7723 0 MG  8017 1_555 ? ? ? ? ? ? ? 2.140 ? ? 
metalc572  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 JB MG  .    MG  ? ? 0 HOH 7724 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.164 ? ? 
metalc573  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 JB MG  .    MG  ? ? 0 HOH 7725 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.156 ? ? 
metalc574  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZA MG  .    MG  ? ? 0 HOH 7726 0 MG  8020 1_555 ? ? ? ? ? ? ? 2.059 ? ? 
metalc575  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 MA MG  .    MG  ? ? 0 HOH 7727 0 MG  8007 1_555 ? ? ? ? ? ? ? 1.958 ? ? 
metalc576  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HC MG  .    MG  ? ? 0 HOH 7728 0 MG  8054 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc577  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 7729 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.087 ? ? 
metalc578  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 7730 0 MG  8021 1_555 ? ? ? ? ? ? ? 1.858 ? ? 
metalc579  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NA MG  .    MG  ? ? 0 HOH 7731 0 MG  8008 1_555 ? ? ? ? ? ? ? 1.994 ? ? 
metalc580  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OA MG  .    MG  ? ? 0 HOH 7732 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc581  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OA MG  .    MG  ? ? 0 HOH 7733 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.940 ? ? 
metalc582  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BB MG  .    MG  ? ? 0 HOH 7734 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.090 ? ? 
metalc583  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 JB MG  .    MG  ? ? 0 HOH 7735 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.018 ? ? 
metalc584  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 LC MG  .    MG  ? ? 0 HOH 7736 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc585  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GA MG  .    MG  ? ? 0 HOH 7737 0 MG  8001 1_555 ? ? ? ? ? ? ? 1.954 ? ? 
metalc586  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KA MG  .    MG  ? ? 0 HOH 7738 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.120 ? ? 
metalc587  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KA MG  .    MG  ? ? 0 HOH 7739 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.958 ? ? 
metalc588  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VA MG  .    MG  ? ? 0 HOH 7740 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.178 ? ? 
metalc589  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VA MG  .    MG  ? ? 0 HOH 7741 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.165 ? ? 
metalc590  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 7742 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc591  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 7743 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.263 ? ? 
metalc592  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 7744 0 MG  8019 1_555 ? ? ? ? ? ? ? 1.930 ? ? 
metalc593  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZA MG  .    MG  ? ? 0 HOH 7745 0 MG  8020 1_555 ? ? ? ? ? ? ? 1.926 ? ? 
metalc594  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SA MG  .    MG  ? ? 0 HOH 7746 0 MG  8013 1_555 ? ? ? ? ? ? ? 1.985 ? ? 
metalc595  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 UA MG  .    MG  ? ? 0 HOH 7748 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc596  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FG NA  .    NA  ? ? 0 HOH 7749 0 NA  8558 1_555 ? ? ? ? ? ? ? 2.786 ? ? 
metalc597  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 CB MG  .    MG  ? ? 0 HOH 7750 0 MG  8023 1_555 ? ? ? ? ? ? ? 1.878 ? ? 
metalc598  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 CB MG  .    MG  ? ? 0 HOH 7751 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.077 ? ? 
metalc599  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EB MG  .    MG  ? ? 0 HOH 7752 0 MG  8025 1_555 ? ? ? ? ? ? ? 1.870 ? ? 
metalc600  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EB MG  .    MG  ? ? 0 HOH 7753 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
metalc601  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FB MG  .    MG  ? ? 0 HOH 7754 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc602  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FB MG  .    MG  ? ? 0 HOH 7755 0 MG  8026 1_555 ? ? ? ? ? ? ? 1.948 ? ? 
metalc603  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IB MG  .    MG  ? ? 0 HOH 7758 0 MG  8029 1_555 ? ? ? ? ? ? ? 1.870 ? ? 
metalc604  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IB MG  .    MG  ? ? 0 HOH 7759 0 MG  8029 1_555 ? ? ? ? ? ? ? 1.991 ? ? 
metalc605  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IB MG  .    MG  ? ? 0 HOH 7760 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc606  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IB MG  .    MG  ? ? 0 HOH 7761 0 MG  8029 1_555 ? ? ? ? ? ? ? 1.925 ? ? 
metalc607  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KB MG  .    MG  ? ? 0 HOH 7763 0 MG  8031 1_555 ? ? ? ? ? ? ? 1.985 ? ? 
metalc608  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KB MG  .    MG  ? ? 0 HOH 7764 0 MG  8031 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc609  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NB MG  .    MG  ? ? 0 HOH 7766 0 MG  8034 1_555 ? ? ? ? ? ? ? 1.907 ? ? 
metalc610  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OB MG  .    MG  ? ? 0 HOH 7767 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.495 ? ? 
metalc611  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OB MG  .    MG  ? ? 0 HOH 7768 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.164 ? ? 
metalc612  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 7769 0 MG  8036 1_555 ? ? ? ? ? ? ? 1.979 ? ? 
metalc613  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 7770 0 MG  8036 1_555 ? ? ? ? ? ? ? 2.052 ? ? 
metalc614  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 7771 0 MG  8036 1_555 ? ? ? ? ? ? ? 1.948 ? ? 
metalc615  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RB MG  .    MG  ? ? 0 HOH 7773 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc616  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SB MG  .    MG  ? ? 0 HOH 7774 0 MG  8039 1_555 ? ? ? ? ? ? ? 1.821 ? ? 
metalc617  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VB MG  .    MG  ? ? 0 HOH 7776 0 MG  8042 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc618  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YB MG  .    MG  ? ? 0 HOH 7777 0 MG  8045 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc619  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EC MG  .    MG  ? ? 0 HOH 7778 0 MG  8051 1_555 ? ? ? ? ? ? ? 1.974 ? ? 
metalc620  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EC MG  .    MG  ? ? 0 HOH 7779 0 MG  8051 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc621  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HC MG  .    MG  ? ? 0 HOH 7780 0 MG  8054 1_555 ? ? ? ? ? ? ? 2.069 ? ? 
metalc622  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HC MG  .    MG  ? ? 0 HOH 7781 0 MG  8054 1_555 ? ? ? ? ? ? ? 1.964 ? ? 
metalc623  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KC MG  .    MG  ? ? 0 HOH 7782 0 MG  8058 1_555 ? ? ? ? ? ? ? 1.935 ? ? 
metalc624  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KC MG  .    MG  ? ? 0 HOH 7783 0 MG  8058 1_555 ? ? ? ? ? ? ? 1.830 ? ? 
metalc625  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 MC MG  .    MG  ? ? 0 HOH 7785 0 MG  8060 1_555 ? ? ? ? ? ? ? 2.049 ? ? 
metalc626  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 MC MG  .    MG  ? ? 0 HOH 7786 0 MG  8060 1_555 ? ? ? ? ? ? ? 1.920 ? ? 
metalc627  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 7787 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
metalc628  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 7788 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.356 ? ? 
metalc629  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 7789 0 MG  8061 1_555 ? ? ? ? ? ? ? 1.952 ? ? 
metalc630  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SC MG  .    MG  ? ? 0 HOH 7791 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc631  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 XC MG  .    MG  ? ? 0 HOH 7792 0 MG  8074 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
metalc632  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 7794 0 MG  8072 1_555 ? ? ? ? ? ? ? 1.987 ? ? 
metalc633  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 7795 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc634  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 7796 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc635  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PC MG  .    MG  ? ? 0 HOH 7797 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.097 ? ? 
metalc636  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 IC MG  .    MG  ? ? 0 HOH 7798 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc637  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZI MG  .    MG  ? ? 0 HOH 7800 2 MG  8076 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc638  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZC MG  .    MG  ? ? 0 HOH 7801 0 MG  8077 1_555 ? ? ? ? ? ? ? 1.963 ? ? 
metalc639  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZC MG  .    MG  ? ? 0 HOH 7802 0 MG  8077 1_555 ? ? ? ? ? ? ? 2.051 ? ? 
metalc640  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BD MG  .    MG  ? ? 0 HOH 7803 0 MG  8080 1_555 ? ? ? ? ? ? ? 1.962 ? ? 
metalc641  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ED MG  .    MG  ? ? 0 HOH 7804 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc642  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FD MG  .    MG  ? ? 0 HOH 7805 0 MG  8084 1_555 ? ? ? ? ? ? ? 1.829 ? ? 
metalc643  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HD MG  .    MG  ? ? 0 HOH 7806 0 MG  8086 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc644  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 HD MG  .    MG  ? ? 0 HOH 7807 0 MG  8086 1_555 ? ? ? ? ? ? ? 2.055 ? ? 
metalc645  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KD MG  .    MG  ? ? 0 HOH 7808 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc646  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 MD MG  .    MG  ? ? 0 HOH 7809 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.042 ? ? 
metalc647  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PD MG  .    MG  ? ? 0 HOH 7810 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc648  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 NA MG  .    MG  ? ? 0 HOH 7814 0 MG  8008 1_555 ? ? ? ? ? ? ? 1.759 ? ? 
metalc649  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 RA MG  .    MG  ? ? 0 HOH 7815 0 MG  8012 1_555 ? ? ? ? ? ? ? 1.945 ? ? 
metalc650  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 XA MG  .    MG  ? ? 0 HOH 7816 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.044 ? ? 
metalc651  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DB MG  .    MG  ? ? 0 HOH 7817 0 MG  8024 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc652  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DB MG  .    MG  ? ? 0 HOH 7818 0 MG  8024 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc653  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 EB MG  .    MG  ? ? 0 HOH 7819 0 MG  8025 1_555 ? ? ? ? ? ? ? 1.926 ? ? 
metalc654  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 7820 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc655  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OB MG  .    MG  ? ? 0 HOH 7822 0 MG  8035 1_555 ? ? ? ? ? ? ? 1.841 ? ? 
metalc656  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 OB MG  .    MG  ? ? 0 HOH 7823 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc657  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 QB MG  .    MG  ? ? 0 HOH 7824 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc658  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TB MG  .    MG  ? ? 0 HOH 7826 0 MG  8040 1_555 ? ? ? ? ? ? ? 2.001 ? ? 
metalc659  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TB MG  .    MG  ? ? 0 HOH 7827 0 MG  8040 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc660  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 YB MG  .    MG  ? ? 0 HOH 7831 0 MG  8045 1_555 ? ? ? ? ? ? ? 2.404 ? ? 
metalc661  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZB MG  .    MG  ? ? 0 HOH 7832 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.236 ? ? 
metalc662  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZB MG  .    MG  ? ? 0 HOH 7833 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc663  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AE MG  .    MG  ? ? 0 HOH 7837 0 MG  8106 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc664  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AE MG  .    MG  ? ? 0 HOH 7838 0 MG  8106 1_555 ? ? ? ? ? ? ? 2.130 ? ? 
metalc665  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AE MG  .    MG  ? ? 0 HOH 7839 0 MG  8106 1_555 ? ? ? ? ? ? ? 1.816 ? ? 
metalc666  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AE MG  .    MG  ? ? 0 HOH 7840 0 MG  8106 1_555 ? ? ? ? ? ? ? 2.264 ? ? 
metalc667  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BE MG  .    MG  ? ? 0 HOH 7842 0 MG  8107 1_555 ? ? ? ? ? ? ? 2.379 ? ? 
metalc668  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BE MG  .    MG  ? ? 0 HOH 7844 0 MG  8107 1_555 ? ? ? ? ? ? ? 2.485 ? ? 
metalc669  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AC MG  .    MG  ? ? 0 HOH 7847 0 MG  8047 1_555 ? ? ? ? ? ? ? 1.950 ? ? 
metalc670  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 FC MG  .    MG  ? ? 0 HOH 7849 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc671  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 TC MG  .    MG  ? ? 0 HOH 7851 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc672  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 7852 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc673  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 XC MG  .    MG  ? ? 0 HOH 7853 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc674  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ZI MG  .    MG  ? ? 0 HOH 7855 2 MG  8076 1_555 ? ? ? ? ? ? ? 2.376 ? ? 
metalc675  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BD MG  .    MG  ? ? 0 HOH 7856 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc676  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ED MG  .    MG  ? ? 0 HOH 7857 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.203 ? ? 
metalc677  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KD MG  .    MG  ? ? 0 HOH 7858 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.205 ? ? 
metalc678  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 KD MG  .    MG  ? ? 0 HOH 7859 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.074 ? ? 
metalc679  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 ND MG  .    MG  ? ? 0 HOH 7860 0 MG  8092 1_555 ? ? ? ? ? ? ? 1.970 ? ? 
metalc680  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 PD MG  .    MG  ? ? 0 HOH 7861 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.367 ? ? 
metalc681  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 XD MG  .    MG  ? ? 0 HOH 7862 0 MG  8103 1_555 ? ? ? ? ? ? ? 2.161 ? ? 
metalc682  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 DD MG  .    MG  ? ? 0 HOH 7864 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.087 ? ? 
metalc683  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 BC MG  .    MG  ? ? 0 HOH 7868 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc684  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 WD MG  .    MG  ? ? 0 HOH 7869 0 MG  8102 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc685  metalc ?    ? GA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8001 0 HOH 9174 1_555 ? ? ? ? ? ? ? 1.965 ? ? 
metalc686  metalc ?    ? IA MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8003 A HOH 8811 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc687  metalc ?    ? IA MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8003 A HOH 8832 1_555 ? ? ? ? ? ? ? 2.538 ? ? 
metalc688  metalc ?    ? JA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8004 0 HOH 9045 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
metalc689  metalc ?    ? JA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8004 0 HOH 9781 1_555 ? ? ? ? ? ? ? 2.093 ? ? 
metalc690  metalc ?    ? LA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8006 0 HOH 9814 1_555 ? ? ? ? ? ? ? 1.985 ? ? 
metalc691  metalc ?    ? MA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8007 0 HOH 9006 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc692  metalc ?    ? PA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8010 0 HOH 9364 1_555 ? ? ? ? ? ? ? 2.217 ? ? 
metalc693  metalc ?    ? PA MG  .    MG    ? ? ? 1_555 D  GLN 231  OE1 ? ? 0 MG  8010 B GLN 230  1_555 ? ? ? ? ? ? ? 2.236 ? ? 
metalc694  metalc ?    ? PA MG  .    MG    ? ? ? 1_555 GJ HOH .    O   ? ? 0 MG  8010 B HOH 8825 1_555 ? ? ? ? ? ? ? 1.887 ? ? 
metalc695  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8012 0 HOH 9037 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc696  metalc ?    ? RA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8012 0 HOH 9639 1_555 ? ? ? ? ? ? ? 1.930 ? ? 
metalc697  metalc ?    ? SA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8013 0 HOH 9019 1_555 ? ? ? ? ? ? ? 1.819 ? ? 
metalc698  metalc ?    ? TA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8014 0 HOH 9031 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc699  metalc ?    ? UA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8015 0 HOH 9004 1_555 ? ? ? ? ? ? ? 1.929 ? ? 
metalc700  metalc ?    ? UA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8015 0 HOH 9022 1_555 ? ? ? ? ? ? ? 1.973 ? ? 
metalc701  metalc ?    ? WA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8017 0 HOH 9416 1_555 ? ? ? ? ? ? ? 1.948 ? ? 
metalc702  metalc ?    ? WA MG  .    MG    ? ? ? 1_555 HJ HOH .    O   ? ? 0 MG  8017 C HOH 8558 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
metalc703  metalc ?    ? ZA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8020 0 HOH 9121 1_555 ? ? ? ? ? ? ? 2.096 ? ? 
metalc704  metalc ?    ? ZA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8020 0 HOH 9124 1_555 ? ? ? ? ? ? ? 2.246 ? ? 
metalc705  metalc ?    ? ZA MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8020 0 HOH 9195 1_555 ? ? ? ? ? ? ? 1.874 ? ? 
metalc706  metalc ?    ? AB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8021 0 HOH 9969 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc707  metalc ?    ? BB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8022 0 HOH 9109 1_555 ? ? ? ? ? ? ? 1.966 ? ? 
metalc708  metalc ?    ? BB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8022 0 HOH 9458 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc709  metalc ?    ? DB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8024 0 HOH 9942 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc710  metalc ?    ? FB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8026 0 HOH 9395 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc711  metalc ?    ? HB MG  .    MG    ? ? ? 1_555 XJ HOH .    O   ? ? 0 MG  8028 S HOH 8549 1_555 ? ? ? ? ? ? ? 1.919 ? ? 
metalc712  metalc ?    ? LB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8032 0 HOH 9993 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
metalc713  metalc ?    ? LB MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8032 A HOH 8848 1_555 ? ? ? ? ? ? ? 2.255 ? ? 
metalc714  metalc ?    ? LB MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8032 A HOH 8926 1_555 ? ? ? ? ? ? ? 1.964 ? ? 
metalc715  metalc ?    ? MB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8033 0 HOH 9679 1_555 ? ? ? ? ? ? ? 2.073 ? ? 
metalc716  metalc ?    ? PB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8036 0 HOH 9370 1_555 ? ? ? ? ? ? ? 1.981 ? ? 
metalc717  metalc ?    ? QB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8037 0 HOH 9077 1_555 ? ? ? ? ? ? ? 2.492 ? ? 
metalc718  metalc ?    ? RB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8038 0 HOH 9283 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc719  metalc ?    ? SB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8039 0 HOH 9916 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc720  metalc ?    ? TB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8040 0 HOH 9693 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc721  metalc ?    ? VB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8042 0 HOH 9438 1_555 ? ? ? ? ? ? ? 2.759 ? ? 
metalc722  metalc ?    ? WB MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8043 0 HOH 9818 1_555 ? ? ? ? ? ? ? 2.460 ? ? 
metalc723  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 T  GLY 66   O   ? ? 0 MG  8044 R GLY 65   1_555 ? ? ? ? ? ? ? 2.225 ? ? 
metalc724  metalc ?    ? XB MG  .    MG    ? ? ? 1_555 WJ HOH .    O   ? ? 0 MG  8044 R HOH 8886 1_555 ? ? ? ? ? ? ? 2.570 ? ? 
metalc725  metalc ?    ? FC MG  .    MG    ? ? ? 1_555 B  G   92   OP1 ? ? 0 MG  8052 9 G   92   1_555 ? ? ? ? ? ? ? 3.093 ? ? 
metalc726  metalc ?    ? FC MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8052 9 HOH 8590 1_555 ? ? ? ? ? ? ? 2.802 ? ? 
metalc727  metalc ?    ? FC MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8052 9 HOH 8616 1_555 ? ? ? ? ? ? ? 2.089 ? ? 
metalc728  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8053 0 HOH 9202 1_555 ? ? ? ? ? ? ? 2.571 ? ? 
metalc729  metalc ?    ? GC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8053 0 HOH 9241 1_555 ? ? ? ? ? ? ? 2.829 ? ? 
metalc730  metalc ?    ? HC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8054 0 HOH 9434 1_555 ? ? ? ? ? ? ? 2.064 ? ? 
metalc731  metalc ?    ? IC MG  .    MG    ? ? ? 1_555 D  ASN 336  O   ? ? 0 MG  8056 B ASN 335  1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc732  metalc ?    ? IC MG  .    MG    ? ? ? 1_555 GJ HOH .    O   ? ? 0 MG  8056 B HOH 8840 1_555 ? ? ? ? ? ? ? 2.001 ? ? 
metalc733  metalc ?    ? JC MG  .    MG    ? ? ? 1_555 C  GLN 208  O   ? ? 0 MG  8057 A GLN 207  1_555 ? ? ? ? ? ? ? 2.820 ? ? 
metalc734  metalc ?    ? JC MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8057 A HOH 8929 1_555 ? ? ? ? ? ? ? 2.932 ? ? 
metalc735  metalc ?    ? KC MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8058 A HOH 8927 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc736  metalc ?    ? KC MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8058 A HOH 8929 1_555 ? ? ? ? ? ? ? 2.136 ? ? 
metalc737  metalc ?    ? LC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8059 0 HOH 9036 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc738  metalc ?    ? LC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8059 0 HOH 9040 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc739  metalc ?    ? MC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8060 0 HOH 9167 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
metalc740  metalc ?    ? NC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8061 0 HOH 9824 1_555 ? ? ? ? ? ? ? 2.354 ? ? 
metalc741  metalc ?    ? OC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8062 0 HOH 9397 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc742  metalc ?    ? QC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8064 0 HOH 9591 1_555 ? ? ? ? ? ? ? 2.678 ? ? 
metalc743  metalc ?    ? RC MG  .    MG    ? ? ? 1_555 C  ASP 27   OD1 ? ? 0 MG  8066 A ASP 26   1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc744  metalc ?    ? RC MG  .    MG    ? ? ? 1_555 C  ASP 27   OD2 ? ? 0 MG  8066 A ASP 26   1_555 ? ? ? ? ? ? ? 2.848 ? ? 
metalc745  metalc ?    ? RC MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8066 A HOH 8858 1_555 ? ? ? ? ? ? ? 3.117 ? ? 
metalc746  metalc ?    ? SC MG  .    MG    ? ? ? 1_555 C  ASN 189  O   ? ? 0 MG  8067 A ASN 188  1_555 ? ? ? ? ? ? ? 2.412 ? ? 
metalc747  metalc ?    ? TC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8068 0 HOH 9736 1_555 ? ? ? ? ? ? ? 2.050 ? ? 
metalc748  metalc ?    ? UC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8070 0 HOH 9122 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc749  metalc ?    ? XC MG  .    MG    ? ? ? 1_555 BK HOH .    O   ? ? 0 MG  8074 W HOH 7804 1_555 ? ? ? ? ? ? ? 1.807 ? ? 
metalc750  metalc ?    ? XC MG  .    MG    ? ? ? 1_555 BK HOH .    O   ? ? 0 MG  8074 W HOH 7874 1_555 ? ? ? ? ? ? ? 2.579 ? ? 
metalc751  metalc ?    ? ZC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8077 0 HOH 9240 1_555 ? ? ? ? ? ? ? 1.892 ? ? 
metalc752  metalc ?    ? CD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8081 0 HOH 9613 1_555 ? ? ? ? ? ? ? 2.664 ? ? 
metalc753  metalc ?    ? DD MG  .    MG    ? ? ? 1_555 UJ HOH .    O   ? ? 0 MG  8082 P HOH 214  1_555 ? ? ? ? ? ? ? 2.893 ? ? 
metalc754  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8084 0 HOH 9249 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc755  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8084 0 HOH 9376 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc756  metalc ?    ? FD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8084 0 HOH 9754 1_555 ? ? ? ? ? ? ? 1.964 ? ? 
metalc757  metalc ?    ? GD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8085 0 HOH 9036 1_555 ? ? ? ? ? ? ? 2.649 ? ? 
metalc758  metalc ?    ? GD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8085 0 HOH 9603 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc759  metalc ?    ? JD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8088 0 HOH 9062 1_555 ? ? ? ? ? ? ? 2.449 ? ? 
metalc760  metalc ?    ? MD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8091 0 HOH 9091 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc761  metalc ?    ? MD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8091 0 HOH 9549 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc762  metalc ?    ? OD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8093 0 HOH 9685 1_555 ? ? ? ? ? ? ? 2.580 ? ? 
metalc763  metalc ?    ? SD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8098 0 HOH 9948 1_555 ? ? ? ? ? ? ? 2.460 ? ? 
metalc764  metalc ?    ? SD MG  .    MG    ? ? ? 1_555 DK HOH .    O   ? ? 0 MG  8098 Y HOH 8867 1_555 ? ? ? ? ? ? ? 2.939 ? ? 
metalc765  metalc ?    ? WD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8102 0 HOH 9252 1_555 ? ? ? ? ? ? ? 2.251 ? ? 
metalc766  metalc ?    ? WD MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8102 0 HOH 9898 1_555 ? ? ? ? ? ? ? 2.913 ? ? 
metalc767  metalc ?    ? WD MG  .    MG    ? ? ? 1_555 HK HOH .    O   ? ? 0 MG  8102 3 HOH 8824 1_555 ? ? ? ? ? ? ? 2.569 ? ? 
metalc768  metalc ?    ? ZD MG  .    MG    ? ? ? 1_555 UJ HOH .    O   ? ? 0 MG  8105 P HOH 188  1_555 ? ? ? ? ? ? ? 2.862 ? ? 
metalc769  metalc ?    ? ZD MG  .    MG    ? ? ? 1_555 UJ HOH .    O   ? ? 0 MG  8105 P HOH 208  1_555 ? ? ? ? ? ? ? 2.651 ? ? 
metalc770  metalc ?    ? CE MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8109 0 HOH 9510 1_555 ? ? ? ? ? ? ? 2.637 ? ? 
metalc771  metalc ?    ? EE MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8111 0 HOH 9128 1_555 ? ? ? ? ? ? ? 2.567 ? ? 
metalc772  metalc ?    ? EE MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8111 0 HOH 9331 1_555 ? ? ? ? ? ? ? 2.156 ? ? 
metalc773  metalc ?    ? EE MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8111 0 HOH 9572 1_555 ? ? ? ? ? ? ? 2.517 ? ? 
metalc774  metalc ?    ? FE MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8112 0 HOH 9591 1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc775  metalc ?    ? GE MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8113 0 HOH 9351 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc776  metalc ?    ? GE MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8113 0 HOH 9452 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc777  metalc ?    ? HE MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8114 A HOH 8852 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc778  metalc ?    ? IE MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8115 A HOH 8852 1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc779  metalc ?    ? JE MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8116 0 HOH 9223 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc780  metalc ?    ? LE K   .    K     ? ? ? 1_555 DJ HOH .    O   ? ? 0 K   8402 0 HOH 9014 1_555 ? ? ? ? ? ? ? 2.892 ? ? 
metalc781  metalc ?    ? LE K   .    K     ? ? ? 1_555 DJ HOH .    O   ? ? 0 K   8402 0 HOH 9110 1_555 ? ? ? ? ? ? ? 2.955 ? ? 
metalc782  metalc ?    ? LE K   .    K     ? ? ? 1_555 DJ HOH .    O   ? ? 0 K   8402 0 HOH 9145 1_555 ? ? ? ? ? ? ? 3.072 ? ? 
metalc783  metalc ?    ? UE NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8511 0 HOH 9181 1_555 ? ? ? ? ? ? ? 2.647 ? ? 
metalc784  metalc ?    ? VE NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8513 0 HOH 9958 1_555 ? ? ? ? ? ? ? 2.600 ? ? 
metalc785  metalc ?    ? WE NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8514 0 HOH 9332 1_555 ? ? ? ? ? ? ? 2.495 ? ? 
metalc786  metalc ?    ? XE NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8515 0 HOH 9688 1_555 ? ? ? ? ? ? ? 2.975 ? ? 
metalc787  metalc ?    ? ZE NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8517 0 HOH 9278 1_555 ? ? ? ? ? ? ? 2.762 ? ? 
metalc788  metalc ?    ? ZE NA  .    NA    ? ? ? 1_555 DA TRP 43   O   ? ? 0 NA  8517 2 TRP 42   1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc789  metalc ?    ? ZE NA  .    NA    ? ? ? 1_555 DA ASN 46   O   ? ? 0 NA  8517 2 ASN 45   1_555 ? ? ? ? ? ? ? 2.833 ? ? 
metalc790  metalc ?    ? ZE NA  .    NA    ? ? ? 1_555 GK HOH .    O   ? ? 0 NA  8517 2 HOH 4135 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc791  metalc ?    ? AF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8518 0 HOH 9210 1_555 ? ? ? ? ? ? ? 2.995 ? ? 
metalc792  metalc ?    ? BF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8519 0 HOH 9058 1_555 ? ? ? ? ? ? ? 2.961 ? ? 
metalc793  metalc ?    ? BF NA  .    NA    ? ? ? 1_555 N  ASP 37   O   ? ? 0 NA  8519 L ASP 36   1_555 ? ? ? ? ? ? ? 2.636 ? ? 
metalc794  metalc ?    ? CF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8520 0 HOH 9086 1_555 ? ? ? ? ? ? ? 2.911 ? ? 
metalc795  metalc ?    ? CF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8520 0 HOH 9745 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc796  metalc ?    ? DF NA  .    NA    ? ? ? 1_555 D  ARG 230  O   ? ? 0 NA  8521 B ARG 229  1_555 ? ? ? ? ? ? ? 2.684 ? ? 
metalc797  metalc ?    ? GF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8525 0 HOH 9627 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc798  metalc ?    ? IF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8527 0 HOH 9035 1_555 ? ? ? ? ? ? ? 2.441 ? ? 
metalc799  metalc ?    ? IF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8527 0 HOH 9732 1_555 ? ? ? ? ? ? ? 2.761 ? ? 
metalc800  metalc ?    ? LF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8530 0 HOH 9234 1_555 ? ? ? ? ? ? ? 2.601 ? ? 
metalc801  metalc ?    ? MF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8531 0 HOH 9301 1_555 ? ? ? ? ? ? ? 2.888 ? ? 
metalc802  metalc ?    ? QF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8535 0 HOH 9878 1_555 ? ? ? ? ? ? ? 2.559 ? ? 
metalc803  metalc ?    ? RF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8536 0 HOH 9931 1_555 ? ? ? ? ? ? ? 2.441 ? ? 
metalc804  metalc ?    ? WF NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8544 0 HOH 9222 1_555 ? ? ? ? ? ? ? 2.716 ? ? 
metalc805  metalc ?    ? AG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8553 0 HOH 9212 1_555 ? ? ? ? ? ? ? 2.763 ? ? 
metalc806  metalc ?    ? AG NA  .    NA    ? ? ? 1_555 N  GLY 15   O   ? ? 0 NA  8553 L GLY 14   1_555 ? ? ? ? ? ? ? 2.680 ? ? 
metalc807  metalc ?    ? CG NA  .    NA    ? ? ? 1_555 OJ HOH .    O   ? ? 0 NA  8555 J HOH 3661 1_555 ? ? ? ? ? ? ? 2.223 ? ? 
metalc808  metalc ?    ? FG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8558 0 HOH 9334 1_555 ? ? ? ? ? ? ? 2.938 ? ? 
metalc809  metalc ?    ? FG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8558 0 HOH 9487 1_555 ? ? ? ? ? ? ? 2.522 ? ? 
metalc810  metalc ?    ? IG NA  .    NA    ? ? ? 1_555 D  GLN 231  O   ? ? 0 NA  8561 B GLN 230  1_555 ? ? ? ? ? ? ? 2.883 ? ? 
metalc811  metalc ?    ? LG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8564 0 HOH 9595 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc812  metalc ?    ? LG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8564 0 HOH 9821 1_555 ? ? ? ? ? ? ? 2.706 ? ? 
metalc813  metalc ?    ? MG NA  .    NA    ? ? ? 1_555 O  LYS 194  O   ? ? 0 NA  8565 M LYS 193  1_555 ? ? ? ? ? ? ? 2.748 ? ? 
metalc814  metalc ?    ? NG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8566 0 HOH 9891 1_555 ? ? ? ? ? ? ? 2.829 ? ? 
metalc815  metalc ?    ? OG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8567 0 HOH 9833 1_555 ? ? ? ? ? ? ? 2.540 ? ? 
metalc816  metalc ?    ? OG NA  .    NA    ? ? ? 1_555 E  ARG 55   O   ? ? 0 NA  8567 C ARG 55   1_555 ? ? ? ? ? ? ? 2.966 ? ? 
metalc817  metalc ?    ? RG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8570 0 HOH 9103 1_555 ? ? ? ? ? ? ? 2.654 ? ? 
metalc818  metalc ?    ? SG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8571 0 HOH 9628 1_555 ? ? ? ? ? ? ? 2.984 ? ? 
metalc819  metalc ?    ? TG NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8572 0 HOH 9274 1_555 ? ? ? ? ? ? ? 2.887 ? ? 
metalc820  metalc ?    ? ZG NA  .    NA    ? ? ? 1_555 N  HIS 19   O   ? ? 0 NA  8578 L HIS 18   1_555 ? ? ? ? ? ? ? 2.933 ? ? 
metalc821  metalc ?    ? ZG NA  .    NA    ? ? ? 1_555 QJ HOH .    O   ? ? 0 NA  8578 L HOH 8831 1_555 ? ? ? ? ? ? ? 2.515 ? ? 
metalc822  metalc ?    ? BH NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 0 NA  8581 0 HOH 9330 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc823  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 AI NA  .    NA  ? ? 0 HOH 9486 J NA  8546 1_555 ? ? ? ? ? ? ? 2.508 ? ? 
metalc824  metalc ?    ? DJ HOH .    O     ? ? ? 1_555 SH MG  .    MG  ? ? 0 HOH 9932 A MG  8065 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc825  metalc ?    ? B  C   40   N3    ? ? ? 1_555 QH NA  .    NA  ? ? 9 C   40   9 NA  8551 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc826  metalc ?    ? B  U   55   O2    ? ? ? 1_555 RH NA  .    NA  ? ? 9 U   55   9 NA  8583 1_555 ? ? ? ? ? ? ? 2.851 ? ? 
metalc827  metalc ?    ? B  A   56   OP2   ? ? ? 1_555 PH MG  .    MG  ? ? 9 A   56   9 MG  8095 1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc828  metalc ?    ? B  A   57   OP2   ? ? ? 1_555 PH MG  .    MG  ? ? 9 A   57   9 MG  8095 1_555 ? ? ? ? ? ? ? 2.410 ? ? 
metalc829  metalc ?    ? B  A   57   N1    ? ? ? 1_555 RH NA  .    NA  ? ? 9 A   57   9 NA  8583 1_555 ? ? ? ? ? ? ? 2.992 ? ? 
metalc830  metalc ?    ? PH MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 9 MG  8095 9 HOH 8712 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc831  metalc ?    ? C  PHE 202  O     ? ? ? 1_555 TH NA  .    NA  ? ? A PHE 201  A NA  8545 1_555 ? ? ? ? ? ? ? 2.289 ? ? 
metalc832  metalc ?    ? C  GLY 204  O     ? ? ? 1_555 TH NA  .    NA  ? ? A GLY 203  A NA  8545 1_555 ? ? ? ? ? ? ? 2.866 ? ? 
metalc833  metalc ?    ? C  HIS 209  O     ? ? ? 1_555 TH NA  .    NA  ? ? A HIS 208  A NA  8545 1_555 ? ? ? ? ? ? ? 2.786 ? ? 
metalc834  metalc ?    ? SH MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? A MG  8065 A HOH 8823 1_555 ? ? ? ? ? ? ? 2.065 ? ? 
metalc835  metalc ?    ? SH MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? A MG  8065 A HOH 8849 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc836  metalc ?    ? SH MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? A MG  8065 A HOH 8899 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc837  metalc ?    ? SH MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? A MG  8065 A HOH 8928 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc838  metalc ?    ? TH NA  .    NA    ? ? ? 1_555 FJ HOH .    O   ? ? A NA  8545 A HOH 8855 1_555 ? ? ? ? ? ? ? 2.418 ? ? 
metalc839  metalc ?    ? TH NA  .    NA    ? ? ? 1_555 FJ HOH .    O   ? ? A NA  8545 A HOH 8898 1_555 ? ? ? ? ? ? ? 2.062 ? ? 
metalc840  metalc ?    ? VH MG  .    MG    ? ? ? 1_555 GJ HOH .    O   ? ? B MG  8055 B HOH 8852 1_555 ? ? ? ? ? ? ? 2.169 ? ? 
metalc841  metalc ?    ? VH MG  .    MG    ? ? ? 1_555 GJ HOH .    O   ? ? B MG  8055 B HOH 8968 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc842  metalc ?    ? VH MG  .    MG    ? ? ? 1_555 GJ HOH .    O   ? ? B MG  8055 B HOH 8969 1_555 ? ? ? ? ? ? ? 2.880 ? ? 
metalc843  metalc ?    ? E  ASP 45   OD1   ? ? ? 1_555 XH NA  .    NA  ? ? C ASP 45   C NA  8504 1_555 ? ? ? ? ? ? ? 2.456 ? ? 
metalc844  metalc ?    ? E  THR 94   O     ? ? ? 1_555 XH NA  .    NA  ? ? C THR 94   C NA  8504 1_555 ? ? ? ? ? ? ? 2.997 ? ? 
metalc845  metalc ?    ? E  LYS 96   O     ? ? ? 1_555 XH NA  .    NA  ? ? C LYS 96   C NA  8504 1_555 ? ? ? ? ? ? ? 2.690 ? ? 
metalc846  metalc ?    ? J  TYR 157  O     ? ? ? 1_555 YH NA  .    NA  ? ? H TYR 157  H NA  8509 1_555 ? ? ? ? ? ? ? 2.881 ? ? 
metalc847  metalc ?    ? J  ILE 160  O     ? ? ? 1_555 YH NA  .    NA  ? ? H ILE 160  H NA  8509 1_555 ? ? ? ? ? ? ? 2.802 ? ? 
metalc848  metalc ?    ? J  PRO 162  O     ? ? ? 1_555 YH NA  .    NA  ? ? H PRO 162  H NA  8509 1_555 ? ? ? ? ? ? ? 2.521 ? ? 
metalc849  metalc ?    ? L  ARG 60   O     ? ? ? 1_555 AI NA  .    NA  ? ? J ARG 60   J NA  8546 1_555 ? ? ? ? ? ? ? 2.751 ? ? 
metalc850  metalc ?    ? L  VAL 61   O     ? ? ? 1_555 AI NA  .    NA  ? ? J VAL 61   J NA  8546 1_555 ? ? ? ? ? ? ? 2.761 ? ? 
metalc851  metalc ?    ? L  ILE 63   O     ? ? ? 1_555 AI NA  .    NA  ? ? J ILE 63   J NA  8546 1_555 ? ? ? ? ? ? ? 2.630 ? ? 
metalc852  metalc ?    ? L  TYR 69   O     ? ? ? 1_555 AI NA  .    NA  ? ? J TYR 69   J NA  8546 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc853  metalc ?    ? M  ASN 42   OD1   ? ? ? 1_555 EI MG  .    MG  ? ? K ASN 42   K MG  8069 1_555 ? ? ? ? ? ? ? 2.452 ? ? 
metalc854  metalc ?    ? PJ HOH .    O     ? ? ? 1_555 EI MG  .    MG  ? ? K HOH 2121 K MG  8069 1_555 ? ? ? ? ? ? ? 1.981 ? ? 
metalc855  metalc ?    ? PJ HOH .    O     ? ? ? 1_555 EI MG  .    MG  ? ? K HOH 7871 K MG  8069 1_555 ? ? ? ? ? ? ? 1.962 ? ? 
metalc856  metalc ?    ? N  GLY 30   O     ? ? ? 1_555 FI NA  .    NA  ? ? L GLY 29   L NA  8580 1_555 ? ? ? ? ? ? ? 2.917 ? ? 
metalc857  metalc ?    ? N  ALA 34   O     ? ? ? 1_555 FI NA  .    NA  ? ? L ALA 33   L NA  8580 1_555 ? ? ? ? ? ? ? 2.899 ? ? 
metalc858  metalc ?    ? N  GLU 40   OE1   ? ? ? 1_555 FI NA  .    NA  ? ? L GLU 39   L NA  8580 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc859  metalc ?    ? O  SER 107  O     ? ? ? 1_555 HI NA  .    NA  ? ? M SER 106  M NA  8547 1_555 ? ? ? ? ? ? ? 2.684 ? ? 
metalc860  metalc ?    ? O  SER 107  OG    ? ? ? 1_555 HI NA  .    NA  ? ? M SER 106  M NA  8547 1_555 ? ? ? ? ? ? ? 2.814 ? ? 
metalc861  metalc ?    ? O  PHE 110  O     ? ? ? 1_555 HI NA  .    NA  ? ? M PHE 109  M NA  8547 1_555 ? ? ? ? ? ? ? 2.879 ? ? 
metalc862  metalc ?    ? O  LEU 113  O     ? ? ? 1_555 HI NA  .    NA  ? ? M LEU 112  M NA  8547 1_555 ? ? ? ? ? ? ? 2.573 ? ? 
metalc863  metalc ?    ? HI NA  .    NA    ? ? ? 1_555 RJ HOH .    O   ? ? M NA  8547 M HOH 8927 1_555 ? ? ? ? ? ? ? 2.910 ? ? 
metalc864  metalc ?    ? Q  HIS 41   ND1   ? ? ? 1_555 KI CD  .    CD  ? ? O HIS 40   O CD  8705 1_555 ? ? ? ? ? ? ? 2.531 ? ? 
metalc865  metalc ?    ? TJ HOH .    O     ? ? ? 1_555 KI CD  .    CD  ? ? O HOH 5650 O CD  8705 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc866  metalc ?    ? S  ASP 21   O     ? ? ? 1_555 MI NA  .    NA  ? ? Q ASP 20   Q NA  8548 1_555 ? ? ? ? ? ? ? 2.616 ? ? 
metalc867  metalc ?    ? S  GLY 23   O     ? ? ? 1_555 MI NA  .    NA  ? ? Q GLY 22   Q NA  8548 1_555 ? ? ? ? ? ? ? 2.470 ? ? 
metalc868  metalc ?    ? S  SER 25   OG    ? ? ? 1_555 MI NA  .    NA  ? ? Q SER 24   Q NA  8548 1_555 ? ? ? ? ? ? ? 2.744 ? ? 
metalc869  metalc ?    ? S  SER 47   OG    ? ? ? 1_555 MI NA  .    NA  ? ? Q SER 46   Q NA  8548 1_555 ? ? ? ? ? ? ? 2.690 ? ? 
metalc870  metalc ?    ? VJ HOH .    O     ? ? ? 1_555 MI NA  .    NA  ? ? Q HOH 1795 Q NA  8548 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc871  metalc ?    ? T  SER 71   O     ? ? ? 1_555 NI NA  .    NA  ? ? R SER 70   R NA  8537 1_555 ? ? ? ? ? ? ? 2.660 ? ? 
metalc872  metalc ?    ? T  VAL 73   O     ? ? ? 1_555 NI NA  .    NA  ? ? R VAL 72   R NA  8537 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc873  metalc ?    ? T  VAL 73   O     ? ? ? 1_555 OI NA  .    NA  ? ? R VAL 72   R NA  8538 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc874  metalc ?    ? T  TRP 76   O     ? ? ? 1_555 OI NA  .    NA  ? ? R TRP 75   R NA  8538 1_555 ? ? ? ? ? ? ? 2.220 ? ? 
metalc875  metalc ?    ? NI NA  .    NA    ? ? ? 1_555 WJ HOH .    O   ? ? R NA  8537 R HOH 8822 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc876  metalc ?    ? NI NA  .    NA    ? ? ? 1_555 WJ HOH .    O   ? ? R NA  8537 R HOH 8824 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc877  metalc ?    ? OI NA  .    NA    ? ? ? 1_555 WJ HOH .    O   ? ? R NA  8538 R HOH 8813 1_555 ? ? ? ? ? ? ? 2.541 ? ? 
metalc878  metalc ?    ? OI NA  .    NA    ? ? ? 1_555 WJ HOH .    O   ? ? R NA  8538 R HOH 8824 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc879  metalc ?    ? U  HIS 8    NE2   ? ? ? 1_555 RI NA  .    NA  ? ? S HIS 7    S NA  8512 1_555 ? ? ? ? ? ? ? 2.590 ? ? 
metalc880  metalc ?    ? U  GLU 62   OE1   ? ? ? 1_555 RI NA  .    NA  ? ? S GLU 61   S NA  8512 1_555 ? ? ? ? ? ? ? 2.558 ? ? 
metalc881  metalc ?    ? U  GLU 62   OE2   ? ? ? 1_555 RI NA  .    NA  ? ? S GLU 61   S NA  8512 1_555 ? ? ? ? ? ? ? 2.156 ? ? 
metalc882  metalc ?    ? RI NA  .    NA    ? ? ? 1_555 XJ HOH .    O   ? ? S NA  8512 S HOH 8525 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc883  metalc ?    ? V  GLN 38   OE1   ? ? ? 1_555 SI MG  .    MG  ? ? T GLN 37   T MG  8073 1_555 ? ? ? ? ? ? ? 2.835 ? ? 
metalc884  metalc ?    ? V  SER 95   OG    ? ? ? 1_555 TI NA  .    NA  ? ? T SER 94   T NA  8543 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc885  metalc ?    ? V  ASN 96   OD1   ? ? ? 1_555 TI NA  .    NA  ? ? T ASN 95   T NA  8543 1_555 ? ? ? ? ? ? ? 2.562 ? ? 
metalc886  metalc ?    ? V  ARG 112  O     ? ? ? 1_555 SI MG  .    MG  ? ? T ARG 111  T MG  8073 1_555 ? ? ? ? ? ? ? 2.783 ? ? 
metalc887  metalc ?    ? V  LEU 113  O     ? ? ? 1_555 SI MG  .    MG  ? ? T LEU 112  T MG  8073 1_555 ? ? ? ? ? ? ? 3.044 ? ? 
metalc888  metalc ?    ? V  SER 115  O     ? ? ? 1_555 SI MG  .    MG  ? ? T SER 114  T MG  8073 1_555 ? ? ? ? ? ? ? 2.243 ? ? 
metalc889  metalc ?    ? V  ASP 118  O     ? ? ? 1_555 SI MG  .    MG  ? ? T ASP 117  T MG  8073 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc890  metalc ?    ? YJ HOH .    O     ? ? ? 1_555 TI NA  .    NA  ? ? T HOH 1124 T NA  8543 1_555 ? ? ? ? ? ? ? 2.766 ? ? 
metalc891  metalc ?    ? YJ HOH .    O     ? ? ? 1_555 SI MG  .    MG  ? ? T HOH 2868 T MG  8073 1_555 ? ? ? ? ? ? ? 2.744 ? ? 
metalc892  metalc ?    ? W  CYS 6    SG    ? ? ? 1_555 UI CD  .    CD  ? ? U CYS 6    U CD  8701 1_555 ? ? ? ? ? ? ? 2.493 ? ? 
metalc893  metalc ?    ? W  CYS 9    SG    ? ? ? 1_555 UI CD  .    CD  ? ? U CYS 9    U CD  8701 1_555 ? ? ? ? ? ? ? 2.545 ? ? 
metalc894  metalc ?    ? W  CYS 32   SG    ? ? ? 1_555 UI CD  .    CD  ? ? U CYS 32   U CD  8701 1_555 ? ? ? ? ? ? ? 2.417 ? ? 
metalc895  metalc ?    ? W  CYS 36   SG    ? ? ? 1_555 UI CD  .    CD  ? ? U CYS 36   U CD  8701 1_555 ? ? ? ? ? ? ? 2.432 ? ? 
metalc896  metalc ?    ? AA HIS 134  O     ? ? ? 1_555 VI MG  .    MG  ? ? Y HIS 133  Y MG  8108 1_555 ? ? ? ? ? ? ? 2.220 ? ? 
metalc897  metalc ?    ? AA LYS 137  O     ? ? ? 1_555 VI MG  .    MG  ? ? Y LYS 136  Y MG  8108 1_555 ? ? ? ? ? ? ? 2.468 ? ? 
metalc898  metalc ?    ? AA VAL 140  O     ? ? ? 1_555 VI MG  .    MG  ? ? Y VAL 139  Y MG  8108 1_555 ? ? ? ? ? ? ? 2.541 ? ? 
metalc899  metalc ?    ? VI MG  .    MG    ? ? ? 1_555 DK HOH .    O   ? ? Y MG  8108 Y HOH 8859 1_555 ? ? ? ? ? ? ? 2.656 ? ? 
metalc900  metalc ?    ? VI MG  .    MG    ? ? ? 1_555 DK HOH .    O   ? ? Y MG  8108 Y HOH 8880 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc901  metalc ?    ? VI MG  .    MG    ? ? ? 1_555 DK HOH .    O   ? ? Y MG  8108 Y HOH 8914 1_555 ? ? ? ? ? ? ? 2.543 ? ? 
metalc902  metalc ?    ? BA CYS 30   SG    ? ? ? 1_555 XI CD  .    CD  ? ? Z CYS 39   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc903  metalc ?    ? BA CYS 33   SG    ? ? ? 1_555 XI CD  .    CD  ? ? Z CYS 42   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc904  metalc ?    ? BA CYS 48   SG    ? ? ? 1_555 XI CD  .    CD  ? ? Z CYS 57   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.451 ? ? 
metalc905  metalc ?    ? BA CYS 51   SG    ? ? ? 1_555 XI CD  .    CD  ? ? Z CYS 60   Z CD  8703 1_555 ? ? ? ? ? ? ? 2.229 ? ? 
metalc906  metalc ?    ? CA CYS 20   SG    ? ? ? 1_555 YI CD  .    CD  ? ? 1 CYS 19   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.554 ? ? 
metalc907  metalc ?    ? CA CYS 23   SG    ? ? ? 1_555 YI CD  .    CD  ? ? 1 CYS 22   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.456 ? ? 
metalc908  metalc ?    ? CA CYS 35   SG    ? ? ? 1_555 YI CD  .    CD  ? ? 1 CYS 34   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.465 ? ? 
metalc909  metalc ?    ? CA CYS 38   SG    ? ? ? 1_555 YI CD  .    CD  ? ? 1 CYS 37   1 CD  8702 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc910  metalc ?    ? EA CYS 11   SG    ? ? ? 1_555 BJ CD  .    CD  ? ? 3 CYS 11   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc911  metalc ?    ? EA CYS 14   SG    ? ? ? 1_555 BJ CD  .    CD  ? ? 3 CYS 14   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.496 ? ? 
metalc912  metalc ?    ? EA GLY 45   O     ? ? ? 1_555 AJ MG  .    MG  ? ? 3 GLY 45   3 MG  8078 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc913  metalc ?    ? EA GLY 47   O     ? ? ? 1_555 AJ MG  .    MG  ? ? 3 GLY 47   3 MG  8078 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc914  metalc ?    ? EA ASP 49   OD2   ? ? ? 1_555 AJ MG  .    MG  ? ? 3 ASP 49   3 MG  8078 1_555 ? ? ? ? ? ? ? 2.738 ? ? 
metalc915  metalc ?    ? EA ASP 49   OD1   ? ? ? 1_555 AJ MG  .    MG  ? ? 3 ASP 49   3 MG  8078 1_555 ? ? ? ? ? ? ? 2.467 ? ? 
metalc916  metalc ?    ? EA CYS 71   SG    ? ? ? 1_555 BJ CD  .    CD  ? ? 3 CYS 71   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc917  metalc ?    ? EA CYS 74   SG    ? ? ? 1_555 BJ CD  .    CD  ? ? 3 CYS 74   3 CD  8704 1_555 ? ? ? ? ? ? ? 2.407 ? ? 
metalc918  metalc ?    ? AJ MG  .    MG    ? ? ? 1_555 HK HOH .    O   ? ? 3 MG  8078 3 HOH 8827 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc919  metalc ?    ? AJ MG  .    MG    ? ? ? 1_555 HK HOH .    O   ? ? 3 MG  8078 3 HOH 8881 1_555 ? ? ? ? ? ? ? 2.467 ? ? 
metalc920  metalc ?    ? AJ MG  .    MG    ? ? ? 1_555 HK HOH .    O   ? ? 3 MG  8078 3 HOH 8882 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc921  metalc ?    ? BJ CD  .    CD    ? ? ? 1_555 HK HOH .    O   ? ? 3 CD  8704 3 HOH 8865 1_555 ? ? ? ? ? ? ? 3.013 ? ? 
hydrog1    hydrog ?    ? A  U   12   O4    ? ? ? 1_555 A  G   531  N2  ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2    hydrog ?    ? A  G   13   N1    ? ? ? 1_555 A  C   530  N3  ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog3    hydrog ?    ? A  G   13   N2    ? ? ? 1_555 A  C   530  O2  ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog4    hydrog ?    ? A  G   13   O6    ? ? ? 1_555 A  C   530  N4  ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog5    hydrog ?    ? A  C   14   N3    ? ? ? 1_555 A  G   529  N1  ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog6    hydrog ?    ? A  C   14   N4    ? ? ? 1_555 A  G   529  O6  ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog7    hydrog ?    ? A  C   14   O2    ? ? ? 1_555 A  G   529  N2  ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog8    hydrog ?    ? A  C   15   N3    ? ? ? 1_555 A  G   528  N1  ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog9    hydrog ?    ? A  C   15   N4    ? ? ? 1_555 A  G   528  O6  ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog10   hydrog ?    ? A  C   15   O2    ? ? ? 1_555 A  G   528  N2  ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog11   hydrog ?    ? A  A   16   N1    ? ? ? 1_555 A  U   527  N3  ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog12   hydrog ?    ? A  A   16   N6    ? ? ? 1_555 A  U   527  O4  ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog13   hydrog ?    ? A  G   17   N1    ? ? ? 1_555 A  U   526  O2  ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog14   hydrog ?    ? A  G   17   O6    ? ? ? 1_555 A  U   526  N3  ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog15   hydrog ?    ? A  C   18   N3    ? ? ? 1_555 A  G   525  N1  ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog16   hydrog ?    ? A  C   18   N4    ? ? ? 1_555 A  G   525  O6  ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog17   hydrog ?    ? A  C   18   O2    ? ? ? 1_555 A  G   525  N2  ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog18   hydrog ?    ? A  U   19   N3    ? ? ? 1_555 A  A   524  N1  ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog19   hydrog ?    ? A  U   19   O4    ? ? ? 1_555 A  A   524  N6  ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog20   hydrog ?    ? A  G   20   N1    ? ? ? 1_555 A  C   523  N3  ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog21   hydrog ?    ? A  G   20   N2    ? ? ? 1_555 A  C   523  O2  ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog22   hydrog ?    ? A  G   20   O6    ? ? ? 1_555 A  C   523  N4  ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog23   hydrog ?    ? A  G   21   N1    ? ? ? 1_555 A  U   522  O2  ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog24   hydrog ?    ? A  G   21   O6    ? ? ? 1_555 A  U   522  N3  ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog25   hydrog ?    ? A  U   22   O2    ? ? ? 1_555 A  A   521  N6  ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog26   hydrog ?    ? A  G   23   N2    ? ? ? 1_555 A  A   520  N7  ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog27   hydrog ?    ? A  G   23   N3    ? ? ? 1_555 A  A   520  N6  ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog28   hydrog ?    ? A  G   24   N2    ? ? ? 1_555 A  A   519  N7  ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog29   hydrog ?    ? A  G   24   N3    ? ? ? 1_555 A  A   519  N6  ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog30   hydrog ?    ? A  A   25   N6    ? ? ? 1_555 A  G   518  N3  ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog31   hydrog ?    ? A  A   25   N7    ? ? ? 1_555 A  G   518  N2  ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog32   hydrog ?    ? A  U   26   N3    ? ? ? 1_555 A  U   517  O2  ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog33   hydrog ?    ? A  U   26   O4    ? ? ? 1_555 A  U   517  N3  ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog34   hydrog ?    ? A  U   27   N3    ? ? ? 1_555 A  A   516  N1  ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog35   hydrog ?    ? A  U   27   O4    ? ? ? 1_555 A  A   516  N6  ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog36   hydrog ?    ? A  G   28   N1    ? ? ? 1_555 A  C   480  N3  ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog37   hydrog ?    ? A  G   28   N2    ? ? ? 1_555 A  C   480  O2  ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog38   hydrog ?    ? A  G   28   O6    ? ? ? 1_555 A  C   480  N4  ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog39   hydrog ?    ? A  C   29   N3    ? ? ? 1_555 A  G   479  N1  ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog40   hydrog ?    ? A  C   29   N4    ? ? ? 1_555 A  G   479  O6  ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog41   hydrog ?    ? A  C   29   O2    ? ? ? 1_555 A  G   479  N2  ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog42   hydrog ?    ? A  U   30   N3    ? ? ? 1_555 A  A   453  N7  ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog43   hydrog ?    ? A  U   30   O2    ? ? ? 1_555 A  A   453  N6  ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog44   hydrog ?    ? A  G   32   N1    ? ? ? 1_555 A  C   451  N3  ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog45   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  C   451  O2  ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog46   hydrog ?    ? A  G   32   O6    ? ? ? 1_555 A  C   451  N4  ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog47   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  A   455  N1  ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog48   hydrog ?    ? A  G   32   N2    ? ? ? 1_555 A  G   456  N3  ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog49   hydrog ?    ? A  G   32   N3    ? ? ? 1_555 A  G   456  N2  ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog50   hydrog ?    ? A  G   33   N1    ? ? ? 1_555 A  C   450  N3  ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog51   hydrog ?    ? A  G   33   N2    ? ? ? 1_555 A  C   450  O2  ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog52   hydrog ?    ? A  G   33   O6    ? ? ? 1_555 A  C   450  N4  ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog53   hydrog ?    ? A  C   34   N3    ? ? ? 1_555 A  G   448  N1  ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog54   hydrog ?    ? A  C   34   N4    ? ? ? 1_555 A  G   448  O6  ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog55   hydrog ?    ? A  C   34   O2    ? ? ? 1_555 A  G   448  N2  ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog56   hydrog ?    ? A  U   35   N3    ? ? ? 1_555 A  A   447  N1  ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog57   hydrog ?    ? A  U   35   O4    ? ? ? 1_555 A  A   447  N6  ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog58   hydrog ?    ? A  C   36   N3    ? ? ? 1_555 A  G   446  N1  ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog59   hydrog ?    ? A  C   36   N4    ? ? ? 1_555 A  G   446  O6  ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog60   hydrog ?    ? A  C   36   O2    ? ? ? 1_555 A  G   446  N2  ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog61   hydrog ?    ? A  C   36   O2    ? ? ? 1_555 A  A   674  N6  ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog62   hydrog ?    ? A  A   37   N1    ? ? ? 1_555 A  U   445  N3  ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog63   hydrog ?    ? A  A   37   N6    ? ? ? 1_555 A  U   445  O4  ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog64   hydrog ?    ? A  G   38   N1    ? ? ? 1_555 A  C   444  N3  ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog65   hydrog ?    ? A  G   38   N2    ? ? ? 1_555 A  C   444  O2  ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog66   hydrog ?    ? A  G   38   O6    ? ? ? 1_555 A  C   444  N4  ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog67   hydrog ?    ? A  G   39   N1    ? ? ? 1_555 A  C   443  N3  ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog68   hydrog ?    ? A  G   39   N2    ? ? ? 1_555 A  C   443  O2  ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog69   hydrog ?    ? A  G   39   O6    ? ? ? 1_555 A  C   443  N4  ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog70   hydrog ?    ? A  C   40   N4    ? ? ? 1_555 A  A   441  N1  ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog71   hydrog ?    ? A  C   40   O2    ? ? ? 1_555 A  A   442  N6  ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog72   hydrog ?    ? A  G   41   N2    ? ? ? 1_555 A  A   151  N1  ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog73   hydrog ?    ? A  G   41   N1    ? ? ? 1_555 A  C   440  N3  ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog74   hydrog ?    ? A  G   41   N2    ? ? ? 1_555 A  C   440  O2  ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog75   hydrog ?    ? A  G   41   O6    ? ? ? 1_555 A  C   440  N4  ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog76   hydrog ?    ? A  C   42   N3    ? ? ? 1_555 A  G   149  N1  ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog77   hydrog ?    ? A  C   42   N4    ? ? ? 1_555 A  G   149  O6  ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog78   hydrog ?    ? A  C   42   O2    ? ? ? 1_555 A  G   149  N2  ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog79   hydrog ?    ? A  U   43   N3    ? ? ? 1_555 A  A   148  N1  ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog80   hydrog ?    ? A  U   43   O4    ? ? ? 1_555 A  A   148  N6  ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog81   hydrog ?    ? A  G   44   N2    ? ? ? 1_555 A  A   45   N1  ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog82   hydrog ?    ? A  A   45   N6    ? ? ? 1_555 A  U   115  O4  ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog83   hydrog ?    ? A  A   45   N7    ? ? ? 1_555 A  U   115  N3  ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog84   hydrog ?    ? A  G   47   N2    ? ? ? 1_555 A  A   113  N7  ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog85   hydrog ?    ? A  G   47   N3    ? ? ? 1_555 A  A   113  N6  ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog86   hydrog ?    ? A  A   48   N7    ? ? ? 1_555 A  A   114  N6  ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog87   hydrog ?    ? A  A   49   N6    ? ? ? 1_555 A  G   112  N3  ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog88   hydrog ?    ? A  A   49   N7    ? ? ? 1_555 A  G   112  N2  ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog89   hydrog ?    ? A  G   50   N1    ? ? ? 1_555 A  C   111  N3  ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog90   hydrog ?    ? A  G   50   N2    ? ? ? 1_555 A  C   111  O2  ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog91   hydrog ?    ? A  G   50   O6    ? ? ? 1_555 A  C   111  N4  ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog92   hydrog ?    ? A  G   51   N1    ? ? ? 1_555 A  C   110  N3  ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog93   hydrog ?    ? A  G   51   N2    ? ? ? 1_555 A  C   110  O2  ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog94   hydrog ?    ? A  G   51   O6    ? ? ? 1_555 A  C   110  N4  ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog95   hydrog ?    ? A  G   51   N2    ? ? ? 1_555 A  U   121  O2  ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog96   hydrog ?    ? A  A   52   N1    ? ? ? 1_555 A  U   109  N3  ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog97   hydrog ?    ? A  A   52   N6    ? ? ? 1_555 A  U   109  O4  ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog98   hydrog ?    ? A  C   53   N3    ? ? ? 1_555 A  G   66   N1  ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog99   hydrog ?    ? A  C   53   N4    ? ? ? 1_555 A  G   66   O6  ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog100  hydrog ?    ? A  C   53   O2    ? ? ? 1_555 A  G   66   N2  ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog101  hydrog ?    ? A  G   54   N1    ? ? ? 1_555 A  C   65   N3  ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog102  hydrog ?    ? A  G   54   N2    ? ? ? 1_555 A  C   65   O2  ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog103  hydrog ?    ? A  G   54   O6    ? ? ? 1_555 A  C   65   N4  ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog104  hydrog ?    ? A  G   54   N2    ? ? ? 1_555 A  A   69   N3  ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog105  hydrog ?    ? A  U   55   N3    ? ? ? 1_555 A  G   64   O6  ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog106  hydrog ?    ? A  U   55   O2    ? ? ? 1_555 A  G   64   N1  ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog107  hydrog ?    ? A  G   56   O6    ? ? ? 1_555 A  C   62   N4  ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog108  hydrog ?    ? A  G   56   N1    ? ? ? 1_555 A  G   84   O6  ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog109  hydrog ?    ? A  G   56   N2    ? ? ? 1_555 A  G   84   N7  ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog110  hydrog ?    ? A  C   57   N3    ? ? ? 1_555 A  G   89   N1  ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog111  hydrog ?    ? A  C   57   N4    ? ? ? 1_555 A  G   89   O6  ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog112  hydrog ?    ? A  C   57   O2    ? ? ? 1_555 A  G   89   N2  ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog113  hydrog ?    ? A  C   58   N3    ? ? ? 1_555 A  G   88   N1  ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog114  hydrog ?    ? A  C   58   N4    ? ? ? 1_555 A  G   88   O6  ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog115  hydrog ?    ? A  C   58   O2    ? ? ? 1_555 A  G   88   N2  ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog116  hydrog ?    ? A  A   59   N3    ? ? ? 1_555 A  A   60   N6  ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog117  hydrog ?    ? A  A   59   N1    ? ? ? 1_555 A  C   85   N4  ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog118  hydrog ?    ? A  A   60   N1    ? ? ? 1_555 A  A   86   N6  ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog119  hydrog ?    ? A  A   60   N6    ? ? ? 1_555 A  A   86   N1  ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog120  hydrog ?    ? A  G   61   N1    ? ? ? 1_555 A  C   85   N3  ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog121  hydrog ?    ? A  G   61   N2    ? ? ? 1_555 A  C   85   O2  ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog122  hydrog ?    ? A  G   61   O6    ? ? ? 1_555 A  C   85   N4  ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog123  hydrog ?    ? A  C   62   N3    ? ? ? 1_555 A  G   84   N1  ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog124  hydrog ?    ? A  C   62   N4    ? ? ? 1_555 A  G   84   O6  ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog125  hydrog ?    ? A  C   62   O2    ? ? ? 1_555 A  G   84   N2  ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog126  hydrog ?    ? A  U   63   N3    ? ? ? 1_555 A  A   70   N7  ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog127  hydrog ?    ? A  U   63   O4    ? ? ? 1_555 A  A   70   N6  ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog128  hydrog ?    ? A  G   66   N2    ? ? ? 1_555 A  A   67   N1  ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog129  hydrog ?    ? A  G   71   N1    ? ? ? 1_555 A  A   106  N1  ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog130  hydrog ?    ? A  G   71   O6    ? ? ? 1_555 A  A   106  N6  ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog131  hydrog ?    ? A  G   71   N1    ? ? ? 1_555 A  U   107  O2  ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog132  hydrog ?    ? A  C   72   N3    ? ? ? 1_555 A  G   105  N1  ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog133  hydrog ?    ? A  C   72   N4    ? ? ? 1_555 A  G   105  O6  ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog134  hydrog ?    ? A  C   72   O2    ? ? ? 1_555 A  G   105  N2  ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog135  hydrog ?    ? A  U   73   N3    ? ? ? 1_555 A  A   104  N1  ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog136  hydrog ?    ? A  U   73   O4    ? ? ? 1_555 A  A   104  N6  ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog137  hydrog ?    ? A  G   74   N1    ? ? ? 1_555 A  C   103  N3  ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog138  hydrog ?    ? A  G   74   N2    ? ? ? 1_555 A  C   103  O2  ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog139  hydrog ?    ? A  G   74   O6    ? ? ? 1_555 A  C   103  N4  ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog140  hydrog ?    ? A  U   75   N3    ? ? ? 1_555 A  A   102  N1  ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog141  hydrog ?    ? A  U   75   O4    ? ? ? 1_555 A  A   102  N6  ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog142  hydrog ?    ? A  G   76   N1    ? ? ? 1_555 A  C   101  N3  ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog143  hydrog ?    ? A  G   76   N2    ? ? ? 1_555 A  C   101  O2  ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog144  hydrog ?    ? A  G   76   O6    ? ? ? 1_555 A  C   101  N4  ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog145  hydrog ?    ? A  G   77   N1    ? ? ? 1_555 A  C   100  N3  ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog146  hydrog ?    ? A  G   77   N2    ? ? ? 1_555 A  C   100  O2  ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog147  hydrog ?    ? A  G   77   O6    ? ? ? 1_555 A  C   100  N4  ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog148  hydrog ?    ? A  G   78   N2    ? ? ? 1_555 A  A   99   N7  ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog149  hydrog ?    ? A  G   78   N3    ? ? ? 1_555 A  A   99   N6  ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog150  hydrog ?    ? A  G   79   N2    ? ? ? 1_555 A  A   98   N7  ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog151  hydrog ?    ? A  A   80   N3    ? ? ? 1_555 A  G   94   N2  ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog152  hydrog ?    ? A  A   80   N6    ? ? ? 1_555 A  G   97   N3  ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog153  hydrog ?    ? A  A   80   N7    ? ? ? 1_555 A  G   97   N2  ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog154  hydrog ?    ? A  G   81   N1    ? ? ? 1_555 A  C   93   N3  ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog155  hydrog ?    ? A  G   81   N2    ? ? ? 1_555 A  C   93   O2  ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog156  hydrog ?    ? A  G   81   O6    ? ? ? 1_555 A  C   93   N4  ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog157  hydrog ?    ? A  G   81   N2    ? ? ? 1_555 A  A   98   N3  ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog158  hydrog ?    ? A  C   82   N3    ? ? ? 1_555 A  G   92   N1  ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog159  hydrog ?    ? A  C   82   N4    ? ? ? 1_555 A  G   92   O6  ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog160  hydrog ?    ? A  C   82   O2    ? ? ? 1_555 A  G   92   N2  ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog161  hydrog ?    ? A  C   83   N3    ? ? ? 1_555 A  G   91   N1  ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog162  hydrog ?    ? A  C   83   N4    ? ? ? 1_555 A  G   91   O6  ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog163  hydrog ?    ? A  C   83   O2    ? ? ? 1_555 A  G   91   N2  ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog164  hydrog ?    ? A  G   116  N1    ? ? ? 1_555 A  C   124  N3  ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog165  hydrog ?    ? A  G   116  N2    ? ? ? 1_555 A  C   124  O2  ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog166  hydrog ?    ? A  G   116  O6    ? ? ? 1_555 A  C   124  N4  ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog167  hydrog ?    ? A  A   117  N1    ? ? ? 1_555 A  U   123  N3  ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog168  hydrog ?    ? A  A   117  N6    ? ? ? 1_555 A  U   123  O4  ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog169  hydrog ?    ? A  G   118  N1    ? ? ? 1_555 A  C   122  N3  ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog170  hydrog ?    ? A  G   118  N2    ? ? ? 1_555 A  C   122  O2  ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog171  hydrog ?    ? A  G   118  O6    ? ? ? 1_555 A  C   122  N4  ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog172  hydrog ?    ? A  U   125  N3    ? ? ? 1_555 A  A   129  N1  ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog173  hydrog ?    ? A  U   125  O4    ? ? ? 1_555 A  A   129  N6  ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog174  hydrog ?    ? A  C   130  N4    ? ? ? 1_555 A  A   144  N7  ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog175  hydrog ?    ? A  C   130  O2    ? ? ? 1_555 A  A   145  N6  ? ? 0 C   130  0 A   145  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog176  hydrog ?    ? A  A   131  N6    ? ? ? 1_555 A  G   147  N7  ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog177  hydrog ?    ? A  A   132  N1    ? ? ? 1_555 A  U   146  N3  ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog178  hydrog ?    ? A  A   132  N6    ? ? ? 1_555 A  U   146  O4  ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog179  hydrog ?    ? A  U   133  N3    ? ? ? 1_555 A  A   145  N1  ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog180  hydrog ?    ? A  U   133  O4    ? ? ? 1_555 A  A   145  N6  ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog181  hydrog ?    ? A  U   134  N3    ? ? ? 1_555 A  A   144  N1  ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog182  hydrog ?    ? A  U   134  O4    ? ? ? 1_555 A  A   144  N6  ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog183  hydrog ?    ? A  G   135  N1    ? ? ? 1_555 A  C   143  N3  ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog184  hydrog ?    ? A  G   135  N2    ? ? ? 1_555 A  C   143  O2  ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog185  hydrog ?    ? A  G   135  O6    ? ? ? 1_555 A  C   143  N4  ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog186  hydrog ?    ? A  C   136  N3    ? ? ? 1_555 A  G   142  N1  ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog187  hydrog ?    ? A  C   136  N4    ? ? ? 1_555 A  G   142  O6  ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog188  hydrog ?    ? A  C   136  O2    ? ? ? 1_555 A  G   142  N2  ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog189  hydrog ?    ? A  U   137  O2    ? ? ? 1_555 A  G   140  N1  ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog190  hydrog ?    ? A  C   141  O2    ? ? ? 1_555 A  C   143  N4  ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog191  hydrog ?    ? A  C   141  N3    ? ? ? 1_555 A  A   144  N6  ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog192  hydrog ?    ? A  A   152  N1    ? ? ? 1_555 A  G   185  N1  ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog193  hydrog ?    ? A  A   152  N6    ? ? ? 1_555 A  G   185  O6  ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog194  hydrog ?    ? A  C   153  N3    ? ? ? 1_555 A  G   184  N1  ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog195  hydrog ?    ? A  C   153  N4    ? ? ? 1_555 A  G   184  O6  ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog196  hydrog ?    ? A  C   153  O2    ? ? ? 1_555 A  G   184  N2  ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog197  hydrog ?    ? A  C   154  N3    ? ? ? 1_555 A  G   182  N1  ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog198  hydrog ?    ? A  C   154  N4    ? ? ? 1_555 A  G   182  O6  ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog199  hydrog ?    ? A  C   154  O2    ? ? ? 1_555 A  G   182  N2  ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog200  hydrog ?    ? A  C   155  N3    ? ? ? 1_555 A  G   181  N1  ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog201  hydrog ?    ? A  C   155  N4    ? ? ? 1_555 A  G   181  O6  ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog202  hydrog ?    ? A  C   155  O2    ? ? ? 1_555 A  G   181  N2  ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog203  hydrog ?    ? A  C   156  N3    ? ? ? 1_555 A  G   180  N1  ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog204  hydrog ?    ? A  C   156  N4    ? ? ? 1_555 A  G   180  O6  ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog205  hydrog ?    ? A  C   156  O2    ? ? ? 1_555 A  G   180  N2  ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog206  hydrog ?    ? A  G   157  N1    ? ? ? 1_555 A  C   179  N3  ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog207  hydrog ?    ? A  G   157  N2    ? ? ? 1_555 A  C   179  O2  ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog208  hydrog ?    ? A  G   157  O6    ? ? ? 1_555 A  C   179  N4  ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog209  hydrog ?    ? A  G   157  N2    ? ? ? 1_555 A  A   1470 N1  ? ? 0 G   157  0 A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog210  hydrog ?    ? A  A   158  N1    ? ? ? 1_555 A  U   178  N3  ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog211  hydrog ?    ? A  A   158  N6    ? ? ? 1_555 A  U   178  O4  ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog212  hydrog ?    ? A  G   159  N2    ? ? ? 1_555 A  A   177  N7  ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog213  hydrog ?    ? A  G   159  N3    ? ? ? 1_555 A  A   177  N6  ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog214  hydrog ?    ? A  A   160  N6    ? ? ? 1_555 A  U   176  O2  ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog215  hydrog ?    ? A  A   160  N7    ? ? ? 1_555 A  U   176  N3  ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog216  hydrog ?    ? A  A   161  N6    ? ? ? 1_555 A  A   174  N7  ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog217  hydrog ?    ? A  A   161  N7    ? ? ? 1_555 A  A   174  N6  ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog218  hydrog ?    ? A  A   161  N3    ? ? ? 1_555 A  G   892  N2  ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog219  hydrog ?    ? A  C   162  N4    ? ? ? 1_555 A  C   173  O2  ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog220  hydrog ?    ? A  C   162  O2    ? ? ? 1_555 A  C   893  N4  ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog221  hydrog ?    ? A  U   163  N3    ? ? ? 1_555 A  U   172  O2  ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog222  hydrog ?    ? A  U   163  O4    ? ? ? 1_555 A  U   172  N3  ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog223  hydrog ?    ? A  G   164  N1    ? ? ? 1_555 A  C   171  N3  ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog224  hydrog ?    ? A  G   164  N2    ? ? ? 1_555 A  C   171  O2  ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog225  hydrog ?    ? A  G   164  O6    ? ? ? 1_555 A  C   171  N4  ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog226  hydrog ?    ? A  G   164  N2    ? ? ? 1_555 A  A   222  N3  ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog227  hydrog ?    ? A  A   165  N3    ? ? ? 1_555 A  G   221  N2  ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog228  hydrog ?    ? A  A   166  N1    ? ? ? 1_555 A  G   924  N2  ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog229  hydrog ?    ? A  A   166  N6    ? ? ? 1_555 A  G   924  N3  ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog230  hydrog ?    ? A  C   168  N3    ? ? ? 1_555 A  G   219  N1  ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog231  hydrog ?    ? A  C   168  N4    ? ? ? 1_555 A  G   219  O6  ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog232  hydrog ?    ? A  C   168  O2    ? ? ? 1_555 A  G   219  N2  ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog233  hydrog ?    ? A  U   170  N3    ? ? ? 1_555 A  G   221  O6  ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? 
? ? 
hydrog234  hydrog ?    ? A  U   170  O4    ? ? ? 1_555 A  G   221  N1  ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? 
? ? 
hydrog235  hydrog ?    ? A  C   171  O2    ? ? ? 1_555 A  G   221  N1  ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog236  hydrog ?    ? A  G   175  N2    ? ? ? 1_555 A  U   176  O4  ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog237  hydrog ?    ? A  G   185  N2    ? ? ? 1_555 A  A   439  N1  ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog238  hydrog ?    ? A  G   190  N2    ? ? ? 1_555 A  A   435  N7  ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog239  hydrog ?    ? A  A   191  N6    ? ? ? 1_555 A  A   236  N3  ? ? 0 A   191  0 A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog240  hydrog ?    ? A  A   191  N6    ? ? ? 1_555 A  U   434  O2  ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog241  hydrog ?    ? A  A   191  N7    ? ? ? 1_555 A  U   434  N3  ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog242  hydrog ?    ? A  A   192  N6    ? ? ? 1_555 A  G   203  N3  ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog243  hydrog ?    ? A  A   192  N7    ? ? ? 1_555 A  G   203  N2  ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog244  hydrog ?    ? A  A   193  N3    ? ? ? 1_555 A  G   413  N2  ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog245  hydrog ?    ? A  A   194  N1    ? ? ? 1_555 A  U   202  N3  ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog246  hydrog ?    ? A  A   194  N6    ? ? ? 1_555 A  U   202  O4  ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog247  hydrog ?    ? A  C   195  N3    ? ? ? 1_555 A  G   201  N1  ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog248  hydrog ?    ? A  C   195  N4    ? ? ? 1_555 A  G   201  O6  ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog249  hydrog ?    ? A  C   195  O2    ? ? ? 1_555 A  G   201  N2  ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog250  hydrog ?    ? A  G   196  N2    ? ? ? 1_555 A  A   199  N7  ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog251  hydrog ?    ? A  G   196  N3    ? ? ? 1_555 A  A   199  N6  ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog252  hydrog ?    ? A  G   196  N1    ? ? ? 1_555 A  U   425  O2  ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog253  hydrog ?    ? A  A   198  N1    ? ? ? 1_555 A  G   416  N2  ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog254  hydrog ?    ? A  A   198  N6    ? ? ? 1_555 A  G   416  N3  ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog255  hydrog ?    ? A  A   204  N1    ? ? ? 1_555 A  A   436  N6  ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog256  hydrog ?    ? A  A   204  N6    ? ? ? 1_555 A  A   436  N1  ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog257  hydrog ?    ? A  U   205  N3    ? ? ? 1_555 A  A   437  N1  ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog258  hydrog ?    ? A  U   205  O2    ? ? ? 1_555 A  A   437  N6  ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog259  hydrog ?    ? A  G   206  N1    ? ? ? 1_555 A  U   233  O2  ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog260  hydrog ?    ? A  G   206  O6    ? ? ? 1_555 A  U   233  N3  ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog261  hydrog ?    ? A  U   207  N3    ? ? ? 1_555 A  A   232  N1  ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog262  hydrog ?    ? A  U   207  O4    ? ? ? 1_555 A  A   232  N6  ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog263  hydrog ?    ? A  C   208  N3    ? ? ? 1_555 A  G   231  N1  ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog264  hydrog ?    ? A  C   208  N4    ? ? ? 1_555 A  G   231  O6  ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog265  hydrog ?    ? A  C   208  O2    ? ? ? 1_555 A  G   231  N2  ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog266  hydrog ?    ? A  G   209  N1    ? ? ? 1_555 A  C   230  N3  ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog267  hydrog ?    ? A  G   209  N2    ? ? ? 1_555 A  C   230  O2  ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog268  hydrog ?    ? A  G   209  O6    ? ? ? 1_555 A  C   230  N4  ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog269  hydrog ?    ? A  U   210  N3    ? ? ? 1_555 A  G   229  O6  ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog270  hydrog ?    ? A  U   210  O2    ? ? ? 1_555 A  G   229  N1  ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog271  hydrog ?    ? A  U   211  O2    ? ? ? 1_555 A  C   228  N4  ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog272  hydrog ?    ? A  A   212  N6    ? ? ? 1_555 A  A   227  N7  ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog273  hydrog ?    ? A  A   212  N7    ? ? ? 1_555 A  A   227  N6  ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog274  hydrog ?    ? A  G   213  N2    ? ? ? 1_555 A  U   214  O4  ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog275  hydrog ?    ? A  U   214  N3    ? ? ? 1_555 A  A   226  N7  ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog276  hydrog ?    ? A  U   214  O2    ? ? ? 1_555 A  A   226  N6  ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog277  hydrog ?    ? A  A   215  N6    ? ? ? 1_555 A  G   225  N3  ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog278  hydrog ?    ? A  A   215  N7    ? ? ? 1_555 A  G   225  N2  ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog279  hydrog ?    ? A  A   216  N1    ? ? ? 1_555 A  U   224  N3  ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog280  hydrog ?    ? A  A   216  N6    ? ? ? 1_555 A  U   224  O4  ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog281  hydrog ?    ? A  C   217  N3    ? ? ? 1_555 A  G   223  N1  ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog282  hydrog ?    ? A  C   217  N4    ? ? ? 1_555 A  G   223  O6  ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog283  hydrog ?    ? A  C   217  O2    ? ? ? 1_555 A  G   223  N2  ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog284  hydrog ?    ? A  C   218  O2    ? ? ? 1_555 A  A   222  N6  ? ? 0 C   218  0 A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog285  hydrog ?    ? A  G   231  N2    ? ? ? 1_555 A  A   666  N3  ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog286  hydrog ?    ? A  G   237  N1    ? ? ? 1_555 A  C   433  N3  ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog287  hydrog ?    ? A  G   237  N2    ? ? ? 1_555 A  C   433  O2  ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog288  hydrog ?    ? A  G   237  O6    ? ? ? 1_555 A  C   433  N4  ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog289  hydrog ?    ? A  C   238  N3    ? ? ? 1_555 A  G   432  N1  ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog290  hydrog ?    ? A  C   238  N4    ? ? ? 1_555 A  G   432  O6  ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog291  hydrog ?    ? A  C   238  O2    ? ? ? 1_555 A  G   432  N2  ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog292  hydrog ?    ? A  C   239  N3    ? ? ? 1_555 A  G   431  N1  ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog293  hydrog ?    ? A  C   239  N4    ? ? ? 1_555 A  G   431  O6  ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog294  hydrog ?    ? A  C   239  O2    ? ? ? 1_555 A  G   431  N2  ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog295  hydrog ?    ? A  C   240  N3    ? ? ? 1_555 A  G   379  N1  ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog296  hydrog ?    ? A  C   240  N4    ? ? ? 1_555 A  G   379  O6  ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog297  hydrog ?    ? A  C   240  O2    ? ? ? 1_555 A  G   379  N2  ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog298  hydrog ?    ? A  A   241  N6    ? ? ? 1_555 A  U   270  O2  ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog299  hydrog ?    ? A  A   241  N7    ? ? ? 1_555 A  U   270  N3  ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog300  hydrog ?    ? A  A   242  N6    ? ? ? 1_555 A  G   269  N3  ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog301  hydrog ?    ? A  A   242  N7    ? ? ? 1_555 A  G   269  N2  ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog302  hydrog ?    ? A  A   243  N6    ? ? ? 1_555 A  U   268  O2  ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog303  hydrog ?    ? A  A   243  N3    ? ? ? 1_555 A  G   274  N2  ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog304  hydrog ?    ? A  C   244  N3    ? ? ? 1_555 A  G   267  N1  ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog305  hydrog ?    ? A  C   244  N4    ? ? ? 1_555 A  G   267  O6  ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog306  hydrog ?    ? A  C   244  O2    ? ? ? 1_555 A  G   267  N2  ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog307  hydrog ?    ? A  C   245  N3    ? ? ? 1_555 A  G   266  N1  ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog308  hydrog ?    ? A  C   245  N4    ? ? ? 1_555 A  G   266  O6  ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog309  hydrog ?    ? A  C   245  O2    ? ? ? 1_555 A  G   266  N2  ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog310  hydrog ?    ? A  G   246  N2    ? ? ? 1_555 A  U   265  O4  ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog311  hydrog ?    ? A  A   247  N6    ? ? ? 1_555 A  G   264  N3  ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog312  hydrog ?    ? A  A   247  N7    ? ? ? 1_555 A  G   264  N2  ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog313  hydrog ?    ? A  A   248  N1    ? ? ? 1_555 A  U   265  N3  ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog314  hydrog ?    ? A  A   248  N6    ? ? ? 1_555 A  U   265  O4  ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog315  hydrog ?    ? A  G   249  N1    ? ? ? 1_555 A  C   260  N3  ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog316  hydrog ?    ? A  G   249  N2    ? ? ? 1_555 A  C   260  O2  ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog317  hydrog ?    ? A  G   249  O6    ? ? ? 1_555 A  C   260  N4  ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog318  hydrog ?    ? A  C   250  N3    ? ? ? 1_555 A  G   259  N1  ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog319  hydrog ?    ? A  C   250  N4    ? ? ? 1_555 A  G   259  O6  ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog320  hydrog ?    ? A  C   250  O2    ? ? ? 1_555 A  G   259  N2  ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog321  hydrog ?    ? A  C   251  N3    ? ? ? 1_555 A  G   258  N1  ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog322  hydrog ?    ? A  C   251  N4    ? ? ? 1_555 A  G   258  O6  ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog323  hydrog ?    ? A  C   251  O2    ? ? ? 1_555 A  G   258  N2  ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog324  hydrog ?    ? A  C   252  N3    ? ? ? 1_555 A  G   257  N1  ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog325  hydrog ?    ? A  C   252  N4    ? ? ? 1_555 A  G   257  O6  ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog326  hydrog ?    ? A  C   252  O2    ? ? ? 1_555 A  G   257  N2  ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog327  hydrog ?    ? A  U   253  O2    ? ? ? 1_555 A  C   256  N4  ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog328  hydrog ?    ? A  U   253  N3    ? ? ? 1_555 A  G   257  O6  ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog329  hydrog ?    ? A  U   253  O2    ? ? ? 1_555 A  G   257  N1  ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog330  hydrog ?    ? A  C   271  N4    ? ? ? 1_555 A  A   378  N1  ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog331  hydrog ?    ? A  G   273  N1    ? ? ? 1_555 A  C   377  N3  ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog332  hydrog ?    ? A  G   273  N2    ? ? ? 1_555 A  C   377  O2  ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog333  hydrog ?    ? A  G   273  O6    ? ? ? 1_555 A  C   377  N4  ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog334  hydrog ?    ? A  G   274  N1    ? ? ? 1_555 A  C   376  N3  ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog335  hydrog ?    ? A  G   274  N2    ? ? ? 1_555 A  C   376  O2  ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog336  hydrog ?    ? A  G   274  O6    ? ? ? 1_555 A  C   376  N4  ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog337  hydrog ?    ? A  G   275  N1    ? ? ? 1_555 A  U   374  O2  ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog338  hydrog ?    ? A  G   275  O6    ? ? ? 1_555 A  U   374  N3  ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog339  hydrog ?    ? A  C   276  N3    ? ? ? 1_555 A  G   373  N1  ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog340  hydrog ?    ? A  C   276  N4    ? ? ? 1_555 A  G   373  O6  ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog341  hydrog ?    ? A  C   276  O2    ? ? ? 1_555 A  G   373  N2  ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog342  hydrog ?    ? A  U   277  N3    ? ? ? 1_555 A  A   372  N1  ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog343  hydrog ?    ? A  U   277  O4    ? ? ? 1_555 A  A   372  N6  ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog344  hydrog ?    ? A  A   278  N1    ? ? ? 1_555 A  U   371  N3  ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog345  hydrog ?    ? A  A   278  N6    ? ? ? 1_555 A  U   371  O4  ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog346  hydrog ?    ? A  C   279  N3    ? ? ? 1_555 A  G   370  N1  ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog347  hydrog ?    ? A  C   279  N4    ? ? ? 1_555 A  G   370  O6  ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog348  hydrog ?    ? A  C   279  O2    ? ? ? 1_555 A  G   370  N2  ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog349  hydrog ?    ? A  C   280  N3    ? ? ? 1_555 A  G   369  N1  ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog350  hydrog ?    ? A  C   280  N4    ? ? ? 1_555 A  G   369  O6  ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog351  hydrog ?    ? A  C   280  O2    ? ? ? 1_555 A  G   369  N2  ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog352  hydrog ?    ? A  U   281  O2    ? ? ? 1_555 A  C   368  N4  ? ? 0 U   281  0 C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog353  hydrog ?    ? A  C   282  O2    ? ? ? 1_555 A  C   368  N4  ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog354  hydrog ?    ? A  C   284  O2    ? ? ? 1_555 A  G   367  N1  ? ? 0 C   284  0 G   367  1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog355  hydrog ?    ? A  A   285  N6    ? ? ? 1_555 A  G   367  N3  ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog356  hydrog ?    ? A  A   285  N7    ? ? ? 1_555 A  G   367  N2  ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog357  hydrog ?    ? A  U   286  N3    ? ? ? 1_555 A  U   366  O2  ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog358  hydrog ?    ? A  U   286  O4    ? ? ? 1_555 A  U   366  N3  ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog359  hydrog ?    ? A  C   287  N3    ? ? ? 1_555 A  G   365  N1  ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog360  hydrog ?    ? A  C   287  N4    ? ? ? 1_555 A  G   365  O6  ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog361  hydrog ?    ? A  C   287  O2    ? ? ? 1_555 A  G   365  N2  ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog362  hydrog ?    ? A  A   288  N1    ? ? ? 1_555 A  U   364  N3  ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog363  hydrog ?    ? A  A   288  N6    ? ? ? 1_555 A  U   364  O4  ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog364  hydrog ?    ? A  G   289  N1    ? ? ? 1_555 A  C   363  N3  ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog365  hydrog ?    ? A  G   289  N2    ? ? ? 1_555 A  C   363  O2  ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog366  hydrog ?    ? A  G   289  O6    ? ? ? 1_555 A  C   363  N4  ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog367  hydrog ?    ? A  C   290  N3    ? ? ? 1_555 A  G   362  N1  ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog368  hydrog ?    ? A  C   290  N4    ? ? ? 1_555 A  G   362  O6  ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog369  hydrog ?    ? A  C   290  O2    ? ? ? 1_555 A  G   362  N2  ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog370  hydrog ?    ? A  C   291  N3    ? ? ? 1_555 A  C   361  N4  ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog371  hydrog ?    ? A  G   292  N2    ? ? ? 1_555 A  A   360  N7  ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog372  hydrog ?    ? A  G   292  N3    ? ? ? 1_555 A  A   360  N6  ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog373  hydrog ?    ? A  A   293  N6    ? ? ? 1_555 A  U   359  O2  ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog374  hydrog ?    ? A  A   293  N7    ? ? ? 1_555 A  U   359  N3  ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog375  hydrog ?    ? A  C   295  N4    ? ? ? 1_555 A  C   356  O2  ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog376  hydrog ?    ? A  G   296  N1    ? ? ? 1_555 A  C   355  N3  ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog377  hydrog ?    ? A  G   296  N2    ? ? ? 1_555 A  C   355  O2  ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog378  hydrog ?    ? A  G   296  O6    ? ? ? 1_555 A  C   355  N4  ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog379  hydrog ?    ? A  U   297  N3    ? ? ? 1_555 A  A   354  N1  ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog380  hydrog ?    ? A  U   297  O4    ? ? ? 1_555 A  A   354  N6  ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog381  hydrog ?    ? A  C   298  N3    ? ? ? 1_555 A  G   353  N1  ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog382  hydrog ?    ? A  C   298  N4    ? ? ? 1_555 A  G   353  O6  ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog383  hydrog ?    ? A  C   298  O2    ? ? ? 1_555 A  G   353  N2  ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog384  hydrog ?    ? A  U   299  N3    ? ? ? 1_555 A  A   352  N1  ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog385  hydrog ?    ? A  U   299  O4    ? ? ? 1_555 A  A   352  N6  ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog386  hydrog ?    ? A  U   300  N3    ? ? ? 1_555 A  A   351  N1  ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog387  hydrog ?    ? A  U   300  O4    ? ? ? 1_555 A  A   351  N6  ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog388  hydrog ?    ? A  C   301  N3    ? ? ? 1_555 A  G   350  N1  ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog389  hydrog ?    ? A  C   301  N4    ? ? ? 1_555 A  G   350  O6  ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog390  hydrog ?    ? A  C   301  O2    ? ? ? 1_555 A  G   350  N2  ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog391  hydrog ?    ? A  A   302  N1    ? ? ? 1_555 A  U   349  N3  ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog392  hydrog ?    ? A  A   302  N6    ? ? ? 1_555 A  U   349  O4  ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog393  hydrog ?    ? A  C   303  N3    ? ? ? 1_555 A  C   348  N4  ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog394  hydrog ?    ? A  G   304  N2    ? ? ? 1_555 A  A   347  N7  ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog395  hydrog ?    ? A  G   304  N3    ? ? ? 1_555 A  A   347  N6  ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog396  hydrog ?    ? A  A   305  N6    ? ? ? 1_555 A  G   345  O6  ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog397  hydrog ?    ? A  A   306  N6    ? ? ? 1_555 A  G   345  O6  ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog398  hydrog ?    ? A  G   307  N1    ? ? ? 1_555 A  C   323  N3  ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog399  hydrog ?    ? A  G   307  N2    ? ? ? 1_555 A  C   323  O2  ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog400  hydrog ?    ? A  G   307  O6    ? ? ? 1_555 A  C   323  N4  ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog401  hydrog ?    ? A  U   308  N3    ? ? ? 1_555 A  A   339  N1  ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog402  hydrog ?    ? A  U   308  O4    ? ? ? 1_555 A  A   339  N6  ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog403  hydrog ?    ? A  C   309  N3    ? ? ? 1_555 A  G   322  N1  ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog404  hydrog ?    ? A  C   309  N4    ? ? ? 1_555 A  G   322  O6  ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog405  hydrog ?    ? A  C   309  O2    ? ? ? 1_555 A  G   322  N2  ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog406  hydrog ?    ? A  U   310  N3    ? ? ? 1_555 A  A   321  N1  ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog407  hydrog ?    ? A  U   310  O4    ? ? ? 1_555 A  A   321  N6  ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog408  hydrog ?    ? A  C   311  N3    ? ? ? 1_555 A  G   320  N1  ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog409  hydrog ?    ? A  C   311  N4    ? ? ? 1_555 A  G   320  O6  ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog410  hydrog ?    ? A  C   311  O2    ? ? ? 1_555 A  G   320  N2  ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog411  hydrog ?    ? A  U   312  N3    ? ? ? 1_555 A  A   319  N1  ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog412  hydrog ?    ? A  U   312  O4    ? ? ? 1_555 A  A   319  N6  ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog413  hydrog ?    ? A  U   313  N3    ? ? ? 1_555 A  A   317  N7  ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog414  hydrog ?    ? A  U   313  O2    ? ? ? 1_555 A  A   317  N6  ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog415  hydrog ?    ? A  G   314  N2    ? ? ? 1_555 A  A   337  N1  ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog416  hydrog ?    ? A  G   314  N3    ? ? ? 1_555 A  A   337  N6  ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog417  hydrog ?    ? A  G   315  N2    ? ? ? 1_555 A  G   336  N3  ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog418  hydrog ?    ? A  G   315  N3    ? ? ? 1_555 A  G   336  N2  ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog419  hydrog ?    ? A  A   316  N6    ? ? ? 1_555 A  U   1314 O2  ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog420  hydrog ?    ? A  G   324  N1    ? ? ? 1_555 A  C   341  N3  ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog421  hydrog ?    ? A  G   324  N2    ? ? ? 1_555 A  C   341  O2  ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog422  hydrog ?    ? A  G   324  O6    ? ? ? 1_555 A  C   341  N4  ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog423  hydrog ?    ? A  U   325  N3    ? ? ? 1_555 A  A   340  N1  ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog424  hydrog ?    ? A  U   325  O4    ? ? ? 1_555 A  A   340  N6  ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog425  hydrog ?    ? A  G   326  N1    ? ? ? 1_555 A  C   330  N3  ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog426  hydrog ?    ? A  G   326  N2    ? ? ? 1_555 A  C   330  O2  ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog427  hydrog ?    ? A  G   326  O6    ? ? ? 1_555 A  C   330  N4  ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog428  hydrog ?    ? A  A   329  N3    ? ? ? 1_555 A  U   346  N3  ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog429  hydrog ?    ? A  A   331  N6    ? ? ? 1_555 A  G   345  N3  ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog430  hydrog ?    ? A  A   331  N7    ? ? ? 1_555 A  G   345  N2  ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog431  hydrog ?    ? A  G   332  N1    ? ? ? 1_555 A  C   344  N3  ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog432  hydrog ?    ? A  G   332  N2    ? ? ? 1_555 A  C   344  O2  ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog433  hydrog ?    ? A  G   332  O6    ? ? ? 1_555 A  C   344  N4  ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog434  hydrog ?    ? A  G   333  N1    ? ? ? 1_555 A  C   343  N3  ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog435  hydrog ?    ? A  G   333  N2    ? ? ? 1_555 A  C   343  O2  ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog436  hydrog ?    ? A  G   333  O6    ? ? ? 1_555 A  C   343  N4  ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog437  hydrog ?    ? A  G   334  N1    ? ? ? 1_555 A  C   342  N3  ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog438  hydrog ?    ? A  G   334  N2    ? ? ? 1_555 A  C   342  O2  ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog439  hydrog ?    ? A  G   334  O6    ? ? ? 1_555 A  C   342  N4  ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog440  hydrog ?    ? A  U   335  N3    ? ? ? 1_555 A  A   339  N7  ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog441  hydrog ?    ? A  U   335  O2    ? ? ? 1_555 A  A   339  N6  ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog442  hydrog ?    ? A  G   358  N2    ? ? ? 1_555 A  U   359  O4  ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog443  hydrog ?    ? A  A   380  N6    ? ? ? 1_555 A  A   408  N7  ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog444  hydrog ?    ? A  A   380  N7    ? ? ? 1_555 A  A   408  N6  ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog445  hydrog ?    ? A  G   381  N2    ? ? ? 1_555 A  U   382  O4  ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog446  hydrog ?    ? A  U   382  N3    ? ? ? 1_555 A  A   407  N7  ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog447  hydrog ?    ? A  U   382  O2    ? ? ? 1_555 A  A   407  N6  ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog448  hydrog ?    ? A  A   383  N6    ? ? ? 1_555 A  G   406  N3  ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog449  hydrog ?    ? A  A   383  N7    ? ? ? 1_555 A  G   406  N2  ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog450  hydrog ?    ? A  G   384  N1    ? ? ? 1_555 A  C   405  N3  ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog451  hydrog ?    ? A  G   384  N2    ? ? ? 1_555 A  C   405  O2  ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog452  hydrog ?    ? A  G   384  O6    ? ? ? 1_555 A  C   405  N4  ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog453  hydrog ?    ? A  C   385  N3    ? ? ? 1_555 A  G   404  N1  ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog454  hydrog ?    ? A  C   385  N4    ? ? ? 1_555 A  G   404  O6  ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog455  hydrog ?    ? A  C   385  O2    ? ? ? 1_555 A  G   404  N2  ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog456  hydrog ?    ? A  G   386  N1    ? ? ? 1_555 A  C   403  N3  ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog457  hydrog ?    ? A  G   386  N2    ? ? ? 1_555 A  C   403  O2  ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog458  hydrog ?    ? A  G   386  O6    ? ? ? 1_555 A  C   403  N4  ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog459  hydrog ?    ? A  G   387  N1    ? ? ? 1_555 A  U   402  O2  ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog460  hydrog ?    ? A  G   387  O6    ? ? ? 1_555 A  U   402  N3  ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog461  hydrog ?    ? A  G   388  N1    ? ? ? 1_555 A  C   401  N3  ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog462  hydrog ?    ? A  G   388  N2    ? ? ? 1_555 A  C   401  O2  ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog463  hydrog ?    ? A  G   388  O6    ? ? ? 1_555 A  C   401  N4  ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog464  hydrog ?    ? A  G   389  N1    ? ? ? 1_555 A  C   400  N3  ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog465  hydrog ?    ? A  G   389  N2    ? ? ? 1_555 A  C   400  O2  ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog466  hydrog ?    ? A  G   389  O6    ? ? ? 1_555 A  C   400  N4  ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog467  hydrog ?    ? A  G   390  N1    ? ? ? 1_555 A  C   399  N3  ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog468  hydrog ?    ? A  G   390  N2    ? ? ? 1_555 A  C   399  O2  ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog469  hydrog ?    ? A  G   390  O6    ? ? ? 1_555 A  C   399  N4  ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog470  hydrog ?    ? A  U   391  N3    ? ? ? 1_555 A  U   398  O4  ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog471  hydrog ?    ? A  U   391  O2    ? ? ? 1_555 A  U   398  N3  ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog472  hydrog ?    ? A  G   394  N3    ? ? ? 1_555 A  G   417  N2  ? ? 0 G   394  0 G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog473  hydrog ?    ? A  A   395  N1    ? ? ? 1_555 A  C   2443 N4  ? ? 0 A   395  0 C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog474  hydrog ?    ? A  U   396  O4    ? ? ? 1_555 A  G   2442 N2  ? ? 0 U   396  0 G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog475  hydrog ?    ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1  ? ? 0 A   407  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog476  hydrog ?    ? A  A   408  N1    ? ? ? 1_555 A  A   429  N6  ? ? 0 A   408  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog477  hydrog ?    ? A  A   408  N6    ? ? ? 1_555 A  A   430  N1  ? ? 0 A   408  0 A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog478  hydrog ?    ? A  C   412  N3    ? ? ? 1_555 A  G   428  N1  ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog479  hydrog ?    ? A  C   412  N4    ? ? ? 1_555 A  G   428  O6  ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog480  hydrog ?    ? A  C   412  O2    ? ? ? 1_555 A  G   428  N2  ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog481  hydrog ?    ? A  G   413  N1    ? ? ? 1_555 A  C   427  N3  ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog482  hydrog ?    ? A  G   413  N2    ? ? ? 1_555 A  C   427  O2  ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog483  hydrog ?    ? A  G   413  O6    ? ? ? 1_555 A  C   427  N4  ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog484  hydrog ?    ? A  C   414  N3    ? ? ? 1_555 A  G   426  N1  ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog485  hydrog ?    ? A  C   414  N4    ? ? ? 1_555 A  G   426  O6  ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog486  hydrog ?    ? A  C   414  O2    ? ? ? 1_555 A  G   426  N2  ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog487  hydrog ?    ? A  A   415  N1    ? ? ? 1_555 A  U   425  N3  ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog488  hydrog ?    ? A  A   415  N6    ? ? ? 1_555 A  U   425  O4  ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog489  hydrog ?    ? A  G   416  N1    ? ? ? 1_555 A  C   424  N3  ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog490  hydrog ?    ? A  G   416  N2    ? ? ? 1_555 A  C   424  O2  ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog491  hydrog ?    ? A  G   416  O6    ? ? ? 1_555 A  C   424  N4  ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog492  hydrog ?    ? A  C   418  N3    ? ? ? 1_555 A  G   2449 N1  ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog493  hydrog ?    ? A  C   418  N4    ? ? ? 1_555 A  G   2449 O6  ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog494  hydrog ?    ? A  C   418  O2    ? ? ? 1_555 A  G   2449 N2  ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog495  hydrog ?    ? A  A   419  N3    ? ? ? 1_555 A  C   1920 N4  ? ? 0 A   419  0 C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog496  hydrog ?    ? A  A   419  N1    ? ? ? 1_555 A  U   2448 N3  ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog497  hydrog ?    ? A  A   419  N6    ? ? ? 1_555 A  U   2448 O4  ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog498  hydrog ?    ? A  U   420  N3    ? ? ? 1_555 A  A   2447 N1  ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog499  hydrog ?    ? A  U   420  O4    ? ? ? 1_555 A  A   2447 N6  ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog500  hydrog ?    ? A  C   421  N3    ? ? ? 1_555 A  G   2446 N1  ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog501  hydrog ?    ? A  C   421  N4    ? ? ? 1_555 A  G   2446 O6  ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog502  hydrog ?    ? A  C   421  O2    ? ? ? 1_555 A  G   2446 N2  ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog503  hydrog ?    ? A  G   422  N1    ? ? ? 1_555 A  U   2445 O2  ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog504  hydrog ?    ? A  G   422  O6    ? ? ? 1_555 A  U   2445 N3  ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog505  hydrog ?    ? A  A   423  N1    ? ? ? 1_555 A  U   2444 N3  ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog506  hydrog ?    ? A  A   423  N6    ? ? ? 1_555 A  U   2444 O4  ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog507  hydrog ?    ? A  A   441  N3    ? ? ? 1_555 A  A   442  N6  ? ? 0 A   441  0 A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog508  hydrog ?    ? A  A   449  N3    ? ? ? 1_555 A  G   1349 N2  ? ? 0 A   449  0 G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog509  hydrog ?    ? A  G   452  N2    ? ? ? 1_555 A  A   460  N1  ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog510  hydrog ?    ? A  U   454  N3    ? ? ? 1_555 A  U   1362 O2  ? ? 0 U   454  0 U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? ? 
hydrog511  hydrog ?    ? A  A   455  N1    ? ? ? 1_555 A  A   460  N6  ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog512  hydrog ?    ? A  A   455  N6    ? ? ? 1_555 A  A   460  N7  ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog513  hydrog ?    ? A  G   458  N2    ? ? ? 1_555 A  A   463  N3  ? ? 0 G   458  0 A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog514  hydrog ?    ? A  A   463  N6    ? ? ? 1_555 A  A   477  N7  ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog515  hydrog ?    ? A  A   463  N7    ? ? ? 1_555 A  A   477  N6  ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog516  hydrog ?    ? A  G   464  N2    ? ? ? 1_555 A  U   465  O4  ? ? 0 G   464  0 U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog517  hydrog ?    ? A  U   465  N3    ? ? ? 1_555 A  A   476  N7  ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog518  hydrog ?    ? A  U   465  O2    ? ? ? 1_555 A  A   476  N6  ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog519  hydrog ?    ? A  A   466  N6    ? ? ? 1_555 A  G   475  N3  ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog520  hydrog ?    ? A  A   466  N7    ? ? ? 1_555 A  G   475  N2  ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog521  hydrog ?    ? A  G   467  N1    ? ? ? 1_555 A  C   474  N3  ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog522  hydrog ?    ? A  G   467  N2    ? ? ? 1_555 A  C   474  O2  ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog523  hydrog ?    ? A  G   467  O6    ? ? ? 1_555 A  C   474  N4  ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog524  hydrog ?    ? A  U   468  N3    ? ? ? 1_555 A  A   473  N1  ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog525  hydrog ?    ? A  U   468  O4    ? ? ? 1_555 A  A   473  N6  ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog526  hydrog ?    ? A  G   469  N2    ? ? ? 1_555 A  A   472  N7  ? ? 0 G   469  0 A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog527  hydrog ?    ? A  G   471  N2    ? ? ? 1_555 A  C   774  O2  ? ? 0 G   471  0 C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog528  hydrog ?    ? A  U   481  N3    ? ? ? 1_555 A  A   485  N7  ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog529  hydrog ?    ? A  U   481  O2    ? ? ? 1_555 A  A   485  N6  ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog530  hydrog ?    ? A  G   482  N2    ? ? ? 1_555 A  A   486  N7  ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog531  hydrog ?    ? A  C   483  N4    ? ? ? 1_555 A  A   507  N7  ? ? 0 C   483  0 A   507  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog532  hydrog ?    ? A  A   485  N1    ? ? ? 1_555 A  A   509  N6  ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog533  hydrog ?    ? A  A   485  N6    ? ? ? 1_555 A  A   509  N1  ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog534  hydrog ?    ? A  A   486  N1    ? ? ? 1_555 A  A   511  N6  ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog535  hydrog ?    ? A  A   486  N6    ? ? ? 1_555 A  A   511  N1  ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog536  hydrog ?    ? A  G   487  N3    ? ? ? 1_555 A  G   512  N2  ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog537  hydrog ?    ? A  G   487  N1    ? ? ? 1_555 A  C   515  N3  ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog538  hydrog ?    ? A  G   487  N2    ? ? ? 1_555 A  C   515  O2  ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog539  hydrog ?    ? A  G   487  O6    ? ? ? 1_555 A  C   515  N4  ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog540  hydrog ?    ? A  U   488  O2    ? ? ? 1_555 A  G   503  N1  ? ? 0 U   488  0 G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog541  hydrog ?    ? A  A   489  N6    ? ? ? 1_555 A  G   503  N3  ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog542  hydrog ?    ? A  A   489  N7    ? ? ? 1_555 A  G   503  N2  ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog543  hydrog ?    ? A  C   490  N4    ? ? ? 1_555 A  A   502  N1  ? ? 0 C   490  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog544  hydrog ?    ? A  C   491  N3    ? ? ? 1_555 A  G   501  N1  ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog545  hydrog ?    ? A  C   491  N4    ? ? ? 1_555 A  G   501  O6  ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog546  hydrog ?    ? A  C   491  O2    ? ? ? 1_555 A  G   501  N2  ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog547  hydrog ?    ? A  C   492  N3    ? ? ? 1_555 A  G   500  N1  ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog548  hydrog ?    ? A  C   492  N4    ? ? ? 1_555 A  G   500  O6  ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog549  hydrog ?    ? A  C   492  O2    ? ? ? 1_555 A  G   500  N2  ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog550  hydrog ?    ? A  U   493  N3    ? ? ? 1_555 A  G   499  O6  ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog551  hydrog ?    ? A  U   493  O2    ? ? ? 1_555 A  G   499  N1  ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog552  hydrog ?    ? A  C   494  O2    ? ? ? 1_555 A  A   498  N6  ? ? 0 C   494  0 A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog553  hydrog ?    ? A  G   504  N1    ? ? ? 1_555 A  G   512  O6  ? ? 0 G   504  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog554  hydrog ?    ? A  C   505  O2    ? ? ? 1_555 A  A   509  N6  ? ? 0 C   505  0 A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog555  hydrog ?    ? A  G   506  N2    ? ? ? 1_555 A  A   511  N7  ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog556  hydrog ?    ? A  G   506  N3    ? ? ? 1_555 A  A   511  N6  ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog557  hydrog ?    ? A  A   521  N3    ? ? ? 1_555 A  G   1364 N2  ? ? 0 A   521  0 G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog558  hydrog ?    ? A  A   532  N3    ? ? ? 1_555 A  G   2660 N2  ? ? 0 A   532  0 G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog559  hydrog ?    ? A  G   535  N7    ? ? ? 1_555 A  G   2082 N1  ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
? 
hydrog560  hydrog ?    ? A  G   535  O6    ? ? ? 1_555 A  G   2082 N2  ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
? 
hydrog561  hydrog ?    ? A  A   536  N3    ? ? ? 1_555 A  G   2075 N2  ? ? 0 A   536  0 G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog562  hydrog ?    ? A  G   537  N1    ? ? ? 1_555 A  U   2059 O2  ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog563  hydrog ?    ? A  G   537  O6    ? ? ? 1_555 A  U   2059 N3  ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog564  hydrog ?    ? A  C   538  N4    ? ? ? 1_555 A  A   2060 N3  ? ? 0 C   538  0 A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog565  hydrog ?    ? A  G   539  N1    ? ? ? 1_555 A  C   617  N3  ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog566  hydrog ?    ? A  G   539  N2    ? ? ? 1_555 A  C   617  O2  ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog567  hydrog ?    ? A  G   539  O6    ? ? ? 1_555 A  C   617  N4  ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog568  hydrog ?    ? A  A   540  N1    ? ? ? 1_555 A  U   616  N3  ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog569  hydrog ?    ? A  A   540  N6    ? ? ? 1_555 A  U   616  O4  ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog570  hydrog ?    ? A  C   541  N3    ? ? ? 1_555 A  G   615  N1  ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog571  hydrog ?    ? A  C   541  N4    ? ? ? 1_555 A  G   615  O6  ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog572  hydrog ?    ? A  C   541  O2    ? ? ? 1_555 A  G   615  N2  ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog573  hydrog ?    ? A  A   542  N1    ? ? ? 1_555 A  U   614  N3  ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog574  hydrog ?    ? A  A   542  N6    ? ? ? 1_555 A  U   614  O4  ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog575  hydrog ?    ? A  G   543  N1    ? ? ? 1_555 A  C   613  N3  ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog576  hydrog ?    ? A  G   543  N2    ? ? ? 1_555 A  C   613  O2  ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog577  hydrog ?    ? A  G   543  O6    ? ? ? 1_555 A  C   613  N4  ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog578  hydrog ?    ? A  G   544  N1    ? ? ? 1_555 A  U   612  O2  ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog579  hydrog ?    ? A  G   544  O6    ? ? ? 1_555 A  U   612  N3  ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog580  hydrog ?    ? A  G   545  N1    ? ? ? 1_555 A  U   611  O2  ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog581  hydrog ?    ? A  G   545  O6    ? ? ? 1_555 A  U   611  N3  ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog582  hydrog ?    ? A  C   546  N3    ? ? ? 1_555 A  G   610  N1  ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog583  hydrog ?    ? A  C   546  N4    ? ? ? 1_555 A  G   610  O6  ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog584  hydrog ?    ? A  C   546  O2    ? ? ? 1_555 A  G   610  N2  ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog585  hydrog ?    ? A  A   547  N1    ? ? ? 1_555 A  U   609  N3  ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog586  hydrog ?    ? A  A   547  N6    ? ? ? 1_555 A  U   609  O4  ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog587  hydrog ?    ? A  U   548  N3    ? ? ? 1_555 A  A   608  N1  ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog588  hydrog ?    ? A  U   548  O4    ? ? ? 1_555 A  A   608  N6  ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog589  hydrog ?    ? A  A   552  N3    ? ? ? 1_555 A  G   1323 N2  ? ? 0 A   552  0 G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog590  hydrog ?    ? A  G   553  N1    ? ? ? 1_555 A  C   606  N3  ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog591  hydrog ?    ? A  G   553  N2    ? ? ? 1_555 A  C   606  O2  ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog592  hydrog ?    ? A  G   553  O6    ? ? ? 1_555 A  C   606  N4  ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog593  hydrog ?    ? A  G   554  N1    ? ? ? 1_555 A  C   605  N3  ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog594  hydrog ?    ? A  G   554  N2    ? ? ? 1_555 A  C   605  O2  ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog595  hydrog ?    ? A  G   554  O6    ? ? ? 1_555 A  C   605  N4  ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog596  hydrog ?    ? A  U   555  N3    ? ? ? 1_555 A  A   602  N1  ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog597  hydrog ?    ? A  U   555  O4    ? ? ? 1_555 A  A   602  N6  ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog598  hydrog ?    ? A  C   556  N3    ? ? ? 1_555 A  G   601  N1  ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog599  hydrog ?    ? A  C   556  N4    ? ? ? 1_555 A  G   601  O6  ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog600  hydrog ?    ? A  C   556  O2    ? ? ? 1_555 A  G   601  N2  ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog601  hydrog ?    ? A  C   557  N3    ? ? ? 1_555 A  G   600  N1  ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog602  hydrog ?    ? A  C   557  N4    ? ? ? 1_555 A  G   600  O6  ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog603  hydrog ?    ? A  C   557  O2    ? ? ? 1_555 A  G   600  N2  ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog604  hydrog ?    ? A  C   558  N3    ? ? ? 1_555 A  G   599  N1  ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog605  hydrog ?    ? A  C   558  N4    ? ? ? 1_555 A  G   599  O6  ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog606  hydrog ?    ? A  C   558  O2    ? ? ? 1_555 A  G   599  N2  ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog607  hydrog ?    ? A  U   559  O4    ? ? ? 1_555 A  C   598  N4  ? ? 0 U   559  0 C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog608  hydrog ?    ? A  U   559  O2    ? ? ? 1_555 A  G   599  N2  ? ? 0 U   559  0 G   599  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog609  hydrog ?    ? A  U   560  N3    ? ? ? 1_555 A  A   597  N1  ? ? 0 U   560  0 A   597  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog610  hydrog ?    ? A  U   560  O4    ? ? ? 1_555 A  A   597  N6  ? ? 0 U   560  0 A   597  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog611  hydrog ?    ? A  G   561  N1    ? ? ? 1_555 A  C   596  N3  ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog612  hydrog ?    ? A  G   561  N2    ? ? ? 1_555 A  C   596  O2  ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog613  hydrog ?    ? A  G   561  O6    ? ? ? 1_555 A  C   596  N4  ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog614  hydrog ?    ? A  A   562  N1    ? ? ? 1_555 A  U   595  N3  ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog615  hydrog ?    ? A  A   562  N6    ? ? ? 1_555 A  U   595  O4  ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog616  hydrog ?    ? A  C   563  O2    ? ? ? 1_555 A  C   594  N4  ? ? 0 C   563  0 C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog617  hydrog ?    ? A  A   566  N6    ? ? ? 1_555 A  G   592  N3  ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog618  hydrog ?    ? A  A   566  N7    ? ? ? 1_555 A  G   592  N2  ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog619  hydrog ?    ? A  A   566  N3    ? ? ? 1_555 A  G   1093 N2  ? ? 0 A   566  0 G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog620  hydrog ?    ? A  U   567  N3    ? ? ? 1_555 A  A   591  N1  ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog621  hydrog ?    ? A  U   567  O4    ? ? ? 1_555 A  A   591  N6  ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog622  hydrog ?    ? A  G   568  N2    ? ? ? 1_555 A  A   590  N7  ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog623  hydrog ?    ? A  G   568  N3    ? ? ? 1_555 A  A   590  N6  ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog624  hydrog ?    ? A  A   569  N6    ? ? ? 1_555 A  U   589  O2  ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog625  hydrog ?    ? A  A   569  N7    ? ? ? 1_555 A  U   589  N3  ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog626  hydrog ?    ? A  C   571  N4    ? ? ? 1_555 A  C   586  O2  ? ? 0 C   571  0 C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog627  hydrog ?    ? A  G   572  N1    ? ? ? 1_555 A  C   585  N3  ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog628  hydrog ?    ? A  G   572  N2    ? ? ? 1_555 A  C   585  O2  ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog629  hydrog ?    ? A  G   572  O6    ? ? ? 1_555 A  C   585  N4  ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog630  hydrog ?    ? A  A   573  N1    ? ? ? 1_555 A  U   584  N3  ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog631  hydrog ?    ? A  A   573  N6    ? ? ? 1_555 A  U   584  O4  ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog632  hydrog ?    ? A  G   574  N1    ? ? ? 1_555 A  C   583  N3  ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog633  hydrog ?    ? A  G   574  N2    ? ? ? 1_555 A  C   583  O2  ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog634  hydrog ?    ? A  G   574  O6    ? ? ? 1_555 A  C   583  N4  ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog635  hydrog ?    ? A  A   575  N1    ? ? ? 1_555 A  U   582  N3  ? ? 0 A   575  0 U   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog636  hydrog ?    ? A  A   575  N6    ? ? ? 1_555 A  U   582  O4  ? ? 0 A   575  0 U   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog637  hydrog ?    ? A  C   576  N3    ? ? ? 1_555 A  G   581  N1  ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog638  hydrog ?    ? A  C   576  N4    ? ? ? 1_555 A  G   581  O6  ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog639  hydrog ?    ? A  C   576  O2    ? ? ? 1_555 A  G   581  N2  ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog640  hydrog ?    ? A  G   577  N2    ? ? ? 1_555 A  A   580  N7  ? ? 0 G   577  0 A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog641  hydrog ?    ? A  G   579  N2    ? ? ? 1_555 A  U   1111 O2  ? ? 0 G   579  0 U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog642  hydrog ?    ? A  A   580  N3    ? ? ? 1_555 A  G   1110 N2  ? ? 0 A   580  0 G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog643  hydrog ?    ? A  G   588  N2    ? ? ? 1_555 A  U   589  O4  ? ? 0 G   588  0 U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog644  hydrog ?    ? A  G   604  N1    ? ? ? 1_555 A  G   607  O6  ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog645  hydrog ?    ? A  G   604  N2    ? ? ? 1_555 A  G   607  N7  ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog646  hydrog ?    ? A  U   619  N3    ? ? ? 1_555 A  A   2074 N1  ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog647  hydrog ?    ? A  U   619  O4    ? ? ? 1_555 A  A   2074 N6  ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog648  hydrog ?    ? A  A   620  N6    ? ? ? 1_555 A  A   635  N1  ? ? 0 A   620  0 A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog649  hydrog ?    ? A  C   621  N3    ? ? ? 1_555 A  G   634  N1  ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog650  hydrog ?    ? A  C   621  N4    ? ? ? 1_555 A  G   634  O6  ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog651  hydrog ?    ? A  C   621  O2    ? ? ? 1_555 A  G   634  N2  ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog652  hydrog ?    ? A  G   622  N1    ? ? ? 1_555 A  C   633  N3  ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog653  hydrog ?    ? A  G   622  N2    ? ? ? 1_555 A  C   633  O2  ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog654  hydrog ?    ? A  G   622  O6    ? ? ? 1_555 A  C   633  N4  ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog655  hydrog ?    ? A  U   623  N3    ? ? ? 1_555 A  A   632  N1  ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog656  hydrog ?    ? A  U   623  O4    ? ? ? 1_555 A  A   632  N6  ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog657  hydrog ?    ? A  U   624  N3    ? ? ? 1_555 A  1MA 628  N7  ? ? 0 U   624  0 1MA 628  1_555 ? ? ? ? ? ? 'U-1MA PAIR' ? 
? ? 
hydrog658  hydrog ?    ? A  U   625  O2    ? ? ? 1_555 A  C   2071 N4  ? ? 0 U   625  0 C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog659  hydrog ?    ? A  U   626  O2    ? ? ? 1_555 A  A   1081 N6  ? ? 0 U   626  0 A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog660  hydrog ?    ? A  A   629  N1    ? ? ? 1_555 A  G   2070 N2  ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog661  hydrog ?    ? A  A   629  N6    ? ? ? 1_555 A  G   2070 N3  ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog662  hydrog ?    ? A  G   636  N1    ? ? ? 1_555 A  C   1365 N3  ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog663  hydrog ?    ? A  G   636  N2    ? ? ? 1_555 A  C   1365 O2  ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog664  hydrog ?    ? A  G   636  O6    ? ? ? 1_555 A  C   1365 N4  ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog665  hydrog ?    ? A  C   637  N3    ? ? ? 1_555 A  G   1364 N1  ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog666  hydrog ?    ? A  C   637  N4    ? ? ? 1_555 A  G   1364 O6  ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog667  hydrog ?    ? A  C   637  O2    ? ? ? 1_555 A  G   1364 N2  ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog668  hydrog ?    ? A  C   638  N3    ? ? ? 1_555 A  G   1363 N1  ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog669  hydrog ?    ? A  C   638  N4    ? ? ? 1_555 A  G   1363 O6  ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog670  hydrog ?    ? A  C   638  O2    ? ? ? 1_555 A  G   1363 N2  ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog671  hydrog ?    ? A  A   639  N1    ? ? ? 1_555 A  U   1362 N3  ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog672  hydrog ?    ? A  A   639  N6    ? ? ? 1_555 A  U   1362 O4  ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog673  hydrog ?    ? A  G   640  N1    ? ? ? 1_555 A  C   1361 N3  ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog674  hydrog ?    ? A  G   640  N2    ? ? ? 1_555 A  C   1361 O2  ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog675  hydrog ?    ? A  G   640  O6    ? ? ? 1_555 A  C   1361 N4  ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog676  hydrog ?    ? A  G   641  N1    ? ? ? 1_555 A  C   1360 N3  ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog677  hydrog ?    ? A  G   641  N2    ? ? ? 1_555 A  C   1360 O2  ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog678  hydrog ?    ? A  G   641  O6    ? ? ? 1_555 A  C   1360 N4  ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog679  hydrog ?    ? A  G   642  N2    ? ? ? 1_555 A  A   1358 N7  ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog680  hydrog ?    ? A  G   642  N3    ? ? ? 1_555 A  A   1358 N6  ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog681  hydrog ?    ? A  A   643  N3    ? ? ? 1_555 A  G   902  N2  ? ? 0 A   643  0 G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog682  hydrog ?    ? A  A   643  N6    ? ? ? 1_555 A  A   1355 N7  ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog683  hydrog ?    ? A  A   643  N7    ? ? ? 1_555 A  A   1355 N6  ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog684  hydrog ?    ? A  G   644  N1    ? ? ? 1_555 A  U   903  O2  ? ? 0 G   644  0 U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog685  hydrog ?    ? A  U   645  N3    ? ? ? 1_555 A  A   761  N3  ? ? 0 U   645  0 A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog686  hydrog ?    ? A  G   646  N1    ? ? ? 1_555 A  C   759  N3  ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog687  hydrog ?    ? A  G   646  N2    ? ? ? 1_555 A  C   759  O2  ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog688  hydrog ?    ? A  G   646  O6    ? ? ? 1_555 A  C   759  N4  ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog689  hydrog ?    ? A  U   647  N3    ? ? ? 1_555 A  A   758  N1  ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog690  hydrog ?    ? A  U   647  O4    ? ? ? 1_555 A  A   758  N6  ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog691  hydrog ?    ? A  G   648  N1    ? ? ? 1_555 A  C   757  N3  ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog692  hydrog ?    ? A  G   648  N2    ? ? ? 1_555 A  C   757  O2  ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog693  hydrog ?    ? A  G   648  O6    ? ? ? 1_555 A  C   757  N4  ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog694  hydrog ?    ? A  U   649  N3    ? ? ? 1_555 A  A   756  N1  ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog695  hydrog ?    ? A  U   649  O4    ? ? ? 1_555 A  A   756  N6  ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog696  hydrog ?    ? A  C   650  N3    ? ? ? 1_555 A  G   755  N1  ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog697  hydrog ?    ? A  C   650  N4    ? ? ? 1_555 A  G   755  O6  ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog698  hydrog ?    ? A  C   650  O2    ? ? ? 1_555 A  G   755  N2  ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog699  hydrog ?    ? A  U   651  N3    ? ? ? 1_555 A  G   754  O6  ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog700  hydrog ?    ? A  U   651  O2    ? ? ? 1_555 A  G   754  N1  ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog701  hydrog ?    ? A  G   652  N1    ? ? ? 1_555 A  U   753  O2  ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog702  hydrog ?    ? A  G   652  O6    ? ? ? 1_555 A  U   753  N3  ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog703  hydrog ?    ? A  U   653  N3    ? ? ? 1_555 A  G   752  O6  ? ? 0 U   653  0 G   752  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog704  hydrog ?    ? A  U   653  O2    ? ? ? 1_555 A  G   752  N1  ? ? 0 U   653  0 G   752  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog705  hydrog ?    ? A  A   654  N1    ? ? ? 1_555 A  U   751  N3  ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog706  hydrog ?    ? A  A   654  N6    ? ? ? 1_555 A  U   751  O4  ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog707  hydrog ?    ? A  U   655  N3    ? ? ? 1_555 A  A   750  N1  ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog708  hydrog ?    ? A  U   655  O4    ? ? ? 1_555 A  A   750  N6  ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog709  hydrog ?    ? A  G   656  N1    ? ? ? 1_555 A  C   749  N3  ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog710  hydrog ?    ? A  G   656  N2    ? ? ? 1_555 A  C   749  O2  ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog711  hydrog ?    ? A  G   656  O6    ? ? ? 1_555 A  C   749  N4  ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog712  hydrog ?    ? A  G   657  N1    ? ? ? 1_555 A  C   748  N3  ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog713  hydrog ?    ? A  G   657  N2    ? ? ? 1_555 A  C   748  O2  ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog714  hydrog ?    ? A  G   657  O6    ? ? ? 1_555 A  C   748  N4  ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog715  hydrog ?    ? A  C   658  N3    ? ? ? 1_555 A  G   747  N1  ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog716  hydrog ?    ? A  C   658  N4    ? ? ? 1_555 A  G   747  O6  ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog717  hydrog ?    ? A  C   658  O2    ? ? ? 1_555 A  G   747  N2  ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog718  hydrog ?    ? A  G   661  N1    ? ? ? 1_555 A  C   685  N3  ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog719  hydrog ?    ? A  G   661  N2    ? ? ? 1_555 A  C   685  O2  ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog720  hydrog ?    ? A  G   661  O6    ? ? ? 1_555 A  C   685  N4  ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog721  hydrog ?    ? A  U   662  N3    ? ? ? 1_555 A  G   684  O6  ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog722  hydrog ?    ? A  U   662  O2    ? ? ? 1_555 A  G   684  N1  ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog723  hydrog ?    ? A  C   663  N3    ? ? ? 1_555 A  G   683  N1  ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog724  hydrog ?    ? A  C   663  N4    ? ? ? 1_555 A  G   683  O6  ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog725  hydrog ?    ? A  C   663  O2    ? ? ? 1_555 A  G   683  N2  ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog726  hydrog ?    ? A  U   664  N3    ? ? ? 1_555 A  A   682  N7  ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog727  hydrog ?    ? A  U   664  O2    ? ? ? 1_555 A  A   682  N6  ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog728  hydrog ?    ? A  A   666  N6    ? ? ? 1_555 A  G   680  N3  ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog729  hydrog ?    ? A  A   666  N7    ? ? ? 1_555 A  G   680  N2  ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog730  hydrog ?    ? A  C   667  N3    ? ? ? 1_555 A  G   679  N1  ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog731  hydrog ?    ? A  C   667  N4    ? ? ? 1_555 A  G   679  O6  ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog732  hydrog ?    ? A  C   667  O2    ? ? ? 1_555 A  G   679  N2  ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog733  hydrog ?    ? A  C   668  N3    ? ? ? 1_555 A  G   678  N1  ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog734  hydrog ?    ? A  C   668  N4    ? ? ? 1_555 A  G   678  O6  ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog735  hydrog ?    ? A  C   668  O2    ? ? ? 1_555 A  G   678  N2  ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog736  hydrog ?    ? A  G   669  N1    ? ? ? 1_555 A  C   677  N3  ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog737  hydrog ?    ? A  G   669  N2    ? ? ? 1_555 A  C   677  O2  ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog738  hydrog ?    ? A  G   669  O6    ? ? ? 1_555 A  C   677  N4  ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog739  hydrog ?    ? A  G   670  N1    ? ? ? 1_555 A  C   676  N3  ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog740  hydrog ?    ? A  G   670  N2    ? ? ? 1_555 A  C   676  O2  ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog741  hydrog ?    ? A  G   670  O6    ? ? ? 1_555 A  C   676  N4  ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog742  hydrog ?    ? A  G   689  N1    ? ? ? 1_555 A  C   696  N3  ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog743  hydrog ?    ? A  G   689  N2    ? ? ? 1_555 A  C   696  O2  ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog744  hydrog ?    ? A  G   689  O6    ? ? ? 1_555 A  C   696  N4  ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog745  hydrog ?    ? A  G   690  N1    ? ? ? 1_555 A  C   695  N3  ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog746  hydrog ?    ? A  G   690  N2    ? ? ? 1_555 A  C   695  O2  ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog747  hydrog ?    ? A  G   690  O6    ? ? ? 1_555 A  C   695  N4  ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog748  hydrog ?    ? A  G   691  N2    ? ? ? 1_555 A  A   694  N7  ? ? 0 G   691  0 A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog749  hydrog ?    ? A  A   692  N1    ? ? ? 1_555 A  G   2453 N2  ? ? 0 A   692  0 G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog750  hydrog ?    ? A  A   698  N3    ? ? ? 1_555 A  G   742  N2  ? ? 0 A   698  0 G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog751  hydrog ?    ? A  C   699  N3    ? ? ? 1_555 A  G   727  N1  ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog752  hydrog ?    ? A  C   699  N4    ? ? ? 1_555 A  G   727  O6  ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog753  hydrog ?    ? A  C   699  O2    ? ? ? 1_555 A  G   727  N2  ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog754  hydrog ?    ? A  G   702  N1    ? ? ? 1_555 A  C   726  N3  ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog755  hydrog ?    ? A  G   702  N2    ? ? ? 1_555 A  C   726  O2  ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog756  hydrog ?    ? A  G   702  O6    ? ? ? 1_555 A  C   726  N4  ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog757  hydrog ?    ? A  G   702  N7    ? ? ? 1_555 A  G   744  N2  ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog758  hydrog ?    ? A  G   702  O6    ? ? ? 1_555 A  G   744  N1  ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
? 
hydrog759  hydrog ?    ? A  G   703  N1    ? ? ? 1_555 A  C   725  N3  ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog760  hydrog ?    ? A  G   703  N2    ? ? ? 1_555 A  C   725  O2  ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog761  hydrog ?    ? A  G   703  O6    ? ? ? 1_555 A  C   725  N4  ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog762  hydrog ?    ? A  C   704  N3    ? ? ? 1_555 A  G   724  N1  ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog763  hydrog ?    ? A  C   704  N4    ? ? ? 1_555 A  G   724  O6  ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog764  hydrog ?    ? A  C   704  O2    ? ? ? 1_555 A  G   724  N2  ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog765  hydrog ?    ? A  C   705  N3    ? ? ? 1_555 A  G   723  N1  ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog766  hydrog ?    ? A  C   705  N4    ? ? ? 1_555 A  G   723  O6  ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog767  hydrog ?    ? A  C   705  O2    ? ? ? 1_555 A  G   723  N2  ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog768  hydrog ?    ? A  G   706  N2    ? ? ? 1_555 A  G   722  O6  ? ? 0 G   706  0 G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog769  hydrog ?    ? A  C   707  N3    ? ? ? 1_555 A  A   721  N6  ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog770  hydrog ?    ? A  C   707  N4    ? ? ? 1_555 A  A   721  N7  ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog771  hydrog ?    ? A  A   708  N6    ? ? ? 1_555 A  G   720  N3  ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog772  hydrog ?    ? A  A   708  N7    ? ? ? 1_555 A  G   720  N2  ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog773  hydrog ?    ? A  G   709  N1    ? ? ? 1_555 A  C   719  N3  ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog774  hydrog ?    ? A  G   709  N2    ? ? ? 1_555 A  C   719  O2  ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog775  hydrog ?    ? A  G   709  O6    ? ? ? 1_555 A  C   719  N4  ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog776  hydrog ?    ? A  G   710  N1    ? ? ? 1_555 A  C   718  N3  ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog777  hydrog ?    ? A  G   710  N2    ? ? ? 1_555 A  C   718  O2  ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog778  hydrog ?    ? A  G   710  O6    ? ? ? 1_555 A  C   718  N4  ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog779  hydrog ?    ? A  G   711  N1    ? ? ? 1_555 A  C   717  N3  ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog780  hydrog ?    ? A  G   711  N2    ? ? ? 1_555 A  C   717  O2  ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog781  hydrog ?    ? A  G   711  O6    ? ? ? 1_555 A  C   717  N4  ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog782  hydrog ?    ? A  C   712  N3    ? ? ? 1_555 A  G   716  N1  ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog783  hydrog ?    ? A  C   712  N4    ? ? ? 1_555 A  G   716  O6  ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog784  hydrog ?    ? A  C   712  O2    ? ? ? 1_555 A  G   716  N2  ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog785  hydrog ?    ? A  C   726  N4    ? ? ? 1_555 A  G   744  O6  ? ? 0 C   726  0 G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog786  hydrog ?    ? A  C   728  N3    ? ? ? 1_555 A  G   743  N1  ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog787  hydrog ?    ? A  C   728  N4    ? ? ? 1_555 A  G   743  O6  ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog788  hydrog ?    ? A  C   728  O2    ? ? ? 1_555 A  G   743  N2  ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog789  hydrog ?    ? A  C   729  N3    ? ? ? 1_555 A  G   742  N1  ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog790  hydrog ?    ? A  C   729  N4    ? ? ? 1_555 A  G   742  O6  ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog791  hydrog ?    ? A  C   729  O2    ? ? ? 1_555 A  G   742  N2  ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog792  hydrog ?    ? A  G   730  N1    ? ? ? 1_555 A  C   741  N3  ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog793  hydrog ?    ? A  G   730  N2    ? ? ? 1_555 A  C   741  O2  ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog794  hydrog ?    ? A  G   730  O6    ? ? ? 1_555 A  C   741  N4  ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog795  hydrog ?    ? A  U   731  N3    ? ? ? 1_555 A  G   740  O6  ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog796  hydrog ?    ? A  U   731  O2    ? ? ? 1_555 A  G   740  N1  ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog797  hydrog ?    ? A  C   732  N3    ? ? ? 1_555 A  G   739  N1  ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog798  hydrog ?    ? A  C   732  N4    ? ? ? 1_555 A  G   739  O6  ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog799  hydrog ?    ? A  C   732  O2    ? ? ? 1_555 A  G   739  N2  ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog800  hydrog ?    ? A  U   733  N3    ? ? ? 1_555 A  G   738  O6  ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog801  hydrog ?    ? A  U   733  O2    ? ? ? 1_555 A  G   738  N1  ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog802  hydrog ?    ? A  C   762  N3    ? ? ? 1_555 A  G   902  N1  ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog803  hydrog ?    ? A  C   762  N4    ? ? ? 1_555 A  G   902  O6  ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog804  hydrog ?    ? A  C   762  O2    ? ? ? 1_555 A  G   902  N2  ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog805  hydrog ?    ? A  C   763  N3    ? ? ? 1_555 A  G   901  N1  ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog806  hydrog ?    ? A  C   763  N4    ? ? ? 1_555 A  G   901  O6  ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog807  hydrog ?    ? A  C   763  O2    ? ? ? 1_555 A  G   901  N2  ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog808  hydrog ?    ? A  C   764  N4    ? ? ? 1_555 A  U   900  O4  ? ? 0 C   764  0 U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog809  hydrog ?    ? A  G   765  N1    ? ? ? 1_555 A  C   899  N3  ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog810  hydrog ?    ? A  G   765  N2    ? ? ? 1_555 A  C   899  O2  ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog811  hydrog ?    ? A  G   765  O6    ? ? ? 1_555 A  C   899  N4  ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog812  hydrog ?    ? A  A   766  N6    ? ? ? 1_555 A  C   896  N3  ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog813  hydrog ?    ? A  A   766  N7    ? ? ? 1_555 A  C   896  N4  ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog814  hydrog ?    ? A  A   767  N6    ? ? ? 1_555 A  A   895  N1  ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog815  hydrog ?    ? A  A   767  N7    ? ? ? 1_555 A  A   895  N6  ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog816  hydrog ?    ? A  A   767  N3    ? ? ? 1_555 A  G   2110 N2  ? ? 0 A   767  0 G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog817  hydrog ?    ? A  U   768  O4    ? ? ? 1_555 A  C   893  N4  ? ? 0 U   768  0 C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog818  hydrog ?    ? A  C   769  N3    ? ? ? 1_555 A  G   892  N1  ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog819  hydrog ?    ? A  C   769  N4    ? ? ? 1_555 A  G   892  O6  ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog820  hydrog ?    ? A  C   769  O2    ? ? ? 1_555 A  G   892  N2  ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog821  hydrog ?    ? A  C   770  N3    ? ? ? 1_555 A  G   891  N1  ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog822  hydrog ?    ? A  C   770  N4    ? ? ? 1_555 A  G   891  O6  ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog823  hydrog ?    ? A  C   770  O2    ? ? ? 1_555 A  G   891  N2  ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog824  hydrog ?    ? A  G   771  N1    ? ? ? 1_555 A  C   890  N3  ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog825  hydrog ?    ? A  G   771  N2    ? ? ? 1_555 A  C   890  O2  ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog826  hydrog ?    ? A  G   771  O6    ? ? ? 1_555 A  C   890  N4  ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog827  hydrog ?    ? A  G   772  N1    ? ? ? 1_555 A  C   889  N3  ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog828  hydrog ?    ? A  G   772  N2    ? ? ? 1_555 A  C   889  O2  ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog829  hydrog ?    ? A  G   772  O6    ? ? ? 1_555 A  C   889  N4  ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog830  hydrog ?    ? A  A   773  N1    ? ? ? 1_555 A  U   888  N3  ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog831  hydrog ?    ? A  A   773  N6    ? ? ? 1_555 A  U   888  O4  ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog832  hydrog ?    ? A  C   774  N3    ? ? ? 1_555 A  G   887  N1  ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog833  hydrog ?    ? A  C   774  N4    ? ? ? 1_555 A  G   887  O6  ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog834  hydrog ?    ? A  C   774  O2    ? ? ? 1_555 A  G   887  N2  ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog835  hydrog ?    ? A  G   775  N1    ? ? ? 1_555 A  G   868  N7  ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
? 
hydrog836  hydrog ?    ? A  G   775  N2    ? ? ? 1_555 A  G   868  O6  ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
? 
hydrog837  hydrog ?    ? A  A   776  N3    ? ? ? 1_555 A  U   779  N3  ? ? 0 A   776  0 U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog838  hydrog ?    ? A  A   776  N1    ? ? ? 1_555 A  G   871  N2  ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog839  hydrog ?    ? A  A   776  N6    ? ? ? 1_555 A  G   871  N3  ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog840  hydrog ?    ? A  C   778  O2    ? ? ? 1_555 A  A   1836 N6  ? ? 0 C   778  0 A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog841  hydrog ?    ? A  A   780  N1    ? ? ? 1_555 A  U   866  N3  ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog842  hydrog ?    ? A  A   780  N6    ? ? ? 1_555 A  U   866  O4  ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog843  hydrog ?    ? A  C   781  N3    ? ? ? 1_555 A  G   865  N1  ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog844  hydrog ?    ? A  C   781  N4    ? ? ? 1_555 A  G   865  O6  ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog845  hydrog ?    ? A  C   781  O2    ? ? ? 1_555 A  G   865  N2  ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog846  hydrog ?    ? A  G   782  N1    ? ? ? 1_555 A  U   864  O2  ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog847  hydrog ?    ? A  G   782  O6    ? ? ? 1_555 A  U   864  N3  ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog848  hydrog ?    ? A  C   783  N3    ? ? ? 1_555 A  G   863  N1  ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog849  hydrog ?    ? A  C   783  N4    ? ? ? 1_555 A  G   863  O6  ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog850  hydrog ?    ? A  C   783  O2    ? ? ? 1_555 A  G   863  N2  ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog851  hydrog ?    ? A  A   784  N1    ? ? ? 1_555 A  U   862  N3  ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog852  hydrog ?    ? A  A   784  N6    ? ? ? 1_555 A  U   862  O4  ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog853  hydrog ?    ? A  U   785  N3    ? ? ? 1_555 A  A   861  N1  ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog854  hydrog ?    ? A  U   785  O4    ? ? ? 1_555 A  A   861  N6  ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog855  hydrog ?    ? A  G   786  N1    ? ? ? 1_555 A  U   860  O2  ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog856  hydrog ?    ? A  G   786  O6    ? ? ? 1_555 A  U   860  N3  ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog857  hydrog ?    ? A  G   787  N1    ? ? ? 1_555 A  C   859  N3  ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog858  hydrog ?    ? A  G   787  N2    ? ? ? 1_555 A  C   859  O2  ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog859  hydrog ?    ? A  G   787  O6    ? ? ? 1_555 A  C   859  N4  ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog860  hydrog ?    ? A  A   788  N1    ? ? ? 1_555 A  U   858  N3  ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog861  hydrog ?    ? A  A   788  N6    ? ? ? 1_555 A  U   858  O4  ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog862  hydrog ?    ? A  C   789  N3    ? ? ? 1_555 A  G   856  N1  ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog863  hydrog ?    ? A  C   789  N4    ? ? ? 1_555 A  G   856  O6  ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog864  hydrog ?    ? A  C   789  O2    ? ? ? 1_555 A  G   856  N2  ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog865  hydrog ?    ? A  A   790  N6    ? ? ? 1_555 A  G   824  N3  ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog866  hydrog ?    ? A  A   790  N7    ? ? ? 1_555 A  G   824  N2  ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog867  hydrog ?    ? A  A   790  N1    ? ? ? 1_555 A  G   1709 N2  ? ? 0 A   790  0 G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog868  hydrog ?    ? A  A   791  N1    ? ? ? 1_555 A  U   823  N3  ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog869  hydrog ?    ? A  A   791  N6    ? ? ? 1_555 A  U   823  O4  ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog870  hydrog ?    ? A  G   792  N1    ? ? ? 1_555 A  C   822  N3  ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog871  hydrog ?    ? A  G   792  N2    ? ? ? 1_555 A  C   822  O2  ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog872  hydrog ?    ? A  G   792  O6    ? ? ? 1_555 A  C   822  N4  ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog873  hydrog ?    ? A  A   793  N1    ? ? ? 1_555 A  U   821  N3  ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog874  hydrog ?    ? A  A   793  N6    ? ? ? 1_555 A  U   821  O4  ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog875  hydrog ?    ? A  U   794  O2    ? ? ? 1_555 A  A   818  N6  ? ? 0 U   794  0 A   818  1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog876  hydrog ?    ? A  U   794  N3    ? ? ? 1_555 A  A   819  N1  ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog877  hydrog ?    ? A  U   794  O4    ? ? ? 1_555 A  A   819  N6  ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog878  hydrog ?    ? A  G   795  N2    ? ? ? 1_555 A  A   818  N7  ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog879  hydrog ?    ? A  G   795  N3    ? ? ? 1_555 A  A   818  N6  ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog880  hydrog ?    ? A  A   796  N6    ? ? ? 1_555 A  G   817  N3  ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog881  hydrog ?    ? A  A   796  N7    ? ? ? 1_555 A  G   817  N2  ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog882  hydrog ?    ? A  A   797  N6    ? ? ? 1_555 A  G   816  N3  ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog883  hydrog ?    ? A  A   797  N7    ? ? ? 1_555 A  G   816  N2  ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog884  hydrog ?    ? A  G   798  N1    ? ? ? 1_555 A  U   815  O2  ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog885  hydrog ?    ? A  G   798  O6    ? ? ? 1_555 A  U   815  N3  ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog886  hydrog ?    ? A  C   799  N3    ? ? ? 1_555 A  G   814  N1  ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog887  hydrog ?    ? A  C   799  N4    ? ? ? 1_555 A  G   814  O6  ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog888  hydrog ?    ? A  C   799  O2    ? ? ? 1_555 A  G   814  N2  ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog889  hydrog ?    ? A  G   800  N1    ? ? ? 1_555 A  C   813  N3  ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog890  hydrog ?    ? A  G   800  N2    ? ? ? 1_555 A  C   813  O2  ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog891  hydrog ?    ? A  G   800  O6    ? ? ? 1_555 A  C   813  N4  ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog892  hydrog ?    ? A  U   801  N3    ? ? ? 1_555 A  A   812  N1  ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog893  hydrog ?    ? A  U   801  O4    ? ? ? 1_555 A  A   812  N6  ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog894  hydrog ?    ? A  G   802  N1    ? ? ? 1_555 A  C   811  N3  ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog895  hydrog ?    ? A  G   802  N2    ? ? ? 1_555 A  C   811  O2  ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog896  hydrog ?    ? A  G   802  O6    ? ? ? 1_555 A  C   811  N4  ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog897  hydrog ?    ? A  C   803  N3    ? ? ? 1_555 A  G   810  N1  ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog898  hydrog ?    ? A  C   803  N4    ? ? ? 1_555 A  G   810  O6  ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog899  hydrog ?    ? A  C   803  O2    ? ? ? 1_555 A  G   810  N2  ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog900  hydrog ?    ? A  C   804  N3    ? ? ? 1_555 A  G   809  N1  ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog901  hydrog ?    ? A  C   804  N4    ? ? ? 1_555 A  G   809  O6  ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog902  hydrog ?    ? A  C   804  O2    ? ? ? 1_555 A  G   809  N2  ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog903  hydrog ?    ? A  G   805  N2    ? ? ? 1_555 A  A   808  N7  ? ? 0 G   805  0 A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog904  hydrog ?    ? A  G   820  N1    ? ? ? 1_555 A  C   1830 N3  ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog905  hydrog ?    ? A  G   820  N2    ? ? ? 1_555 A  C   1830 O2  ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog906  hydrog ?    ? A  G   820  O6    ? ? ? 1_555 A  C   1830 N4  ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog907  hydrog ?    ? A  A   827  N6    ? ? ? 1_555 A  G   854  N3  ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog908  hydrog ?    ? A  A   827  N7    ? ? ? 1_555 A  G   854  N2  ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog909  hydrog ?    ? A  G   828  N1    ? ? ? 1_555 A  C   853  N3  ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog910  hydrog ?    ? A  G   828  N2    ? ? ? 1_555 A  C   853  O2  ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog911  hydrog ?    ? A  G   828  O6    ? ? ? 1_555 A  C   853  N4  ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog912  hydrog ?    ? A  A   829  N1    ? ? ? 1_555 A  U   852  N3  ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog913  hydrog ?    ? A  A   829  N6    ? ? ? 1_555 A  U   852  O4  ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog914  hydrog ?    ? A  G   830  N1    ? ? ? 1_555 A  C   851  N3  ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog915  hydrog ?    ? A  G   830  N2    ? ? ? 1_555 A  C   851  O2  ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog916  hydrog ?    ? A  G   830  O6    ? ? ? 1_555 A  C   851  N4  ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog917  hydrog ?    ? A  G   830  N2    ? ? ? 1_555 A  A   2022 N1  ? ? 0 G   830  0 A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog918  hydrog ?    ? A  U   832  N3    ? ? ? 1_555 A  U   850  O2  ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog919  hydrog ?    ? A  U   832  O4    ? ? ? 1_555 A  U   850  N3  ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog920  hydrog ?    ? A  G   833  N1    ? ? ? 1_555 A  C   849  N3  ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog921  hydrog ?    ? A  G   833  N2    ? ? ? 1_555 A  C   849  O2  ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog922  hydrog ?    ? A  G   833  O6    ? ? ? 1_555 A  C   849  N4  ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog923  hydrog ?    ? A  G   834  N1    ? ? ? 1_555 A  C   848  N3  ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog924  hydrog ?    ? A  G   834  N2    ? ? ? 1_555 A  C   848  O2  ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog925  hydrog ?    ? A  G   834  O6    ? ? ? 1_555 A  C   848  N4  ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog926  hydrog ?    ? A  G   836  N1    ? ? ? 1_555 A  C   847  N3  ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog927  hydrog ?    ? A  G   836  N2    ? ? ? 1_555 A  C   847  O2  ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog928  hydrog ?    ? A  G   836  O6    ? ? ? 1_555 A  C   847  N4  ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog929  hydrog ?    ? A  U   837  N3    ? ? ? 1_555 A  A   846  N1  ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog930  hydrog ?    ? A  U   837  O4    ? ? ? 1_555 A  A   846  N6  ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog931  hydrog ?    ? A  C   838  O2    ? ? ? 1_555 A  A   843  N6  ? ? 0 C   838  0 A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog932  hydrog ?    ? A  U   840  N3    ? ? ? 1_555 A  A   2055 N3  ? ? 0 U   840  0 A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog933  hydrog ?    ? A  C   842  N4    ? ? ? 1_555 A  A   846  N3  ? ? 0 C   842  0 A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog934  hydrog ?    ? A  A   857  N6    ? ? ? 1_555 A  U   1831 O4  ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog935  hydrog ?    ? A  A   857  N7    ? ? ? 1_555 A  U   1831 N3  ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog936  hydrog ?    ? A  A   857  N6    ? ? ? 1_555 A  A   1845 N3  ? ? 0 A   857  0 A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog937  hydrog ?    ? A  A   861  N3    ? ? ? 1_555 A  U   1488 N3  ? ? 0 A   861  0 U   1488 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog938  hydrog ?    ? A  G   863  N2    ? ? ? 1_555 A  A   1459 N3  ? ? 0 G   863  0 A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog939  hydrog ?    ? A  A   867  N3    ? ? ? 1_555 A  G   870  N2  ? ? 0 A   867  0 G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog940  hydrog ?    ? A  G   868  N1    ? ? ? 1_555 A  C   884  N3  ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog941  hydrog ?    ? A  G   868  N2    ? ? ? 1_555 A  C   884  O2  ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog942  hydrog ?    ? A  G   868  O6    ? ? ? 1_555 A  C   884  N4  ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog943  hydrog ?    ? A  G   870  N1    ? ? ? 1_555 A  C   880  N3  ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog944  hydrog ?    ? A  G   870  N2    ? ? ? 1_555 A  C   880  O2  ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog945  hydrog ?    ? A  G   870  O6    ? ? ? 1_555 A  C   880  N4  ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog946  hydrog ?    ? A  G   871  N1    ? ? ? 1_555 A  C   879  N3  ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog947  hydrog ?    ? A  G   871  N2    ? ? ? 1_555 A  C   879  O2  ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog948  hydrog ?    ? A  G   871  O6    ? ? ? 1_555 A  C   879  N4  ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog949  hydrog ?    ? A  U   872  N3    ? ? ? 1_555 A  G   878  O6  ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog950  hydrog ?    ? A  U   872  O2    ? ? ? 1_555 A  G   878  N1  ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog951  hydrog ?    ? A  G   873  N2    ? ? ? 1_555 A  A   876  N1  ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog952  hydrog ?    ? A  G   873  N3    ? ? ? 1_555 A  A   876  N6  ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog953  hydrog ?    ? A  A   874  N3    ? ? ? 1_555 A  G   1832 N2  ? ? 0 A   874  0 G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog954  hydrog ?    ? A  G   885  N2    ? ? ? 1_555 A  G   2113 N3  ? ? 0 G   885  0 G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog955  hydrog ?    ? A  U   900  O2    ? ? ? 1_555 A  A   2101 N6  ? ? 0 U   900  0 A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog956  hydrog ?    ? A  G   901  N2    ? ? ? 1_555 A  A   1358 N3  ? ? 0 G   901  0 A   1358 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog957  hydrog ?    ? A  C   905  N3    ? ? ? 1_555 A  G   1300 N1  ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog958  hydrog ?    ? A  C   905  N4    ? ? ? 1_555 A  G   1300 O6  ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog959  hydrog ?    ? A  C   905  O2    ? ? ? 1_555 A  G   1300 N2  ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog960  hydrog ?    ? A  C   906  N3    ? ? ? 1_555 A  G   1299 N1  ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog961  hydrog ?    ? A  C   906  N4    ? ? ? 1_555 A  G   1299 O6  ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog962  hydrog ?    ? A  C   906  O2    ? ? ? 1_555 A  G   1299 N2  ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog963  hydrog ?    ? A  C   906  O2    ? ? ? 1_555 A  G   1329 N2  ? ? 0 C   906  0 G   1329 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog964  hydrog ?    ? A  A   907  N1    ? ? ? 1_555 A  U   1298 N3  ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog965  hydrog ?    ? A  A   907  N6    ? ? ? 1_555 A  U   1298 O4  ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog966  hydrog ?    ? A  A   908  N1    ? ? ? 1_555 A  U   1297 N3  ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog967  hydrog ?    ? A  A   908  N6    ? ? ? 1_555 A  U   1297 O4  ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog968  hydrog ?    ? A  U   909  N3    ? ? ? 1_555 A  A   1296 N1  ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog969  hydrog ?    ? A  U   909  O4    ? ? ? 1_555 A  A   1296 N6  ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog970  hydrog ?    ? A  C   910  N3    ? ? ? 1_555 A  G   1295 N1  ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog971  hydrog ?    ? A  C   910  N4    ? ? ? 1_555 A  G   1295 O6  ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog972  hydrog ?    ? A  C   910  O2    ? ? ? 1_555 A  G   1295 N2  ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog973  hydrog ?    ? A  G   911  N2    ? ? ? 1_555 A  A   1294 N7  ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog974  hydrog ?    ? A  G   911  N3    ? ? ? 1_555 A  A   1294 N6  ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog975  hydrog ?    ? A  A   912  N6    ? ? ? 1_555 A  U   1293 O2  ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog976  hydrog ?    ? A  A   912  N7    ? ? ? 1_555 A  U   1293 N3  ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog977  hydrog ?    ? A  A   913  N6    ? ? ? 1_555 A  G   1071 O6  ? ? 0 A   913  0 G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog978  hydrog ?    ? A  A   914  N6    ? ? ? 1_555 A  A   1070 N3  ? ? 0 A   914  0 A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog979  hydrog ?    ? A  C   915  N3    ? ? ? 1_555 A  G   928  N1  ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog980  hydrog ?    ? A  C   915  N4    ? ? ? 1_555 A  G   928  O6  ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog981  hydrog ?    ? A  C   915  O2    ? ? ? 1_555 A  G   928  N2  ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog982  hydrog ?    ? A  C   915  N4    ? ? ? 1_555 A  U   1042 O2  ? ? 0 C   915  0 U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog983  hydrog ?    ? A  A   916  N1    ? ? ? 1_555 A  U   927  N3  ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog984  hydrog ?    ? A  A   916  N6    ? ? ? 1_555 A  U   927  O4  ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog985  hydrog ?    ? A  U   917  N3    ? ? ? 1_555 A  A   926  N1  ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog986  hydrog ?    ? A  U   917  O4    ? ? ? 1_555 A  A   926  N6  ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog987  hydrog ?    ? A  G   918  N1    ? ? ? 1_555 A  C   925  N3  ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog988  hydrog ?    ? A  G   918  N2    ? ? ? 1_555 A  C   925  O2  ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog989  hydrog ?    ? A  G   918  O6    ? ? ? 1_555 A  C   925  N4  ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog990  hydrog ?    ? A  U   919  N3    ? ? ? 1_555 A  G   924  O6  ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog991  hydrog ?    ? A  U   919  O2    ? ? ? 1_555 A  G   924  N1  ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog992  hydrog ?    ? A  G   921  O6    ? ? ? 1_555 A  G   2279 N2  ? ? 0 G   921  0 G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog993  hydrog ?    ? A  A   923  N6    ? ? ? 1_555 A  U   2107 O2  ? ? 0 A   923  0 U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog994  hydrog ?    ? A  A   923  N6    ? ? ? 1_555 A  G   2480 N3  ? ? 0 A   923  0 G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog995  hydrog ?    ? A  A   926  N6    ? ? ? 1_555 A  C   1043 N3  ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog996  hydrog ?    ? A  A   926  N7    ? ? ? 1_555 A  C   1043 N4  ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog997  hydrog ?    ? A  G   928  N2    ? ? ? 1_555 A  A   2394 N1  ? ? 0 G   928  0 A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog998  hydrog ?    ? A  A   929  N6    ? ? ? 1_555 A  U   1041 O4  ? ? 0 A   929  0 U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog999  hydrog ?    ? A  C   930  O2    ? ? ? 1_555 A  A   1040 N6  ? ? 0 C   930  0 A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1000 hydrog ?    ? A  C   931  N3    ? ? ? 1_555 A  G   1039 N1  ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1001 hydrog ?    ? A  C   931  N4    ? ? ? 1_555 A  G   1039 O6  ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1002 hydrog ?    ? A  C   931  O2    ? ? ? 1_555 A  G   1039 N2  ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1003 hydrog ?    ? A  U   932  N3    ? ? ? 1_555 A  G   1038 O6  ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1004 hydrog ?    ? A  U   932  O2    ? ? ? 1_555 A  G   1038 N1  ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1005 hydrog ?    ? A  C   933  N3    ? ? ? 1_555 A  G   1037 N1  ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1006 hydrog ?    ? A  C   933  N4    ? ? ? 1_555 A  G   1037 O6  ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1007 hydrog ?    ? A  C   933  O2    ? ? ? 1_555 A  G   1037 N2  ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1008 hydrog ?    ? A  C   934  N3    ? ? ? 1_555 A  G   1036 N1  ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1009 hydrog ?    ? A  C   934  N4    ? ? ? 1_555 A  G   1036 O6  ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1010 hydrog ?    ? A  C   934  O2    ? ? ? 1_555 A  G   1036 N2  ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1011 hydrog ?    ? A  G   935  N1    ? ? ? 1_555 A  C   1035 N3  ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1012 hydrog ?    ? A  G   935  N2    ? ? ? 1_555 A  C   1035 O2  ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1013 hydrog ?    ? A  G   935  O6    ? ? ? 1_555 A  C   1035 N4  ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1014 hydrog ?    ? A  C   936  N3    ? ? ? 1_555 A  G   1034 N1  ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1015 hydrog ?    ? A  C   936  N4    ? ? ? 1_555 A  G   1034 O6  ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1016 hydrog ?    ? A  C   936  O2    ? ? ? 1_555 A  G   1034 N2  ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1017 hydrog ?    ? A  C   937  O2    ? ? ? 1_555 A  C   1033 N4  ? ? 0 C   937  0 C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1018 hydrog ?    ? A  G   938  N2    ? ? ? 1_555 A  A   1032 N7  ? ? 0 G   938  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1019 hydrog ?    ? A  A   939  N3    ? ? ? 1_555 A  G   1027 N2  ? ? 0 A   939  0 G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1020 hydrog ?    ? A  A   939  N6    ? ? ? 1_555 A  G   1031 N3  ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1021 hydrog ?    ? A  A   939  N7    ? ? ? 1_555 A  G   1031 N2  ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1022 hydrog ?    ? A  G   940  N1    ? ? ? 1_555 A  U   1026 O2  ? ? 0 G   940  0 U   1026 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1023 hydrog ?    ? A  G   940  O6    ? ? ? 1_555 A  U   1026 N3  ? ? 0 G   940  0 U   1026 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1024 hydrog ?    ? A  G   940  N2    ? ? ? 1_555 A  A   1032 N3  ? ? 0 G   940  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1025 hydrog ?    ? A  G   941  N1    ? ? ? 1_555 A  C   1025 N3  ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1026 hydrog ?    ? A  G   941  N2    ? ? ? 1_555 A  C   1025 O2  ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1027 hydrog ?    ? A  G   941  O6    ? ? ? 1_555 A  C   1025 N4  ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1028 hydrog ?    ? A  U   942  N3    ? ? ? 1_555 A  G   1024 O6  ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1029 hydrog ?    ? A  U   942  O2    ? ? ? 1_555 A  G   1024 N1  ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1030 hydrog ?    ? A  A   943  N6    ? ? ? 1_555 A  C   1025 O2  ? ? 0 A   943  0 C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1031 hydrog ?    ? A  G   944  N1    ? ? ? 1_555 A  C   1023 N3  ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1032 hydrog ?    ? A  G   944  N2    ? ? ? 1_555 A  C   1023 O2  ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1033 hydrog ?    ? A  G   944  O6    ? ? ? 1_555 A  C   1023 N4  ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1034 hydrog ?    ? A  U   945  N3    ? ? ? 1_555 A  A   1022 N1  ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1035 hydrog ?    ? A  U   945  O4    ? ? ? 1_555 A  A   1022 N6  ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1036 hydrog ?    ? A  C   946  N3    ? ? ? 1_555 A  G   1021 N1  ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1037 hydrog ?    ? A  C   946  N4    ? ? ? 1_555 A  G   1021 O6  ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1038 hydrog ?    ? A  C   946  O2    ? ? ? 1_555 A  G   1021 N2  ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1039 hydrog ?    ? A  U   947  N3    ? ? ? 1_555 A  A   1020 N1  ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1040 hydrog ?    ? A  U   947  O4    ? ? ? 1_555 A  A   1020 N6  ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1041 hydrog ?    ? A  G   948  N1    ? ? ? 1_555 A  C   1019 N3  ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1042 hydrog ?    ? A  G   948  N2    ? ? ? 1_555 A  C   1019 O2  ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1043 hydrog ?    ? A  G   948  O6    ? ? ? 1_555 A  C   1019 N4  ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1044 hydrog ?    ? A  U   949  N3    ? ? ? 1_555 A  A   1018 N1  ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1045 hydrog ?    ? A  U   949  O4    ? ? ? 1_555 A  A   1018 N6  ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1046 hydrog ?    ? A  G   950  N1    ? ? ? 1_555 A  U   1017 O2  ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1047 hydrog ?    ? A  G   950  O6    ? ? ? 1_555 A  U   1017 N3  ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1048 hydrog ?    ? A  A   951  N1    ? ? ? 1_555 A  U   1016 N3  ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1049 hydrog ?    ? A  A   951  N6    ? ? ? 1_555 A  U   1016 O4  ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1050 hydrog ?    ? A  G   952  N1    ? ? ? 1_555 A  C   1015 N3  ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1051 hydrog ?    ? A  G   952  N2    ? ? ? 1_555 A  C   1015 O2  ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1052 hydrog ?    ? A  G   952  O6    ? ? ? 1_555 A  C   1015 N4  ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1053 hydrog ?    ? A  G   953  N2    ? ? ? 1_555 A  U   954  O4  ? ? 0 G   953  0 U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1054 hydrog ?    ? A  U   954  N3    ? ? ? 1_555 A  A   1013 N7  ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1055 hydrog ?    ? A  U   954  O2    ? ? ? 1_555 A  A   1013 N6  ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1056 hydrog ?    ? A  A   955  N6    ? ? ? 1_555 A  A   1012 N3  ? ? 0 A   955  0 A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1057 hydrog ?    ? A  G   956  N1    ? ? ? 1_555 A  C   1011 N3  ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1058 hydrog ?    ? A  G   956  N2    ? ? ? 1_555 A  C   1011 O2  ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1059 hydrog ?    ? A  G   956  O6    ? ? ? 1_555 A  C   1011 N4  ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1060 hydrog ?    ? A  A   957  N1    ? ? ? 1_555 A  U   1009 N3  ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1061 hydrog ?    ? A  A   957  N6    ? ? ? 1_555 A  U   1009 O4  ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1062 hydrog ?    ? A  G   958  N2    ? ? ? 1_555 A  A   961  N1  ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1063 hydrog ?    ? A  G   958  N3    ? ? ? 1_555 A  A   961  N6  ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1064 hydrog ?    ? A  G   958  N1    ? ? ? 1_555 A  C   1008 N3  ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1065 hydrog ?    ? A  G   958  N2    ? ? ? 1_555 A  C   1008 O2  ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1066 hydrog ?    ? A  G   958  O6    ? ? ? 1_555 A  C   1008 N4  ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1067 hydrog ?    ? A  C   959  O2    ? ? ? 1_555 A  C   963  N4  ? ? 0 C   959  0 C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1068 hydrog ?    ? A  C   959  N3    ? ? ? 1_555 A  A   1005 N6  ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1069 hydrog ?    ? A  C   959  N4    ? ? ? 1_555 A  A   1005 N7  ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1070 hydrog ?    ? A  C   962  N4    ? ? ? 1_555 A  C   1008 O2  ? ? 0 C   962  0 C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1071 hydrog ?    ? A  C   963  N3    ? ? ? 1_555 A  A   1005 N6  ? ? 0 C   963  0 A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1072 hydrog ?    ? A  G   964  N1    ? ? ? 1_555 A  C   1004 N3  ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1073 hydrog ?    ? A  G   964  N2    ? ? ? 1_555 A  C   1004 O2  ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1074 hydrog ?    ? A  G   964  O6    ? ? ? 1_555 A  C   1004 N4  ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1075 hydrog ?    ? A  A   965  N1    ? ? ? 1_555 A  U   1003 N3  ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1076 hydrog ?    ? A  A   965  N6    ? ? ? 1_555 A  U   1003 O4  ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1077 hydrog ?    ? A  U   966  O2    ? ? ? 1_555 A  G   1002 N1  ? ? 0 U   966  0 G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog1078 hydrog ?    ? A  U   967  N3    ? ? ? 1_555 A  U   1001 O2  ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1079 hydrog ?    ? A  U   967  O4    ? ? ? 1_555 A  U   1001 N3  ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1080 hydrog ?    ? A  G   968  N1    ? ? ? 1_555 A  C   1000 N3  ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1081 hydrog ?    ? A  G   968  N2    ? ? ? 1_555 A  C   1000 O2  ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1082 hydrog ?    ? A  G   968  O6    ? ? ? 1_555 A  C   1000 N4  ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1083 hydrog ?    ? A  G   969  N2    ? ? ? 1_555 A  C   999  N3  ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1084 hydrog ?    ? A  U   1009 O2    ? ? ? 1_555 A  C   1010 N4  ? ? 0 U   1009 0 C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog1085 hydrog ?    ? A  A   1014 N6    ? ? ? 1_555 A  A   2302 N7  ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1086 hydrog ?    ? A  A   1014 N7    ? ? ? 1_555 A  A   2302 N6  ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1087 hydrog ?    ? A  G   1045 N1    ? ? ? 1_555 A  C   1069 N3  ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1088 hydrog ?    ? A  G   1045 N2    ? ? ? 1_555 A  C   1069 O2  ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1089 hydrog ?    ? A  G   1045 O6    ? ? ? 1_555 A  C   1069 N4  ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1090 hydrog ?    ? A  G   1046 N1    ? ? ? 1_555 A  C   1068 N3  ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1091 hydrog ?    ? A  G   1046 N2    ? ? ? 1_555 A  C   1068 O2  ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1092 hydrog ?    ? A  G   1046 O6    ? ? ? 1_555 A  C   1068 N4  ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1093 hydrog ?    ? A  G   1046 N2    ? ? ? 1_555 A  A   1082 N3  ? ? 0 G   1046 0 A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1094 hydrog ?    ? A  U   1047 N3    ? ? ? 1_555 A  A   1067 N1  ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1095 hydrog ?    ? A  U   1047 O4    ? ? ? 1_555 A  A   1067 N6  ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1096 hydrog ?    ? A  G   1048 N1    ? ? ? 1_555 A  U   1066 O2  ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1097 hydrog ?    ? A  G   1048 O6    ? ? ? 1_555 A  U   1066 N3  ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1098 hydrog ?    ? A  C   1049 N3    ? ? ? 1_555 A  G   1065 N1  ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1099 hydrog ?    ? A  C   1049 N4    ? ? ? 1_555 A  G   1065 O6  ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1100 hydrog ?    ? A  C   1049 O2    ? ? ? 1_555 A  G   1065 N2  ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1101 hydrog ?    ? A  G   1050 N1    ? ? ? 1_555 A  U   1064 O2  ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1102 hydrog ?    ? A  G   1050 O6    ? ? ? 1_555 A  U   1064 N3  ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1103 hydrog ?    ? A  C   1051 N3    ? ? ? 1_555 A  G   1063 N1  ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1104 hydrog ?    ? A  C   1051 N4    ? ? ? 1_555 A  G   1063 O6  ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1105 hydrog ?    ? A  C   1051 O2    ? ? ? 1_555 A  G   1063 N2  ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1106 hydrog ?    ? A  G   1052 N1    ? ? ? 1_555 A  U   1062 O2  ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1107 hydrog ?    ? A  G   1052 O6    ? ? ? 1_555 A  U   1062 N3  ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1108 hydrog ?    ? A  G   1053 N1    ? ? ? 1_555 A  C   1061 N3  ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1109 hydrog ?    ? A  G   1053 N2    ? ? ? 1_555 A  C   1061 O2  ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1110 hydrog ?    ? A  G   1053 O6    ? ? ? 1_555 A  C   1061 N4  ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1111 hydrog ?    ? A  G   1053 N2    ? ? ? 1_555 A  U   2308 O2  ? ? 0 G   1053 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1112 hydrog ?    ? A  G   1054 N1    ? ? ? 1_555 A  C   1060 N3  ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1113 hydrog ?    ? A  G   1054 N2    ? ? ? 1_555 A  C   1060 O2  ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1114 hydrog ?    ? A  G   1054 O6    ? ? ? 1_555 A  C   1060 N4  ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1115 hydrog ?    ? A  G   1054 N2    ? ? ? 1_555 A  G   2283 O6  ? ? 0 G   1054 0 G   2283 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog1116 hydrog ?    ? A  G   1055 N2    ? ? ? 1_555 A  A   1058 N7  ? ? 0 G   1055 0 A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1117 hydrog ?    ? A  U   1056 O4    ? ? ? 1_555 A  G   2529 N2  ? ? 0 U   1056 0 G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog1118 hydrog ?    ? A  A   1058 N3    ? ? ? 1_555 A  G   2491 N2  ? ? 0 A   1058 0 G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1119 hydrog ?    ? A  G   1063 N2    ? ? ? 1_555 A  A   2301 N7  ? ? 0 G   1063 0 A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1120 hydrog ?    ? A  G   1072 N2    ? ? ? 1_555 A  A   1088 N7  ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1121 hydrog ?    ? A  G   1072 N3    ? ? ? 1_555 A  A   1088 N6  ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1122 hydrog ?    ? A  A   1073 N6    ? ? ? 1_555 A  A   1086 N3  ? ? 0 A   1073 0 A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1123 hydrog ?    ? A  A   1073 N7    ? ? ? 1_555 A  G   1087 N2  ? ? 0 A   1073 0 G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1124 hydrog ?    ? A  G   1074 N1    ? ? ? 1_555 A  C   1085 N3  ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1125 hydrog ?    ? A  G   1074 N2    ? ? ? 1_555 A  C   1085 O2  ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1126 hydrog ?    ? A  G   1074 O6    ? ? ? 1_555 A  C   1085 N4  ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1127 hydrog ?    ? A  G   1075 N1    ? ? ? 1_555 A  C   1084 N3  ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1128 hydrog ?    ? A  G   1075 N2    ? ? ? 1_555 A  C   1084 O2  ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1129 hydrog ?    ? A  G   1075 O6    ? ? ? 1_555 A  C   1084 N4  ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1130 hydrog ?    ? A  G   1075 N2    ? ? ? 1_555 A  A   1098 N3  ? ? 0 G   1075 0 A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1131 hydrog ?    ? A  G   1076 N1    ? ? ? 1_555 A  C   1083 N3  ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1132 hydrog ?    ? A  G   1076 N2    ? ? ? 1_555 A  C   1083 O2  ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1133 hydrog ?    ? A  G   1076 O6    ? ? ? 1_555 A  C   1083 N4  ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1134 hydrog ?    ? A  G   1076 N2    ? ? ? 1_555 B  U   87   O4  ? ? 0 G   1076 9 U   87   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1135 hydrog ?    ? A  A   1079 N3    ? ? ? 1_555 A  G   2068 N2  ? ? 0 A   1079 0 G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1136 hydrog ?    ? A  C   1083 O2    ? ? ? 1_555 A  A   1124 N6  ? ? 0 C   1083 0 A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1137 hydrog ?    ? A  G   1089 N1    ? ? ? 1_555 A  C   1267 N3  ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1138 hydrog ?    ? A  G   1089 N2    ? ? ? 1_555 A  C   1267 O2  ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1139 hydrog ?    ? A  G   1089 O6    ? ? ? 1_555 A  C   1267 N4  ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1140 hydrog ?    ? A  A   1090 N1    ? ? ? 1_555 A  U   1266 N3  ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1141 hydrog ?    ? A  A   1090 N6    ? ? ? 1_555 A  U   1266 O4  ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1142 hydrog ?    ? A  U   1091 N3    ? ? ? 1_555 A  G   1265 O6  ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1143 hydrog ?    ? A  U   1091 O2    ? ? ? 1_555 A  G   1265 N1  ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1144 hydrog ?    ? A  A   1092 N1    ? ? ? 1_555 A  U   1264 N3  ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1145 hydrog ?    ? A  A   1092 N6    ? ? ? 1_555 A  U   1264 O4  ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1146 hydrog ?    ? A  G   1093 N1    ? ? ? 1_555 A  C   1263 N3  ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1147 hydrog ?    ? A  G   1093 N2    ? ? ? 1_555 A  C   1263 O2  ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1148 hydrog ?    ? A  G   1093 O6    ? ? ? 1_555 A  C   1263 N4  ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1149 hydrog ?    ? A  G   1094 N1    ? ? ? 1_555 A  C   1262 N3  ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1150 hydrog ?    ? A  G   1094 N2    ? ? ? 1_555 A  C   1262 O2  ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1151 hydrog ?    ? A  G   1094 O6    ? ? ? 1_555 A  C   1262 N4  ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1152 hydrog ?    ? A  U   1095 N3    ? ? ? 1_555 A  A   1261 N1  ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1153 hydrog ?    ? A  U   1095 O4    ? ? ? 1_555 A  A   1261 N6  ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1154 hydrog ?    ? A  U   1096 N3    ? ? ? 1_555 A  A   1259 N7  ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1155 hydrog ?    ? A  U   1096 O2    ? ? ? 1_555 A  A   1259 N6  ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1156 hydrog ?    ? A  A   1098 N6    ? ? ? 1_555 A  G   1258 N3  ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1157 hydrog ?    ? A  A   1098 N7    ? ? ? 1_555 A  G   1258 N2  ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1158 hydrog ?    ? A  G   1099 N1    ? ? ? 1_555 A  C   1257 N3  ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1159 hydrog ?    ? A  G   1099 N2    ? ? ? 1_555 A  C   1257 O2  ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1160 hydrog ?    ? A  G   1099 O6    ? ? ? 1_555 A  C   1257 N4  ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1161 hydrog ?    ? A  G   1100 N2    ? ? ? 1_555 A  A   1107 N3  ? ? 0 G   1100 0 A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1162 hydrog ?    ? A  G   1100 N1    ? ? ? 1_555 A  C   1256 N3  ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1163 hydrog ?    ? A  G   1100 N2    ? ? ? 1_555 A  C   1256 O2  ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1164 hydrog ?    ? A  G   1100 O6    ? ? ? 1_555 A  C   1256 N4  ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1165 hydrog ?    ? A  U   1101 N3    ? ? ? 1_555 A  A   1255 N1  ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1166 hydrog ?    ? A  U   1101 O4    ? ? ? 1_555 A  A   1255 N6  ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1167 hydrog ?    ? A  C   1102 N3    ? ? ? 1_555 A  G   1241 N1  ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1168 hydrog ?    ? A  C   1102 N4    ? ? ? 1_555 A  G   1241 O6  ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1169 hydrog ?    ? A  C   1102 O2    ? ? ? 1_555 A  G   1241 N2  ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1170 hydrog ?    ? A  C   1103 N3    ? ? ? 1_555 A  G   1240 N1  ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1171 hydrog ?    ? A  C   1103 N4    ? ? ? 1_555 A  G   1240 O6  ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1172 hydrog ?    ? A  C   1103 O2    ? ? ? 1_555 A  G   1240 N2  ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1173 hydrog ?    ? A  C   1104 N3    ? ? ? 1_555 A  G   1239 N1  ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1174 hydrog ?    ? A  C   1104 N4    ? ? ? 1_555 A  G   1239 O6  ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1175 hydrog ?    ? A  C   1104 O2    ? ? ? 1_555 A  G   1239 N2  ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1176 hydrog ?    ? A  C   1105 O2    ? ? ? 1_555 A  A   1106 N6  ? ? 0 C   1105 0 A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1177 hydrog ?    ? A  C   1105 O2    ? ? ? 1_555 A  A   1107 N6  ? ? 0 C   1105 0 A   1107 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1178 hydrog ?    ? A  G   1108 N1    ? ? ? 1_555 A  C   1254 N3  ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1179 hydrog ?    ? A  G   1108 N2    ? ? ? 1_555 A  C   1254 O2  ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1180 hydrog ?    ? A  G   1108 O6    ? ? ? 1_555 A  C   1254 N4  ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1181 hydrog ?    ? A  U   1109 N3    ? ? ? 1_555 A  A   1247 N7  ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1182 hydrog ?    ? A  U   1109 O4    ? ? ? 1_555 A  A   1247 N6  ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1183 hydrog ?    ? A  G   1110 N1    ? ? ? 1_555 A  C   1253 N3  ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1184 hydrog ?    ? A  G   1110 N2    ? ? ? 1_555 A  C   1253 O2  ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1185 hydrog ?    ? A  G   1110 O6    ? ? ? 1_555 A  C   1253 N4  ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1186 hydrog ?    ? A  U   1111 N3    ? ? ? 1_555 A  A   1252 N1  ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1187 hydrog ?    ? A  U   1111 O4    ? ? ? 1_555 A  A   1252 N6  ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1188 hydrog ?    ? A  G   1112 N1    ? ? ? 1_555 A  C   1251 N3  ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1189 hydrog ?    ? A  G   1112 N2    ? ? ? 1_555 A  C   1251 O2  ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1190 hydrog ?    ? A  G   1112 O6    ? ? ? 1_555 A  C   1251 N4  ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1191 hydrog ?    ? A  G   1113 N1    ? ? ? 1_555 A  C   1250 N3  ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1192 hydrog ?    ? A  G   1113 N2    ? ? ? 1_555 A  C   1250 O2  ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1193 hydrog ?    ? A  G   1113 O6    ? ? ? 1_555 A  C   1250 N4  ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1194 hydrog ?    ? A  A   1114 N1    ? ? ? 1_555 A  U   1249 N3  ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1195 hydrog ?    ? A  U   1115 N3    ? ? ? 1_555 A  A   1248 N1  ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1196 hydrog ?    ? A  U   1115 O4    ? ? ? 1_555 A  A   1248 N6  ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1197 hydrog ?    ? A  U   1116 O2    ? ? ? 1_555 A  A   1246 N6  ? ? 0 U   1116 0 A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1198 hydrog ?    ? A  A   1118 N6    ? ? ? 1_555 A  U   1244 O2  ? ? 0 A   1118 0 U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1199 hydrog ?    ? A  G   1119 N2    ? ? ? 1_555 A  U   1120 O4  ? ? 0 G   1119 0 U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1200 hydrog ?    ? A  G   1121 N1    ? ? ? 1_555 A  C   1243 N3  ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1201 hydrog ?    ? A  G   1121 N2    ? ? ? 1_555 A  C   1243 O2  ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1202 hydrog ?    ? A  G   1121 O6    ? ? ? 1_555 A  C   1243 N4  ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1203 hydrog ?    ? A  U   1122 N3    ? ? ? 1_555 A  A   1242 N1  ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1204 hydrog ?    ? A  U   1122 O4    ? ? ? 1_555 A  A   1242 N6  ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1205 hydrog ?    ? A  A   1132 N6    ? ? ? 1_555 A  A   1230 N7  ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1206 hydrog ?    ? A  A   1132 N7    ? ? ? 1_555 A  A   1230 N6  ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1207 hydrog ?    ? A  A   1133 N6    ? ? ? 1_555 A  C   1229 O2  ? ? 0 A   1133 0 C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1208 hydrog ?    ? A  A   1133 N3    ? ? ? 1_555 A  G   2520 N2  ? ? 0 A   1133 0 G   2520 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1209 hydrog ?    ? A  G   1134 N1    ? ? ? 1_555 A  C   1228 N3  ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1210 hydrog ?    ? A  G   1134 N2    ? ? ? 1_555 A  C   1228 O2  ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1211 hydrog ?    ? A  G   1134 O6    ? ? ? 1_555 A  C   1228 N4  ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1212 hydrog ?    ? A  G   1135 N1    ? ? ? 1_555 A  C   1227 N3  ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1213 hydrog ?    ? A  G   1135 N2    ? ? ? 1_555 A  C   1227 O2  ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1214 hydrog ?    ? A  G   1135 O6    ? ? ? 1_555 A  C   1227 N4  ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1215 hydrog ?    ? A  U   1136 N3    ? ? ? 1_555 A  G   1226 O6  ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1216 hydrog ?    ? A  U   1136 O2    ? ? ? 1_555 A  G   1226 N1  ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1217 hydrog ?    ? A  G   1138 N1    ? ? ? 1_555 A  C   1225 N3  ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1218 hydrog ?    ? A  G   1138 N2    ? ? ? 1_555 A  C   1225 O2  ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1219 hydrog ?    ? A  G   1138 O6    ? ? ? 1_555 A  C   1225 N4  ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1220 hydrog ?    ? A  U   1139 N3    ? ? ? 1_555 A  G   1224 O6  ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1221 hydrog ?    ? A  U   1139 O2    ? ? ? 1_555 A  G   1224 N1  ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1222 hydrog ?    ? A  C   1140 N3    ? ? ? 1_555 A  G   1223 N1  ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1223 hydrog ?    ? A  C   1140 N4    ? ? ? 1_555 A  G   1223 O6  ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1224 hydrog ?    ? A  C   1140 O2    ? ? ? 1_555 A  G   1223 N2  ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1225 hydrog ?    ? A  U   1141 N3    ? ? ? 1_555 A  A   1222 N1  ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1226 hydrog ?    ? A  U   1141 O4    ? ? ? 1_555 A  A   1222 N6  ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1227 hydrog ?    ? A  C   1142 N3    ? ? ? 1_555 A  G   1221 N1  ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1228 hydrog ?    ? A  C   1142 N4    ? ? ? 1_555 A  G   1221 O6  ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1229 hydrog ?    ? A  C   1142 O2    ? ? ? 1_555 A  G   1221 N2  ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1230 hydrog ?    ? A  G   1143 N1    ? ? ? 1_555 A  U   1220 O2  ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1231 hydrog ?    ? A  G   1143 O6    ? ? ? 1_555 A  U   1220 N3  ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1232 hydrog ?    ? A  A   1144 N1    ? ? ? 1_555 A  U   1219 N3  ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1233 hydrog ?    ? A  A   1144 N6    ? ? ? 1_555 A  U   1219 O4  ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1234 hydrog ?    ? A  G   1145 N1    ? ? ? 1_555 A  U   1218 O2  ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1235 hydrog ?    ? A  G   1145 O6    ? ? ? 1_555 A  U   1218 N3  ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1236 hydrog ?    ? A  C   1146 N3    ? ? ? 1_555 A  G   1217 N1  ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1237 hydrog ?    ? A  C   1146 N4    ? ? ? 1_555 A  G   1217 O6  ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1238 hydrog ?    ? A  C   1146 O2    ? ? ? 1_555 A  G   1217 N2  ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1239 hydrog ?    ? A  C   1147 N3    ? ? ? 1_555 A  G   1216 N1  ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1240 hydrog ?    ? A  C   1147 N4    ? ? ? 1_555 A  G   1216 O6  ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1241 hydrog ?    ? A  C   1147 O2    ? ? ? 1_555 A  G   1216 N2  ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1242 hydrog ?    ? A  G   1151 N2    ? ? ? 1_555 A  A   1215 N7  ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1243 hydrog ?    ? A  G   1151 N3    ? ? ? 1_555 A  A   1215 N6  ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1244 hydrog ?    ? A  A   1152 N7    ? ? ? 1_555 A  G   1214 N2  ? ? 0 A   1152 0 G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1245 hydrog ?    ? A  A   1152 N3    ? ? ? 1_555 A  G   1216 N2  ? ? 0 A   1152 0 G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1246 hydrog ?    ? A  A   1152 N6    ? ? ? 1_555 A  G   2786 O6  ? ? 0 A   1152 0 G   2786 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1247 hydrog ?    ? A  C   1153 N4    ? ? ? 1_555 A  G   2786 O6  ? ? 0 C   1153 0 G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog1248 hydrog ?    ? A  A   1154 N6    ? ? ? 1_555 A  C   1213 O2  ? ? 0 A   1154 0 C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1249 hydrog ?    ? A  G   1155 N1    ? ? ? 1_555 A  C   1212 N3  ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1250 hydrog ?    ? A  G   1155 N2    ? ? ? 1_555 A  C   1212 O2  ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1251 hydrog ?    ? A  G   1155 O6    ? ? ? 1_555 A  C   1212 N4  ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1252 hydrog ?    ? A  C   1156 N3    ? ? ? 1_555 A  G   1211 N1  ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1253 hydrog ?    ? A  C   1156 N4    ? ? ? 1_555 A  G   1211 O6  ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1254 hydrog ?    ? A  C   1156 O2    ? ? ? 1_555 A  G   1211 N2  ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1255 hydrog ?    ? A  C   1157 N3    ? ? ? 1_555 A  G   1210 N1  ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1256 hydrog ?    ? A  C   1157 N4    ? ? ? 1_555 A  G   1210 O6  ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1257 hydrog ?    ? A  C   1157 O2    ? ? ? 1_555 A  G   1210 N2  ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1258 hydrog ?    ? A  G   1158 N1    ? ? ? 1_555 A  C   1209 N3  ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1259 hydrog ?    ? A  G   1158 N2    ? ? ? 1_555 A  C   1209 O2  ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1260 hydrog ?    ? A  G   1158 O6    ? ? ? 1_555 A  C   1209 N4  ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1261 hydrog ?    ? A  G   1159 N1    ? ? ? 1_555 A  C   1208 N3  ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1262 hydrog ?    ? A  G   1159 N2    ? ? ? 1_555 A  C   1208 O2  ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1263 hydrog ?    ? A  G   1159 O6    ? ? ? 1_555 A  C   1208 N4  ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1264 hydrog ?    ? A  G   1160 N2    ? ? ? 1_555 A  A   1207 N7  ? ? 0 G   1160 0 A   1207 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1265 hydrog ?    ? A  A   1161 N1    ? ? ? 1_555 A  U   1185 N3  ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1266 hydrog ?    ? A  A   1161 N6    ? ? ? 1_555 A  U   1185 O4  ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1267 hydrog ?    ? A  G   1162 N1    ? ? ? 1_555 A  C   1184 N3  ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1268 hydrog ?    ? A  G   1162 N2    ? ? ? 1_555 A  C   1184 O2  ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1269 hydrog ?    ? A  G   1162 O6    ? ? ? 1_555 A  C   1184 N4  ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1270 hydrog ?    ? A  G   1163 N2    ? ? ? 1_555 A  C   1183 O2  ? ? 0 G   1163 0 C   1183 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1271 hydrog ?    ? A  G   1163 N1    ? ? ? 1_555 A  C   1184 N3  ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1272 hydrog ?    ? A  A   1166 N6    ? ? ? 1_555 A  U   1180 O4  ? ? 0 A   1166 0 U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1273 hydrog ?    ? A  G   1167 N1    ? ? ? 1_555 A  C   1179 N3  ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1274 hydrog ?    ? A  G   1167 N2    ? ? ? 1_555 A  C   1179 O2  ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1275 hydrog ?    ? A  G   1167 O6    ? ? ? 1_555 A  C   1179 N4  ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1276 hydrog ?    ? A  C   1168 O2    ? ? ? 1_555 A  G   1178 N2  ? ? 0 C   1168 0 G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog1277 hydrog ?    ? A  U   1169 O2    ? ? ? 1_555 A  A   1177 N6  ? ? 0 U   1169 0 A   1177 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1278 hydrog ?    ? A  G   1175 O6    ? ? ? 1_555 A  C   1204 N4  ? ? 0 G   1175 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1279 hydrog ?    ? A  C   1176 N3    ? ? ? 1_555 A  C   1196 N4  ? ? 0 C   1176 0 C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1280 hydrog ?    ? A  C   1186 N3    ? ? ? 1_555 A  G   1190 N2  ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1281 hydrog ?    ? A  C   1186 O2    ? ? ? 1_555 A  G   1190 N1  ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1282 hydrog ?    ? A  A   1193 N3    ? ? ? 1_555 A  A   1194 N6  ? ? 0 A   1193 0 A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1283 hydrog ?    ? A  G   1195 N1    ? ? ? 1_555 A  C   1204 N3  ? ? 0 G   1195 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1284 hydrog ?    ? A  C   1196 N3    ? ? ? 1_555 A  G   1203 N1  ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1285 hydrog ?    ? A  C   1196 N4    ? ? ? 1_555 A  G   1203 O6  ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1286 hydrog ?    ? A  C   1196 O2    ? ? ? 1_555 A  G   1203 N2  ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1287 hydrog ?    ? A  G   1197 N2    ? ? ? 1_555 A  A   1202 N7  ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1288 hydrog ?    ? A  G   1197 N3    ? ? ? 1_555 A  A   1202 N6  ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1289 hydrog ?    ? A  A   1231 N6    ? ? ? 1_555 A  C   2498 O2  ? ? 0 A   1231 0 C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1290 hydrog ?    ? A  A   1231 N6    ? ? ? 1_555 A  U   2523 O2  ? ? 0 A   1231 0 U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1291 hydrog ?    ? A  G   1235 N2    ? ? ? 1_555 A  A   1236 N7  ? ? 0 G   1235 0 A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1292 hydrog ?    ? A  G   1235 O6    ? ? ? 1_555 A  G   2080 N2  ? ? 0 G   1235 0 G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog1293 hydrog ?    ? A  C   1238 N4    ? ? ? 1_555 A  G   1241 N7  ? ? 0 C   1238 0 G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog1294 hydrog ?    ? A  C   1268 N3    ? ? ? 1_555 A  G   1290 N1  ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1295 hydrog ?    ? A  C   1268 N4    ? ? ? 1_555 A  G   1290 O6  ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1296 hydrog ?    ? A  C   1268 O2    ? ? ? 1_555 A  G   1290 N2  ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1297 hydrog ?    ? A  G   1269 N1    ? ? ? 1_555 A  C   1289 N3  ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1298 hydrog ?    ? A  G   1269 N2    ? ? ? 1_555 A  C   1289 O2  ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1299 hydrog ?    ? A  G   1269 O6    ? ? ? 1_555 A  C   1289 N4  ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1300 hydrog ?    ? A  U   1270 N3    ? ? ? 1_555 A  A   1286 N1  ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1301 hydrog ?    ? A  U   1270 O4    ? ? ? 1_555 A  A   1286 N6  ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1302 hydrog ?    ? A  A   1271 N1    ? ? ? 1_555 A  U   1285 N3  ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1303 hydrog ?    ? A  A   1271 N6    ? ? ? 1_555 A  U   1285 O4  ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1304 hydrog ?    ? A  C   1272 N3    ? ? ? 1_555 A  G   1284 N1  ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1305 hydrog ?    ? A  C   1272 N4    ? ? ? 1_555 A  G   1284 O6  ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1306 hydrog ?    ? A  C   1272 O2    ? ? ? 1_555 A  G   1284 N2  ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1307 hydrog ?    ? A  C   1273 N3    ? ? ? 1_555 A  G   1283 N1  ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1308 hydrog ?    ? A  C   1273 N4    ? ? ? 1_555 A  G   1283 O6  ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1309 hydrog ?    ? A  C   1273 O2    ? ? ? 1_555 A  G   1283 N2  ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1310 hydrog ?    ? A  A   1274 N1    ? ? ? 1_555 A  U   1282 N3  ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1311 hydrog ?    ? A  A   1274 N6    ? ? ? 1_555 A  U   1282 O4  ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1312 hydrog ?    ? A  C   1275 O2    ? ? ? 1_555 A  C   1281 N4  ? ? 0 C   1275 0 C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1313 hydrog ?    ? A  U   1276 O2    ? ? ? 1_555 A  A   1280 N6  ? ? 0 U   1276 0 A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1314 hydrog ?    ? A  G   1292 N2    ? ? ? 1_555 A  U   1293 O4  ? ? 0 G   1292 0 U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1315 hydrog ?    ? A  G   1300 N2    ? ? ? 1_555 A  A   1330 N3  ? ? 0 G   1300 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1316 hydrog ?    ? A  C   1301 N3    ? ? ? 1_555 A  G   1354 N1  ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1317 hydrog ?    ? A  C   1301 N4    ? ? ? 1_555 A  G   1354 O6  ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1318 hydrog ?    ? A  C   1301 O2    ? ? ? 1_555 A  G   1354 N2  ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1319 hydrog ?    ? A  G   1302 N1    ? ? ? 1_555 A  C   1353 O2  ? ? 0 G   1302 0 C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1320 hydrog ?    ? A  C   1303 N3    ? ? ? 1_555 A  G   1351 N1  ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1321 hydrog ?    ? A  C   1303 N4    ? ? ? 1_555 A  G   1351 O6  ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1322 hydrog ?    ? A  C   1303 O2    ? ? ? 1_555 A  G   1351 N2  ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1323 hydrog ?    ? A  U   1304 N3    ? ? ? 1_555 A  U   1350 O2  ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1324 hydrog ?    ? A  U   1304 O4    ? ? ? 1_555 A  U   1350 N3  ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1325 hydrog ?    ? A  C   1305 N3    ? ? ? 1_555 A  G   1349 N1  ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1326 hydrog ?    ? A  C   1305 N4    ? ? ? 1_555 A  G   1349 O6  ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1327 hydrog ?    ? A  C   1305 O2    ? ? ? 1_555 A  G   1349 N2  ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1328 hydrog ?    ? A  U   1306 N3    ? ? ? 1_555 A  A   1348 N1  ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1329 hydrog ?    ? A  U   1306 O4    ? ? ? 1_555 A  A   1348 N6  ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1330 hydrog ?    ? A  A   1307 N1    ? ? ? 1_555 A  U   1347 N3  ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1331 hydrog ?    ? A  A   1307 N6    ? ? ? 1_555 A  U   1347 O4  ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1332 hydrog ?    ? A  A   1308 N1    ? ? ? 1_555 A  U   1346 N3  ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1333 hydrog ?    ? A  A   1308 N6    ? ? ? 1_555 A  U   1346 O4  ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1334 hydrog ?    ? A  U   1309 N3    ? ? ? 1_555 A  A   1345 N1  ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1335 hydrog ?    ? A  U   1309 O4    ? ? ? 1_555 A  A   1345 N6  ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1336 hydrog ?    ? A  U   1310 N3    ? ? ? 1_555 A  G   1344 O6  ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1337 hydrog ?    ? A  U   1310 O2    ? ? ? 1_555 A  G   1344 N1  ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1338 hydrog ?    ? A  G   1311 N1    ? ? ? 1_555 A  C   1343 N3  ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1339 hydrog ?    ? A  G   1311 N2    ? ? ? 1_555 A  C   1343 O2  ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1340 hydrog ?    ? A  G   1311 O6    ? ? ? 1_555 A  C   1343 N4  ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1341 hydrog ?    ? A  G   1312 N1    ? ? ? 1_555 A  C   1342 N3  ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1342 hydrog ?    ? A  G   1312 N2    ? ? ? 1_555 A  C   1342 O2  ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1343 hydrog ?    ? A  G   1312 O6    ? ? ? 1_555 A  C   1342 N4  ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1344 hydrog ?    ? A  G   1316 N2    ? ? ? 1_555 A  A   1341 N7  ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1345 hydrog ?    ? A  G   1316 N3    ? ? ? 1_555 A  A   1341 N6  ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1346 hydrog ?    ? A  A   1317 N7    ? ? ? 1_555 A  G   1340 N2  ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1347 hydrog ?    ? A  A   1318 N6    ? ? ? 1_555 A  G   1339 N3  ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1348 hydrog ?    ? A  A   1318 N7    ? ? ? 1_555 A  G   1339 N2  ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1349 hydrog ?    ? A  G   1319 N1    ? ? ? 1_555 A  U   1338 O2  ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1350 hydrog ?    ? A  G   1319 O6    ? ? ? 1_555 A  U   1338 N3  ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1351 hydrog ?    ? A  C   1320 N3    ? ? ? 1_555 A  G   1337 N1  ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1352 hydrog ?    ? A  C   1320 N4    ? ? ? 1_555 A  G   1337 O6  ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1353 hydrog ?    ? A  C   1320 O2    ? ? ? 1_555 A  G   1337 N2  ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1354 hydrog ?    ? A  A   1321 N1    ? ? ? 1_555 A  U   1336 N3  ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1355 hydrog ?    ? A  A   1321 N6    ? ? ? 1_555 A  U   1336 O4  ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1356 hydrog ?    ? A  G   1322 N1    ? ? ? 1_555 A  C   1335 N3  ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1357 hydrog ?    ? A  G   1322 N2    ? ? ? 1_555 A  C   1335 O2  ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1358 hydrog ?    ? A  G   1322 O6    ? ? ? 1_555 A  C   1335 N4  ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1359 hydrog ?    ? A  G   1323 N1    ? ? ? 1_555 A  C   1334 N3  ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1360 hydrog ?    ? A  G   1323 N2    ? ? ? 1_555 A  C   1334 O2  ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1361 hydrog ?    ? A  G   1323 O6    ? ? ? 1_555 A  C   1334 N4  ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1362 hydrog ?    ? A  G   1324 N1    ? ? ? 1_555 A  U   1333 O2  ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1363 hydrog ?    ? A  G   1324 O6    ? ? ? 1_555 A  U   1333 N3  ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1364 hydrog ?    ? A  G   1325 N1    ? ? ? 1_555 A  C   1332 N3  ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1365 hydrog ?    ? A  G   1325 N2    ? ? ? 1_555 A  C   1332 O2  ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1366 hydrog ?    ? A  G   1325 O6    ? ? ? 1_555 A  C   1332 N4  ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1367 hydrog ?    ? A  C   1326 N3    ? ? ? 1_555 A  G   1331 N1  ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1368 hydrog ?    ? A  C   1326 N4    ? ? ? 1_555 A  G   1331 O6  ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1369 hydrog ?    ? A  C   1326 O2    ? ? ? 1_555 A  G   1331 N2  ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1370 hydrog ?    ? A  G   1327 N2    ? ? ? 1_555 A  A   1330 N7  ? ? 0 G   1327 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1371 hydrog ?    ? A  C   1366 N3    ? ? ? 1_555 A  G   2058 N1  ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1372 hydrog ?    ? A  C   1366 N4    ? ? ? 1_555 A  G   2058 O6  ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1373 hydrog ?    ? A  C   1366 O2    ? ? ? 1_555 A  G   2058 N2  ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1374 hydrog ?    ? A  A   1367 N1    ? ? ? 1_555 A  U   2057 N3  ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1375 hydrog ?    ? A  A   1367 N6    ? ? ? 1_555 A  U   2057 O4  ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1376 hydrog ?    ? A  U   1368 O2    ? ? ? 1_555 A  C   2056 N4  ? ? 0 U   1368 0 C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog1377 hydrog ?    ? A  A   1369 N6    ? ? ? 1_555 A  A   2055 N7  ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1378 hydrog ?    ? A  A   1369 N7    ? ? ? 1_555 A  A   2055 N6  ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1379 hydrog ?    ? A  G   1370 N2    ? ? ? 1_555 A  U   1371 O4  ? ? 0 G   1370 0 U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1380 hydrog ?    ? A  U   1371 N3    ? ? ? 1_555 A  A   2054 N7  ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1381 hydrog ?    ? A  U   1371 O2    ? ? ? 1_555 A  A   2054 N6  ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1382 hydrog ?    ? A  A   1372 N6    ? ? ? 1_555 A  G   2053 N3  ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1383 hydrog ?    ? A  A   1372 N7    ? ? ? 1_555 A  G   2053 N2  ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1384 hydrog ?    ? A  G   1373 N2    ? ? ? 1_555 A  C   1431 O2  ? ? 0 G   1373 0 C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1385 hydrog ?    ? A  G   1373 N1    ? ? ? 1_555 A  U   2052 O2  ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1386 hydrog ?    ? A  G   1373 O6    ? ? ? 1_555 A  U   2052 N3  ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1387 hydrog ?    ? A  C   1374 N3    ? ? ? 1_555 A  G   2051 N1  ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1388 hydrog ?    ? A  C   1374 N4    ? ? ? 1_555 A  G   2051 O6  ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1389 hydrog ?    ? A  C   1374 O2    ? ? ? 1_555 A  G   2051 N2  ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1390 hydrog ?    ? A  C   1377 N3    ? ? ? 1_555 A  G   1683 N2  ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1391 hydrog ?    ? A  C   1377 O2    ? ? ? 1_555 A  G   1683 N1  ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1392 hydrog ?    ? A  A   1381 N3    ? ? ? 1_555 A  G   1401 N2  ? ? 0 A   1381 0 G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1393 hydrog ?    ? A  G   1382 N1    ? ? ? 1_555 A  C   1400 N3  ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1394 hydrog ?    ? A  G   1382 N2    ? ? ? 1_555 A  C   1400 O2  ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1395 hydrog ?    ? A  G   1382 O6    ? ? ? 1_555 A  C   1400 N4  ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1396 hydrog ?    ? A  U   1383 N3    ? ? ? 1_555 A  A   1399 N1  ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1397 hydrog ?    ? A  U   1383 O4    ? ? ? 1_555 A  A   1399 N6  ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1398 hydrog ?    ? A  C   1384 N3    ? ? ? 1_555 A  G   1398 N1  ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1399 hydrog ?    ? A  C   1384 N4    ? ? ? 1_555 A  G   1398 O6  ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1400 hydrog ?    ? A  C   1384 O2    ? ? ? 1_555 A  G   1398 N2  ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1401 hydrog ?    ? A  G   1385 N1    ? ? ? 1_555 A  C   1397 N3  ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1402 hydrog ?    ? A  G   1385 N2    ? ? ? 1_555 A  C   1397 O2  ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1403 hydrog ?    ? A  G   1385 O6    ? ? ? 1_555 A  C   1397 N4  ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1404 hydrog ?    ? A  G   1386 N1    ? ? ? 1_555 A  C   1396 N3  ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1405 hydrog ?    ? A  G   1386 N2    ? ? ? 1_555 A  C   1396 O2  ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1406 hydrog ?    ? A  G   1386 O6    ? ? ? 1_555 A  C   1396 N4  ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1407 hydrog ?    ? A  G   1387 N1    ? ? ? 1_555 A  C   1395 N3  ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1408 hydrog ?    ? A  G   1387 N2    ? ? ? 1_555 A  C   1395 O2  ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1409 hydrog ?    ? A  G   1387 O6    ? ? ? 1_555 A  C   1395 N4  ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1410 hydrog ?    ? A  U   1388 N3    ? ? ? 1_555 A  A   1392 N7  ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1411 hydrog ?    ? A  U   1388 O2    ? ? ? 1_555 A  A   1392 N6  ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1412 hydrog ?    ? A  G   1389 N2    ? ? ? 1_555 A  U   1435 O4  ? ? 0 G   1389 0 U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1413 hydrog ?    ? A  A   1393 N6    ? ? ? 1_555 A  C   1725 O2  ? ? 0 A   1393 0 C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1414 hydrog ?    ? A  C   1394 N3    ? ? ? 1_555 A  U   1432 N3  ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? 
? ? 
hydrog1415 hydrog ?    ? A  C   1394 N4    ? ? ? 1_555 A  U   1432 O2  ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? 
? ? 
hydrog1416 hydrog ?    ? A  G   1401 N1    ? ? ? 1_555 A  C   1721 N3  ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1417 hydrog ?    ? A  G   1401 N2    ? ? ? 1_555 A  C   1721 O2  ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1418 hydrog ?    ? A  G   1401 O6    ? ? ? 1_555 A  C   1721 N4  ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1419 hydrog ?    ? A  G   1402 N1    ? ? ? 1_555 A  C   1720 N3  ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1420 hydrog ?    ? A  G   1402 N2    ? ? ? 1_555 A  C   1720 O2  ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1421 hydrog ?    ? A  G   1402 O6    ? ? ? 1_555 A  C   1720 N4  ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1422 hydrog ?    ? A  C   1403 N3    ? ? ? 1_555 A  G   1719 N1  ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1423 hydrog ?    ? A  C   1403 N4    ? ? ? 1_555 A  G   1719 O6  ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1424 hydrog ?    ? A  C   1403 O2    ? ? ? 1_555 A  G   1719 N2  ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1425 hydrog ?    ? A  C   1404 N3    ? ? ? 1_555 A  G   1718 N1  ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1426 hydrog ?    ? A  C   1404 N4    ? ? ? 1_555 A  G   1718 O6  ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1427 hydrog ?    ? A  C   1404 O2    ? ? ? 1_555 A  G   1718 N2  ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1428 hydrog ?    ? A  U   1405 N3    ? ? ? 1_555 A  A   1716 N7  ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1429 hydrog ?    ? A  U   1405 O2    ? ? ? 1_555 A  A   1716 N6  ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1430 hydrog ?    ? A  A   1407 N1    ? ? ? 1_555 A  A   1717 N6  ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog1431 hydrog ?    ? A  A   1407 N6    ? ? ? 1_555 A  A   1717 N1  ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog1432 hydrog ?    ? A  G   1409 N1    ? ? ? 1_555 A  C   1700 N3  ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1433 hydrog ?    ? A  G   1409 N2    ? ? ? 1_555 A  C   1700 O2  ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1434 hydrog ?    ? A  G   1409 O6    ? ? ? 1_555 A  C   1700 N4  ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1435 hydrog ?    ? A  G   1410 N1    ? ? ? 1_555 A  C   1699 N3  ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1436 hydrog ?    ? A  G   1410 N2    ? ? ? 1_555 A  C   1699 O2  ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1437 hydrog ?    ? A  G   1410 O6    ? ? ? 1_555 A  C   1699 N4  ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1438 hydrog ?    ? A  A   1411 N1    ? ? ? 1_555 A  U   1698 N3  ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1439 hydrog ?    ? A  A   1411 N6    ? ? ? 1_555 A  U   1698 O4  ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1440 hydrog ?    ? A  U   1412 N3    ? ? ? 1_555 A  G   1697 O6  ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1441 hydrog ?    ? A  U   1412 O2    ? ? ? 1_555 A  G   1697 N1  ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1442 hydrog ?    ? A  A   1414 N6    ? ? ? 1_555 A  G   1681 N3  ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1443 hydrog ?    ? A  A   1414 N7    ? ? ? 1_555 A  G   1681 N2  ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1444 hydrog ?    ? A  A   1414 N1    ? ? ? 1_555 A  A   1682 N6  ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog1445 hydrog ?    ? A  A   1414 N6    ? ? ? 1_555 A  A   1682 N1  ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog1446 hydrog ?    ? A  G   1415 N1    ? ? ? 1_555 A  C   1680 N3  ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1447 hydrog ?    ? A  G   1415 N2    ? ? ? 1_555 A  C   1680 O2  ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1448 hydrog ?    ? A  G   1415 O6    ? ? ? 1_555 A  C   1680 N4  ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1449 hydrog ?    ? A  G   1416 N1    ? ? ? 1_555 A  C   1679 N3  ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1450 hydrog ?    ? A  G   1416 N2    ? ? ? 1_555 A  C   1679 O2  ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1451 hydrog ?    ? A  G   1416 O6    ? ? ? 1_555 A  C   1679 N4  ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1452 hydrog ?    ? A  G   1416 N2    ? ? ? 1_555 A  A   1685 N3  ? ? 0 G   1416 0 A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1453 hydrog ?    ? A  U   1418 N3    ? ? ? 1_555 A  U   1446 O4  ? ? 0 U   1418 0 U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? ? 
hydrog1454 hydrog ?    ? A  U   1419 N3    ? ? ? 1_555 A  A   1678 N1  ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1455 hydrog ?    ? A  U   1419 O4    ? ? ? 1_555 A  A   1678 N6  ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1456 hydrog ?    ? A  C   1420 N3    ? ? ? 1_555 A  G   1444 N1  ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1457 hydrog ?    ? A  C   1420 N4    ? ? ? 1_555 A  G   1444 O6  ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1458 hydrog ?    ? A  C   1420 O2    ? ? ? 1_555 A  G   1444 N2  ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1459 hydrog ?    ? A  C   1421 N3    ? ? ? 1_555 A  G   1443 N1  ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1460 hydrog ?    ? A  C   1421 N4    ? ? ? 1_555 A  G   1443 O6  ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1461 hydrog ?    ? A  C   1421 O2    ? ? ? 1_555 A  G   1443 N2  ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1462 hydrog ?    ? A  U   1422 N3    ? ? ? 1_555 A  A   1442 N1  ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1463 hydrog ?    ? A  U   1422 O4    ? ? ? 1_555 A  A   1442 N6  ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1464 hydrog ?    ? A  C   1423 N3    ? ? ? 1_555 A  G   1441 N1  ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1465 hydrog ?    ? A  C   1423 N4    ? ? ? 1_555 A  G   1441 O6  ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1466 hydrog ?    ? A  C   1423 O2    ? ? ? 1_555 A  G   1441 N2  ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1467 hydrog ?    ? A  A   1424 N1    ? ? ? 1_555 A  U   1440 N3  ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1468 hydrog ?    ? A  A   1424 N6    ? ? ? 1_555 A  U   1440 O4  ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1469 hydrog ?    ? A  G   1425 N1    ? ? ? 1_555 A  C   1439 N3  ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1470 hydrog ?    ? A  G   1425 N2    ? ? ? 1_555 A  C   1439 O2  ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1471 hydrog ?    ? A  G   1425 O6    ? ? ? 1_555 A  C   1439 N4  ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1472 hydrog ?    ? A  C   1426 N3    ? ? ? 1_555 A  A   1437 N6  ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1473 hydrog ?    ? A  C   1426 N4    ? ? ? 1_555 A  A   1437 N7  ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1474 hydrog ?    ? A  C   1428 N4    ? ? ? 1_555 A  C   1439 O2  ? ? 0 C   1428 0 C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1475 hydrog ?    ? A  U   1429 N3    ? ? ? 1_555 A  A   1437 N1  ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1476 hydrog ?    ? A  U   1429 O4    ? ? ? 1_555 A  A   1437 N6  ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1477 hydrog ?    ? A  G   1430 N1    ? ? ? 1_555 A  C   1436 N3  ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1478 hydrog ?    ? A  G   1430 N2    ? ? ? 1_555 A  C   1436 O2  ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1479 hydrog ?    ? A  G   1430 O6    ? ? ? 1_555 A  C   1436 N4  ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1480 hydrog ?    ? A  G   1430 N3    ? ? ? 1_555 A  A   1691 N6  ? ? 0 G   1430 0 A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1481 hydrog ?    ? A  G   1444 N2    ? ? ? 1_555 A  A   1502 N3  ? ? 0 G   1444 0 A   1502 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1482 hydrog ?    ? A  A   1448 N6    ? ? ? 1_555 A  U   1677 O2  ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1483 hydrog ?    ? A  A   1448 N7    ? ? ? 1_555 A  U   1677 N3  ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1484 hydrog ?    ? A  G   1449 N2    ? ? ? 1_555 A  A   1493 N3  ? ? 0 G   1449 0 A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1485 hydrog ?    ? A  G   1449 N1    ? ? ? 1_555 A  C   1513 N3  ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1486 hydrog ?    ? A  G   1449 N2    ? ? ? 1_555 A  C   1513 O2  ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1487 hydrog ?    ? A  G   1449 O6    ? ? ? 1_555 A  C   1513 N4  ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1488 hydrog ?    ? A  C   1450 N3    ? ? ? 1_555 A  G   1512 N1  ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1489 hydrog ?    ? A  C   1450 N4    ? ? ? 1_555 A  G   1512 O6  ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1490 hydrog ?    ? A  C   1450 O2    ? ? ? 1_555 A  G   1512 N2  ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1491 hydrog ?    ? A  C   1451 N3    ? ? ? 1_555 A  G   1676 N1  ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1492 hydrog ?    ? A  C   1451 N4    ? ? ? 1_555 A  G   1676 O6  ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1493 hydrog ?    ? A  C   1451 O2    ? ? ? 1_555 A  G   1676 N2  ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1494 hydrog ?    ? A  G   1452 N2    ? ? ? 1_555 A  A   1486 N1  ? ? 0 G   1452 0 A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1495 hydrog ?    ? A  G   1452 N1    ? ? ? 1_555 A  C   1675 N3  ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1496 hydrog ?    ? A  G   1452 N2    ? ? ? 1_555 A  C   1675 O2  ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1497 hydrog ?    ? A  G   1452 O6    ? ? ? 1_555 A  C   1675 N4  ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1498 hydrog ?    ? A  G   1453 N1    ? ? ? 1_555 A  C   1674 N3  ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1499 hydrog ?    ? A  G   1453 N2    ? ? ? 1_555 A  C   1674 O2  ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1500 hydrog ?    ? A  G   1453 O6    ? ? ? 1_555 A  C   1674 N4  ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1501 hydrog ?    ? A  U   1454 O4    ? ? ? 1_555 A  G   1491 N2  ? ? 0 U   1454 0 G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog1502 hydrog ?    ? A  C   1455 N3    ? ? ? 1_555 A  G   1490 N1  ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1503 hydrog ?    ? A  C   1455 N4    ? ? ? 1_555 A  G   1490 O6  ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1504 hydrog ?    ? A  C   1455 O2    ? ? ? 1_555 A  G   1490 N2  ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1505 hydrog ?    ? A  C   1456 N3    ? ? ? 1_555 A  G   1489 N1  ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1506 hydrog ?    ? A  C   1456 N4    ? ? ? 1_555 A  G   1489 O6  ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1507 hydrog ?    ? A  C   1456 O2    ? ? ? 1_555 A  G   1489 N2  ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1508 hydrog ?    ? A  U   1457 N3    ? ? ? 1_555 A  A   1485 N7  ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1509 hydrog ?    ? A  U   1457 O2    ? ? ? 1_555 A  A   1485 N6  ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1510 hydrog ?    ? A  A   1459 N6    ? ? ? 1_555 A  G   1484 N3  ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1511 hydrog ?    ? A  A   1459 N7    ? ? ? 1_555 A  G   1484 N2  ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1512 hydrog ?    ? A  G   1460 N1    ? ? ? 1_555 A  C   1483 N3  ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1513 hydrog ?    ? A  G   1460 N2    ? ? ? 1_555 A  C   1483 O2  ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1514 hydrog ?    ? A  G   1460 O6    ? ? ? 1_555 A  C   1483 N4  ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1515 hydrog ?    ? A  U   1461 N3    ? ? ? 1_555 A  A   1482 N1  ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1516 hydrog ?    ? A  U   1461 O4    ? ? ? 1_555 A  A   1482 N6  ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1517 hydrog ?    ? A  C   1462 N3    ? ? ? 1_555 A  G   1481 N1  ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1518 hydrog ?    ? A  C   1462 N4    ? ? ? 1_555 A  G   1481 O6  ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1519 hydrog ?    ? A  C   1462 O2    ? ? ? 1_555 A  G   1481 N2  ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1520 hydrog ?    ? A  U   1463 N3    ? ? ? 1_555 A  A   1480 N1  ? ? 0 U   1463 0 A   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1521 hydrog ?    ? A  U   1463 O4    ? ? ? 1_555 A  A   1480 N6  ? ? 0 U   1463 0 A   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1522 hydrog ?    ? A  C   1464 N3    ? ? ? 1_555 A  G   1479 N1  ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1523 hydrog ?    ? A  C   1464 N4    ? ? ? 1_555 A  G   1479 O6  ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1524 hydrog ?    ? A  C   1464 O2    ? ? ? 1_555 A  G   1479 N2  ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1525 hydrog ?    ? A  A   1465 N1    ? ? ? 1_555 A  U   1478 N3  ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1526 hydrog ?    ? A  A   1465 N6    ? ? ? 1_555 A  U   1478 O4  ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1527 hydrog ?    ? A  C   1466 O2    ? ? ? 1_555 A  C   1477 N4  ? ? 0 C   1466 0 C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1528 hydrog ?    ? A  C   1467 N3    ? ? ? 1_555 A  G   1475 N1  ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1529 hydrog ?    ? A  C   1467 N4    ? ? ? 1_555 A  G   1475 O6  ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1530 hydrog ?    ? A  C   1467 O2    ? ? ? 1_555 A  G   1475 N2  ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1531 hydrog ?    ? A  C   1467 O2    ? ? ? 1_555 A  A   1476 N6  ? ? 0 C   1467 0 A   1476 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1532 hydrog ?    ? A  G   1468 N1    ? ? ? 1_555 A  C   1474 N3  ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1533 hydrog ?    ? A  G   1468 N2    ? ? ? 1_555 A  C   1474 O2  ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1534 hydrog ?    ? A  G   1468 O6    ? ? ? 1_555 A  C   1474 N4  ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1535 hydrog ?    ? A  G   1475 N2    ? ? ? 1_555 A  A   1866 N3  ? ? 0 G   1475 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1536 hydrog ?    ? A  A   1485 N6    ? ? ? 1_555 A  A   1656 N1  ? ? 0 A   1485 0 A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1537 hydrog ?    ? A  A   1487 N3    ? ? ? 1_555 A  G   1697 N2  ? ? 0 A   1487 0 G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1538 hydrog ?    ? A  G   1489 N3    ? ? ? 1_555 A  A   1656 N6  ? ? 0 G   1489 0 A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1539 hydrog ?    ? A  G   1489 N2    ? ? ? 1_555 A  A   1657 N1  ? ? 0 G   1489 0 A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1540 hydrog ?    ? A  A   1494 N1    ? ? ? 1_555 A  U   1511 N3  ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1541 hydrog ?    ? A  A   1494 N6    ? ? ? 1_555 A  U   1511 O4  ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1542 hydrog ?    ? A  C   1495 N3    ? ? ? 1_555 A  G   1510 N1  ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1543 hydrog ?    ? A  C   1495 N4    ? ? ? 1_555 A  G   1510 O6  ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1544 hydrog ?    ? A  C   1495 O2    ? ? ? 1_555 A  G   1510 N2  ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1545 hydrog ?    ? A  A   1496 N1    ? ? ? 1_555 A  U   1509 N3  ? ? 0 A   1496 0 U   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1546 hydrog ?    ? A  A   1496 N6    ? ? ? 1_555 A  U   1509 O4  ? ? 0 A   1496 0 U   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1547 hydrog ?    ? A  G   1497 N1    ? ? ? 1_555 A  C   1508 N3  ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1548 hydrog ?    ? A  G   1497 N2    ? ? ? 1_555 A  C   1508 O2  ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1549 hydrog ?    ? A  G   1497 O6    ? ? ? 1_555 A  C   1508 N4  ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1550 hydrog ?    ? A  G   1498 N1    ? ? ? 1_555 A  C   1507 N3  ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1551 hydrog ?    ? A  G   1498 N2    ? ? ? 1_555 A  C   1507 O2  ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1552 hydrog ?    ? A  G   1498 O6    ? ? ? 1_555 A  C   1507 N4  ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1553 hydrog ?    ? A  U   1499 N3    ? ? ? 1_555 A  A   1504 N7  ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1554 hydrog ?    ? A  U   1499 O2    ? ? ? 1_555 A  A   1504 N6  ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1555 hydrog ?    ? A  C   1514 N3    ? ? ? 1_555 A  G   1672 N1  ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1556 hydrog ?    ? A  C   1514 N4    ? ? ? 1_555 A  G   1672 O6  ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1557 hydrog ?    ? A  C   1514 O2    ? ? ? 1_555 A  G   1672 N2  ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1558 hydrog ?    ? A  A   1515 N1    ? ? ? 1_555 A  U   1671 N3  ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1559 hydrog ?    ? A  A   1515 N6    ? ? ? 1_555 A  U   1671 O4  ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1560 hydrog ?    ? A  U   1516 N3    ? ? ? 1_555 A  A   1670 N1  ? ? 0 U   1516 0 A   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1561 hydrog ?    ? A  U   1516 O4    ? ? ? 1_555 A  A   1670 N6  ? ? 0 U   1516 0 A   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1562 hydrog ?    ? A  C   1517 N3    ? ? ? 1_555 A  G   1669 N1  ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1563 hydrog ?    ? A  C   1517 N4    ? ? ? 1_555 A  G   1669 O6  ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1564 hydrog ?    ? A  C   1517 O2    ? ? ? 1_555 A  G   1669 N2  ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1565 hydrog ?    ? A  A   1518 N1    ? ? ? 1_555 A  U   1668 N3  ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1566 hydrog ?    ? A  A   1518 N6    ? ? ? 1_555 A  U   1668 O4  ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1567 hydrog ?    ? A  U   1519 N3    ? ? ? 1_555 A  A   1667 N1  ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1568 hydrog ?    ? A  U   1519 O4    ? ? ? 1_555 A  A   1667 N6  ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1569 hydrog ?    ? A  G   1520 N1    ? ? ? 1_555 A  C   1666 N3  ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1570 hydrog ?    ? A  C   1521 N3    ? ? ? 1_555 A  G   1665 N1  ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1571 hydrog ?    ? A  C   1521 N4    ? ? ? 1_555 A  G   1665 O6  ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1572 hydrog ?    ? A  C   1521 O2    ? ? ? 1_555 A  G   1665 N2  ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1573 hydrog ?    ? A  A   1527 N6    ? ? ? 1_555 A  A   1664 N7  ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1574 hydrog ?    ? A  A   1527 N7    ? ? ? 1_555 A  A   1664 N6  ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1575 hydrog ?    ? A  A   1528 N6    ? ? ? 1_555 A  G   1663 N3  ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1576 hydrog ?    ? A  A   1528 N7    ? ? ? 1_555 A  G   1663 N2  ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1577 hydrog ?    ? A  G   1529 N1    ? ? ? 1_555 A  C   1662 N3  ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1578 hydrog ?    ? A  G   1529 N2    ? ? ? 1_555 A  C   1662 O2  ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1579 hydrog ?    ? A  G   1529 O6    ? ? ? 1_555 A  C   1662 N4  ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1580 hydrog ?    ? A  U   1530 N3    ? ? ? 1_555 A  A   1661 N1  ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1581 hydrog ?    ? A  U   1530 O4    ? ? ? 1_555 A  A   1661 N6  ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1582 hydrog ?    ? A  U   1531 N3    ? ? ? 1_555 A  G   1660 O6  ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1583 hydrog ?    ? A  U   1531 O2    ? ? ? 1_555 A  G   1660 N1  ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1584 hydrog ?    ? A  G   1532 N2    ? ? ? 1_555 A  A   1659 N7  ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1585 hydrog ?    ? A  G   1532 N3    ? ? ? 1_555 A  A   1659 N6  ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1586 hydrog ?    ? A  A   1533 N6    ? ? ? 1_555 A  A   1658 N7  ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1587 hydrog ?    ? A  A   1533 N7    ? ? ? 1_555 A  A   1658 N6  ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1588 hydrog ?    ? A  C   1534 N4    ? ? ? 1_555 A  A   1657 N7  ? ? 0 C   1534 0 A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1589 hydrog ?    ? A  G   1535 N1    ? ? ? 1_555 A  C   1650 N3  ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1590 hydrog ?    ? A  G   1535 N2    ? ? ? 1_555 A  C   1650 O2  ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1591 hydrog ?    ? A  G   1535 O6    ? ? ? 1_555 A  C   1650 N4  ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1592 hydrog ?    ? A  C   1536 N3    ? ? ? 1_555 A  G   1649 N1  ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1593 hydrog ?    ? A  C   1536 N4    ? ? ? 1_555 A  G   1649 O6  ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1594 hydrog ?    ? A  C   1536 O2    ? ? ? 1_555 A  G   1649 N2  ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1595 hydrog ?    ? A  C   1537 N3    ? ? ? 1_555 A  G   1648 N1  ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1596 hydrog ?    ? A  C   1537 N4    ? ? ? 1_555 A  G   1648 O6  ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1597 hydrog ?    ? A  C   1537 O2    ? ? ? 1_555 A  G   1648 N2  ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1598 hydrog ?    ? A  C   1538 N3    ? ? ? 1_555 A  G   1647 N1  ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1599 hydrog ?    ? A  C   1538 N4    ? ? ? 1_555 A  G   1647 O6  ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1600 hydrog ?    ? A  C   1538 O2    ? ? ? 1_555 A  G   1647 N2  ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1601 hydrog ?    ? A  U   1539 N3    ? ? ? 1_555 A  G   1646 O6  ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1602 hydrog ?    ? A  U   1539 O2    ? ? ? 1_555 A  G   1646 N1  ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1603 hydrog ?    ? A  G   1540 N1    ? ? ? 1_555 A  U   1645 O2  ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1604 hydrog ?    ? A  G   1540 O6    ? ? ? 1_555 A  U   1645 N3  ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1605 hydrog ?    ? A  G   1541 N1    ? ? ? 1_555 A  C   1644 N3  ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1606 hydrog ?    ? A  G   1541 N2    ? ? ? 1_555 A  C   1644 O2  ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1607 hydrog ?    ? A  G   1541 O6    ? ? ? 1_555 A  C   1644 N4  ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1608 hydrog ?    ? A  G   1542 N2    ? ? ? 1_555 A  A   1616 N3  ? ? 0 G   1542 0 A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1609 hydrog ?    ? A  G   1542 N1    ? ? ? 1_555 A  C   1643 N3  ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1610 hydrog ?    ? A  G   1542 N2    ? ? ? 1_555 A  C   1643 O2  ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1611 hydrog ?    ? A  G   1542 O6    ? ? ? 1_555 A  C   1643 N4  ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1612 hydrog ?    ? A  G   1543 N2    ? ? ? 1_555 A  A   1642 N7  ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1613 hydrog ?    ? A  G   1543 N3    ? ? ? 1_555 A  A   1642 N6  ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1614 hydrog ?    ? A  U   1544 N3    ? ? ? 1_555 A  A   1641 N7  ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1615 hydrog ?    ? A  U   1544 O2    ? ? ? 1_555 A  A   1641 N6  ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1616 hydrog ?    ? A  C   1545 N4    ? ? ? 1_555 A  C   1640 O2  ? ? 0 C   1545 0 C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1617 hydrog ?    ? A  C   1545 N3    ? ? ? 1_555 A  U   1702 N3  ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? 
? ? 
hydrog1618 hydrog ?    ? A  C   1545 N4    ? ? ? 1_555 A  U   1702 O4  ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? 
? ? 
hydrog1619 hydrog ?    ? A  G   1546 N1    ? ? ? 1_555 A  U   1639 O2  ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1620 hydrog ?    ? A  G   1546 O6    ? ? ? 1_555 A  U   1639 N3  ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1621 hydrog ?    ? A  A   1547 N1    ? ? ? 1_555 A  U   1638 N3  ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1622 hydrog ?    ? A  A   1547 N6    ? ? ? 1_555 A  U   1638 O4  ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1623 hydrog ?    ? A  U   1548 N3    ? ? ? 1_555 A  A   1637 N1  ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1624 hydrog ?    ? A  U   1548 O4    ? ? ? 1_555 A  A   1637 N6  ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1625 hydrog ?    ? A  C   1549 N3    ? ? ? 1_555 A  G   1636 N1  ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1626 hydrog ?    ? A  C   1549 N4    ? ? ? 1_555 A  G   1636 O6  ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1627 hydrog ?    ? A  C   1549 O2    ? ? ? 1_555 A  G   1636 N2  ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1628 hydrog ?    ? A  A   1550 N1    ? ? ? 1_555 A  U   1635 N3  ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1629 hydrog ?    ? A  A   1550 N6    ? ? ? 1_555 A  U   1635 O4  ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1630 hydrog ?    ? A  C   1551 N3    ? ? ? 1_555 A  G   1634 N1  ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1631 hydrog ?    ? A  C   1551 N4    ? ? ? 1_555 A  G   1634 O6  ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1632 hydrog ?    ? A  C   1551 O2    ? ? ? 1_555 A  G   1634 N2  ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1633 hydrog ?    ? A  G   1552 N1    ? ? ? 1_555 A  U   1569 O2  ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1634 hydrog ?    ? A  G   1552 O6    ? ? ? 1_555 A  U   1569 N3  ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1635 hydrog ?    ? A  C   1553 N3    ? ? ? 1_555 A  G   1568 N1  ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1636 hydrog ?    ? A  C   1553 N4    ? ? ? 1_555 A  G   1568 O6  ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1637 hydrog ?    ? A  C   1553 O2    ? ? ? 1_555 A  G   1568 N2  ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1638 hydrog ?    ? A  C   1554 N3    ? ? ? 1_555 A  G   1567 N1  ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1639 hydrog ?    ? A  C   1554 N4    ? ? ? 1_555 A  G   1567 O6  ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1640 hydrog ?    ? A  C   1554 O2    ? ? ? 1_555 A  G   1567 N2  ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1641 hydrog ?    ? A  G   1555 N1    ? ? ? 1_555 A  C   1566 N3  ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1642 hydrog ?    ? A  G   1555 N2    ? ? ? 1_555 A  C   1566 O2  ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1643 hydrog ?    ? A  G   1555 O6    ? ? ? 1_555 A  C   1566 N4  ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1644 hydrog ?    ? A  G   1556 N1    ? ? ? 1_555 A  C   1565 N3  ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1645 hydrog ?    ? A  G   1556 N2    ? ? ? 1_555 A  C   1565 O2  ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1646 hydrog ?    ? A  G   1556 O6    ? ? ? 1_555 A  C   1565 N4  ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1647 hydrog ?    ? A  G   1557 N1    ? ? ? 1_555 A  C   1564 N3  ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1648 hydrog ?    ? A  G   1557 N2    ? ? ? 1_555 A  C   1564 O2  ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1649 hydrog ?    ? A  G   1557 O6    ? ? ? 1_555 A  C   1564 N4  ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1650 hydrog ?    ? A  U   1561 N3    ? ? ? 1_555 A  A   2739 N1  ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1651 hydrog ?    ? A  U   1561 O4    ? ? ? 1_555 A  A   2739 N6  ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1652 hydrog ?    ? A  C   1562 N3    ? ? ? 1_555 A  G   2738 N1  ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1653 hydrog ?    ? A  C   1562 N4    ? ? ? 1_555 A  G   2738 O6  ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1654 hydrog ?    ? A  C   1562 O2    ? ? ? 1_555 A  G   2738 N2  ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1655 hydrog ?    ? A  G   1568 N2    ? ? ? 1_555 A  A   1632 N3  ? ? 0 G   1568 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1656 hydrog ?    ? A  C   1570 N3    ? ? ? 1_555 A  G   1627 N1  ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1657 hydrog ?    ? A  C   1570 N4    ? ? ? 1_555 A  G   1627 O6  ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1658 hydrog ?    ? A  C   1570 O2    ? ? ? 1_555 A  G   1627 N2  ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1659 hydrog ?    ? A  G   1571 N2    ? ? ? 1_555 A  A   1626 N7  ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1660 hydrog ?    ? A  G   1571 N3    ? ? ? 1_555 A  A   1626 N6  ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1661 hydrog ?    ? A  A   1572 N6    ? ? ? 1_555 A  A   1624 N7  ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1662 hydrog ?    ? A  A   1572 N7    ? ? ? 1_555 A  A   1624 N6  ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1663 hydrog ?    ? A  A   1573 N6    ? ? ? 1_555 A  C   1623 O2  ? ? 0 A   1573 0 C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1664 hydrog ?    ? A  C   1574 N3    ? ? ? 1_555 A  G   1622 N1  ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1665 hydrog ?    ? A  C   1574 N4    ? ? ? 1_555 A  G   1622 O6  ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1666 hydrog ?    ? A  C   1574 O2    ? ? ? 1_555 A  G   1622 N2  ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1667 hydrog ?    ? A  C   1575 N3    ? ? ? 1_555 A  G   1621 N1  ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1668 hydrog ?    ? A  C   1575 N4    ? ? ? 1_555 A  G   1621 O6  ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1669 hydrog ?    ? A  C   1575 O2    ? ? ? 1_555 A  G   1621 N2  ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1670 hydrog ?    ? A  G   1576 N1    ? ? ? 1_555 A  C   1620 N3  ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1671 hydrog ?    ? A  G   1576 N2    ? ? ? 1_555 A  C   1620 O2  ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1672 hydrog ?    ? A  G   1576 O6    ? ? ? 1_555 A  C   1620 N4  ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1673 hydrog ?    ? A  U   1577 N3    ? ? ? 1_555 A  G   1619 O6  ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1674 hydrog ?    ? A  U   1577 O2    ? ? ? 1_555 A  G   1619 N1  ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1675 hydrog ?    ? A  C   1578 N3    ? ? ? 1_555 A  G   1618 N1  ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1676 hydrog ?    ? A  C   1578 N4    ? ? ? 1_555 A  G   1618 O6  ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1677 hydrog ?    ? A  C   1578 O2    ? ? ? 1_555 A  G   1618 N2  ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1678 hydrog ?    ? A  C   1579 N3    ? ? ? 1_555 A  A   1616 N6  ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1679 hydrog ?    ? A  C   1579 N4    ? ? ? 1_555 A  A   1616 N7  ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1680 hydrog ?    ? A  C   1579 N4    ? ? ? 1_555 A  G   1618 O6  ? ? 0 C   1579 0 G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog1681 hydrog ?    ? A  A   1581 N6    ? ? ? 1_555 A  G   1614 N3  ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1682 hydrog ?    ? A  A   1581 N7    ? ? ? 1_555 A  G   1614 N2  ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1683 hydrog ?    ? A  C   1582 N4    ? ? ? 1_555 A  C   1613 N3  ? ? 0 C   1582 0 C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1684 hydrog ?    ? A  U   1583 N3    ? ? ? 1_555 A  A   1612 N1  ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1685 hydrog ?    ? A  U   1583 O4    ? ? ? 1_555 A  A   1612 N6  ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1686 hydrog ?    ? A  C   1584 N3    ? ? ? 1_555 A  G   1611 N1  ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1687 hydrog ?    ? A  C   1584 N4    ? ? ? 1_555 A  G   1611 O6  ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1688 hydrog ?    ? A  C   1584 O2    ? ? ? 1_555 A  G   1611 N2  ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1689 hydrog ?    ? A  C   1585 N3    ? ? ? 1_555 A  G   1610 N1  ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1690 hydrog ?    ? A  C   1585 N4    ? ? ? 1_555 A  G   1610 O6  ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1691 hydrog ?    ? A  C   1585 O2    ? ? ? 1_555 A  G   1610 N2  ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1692 hydrog ?    ? A  G   1586 N1    ? ? ? 1_555 A  C   1609 N3  ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1693 hydrog ?    ? A  G   1586 N2    ? ? ? 1_555 A  C   1609 O2  ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1694 hydrog ?    ? A  G   1586 O6    ? ? ? 1_555 A  C   1609 N4  ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1695 hydrog ?    ? A  U   1587 N3    ? ? ? 1_555 A  G   1608 O6  ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1696 hydrog ?    ? A  U   1587 O2    ? ? ? 1_555 A  G   1608 N1  ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1697 hydrog ?    ? A  G   1588 N2    ? ? ? 1_555 A  A   1607 N7  ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1698 hydrog ?    ? A  G   1588 N3    ? ? ? 1_555 A  A   1607 N6  ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1699 hydrog ?    ? A  G   1589 N2    ? ? ? 1_555 A  A   1606 N7  ? ? 0 G   1589 0 A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1700 hydrog ?    ? A  A   1590 N6    ? ? ? 1_555 A  G   1605 N3  ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1701 hydrog ?    ? A  A   1590 N7    ? ? ? 1_555 A  G   1605 N2  ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1702 hydrog ?    ? A  G   1592 N1    ? ? ? 1_555 A  C   1602 N3  ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1703 hydrog ?    ? A  G   1592 N2    ? ? ? 1_555 A  C   1602 O2  ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1704 hydrog ?    ? A  G   1592 O6    ? ? ? 1_555 A  C   1602 N4  ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1705 hydrog ?    ? A  C   1593 N3    ? ? ? 1_555 A  G   1601 N1  ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1706 hydrog ?    ? A  C   1593 N4    ? ? ? 1_555 A  G   1601 O6  ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1707 hydrog ?    ? A  C   1593 O2    ? ? ? 1_555 A  G   1601 N2  ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1708 hydrog ?    ? A  C   1594 N3    ? ? ? 1_555 A  G   1600 N1  ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1709 hydrog ?    ? A  C   1594 N4    ? ? ? 1_555 A  G   1600 O6  ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1710 hydrog ?    ? A  C   1594 O2    ? ? ? 1_555 A  G   1600 N2  ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1711 hydrog ?    ? A  G   1628 N1    ? ? ? 1_555 A  C   1633 N3  ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1712 hydrog ?    ? A  G   1628 N2    ? ? ? 1_555 A  C   1633 O2  ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1713 hydrog ?    ? A  G   1628 O6    ? ? ? 1_555 A  C   1633 N4  ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1714 hydrog ?    ? A  G   1629 N2    ? ? ? 1_555 A  A   1632 N7  ? ? 0 G   1629 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1715 hydrog ?    ? A  G   1629 N1    ? ? ? 1_555 A  C   1633 N3  ? ? 0 G   1629 0 C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog1716 hydrog ?    ? A  C   1651 N3    ? ? ? 1_555 A  G   1655 N1  ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1717 hydrog ?    ? A  C   1651 N4    ? ? ? 1_555 A  G   1655 O6  ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1718 hydrog ?    ? A  C   1651 O2    ? ? ? 1_555 A  G   1655 N2  ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1719 hydrog ?    ? A  A   1682 N6    ? ? ? 1_555 A  U   1696 O2  ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1720 hydrog ?    ? A  A   1682 N7    ? ? ? 1_555 A  U   1696 N3  ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1721 hydrog ?    ? A  A   1684 N6    ? ? ? 1_555 A  U   1722 O4  ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1722 hydrog ?    ? A  A   1684 N7    ? ? ? 1_555 A  U   1722 N3  ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1723 hydrog ?    ? A  C   1686 N3    ? ? ? 1_555 A  G   1695 N1  ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1724 hydrog ?    ? A  C   1686 N4    ? ? ? 1_555 A  G   1695 O6  ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1725 hydrog ?    ? A  C   1686 O2    ? ? ? 1_555 A  G   1695 N2  ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1726 hydrog ?    ? A  C   1687 N3    ? ? ? 1_555 A  G   1694 N1  ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1727 hydrog ?    ? A  C   1687 N4    ? ? ? 1_555 A  G   1694 O6  ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1728 hydrog ?    ? A  C   1687 O2    ? ? ? 1_555 A  G   1694 N2  ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1729 hydrog ?    ? A  G   1703 N1    ? ? ? 1_555 A  C   1715 N3  ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1730 hydrog ?    ? A  G   1703 N2    ? ? ? 1_555 A  C   1715 O2  ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1731 hydrog ?    ? A  G   1703 O6    ? ? ? 1_555 A  C   1715 N4  ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1732 hydrog ?    ? A  G   1704 N1    ? ? ? 1_555 A  C   1714 N3  ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1733 hydrog ?    ? A  G   1704 N2    ? ? ? 1_555 A  C   1714 O2  ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1734 hydrog ?    ? A  G   1704 O6    ? ? ? 1_555 A  C   1714 N4  ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1735 hydrog ?    ? A  C   1705 N3    ? ? ? 1_555 A  G   1713 N1  ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1736 hydrog ?    ? A  C   1705 N4    ? ? ? 1_555 A  G   1713 O6  ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1737 hydrog ?    ? A  C   1705 O2    ? ? ? 1_555 A  G   1713 N2  ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1738 hydrog ?    ? A  G   1706 N2    ? ? ? 1_555 A  A   1712 N7  ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1739 hydrog ?    ? A  G   1706 N3    ? ? ? 1_555 A  A   1712 N6  ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1740 hydrog ?    ? A  G   1707 N2    ? ? ? 1_555 A  A   1711 N7  ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1741 hydrog ?    ? A  G   1707 N3    ? ? ? 1_555 A  A   1711 N6  ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1742 hydrog ?    ? A  C   1725 N3    ? ? ? 1_555 A  G   2050 N1  ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1743 hydrog ?    ? A  C   1725 N4    ? ? ? 1_555 A  G   2050 O6  ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1744 hydrog ?    ? A  C   1725 O2    ? ? ? 1_555 A  G   2050 N2  ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1745 hydrog ?    ? A  G   1726 N1    ? ? ? 1_555 A  C   2049 N3  ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1746 hydrog ?    ? A  G   1726 N2    ? ? ? 1_555 A  C   2049 O2  ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1747 hydrog ?    ? A  G   1726 O6    ? ? ? 1_555 A  C   2049 N4  ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1748 hydrog ?    ? A  G   1727 N1    ? ? ? 1_555 A  C   2048 N3  ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1749 hydrog ?    ? A  G   1727 N2    ? ? ? 1_555 A  C   2048 O2  ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1750 hydrog ?    ? A  G   1727 O6    ? ? ? 1_555 A  C   2048 N4  ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1751 hydrog ?    ? A  G   1728 N1    ? ? ? 1_555 A  C   2047 N3  ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1752 hydrog ?    ? A  G   1728 N2    ? ? ? 1_555 A  C   2047 O2  ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1753 hydrog ?    ? A  G   1728 O6    ? ? ? 1_555 A  C   2047 N4  ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1754 hydrog ?    ? A  A   1733 N6    ? ? ? 1_555 A  G   2046 N3  ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1755 hydrog ?    ? A  A   1733 N7    ? ? ? 1_555 A  G   2046 N2  ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1756 hydrog ?    ? A  C   1734 N3    ? ? ? 1_555 A  G   2045 N1  ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1757 hydrog ?    ? A  C   1734 N4    ? ? ? 1_555 A  G   2045 O6  ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1758 hydrog ?    ? A  C   1734 O2    ? ? ? 1_555 A  G   2045 N2  ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1759 hydrog ?    ? A  C   1735 N3    ? ? ? 1_555 A  G   2044 N1  ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1760 hydrog ?    ? A  C   1735 N4    ? ? ? 1_555 A  G   2044 O6  ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1761 hydrog ?    ? A  C   1735 O2    ? ? ? 1_555 A  G   2044 N2  ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1762 hydrog ?    ? A  A   1736 N1    ? ? ? 1_555 A  U   2043 N3  ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1763 hydrog ?    ? A  A   1736 N6    ? ? ? 1_555 A  U   2043 O4  ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1764 hydrog ?    ? A  A   1737 N1    ? ? ? 1_555 A  U   2042 N3  ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1765 hydrog ?    ? A  A   1737 N6    ? ? ? 1_555 A  U   2042 O4  ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1766 hydrog ?    ? A  C   1738 N3    ? ? ? 1_555 A  G   2041 N1  ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1767 hydrog ?    ? A  C   1738 N4    ? ? ? 1_555 A  G   2041 O6  ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1768 hydrog ?    ? A  C   1738 O2    ? ? ? 1_555 A  G   2041 N2  ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1769 hydrog ?    ? A  G   1739 N1    ? ? ? 1_555 A  C   2040 N3  ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1770 hydrog ?    ? A  G   1739 N2    ? ? ? 1_555 A  C   2040 O2  ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1771 hydrog ?    ? A  G   1739 O6    ? ? ? 1_555 A  C   2040 N4  ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1772 hydrog ?    ? A  U   1740 N3    ? ? ? 1_555 A  A   2039 N1  ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1773 hydrog ?    ? A  U   1740 O4    ? ? ? 1_555 A  A   2039 N6  ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1774 hydrog ?    ? A  U   1741 N3    ? ? ? 1_555 A  A   2038 N1  ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1775 hydrog ?    ? A  U   1741 O4    ? ? ? 1_555 A  A   2038 N6  ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1776 hydrog ?    ? A  A   1742 N6    ? ? ? 1_555 A  G   2033 O6  ? ? 0 A   1742 0 G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1777 hydrog ?    ? A  A   1742 N1    ? ? ? 1_555 A  C   2037 N4  ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? 
? ? 
hydrog1778 hydrog ?    ? A  A   1742 N6    ? ? ? 1_555 A  C   2037 N3  ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? 
? ? 
hydrog1779 hydrog ?    ? A  G   1743 N1    ? ? ? 1_555 A  C   2036 N3  ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1780 hydrog ?    ? A  G   1743 N2    ? ? ? 1_555 A  C   2036 O2  ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1781 hydrog ?    ? A  G   1743 O6    ? ? ? 1_555 A  C   2036 N4  ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1782 hydrog ?    ? A  G   1744 N1    ? ? ? 1_555 A  C   2035 N3  ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1783 hydrog ?    ? A  G   1744 N2    ? ? ? 1_555 A  C   2035 O2  ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1784 hydrog ?    ? A  G   1744 O6    ? ? ? 1_555 A  C   2035 N4  ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1785 hydrog ?    ? A  G   1745 N2    ? ? ? 1_555 A  U   2034 O4  ? ? 0 G   1745 0 U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1786 hydrog ?    ? A  A   1746 N6    ? ? ? 1_555 A  U   2032 O2  ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1787 hydrog ?    ? A  A   1746 N7    ? ? ? 1_555 A  U   2032 N3  ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog1788 hydrog ?    ? A  A   1747 N1    ? ? ? 1_555 A  U   2034 N3  ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1789 hydrog ?    ? A  A   1747 N6    ? ? ? 1_555 A  U   2034 O4  ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1790 hydrog ?    ? A  G   1752 N1    ? ? ? 1_555 A  C   2031 N3  ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1791 hydrog ?    ? A  G   1752 N2    ? ? ? 1_555 A  C   2031 O2  ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1792 hydrog ?    ? A  G   1752 O6    ? ? ? 1_555 A  C   2031 N4  ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1793 hydrog ?    ? A  G   1760 N1    ? ? ? 1_555 A  U   1784 O2  ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1794 hydrog ?    ? A  G   1760 O6    ? ? ? 1_555 A  U   1784 N3  ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1795 hydrog ?    ? A  U   1761 N3    ? ? ? 1_555 A  A   1783 N1  ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1796 hydrog ?    ? A  U   1761 O4    ? ? ? 1_555 A  A   1783 N6  ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1797 hydrog ?    ? A  C   1762 N3    ? ? ? 1_555 A  G   1782 N1  ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1798 hydrog ?    ? A  C   1762 N4    ? ? ? 1_555 A  G   1782 O6  ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1799 hydrog ?    ? A  C   1762 O2    ? ? ? 1_555 A  G   1782 N2  ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1800 hydrog ?    ? A  C   1763 N3    ? ? ? 1_555 A  G   1781 N1  ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1801 hydrog ?    ? A  C   1763 N4    ? ? ? 1_555 A  G   1781 O6  ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1802 hydrog ?    ? A  C   1763 O2    ? ? ? 1_555 A  G   1781 N2  ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1803 hydrog ?    ? A  C   1764 N3    ? ? ? 1_555 A  G   1780 N1  ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1804 hydrog ?    ? A  C   1764 N4    ? ? ? 1_555 A  G   1780 O6  ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1805 hydrog ?    ? A  C   1764 O2    ? ? ? 1_555 A  G   1780 N2  ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1806 hydrog ?    ? A  G   1765 N2    ? ? ? 1_555 A  A   1779 N7  ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1807 hydrog ?    ? A  G   1765 N3    ? ? ? 1_555 A  A   1779 N6  ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1808 hydrog ?    ? A  A   1767 N6    ? ? ? 1_555 A  A   1776 N7  ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1809 hydrog ?    ? A  A   1767 N7    ? ? ? 1_555 A  A   1776 N6  ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog1810 hydrog ?    ? A  C   1768 N4    ? ? ? 1_555 A  A   1775 N3  ? ? 0 C   1768 0 A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1811 hydrog ?    ? A  C   1769 N3    ? ? ? 1_555 A  G   1774 N1  ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1812 hydrog ?    ? A  C   1769 N4    ? ? ? 1_555 A  G   1774 O6  ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1813 hydrog ?    ? A  C   1769 O2    ? ? ? 1_555 A  G   1774 N2  ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1814 hydrog ?    ? A  U   1770 O2    ? ? ? 1_555 A  G   1773 N1  ? ? 0 U   1770 0 G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog1815 hydrog ?    ? A  U   1771 N3    ? ? ? 1_555 A  A   1885 N1  ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1816 hydrog ?    ? A  U   1771 O4    ? ? ? 1_555 A  A   1885 N6  ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1817 hydrog ?    ? A  G   1785 N1    ? ? ? 1_555 A  U   1807 O2  ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1818 hydrog ?    ? A  G   1785 O6    ? ? ? 1_555 A  U   1807 N3  ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1819 hydrog ?    ? A  C   1786 N3    ? ? ? 1_555 A  G   1806 N1  ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1820 hydrog ?    ? A  C   1786 N4    ? ? ? 1_555 A  G   1806 O6  ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1821 hydrog ?    ? A  C   1786 O2    ? ? ? 1_555 A  G   1806 N2  ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1822 hydrog ?    ? A  C   1787 N3    ? ? ? 1_555 A  G   1805 N1  ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1823 hydrog ?    ? A  C   1787 N4    ? ? ? 1_555 A  G   1805 O6  ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1824 hydrog ?    ? A  C   1787 O2    ? ? ? 1_555 A  G   1805 N2  ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1825 hydrog ?    ? A  U   1788 N3    ? ? ? 1_555 A  A   1804 N1  ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1826 hydrog ?    ? A  U   1788 O4    ? ? ? 1_555 A  A   1804 N6  ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1827 hydrog ?    ? A  G   1789 N1    ? ? ? 1_555 A  C   1803 N3  ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1828 hydrog ?    ? A  G   1789 N2    ? ? ? 1_555 A  C   1803 O2  ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1829 hydrog ?    ? A  G   1789 O6    ? ? ? 1_555 A  C   1803 N4  ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1830 hydrog ?    ? A  C   1790 N3    ? ? ? 1_555 A  G   1802 N1  ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1831 hydrog ?    ? A  C   1790 N4    ? ? ? 1_555 A  G   1802 O6  ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1832 hydrog ?    ? A  C   1790 O2    ? ? ? 1_555 A  G   1802 N2  ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1833 hydrog ?    ? A  U   1791 N3    ? ? ? 1_555 A  A   1801 N1  ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1834 hydrog ?    ? A  U   1791 O4    ? ? ? 1_555 A  A   1801 N6  ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1835 hydrog ?    ? A  C   1792 N3    ? ? ? 1_555 A  G   1800 N1  ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1836 hydrog ?    ? A  C   1792 N4    ? ? ? 1_555 A  G   1800 O6  ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1837 hydrog ?    ? A  C   1792 O2    ? ? ? 1_555 A  G   1800 N2  ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1838 hydrog ?    ? A  C   1793 N3    ? ? ? 1_555 A  G   1799 N1  ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1839 hydrog ?    ? A  C   1793 N4    ? ? ? 1_555 A  G   1799 O6  ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1840 hydrog ?    ? A  C   1793 O2    ? ? ? 1_555 A  G   1799 N2  ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1841 hydrog ?    ? A  G   1794 N2    ? ? ? 1_555 A  A   1797 N7  ? ? 0 G   1794 0 A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1842 hydrog ?    ? A  G   1805 N2    ? ? ? 1_555 A  A   2875 N3  ? ? 0 G   1805 0 A   2875 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1843 hydrog ?    ? A  G   1806 N2    ? ? ? 1_555 A  A   2883 N3  ? ? 0 G   1806 0 A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1844 hydrog ?    ? A  C   1808 N3    ? ? ? 1_555 A  G   1812 N1  ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1845 hydrog ?    ? A  C   1808 N4    ? ? ? 1_555 A  G   1812 O6  ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1846 hydrog ?    ? A  C   1808 O2    ? ? ? 1_555 A  G   1812 N2  ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1847 hydrog ?    ? A  C   1810 N4    ? ? ? 1_555 A  C   2752 O2  ? ? 0 C   1810 0 C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1848 hydrog ?    ? A  A   1811 N1    ? ? ? 1_555 A  G   2731 N2  ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1849 hydrog ?    ? A  A   1811 N6    ? ? ? 1_555 A  G   2731 N3  ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1850 hydrog ?    ? A  U   1813 O2    ? ? ? 1_555 A  U   1817 N3  ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? ? 
hydrog1851 hydrog ?    ? A  U   1813 N3    ? ? ? 1_555 A  C   1818 O2  ? ? 0 U   1813 0 C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog1852 hydrog ?    ? A  G   1820 N1    ? ? ? 1_555 A  C   2029 N3  ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1853 hydrog ?    ? A  G   1820 N2    ? ? ? 1_555 A  C   2029 O2  ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1854 hydrog ?    ? A  G   1820 O6    ? ? ? 1_555 A  C   2029 N4  ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1855 hydrog ?    ? A  A   1821 N1    ? ? ? 1_555 A  U   2028 N3  ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1856 hydrog ?    ? A  A   1821 N6    ? ? ? 1_555 A  U   2028 O4  ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1857 hydrog ?    ? A  A   1822 N1    ? ? ? 1_555 A  U   2027 N3  ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1858 hydrog ?    ? A  A   1822 N6    ? ? ? 1_555 A  U   2027 O4  ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1859 hydrog ?    ? A  G   1823 N1    ? ? ? 1_555 A  C   2026 N3  ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1860 hydrog ?    ? A  G   1823 N2    ? ? ? 1_555 A  C   2026 O2  ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1861 hydrog ?    ? A  G   1823 O6    ? ? ? 1_555 A  C   2026 N4  ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1862 hydrog ?    ? A  C   1824 N3    ? ? ? 1_555 A  G   2025 N1  ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1863 hydrog ?    ? A  C   1824 N4    ? ? ? 1_555 A  G   2025 O6  ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1864 hydrog ?    ? A  C   1824 O2    ? ? ? 1_555 A  G   2025 N2  ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1865 hydrog ?    ? A  U   1825 N3    ? ? ? 1_555 A  A   2024 N1  ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1866 hydrog ?    ? A  U   1825 O4    ? ? ? 1_555 A  A   2024 N6  ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1867 hydrog ?    ? A  C   1826 N3    ? ? ? 1_555 A  G   2023 N1  ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1868 hydrog ?    ? A  C   1826 N4    ? ? ? 1_555 A  G   2023 O6  ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1869 hydrog ?    ? A  C   1826 O2    ? ? ? 1_555 A  G   2023 N2  ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1870 hydrog ?    ? A  G   1827 N1    ? ? ? 1_555 A  C   2021 N3  ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1871 hydrog ?    ? A  G   1827 N2    ? ? ? 1_555 A  C   2021 O2  ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1872 hydrog ?    ? A  G   1827 O6    ? ? ? 1_555 A  C   2021 N4  ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1873 hydrog ?    ? A  G   1828 N1    ? ? ? 1_555 A  C   2020 N3  ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1874 hydrog ?    ? A  G   1828 N2    ? ? ? 1_555 A  C   2020 O2  ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1875 hydrog ?    ? A  G   1828 O6    ? ? ? 1_555 A  C   2020 N4  ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1876 hydrog ?    ? A  A   1829 N3    ? ? ? 1_555 A  A   2018 N6  ? ? 0 A   1829 0 A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1877 hydrog ?    ? A  C   1830 N4    ? ? ? 1_555 A  U   1846 O2  ? ? 0 C   1830 0 U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog1878 hydrog ?    ? A  G   1832 N1    ? ? ? 1_555 A  C   1844 N3  ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1879 hydrog ?    ? A  G   1832 N2    ? ? ? 1_555 A  C   1844 O2  ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1880 hydrog ?    ? A  G   1832 O6    ? ? ? 1_555 A  C   1844 N4  ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1881 hydrog ?    ? A  U   1833 N3    ? ? ? 1_555 A  A   1843 N1  ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1882 hydrog ?    ? A  U   1833 O4    ? ? ? 1_555 A  A   1843 N6  ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1883 hydrog ?    ? A  C   1834 O2    ? ? ? 1_555 A  C   1841 N4  ? ? 0 C   1834 0 C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1884 hydrog ?    ? A  U   1835 O4    ? ? ? 1_555 A  C   1841 N4  ? ? 0 U   1835 0 C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog1885 hydrog ?    ? A  U   1838 N3    ? ? ? 1_555 A  PSU 2621 O2  ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1886 hydrog ?    ? A  U   1838 O4    ? ? ? 1_555 A  PSU 2621 N3  ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog1887 hydrog ?    ? A  A   1839 N3    ? ? ? 1_555 A  G   2642 N2  ? ? 0 A   1839 0 G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1888 hydrog ?    ? A  A   1847 N6    ? ? ? 1_555 A  G   1884 N3  ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1889 hydrog ?    ? A  A   1847 N7    ? ? ? 1_555 A  G   1884 N2  ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1890 hydrog ?    ? A  G   1848 N1    ? ? ? 1_555 A  U   1883 O2  ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1891 hydrog ?    ? A  G   1848 O6    ? ? ? 1_555 A  U   1883 N3  ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1892 hydrog ?    ? A  G   1849 N1    ? ? ? 1_555 A  C   1882 N3  ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1893 hydrog ?    ? A  G   1849 N2    ? ? ? 1_555 A  C   1882 O2  ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1894 hydrog ?    ? A  G   1849 O6    ? ? ? 1_555 A  C   1882 N4  ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1895 hydrog ?    ? A  G   1849 N2    ? ? ? 1_555 A  A   1941 N3  ? ? 0 G   1849 0 A   1941 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1896 hydrog ?    ? A  U   1850 N3    ? ? ? 1_555 A  A   1881 N1  ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1897 hydrog ?    ? A  U   1850 O4    ? ? ? 1_555 A  A   1881 N6  ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1898 hydrog ?    ? A  G   1851 N1    ? ? ? 1_555 A  C   1880 N3  ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1899 hydrog ?    ? A  G   1851 N2    ? ? ? 1_555 A  C   1880 O2  ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1900 hydrog ?    ? A  G   1851 O6    ? ? ? 1_555 A  C   1880 N4  ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1901 hydrog ?    ? A  A   1852 N1    ? ? ? 1_555 A  U   1879 N3  ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1902 hydrog ?    ? A  A   1852 N6    ? ? ? 1_555 A  U   1879 O4  ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1903 hydrog ?    ? A  C   1853 N3    ? ? ? 1_555 A  G   1878 N1  ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1904 hydrog ?    ? A  C   1853 N4    ? ? ? 1_555 A  G   1878 O6  ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1905 hydrog ?    ? A  C   1853 O2    ? ? ? 1_555 A  G   1878 N2  ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1906 hydrog ?    ? A  C   1854 N3    ? ? ? 1_555 A  G   1877 N1  ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1907 hydrog ?    ? A  C   1854 N4    ? ? ? 1_555 A  G   1877 O6  ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1908 hydrog ?    ? A  C   1854 O2    ? ? ? 1_555 A  G   1877 N2  ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1909 hydrog ?    ? A  G   1855 N2    ? ? ? 1_555 A  U   1874 O2  ? ? 0 G   1855 0 U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog1910 hydrog ?    ? A  C   1856 N3    ? ? ? 1_555 A  G   1873 N2  ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1911 hydrog ?    ? A  C   1856 O2    ? ? ? 1_555 A  G   1873 N1  ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog1912 hydrog ?    ? A  C   1856 N4    ? ? ? 1_555 A  A   1875 N7  ? ? 0 C   1856 0 A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog1913 hydrog ?    ? A  A   1858 N6    ? ? ? 1_555 A  U   1871 O4  ? ? 0 A   1858 0 U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1914 hydrog ?    ? A  A   1859 N6    ? ? ? 1_555 A  C   1870 O2  ? ? 0 A   1859 0 C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog1915 hydrog ?    ? A  A   1859 N3    ? ? ? 1_555 A  G   1878 N2  ? ? 0 A   1859 0 G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1916 hydrog ?    ? A  U   1860 N3    ? ? ? 1_555 A  A   1869 N1  ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1917 hydrog ?    ? A  U   1860 O4    ? ? ? 1_555 A  A   1869 N6  ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1918 hydrog ?    ? A  C   1861 N3    ? ? ? 1_555 A  G   1868 N1  ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1919 hydrog ?    ? A  C   1861 N4    ? ? ? 1_555 A  G   1868 O6  ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1920 hydrog ?    ? A  C   1861 O2    ? ? ? 1_555 A  G   1868 N2  ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1921 hydrog ?    ? A  C   1862 N3    ? ? ? 1_555 A  G   1867 N1  ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1922 hydrog ?    ? A  C   1862 N4    ? ? ? 1_555 A  G   1867 O6  ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1923 hydrog ?    ? A  C   1862 O2    ? ? ? 1_555 A  G   1867 N2  ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1924 hydrog ?    ? A  G   1863 N2    ? ? ? 1_555 A  A   1866 N7  ? ? 0 G   1863 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1925 hydrog ?    ? A  A   1885 N6    ? ? ? 1_555 A  U   2017 O2  ? ? 0 A   1885 0 U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1926 hydrog ?    ? A  A   1886 N6    ? ? ? 1_555 A  U   2016 O2  ? ? 0 A   1886 0 U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ? ? 
? 
hydrog1927 hydrog ?    ? A  U   1887 N3    ? ? ? 1_555 A  A   2015 N1  ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1928 hydrog ?    ? A  U   1887 O4    ? ? ? 1_555 A  A   2015 N6  ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1929 hydrog ?    ? A  C   1888 N3    ? ? ? 1_555 A  G   2014 N1  ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1930 hydrog ?    ? A  C   1888 N4    ? ? ? 1_555 A  G   2014 O6  ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1931 hydrog ?    ? A  C   1888 O2    ? ? ? 1_555 A  G   2014 N2  ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1932 hydrog ?    ? A  C   1889 N3    ? ? ? 1_555 A  G   2013 N1  ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1933 hydrog ?    ? A  C   1889 N4    ? ? ? 1_555 A  G   2013 O6  ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1934 hydrog ?    ? A  C   1889 O2    ? ? ? 1_555 A  G   2013 N2  ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1935 hydrog ?    ? A  U   1890 O4    ? ? ? 1_555 A  A   1941 N6  ? ? 0 U   1890 0 A   1941 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1936 hydrog ?    ? A  U   1890 N3    ? ? ? 1_555 A  A   2011 N7  ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1937 hydrog ?    ? A  U   1890 O4    ? ? ? 1_555 A  A   2011 N6  ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog1938 hydrog ?    ? A  G   1891 N1    ? ? ? 1_555 A  C   1946 N3  ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1939 hydrog ?    ? A  G   1891 N2    ? ? ? 1_555 A  C   1946 O2  ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1940 hydrog ?    ? A  G   1891 O6    ? ? ? 1_555 A  C   1946 N4  ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1941 hydrog ?    ? A  C   1892 N3    ? ? ? 1_555 A  G   1945 N1  ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1942 hydrog ?    ? A  C   1892 N4    ? ? ? 1_555 A  G   1945 O6  ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1943 hydrog ?    ? A  C   1892 O2    ? ? ? 1_555 A  G   1945 N2  ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1944 hydrog ?    ? A  C   1893 N3    ? ? ? 1_555 A  G   1944 N1  ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1945 hydrog ?    ? A  C   1893 N4    ? ? ? 1_555 A  G   1944 O6  ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1946 hydrog ?    ? A  C   1893 O2    ? ? ? 1_555 A  G   1944 N2  ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1947 hydrog ?    ? A  C   1894 N3    ? ? ? 1_555 A  A   1942 N6  ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1948 hydrog ?    ? A  C   1894 N4    ? ? ? 1_555 A  A   1942 N7  ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog1949 hydrog ?    ? A  G   1896 N1    ? ? ? 1_555 A  C   1943 N3  ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1950 hydrog ?    ? A  G   1896 N2    ? ? ? 1_555 A  C   1943 O2  ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1951 hydrog ?    ? A  G   1896 O6    ? ? ? 1_555 A  C   1943 N4  ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1952 hydrog ?    ? A  U   1897 N3    ? ? ? 1_555 A  A   1942 N1  ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1953 hydrog ?    ? A  U   1897 O4    ? ? ? 1_555 A  A   1942 N6  ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1954 hydrog ?    ? A  G   1898 N1    ? ? ? 1_555 A  U   1939 O2  ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1955 hydrog ?    ? A  G   1898 O6    ? ? ? 1_555 A  U   1939 N3  ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1956 hydrog ?    ? A  C   1899 N3    ? ? ? 1_555 A  G   1938 N1  ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1957 hydrog ?    ? A  C   1899 N4    ? ? ? 1_555 A  G   1938 O6  ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1958 hydrog ?    ? A  C   1899 O2    ? ? ? 1_555 A  G   1938 N2  ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1959 hydrog ?    ? A  A   1900 N1    ? ? ? 1_555 A  U   1937 N3  ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1960 hydrog ?    ? A  A   1900 N6    ? ? ? 1_555 A  U   1937 O4  ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1961 hydrog ?    ? A  G   1901 N1    ? ? ? 1_555 A  C   1936 N3  ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1962 hydrog ?    ? A  G   1901 N2    ? ? ? 1_555 A  C   1936 O2  ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1963 hydrog ?    ? A  G   1901 O6    ? ? ? 1_555 A  C   1936 N4  ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1964 hydrog ?    ? A  G   1902 N1    ? ? ? 1_555 A  C   1935 N3  ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1965 hydrog ?    ? A  G   1902 N2    ? ? ? 1_555 A  C   1935 O2  ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1966 hydrog ?    ? A  G   1902 O6    ? ? ? 1_555 A  C   1935 N4  ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1967 hydrog ?    ? A  U   1903 O2    ? ? ? 1_555 A  A   1934 N6  ? ? 0 U   1903 0 A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog1968 hydrog ?    ? A  U   1905 N3    ? ? ? 1_555 A  A   1934 N1  ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1969 hydrog ?    ? A  U   1905 O4    ? ? ? 1_555 A  A   1934 N6  ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1970 hydrog ?    ? A  C   1906 N3    ? ? ? 1_555 A  G   1933 N1  ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1971 hydrog ?    ? A  C   1906 N4    ? ? ? 1_555 A  G   1933 O6  ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1972 hydrog ?    ? A  C   1906 O2    ? ? ? 1_555 A  G   1933 N2  ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1973 hydrog ?    ? A  U   1907 N3    ? ? ? 1_555 A  G   1932 O6  ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1974 hydrog ?    ? A  U   1907 O2    ? ? ? 1_555 A  G   1932 N1  ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog1975 hydrog ?    ? A  G   1908 N2    ? ? ? 1_555 A  A   1931 N7  ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1976 hydrog ?    ? A  G   1908 N3    ? ? ? 1_555 A  A   1931 N6  ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog1977 hydrog ?    ? A  A   1910 N3    ? ? ? 1_555 A  G   2128 N2  ? ? 0 A   1910 0 G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1978 hydrog ?    ? A  A   1912 N6    ? ? ? 1_555 A  A   1927 N1  ? ? 0 A   1912 0 A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog1979 hydrog ?    ? A  C   1913 N3    ? ? ? 1_555 A  G   1926 N1  ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1980 hydrog ?    ? A  C   1913 N4    ? ? ? 1_555 A  G   1926 O6  ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1981 hydrog ?    ? A  C   1913 O2    ? ? ? 1_555 A  G   1926 N2  ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1982 hydrog ?    ? A  C   1914 N3    ? ? ? 1_555 A  G   1925 N1  ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1983 hydrog ?    ? A  C   1914 N4    ? ? ? 1_555 A  G   1925 O6  ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1984 hydrog ?    ? A  C   1914 O2    ? ? ? 1_555 A  G   1925 N2  ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1985 hydrog ?    ? A  U   1915 N3    ? ? ? 1_555 A  A   1924 N1  ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1986 hydrog ?    ? A  U   1915 O4    ? ? ? 1_555 A  A   1924 N6  ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1987 hydrog ?    ? A  C   1916 N3    ? ? ? 1_555 A  G   1923 N1  ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1988 hydrog ?    ? A  C   1916 N4    ? ? ? 1_555 A  G   1923 O6  ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1989 hydrog ?    ? A  C   1916 O2    ? ? ? 1_555 A  G   1923 N2  ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1990 hydrog ?    ? A  G   1917 N2    ? ? ? 1_555 A  A   1922 N7  ? ? 0 G   1917 0 A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1991 hydrog ?    ? A  A   1921 N1    ? ? ? 1_555 A  G   2449 N2  ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1992 hydrog ?    ? A  A   1921 N6    ? ? ? 1_555 A  G   2449 N3  ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog1993 hydrog ?    ? A  A   1931 N3    ? ? ? 1_555 A  G   2267 N2  ? ? 0 A   1931 0 G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog1994 hydrog ?    ? A  C   1940 O2    ? ? ? 1_555 A  C   1943 N4  ? ? 0 C   1940 0 C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog1995 hydrog ?    ? A  G   1945 N2    ? ? ? 1_555 A  A   1969 N3  ? ? 0 G   1945 0 A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog1996 hydrog ?    ? A  G   1947 N1    ? ? ? 1_555 A  C   1965 N3  ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1997 hydrog ?    ? A  G   1947 N2    ? ? ? 1_555 A  C   1965 O2  ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1998 hydrog ?    ? A  G   1947 O6    ? ? ? 1_555 A  C   1965 N4  ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog1999 hydrog ?    ? A  G   1948 N1    ? ? ? 1_555 A  U   1964 O2  ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2000 hydrog ?    ? A  G   1948 O6    ? ? ? 1_555 A  U   1964 N3  ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2001 hydrog ?    ? A  U   1966 N3    ? ? ? 1_555 A  G   1970 O6  ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? 
? ? 
hydrog2002 hydrog ?    ? A  U   1966 O4    ? ? ? 1_555 A  G   1970 N1  ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? 
? ? 
hydrog2003 hydrog ?    ? A  G   1971 N2    ? ? ? 1_555 A  U   1972 O4  ? ? 0 G   1971 0 U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2004 hydrog ?    ? A  U   1972 N3    ? ? ? 1_555 A  A   2010 N7  ? ? 0 U   1972 0 A   2010 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2005 hydrog ?    ? A  A   1973 N6    ? ? ? 1_555 A  G   2009 N3  ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2006 hydrog ?    ? A  A   1973 N7    ? ? ? 1_555 A  G   2009 N2  ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2007 hydrog ?    ? A  G   1974 N1    ? ? ? 1_555 A  U   2008 O2  ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2008 hydrog ?    ? A  G   1974 O6    ? ? ? 1_555 A  U   2008 N3  ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2009 hydrog ?    ? A  C   1975 N3    ? ? ? 1_555 A  G   2005 N1  ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2010 hydrog ?    ? A  C   1975 N4    ? ? ? 1_555 A  G   2005 O6  ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2011 hydrog ?    ? A  C   1975 O2    ? ? ? 1_555 A  G   2005 N2  ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2012 hydrog ?    ? A  U   1977 N3    ? ? ? 1_555 A  U   1984 O4  ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2013 hydrog ?    ? A  U   1977 O2    ? ? ? 1_555 A  U   1984 N3  ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2014 hydrog ?    ? A  A   1978 N1    ? ? ? 1_555 A  G   2005 N2  ? ? 0 A   1978 0 G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2015 hydrog ?    ? A  G   1979 N2    ? ? ? 1_555 A  U   2640 O2  ? ? 0 G   1979 0 U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2016 hydrog ?    ? A  A   1981 N3    ? ? ? 1_555 A  C   1983 N4  ? ? 0 A   1981 0 C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2017 hydrog ?    ? A  G   1986 N1    ? ? ? 1_555 A  C   2002 N3  ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2018 hydrog ?    ? A  G   1986 N2    ? ? ? 1_555 A  C   2002 O2  ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2019 hydrog ?    ? A  G   1986 O6    ? ? ? 1_555 A  C   2002 N4  ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2020 hydrog ?    ? A  C   1987 N3    ? ? ? 1_555 A  G   2001 N1  ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2021 hydrog ?    ? A  C   1987 N4    ? ? ? 1_555 A  G   2001 O6  ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2022 hydrog ?    ? A  C   1987 O2    ? ? ? 1_555 A  G   2001 N2  ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2023 hydrog ?    ? A  C   1988 N3    ? ? ? 1_555 A  G   2000 N1  ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2024 hydrog ?    ? A  C   1988 N4    ? ? ? 1_555 A  G   2000 O6  ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2025 hydrog ?    ? A  C   1988 O2    ? ? ? 1_555 A  G   2000 N2  ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2026 hydrog ?    ? A  G   1989 N1    ? ? ? 1_555 A  C   1999 N3  ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2027 hydrog ?    ? A  G   1989 N2    ? ? ? 1_555 A  C   1999 O2  ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2028 hydrog ?    ? A  G   1989 O6    ? ? ? 1_555 A  C   1999 N4  ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2029 hydrog ?    ? A  C   1990 N3    ? ? ? 1_555 A  G   1998 N1  ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2030 hydrog ?    ? A  C   1990 N4    ? ? ? 1_555 A  G   1998 O6  ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2031 hydrog ?    ? A  C   1990 O2    ? ? ? 1_555 A  G   1998 N2  ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2032 hydrog ?    ? A  A   1994 N3    ? ? ? 1_555 A  G   2584 N2  ? ? 0 A   1994 0 G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2033 hydrog ?    ? A  U   1996 O4    ? ? ? 1_555 A  C   2591 N4  ? ? 0 U   1996 0 C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2034 hydrog ?    ? A  A   2010 N3    ? ? ? 1_555 A  G   2013 N2  ? ? 0 A   2010 0 G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2035 hydrog ?    ? A  G   2033 N1    ? ? ? 1_555 A  C   2037 O2  ? ? 0 G   2033 0 C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2036 hydrog ?    ? A  G   2041 N2    ? ? ? 1_555 A  U   2726 O4  ? ? 0 G   2041 0 U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2037 hydrog ?    ? A  A   2054 N1    ? ? ? 1_555 A  U   2648 N3  ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2038 hydrog ?    ? A  A   2054 N6    ? ? ? 1_555 A  U   2648 O2  ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2039 hydrog ?    ? A  A   2060 N1    ? ? ? 1_555 A  U   2076 N3  ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2040 hydrog ?    ? A  A   2060 N6    ? ? ? 1_555 A  U   2076 O4  ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2041 hydrog ?    ? A  C   2061 N3    ? ? ? 1_555 A  G   2075 N1  ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2042 hydrog ?    ? A  C   2061 N4    ? ? ? 1_555 A  G   2075 O6  ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2043 hydrog ?    ? A  C   2061 O2    ? ? ? 1_555 A  G   2075 N2  ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2044 hydrog ?    ? A  U   2063 N3    ? ? ? 1_555 A  A   2083 N3  ? ? 0 U   2063 0 A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2045 hydrog ?    ? A  U   2064 N3    ? ? ? 1_555 A  A   2081 N1  ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2046 hydrog ?    ? A  U   2064 O4    ? ? ? 1_555 A  A   2081 N6  ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2047 hydrog ?    ? A  C   2065 N3    ? ? ? 1_555 A  G   2080 N1  ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2048 hydrog ?    ? A  C   2065 N4    ? ? ? 1_555 A  G   2080 O6  ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2049 hydrog ?    ? A  C   2065 O2    ? ? ? 1_555 A  G   2080 N2  ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2050 hydrog ?    ? A  C   2066 N3    ? ? ? 1_555 A  G   2079 N1  ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2051 hydrog ?    ? A  C   2066 N4    ? ? ? 1_555 A  G   2079 O6  ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2052 hydrog ?    ? A  C   2066 O2    ? ? ? 1_555 A  G   2079 N2  ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2053 hydrog ?    ? A  A   2067 N1    ? ? ? 1_555 A  U   2078 N3  ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2054 hydrog ?    ? A  A   2067 N6    ? ? ? 1_555 A  U   2078 O4  ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2055 hydrog ?    ? A  G   2068 N1    ? ? ? 1_555 A  C   2077 N3  ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2056 hydrog ?    ? A  G   2068 N2    ? ? ? 1_555 A  C   2077 O2  ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2057 hydrog ?    ? A  G   2068 O6    ? ? ? 1_555 A  C   2077 N4  ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2058 hydrog ?    ? A  U   2069 N3    ? ? ? 1_555 A  A   2074 N7  ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2059 hydrog ?    ? A  U   2069 O2    ? ? ? 1_555 A  A   2074 N6  ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2060 hydrog ?    ? A  G   2072 N2    ? ? ? 1_555 A  A   2490 N3  ? ? 0 G   2072 0 A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2061 hydrog ?    ? A  C   2084 N3    ? ? ? 1_555 A  G   2660 N1  ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2062 hydrog ?    ? A  C   2084 N4    ? ? ? 1_555 A  G   2660 O6  ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2063 hydrog ?    ? A  C   2084 O2    ? ? ? 1_555 A  G   2660 N2  ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2064 hydrog ?    ? A  A   2085 N1    ? ? ? 1_555 A  U   2659 N3  ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2065 hydrog ?    ? A  A   2085 N6    ? ? ? 1_555 A  U   2659 O4  ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2066 hydrog ?    ? A  C   2086 N3    ? ? ? 1_555 A  G   2658 N1  ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2067 hydrog ?    ? A  C   2086 N4    ? ? ? 1_555 A  G   2658 O6  ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2068 hydrog ?    ? A  C   2086 O2    ? ? ? 1_555 A  G   2658 N2  ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2069 hydrog ?    ? A  C   2087 N3    ? ? ? 1_555 A  G   2657 N1  ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2070 hydrog ?    ? A  C   2087 N4    ? ? ? 1_555 A  G   2657 O6  ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2071 hydrog ?    ? A  C   2087 O2    ? ? ? 1_555 A  G   2657 N2  ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2072 hydrog ?    ? A  C   2088 N3    ? ? ? 1_555 A  G   2656 N1  ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2073 hydrog ?    ? A  C   2088 N4    ? ? ? 1_555 A  G   2656 O6  ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2074 hydrog ?    ? A  C   2088 O2    ? ? ? 1_555 A  G   2656 N2  ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2075 hydrog ?    ? A  C   2088 O2    ? ? ? 1_555 A  A   2840 N6  ? ? 0 C   2088 0 A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2076 hydrog ?    ? A  A   2089 N1    ? ? ? 1_555 A  U   2655 N3  ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2077 hydrog ?    ? A  A   2089 N6    ? ? ? 1_555 A  U   2655 O4  ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2078 hydrog ?    ? A  G   2090 N1    ? ? ? 1_555 A  C   2654 N3  ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2079 hydrog ?    ? A  G   2090 N2    ? ? ? 1_555 A  C   2654 O2  ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2080 hydrog ?    ? A  G   2090 O6    ? ? ? 1_555 A  C   2654 N4  ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2081 hydrog ?    ? A  G   2091 N1    ? ? ? 1_555 A  A   2653 N1  ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2082 hydrog ?    ? A  G   2091 O6    ? ? ? 1_555 A  A   2653 N6  ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2083 hydrog ?    ? A  G   2092 N2    ? ? ? 1_555 A  G   2093 O6  ? ? 0 G   2092 0 G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog2084 hydrog ?    ? A  G   2092 N2    ? ? ? 1_555 A  U   2652 O4  ? ? 0 G   2092 0 U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2085 hydrog ?    ? A  G   2093 N1    ? ? ? 1_555 A  U   2652 O2  ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2086 hydrog ?    ? A  G   2093 O6    ? ? ? 1_555 A  U   2652 N3  ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2087 hydrog ?    ? A  G   2094 N1    ? ? ? 1_555 A  C   2651 N3  ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2088 hydrog ?    ? A  G   2094 N2    ? ? ? 1_555 A  C   2651 O2  ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2089 hydrog ?    ? A  G   2094 O6    ? ? ? 1_555 A  C   2651 N4  ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2090 hydrog ?    ? A  A   2095 N6    ? ? ? 1_555 A  A   2612 N1  ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog2091 hydrog ?    ? A  A   2095 N7    ? ? ? 1_555 A  A   2612 N6  ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog2092 hydrog ?    ? A  A   2095 N1    ? ? ? 1_555 A  U   2650 N3  ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2093 hydrog ?    ? A  A   2095 N6    ? ? ? 1_555 A  U   2650 O4  ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2094 hydrog ?    ? A  G   2097 N1    ? ? ? 1_555 A  C   2647 N3  ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2095 hydrog ?    ? A  G   2097 N2    ? ? ? 1_555 A  C   2647 O2  ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2096 hydrog ?    ? A  G   2097 O6    ? ? ? 1_555 A  C   2647 N4  ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2097 hydrog ?    ? A  C   2098 N3    ? ? ? 1_555 A  G   2646 N1  ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2098 hydrog ?    ? A  C   2098 N4    ? ? ? 1_555 A  G   2646 O6  ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2099 hydrog ?    ? A  C   2098 O2    ? ? ? 1_555 A  G   2646 N2  ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2100 hydrog ?    ? A  G   2102 N1    ? ? ? 1_555 A  A   2486 N1  ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2101 hydrog ?    ? A  G   2102 O6    ? ? ? 1_555 A  A   2486 N6  ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2102 hydrog ?    ? A  C   2104 N3    ? ? ? 1_555 A  A   2485 N6  ? ? 0 C   2104 0 A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2103 hydrog ?    ? A  C   2104 N4    ? ? ? 1_555 A  C   2536 O2  ? ? 0 C   2104 0 C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2104 hydrog ?    ? A  C   2105 N3    ? ? ? 1_555 A  G   2481 N1  ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2105 hydrog ?    ? A  C   2105 N4    ? ? ? 1_555 A  G   2481 O6  ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2106 hydrog ?    ? A  C   2105 O2    ? ? ? 1_555 A  G   2481 N2  ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2107 hydrog ?    ? A  C   2106 N3    ? ? ? 1_555 A  G   2480 N1  ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2108 hydrog ?    ? A  C   2106 N4    ? ? ? 1_555 A  G   2480 O6  ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2109 hydrog ?    ? A  C   2106 O2    ? ? ? 1_555 A  G   2480 N2  ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2110 hydrog ?    ? A  U   2107 N3    ? ? ? 1_555 A  A   2479 N1  ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2111 hydrog ?    ? A  U   2107 O4    ? ? ? 1_555 A  A   2479 N6  ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2112 hydrog ?    ? A  A   2108 N1    ? ? ? 1_555 A  U   2478 N3  ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2113 hydrog ?    ? A  A   2108 N6    ? ? ? 1_555 A  U   2478 O4  ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2114 hydrog ?    ? A  U   2109 N3    ? ? ? 1_555 A  A   2467 N1  ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2115 hydrog ?    ? A  U   2109 O2    ? ? ? 1_555 A  A   2467 N6  ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2116 hydrog ?    ? A  G   2110 N1    ? ? ? 1_555 A  C   2477 N3  ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2117 hydrog ?    ? A  G   2110 N2    ? ? ? 1_555 A  C   2477 O2  ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2118 hydrog ?    ? A  G   2110 O6    ? ? ? 1_555 A  C   2477 N4  ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2119 hydrog ?    ? A  G   2111 N1    ? ? ? 1_555 A  C   2476 N3  ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2120 hydrog ?    ? A  G   2111 N2    ? ? ? 1_555 A  C   2476 O2  ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2121 hydrog ?    ? A  G   2111 O6    ? ? ? 1_555 A  C   2476 N4  ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2122 hydrog ?    ? A  A   2112 N1    ? ? ? 1_555 A  U   2473 N3  ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2123 hydrog ?    ? A  A   2112 N6    ? ? ? 1_555 A  U   2473 O4  ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2124 hydrog ?    ? A  G   2113 N1    ? ? ? 1_555 A  C   2472 N3  ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2125 hydrog ?    ? A  G   2113 N2    ? ? ? 1_555 A  C   2472 O2  ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2126 hydrog ?    ? A  G   2113 O6    ? ? ? 1_555 A  C   2472 N4  ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2127 hydrog ?    ? A  G   2113 N3    ? ? ? 1_555 A  C   2475 N4  ? ? 0 G   2113 0 C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2128 hydrog ?    ? A  C   2114 N3    ? ? ? 1_555 A  G   2471 N1  ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2129 hydrog ?    ? A  C   2114 N4    ? ? ? 1_555 A  G   2471 O6  ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2130 hydrog ?    ? A  C   2114 O2    ? ? ? 1_555 A  G   2471 N2  ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2131 hydrog ?    ? A  U   2115 N3    ? ? ? 1_555 A  A   2470 N1  ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2132 hydrog ?    ? A  U   2115 O4    ? ? ? 1_555 A  A   2470 N6  ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2133 hydrog ?    ? A  U   2115 O2    ? ? ? 1_555 A  G   2632 N2  ? ? 0 U   2115 0 G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2134 hydrog ?    ? A  U   2116 N3    ? ? ? 1_555 A  A   2118 N7  ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2135 hydrog ?    ? A  U   2116 O4    ? ? ? 1_555 A  A   2118 N6  ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2136 hydrog ?    ? A  A   2118 N1    ? ? ? 1_555 A  U   2276 N3  ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2137 hydrog ?    ? A  A   2118 N6    ? ? ? 1_555 A  U   2276 O4  ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2138 hydrog ?    ? A  C   2119 N4    ? ? ? 1_555 A  G   2271 O6  ? ? 0 C   2119 0 G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2139 hydrog ?    ? A  C   2119 N3    ? ? ? 1_555 A  G   2275 N1  ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2140 hydrog ?    ? A  C   2119 N4    ? ? ? 1_555 A  G   2275 O6  ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2141 hydrog ?    ? A  C   2119 O2    ? ? ? 1_555 A  G   2275 N2  ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2142 hydrog ?    ? A  U   2120 N3    ? ? ? 1_555 A  A   2274 N1  ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2143 hydrog ?    ? A  U   2120 O4    ? ? ? 1_555 A  A   2274 N6  ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2144 hydrog ?    ? A  G   2121 N1    ? ? ? 1_555 A  C   2273 N3  ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2145 hydrog ?    ? A  G   2121 N2    ? ? ? 1_555 A  C   2273 O2  ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2146 hydrog ?    ? A  G   2121 O6    ? ? ? 1_555 A  C   2273 N4  ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2147 hydrog ?    ? A  C   2122 N3    ? ? ? 1_555 A  G   2272 N1  ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2148 hydrog ?    ? A  C   2122 N4    ? ? ? 1_555 A  G   2272 O6  ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2149 hydrog ?    ? A  C   2122 O2    ? ? ? 1_555 A  G   2272 N2  ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2150 hydrog ?    ? A  A   2123 N6    ? ? ? 1_555 A  G   2270 N3  ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2151 hydrog ?    ? A  A   2123 N7    ? ? ? 1_555 A  G   2270 N2  ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2152 hydrog ?    ? A  G   2124 N1    ? ? ? 1_555 A  C   2269 N3  ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2153 hydrog ?    ? A  G   2124 N2    ? ? ? 1_555 A  C   2269 O2  ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2154 hydrog ?    ? A  G   2124 O6    ? ? ? 1_555 A  C   2269 N4  ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2155 hydrog ?    ? A  G   2125 N1    ? ? ? 1_555 A  C   2268 N3  ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2156 hydrog ?    ? A  G   2125 N2    ? ? ? 1_555 A  C   2268 O2  ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2157 hydrog ?    ? A  G   2125 O6    ? ? ? 1_555 A  C   2268 N4  ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2158 hydrog ?    ? A  C   2126 N3    ? ? ? 1_555 A  G   2267 N1  ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2159 hydrog ?    ? A  C   2126 N4    ? ? ? 1_555 A  G   2267 O6  ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2160 hydrog ?    ? A  C   2126 O2    ? ? ? 1_555 A  G   2267 N2  ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2161 hydrog ?    ? A  U   2127 N3    ? ? ? 1_555 A  A   2266 N1  ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2162 hydrog ?    ? A  U   2127 O4    ? ? ? 1_555 A  A   2266 N6  ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2163 hydrog ?    ? A  G   2128 N1    ? ? ? 1_555 A  U   2265 O2  ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2164 hydrog ?    ? A  G   2128 O6    ? ? ? 1_555 A  U   2265 N3  ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2165 hydrog ?    ? A  U   2129 N3    ? ? ? 1_555 A  A   2264 N1  ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2166 hydrog ?    ? A  U   2129 O4    ? ? ? 1_555 A  A   2264 N6  ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2167 hydrog ?    ? A  C   2130 N3    ? ? ? 1_555 A  G   2263 N1  ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2168 hydrog ?    ? A  C   2130 N4    ? ? ? 1_555 A  G   2263 O6  ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2169 hydrog ?    ? A  C   2130 O2    ? ? ? 1_555 A  G   2263 N2  ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2170 hydrog ?    ? A  G   2131 N1    ? ? ? 1_555 A  C   2262 N3  ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2171 hydrog ?    ? A  G   2131 N2    ? ? ? 1_555 A  C   2262 O2  ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2172 hydrog ?    ? A  G   2131 O6    ? ? ? 1_555 A  C   2262 N4  ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2173 hydrog ?    ? A  C   2132 O2    ? ? ? 1_555 A  C   2261 N4  ? ? 0 C   2132 0 C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2174 hydrog ?    ? A  U   2133 O4    ? ? ? 1_555 A  A   2260 N6  ? ? 0 U   2133 0 A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2175 hydrog ?    ? A  G   2134 N1    ? ? ? 1_555 A  C   2241 N3  ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2176 hydrog ?    ? A  G   2134 N2    ? ? ? 1_555 A  C   2241 O2  ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2177 hydrog ?    ? A  G   2134 O6    ? ? ? 1_555 A  C   2241 N4  ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2178 hydrog ?    ? A  A   2135 N1    ? ? ? 1_555 A  U   2240 N3  ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2179 hydrog ?    ? A  A   2135 N6    ? ? ? 1_555 A  U   2240 O4  ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2180 hydrog ?    ? A  G   2136 N1    ? ? ? 1_555 A  C   2239 N3  ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2181 hydrog ?    ? A  U   2242 N3    ? ? ? 1_555 A  A   2258 N7  ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2182 hydrog ?    ? A  U   2242 O2    ? ? ? 1_555 A  A   2258 N6  ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2183 hydrog ?    ? A  A   2244 N6    ? ? ? 1_555 A  G   2257 N3  ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2184 hydrog ?    ? A  A   2244 N7    ? ? ? 1_555 A  G   2257 N2  ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2185 hydrog ?    ? A  C   2245 N3    ? ? ? 1_555 A  G   2256 N1  ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2186 hydrog ?    ? A  C   2245 N4    ? ? ? 1_555 A  G   2256 O6  ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2187 hydrog ?    ? A  C   2245 O2    ? ? ? 1_555 A  G   2256 N2  ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2188 hydrog ?    ? A  U   2246 N3    ? ? ? 1_555 A  A   2255 N1  ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2189 hydrog ?    ? A  U   2246 O4    ? ? ? 1_555 A  A   2255 N6  ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2190 hydrog ?    ? A  C   2247 N3    ? ? ? 1_555 A  G   2254 N1  ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2191 hydrog ?    ? A  C   2247 N4    ? ? ? 1_555 A  G   2254 O6  ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2192 hydrog ?    ? A  C   2247 O2    ? ? ? 1_555 A  G   2254 N2  ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2193 hydrog ?    ? A  C   2248 N3    ? ? ? 1_555 A  G   2253 N1  ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2194 hydrog ?    ? A  C   2248 N4    ? ? ? 1_555 A  G   2253 O6  ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2195 hydrog ?    ? A  C   2248 O2    ? ? ? 1_555 A  G   2253 N2  ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2196 hydrog ?    ? A  G   2249 N2    ? ? ? 1_555 A  A   2252 N7  ? ? 0 G   2249 0 A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2197 hydrog ?    ? A  G   2271 N7    ? ? ? 1_555 A  A   2274 N6  ? ? 0 G   2271 0 A   2274 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2198 hydrog ?    ? A  U   2277 N3    ? ? ? 1_555 A  A   2470 N7  ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2199 hydrog ?    ? A  U   2277 O4    ? ? ? 1_555 A  A   2470 N6  ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2200 hydrog ?    ? A  U   2278 N3    ? ? ? 1_555 A  G   2471 N7  ? ? 0 U   2278 0 G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2201 hydrog ?    ? A  G   2279 N1    ? ? ? 1_555 A  C   2292 N3  ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2202 hydrog ?    ? A  G   2279 N2    ? ? ? 1_555 A  C   2292 O2  ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2203 hydrog ?    ? A  G   2279 O6    ? ? ? 1_555 A  C   2292 N4  ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2204 hydrog ?    ? A  A   2280 N1    ? ? ? 1_555 A  U   2290 N3  ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2205 hydrog ?    ? A  A   2280 N6    ? ? ? 1_555 A  U   2290 O4  ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2206 hydrog ?    ? A  C   2281 N3    ? ? ? 1_555 A  G   2289 N1  ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2207 hydrog ?    ? A  C   2281 N4    ? ? ? 1_555 A  G   2289 O6  ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2208 hydrog ?    ? A  C   2281 O2    ? ? ? 1_555 A  G   2289 N2  ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2209 hydrog ?    ? A  G   2288 N1    ? ? ? 1_555 A  C   2309 N3  ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2210 hydrog ?    ? A  G   2288 N2    ? ? ? 1_555 A  C   2309 O2  ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2211 hydrog ?    ? A  G   2288 O6    ? ? ? 1_555 A  C   2309 N4  ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2212 hydrog ?    ? A  G   2289 N2    ? ? ? 1_555 A  A   2291 N1  ? ? 0 G   2289 0 A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2213 hydrog ?    ? A  G   2293 N1    ? ? ? 1_555 A  C   2315 N3  ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2214 hydrog ?    ? A  G   2293 N2    ? ? ? 1_555 A  C   2315 O2  ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2215 hydrog ?    ? A  G   2293 O6    ? ? ? 1_555 A  C   2315 N4  ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2216 hydrog ?    ? A  C   2294 N3    ? ? ? 1_555 A  G   2314 N1  ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2217 hydrog ?    ? A  C   2294 N4    ? ? ? 1_555 A  G   2314 O6  ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2218 hydrog ?    ? A  C   2294 O2    ? ? ? 1_555 A  G   2314 N2  ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2219 hydrog ?    ? A  G   2295 N1    ? ? ? 1_555 A  C   2313 N3  ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2220 hydrog ?    ? A  G   2295 N2    ? ? ? 1_555 A  C   2313 O2  ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2221 hydrog ?    ? A  G   2295 O6    ? ? ? 1_555 A  C   2313 N4  ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2222 hydrog ?    ? A  G   2295 N2    ? ? ? 1_555 A  A   2361 N3  ? ? 0 G   2295 0 A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2223 hydrog ?    ? A  C   2296 N3    ? ? ? 1_555 A  G   2312 N1  ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2224 hydrog ?    ? A  C   2296 N4    ? ? ? 1_555 A  G   2312 O6  ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2225 hydrog ?    ? A  C   2296 O2    ? ? ? 1_555 A  G   2312 N2  ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2226 hydrog ?    ? A  U   2297 N3    ? ? ? 1_555 A  A   2311 N1  ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2227 hydrog ?    ? A  U   2297 O4    ? ? ? 1_555 A  A   2311 N6  ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2228 hydrog ?    ? A  C   2298 N3    ? ? ? 1_555 A  G   2310 N1  ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2229 hydrog ?    ? A  C   2298 N4    ? ? ? 1_555 A  G   2310 O6  ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2230 hydrog ?    ? A  C   2298 O2    ? ? ? 1_555 A  G   2310 N2  ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2231 hydrog ?    ? A  G   2299 N2    ? ? ? 1_555 A  U   2308 O4  ? ? 0 G   2299 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2232 hydrog ?    ? A  A   2300 N6    ? ? ? 1_555 A  A   2307 N7  ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2233 hydrog ?    ? A  A   2300 N7    ? ? ? 1_555 A  A   2307 N6  ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2234 hydrog ?    ? A  A   2301 N1    ? ? ? 1_555 A  U   2306 N3  ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2235 hydrog ?    ? A  A   2301 N6    ? ? ? 1_555 A  U   2306 O2  ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2236 hydrog ?    ? A  G   2314 N2    ? ? ? 1_555 A  A   2425 N3  ? ? 0 G   2314 0 A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2237 hydrog ?    ? A  G   2316 N1    ? ? ? 1_555 A  C   2464 N3  ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2238 hydrog ?    ? A  G   2316 N2    ? ? ? 1_555 A  C   2464 O2  ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2239 hydrog ?    ? A  G   2316 O6    ? ? ? 1_555 A  C   2464 N4  ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2240 hydrog ?    ? A  C   2317 N3    ? ? ? 1_555 A  G   2359 N1  ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2241 hydrog ?    ? A  C   2317 N4    ? ? ? 1_555 A  G   2359 O6  ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2242 hydrog ?    ? A  C   2317 O2    ? ? ? 1_555 A  G   2359 N2  ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2243 hydrog ?    ? A  C   2318 N3    ? ? ? 1_555 A  G   2421 N1  ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2244 hydrog ?    ? A  C   2318 N4    ? ? ? 1_555 A  G   2421 O6  ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2245 hydrog ?    ? A  C   2318 O2    ? ? ? 1_555 A  G   2421 N2  ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2246 hydrog ?    ? A  C   2319 N3    ? ? ? 1_555 A  G   2420 N1  ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2247 hydrog ?    ? A  C   2319 N4    ? ? ? 1_555 A  G   2420 O6  ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2248 hydrog ?    ? A  C   2319 O2    ? ? ? 1_555 A  G   2420 N2  ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2249 hydrog ?    ? A  A   2321 N1    ? ? ? 1_555 A  U   2378 N3  ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2250 hydrog ?    ? A  A   2321 N6    ? ? ? 1_555 A  U   2378 O2  ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2251 hydrog ?    ? A  A   2321 N6    ? ? ? 1_555 A  A   2380 N7  ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2252 hydrog ?    ? A  A   2321 N7    ? ? ? 1_555 A  A   2380 N6  ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2253 hydrog ?    ? A  G   2323 N1    ? ? ? 1_555 A  U   2377 O2  ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2254 hydrog ?    ? A  G   2323 O6    ? ? ? 1_555 A  U   2377 N3  ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2255 hydrog ?    ? A  G   2324 N1    ? ? ? 1_555 A  C   2376 N3  ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2256 hydrog ?    ? A  G   2324 N2    ? ? ? 1_555 A  C   2376 O2  ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2257 hydrog ?    ? A  G   2324 O6    ? ? ? 1_555 A  C   2376 N4  ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2258 hydrog ?    ? A  U   2325 N3    ? ? ? 1_555 A  A   2375 N1  ? ? 0 U   2325 0 A   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2259 hydrog ?    ? A  U   2325 O4    ? ? ? 1_555 A  A   2375 N6  ? ? 0 U   2325 0 A   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2260 hydrog ?    ? A  C   2326 N3    ? ? ? 1_555 A  G   2374 N1  ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2261 hydrog ?    ? A  C   2326 N4    ? ? ? 1_555 A  G   2374 O6  ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2262 hydrog ?    ? A  C   2326 O2    ? ? ? 1_555 A  G   2374 N2  ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2263 hydrog ?    ? A  A   2327 N1    ? ? ? 1_555 A  U   2373 N3  ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2264 hydrog ?    ? A  A   2327 N6    ? ? ? 1_555 A  U   2373 O4  ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2265 hydrog ?    ? A  U   2328 N3    ? ? ? 1_555 A  A   2372 N1  ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2266 hydrog ?    ? A  U   2328 O4    ? ? ? 1_555 A  A   2372 N6  ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2267 hydrog ?    ? A  C   2329 N3    ? ? ? 1_555 A  G   2371 N1  ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2268 hydrog ?    ? A  C   2329 N4    ? ? ? 1_555 A  G   2371 O6  ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2269 hydrog ?    ? A  C   2329 O2    ? ? ? 1_555 A  G   2371 N2  ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2270 hydrog ?    ? A  U   2330 N3    ? ? ? 1_555 A  A   2369 N7  ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2271 hydrog ?    ? A  U   2330 O2    ? ? ? 1_555 A  A   2369 N6  ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2272 hydrog ?    ? A  C   2331 N3    ? ? ? 1_555 A  G   2355 N1  ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2273 hydrog ?    ? A  C   2331 N4    ? ? ? 1_555 A  G   2355 O6  ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2274 hydrog ?    ? A  C   2331 O2    ? ? ? 1_555 A  G   2355 N2  ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2275 hydrog ?    ? A  A   2332 N7    ? ? ? 1_555 A  G   2352 N2  ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2276 hydrog ?    ? A  G   2333 N1    ? ? ? 1_555 A  C   2351 N3  ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2277 hydrog ?    ? A  G   2333 N2    ? ? ? 1_555 A  C   2351 O2  ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2278 hydrog ?    ? A  G   2333 O6    ? ? ? 1_555 A  C   2351 N4  ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2279 hydrog ?    ? A  C   2334 N3    ? ? ? 1_555 A  G   2350 N1  ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2280 hydrog ?    ? A  C   2334 N4    ? ? ? 1_555 A  G   2350 O6  ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2281 hydrog ?    ? A  C   2334 O2    ? ? ? 1_555 A  G   2350 N2  ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2282 hydrog ?    ? A  C   2335 N3    ? ? ? 1_555 A  G   2349 N1  ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2283 hydrog ?    ? A  C   2335 N4    ? ? ? 1_555 A  G   2349 O6  ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2284 hydrog ?    ? A  C   2335 O2    ? ? ? 1_555 A  G   2349 N2  ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2285 hydrog ?    ? A  G   2336 N1    ? ? ? 1_555 A  C   2348 N3  ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2286 hydrog ?    ? A  G   2336 N2    ? ? ? 1_555 A  C   2348 O2  ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2287 hydrog ?    ? A  G   2336 O6    ? ? ? 1_555 A  C   2348 N4  ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2288 hydrog ?    ? A  G   2337 N1    ? ? ? 1_555 A  C   2347 N3  ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2289 hydrog ?    ? A  G   2337 N2    ? ? ? 1_555 A  C   2347 O2  ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2290 hydrog ?    ? A  G   2337 O6    ? ? ? 1_555 A  C   2347 N4  ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2291 hydrog ?    ? A  G   2338 N1    ? ? ? 1_555 A  C   2346 N3  ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2292 hydrog ?    ? A  G   2338 N2    ? ? ? 1_555 A  C   2346 O2  ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2293 hydrog ?    ? A  G   2338 O6    ? ? ? 1_555 A  C   2346 N4  ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2294 hydrog ?    ? A  A   2356 N1    ? ? ? 1_555 A  A   2369 N6  ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog2295 hydrog ?    ? A  A   2356 N6    ? ? ? 1_555 A  A   2369 N1  ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog2296 hydrog ?    ? A  G   2357 N1    ? ? ? 1_555 A  C   2366 N3  ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2297 hydrog ?    ? A  G   2357 N2    ? ? ? 1_555 A  C   2366 O2  ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2298 hydrog ?    ? A  G   2357 O6    ? ? ? 1_555 A  C   2366 N4  ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2299 hydrog ?    ? A  U   2358 N3    ? ? ? 1_555 A  G   2365 O6  ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2300 hydrog ?    ? A  U   2358 O2    ? ? ? 1_555 A  G   2365 N1  ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2301 hydrog ?    ? A  C   2360 N3    ? ? ? 1_555 A  G   2426 N1  ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2302 hydrog ?    ? A  C   2360 N4    ? ? ? 1_555 A  G   2426 O6  ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2303 hydrog ?    ? A  C   2360 O2    ? ? ? 1_555 A  G   2426 N2  ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2304 hydrog ?    ? A  A   2362 N1    ? ? ? 1_555 A  U   2424 N3  ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2305 hydrog ?    ? A  A   2362 N6    ? ? ? 1_555 A  U   2424 O4  ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2306 hydrog ?    ? A  G   2363 N1    ? ? ? 1_555 A  C   2423 N3  ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2307 hydrog ?    ? A  G   2363 N2    ? ? ? 1_555 A  C   2423 O2  ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2308 hydrog ?    ? A  G   2363 O6    ? ? ? 1_555 A  C   2423 N4  ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2309 hydrog ?    ? A  A   2364 N1    ? ? ? 1_555 A  U   2422 N3  ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2310 hydrog ?    ? A  A   2364 N6    ? ? ? 1_555 A  U   2422 O4  ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2311 hydrog ?    ? A  G   2365 N2    ? ? ? 1_555 A  A   2370 N3  ? ? 0 G   2365 0 A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2312 hydrog ?    ? A  G   2379 O6    ? ? ? 1_555 A  A   2408 N6  ? ? 0 G   2379 0 A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2313 hydrog ?    ? A  C   2381 N3    ? ? ? 1_555 A  G   2407 N1  ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2314 hydrog ?    ? A  C   2381 N4    ? ? ? 1_555 A  G   2407 O6  ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2315 hydrog ?    ? A  C   2381 O2    ? ? ? 1_555 A  G   2407 N2  ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2316 hydrog ?    ? A  A   2382 N1    ? ? ? 1_555 A  U   2406 N3  ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2317 hydrog ?    ? A  A   2382 N6    ? ? ? 1_555 A  U   2406 O4  ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2318 hydrog ?    ? A  G   2383 N1    ? ? ? 1_555 A  C   2405 N3  ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2319 hydrog ?    ? A  G   2383 N2    ? ? ? 1_555 A  C   2405 O2  ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2320 hydrog ?    ? A  G   2383 O6    ? ? ? 1_555 A  C   2405 N4  ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2321 hydrog ?    ? A  U   2384 N3    ? ? ? 1_555 A  G   2404 O6  ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2322 hydrog ?    ? A  U   2384 O2    ? ? ? 1_555 A  G   2404 N1  ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2323 hydrog ?    ? A  G   2385 N1    ? ? ? 1_555 A  C   2403 N3  ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2324 hydrog ?    ? A  G   2385 N2    ? ? ? 1_555 A  C   2403 O2  ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2325 hydrog ?    ? A  G   2385 O6    ? ? ? 1_555 A  C   2403 N4  ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2326 hydrog ?    ? A  U   2386 N3    ? ? ? 1_555 A  A   2402 N1  ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2327 hydrog ?    ? A  U   2386 O4    ? ? ? 1_555 A  A   2402 N6  ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2328 hydrog ?    ? A  U   2387 N3    ? ? ? 1_555 A  A   2401 N1  ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2329 hydrog ?    ? A  U   2387 O4    ? ? ? 1_555 A  A   2401 N6  ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2330 hydrog ?    ? A  C   2388 N3    ? ? ? 1_555 A  G   2400 N1  ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2331 hydrog ?    ? A  C   2388 N4    ? ? ? 1_555 A  G   2400 O6  ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2332 hydrog ?    ? A  C   2388 O2    ? ? ? 1_555 A  G   2400 N2  ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2333 hydrog ?    ? A  U   2389 N3    ? ? ? 1_555 A  G   2399 O6  ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2334 hydrog ?    ? A  U   2389 O2    ? ? ? 1_555 A  G   2399 N1  ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2335 hydrog ?    ? A  U   2390 O2    ? ? ? 1_555 A  A   2398 N6  ? ? 0 U   2390 0 A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2336 hydrog ?    ? A  C   2391 N4    ? ? ? 1_555 A  G   2397 N7  ? ? 0 C   2391 0 G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2337 hydrog ?    ? A  C   2409 N3    ? ? ? 1_555 A  G   2418 N1  ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2338 hydrog ?    ? A  C   2409 N4    ? ? ? 1_555 A  G   2418 O6  ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2339 hydrog ?    ? A  C   2409 O2    ? ? ? 1_555 A  G   2418 N2  ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2340 hydrog ?    ? A  G   2410 N1    ? ? ? 1_555 A  C   2417 N3  ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2341 hydrog ?    ? A  G   2410 N2    ? ? ? 1_555 A  C   2417 O2  ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2342 hydrog ?    ? A  G   2410 O6    ? ? ? 1_555 A  C   2417 N4  ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2343 hydrog ?    ? A  C   2411 N3    ? ? ? 1_555 A  G   2416 N1  ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2344 hydrog ?    ? A  C   2411 N4    ? ? ? 1_555 A  G   2416 O6  ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2345 hydrog ?    ? A  C   2411 O2    ? ? ? 1_555 A  G   2416 N2  ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2346 hydrog ?    ? A  G   2412 N2    ? ? ? 1_555 A  A   2415 N7  ? ? 0 G   2412 0 A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2347 hydrog ?    ? A  C   2427 N4    ? ? ? 1_555 A  G   2462 O6  ? ? 0 C   2427 0 G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2348 hydrog ?    ? A  G   2428 N2    ? ? ? 1_555 A  G   2466 N3  ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog2349 hydrog ?    ? A  G   2428 N3    ? ? ? 1_555 A  G   2466 N2  ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog2350 hydrog ?    ? A  A   2429 N6    ? ? ? 1_555 A  U   2461 O2  ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2351 hydrog ?    ? A  A   2429 N7    ? ? ? 1_555 A  U   2461 N3  ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2352 hydrog ?    ? A  A   2430 N6    ? ? ? 1_555 A  A   2460 N1  ? ? 0 A   2430 0 A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2353 hydrog ?    ? A  C   2432 N3    ? ? ? 1_555 A  G   2459 N1  ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2354 hydrog ?    ? A  C   2432 N4    ? ? ? 1_555 A  G   2459 O6  ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2355 hydrog ?    ? A  C   2432 O2    ? ? ? 1_555 A  G   2459 N2  ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2356 hydrog ?    ? A  A   2433 N1    ? ? ? 1_555 A  U   2458 N3  ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2357 hydrog ?    ? A  A   2433 N6    ? ? ? 1_555 A  U   2458 O4  ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2358 hydrog ?    ? A  A   2434 N1    ? ? ? 1_555 A  U   2457 N3  ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2359 hydrog ?    ? A  A   2434 N6    ? ? ? 1_555 A  U   2457 O4  ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2360 hydrog ?    ? A  U   2435 N3    ? ? ? 1_555 A  A   2456 N1  ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2361 hydrog ?    ? A  U   2435 O4    ? ? ? 1_555 A  A   2456 N6  ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2362 hydrog ?    ? A  U   2436 N3    ? ? ? 1_555 A  A   2455 N1  ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2363 hydrog ?    ? A  U   2436 O4    ? ? ? 1_555 A  A   2455 N6  ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2364 hydrog ?    ? A  G   2438 N1    ? ? ? 1_555 A  C   2454 N3  ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2365 hydrog ?    ? A  G   2438 N2    ? ? ? 1_555 A  C   2454 O2  ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2366 hydrog ?    ? A  G   2438 O6    ? ? ? 1_555 A  C   2454 N4  ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2367 hydrog ?    ? A  C   2439 N3    ? ? ? 1_555 A  G   2453 N1  ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2368 hydrog ?    ? A  C   2439 N4    ? ? ? 1_555 A  G   2453 O6  ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2369 hydrog ?    ? A  C   2439 O2    ? ? ? 1_555 A  G   2453 N2  ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2370 hydrog ?    ? A  C   2440 N3    ? ? ? 1_555 A  G   2452 N1  ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2371 hydrog ?    ? A  C   2440 N4    ? ? ? 1_555 A  G   2452 O6  ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2372 hydrog ?    ? A  C   2440 O2    ? ? ? 1_555 A  G   2452 N2  ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2373 hydrog ?    ? A  U   2441 N3    ? ? ? 1_555 A  G   2451 O6  ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2374 hydrog ?    ? A  U   2441 O2    ? ? ? 1_555 A  G   2451 N1  ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2375 hydrog ?    ? A  G   2442 N1    ? ? ? 1_555 A  C   2450 N3  ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2376 hydrog ?    ? A  G   2442 N2    ? ? ? 1_555 A  C   2450 O2  ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2377 hydrog ?    ? A  G   2442 O6    ? ? ? 1_555 A  C   2450 N4  ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2378 hydrog ?    ? A  G   2471 N2    ? ? ? 1_555 A  A   2633 N3  ? ? 0 G   2471 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2379 hydrog ?    ? A  U   2473 O2    ? ? ? 1_555 A  C   2475 N4  ? ? 0 U   2473 0 C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2380 hydrog ?    ? A  G   2482 O6    ? ? ? 1_555 A  A   2486 N6  ? ? 0 G   2482 0 A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2381 hydrog ?    ? A  A   2485 N6    ? ? ? 1_555 A  C   2536 N3  ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog2382 hydrog ?    ? A  A   2485 N7    ? ? ? 1_555 A  C   2536 N4  ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog2383 hydrog ?    ? A  G   2489 N1    ? ? ? 1_555 A  C   2533 N3  ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2384 hydrog ?    ? A  G   2489 N2    ? ? ? 1_555 A  C   2533 O2  ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2385 hydrog ?    ? A  G   2489 O6    ? ? ? 1_555 A  C   2533 N4  ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2386 hydrog ?    ? A  A   2490 N1    ? ? ? 1_555 A  U   2531 N3  ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2387 hydrog ?    ? A  A   2490 N6    ? ? ? 1_555 A  U   2531 O4  ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2388 hydrog ?    ? A  G   2491 N1    ? ? ? 1_555 A  C   2530 N3  ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2389 hydrog ?    ? A  G   2491 N2    ? ? ? 1_555 A  C   2530 O2  ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2390 hydrog ?    ? A  G   2491 O6    ? ? ? 1_555 A  C   2530 N4  ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2391 hydrog ?    ? A  U   2492 N3    ? ? ? 1_555 A  G   2529 O6  ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2392 hydrog ?    ? A  U   2492 O2    ? ? ? 1_555 A  G   2529 N1  ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2393 hydrog ?    ? A  G   2494 N1    ? ? ? 1_555 A  U   2528 O2  ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2394 hydrog ?    ? A  G   2494 O6    ? ? ? 1_555 A  U   2528 N3  ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2395 hydrog ?    ? A  U   2495 O4    ? ? ? 1_555 A  G   2525 N2  ? ? 0 U   2495 0 G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2396 hydrog ?    ? A  U   2495 N3    ? ? ? 1_555 A  U   2527 O4  ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2397 hydrog ?    ? A  U   2495 O2    ? ? ? 1_555 A  U   2527 N3  ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2398 hydrog ?    ? A  C   2496 N3    ? ? ? 1_555 A  G   2524 N1  ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2399 hydrog ?    ? A  C   2496 N4    ? ? ? 1_555 A  G   2524 O6  ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2400 hydrog ?    ? A  C   2496 O2    ? ? ? 1_555 A  G   2524 N2  ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2401 hydrog ?    ? A  A   2497 N1    ? ? ? 1_555 A  U   2523 N3  ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2402 hydrog ?    ? A  A   2497 N6    ? ? ? 1_555 A  U   2523 O4  ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2403 hydrog ?    ? A  C   2498 N3    ? ? ? 1_555 A  G   2522 N1  ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2404 hydrog ?    ? A  C   2498 N4    ? ? ? 1_555 A  G   2522 O6  ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2405 hydrog ?    ? A  C   2498 O2    ? ? ? 1_555 A  G   2522 N2  ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2406 hydrog ?    ? A  U   2499 N3    ? ? ? 1_555 A  A   2521 N1  ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2407 hydrog ?    ? A  U   2499 O4    ? ? ? 1_555 A  A   2521 N6  ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2408 hydrog ?    ? A  C   2500 N3    ? ? ? 1_555 A  G   2520 N1  ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2409 hydrog ?    ? A  C   2500 N4    ? ? ? 1_555 A  G   2520 O6  ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2410 hydrog ?    ? A  C   2500 O2    ? ? ? 1_555 A  G   2520 N2  ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2411 hydrog ?    ? A  G   2501 N1    ? ? ? 1_555 A  C   2519 N3  ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2412 hydrog ?    ? A  G   2501 N2    ? ? ? 1_555 A  C   2519 O2  ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2413 hydrog ?    ? A  G   2501 O6    ? ? ? 1_555 A  C   2519 N4  ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2414 hydrog ?    ? A  C   2502 O2    ? ? ? 1_555 A  C   2518 N4  ? ? 0 C   2502 0 C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2415 hydrog ?    ? A  A   2503 N3    ? ? ? 1_555 A  A   2517 N6  ? ? 0 A   2503 0 A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2416 hydrog ?    ? A  A   2504 N6    ? ? ? 1_555 A  G   2516 N3  ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2417 hydrog ?    ? A  A   2504 N7    ? ? ? 1_555 A  G   2516 N2  ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2418 hydrog ?    ? A  G   2505 N1    ? ? ? 1_555 A  C   2515 N3  ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2419 hydrog ?    ? A  G   2505 N2    ? ? ? 1_555 A  C   2515 O2  ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2420 hydrog ?    ? A  G   2505 O6    ? ? ? 1_555 A  C   2515 N4  ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2421 hydrog ?    ? A  A   2506 N1    ? ? ? 1_555 A  U   2514 N3  ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2422 hydrog ?    ? A  A   2506 N6    ? ? ? 1_555 A  U   2514 O4  ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2423 hydrog ?    ? A  G   2507 N2    ? ? ? 1_555 A  A   2513 N7  ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2424 hydrog ?    ? A  G   2507 N3    ? ? ? 1_555 A  A   2513 N6  ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2425 hydrog ?    ? A  C   2510 N3    ? ? ? 1_555 A  G   2564 N2  ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2426 hydrog ?    ? A  C   2510 O2    ? ? ? 1_555 A  G   2564 N1  ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog2427 hydrog ?    ? A  G   2525 N2    ? ? ? 1_555 A  U   2527 O4  ? ? 0 G   2525 0 U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2428 hydrog ?    ? A  A   2532 N3    ? ? ? 1_555 A  C   2533 N4  ? ? 0 A   2532 0 C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2429 hydrog ?    ? A  G   2540 N1    ? ? ? 1_555 A  U   2645 O2  ? ? 0 G   2540 0 U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2430 hydrog ?    ? A  U   2541 N3    ? ? ? 1_555 A  G   2618 O6  ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2431 hydrog ?    ? A  U   2541 O2    ? ? ? 1_555 A  G   2618 N1  ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2432 hydrog ?    ? A  C   2542 O2    ? ? ? 1_555 A  OMG 2588 N2  ? ? 0 C   2542 0 OMG 2588 1_555 ? ? ? ? ? ? 'C-OMG PAIR' ? 
? ? 
hydrog2433 hydrog ?    ? A  C   2542 N3    ? ? ? 1_555 A  G   2617 N1  ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2434 hydrog ?    ? A  C   2542 N4    ? ? ? 1_555 A  G   2617 O6  ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2435 hydrog ?    ? A  C   2542 O2    ? ? ? 1_555 A  G   2617 N2  ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2436 hydrog ?    ? A  G   2543 N1    ? ? ? 1_555 A  U   2615 O2  ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2437 hydrog ?    ? A  G   2543 O6    ? ? ? 1_555 A  U   2615 N3  ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2438 hydrog ?    ? A  G   2544 N1    ? ? ? 1_555 A  C   2614 N3  ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2439 hydrog ?    ? A  G   2544 N2    ? ? ? 1_555 A  C   2614 O2  ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2440 hydrog ?    ? A  G   2544 O6    ? ? ? 1_555 A  C   2614 N4  ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2441 hydrog ?    ? A  U   2545 N3    ? ? ? 1_555 A  G   2613 O6  ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2442 hydrog ?    ? A  U   2545 O2    ? ? ? 1_555 A  G   2613 N1  ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2443 hydrog ?    ? A  U   2546 N3    ? ? ? 1_555 A  U   2610 O2  ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2444 hydrog ?    ? A  U   2546 O4    ? ? ? 1_555 A  U   2610 N3  ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2445 hydrog ?    ? A  C   2547 N3    ? ? ? 1_555 A  G   2609 N1  ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2446 hydrog ?    ? A  C   2547 N4    ? ? ? 1_555 A  G   2609 O6  ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2447 hydrog ?    ? A  C   2547 O2    ? ? ? 1_555 A  G   2609 N2  ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2448 hydrog ?    ? A  C   2548 N3    ? ? ? 1_555 A  G   2606 N1  ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2449 hydrog ?    ? A  C   2548 N4    ? ? ? 1_555 A  G   2606 O6  ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2450 hydrog ?    ? A  C   2548 O2    ? ? ? 1_555 A  G   2606 N2  ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2451 hydrog ?    ? A  C   2549 N3    ? ? ? 1_555 A  G   2605 N1  ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2452 hydrog ?    ? A  C   2549 N4    ? ? ? 1_555 A  G   2605 O6  ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2453 hydrog ?    ? A  C   2549 O2    ? ? ? 1_555 A  G   2605 N2  ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2454 hydrog ?    ? A  U   2550 N3    ? ? ? 1_555 A  A   2604 N1  ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2455 hydrog ?    ? A  U   2550 O4    ? ? ? 1_555 A  A   2604 N6  ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2456 hydrog ?    ? A  C   2551 N3    ? ? ? 1_555 A  G   2603 N1  ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2457 hydrog ?    ? A  C   2551 N4    ? ? ? 1_555 A  G   2603 O6  ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2458 hydrog ?    ? A  C   2551 O2    ? ? ? 1_555 A  G   2603 N2  ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2459 hydrog ?    ? A  C   2552 N3    ? ? ? 1_555 A  G   2602 N1  ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2460 hydrog ?    ? A  C   2552 N4    ? ? ? 1_555 A  G   2602 O6  ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2461 hydrog ?    ? A  C   2552 O2    ? ? ? 1_555 A  G   2602 N2  ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2462 hydrog ?    ? A  U   2554 O2    ? ? ? 1_555 A  C   2556 N4  ? ? 0 U   2554 0 C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2463 hydrog ?    ? A  C   2555 N4    ? ? ? 1_555 A  A   2577 N1  ? ? 0 C   2555 0 A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2464 hydrog ?    ? A  C   2555 N3    ? ? ? 1_555 A  G   2580 N1  ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2465 hydrog ?    ? A  C   2555 N4    ? ? ? 1_555 A  G   2580 O6  ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2466 hydrog ?    ? A  C   2555 O2    ? ? ? 1_555 A  G   2580 N2  ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2467 hydrog ?    ? A  C   2556 N3    ? ? ? 1_555 A  G   2579 N1  ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2468 hydrog ?    ? A  C   2556 N4    ? ? ? 1_555 A  G   2579 O6  ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2469 hydrog ?    ? A  C   2556 O2    ? ? ? 1_555 A  G   2579 N2  ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2470 hydrog ?    ? A  U   2557 N3    ? ? ? 1_555 A  G   2578 O6  ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2471 hydrog ?    ? A  U   2557 O2    ? ? ? 1_555 A  G   2578 N1  ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2472 hydrog ?    ? A  G   2558 N1    ? ? ? 1_555 A  C   2575 N3  ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2473 hydrog ?    ? A  G   2558 N2    ? ? ? 1_555 A  C   2575 O2  ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2474 hydrog ?    ? A  G   2558 O6    ? ? ? 1_555 A  C   2575 N4  ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2475 hydrog ?    ? A  C   2559 N3    ? ? ? 1_555 A  G   2574 N1  ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2476 hydrog ?    ? A  C   2559 N4    ? ? ? 1_555 A  G   2574 O6  ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2477 hydrog ?    ? A  C   2559 O2    ? ? ? 1_555 A  G   2574 N2  ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2478 hydrog ?    ? A  C   2560 N3    ? ? ? 1_555 A  G   2573 N1  ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2479 hydrog ?    ? A  C   2560 N4    ? ? ? 1_555 A  G   2573 O6  ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2480 hydrog ?    ? A  C   2560 O2    ? ? ? 1_555 A  G   2573 N2  ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2481 hydrog ?    ? A  C   2561 N3    ? ? ? 1_555 A  G   2572 N1  ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2482 hydrog ?    ? A  C   2561 N4    ? ? ? 1_555 A  G   2572 O6  ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2483 hydrog ?    ? A  C   2561 O2    ? ? ? 1_555 A  G   2572 N2  ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2484 hydrog ?    ? A  G   2562 N1    ? ? ? 1_555 A  C   2571 N3  ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2485 hydrog ?    ? A  G   2562 N2    ? ? ? 1_555 A  C   2571 O2  ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2486 hydrog ?    ? A  G   2562 O6    ? ? ? 1_555 A  C   2571 N4  ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2487 hydrog ?    ? A  U   2563 N3    ? ? ? 1_555 A  G   2570 O6  ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2488 hydrog ?    ? A  U   2563 O2    ? ? ? 1_555 A  G   2570 N1  ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2489 hydrog ?    ? A  A   2566 N1    ? ? ? 1_555 A  A   2699 N6  ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog2490 hydrog ?    ? A  A   2566 N6    ? ? ? 1_555 A  A   2699 N1  ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
? 
hydrog2491 hydrog ?    ? A  G   2567 N2    ? ? ? 1_555 A  G   2700 N3  ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog2492 hydrog ?    ? A  G   2567 N3    ? ? ? 1_555 A  G   2700 N2  ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
? 
hydrog2493 hydrog ?    ? A  G   2574 N2    ? ? ? 1_555 A  A   2776 N3  ? ? 0 G   2574 0 A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2494 hydrog ?    ? A  A   2576 N3    ? ? ? 1_555 A  A   2800 N6  ? ? 0 A   2576 0 A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2495 hydrog ?    ? A  G   2580 N2    ? ? ? 1_555 A  A   2600 N3  ? ? 0 G   2580 0 A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2496 hydrog ?    ? A  U   2581 N3    ? ? ? 1_555 A  G   2602 N7  ? ? 0 U   2581 0 G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2497 hydrog ?    ? A  G   2582 N1    ? ? ? 1_555 A  A   2596 N1  ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2498 hydrog ?    ? A  G   2582 O6    ? ? ? 1_555 A  A   2596 N6  ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2499 hydrog ?    ? A  A   2583 N1    ? ? ? 1_555 A  U   2595 N3  ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2500 hydrog ?    ? A  A   2583 N6    ? ? ? 1_555 A  U   2595 O4  ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2501 hydrog ?    ? A  G   2584 N1    ? ? ? 1_555 A  C   2594 N3  ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2502 hydrog ?    ? A  G   2584 N2    ? ? ? 1_555 A  C   2594 O2  ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2503 hydrog ?    ? A  G   2584 O6    ? ? ? 1_555 A  C   2594 N4  ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2504 hydrog ?    ? A  G   2585 N1    ? ? ? 1_555 A  C   2593 N3  ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2505 hydrog ?    ? A  G   2585 N2    ? ? ? 1_555 A  C   2593 O2  ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2506 hydrog ?    ? A  G   2585 O6    ? ? ? 1_555 A  C   2593 N4  ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2507 hydrog ?    ? A  U   2586 O4    ? ? ? 1_555 A  G   2592 N1  ? ? 0 U   2586 0 G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? ? 
hydrog2508 hydrog ?    ? A  OMU 2587 O2    ? ? ? 1_555 A  C   2591 N4  ? ? 0 OMU 2587 0 C   2591 1_555 ? ? ? ? ? ? 'OMU-C MISPAIR' 
?     ? ? 
hydrog2509 hydrog ?    ? A  U   2597 N3    ? ? ? 1_555 A  A   2601 N7  ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2510 hydrog ?    ? A  U   2597 O2    ? ? ? 1_555 A  A   2601 N6  ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2511 hydrog ?    ? A  A   2622 N6    ? ? ? 1_555 A  G   2643 N3  ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2512 hydrog ?    ? A  A   2622 N7    ? ? ? 1_555 A  G   2643 N2  ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2513 hydrog ?    ? A  G   2623 N1    ? ? ? 1_555 A  C   2641 N3  ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2514 hydrog ?    ? A  G   2623 N2    ? ? ? 1_555 A  C   2641 O2  ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2515 hydrog ?    ? A  G   2623 O6    ? ? ? 1_555 A  C   2641 N4  ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2516 hydrog ?    ? A  A   2624 N1    ? ? ? 1_555 A  U   2640 N3  ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2517 hydrog ?    ? A  A   2624 N6    ? ? ? 1_555 A  U   2640 O4  ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2518 hydrog ?    ? A  C   2625 N3    ? ? ? 1_555 A  G   2639 N1  ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2519 hydrog ?    ? A  C   2625 N4    ? ? ? 1_555 A  G   2639 O6  ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2520 hydrog ?    ? A  C   2625 O2    ? ? ? 1_555 A  G   2639 N2  ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2521 hydrog ?    ? A  C   2626 N3    ? ? ? 1_555 A  G   2638 N1  ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2522 hydrog ?    ? A  C   2626 N4    ? ? ? 1_555 A  G   2638 O6  ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2523 hydrog ?    ? A  C   2626 O2    ? ? ? 1_555 A  G   2638 N2  ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2524 hydrog ?    ? A  G   2627 N1    ? ? ? 1_555 A  C   2636 N3  ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2525 hydrog ?    ? A  G   2627 N2    ? ? ? 1_555 A  C   2636 O2  ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2526 hydrog ?    ? A  G   2627 O6    ? ? ? 1_555 A  C   2636 N4  ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2527 hydrog ?    ? A  U   2628 N3    ? ? ? 1_555 A  A   2635 N1  ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2528 hydrog ?    ? A  U   2628 O4    ? ? ? 1_555 A  A   2635 N6  ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2529 hydrog ?    ? A  C   2629 N3    ? ? ? 1_555 A  G   2634 N1  ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2530 hydrog ?    ? A  C   2629 N4    ? ? ? 1_555 A  G   2634 O6  ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2531 hydrog ?    ? A  C   2629 O2    ? ? ? 1_555 A  G   2634 N2  ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2532 hydrog ?    ? A  G   2630 N2    ? ? ? 1_555 A  A   2633 N7  ? ? 0 G   2630 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2533 hydrog ?    ? A  A   2649 N3    ? ? ? 1_555 A  C   2651 N4  ? ? 0 A   2649 0 C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2534 hydrog ?    ? A  G   2657 N2    ? ? ? 1_555 A  A   2841 N1  ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog2535 hydrog ?    ? A  G   2657 N3    ? ? ? 1_555 A  A   2841 N6  ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? 
? ? 
hydrog2536 hydrog ?    ? A  U   2661 O2    ? ? ? 1_555 A  A   2812 N6  ? ? 0 U   2661 0 A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2537 hydrog ?    ? A  G   2662 N2    ? ? ? 1_555 A  A   2816 N3  ? ? 0 G   2662 0 A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2538 hydrog ?    ? A  G   2667 N1    ? ? ? 1_555 A  C   2822 N3  ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2539 hydrog ?    ? A  G   2667 N2    ? ? ? 1_555 A  C   2822 O2  ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2540 hydrog ?    ? A  G   2667 O6    ? ? ? 1_555 A  C   2822 N4  ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2541 hydrog ?    ? A  G   2667 N2    ? ? ? 1_555 A  A   2827 N3  ? ? 0 G   2667 0 A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2542 hydrog ?    ? A  G   2668 N1    ? ? ? 1_555 A  C   2821 N3  ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2543 hydrog ?    ? A  G   2668 N2    ? ? ? 1_555 A  C   2821 O2  ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2544 hydrog ?    ? A  G   2668 O6    ? ? ? 1_555 A  C   2821 N4  ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2545 hydrog ?    ? A  U   2669 N3    ? ? ? 1_555 A  A   2820 N1  ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2546 hydrog ?    ? A  U   2669 O4    ? ? ? 1_555 A  A   2820 N6  ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2547 hydrog ?    ? A  G   2670 N1    ? ? ? 1_555 A  C   2819 N3  ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2548 hydrog ?    ? A  G   2670 N2    ? ? ? 1_555 A  C   2819 O2  ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2549 hydrog ?    ? A  G   2670 O6    ? ? ? 1_555 A  C   2819 N4  ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2550 hydrog ?    ? A  U   2671 N3    ? ? ? 1_555 A  A   2818 N1  ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2551 hydrog ?    ? A  U   2671 O4    ? ? ? 1_555 A  A   2818 N6  ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2552 hydrog ?    ? A  C   2672 N3    ? ? ? 1_555 A  G   2817 N1  ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2553 hydrog ?    ? A  C   2672 N4    ? ? ? 1_555 A  G   2817 O6  ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2554 hydrog ?    ? A  C   2672 O2    ? ? ? 1_555 A  G   2817 N2  ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2555 hydrog ?    ? A  U   2673 N3    ? ? ? 1_555 A  A   2811 N7  ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2556 hydrog ?    ? A  U   2673 O2    ? ? ? 1_555 A  A   2811 N6  ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2557 hydrog ?    ? A  G   2674 N2    ? ? ? 1_555 A  A   2813 N7  ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2558 hydrog ?    ? A  G   2674 N3    ? ? ? 1_555 A  A   2813 N6  ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2559 hydrog ?    ? A  A   2675 N6    ? ? ? 1_555 A  G   2810 N3  ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2560 hydrog ?    ? A  A   2675 N7    ? ? ? 1_555 A  G   2810 N2  ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2561 hydrog ?    ? A  C   2676 N3    ? ? ? 1_555 A  G   2809 N1  ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2562 hydrog ?    ? A  C   2676 N4    ? ? ? 1_555 A  G   2809 O6  ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2563 hydrog ?    ? A  C   2676 O2    ? ? ? 1_555 A  G   2809 N2  ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2564 hydrog ?    ? A  A   2677 N1    ? ? ? 1_555 A  U   2808 N3  ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2565 hydrog ?    ? A  A   2677 N6    ? ? ? 1_555 A  U   2808 O4  ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2566 hydrog ?    ? A  A   2678 N1    ? ? ? 1_555 A  U   2807 N3  ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2567 hydrog ?    ? A  A   2678 N6    ? ? ? 1_555 A  U   2807 O4  ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2568 hydrog ?    ? A  G   2679 N1    ? ? ? 1_555 A  C   2806 N3  ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2569 hydrog ?    ? A  G   2679 N2    ? ? ? 1_555 A  C   2806 O2  ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2570 hydrog ?    ? A  G   2679 O6    ? ? ? 1_555 A  C   2806 N4  ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2571 hydrog ?    ? A  A   2680 N1    ? ? ? 1_555 A  G   2712 N2  ? ? 0 A   2680 0 G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2572 hydrog ?    ? A  A   2681 N3    ? ? ? 1_555 A  G   2713 N2  ? ? 0 A   2681 0 G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2573 hydrog ?    ? A  C   2682 N3    ? ? ? 1_555 A  G   2712 N1  ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2574 hydrog ?    ? A  C   2682 N4    ? ? ? 1_555 A  G   2712 O6  ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2575 hydrog ?    ? A  C   2682 O2    ? ? ? 1_555 A  G   2712 N2  ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2576 hydrog ?    ? A  G   2683 N1    ? ? ? 1_555 A  U   2711 O2  ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2577 hydrog ?    ? A  G   2683 O6    ? ? ? 1_555 A  U   2711 N3  ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2578 hydrog ?    ? A  A   2684 N1    ? ? ? 1_555 A  U   2710 N3  ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2579 hydrog ?    ? A  A   2684 N6    ? ? ? 1_555 A  U   2710 O4  ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2580 hydrog ?    ? A  C   2685 N3    ? ? ? 1_555 A  G   2709 N1  ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2581 hydrog ?    ? A  C   2685 N4    ? ? ? 1_555 A  G   2709 O6  ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2582 hydrog ?    ? A  C   2685 O2    ? ? ? 1_555 A  G   2709 N2  ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2583 hydrog ?    ? A  C   2686 N3    ? ? ? 1_555 A  G   2708 N1  ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2584 hydrog ?    ? A  C   2686 N4    ? ? ? 1_555 A  G   2708 O6  ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2585 hydrog ?    ? A  C   2686 O2    ? ? ? 1_555 A  G   2708 N2  ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2586 hydrog ?    ? A  G   2687 N1    ? ? ? 1_555 A  C   2707 N3  ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2587 hydrog ?    ? A  G   2687 N2    ? ? ? 1_555 A  C   2707 O2  ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2588 hydrog ?    ? A  G   2687 O6    ? ? ? 1_555 A  C   2707 N4  ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2589 hydrog ?    ? A  U   2688 N3    ? ? ? 1_555 A  A   2706 N1  ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2590 hydrog ?    ? A  U   2688 O4    ? ? ? 1_555 A  A   2706 N6  ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2591 hydrog ?    ? A  A   2689 N1    ? ? ? 1_555 A  U   2705 N3  ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2592 hydrog ?    ? A  A   2689 N6    ? ? ? 1_555 A  U   2705 O4  ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2593 hydrog ?    ? A  U   2690 O2    ? ? ? 1_555 A  C   2704 N4  ? ? 0 U   2690 0 C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2594 hydrog ?    ? A  A   2691 N6    ? ? ? 1_555 A  A   2703 N7  ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2595 hydrog ?    ? A  A   2691 N7    ? ? ? 1_555 A  A   2703 N6  ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2596 hydrog ?    ? A  G   2692 N2    ? ? ? 1_555 A  U   2693 O4  ? ? 0 G   2692 0 U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2597 hydrog ?    ? A  U   2693 N3    ? ? ? 1_555 A  A   2702 N7  ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2598 hydrog ?    ? A  U   2693 O2    ? ? ? 1_555 A  A   2702 N6  ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2599 hydrog ?    ? A  A   2694 N6    ? ? ? 1_555 A  G   2701 N3  ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2600 hydrog ?    ? A  A   2694 N7    ? ? ? 1_555 A  G   2701 N2  ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2601 hydrog ?    ? A  C   2695 N3    ? ? ? 1_555 A  G   2700 N1  ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2602 hydrog ?    ? A  C   2695 N4    ? ? ? 1_555 A  G   2700 O6  ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2603 hydrog ?    ? A  C   2695 O2    ? ? ? 1_555 A  G   2700 N2  ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2604 hydrog ?    ? A  G   2696 N2    ? ? ? 1_555 A  A   2699 N7  ? ? 0 G   2696 0 A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2605 hydrog ?    ? A  G   2713 N1    ? ? ? 1_555 A  C   2767 N3  ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2606 hydrog ?    ? A  G   2713 N2    ? ? ? 1_555 A  C   2767 O2  ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2607 hydrog ?    ? A  G   2713 O6    ? ? ? 1_555 A  C   2767 N4  ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2608 hydrog ?    ? A  U   2714 N3    ? ? ? 1_555 A  A   2766 N1  ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2609 hydrog ?    ? A  U   2714 O4    ? ? ? 1_555 A  A   2766 N6  ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2610 hydrog ?    ? A  G   2715 N1    ? ? ? 1_555 A  C   2765 N3  ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2611 hydrog ?    ? A  G   2715 N2    ? ? ? 1_555 A  C   2765 O2  ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2612 hydrog ?    ? A  G   2715 O6    ? ? ? 1_555 A  C   2765 N4  ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2613 hydrog ?    ? A  G   2716 N1    ? ? ? 1_555 A  C   2764 N3  ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2614 hydrog ?    ? A  G   2716 N2    ? ? ? 1_555 A  C   2764 O2  ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2615 hydrog ?    ? A  G   2716 O6    ? ? ? 1_555 A  C   2764 N4  ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2616 hydrog ?    ? A  C   2717 N3    ? ? ? 1_555 A  G   2763 N1  ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2617 hydrog ?    ? A  C   2717 N4    ? ? ? 1_555 A  G   2763 O6  ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2618 hydrog ?    ? A  C   2717 O2    ? ? ? 1_555 A  G   2763 N2  ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2619 hydrog ?    ? A  C   2718 N3    ? ? ? 1_555 A  A   2761 N6  ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog2620 hydrog ?    ? A  C   2718 N4    ? ? ? 1_555 A  A   2761 N7  ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? 
? ? 
hydrog2621 hydrog ?    ? A  C   2720 N4    ? ? ? 1_555 A  G   2763 N3  ? ? 0 C   2720 0 G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2622 hydrog ?    ? A  U   2721 N3    ? ? ? 1_555 A  A   2761 N1  ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2623 hydrog ?    ? A  U   2721 O4    ? ? ? 1_555 A  A   2761 N6  ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2624 hydrog ?    ? A  G   2722 N1    ? ? ? 1_555 A  C   2760 N3  ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2625 hydrog ?    ? A  G   2722 N2    ? ? ? 1_555 A  C   2760 O2  ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2626 hydrog ?    ? A  G   2722 O6    ? ? ? 1_555 A  C   2760 N4  ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2627 hydrog ?    ? A  G   2723 N1    ? ? ? 1_555 A  C   2759 N3  ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2628 hydrog ?    ? A  G   2723 N2    ? ? ? 1_555 A  C   2759 O2  ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2629 hydrog ?    ? A  G   2723 O6    ? ? ? 1_555 A  C   2759 N4  ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2630 hydrog ?    ? A  U   2724 N3    ? ? ? 1_555 A  G   2758 O6  ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2631 hydrog ?    ? A  U   2724 O2    ? ? ? 1_555 A  G   2758 N1  ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2632 hydrog ?    ? A  G   2725 N2    ? ? ? 1_555 A  A   2757 N7  ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2633 hydrog ?    ? A  G   2725 N3    ? ? ? 1_555 A  A   2757 N6  ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2634 hydrog ?    ? A  A   2727 N7    ? ? ? 1_555 A  G   2755 N2  ? ? 0 A   2727 0 G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2635 hydrog ?    ? A  C   2728 N3    ? ? ? 1_555 A  G   2754 N1  ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2636 hydrog ?    ? A  C   2728 N4    ? ? ? 1_555 A  G   2754 O6  ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2637 hydrog ?    ? A  C   2728 O2    ? ? ? 1_555 A  G   2754 N2  ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2638 hydrog ?    ? A  C   2729 N3    ? ? ? 1_555 A  G   2753 N1  ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2639 hydrog ?    ? A  C   2729 N4    ? ? ? 1_555 A  G   2753 O6  ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2640 hydrog ?    ? A  C   2729 O2    ? ? ? 1_555 A  G   2753 N2  ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2641 hydrog ?    ? A  G   2730 N1    ? ? ? 1_555 A  C   2752 N3  ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2642 hydrog ?    ? A  G   2730 N2    ? ? ? 1_555 A  C   2752 O2  ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2643 hydrog ?    ? A  G   2730 O6    ? ? ? 1_555 A  C   2752 N4  ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2644 hydrog ?    ? A  G   2731 N1    ? ? ? 1_555 A  C   2751 N3  ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2645 hydrog ?    ? A  G   2731 N2    ? ? ? 1_555 A  C   2751 O2  ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2646 hydrog ?    ? A  G   2731 O6    ? ? ? 1_555 A  C   2751 N4  ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2647 hydrog ?    ? A  U   2732 N3    ? ? ? 1_555 A  G   2750 O6  ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2648 hydrog ?    ? A  U   2732 O2    ? ? ? 1_555 A  G   2750 N1  ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2649 hydrog ?    ? A  U   2733 N3    ? ? ? 1_555 A  A   2746 N1  ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2650 hydrog ?    ? A  U   2733 O4    ? ? ? 1_555 A  A   2746 N6  ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2651 hydrog ?    ? A  G   2734 N1    ? ? ? 1_555 A  C   2745 N3  ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2652 hydrog ?    ? A  G   2734 N2    ? ? ? 1_555 A  C   2745 O2  ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2653 hydrog ?    ? A  G   2734 O6    ? ? ? 1_555 A  C   2745 N4  ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2654 hydrog ?    ? A  U   2735 N3    ? ? ? 1_555 A  G   2744 O6  ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2655 hydrog ?    ? A  U   2735 O2    ? ? ? 1_555 A  G   2744 N1  ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2656 hydrog ?    ? A  U   2736 N3    ? ? ? 1_555 A  A   2743 N1  ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2657 hydrog ?    ? A  U   2736 O4    ? ? ? 1_555 A  A   2743 N6  ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2658 hydrog ?    ? A  C   2737 N3    ? ? ? 1_555 A  G   2742 N1  ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2659 hydrog ?    ? A  C   2737 N4    ? ? ? 1_555 A  G   2742 O6  ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2660 hydrog ?    ? A  C   2737 O2    ? ? ? 1_555 A  G   2742 N2  ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2661 hydrog ?    ? A  U   2756 N3    ? ? ? 1_555 A  A   2896 N1  ? ? 0 U   2756 0 A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2662 hydrog ?    ? A  C   2769 N4    ? ? ? 1_555 A  A   2805 N3  ? ? 0 C   2769 0 A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2663 hydrog ?    ? A  G   2770 N1    ? ? ? 1_555 A  C   2804 N3  ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2664 hydrog ?    ? A  G   2770 N2    ? ? ? 1_555 A  C   2804 O2  ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2665 hydrog ?    ? A  G   2770 O6    ? ? ? 1_555 A  C   2804 N4  ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2666 hydrog ?    ? A  G   2771 N1    ? ? ? 1_555 A  C   2803 N3  ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2667 hydrog ?    ? A  G   2771 N2    ? ? ? 1_555 A  C   2803 O2  ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2668 hydrog ?    ? A  G   2771 O6    ? ? ? 1_555 A  C   2803 N4  ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2669 hydrog ?    ? A  G   2772 N1    ? ? ? 1_555 A  C   2802 N3  ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2670 hydrog ?    ? A  G   2772 N2    ? ? ? 1_555 A  C   2802 O2  ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2671 hydrog ?    ? A  G   2772 O6    ? ? ? 1_555 A  C   2802 N4  ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2672 hydrog ?    ? A  G   2773 N1    ? ? ? 1_555 A  A   2801 N1  ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2673 hydrog ?    ? A  G   2773 O6    ? ? ? 1_555 A  A   2801 N6  ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
? 
hydrog2674 hydrog ?    ? A  U   2774 N3    ? ? ? 1_555 A  A   2799 N7  ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2675 hydrog ?    ? A  U   2774 O2    ? ? ? 1_555 A  A   2799 N6  ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2676 hydrog ?    ? A  A   2776 N6    ? ? ? 1_555 A  G   2798 N3  ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2677 hydrog ?    ? A  A   2776 N7    ? ? ? 1_555 A  G   2798 N2  ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2678 hydrog ?    ? A  G   2777 N1    ? ? ? 1_555 A  C   2797 N3  ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2679 hydrog ?    ? A  G   2777 N2    ? ? ? 1_555 A  C   2797 O2  ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2680 hydrog ?    ? A  G   2777 O6    ? ? ? 1_555 A  C   2797 N4  ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2681 hydrog ?    ? A  A   2778 N1    ? ? ? 1_555 A  U   2796 N3  ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2682 hydrog ?    ? A  A   2778 N6    ? ? ? 1_555 A  U   2796 O4  ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2683 hydrog ?    ? A  G   2779 N1    ? ? ? 1_555 A  C   2795 N3  ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2684 hydrog ?    ? A  G   2779 N2    ? ? ? 1_555 A  C   2795 O2  ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2685 hydrog ?    ? A  G   2779 O6    ? ? ? 1_555 A  C   2795 N4  ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2686 hydrog ?    ? A  C   2780 N3    ? ? ? 1_555 A  G   2794 N1  ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2687 hydrog ?    ? A  C   2780 N4    ? ? ? 1_555 A  G   2794 O6  ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2688 hydrog ?    ? A  C   2780 O2    ? ? ? 1_555 A  G   2794 N2  ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2689 hydrog ?    ? A  U   2781 N3    ? ? ? 1_555 A  U   2791 O4  ? ? 0 U   2781 0 U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? ? 
hydrog2690 hydrog ?    ? A  U   2781 O2    ? ? ? 1_555 A  A   2793 N6  ? ? 0 U   2781 0 A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2691 hydrog ?    ? A  G   2782 N2    ? ? ? 1_555 A  A   2792 N7  ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2692 hydrog ?    ? A  G   2782 N3    ? ? ? 1_555 A  A   2792 N6  ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2693 hydrog ?    ? A  A   2783 N6    ? ? ? 1_555 A  U   2789 O2  ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2694 hydrog ?    ? A  A   2783 N7    ? ? ? 1_555 A  U   2789 N3  ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2695 hydrog ?    ? A  A   2784 N6    ? ? ? 1_555 A  A   2788 N1  ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog2696 hydrog ?    ? A  A   2784 N7    ? ? ? 1_555 A  A   2788 N6  ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
? 
hydrog2697 hydrog ?    ? A  C   2785 O2    ? ? ? 1_555 A  C   2787 N4  ? ? 0 C   2785 0 C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2698 hydrog ?    ? A  U   2791 N3    ? ? ? 1_555 A  A   2793 N7  ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2699 hydrog ?    ? A  U   2791 O4    ? ? ? 1_555 A  A   2793 N6  ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? ? 
hydrog2700 hydrog ?    ? A  A   2812 N1    ? ? ? 1_555 A  A   2814 N6  ? ? 0 A   2812 0 A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2701 hydrog ?    ? A  G   2823 N2    ? ? ? 1_555 A  A   2914 N3  ? ? 0 G   2823 0 A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2702 hydrog ?    ? A  G   2826 N2    ? ? ? 1_555 A  A   2914 N7  ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2703 hydrog ?    ? A  G   2826 N3    ? ? ? 1_555 A  A   2914 N6  ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2704 hydrog ?    ? A  A   2827 N6    ? ? ? 1_555 A  A   2913 N3  ? ? 0 A   2827 0 A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2705 hydrog ?    ? A  G   2828 N1    ? ? ? 1_555 A  C   2912 N3  ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2706 hydrog ?    ? A  G   2828 N2    ? ? ? 1_555 A  C   2912 O2  ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2707 hydrog ?    ? A  G   2828 O6    ? ? ? 1_555 A  C   2912 N4  ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2708 hydrog ?    ? A  G   2829 N1    ? ? ? 1_555 A  C   2911 N3  ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2709 hydrog ?    ? A  G   2829 N2    ? ? ? 1_555 A  C   2911 O2  ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2710 hydrog ?    ? A  G   2829 O6    ? ? ? 1_555 A  C   2911 N4  ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2711 hydrog ?    ? A  U   2830 N3    ? ? ? 1_555 A  A   2910 N1  ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2712 hydrog ?    ? A  U   2830 O4    ? ? ? 1_555 A  A   2910 N6  ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2713 hydrog ?    ? A  C   2831 O2    ? ? ? 1_555 A  G   2909 N2  ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2714 hydrog ?    ? A  C   2832 N3    ? ? ? 1_555 A  G   2848 N1  ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2715 hydrog ?    ? A  C   2832 N4    ? ? ? 1_555 A  G   2848 O6  ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2716 hydrog ?    ? A  C   2832 O2    ? ? ? 1_555 A  G   2848 N2  ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2717 hydrog ?    ? A  C   2832 O2    ? ? ? 1_555 A  A   2908 N6  ? ? 0 C   2832 0 A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2718 hydrog ?    ? A  C   2833 N3    ? ? ? 1_555 A  G   2847 N1  ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2719 hydrog ?    ? A  C   2833 N4    ? ? ? 1_555 A  G   2847 O6  ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2720 hydrog ?    ? A  C   2833 O2    ? ? ? 1_555 A  G   2847 N2  ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2721 hydrog ?    ? A  G   2834 N1    ? ? ? 1_555 A  C   2846 N3  ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2722 hydrog ?    ? A  G   2834 N2    ? ? ? 1_555 A  C   2846 O2  ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2723 hydrog ?    ? A  G   2834 O6    ? ? ? 1_555 A  C   2846 N4  ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2724 hydrog ?    ? A  C   2835 N3    ? ? ? 1_555 A  G   2845 N1  ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2725 hydrog ?    ? A  C   2835 N4    ? ? ? 1_555 A  G   2845 O6  ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2726 hydrog ?    ? A  C   2835 O2    ? ? ? 1_555 A  G   2845 N2  ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2727 hydrog ?    ? A  G   2836 N1    ? ? ? 1_555 A  C   2844 N3  ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2728 hydrog ?    ? A  G   2836 N2    ? ? ? 1_555 A  C   2844 O2  ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2729 hydrog ?    ? A  G   2836 O6    ? ? ? 1_555 A  C   2844 N4  ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2730 hydrog ?    ? A  A   2838 N3    ? ? ? 1_555 A  A   2843 N6  ? ? 0 A   2838 0 A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2731 hydrog ?    ? A  G   2847 N2    ? ? ? 1_555 A  A   2906 N3  ? ? 0 G   2847 0 A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2732 hydrog ?    ? A  G   2851 N2    ? ? ? 1_555 A  A   2906 N7  ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2733 hydrog ?    ? A  G   2851 N3    ? ? ? 1_555 A  A   2906 N6  ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2734 hydrog ?    ? A  A   2852 N1    ? ? ? 1_555 A  C   2903 N4  ? ? 0 A   2852 0 C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2735 hydrog ?    ? A  U   2853 O4    ? ? ? 1_555 A  A   2902 N6  ? ? 0 U   2853 0 A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2736 hydrog ?    ? A  U   2853 N3    ? ? ? 1_555 A  A   2905 N1  ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2737 hydrog ?    ? A  U   2853 O4    ? ? ? 1_555 A  A   2905 N6  ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2738 hydrog ?    ? A  A   2854 N1    ? ? ? 1_555 A  U   2904 N3  ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2739 hydrog ?    ? A  A   2854 N6    ? ? ? 1_555 A  U   2904 O4  ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2740 hydrog ?    ? A  G   2855 N1    ? ? ? 1_555 A  C   2903 N3  ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2741 hydrog ?    ? A  G   2855 N2    ? ? ? 1_555 A  C   2903 O2  ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2742 hydrog ?    ? A  G   2855 O6    ? ? ? 1_555 A  C   2903 N4  ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2743 hydrog ?    ? A  A   2856 N6    ? ? ? 1_555 A  C   2901 O2  ? ? 0 A   2856 0 C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2744 hydrog ?    ? A  C   2857 N3    ? ? ? 1_555 A  G   2900 N1  ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2745 hydrog ?    ? A  C   2857 N4    ? ? ? 1_555 A  G   2900 O6  ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2746 hydrog ?    ? A  C   2857 O2    ? ? ? 1_555 A  G   2900 N2  ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2747 hydrog ?    ? A  U   2858 N3    ? ? ? 1_555 A  A   2899 N1  ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2748 hydrog ?    ? A  U   2858 O4    ? ? ? 1_555 A  A   2899 N6  ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2749 hydrog ?    ? A  C   2859 N3    ? ? ? 1_555 A  G   2898 N1  ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2750 hydrog ?    ? A  C   2859 N4    ? ? ? 1_555 A  G   2898 O6  ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2751 hydrog ?    ? A  C   2859 O2    ? ? ? 1_555 A  G   2898 N2  ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2752 hydrog ?    ? A  G   2860 N1    ? ? ? 1_555 A  C   2897 N3  ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2753 hydrog ?    ? A  G   2860 N2    ? ? ? 1_555 A  C   2897 O2  ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2754 hydrog ?    ? A  G   2860 O6    ? ? ? 1_555 A  C   2897 N4  ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2755 hydrog ?    ? A  G   2861 N1    ? ? ? 1_555 A  C   2895 N3  ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2756 hydrog ?    ? A  G   2861 N2    ? ? ? 1_555 A  C   2895 O2  ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2757 hydrog ?    ? A  G   2861 O6    ? ? ? 1_555 A  C   2895 N4  ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2758 hydrog ?    ? A  G   2862 N1    ? ? ? 1_555 A  C   2894 N3  ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2759 hydrog ?    ? A  G   2862 N2    ? ? ? 1_555 A  C   2894 O2  ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2760 hydrog ?    ? A  G   2862 O6    ? ? ? 1_555 A  C   2894 N4  ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2761 hydrog ?    ? A  G   2863 N1    ? ? ? 1_555 A  C   2893 N3  ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2762 hydrog ?    ? A  G   2863 N2    ? ? ? 1_555 A  C   2893 O2  ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2763 hydrog ?    ? A  G   2863 O6    ? ? ? 1_555 A  C   2893 N4  ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2764 hydrog ?    ? A  U   2864 N3    ? ? ? 1_555 A  G   2892 O6  ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2765 hydrog ?    ? A  U   2864 O2    ? ? ? 1_555 A  G   2892 N1  ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2766 hydrog ?    ? A  G   2865 N2    ? ? ? 1_555 A  A   2891 N7  ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2767 hydrog ?    ? A  G   2865 N3    ? ? ? 1_555 A  A   2891 N6  ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2768 hydrog ?    ? A  C   2868 N4    ? ? ? 1_555 A  U   2889 O4  ? ? 0 C   2868 0 U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog2769 hydrog ?    ? A  G   2869 N1    ? ? ? 1_555 A  U   2888 O2  ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2770 hydrog ?    ? A  G   2869 O6    ? ? ? 1_555 A  U   2888 N3  ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2771 hydrog ?    ? A  C   2870 N3    ? ? ? 1_555 A  G   2887 N1  ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2772 hydrog ?    ? A  C   2870 N4    ? ? ? 1_555 A  G   2887 O6  ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2773 hydrog ?    ? A  C   2870 O2    ? ? ? 1_555 A  G   2887 N2  ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2774 hydrog ?    ? A  G   2871 N1    ? ? ? 1_555 A  C   2886 N3  ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2775 hydrog ?    ? A  G   2871 N2    ? ? ? 1_555 A  C   2886 O2  ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2776 hydrog ?    ? A  G   2871 O6    ? ? ? 1_555 A  C   2886 N4  ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2777 hydrog ?    ? A  U   2872 N3    ? ? ? 1_555 A  A   2885 N1  ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2778 hydrog ?    ? A  U   2872 O4    ? ? ? 1_555 A  A   2885 N6  ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2779 hydrog ?    ? A  C   2873 O2    ? ? ? 1_555 A  G   2884 N2  ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2780 hydrog ?    ? A  G   2874 N2    ? ? ? 1_555 A  A   2883 N7  ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2781 hydrog ?    ? A  G   2874 N3    ? ? ? 1_555 A  A   2883 N6  ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2782 hydrog ?    ? A  A   2875 N6    ? ? ? 1_555 A  G   2882 N3  ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2783 hydrog ?    ? A  A   2875 N7    ? ? ? 1_555 A  G   2882 N2  ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2784 hydrog ?    ? A  G   2876 N1    ? ? ? 1_555 A  C   2881 N3  ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2785 hydrog ?    ? A  G   2876 N2    ? ? ? 1_555 A  C   2881 O2  ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2786 hydrog ?    ? A  G   2876 O6    ? ? ? 1_555 A  C   2881 N4  ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2787 hydrog ?    ? A  G   2877 N2    ? ? ? 1_555 A  A   2880 N7  ? ? 0 G   2877 0 A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
hydrog2788 hydrog ?    ? A  C   2901 O2    ? ? ? 1_555 A  C   2903 N4  ? ? 0 C   2901 0 C   2903 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2789 hydrog ?    ? A  A   2902 N7    ? ? ? 1_555 A  A   2905 N6  ? ? 0 A   2902 0 A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2790 hydrog ?    ? B  A   3    N3    ? ? ? 1_555 B  G   21   N2  ? ? 9 A   3    9 G   21   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2791 hydrog ?    ? B  A   3    N6    ? ? ? 1_555 B  G   25   O6  ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
? 
hydrog2792 hydrog ?    ? B  A   3    N7    ? ? ? 1_555 B  G   25   N1  ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
? 
hydrog2793 hydrog ?    ? B  G   4    N1    ? ? ? 1_555 B  C   119  N3  ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2794 hydrog ?    ? B  G   4    N2    ? ? ? 1_555 B  C   119  O2  ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2795 hydrog ?    ? B  G   4    O6    ? ? ? 1_555 B  C   119  N4  ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2796 hydrog ?    ? B  G   5    N1    ? ? ? 1_555 B  C   118  N3  ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2797 hydrog ?    ? B  G   5    N2    ? ? ? 1_555 B  C   118  O2  ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2798 hydrog ?    ? B  G   5    O6    ? ? ? 1_555 B  C   118  N4  ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2799 hydrog ?    ? B  C   6    N3    ? ? ? 1_555 B  G   117  N1  ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2800 hydrog ?    ? B  C   6    N4    ? ? ? 1_555 B  G   117  O6  ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2801 hydrog ?    ? B  C   6    O2    ? ? ? 1_555 B  G   117  N2  ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2802 hydrog ?    ? B  G   7    N1    ? ? ? 1_555 B  C   116  N3  ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2803 hydrog ?    ? B  G   7    N2    ? ? ? 1_555 B  C   116  O2  ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2804 hydrog ?    ? B  G   7    O6    ? ? ? 1_555 B  C   116  N4  ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2805 hydrog ?    ? B  G   8    N1    ? ? ? 1_555 B  C   115  N3  ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2806 hydrog ?    ? B  G   8    N2    ? ? ? 1_555 B  C   115  O2  ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2807 hydrog ?    ? B  G   8    O6    ? ? ? 1_555 B  C   115  N4  ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2808 hydrog ?    ? B  C   9    N3    ? ? ? 1_555 B  G   114  N1  ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2809 hydrog ?    ? B  C   9    N4    ? ? ? 1_555 B  G   114  O6  ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2810 hydrog ?    ? B  C   9    O2    ? ? ? 1_555 B  G   114  N2  ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2811 hydrog ?    ? B  A   11   N3    ? ? ? 1_555 B  G   68   N2  ? ? 9 A   11   9 G   68   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? ? 
hydrog2812 hydrog ?    ? B  G   14   N1    ? ? ? 1_555 B  C   67   N3  ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2813 hydrog ?    ? B  G   14   N2    ? ? ? 1_555 B  C   67   O2  ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2814 hydrog ?    ? B  G   14   O6    ? ? ? 1_555 B  C   67   N4  ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2815 hydrog ?    ? B  C   15   N3    ? ? ? 1_555 B  G   66   N1  ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2816 hydrog ?    ? B  C   15   N4    ? ? ? 1_555 B  G   66   O6  ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2817 hydrog ?    ? B  C   15   O2    ? ? ? 1_555 B  G   66   N2  ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2818 hydrog ?    ? B  C   15   N4    ? ? ? 1_555 B  C   113  O2  ? ? 9 C   15   9 C   113  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2819 hydrog ?    ? B  G   16   N1    ? ? ? 1_555 B  C   64   N3  ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2820 hydrog ?    ? B  G   16   N2    ? ? ? 1_555 B  C   64   O2  ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2821 hydrog ?    ? B  G   16   O6    ? ? ? 1_555 B  C   64   N4  ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2822 hydrog ?    ? B  G   17   N1    ? ? ? 1_555 B  C   63   N3  ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2823 hydrog ?    ? B  G   17   N2    ? ? ? 1_555 B  C   63   O2  ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2824 hydrog ?    ? B  G   17   O6    ? ? ? 1_555 B  C   63   N4  ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2825 hydrog ?    ? B  U   18   N3    ? ? ? 1_555 B  A   62   N1  ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2826 hydrog ?    ? B  U   18   O4    ? ? ? 1_555 B  A   62   N6  ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2827 hydrog ?    ? B  G   19   N1    ? ? ? 1_555 B  C   61   N3  ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2828 hydrog ?    ? B  G   19   N2    ? ? ? 1_555 B  C   61   O2  ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2829 hydrog ?    ? B  G   19   O6    ? ? ? 1_555 B  C   61   N4  ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2830 hydrog ?    ? B  G   20   N1    ? ? ? 1_555 B  C   60   N3  ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2831 hydrog ?    ? B  G   20   N2    ? ? ? 1_555 B  C   60   O2  ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2832 hydrog ?    ? B  G   20   O6    ? ? ? 1_555 B  C   60   N4  ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2833 hydrog ?    ? B  G   21   N1    ? ? ? 1_555 B  C   59   N3  ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2834 hydrog ?    ? B  G   21   N2    ? ? ? 1_555 B  C   59   O2  ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2835 hydrog ?    ? B  G   21   O6    ? ? ? 1_555 B  C   59   N4  ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2836 hydrog ?    ? B  G   22   N2    ? ? ? 1_555 B  C   26   N3  ? ? 9 G   22   9 C   26   1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2837 hydrog ?    ? B  G   22   N1    ? ? ? 1_555 B  G   58   O6  ? ? 9 G   22   9 G   58   1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? ? 
hydrog2838 hydrog ?    ? B  C   27   N4    ? ? ? 1_555 B  U   55   O4  ? ? 9 C   27   9 U   55   1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? ? 
hydrog2839 hydrog ?    ? B  C   27   O2    ? ? ? 1_555 B  G   58   N1  ? ? 9 C   27   9 G   58   1_555 ? ? ? ? ? ? 'C-G PAIR' ? ? 
? 
hydrog2840 hydrog ?    ? B  U   28   N3    ? ? ? 1_555 B  A   54   N1  ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2841 hydrog ?    ? B  U   28   O4    ? ? ? 1_555 B  A   54   N6  ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2842 hydrog ?    ? B  C   29   N3    ? ? ? 1_555 B  G   53   N1  ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2843 hydrog ?    ? B  C   29   N4    ? ? ? 1_555 B  G   53   O6  ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2844 hydrog ?    ? B  C   29   O2    ? ? ? 1_555 B  G   53   N2  ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2845 hydrog ?    ? B  C   29   O2    ? ? ? 1_555 B  A   56   N6  ? ? 9 C   29   9 A   56   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2846 hydrog ?    ? B  C   30   N3    ? ? ? 1_555 B  G   50   N1  ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2847 hydrog ?    ? B  C   30   N4    ? ? ? 1_555 B  G   50   O6  ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2848 hydrog ?    ? B  C   30   O2    ? ? ? 1_555 B  G   50   N2  ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2849 hydrog ?    ? B  C   30   O2    ? ? ? 1_555 B  A   52   N6  ? ? 9 C   30   9 A   52   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2850 hydrog ?    ? B  C   31   N3    ? ? ? 1_555 B  G   49   N1  ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2851 hydrog ?    ? B  C   31   N4    ? ? ? 1_555 B  G   49   O6  ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2852 hydrog ?    ? B  C   31   O2    ? ? ? 1_555 B  G   49   N2  ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2853 hydrog ?    ? B  G   32   N1    ? ? ? 1_555 B  C   48   N3  ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2854 hydrog ?    ? B  G   32   N2    ? ? ? 1_555 B  C   48   O2  ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2855 hydrog ?    ? B  G   32   O6    ? ? ? 1_555 B  C   48   N4  ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2856 hydrog ?    ? B  U   33   O2    ? ? ? 1_555 B  C   35   N4  ? ? 9 U   33   9 C   35   1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? ? 
hydrog2857 hydrog ?    ? B  U   33   N3    ? ? ? 1_555 B  A   47   N1  ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2858 hydrog ?    ? B  U   33   O4    ? ? ? 1_555 B  A   47   N6  ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2859 hydrog ?    ? B  C   35   N4    ? ? ? 1_555 B  C   48   O2  ? ? 9 C   35   9 C   48   1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? ? 
hydrog2860 hydrog ?    ? B  C   36   N4    ? ? ? 1_555 B  A   47   N3  ? ? 9 C   36   9 A   47   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? ? 
hydrog2861 hydrog ?    ? B  C   37   N3    ? ? ? 1_555 B  G   43   N1  ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2862 hydrog ?    ? B  C   37   N4    ? ? ? 1_555 B  G   43   O6  ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2863 hydrog ?    ? B  C   37   O2    ? ? ? 1_555 B  G   43   N2  ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2864 hydrog ?    ? B  A   38   N3    ? ? ? 1_555 B  A   45   N6  ? ? 9 A   38   9 A   45   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2865 hydrog ?    ? B  U   39   O2    ? ? ? 1_555 B  A   44   N6  ? ? 9 U   39   9 A   44   1_555 ? ? ? ? ? ? 'U-A PAIR' ? ? 
? 
hydrog2866 hydrog ?    ? B  G   43   N2    ? ? ? 1_555 B  C   46   O2  ? ? 9 G   43   9 C   46   1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2867 hydrog ?    ? B  A   51   N3    ? ? ? 1_555 B  A   52   N6  ? ? 9 A   51   9 A   52   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? ? 
hydrog2868 hydrog ?    ? B  A   65   N3    ? ? ? 1_555 B  C   67   N4  ? ? 9 A   65   9 C   67   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2869 hydrog ?    ? B  G   66   O6    ? ? ? 1_555 B  C   113  N4  ? ? 9 G   66   9 C   113  1_555 ? ? ? ? ? ? 'G-C PAIR' ? ? 
? 
hydrog2870 hydrog ?    ? B  U   69   N3    ? ? ? 1_555 B  U   112  O2  ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2871 hydrog ?    ? B  U   69   O4    ? ? ? 1_555 B  U   112  N3  ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2872 hydrog ?    ? B  U   70   N3    ? ? ? 1_555 B  U   111  O2  ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2873 hydrog ?    ? B  U   70   O4    ? ? ? 1_555 B  U   111  N3  ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? 
? ? 
hydrog2874 hydrog ?    ? B  C   71   N3    ? ? ? 1_555 B  G   110  N1  ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2875 hydrog ?    ? B  C   71   N4    ? ? ? 1_555 B  G   110  O6  ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2876 hydrog ?    ? B  C   71   O2    ? ? ? 1_555 B  G   110  N2  ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2877 hydrog ?    ? B  C   72   N3    ? ? ? 1_555 B  G   109  N1  ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2878 hydrog ?    ? B  C   72   N4    ? ? ? 1_555 B  G   109  O6  ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2879 hydrog ?    ? B  C   72   O2    ? ? ? 1_555 B  G   109  N2  ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2880 hydrog ?    ? B  A   73   N6    ? ? ? 1_555 B  C   108  N3  ? ? 9 A   73   9 C   108  1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? ? 
hydrog2881 hydrog ?    ? B  G   74   N1    ? ? ? 1_555 B  C   107  N3  ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2882 hydrog ?    ? B  G   74   N2    ? ? ? 1_555 B  C   107  O2  ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2883 hydrog ?    ? B  G   74   O6    ? ? ? 1_555 B  C   107  N4  ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2884 hydrog ?    ? B  G   75   N2    ? ? ? 1_555 B  U   106  O2  ? ? 9 G   75   9 U   106  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2885 hydrog ?    ? B  G   76   N2    ? ? ? 1_555 B  A   105  N7  ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2886 hydrog ?    ? B  G   76   N3    ? ? ? 1_555 B  A   105  N6  ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2887 hydrog ?    ? B  G   76   N2    ? ? ? 1_555 B  U   106  O4  ? ? 9 G   76   9 U   106  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2888 hydrog ?    ? B  A   77   N6    ? ? ? 1_555 B  A   104  N7  ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2889 hydrog ?    ? B  A   77   N7    ? ? ? 1_555 B  A   104  N6  ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
? 
hydrog2890 hydrog ?    ? B  G   78   N2    ? ? ? 1_555 B  U   79   O4  ? ? 9 G   78   9 U   79   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? ? 
hydrog2891 hydrog ?    ? B  U   79   N3    ? ? ? 1_555 B  A   103  N7  ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2892 hydrog ?    ? B  U   79   O2    ? ? ? 1_555 B  A   103  N6  ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog2893 hydrog ?    ? B  A   80   N6    ? ? ? 1_555 B  G   102  N3  ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2894 hydrog ?    ? B  A   80   N7    ? ? ? 1_555 B  G   102  N2  ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? 
? ? 
hydrog2895 hydrog ?    ? B  C   81   N3    ? ? ? 1_555 B  G   101  N1  ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2896 hydrog ?    ? B  C   81   N4    ? ? ? 1_555 B  G   101  O6  ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2897 hydrog ?    ? B  C   81   O2    ? ? ? 1_555 B  G   101  N2  ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2898 hydrog ?    ? B  U   82   N3    ? ? ? 1_555 B  G   100  O6  ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2899 hydrog ?    ? B  U   82   O2    ? ? ? 1_555 B  G   100  N1  ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2900 hydrog ?    ? B  G   83   N1    ? ? ? 1_555 B  U   99   O2  ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2901 hydrog ?    ? B  G   83   O6    ? ? ? 1_555 B  U   99   N3  ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? 
? ? 
hydrog2902 hydrog ?    ? B  G   84   N1    ? ? ? 1_555 B  C   98   N3  ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2903 hydrog ?    ? B  G   84   N2    ? ? ? 1_555 B  C   98   O2  ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2904 hydrog ?    ? B  G   84   O6    ? ? ? 1_555 B  C   98   N4  ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2905 hydrog ?    ? B  A   85   N1    ? ? ? 1_555 B  U   97   N3  ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2906 hydrog ?    ? B  A   85   N6    ? ? ? 1_555 B  U   97   O4  ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2907 hydrog ?    ? B  G   86   N1    ? ? ? 1_555 B  C   96   N3  ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2908 hydrog ?    ? B  G   86   N2    ? ? ? 1_555 B  C   96   O2  ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2909 hydrog ?    ? B  G   86   O6    ? ? ? 1_555 B  C   96   N4  ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2910 hydrog ?    ? B  G   88   N1    ? ? ? 1_555 B  C   95   N3  ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2911 hydrog ?    ? B  G   88   N2    ? ? ? 1_555 B  C   95   O2  ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2912 hydrog ?    ? B  G   88   O6    ? ? ? 1_555 B  C   95   N4  ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2913 hydrog ?    ? B  C   89   N3    ? ? ? 1_555 B  G   94   N1  ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2914 hydrog ?    ? B  C   89   N4    ? ? ? 1_555 B  G   94   O6  ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2915 hydrog ?    ? B  C   89   O2    ? ? ? 1_555 B  G   94   N2  ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? 
? ? 
hydrog2916 hydrog ?    ? B  G   90   N2    ? ? ? 1_555 B  A   93   N7  ? ? 9 G   90   9 A   93   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 187 C . ? TRP 186 A PRO 188 C ? PRO 187 A 1 -0.02 
2 GLY 15  D . ? GLY 14  B PRO 16  D ? PRO 15  B 1 -0.12 
3 ASN 244 D . ? ASN 243 B PRO 245 D ? PRO 244 B 1 -0.04 
4 VAL 136 E . ? VAL 136 C PRO 137 E ? PRO 137 C 1 0.22  
5 GLN 56  H . ? GLN 55  F PRO 57  H ? PRO 56  F 1 0.04  
6 ARG 185 O . ? ARG 184 M PRO 186 O ? PRO 185 M 1 0.56  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 6 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 5 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 3 ? 
P  ? 4 ? 
Q  ? 5 ? 
R  ? 3 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 5 ? 
W  ? 2 ? 
X  ? 6 ? 
Y  ? 3 ? 
Z  ? 3 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 2 ? 
AF ? 5 ? 
AG ? 3 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 4 ? 
AK ? 6 ? 
AL ? 2 ? 
AM ? 5 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 2 ? 
AQ ? 3 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
F  7 8 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? parallel      
H  3 4 ? parallel      
H  4 5 ? parallel      
H  5 6 ? parallel      
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? parallel      
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? parallel      
T  1 2 ? parallel      
T  2 3 ? parallel      
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? parallel      
V  4 5 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
X  5 6 ? parallel      
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? parallel      
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AK 5 6 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? parallel      
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? parallel      
AO 1 2 ? anti-parallel 
AP 1 2 ? parallel      
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? parallel      
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG C  66  ? LEU C  70  ? ARG A 65  LEU A 69  
A  2 PRO C  55  ? PHE C  61  ? PRO A 54  PHE A 60  
A  3 ALA C  40  ? HIS C  48  ? ALA A 39  HIS A 47  
A  4 GLU C  80  ? GLN C  82  ? GLU A 79  GLN A 81  
B  1 THR C  94  ? PRO C  96  ? THR A 93  PRO A 95  
B  2 ARG C  154 ? ILE C  157 ? ARG A 153 ILE A 156 
B  3 PRO C  105 ? CYS C  107 ? PRO A 104 CYS A 106 
B  4 ALA C  127 ? THR C  131 ? ALA A 126 THR A 130 
B  5 ALA C  137 ? LYS C  140 ? ALA A 136 LYS A 139 
B  6 MET C  146 ? LEU C  149 ? MET A 145 LEU A 148 
C  1 SER C  215 ? ILE C  216 ? SER A 214 ILE A 215 
C  2 ASP C  228 ? ILE C  229 ? ASP A 227 ILE A 228 
D  1 GLY D  38  ? VAL D  39  ? GLY B 37  VAL B 38  
D  2 VAL D  162 ? GLY D  168 ? VAL B 161 GLY B 167 
D  3 LEU D  138 ? HIS D  146 ? LEU B 137 HIS B 145 
D  4 MET D  80  ? THR D  91  ? MET B 79  THR B 90  
D  5 GLY D  94  ? TRP D  102 ? GLY B 93  TRP B 101 
E  1 GLY D  38  ? VAL D  39  ? GLY B 37  VAL B 38  
E  2 VAL D  162 ? GLY D  168 ? VAL B 161 GLY B 167 
E  3 LEU D  138 ? HIS D  146 ? LEU B 137 HIS B 145 
E  4 MET D  80  ? THR D  91  ? MET B 79  THR B 90  
E  5 GLU D  188 ? HIS D  189 ? GLU B 187 HIS B 188 
F  1 VAL D  328 ? VAL D  331 ? VAL B 327 VAL B 330 
F  2 PHE D  42  ? VAL D  55  ? PHE B 41  VAL B 54  
F  3 LEU D  309 ? PRO D  314 ? LEU B 308 PRO B 313 
F  4 TYR D  200 ? VAL D  206 ? TYR B 199 VAL B 205 
F  5 GLN D  262 ? GLY D  276 ? GLN B 261 GLY B 275 
F  6 GLY D  293 ? LYS D  299 ? GLY B 292 LYS B 298 
F  7 GLU D  67  ? GLU D  76  ? GLU B 66  GLU B 75  
F  8 PHE D  42  ? VAL D  55  ? PHE B 41  VAL B 54  
G  1 THR D  212 ? GLN D  213 ? THR B 211 GLN B 212 
G  2 GLY D  256 ? GLN D  257 ? GLY B 255 GLN B 256 
H  1 THR E  12  ? ASP E  17  ? THR C 12  ASP C 17  
H  2 GLN E  2   ? TYR E  6   ? GLN C 2   TYR C 6   
H  3 VAL E  138 ? VAL E  140 ? VAL C 138 VAL C 140 
H  4 THR E  233 ? THR E  236 ? THR C 233 THR C 236 
H  5 LEU E  193 ? THR E  196 ? LEU C 193 THR C 196 
H  6 ASP E  211 ? THR E  214 ? ASP C 211 THR C 214 
I  1 LYS E  72  ? LEU E  73  ? LYS C 72  LEU C 73  
I  2 ARG E  76  ? ALA E  77  ? ARG C 76  ALA C 77  
J  1 LYS E  173 ? ILE E  174 ? LYS C 173 ILE C 174 
J  2 TYR E  186 ? ARG E  187 ? TYR C 186 ARG C 187 
K  1 VAL F  51  ? THR F  53  ? VAL D 50  THR D 52  
K  2 GLY F  71  ? LEU F  76  ? GLY D 70  LEU D 75  
K  3 ARG F  18  ? GLY F  27  ? ARG D 17  GLY D 26  
K  4 ASP F  130 ? VAL F  136 ? ASP D 129 VAL D 135 
K  5 PHE F  105 ? PHE F  107 ? PHE D 104 PHE D 106 
L  1 ARG G  3   ? GLU G  7   ? ARG E 2   GLU E 6   
L  2 THR G  47  ? GLU G  51  ? THR E 46  GLU E 50  
L  3 ASP G  40  ? ASP G  44  ? ASP E 39  ASP E 43  
M  1 ASP G  13  ? ASP G  17  ? ASP E 12  ASP E 16  
M  2 ASP G  20  ? GLY G  25  ? ASP E 19  GLY E 24  
M  3 GLY G  28  ? ARG G  33  ? GLY E 27  ARG E 32  
N  1 ASP G  124 ? ASP G  128 ? ASP E 123 ASP E 127 
N  2 GLU G  131 ? GLY G  136 ? GLU E 130 GLY E 135 
N  3 TRP G  81  ? PHE G  88  ? TRP E 80  PHE E 87  
N  4 GLY G  166 ? ARG G  171 ? GLY E 165 ARG E 170 
O  1 GLN G  95  ? VAL G  98  ? GLN E 94  VAL E 97  
O  2 GLU G  102 ? GLU G  106 ? GLU E 101 GLU E 105 
O  3 ARG G  115 ? THR G  118 ? ARG E 114 THR E 117 
P  1 ALA H  29  ? LYS H  32  ? ALA F 28  LYS F 31  
P  2 ALA H  96  ? THR H  100 ? ALA F 95  THR F 99  
P  3 VAL H  49  ? ALA H  52  ? VAL F 48  ALA F 51  
P  4 PHE H  75  ? VAL H  78  ? PHE F 74  VAL F 77  
Q  1 LYS J  35  ? GLY J  37  ? LYS H 35  GLY H 37  
Q  2 TYR J  86  ? LEU J  90  ? TYR H 86  LEU H 90  
Q  3 GLN J  135 ? CYS J  141 ? GLN H 135 CYS H 141 
Q  4 VAL J  48  ? VAL J  54  ? VAL H 48  VAL H 54  
Q  5 CYS J  164 ? VAL J  168 ? CYS H 164 VAL H 168 
R  1 VAL J  58  ? ARG J  61  ? VAL H 58  ARG H 61  
R  2 LYS J  122 ? VAL J  130 ? LYS H 122 VAL H 130 
R  3 GLN J  96  ? GLU J  100 ? GLN H 96  GLU H 100 
S  1 ALA K  94  ? LEU K  96  ? ALA I 93  LEU I 95  
S  2 VAL K  133 ? ILE K  135 ? VAL I 132 ILE I 134 
T  1 VAL L  10  ? ASP L  13  ? VAL J 10  ASP J 13  
T  2 VAL L  36  ? VAL L  39  ? VAL J 36  VAL J 39  
T  3 VAL L  101 ? VAL L  103 ? VAL J 101 VAL J 103 
U  1 VAL L  45  ? THR L  47  ? VAL J 45  THR J 47  
U  2 PHE L  129 ? THR L  131 ? PHE J 129 THR J 131 
V  1 ASP M  7   ? VAL M  8   ? ASP K 7   VAL K 8   
V  2 ILE M  80  ? ARG M  81  ? ILE K 80  ARG K 81  
V  3 ARG M  87  ? PHE M  90  ? ARG K 87  PHE K 90  
V  4 THR W  19  ? VAL W  22  ? THR U 19  VAL U 22  
V  5 THR W  28  ? PHE W  31  ? THR U 28  PHE U 31  
W  1 LEU M  12  ? GLU M  13  ? LEU K 12  GLU K 13  
W  2 LYS M  46  ? ALA M  47  ? LYS K 46  ALA K 47  
X  1 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
X  2 ALA M  26  ? VAL M  34  ? ALA K 26  VAL K 34  
X  3 LYS M  52  ? GLY M  60  ? LYS K 52  GLY K 60  
X  4 VAL M  68  ? ARG M  75  ? VAL K 68  ARG K 75  
X  5 ALA M  94  ? VAL M  98  ? ALA K 94  VAL K 98  
X  6 LEU M  17  ? CYS M  20  ? LEU K 17  CYS K 20  
Y  1 ALA N  62  ? ASP N  66  ? ALA L 61  ASP L 65  
Y  2 TYR N  106 ? LEU N  110 ? TYR L 105 LEU L 109 
Y  3 ASP N  125 ? PHE N  126 ? ASP L 124 PHE L 125 
Z  1 ARG N  91  ? ASP N  93  ? ARG L 90  ASP L 92  
Z  2 THR N  120 ? ALA N  123 ? THR L 119 ALA L 122 
Z  3 SER N  140 ? LEU N  143 ? SER L 139 LEU L 142 
AA 1 VAL O  38  ? ARG O  40  ? VAL M 37  ARG M 39  
AA 2 VAL O  61  ? ARG O  69  ? VAL M 60  ARG M 68  
AA 3 GLN O  127 ? ILE O  135 ? GLN M 126 ILE M 134 
AA 4 ARG O  114 ? GLN O  123 ? ARG M 113 GLN M 122 
AB 1 ASP P  57  ? HIS P  63  ? ASP N 56  HIS N 62  
AB 2 VAL P  44  ? THR P  50  ? VAL N 43  THR N 49  
AB 3 ARG P  34  ? LYS P  39  ? ARG N 33  LYS N 38  
AB 4 VAL P  102 ? ASP P  104 ? VAL N 101 ASP N 103 
AC 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AC 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AC 3 THR Q  76  ? PHE Q  82  ? THR O 75  PHE O 81  
AC 4 GLU Q  95  ? SER Q  98  ? GLU O 94  SER O 97  
AD 1 ALA Q  42  ? ASN Q  45  ? ALA O 41  ASN O 44  
AD 2 THR Q  58  ? LEU Q  66  ? THR O 57  LEU O 65  
AD 3 VAL Q  112 ? VAL Q  114 ? VAL O 111 VAL O 113 
AE 1 VAL R  22  ? PHE R  24  ? VAL P 21  PHE P 23  
AE 2 ILE R  50  ? ALA R  52  ? ILE P 49  ALA P 51  
AF 1 LYS S  81  ? VAL S  87  ? LYS Q 80  VAL Q 86  
AF 2 ALA S  71  ? ASP S  78  ? ALA Q 70  ASP Q 77  
AF 3 THR S  61  ? GLN S  68  ? THR Q 60  GLN Q 67  
AF 4 LYS S  39  ? LEU S  42  ? LYS Q 38  LEU Q 41  
AF 5 LEU S  92  ? ARG S  94  ? LEU Q 91  ARG Q 93  
AG 1 THR T  14  ? GLN T  23  ? THR R 13  GLN R 22  
AG 2 SER T  139 ? GLU T  149 ? SER R 138 GLU R 148 
AG 3 THR T  111 ? GLN T  123 ? THR R 110 GLN R 122 
AH 1 VAL T  58  ? PRO T  59  ? VAL R 57  PRO R 58  
AH 2 GLY T  79  ? ARG T  80  ? GLY R 78  ARG R 79  
AI 1 ARG T  126 ? PRO T  128 ? ARG R 125 PRO R 127 
AI 2 ALA T  134 ? ALA T  136 ? ALA R 133 ALA R 135 
AJ 1 ILE U  6   ? PRO U  9   ? ILE S 5   PRO S 8   
AJ 2 LYS U  24  ? VAL U  29  ? LYS S 23  VAL S 28  
AJ 3 LYS U  63  ? LEU U  69  ? LYS S 62  LEU S 68  
AJ 4 VAL U  50  ? ASN U  57  ? VAL S 49  ASN S 56  
AK 1 ASN V  40  ? ARG V  42  ? ASN T 39  ARG T 41  
AK 2 ARG V  25  ? LEU V  28  ? ARG T 24  LEU T 27  
AK 3 VAL V  97  ? ASP V  101 ? VAL T 96  ASP T 100 
AK 4 THR V  48  ? VAL V  51  ? THR T 47  VAL T 50  
AK 5 GLU V  60  ? ASP V  67  ? GLU T 59  ASP T 66  
AK 6 VAL V  72  ? VAL V  75  ? VAL T 71  VAL T 74  
AL 1 THR V  79  ? GLU V  81  ? THR T 78  GLU T 80  
AL 2 GLU V  87  ? PRO V  89  ? GLU T 86  PRO T 88  
AM 1 THR Y  115 ? ARG Y  117 ? THR W 115 ARG W 117 
AM 2 HIS Y  31  ? VAL Y  35  ? HIS W 31  VAL W 35  
AM 3 HIS Y  2   ? GLN Y  6   ? HIS W 2   GLN W 6   
AM 4 VAL Y  52  ? GLY Y  55  ? VAL W 52  GLY W 55  
AM 5 GLY Y  139 ? LYS Y  140 ? GLY W 139 LYS W 140 
AN 1 ARG Z  9   ? PRO Z  14  ? ARG X 8   PRO X 13  
AN 2 LYS Z  70  ? PHE Z  78  ? LYS X 69  PHE X 77  
AN 3 GLU Z  83  ? GLU Z  87  ? GLU X 82  GLU X 86  
AN 4 VAL Z  49  ? LEU Z  51  ? VAL X 48  LEU X 50  
AO 1 GLU AA 97  ? ALA AA 100 ? GLU Y 96  ALA Y 99  
AO 2 TYR AA 234 ? VAL AA 237 ? TYR Y 233 VAL Y 236 
AP 1 GLU AA 184 ? VAL AA 188 ? GLU Y 183 VAL Y 187 
AP 2 GLU AA 202 ? ILE AA 206 ? GLU Y 201 ILE Y 205 
AQ 1 VAL BA 38  ? GLY BA 42  ? VAL Z 47  GLY Z 51  
AQ 2 ILE BA 45  ? CYS BA 48  ? ILE Z 54  CYS Z 57  
AQ 3 LYS BA 54  ? THR BA 56  ? LYS Z 63  THR Z 65  
AR 1 HIS CA 17  ? THR CA 18  ? HIS 1 16  THR 1 17  
AR 2 TYR CA 28  ? HIS CA 29  ? TYR 1 27  HIS 1 28  
AR 3 VAL CA 34  ? CYS CA 35  ? VAL 1 33  CYS 1 34  
AS 1 GLN EA 2   ? PRO EA 4   ? GLN 3 2   PRO 3 4   
AS 2 GLU EA 89  ? GLN EA 91  ? GLU 3 89  GLN 3 91  
AT 1 ARG EA 6   ? THR EA 9   ? ARG 3 6   THR 3 9   
AT 2 GLN EA 18  ? LYS EA 24  ? GLN 3 18  LYS 3 24  
AT 3 LEU EA 67  ? CYS EA 71  ? LEU 3 67  CYS 3 71  
AT 4 ALA EA 77  ? HIS EA 78  ? ALA 3 77  HIS 3 78  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ILE C  69  ? O ILE A 68  N ALA C  57  ? N ALA A 56  
A  2 3 O VAL C  56  ? O VAL A 55  N GLU C  47  ? N GLU A 46  
A  3 4 N GLY C  41  ? N GLY A 40  O LEU C  81  ? O LEU A 80  
B  1 2 N LEU C  95  ? N LEU A 94  O ALA C  155 ? O ALA A 154 
B  2 3 O THR C  156 ? O THR A 155 N CYS C  107 ? N CYS A 106 
B  3 4 N VAL C  106 ? N VAL A 105 O ALA C  127 ? O ALA A 126 
B  4 5 N LEU C  130 ? N LEU A 129 O VAL C  138 ? O VAL A 137 
B  5 6 N ALA C  137 ? N ALA A 136 O LEU C  149 ? O LEU A 148 
C  1 2 N ILE C  216 ? N ILE A 215 O ASP C  228 ? O ASP A 227 
D  1 2 N GLY D  38  ? N GLY B 37  O GLY D  168 ? O GLY B 167 
D  2 3 O MET D  163 ? O MET B 162 N THR D  145 ? N THR B 144 
D  3 4 O GLY D  139 ? O GLY B 138 N TYR D  88  ? N TYR B 87  
D  4 5 N ALA D  87  ? N ALA B 86  O LEU D  98  ? O LEU B 97  
E  1 2 N GLY D  38  ? N GLY B 37  O GLY D  168 ? O GLY B 167 
E  2 3 O MET D  163 ? O MET B 162 N THR D  145 ? N THR B 144 
E  3 4 O GLY D  139 ? O GLY B 138 N TYR D  88  ? N TYR B 87  
E  4 5 N MET D  80  ? N MET B 79  O HIS D  189 ? O HIS B 188 
F  1 2 O TYR D  330 ? O TYR B 329 N VAL D  53  ? N VAL B 52  
F  2 3 N PHE D  42  ? N PHE B 41  O PHE D  312 ? O PHE B 311 
F  3 4 O ARG D  313 ? O ARG B 312 N ASP D  202 ? N ASP B 201 
F  4 5 N ALA D  201 ? N ALA B 200 O LYS D  268 ? O LYS B 267 
F  5 6 N ASP D  272 ? N ASP B 271 O LEU D  297 ? O LEU B 296 
F  6 7 O VAL D  298 ? O VAL B 297 N THR D  73  ? N THR B 72  
F  7 8 O GLU D  68  ? O GLU B 67  N LEU D  54  ? N LEU B 53  
G  1 2 N GLN D  213 ? N GLN B 212 O GLY D  256 ? O GLY B 255 
H  1 2 O VAL E  16  ? O VAL C 16  N ALA E  3   ? N ALA C 3   
H  2 3 N TYR E  6   ? N TYR C 6   O VAL E  139 ? O VAL C 139 
H  3 4 N VAL E  138 ? N VAL C 138 O THR E  233 ? O THR C 233 
H  4 5 O VAL E  234 ? O VAL C 234 N VAL E  195 ? N VAL C 195 
H  5 6 N PHE E  194 ? N PHE C 194 O ALA E  213 ? O ALA C 213 
I  1 2 N LEU E  73  ? N LEU C 73  O ARG E  76  ? O ARG C 76  
J  1 2 N LYS E  173 ? N LYS C 173 O ARG E  187 ? O ARG C 187 
K  1 2 N THR F  53  ? N THR D 52  O GLY F  71  ? O GLY D 70  
K  2 3 O LEU F  76  ? O LEU D 75  N VAL F  22  ? N VAL D 21  
K  3 4 N LYS F  21  ? N LYS D 20  O ASN F  134 ? O ASN D 133 
K  4 5 O VAL F  133 ? O VAL D 132 N PHE F  105 ? N PHE D 104 
L  1 2 N LEU G  6   ? N LEU E 5   O VAL G  48  ? O VAL E 47  
L  2 3 O VAL G  49  ? O VAL E 48  N SER G  42  ? N SER E 41  
M  1 2 N GLU G  15  ? N GLU E 14  O THR G  22  ? O THR E 21  
M  2 3 N GLY G  25  ? N GLY E 24  O GLY G  28  ? O GLY E 27  
N  1 2 N ASP G  124 ? N ASP E 123 O SER G  135 ? O SER E 134 
N  2 3 O LEU G  132 ? O LEU E 131 N MET G  85  ? N MET E 84  
N  3 4 N GLY G  84  ? N GLY E 83  O THR G  170 ? O THR E 169 
O  1 2 N ASN G  97  ? N ASN E 96  O VAL G  104 ? O VAL E 103 
O  2 3 N ILE G  105 ? N ILE E 104 O ARG G  115 ? O ARG E 114 
P  1 2 N LYS H  31  ? N LYS F 30  O ALA H  98  ? O ALA F 97  
P  2 3 O ALA H  97  ? O ALA F 96  N PHE H  50  ? N PHE F 49  
P  3 4 N VAL H  49  ? N VAL F 48  O ILE H  76  ? O ILE F 75  
Q  1 2 N MET J  36  ? N MET H 36  O MET J  88  ? O MET H 88  
Q  2 3 N THR J  89  ? N THR H 89  O THR J  138 ? O THR H 138 
Q  3 4 O ALA J  139 ? O ALA H 139 N ILE J  50  ? N ILE H 50  
Q  4 5 N ILE J  53  ? N ILE H 53  O ARG J  165 ? O ARG H 165 
R  1 2 N LEU J  60  ? N LEU H 60  O ALA J  128 ? O ALA H 128 
R  2 3 O GLY J  125 ? O GLY H 125 N LEU J  98  ? N LEU H 98  
S  1 2 N ALA K  94  ? N ALA I 93  O THR K  134 ? O THR I 133 
T  1 2 N VAL L  12  ? N VAL J 12  O VAL L  39  ? O VAL J 39  
T  2 3 N VAL L  38  ? N VAL J 38  O ARG L  102 ? O ARG J 102 
U  1 2 N ILE L  46  ? N ILE J 46  O VAL L  130 ? O VAL J 130 
V  1 2 N ASP M  7   ? N ASP K 7   O ARG M  81  ? O ARG K 81  
V  2 3 N ILE M  80  ? N ILE K 80  O VAL M  88  ? O VAL K 88  
V  3 4 N LYS M  89  ? N LYS K 89  O VAL W  22  ? O VAL U 22  
V  4 5 N THR W  19  ? N THR U 19  O PHE W  31  ? O PHE U 31  
W  1 2 N LEU M  12  ? N LEU K 12  O ALA M  47  ? O ALA K 47  
X  1 2 N ILE M  18  ? N ILE K 18  O LEU M  29  ? O LEU K 29  
X  2 3 N SER M  33  ? N SER K 33  O THR M  54  ? O THR K 54  
X  3 4 N VAL M  55  ? N VAL K 55  O LEU M  69  ? O LEU K 69  
X  4 5 N GLU M  70  ? N GLU K 70  O VAL M  98  ? O VAL K 98  
X  5 6 O ALA M  95  ? O ALA K 95  N THR M  19  ? N THR K 19  
Y  1 2 N ALA N  63  ? N ALA L 62  O TYR N  106 ? O TYR L 105 
Y  2 3 N VAL N  109 ? N VAL L 108 O ASP N  125 ? O ASP L 124 
Z  1 2 N VAL N  92  ? N VAL L 91  O THR N  120 ? O THR L 119 
Z  2 3 N LEU N  121 ? N LEU L 120 O GLU N  142 ? O GLU L 141 
AA 1 2 N GLU O  39  ? N GLU M 38  O ARG O  65  ? O ARG M 64  
AA 2 3 N ILE O  62  ? N ILE M 61  O LEU O  134 ? O LEU M 133 
AA 3 4 O ILE O  133 ? O ILE M 132 N LEU O  116 ? N LEU M 115 
AB 1 2 O ASP P  57  ? O ASP N 56  N THR P  50  ? N THR N 49  
AB 2 3 O VAL P  49  ? O VAL N 48  N ARG P  34  ? N ARG N 33  
AB 3 4 N LEU P  35  ? N LEU N 34  O VAL P  102 ? O VAL N 101 
AC 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AC 2 3 N VAL Q  59  ? N VAL O 58  O ALA Q  78  ? O ALA O 77  
AC 3 4 N VAL Q  77  ? N VAL O 76  O VAL Q  97  ? O VAL O 96  
AD 1 2 N VAL Q  44  ? N VAL O 43  O LEU Q  66  ? O LEU O 65  
AD 2 3 N THR Q  58  ? N THR O 57  O ARG Q  113 ? O ARG O 112 
AE 1 2 N TRP R  23  ? N TRP P 22  O GLN R  51  ? O GLN P 50  
AF 1 2 O VAL S  87  ? O VAL Q 86  N TYR S  72  ? N TYR Q 71  
AF 2 3 O LYS S  73  ? O LYS Q 72  N GLU S  65  ? N GLU Q 64  
AF 3 4 O GLY S  62  ? O GLY Q 61  N VAL S  40  ? N VAL Q 39  
AF 4 5 N HIS S  41  ? N HIS Q 40  O ARG S  93  ? O ARG Q 92  
AG 1 2 N ARG T  22  ? N ARG R 21  O VAL T  142 ? O VAL R 141 
AG 2 3 O ILE T  147 ? O ILE R 146 N HIS T  114 ? N HIS R 113 
AH 1 2 N VAL T  58  ? N VAL R 57  O ARG T  80  ? O ARG R 79  
AI 1 2 N LYS T  127 ? N LYS R 126 O SER T  135 ? O SER R 134 
AJ 1 2 N HIS U  8   ? N HIS S 7   O ALA U  28  ? O ALA S 27  
AJ 2 3 N VAL U  29  ? N VAL S 28  O LYS U  63  ? O LYS S 62  
AJ 3 4 O VAL U  66  ? O VAL S 65  N ASN U  54  ? N ASN S 53  
AK 1 2 O VAL V  41  ? O VAL T 40  N ALA V  26  ? N ALA T 25  
AK 2 3 N THR V  27  ? N THR T 26  O VAL V  99  ? O VAL T 98  
AK 3 4 O ARG V  98  ? O ARG T 97  N GLU V  50  ? N GLU T 49  
AK 4 5 N VAL V  49  ? N VAL T 48  O GLY V  61  ? O GLY T 60  
AK 5 6 N ILE V  64  ? N ILE T 63  O HIS V  74  ? O HIS T 73  
AL 1 2 N LEU V  80  ? N LEU T 79  O VAL V  88  ? O VAL T 87  
AM 1 2 O LEU Y  116 ? O LEU W 116 N CYS Y  32  ? N CYS W 32  
AM 2 3 O THR Y  33  ? O THR W 33  N LEU Y  4   ? N LEU W 4   
AM 3 4 N ALA Y  3   ? N ALA W 3   O GLY Y  55  ? O GLY W 55  
AM 4 5 N VAL Y  52  ? N VAL W 52  O GLY Y  139 ? O GLY W 139 
AN 1 2 N VAL Z  11  ? N VAL X 10  O VAL Z  73  ? O VAL X 72  
AN 2 3 N ARG Z  74  ? N ARG X 73  O GLU Z  87  ? O GLU X 86  
AN 3 4 O ALA Z  84  ? O ALA X 83  N ARG Z  50  ? N ARG X 49  
AO 1 2 N GLU AA 97  ? N GLU Y 96  O VAL AA 237 ? O VAL Y 236 
AP 1 2 N VAL AA 188 ? N VAL Y 187 O ARG AA 205 ? O ARG Y 204 
AQ 1 2 N GLN BA 41  ? N GLN Z 50  O ILE BA 45  ? O ILE Z 54  
AQ 2 3 N TRP BA 46  ? N TRP Z 55  O PHE BA 55  ? O PHE Z 64  
AR 1 2 N THR CA 18  ? N THR 1 17  O TYR CA 28  ? O TYR 1 27  
AR 2 3 N HIS CA 29  ? N HIS 1 28  O VAL CA 34  ? O VAL 1 33  
AS 1 2 N MET EA 3   ? N MET 3 3   O GLU EA 89  ? O GLU 3 89  
AT 1 2 N PHE EA 7   ? N PHE 3 7   O HIS EA 20  ? O HIS 3 20  
AT 2 3 N GLU EA 21  ? N GLU 3 21  O ARG EA 70  ? O ARG 3 70  
AT 3 4 N TYR EA 69  ? N TYR 3 69  O HIS EA 78  ? O HIS 3 78  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software 0 ERY 9000 ? 7 'BINDING SITE FOR RESIDUE ERY 0 9000' 
AC2 Software 0 MG  8001 ? 7 'BINDING SITE FOR RESIDUE MG 0 8001'  
AC3 Software 0 MG  8002 ? 6 'BINDING SITE FOR RESIDUE MG 0 8002'  
AC4 Software 0 MG  8003 ? 6 'BINDING SITE FOR RESIDUE MG 0 8003'  
AC5 Software 0 MG  8004 ? 6 'BINDING SITE FOR RESIDUE MG 0 8004'  
AC6 Software 0 MG  8005 ? 6 'BINDING SITE FOR RESIDUE MG 0 8005'  
AC7 Software 0 MG  8006 ? 6 'BINDING SITE FOR RESIDUE MG 0 8006'  
AC8 Software 0 MG  8007 ? 6 'BINDING SITE FOR RESIDUE MG 0 8007'  
AC9 Software 0 MG  8008 ? 6 'BINDING SITE FOR RESIDUE MG 0 8008'  
BC1 Software 0 MG  8009 ? 8 'BINDING SITE FOR RESIDUE MG 0 8009'  
BC2 Software 0 MG  8010 ? 6 'BINDING SITE FOR RESIDUE MG 0 8010'  
BC3 Software 0 MG  8011 ? 6 'BINDING SITE FOR RESIDUE MG 0 8011'  
BC4 Software 0 MG  8012 ? 6 'BINDING SITE FOR RESIDUE MG 0 8012'  
BC5 Software 0 MG  8013 ? 6 'BINDING SITE FOR RESIDUE MG 0 8013'  
BC6 Software 0 MG  8014 ? 7 'BINDING SITE FOR RESIDUE MG 0 8014'  
BC7 Software 0 MG  8015 ? 6 'BINDING SITE FOR RESIDUE MG 0 8015'  
BC8 Software 0 MG  8016 ? 6 'BINDING SITE FOR RESIDUE MG 0 8016'  
BC9 Software 0 MG  8017 ? 6 'BINDING SITE FOR RESIDUE MG 0 8017'  
CC1 Software 0 MG  8018 ? 6 'BINDING SITE FOR RESIDUE MG 0 8018'  
CC2 Software 0 MG  8019 ? 6 'BINDING SITE FOR RESIDUE MG 0 8019'  
CC3 Software 0 MG  8020 ? 6 'BINDING SITE FOR RESIDUE MG 0 8020'  
CC4 Software 0 MG  8021 ? 6 'BINDING SITE FOR RESIDUE MG 0 8021'  
CC5 Software 0 MG  8022 ? 6 'BINDING SITE FOR RESIDUE MG 0 8022'  
CC6 Software 0 MG  8023 ? 7 'BINDING SITE FOR RESIDUE MG 0 8023'  
CC7 Software 0 MG  8024 ? 5 'BINDING SITE FOR RESIDUE MG 0 8024'  
CC8 Software 0 MG  8025 ? 6 'BINDING SITE FOR RESIDUE MG 0 8025'  
CC9 Software 0 MG  8026 ? 7 'BINDING SITE FOR RESIDUE MG 0 8026'  
DC1 Software 0 MG  8027 ? 6 'BINDING SITE FOR RESIDUE MG 0 8027'  
DC2 Software 0 MG  8028 ? 6 'BINDING SITE FOR RESIDUE MG 0 8028'  
DC3 Software 0 MG  8029 ? 7 'BINDING SITE FOR RESIDUE MG 0 8029'  
DC4 Software 0 MG  8030 ? 6 'BINDING SITE FOR RESIDUE MG 0 8030'  
DC5 Software 0 MG  8031 ? 6 'BINDING SITE FOR RESIDUE MG 0 8031'  
DC6 Software 0 MG  8032 ? 6 'BINDING SITE FOR RESIDUE MG 0 8032'  
DC7 Software 0 MG  8033 ? 6 'BINDING SITE FOR RESIDUE MG 0 8033'  
DC8 Software 0 MG  8034 ? 6 'BINDING SITE FOR RESIDUE MG 0 8034'  
DC9 Software 0 MG  8035 ? 6 'BINDING SITE FOR RESIDUE MG 0 8035'  
EC1 Software 0 MG  8036 ? 6 'BINDING SITE FOR RESIDUE MG 0 8036'  
EC2 Software 0 MG  8037 ? 7 'BINDING SITE FOR RESIDUE MG 0 8037'  
EC3 Software 0 MG  8038 ? 7 'BINDING SITE FOR RESIDUE MG 0 8038'  
EC4 Software 0 MG  8039 ? 6 'BINDING SITE FOR RESIDUE MG 0 8039'  
EC5 Software 0 MG  8040 ? 6 'BINDING SITE FOR RESIDUE MG 0 8040'  
EC6 Software 0 MG  8041 ? 7 'BINDING SITE FOR RESIDUE MG 0 8041'  
EC7 Software 0 MG  8042 ? 6 'BINDING SITE FOR RESIDUE MG 0 8042'  
EC8 Software 0 MG  8043 ? 6 'BINDING SITE FOR RESIDUE MG 0 8043'  
EC9 Software 0 MG  8044 ? 6 'BINDING SITE FOR RESIDUE MG 0 8044'  
FC1 Software 0 MG  8045 ? 5 'BINDING SITE FOR RESIDUE MG 0 8045'  
FC2 Software 0 MG  8046 ? 4 'BINDING SITE FOR RESIDUE MG 0 8046'  
FC3 Software 0 MG  8047 ? 4 'BINDING SITE FOR RESIDUE MG 0 8047'  
FC4 Software 0 MG  8048 ? 6 'BINDING SITE FOR RESIDUE MG 0 8048'  
FC5 Software 0 MG  8049 ? 5 'BINDING SITE FOR RESIDUE MG 0 8049'  
FC6 Software 0 MG  8050 ? 2 'BINDING SITE FOR RESIDUE MG 0 8050'  
FC7 Software 0 MG  8051 ? 4 'BINDING SITE FOR RESIDUE MG 0 8051'  
FC8 Software 0 MG  8052 ? 7 'BINDING SITE FOR RESIDUE MG 0 8052'  
FC9 Software 0 MG  8053 ? 6 'BINDING SITE FOR RESIDUE MG 0 8053'  
GC1 Software 0 MG  8054 ? 6 'BINDING SITE FOR RESIDUE MG 0 8054'  
GC2 Software 0 MG  8056 ? 6 'BINDING SITE FOR RESIDUE MG 0 8056'  
GC3 Software 0 MG  8057 ? 6 'BINDING SITE FOR RESIDUE MG 0 8057'  
GC4 Software 0 MG  8058 ? 6 'BINDING SITE FOR RESIDUE MG 0 8058'  
GC5 Software 0 MG  8059 ? 7 'BINDING SITE FOR RESIDUE MG 0 8059'  
GC6 Software 0 MG  8060 ? 7 'BINDING SITE FOR RESIDUE MG 0 8060'  
GC7 Software 0 MG  8061 ? 6 'BINDING SITE FOR RESIDUE MG 0 8061'  
GC8 Software 0 MG  8062 ? 6 'BINDING SITE FOR RESIDUE MG 0 8062'  
GC9 Software 0 MG  8063 ? 6 'BINDING SITE FOR RESIDUE MG 0 8063'  
HC1 Software 0 MG  8064 ? 6 'BINDING SITE FOR RESIDUE MG 0 8064'  
HC2 Software 0 MG  8066 ? 4 'BINDING SITE FOR RESIDUE MG 0 8066'  
HC3 Software 0 MG  8067 ? 6 'BINDING SITE FOR RESIDUE MG 0 8067'  
HC4 Software 0 MG  8068 ? 6 'BINDING SITE FOR RESIDUE MG 0 8068'  
HC5 Software 0 MG  8070 ? 5 'BINDING SITE FOR RESIDUE MG 0 8070'  
HC6 Software 0 MG  8071 ? 6 'BINDING SITE FOR RESIDUE MG 0 8071'  
HC7 Software 0 MG  8072 ? 6 'BINDING SITE FOR RESIDUE MG 0 8072'  
HC8 Software 0 MG  8074 ? 6 'BINDING SITE FOR RESIDUE MG 0 8074'  
HC9 Software 0 MG  8075 ? 6 'BINDING SITE FOR RESIDUE MG 0 8075'  
IC1 Software 0 MG  8077 ? 6 'BINDING SITE FOR RESIDUE MG 0 8077'  
IC2 Software 0 MG  8079 ? 6 'BINDING SITE FOR RESIDUE MG 0 8079'  
IC3 Software 0 MG  8080 ? 6 'BINDING SITE FOR RESIDUE MG 0 8080'  
IC4 Software 0 MG  8081 ? 5 'BINDING SITE FOR RESIDUE MG 0 8081'  
IC5 Software 0 MG  8082 ? 6 'BINDING SITE FOR RESIDUE MG 0 8082'  
IC6 Software 0 MG  8083 ? 6 'BINDING SITE FOR RESIDUE MG 0 8083'  
IC7 Software 0 MG  8084 ? 6 'BINDING SITE FOR RESIDUE MG 0 8084'  
IC8 Software 0 MG  8085 ? 8 'BINDING SITE FOR RESIDUE MG 0 8085'  
IC9 Software 0 MG  8086 ? 6 'BINDING SITE FOR RESIDUE MG 0 8086'  
JC1 Software 0 MG  8087 ? 3 'BINDING SITE FOR RESIDUE MG 0 8087'  
JC2 Software 0 MG  8088 ? 6 'BINDING SITE FOR RESIDUE MG 0 8088'  
JC3 Software 0 MG  8089 ? 7 'BINDING SITE FOR RESIDUE MG 0 8089'  
JC4 Software 0 MG  8090 ? 4 'BINDING SITE FOR RESIDUE MG 0 8090'  
JC5 Software 0 MG  8091 ? 6 'BINDING SITE FOR RESIDUE MG 0 8091'  
JC6 Software 0 MG  8092 ? 4 'BINDING SITE FOR RESIDUE MG 0 8092'  
JC7 Software 0 MG  8093 ? 6 'BINDING SITE FOR RESIDUE MG 0 8093'  
JC8 Software 0 MG  8094 ? 4 'BINDING SITE FOR RESIDUE MG 0 8094'  
JC9 Software 0 MG  8096 ? 7 'BINDING SITE FOR RESIDUE MG 0 8096'  
KC1 Software 0 MG  8097 ? 6 'BINDING SITE FOR RESIDUE MG 0 8097'  
KC2 Software 0 MG  8098 ? 7 'BINDING SITE FOR RESIDUE MG 0 8098'  
KC3 Software 0 MG  8099 ? 4 'BINDING SITE FOR RESIDUE MG 0 8099'  
KC4 Software 0 MG  8100 ? 5 'BINDING SITE FOR RESIDUE MG 0 8100'  
KC5 Software 0 MG  8101 ? 6 'BINDING SITE FOR RESIDUE MG 0 8101'  
KC6 Software 0 MG  8102 ? 6 'BINDING SITE FOR RESIDUE MG 0 8102'  
KC7 Software 0 MG  8103 ? 4 'BINDING SITE FOR RESIDUE MG 0 8103'  
KC8 Software 0 MG  8104 ? 3 'BINDING SITE FOR RESIDUE MG 0 8104'  
KC9 Software 0 MG  8105 ? 7 'BINDING SITE FOR RESIDUE MG 0 8105'  
LC1 Software 0 MG  8106 ? 6 'BINDING SITE FOR RESIDUE MG 0 8106'  
LC2 Software 0 MG  8107 ? 7 'BINDING SITE FOR RESIDUE MG 0 8107'  
LC3 Software 0 MG  8109 ? 6 'BINDING SITE FOR RESIDUE MG 0 8109'  
LC4 Software 0 MG  8110 ? 6 'BINDING SITE FOR RESIDUE MG 0 8110'  
LC5 Software 0 MG  8111 ? 6 'BINDING SITE FOR RESIDUE MG 0 8111'  
LC6 Software 0 MG  8112 ? 6 'BINDING SITE FOR RESIDUE MG 0 8112'  
LC7 Software 0 MG  8113 ? 6 'BINDING SITE FOR RESIDUE MG 0 8113'  
LC8 Software 0 MG  8114 ? 5 'BINDING SITE FOR RESIDUE MG 0 8114'  
LC9 Software 0 MG  8115 ? 8 'BINDING SITE FOR RESIDUE MG 0 8115'  
MC1 Software 0 MG  8116 ? 6 'BINDING SITE FOR RESIDUE MG 0 8116'  
MC2 Software 0 K   8401 ? 3 'BINDING SITE FOR RESIDUE K 0 8401'   
MC3 Software 0 K   8402 ? 6 'BINDING SITE FOR RESIDUE K 0 8402'   
MC4 Software 0 NA  8501 ? 5 'BINDING SITE FOR RESIDUE NA 0 8501'  
MC5 Software 0 NA  8502 ? 7 'BINDING SITE FOR RESIDUE NA 0 8502'  
MC6 Software 0 NA  8503 ? 6 'BINDING SITE FOR RESIDUE NA 0 8503'  
MC7 Software 0 NA  8505 ? 6 'BINDING SITE FOR RESIDUE NA 0 8505'  
MC8 Software 0 NA  8506 ? 5 'BINDING SITE FOR RESIDUE NA 0 8506'  
MC9 Software 0 NA  8507 ? 4 'BINDING SITE FOR RESIDUE NA 0 8507'  
NC1 Software 0 NA  8508 ? 5 'BINDING SITE FOR RESIDUE NA 0 8508'  
NC2 Software 0 NA  8510 ? 4 'BINDING SITE FOR RESIDUE NA 0 8510'  
NC3 Software 0 NA  8511 ? 5 'BINDING SITE FOR RESIDUE NA 0 8511'  
NC4 Software 0 NA  8513 ? 5 'BINDING SITE FOR RESIDUE NA 0 8513'  
NC5 Software 0 NA  8514 ? 5 'BINDING SITE FOR RESIDUE NA 0 8514'  
NC6 Software 0 NA  8515 ? 4 'BINDING SITE FOR RESIDUE NA 0 8515'  
NC7 Software 0 NA  8516 ? 4 'BINDING SITE FOR RESIDUE NA 0 8516'  
NC8 Software 0 NA  8517 ? 6 'BINDING SITE FOR RESIDUE NA 0 8517'  
NC9 Software 0 NA  8518 ? 6 'BINDING SITE FOR RESIDUE NA 0 8518'  
OC1 Software 0 NA  8519 ? 6 'BINDING SITE FOR RESIDUE NA 0 8519'  
OC2 Software 0 NA  8520 ? 8 'BINDING SITE FOR RESIDUE NA 0 8520'  
OC3 Software 0 NA  8521 ? 5 'BINDING SITE FOR RESIDUE NA 0 8521'  
OC4 Software 0 NA  8523 ? 7 'BINDING SITE FOR RESIDUE NA 0 8523'  
OC5 Software 0 NA  8524 ? 5 'BINDING SITE FOR RESIDUE NA 0 8524'  
OC6 Software 0 NA  8525 ? 6 'BINDING SITE FOR RESIDUE NA 0 8525'  
OC7 Software 0 NA  8526 ? 4 'BINDING SITE FOR RESIDUE NA 0 8526'  
OC8 Software 0 NA  8527 ? 7 'BINDING SITE FOR RESIDUE NA 0 8527'  
OC9 Software 0 NA  8528 ? 5 'BINDING SITE FOR RESIDUE NA 0 8528'  
PC1 Software 0 NA  8529 ? 4 'BINDING SITE FOR RESIDUE NA 0 8529'  
PC2 Software 0 NA  8530 ? 4 'BINDING SITE FOR RESIDUE NA 0 8530'  
PC3 Software 0 NA  8531 ? 5 'BINDING SITE FOR RESIDUE NA 0 8531'  
PC4 Software 0 NA  8532 ? 6 'BINDING SITE FOR RESIDUE NA 0 8532'  
PC5 Software 0 NA  8533 ? 4 'BINDING SITE FOR RESIDUE NA 0 8533'  
PC6 Software 0 NA  8534 ? 5 'BINDING SITE FOR RESIDUE NA 0 8534'  
PC7 Software 0 NA  8535 ? 5 'BINDING SITE FOR RESIDUE NA 0 8535'  
PC8 Software 0 NA  8536 ? 6 'BINDING SITE FOR RESIDUE NA 0 8536'  
PC9 Software 0 NA  8539 ? 7 'BINDING SITE FOR RESIDUE NA 0 8539'  
QC1 Software 0 NA  8540 ? 3 'BINDING SITE FOR RESIDUE NA 0 8540'  
QC2 Software 0 NA  8541 ? 3 'BINDING SITE FOR RESIDUE NA 0 8541'  
QC3 Software 0 NA  8542 ? 4 'BINDING SITE FOR RESIDUE NA 0 8542'  
QC4 Software 0 NA  8544 ? 6 'BINDING SITE FOR RESIDUE NA 0 8544'  
QC5 Software 0 NA  8549 ? 5 'BINDING SITE FOR RESIDUE NA 0 8549'  
QC6 Software 0 NA  8550 ? 4 'BINDING SITE FOR RESIDUE NA 0 8550'  
QC7 Software 0 NA  8552 ? 5 'BINDING SITE FOR RESIDUE NA 0 8552'  
QC8 Software 0 NA  8553 ? 6 'BINDING SITE FOR RESIDUE NA 0 8553'  
QC9 Software 0 NA  8554 ? 5 'BINDING SITE FOR RESIDUE NA 0 8554'  
RC1 Software 0 NA  8555 ? 4 'BINDING SITE FOR RESIDUE NA 0 8555'  
RC2 Software 0 NA  8556 ? 5 'BINDING SITE FOR RESIDUE NA 0 8556'  
RC3 Software 0 NA  8557 ? 4 'BINDING SITE FOR RESIDUE NA 0 8557'  
RC4 Software 0 NA  8558 ? 7 'BINDING SITE FOR RESIDUE NA 0 8558'  
RC5 Software 0 NA  8559 ? 5 'BINDING SITE FOR RESIDUE NA 0 8559'  
RC6 Software 0 NA  8560 ? 5 'BINDING SITE FOR RESIDUE NA 0 8560'  
RC7 Software 0 NA  8561 ? 5 'BINDING SITE FOR RESIDUE NA 0 8561'  
RC8 Software 0 NA  8562 ? 5 'BINDING SITE FOR RESIDUE NA 0 8562'  
RC9 Software 0 NA  8563 ? 3 'BINDING SITE FOR RESIDUE NA 0 8563'  
SC1 Software 0 NA  8564 ? 5 'BINDING SITE FOR RESIDUE NA 0 8564'  
SC2 Software 0 NA  8565 ? 6 'BINDING SITE FOR RESIDUE NA 0 8565'  
SC3 Software 0 NA  8566 ? 7 'BINDING SITE FOR RESIDUE NA 0 8566'  
SC4 Software 0 NA  8567 ? 6 'BINDING SITE FOR RESIDUE NA 0 8567'  
SC5 Software 0 NA  8568 ? 5 'BINDING SITE FOR RESIDUE NA 0 8568'  
SC6 Software 0 NA  8569 ? 7 'BINDING SITE FOR RESIDUE NA 0 8569'  
SC7 Software 0 NA  8570 ? 5 'BINDING SITE FOR RESIDUE NA 0 8570'  
SC8 Software 0 NA  8571 ? 5 'BINDING SITE FOR RESIDUE NA 0 8571'  
SC9 Software 0 NA  8572 ? 5 'BINDING SITE FOR RESIDUE NA 0 8572'  
TC1 Software 0 NA  8573 ? 7 'BINDING SITE FOR RESIDUE NA 0 8573'  
TC2 Software 0 NA  8574 ? 4 'BINDING SITE FOR RESIDUE NA 0 8574'  
TC3 Software 0 NA  8575 ? 5 'BINDING SITE FOR RESIDUE NA 0 8575'  
TC4 Software 0 NA  8576 ? 8 'BINDING SITE FOR RESIDUE NA 0 8576'  
TC5 Software 0 NA  8577 ? 4 'BINDING SITE FOR RESIDUE NA 0 8577'  
TC6 Software 0 NA  8578 ? 6 'BINDING SITE FOR RESIDUE NA 0 8578'  
TC7 Software 0 NA  8579 ? 5 'BINDING SITE FOR RESIDUE NA 0 8579'  
TC8 Software 0 NA  8581 ? 8 'BINDING SITE FOR RESIDUE NA 0 8581'  
TC9 Software 0 NA  8582 ? 3 'BINDING SITE FOR RESIDUE NA 0 8582'  
UC1 Software 0 NA  8584 ? 4 'BINDING SITE FOR RESIDUE NA 0 8584'  
UC2 Software 0 NA  8585 ? 3 'BINDING SITE FOR RESIDUE NA 0 8585'  
UC3 Software 0 CL  8803 ? 2 'BINDING SITE FOR RESIDUE CL 0 8803'  
UC4 Software 0 CL  8805 ? 2 'BINDING SITE FOR RESIDUE CL 0 8805'  
UC5 Software 0 CL  8811 ? 3 'BINDING SITE FOR RESIDUE CL 0 8811'  
UC6 Software 0 CL  8812 ? 5 'BINDING SITE FOR RESIDUE CL 0 8812'  
UC7 Software 0 CL  8813 ? 4 'BINDING SITE FOR RESIDUE CL 0 8813'  
UC8 Software 0 CL  8814 ? 2 'BINDING SITE FOR RESIDUE CL 0 8814'  
UC9 Software 0 CL  8815 ? 3 'BINDING SITE FOR RESIDUE CL 0 8815'  
VC1 Software 0 CL  8816 ? 3 'BINDING SITE FOR RESIDUE CL 0 8816'  
VC2 Software 0 CL  8817 ? 4 'BINDING SITE FOR RESIDUE CL 0 8817'  
VC3 Software 0 CL  8822 ? 3 'BINDING SITE FOR RESIDUE CL 0 8822'  
VC4 Software 9 MG  8095 ? 4 'BINDING SITE FOR RESIDUE MG 9 8095'  
VC5 Software 9 NA  8551 ? 1 'BINDING SITE FOR RESIDUE NA 9 8551'  
VC6 Software 9 NA  8583 ? 5 'BINDING SITE FOR RESIDUE NA 9 8583'  
VC7 Software A MG  8065 ? 6 'BINDING SITE FOR RESIDUE MG A 8065'  
VC8 Software A NA  8545 ? 7 'BINDING SITE FOR RESIDUE NA A 8545'  
VC9 Software A CL  8809 ? 1 'BINDING SITE FOR RESIDUE CL A 8809'  
WC1 Software B MG  8055 ? 6 'BINDING SITE FOR RESIDUE MG B 8055'  
WC2 Software B CL  8819 ? 3 'BINDING SITE FOR RESIDUE CL B 8819'  
WC3 Software C NA  8504 ? 3 'BINDING SITE FOR RESIDUE NA C 8504'  
WC4 Software H NA  8509 ? 6 'BINDING SITE FOR RESIDUE NA H 8509'  
WC5 Software H NA  8522 ? 2 'BINDING SITE FOR RESIDUE NA H 8522'  
WC6 Software J NA  8546 ? 6 'BINDING SITE FOR RESIDUE NA J 8546'  
WC7 Software J CL  8801 ? 3 'BINDING SITE FOR RESIDUE CL J 8801'  
WC8 Software J CL  8802 ? 2 'BINDING SITE FOR RESIDUE CL J 8802'  
WC9 Software J CL  8821 ? 4 'BINDING SITE FOR RESIDUE CL J 8821'  
XC1 Software K MG  8069 ? 6 'BINDING SITE FOR RESIDUE MG K 8069'  
XC2 Software L NA  8580 ? 6 'BINDING SITE FOR RESIDUE NA L 8580'  
XC3 Software L CL  8810 ? 1 'BINDING SITE FOR RESIDUE CL L 8810'  
XC4 Software M NA  8547 ? 5 'BINDING SITE FOR RESIDUE NA M 8547'  
XC5 Software M CL  8818 ? 5 'BINDING SITE FOR RESIDUE CL M 8818'  
XC6 Software N CL  8807 ? 4 'BINDING SITE FOR RESIDUE CL N 8807'  
XC7 Software O CD  8705 ? 3 'BINDING SITE FOR RESIDUE CD O 8705'  
XC8 Software O CL  8808 ? 1 'BINDING SITE FOR RESIDUE CL O 8808'  
XC9 Software Q NA  8548 ? 5 'BINDING SITE FOR RESIDUE NA Q 8548'  
YC1 Software R NA  8537 ? 5 'BINDING SITE FOR RESIDUE NA R 8537'  
YC2 Software R NA  8538 ? 6 'BINDING SITE FOR RESIDUE NA R 8538'  
YC3 Software R NA  8586 ? 3 'BINDING SITE FOR RESIDUE NA R 8586'  
YC4 Software R CL  8806 ? 2 'BINDING SITE FOR RESIDUE CL R 8806'  
YC5 Software S NA  8512 ? 3 'BINDING SITE FOR RESIDUE NA S 8512'  
YC6 Software T MG  8073 ? 6 'BINDING SITE FOR RESIDUE MG T 8073'  
YC7 Software T NA  8543 ? 7 'BINDING SITE FOR RESIDUE NA T 8543'  
YC8 Software U CD  8701 ? 4 'BINDING SITE FOR RESIDUE CD U 8701'  
YC9 Software Y MG  8108 ? 7 'BINDING SITE FOR RESIDUE MG Y 8108'  
ZC1 Software Y CL  8820 ? 1 'BINDING SITE FOR RESIDUE CL Y 8820'  
ZC2 Software Z CD  8703 ? 4 'BINDING SITE FOR RESIDUE CD Z 8703'  
ZC3 Software 1 CD  8702 ? 4 'BINDING SITE FOR RESIDUE CD 1 8702'  
ZC4 Software 2 MG  8076 ? 4 'BINDING SITE FOR RESIDUE MG 2 8076'  
ZC5 Software 3 MG  8078 ? 6 'BINDING SITE FOR RESIDUE MG 3 8078'  
ZC6 Software 3 CD  8704 ? 5 'BINDING SITE FOR RESIDUE CD 3 8704'  
ZC7 Software 3 CL  8804 ? 1 'BINDING SITE FOR RESIDUE CL 3 8804'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 7 C   A  839  ? C   0 839  . ? 1_555 ? 
2    AC1 7 A   A  2099 ? A   0 2099 . ? 1_555 ? 
3    AC1 7 A   A  2100 ? A   0 2100 . ? 1_555 ? 
4    AC1 7 A   A  2103 ? A   0 2103 . ? 1_555 ? 
5    AC1 7 A   A  2538 ? A   0 2538 . ? 1_555 ? 
6    AC1 7 G   A  2540 ? G   0 2540 . ? 1_555 ? 
7    AC1 7 G   A  2646 ? G   0 2646 . ? 1_555 ? 
8    AC2 7 G   A  2482 ? G   0 2482 . ? 1_555 ? 
9    AC2 7 A   A  2483 ? A   0 2483 . ? 1_555 ? 
10   AC2 7 C   A  2533 ? C   0 2533 . ? 1_555 ? 
11   AC2 7 C   A  2534 ? C   0 2534 . ? 1_555 ? 
12   AC2 7 HOH DJ .    ? HOH 0 3613 . ? 1_555 ? 
13   AC2 7 HOH DJ .    ? HOH 0 7737 . ? 1_555 ? 
14   AC2 7 HOH DJ .    ? HOH 0 9174 . ? 1_555 ? 
15   AC3 6 G   A  627  ? G   0 627  . ? 1_555 ? 
16   AC3 6 A   A  2483 ? A   0 2483 . ? 1_555 ? 
17   AC3 6 C   A  2534 ? C   0 2534 . ? 1_555 ? 
18   AC3 6 HOH DJ .    ? HOH 0 4320 . ? 1_555 ? 
19   AC3 6 HOH DJ .    ? HOH 0 7715 . ? 1_555 ? 
20   AC3 6 HOH DJ .    ? HOH 0 7716 . ? 1_555 ? 
21   AC4 6 A   A  876  ? A   0 876  . ? 1_555 ? 
22   AC4 6 G   A  877  ? G   0 877  . ? 1_555 ? 
23   AC4 6 A   A  2624 ? A   0 2624 . ? 1_555 ? 
24   AC4 6 HOH DJ .    ? HOH 0 3663 . ? 1_555 ? 
25   AC4 6 HOH FJ .    ? HOH A 8811 . ? 1_555 ? 
26   AC4 6 HOH FJ .    ? HOH A 8832 . ? 1_555 ? 
27   AC5 6 G   A  456  ? G   0 456  . ? 1_555 ? 
28   AC5 6 A   A  459  ? A   0 459  . ? 1_555 ? 
29   AC5 6 HOH DJ .    ? HOH 0 3780 . ? 1_555 ? 
30   AC5 6 HOH DJ .    ? HOH 0 7722 . ? 1_555 ? 
31   AC5 6 HOH DJ .    ? HOH 0 9045 . ? 1_555 ? 
32   AC5 6 HOH DJ .    ? HOH 0 9781 . ? 1_555 ? 
33   AC6 6 A   A  1836 ? A   0 1836 . ? 1_555 ? 
34   AC6 6 U   A  1838 ? U   0 1838 . ? 1_555 ? 
35   AC6 6 A   A  1839 ? A   0 1839 . ? 1_555 ? 
36   AC6 6 HOH DJ .    ? HOH 0 3609 . ? 1_555 ? 
37   AC6 6 HOH DJ .    ? HOH 0 7738 . ? 1_555 ? 
38   AC6 6 HOH DJ .    ? HOH 0 7739 . ? 1_555 ? 
39   AC7 6 U   A  821  ? U   0 821  . ? 1_555 ? 
40   AC7 6 C   A  822  ? C   0 822  . ? 1_555 ? 
41   AC7 6 G   A  854  ? G   0 854  . ? 1_555 ? 
42   AC7 6 HOH DJ .    ? HOH 0 3615 . ? 1_555 ? 
43   AC7 6 HOH DJ .    ? HOH 0 3751 . ? 1_555 ? 
44   AC7 6 HOH DJ .    ? HOH 0 9814 . ? 1_555 ? 
45   AC8 6 U   A  832  ? U   0 832  . ? 1_555 ? 
46   AC8 6 A   A  1839 ? A   0 1839 . ? 1_555 ? 
47   AC8 6 A   A  1840 ? A   0 1840 . ? 1_555 ? 
48   AC8 6 HOH DJ .    ? HOH 0 3358 . ? 1_555 ? 
49   AC8 6 HOH DJ .    ? HOH 0 7727 . ? 1_555 ? 
50   AC8 6 HOH DJ .    ? HOH 0 9006 . ? 1_555 ? 
51   AC9 6 U   A  919  ? U   0 919  . ? 1_555 ? 
52   AC9 6 C   A  2464 ? C   0 2464 . ? 1_555 ? 
53   AC9 6 A   A  2465 ? A   0 2465 . ? 1_555 ? 
54   AC9 6 HOH DJ .    ? HOH 0 3627 . ? 1_555 ? 
55   AC9 6 HOH DJ .    ? HOH 0 7731 . ? 1_555 ? 
56   AC9 6 HOH DJ .    ? HOH 0 7814 . ? 1_555 ? 
57   BC1 8 U   A  2610 ? U   0 2610 . ? 1_555 ? 
58   BC1 8 G   A  2611 ? G   0 2611 . ? 1_555 ? 
59   BC1 8 A   A  2612 ? A   0 2612 . ? 1_555 ? 
60   BC1 8 HOH DJ .    ? HOH 0 3736 . ? 1_555 ? 
61   BC1 8 HOH DJ .    ? HOH 0 7398 . ? 1_555 ? 
62   BC1 8 HOH DJ .    ? HOH 0 7732 . ? 1_555 ? 
63   BC1 8 HOH DJ .    ? HOH 0 7733 . ? 1_555 ? 
64   BC1 8 NA  FG .    ? NA  0 8558 . ? 1_555 ? 
65   BC2 6 G   A  836  ? G   0 836  . ? 1_555 ? 
66   BC2 6 U   A  2615 ? U   0 2615 . ? 1_555 ? 
67   BC2 6 HOH DJ .    ? HOH 0 3837 . ? 1_555 ? 
68   BC2 6 HOH DJ .    ? HOH 0 9364 . ? 1_555 ? 
69   BC2 6 GLN D  231  ? GLN B 230  . ? 1_555 ? 
70   BC2 6 HOH GJ .    ? HOH B 8825 . ? 1_555 ? 
71   BC3 6 G   A  824  ? G   0 824  . ? 1_555 ? 
72   BC3 6 G   A  854  ? G   0 854  . ? 1_555 ? 
73   BC3 6 HOH DJ .    ? HOH 0 3956 . ? 1_555 ? 
74   BC3 6 HOH DJ .    ? HOH 0 4286 . ? 1_555 ? 
75   BC3 6 HOH DJ .    ? HOH 0 4419 . ? 1_555 ? 
76   BC3 6 HOH DJ .    ? HOH 0 4522 . ? 1_555 ? 
77   BC4 6 G   A  28   ? G   0 28   . ? 1_555 ? 
78   BC4 6 HOH DJ .    ? HOH 0 3229 . ? 1_555 ? 
79   BC4 6 HOH DJ .    ? HOH 0 3645 . ? 1_555 ? 
80   BC4 6 HOH DJ .    ? HOH 0 7815 . ? 1_555 ? 
81   BC4 6 HOH DJ .    ? HOH 0 9037 . ? 1_555 ? 
82   BC4 6 HOH DJ .    ? HOH 0 9639 . ? 1_555 ? 
83   BC5 6 G   A  877  ? G   0 877  . ? 1_555 ? 
84   BC5 6 G   A  2623 ? G   0 2623 . ? 1_555 ? 
85   BC5 6 HOH DJ .    ? HOH 0 3639 . ? 1_555 ? 
86   BC5 6 HOH DJ .    ? HOH 0 3652 . ? 1_555 ? 
87   BC5 6 HOH DJ .    ? HOH 0 7746 . ? 1_555 ? 
88   BC5 6 HOH DJ .    ? HOH 0 9019 . ? 1_555 ? 
89   BC6 7 A   A  2101 ? A   0 2101 . ? 1_555 ? 
90   BC6 7 G   A  2102 ? G   0 2102 . ? 1_555 ? 
91   BC6 7 G   A  2537 ? G   0 2537 . ? 1_555 ? 
92   BC6 7 HOH DJ .    ? HOH 0 3656 . ? 1_555 ? 
93   BC6 7 HOH DJ .    ? HOH 0 4159 . ? 1_555 ? 
94   BC6 7 HOH DJ .    ? HOH 0 7713 . ? 1_555 ? 
95   BC6 7 HOH DJ .    ? HOH 0 9031 . ? 1_555 ? 
96   BC7 6 A   A  844  ? A   0 844  . ? 1_555 ? 
97   BC7 6 A   A  1689 ? A   0 1689 . ? 1_555 ? 
98   BC7 6 HOH DJ .    ? HOH 0 3619 . ? 1_555 ? 
99   BC7 6 HOH DJ .    ? HOH 0 7748 . ? 1_555 ? 
100  BC7 6 HOH DJ .    ? HOH 0 9004 . ? 1_555 ? 
101  BC7 6 HOH DJ .    ? HOH 0 9022 . ? 1_555 ? 
102  BC8 6 A   A  1504 ? A   0 1504 . ? 1_555 ? 
103  BC8 6 A   A  1678 ? A   0 1678 . ? 1_555 ? 
104  BC8 6 C   A  1679 ? C   0 1679 . ? 1_555 ? 
105  BC8 6 HOH DJ .    ? HOH 0 3743 . ? 1_555 ? 
106  BC8 6 HOH DJ .    ? HOH 0 7740 . ? 1_555 ? 
107  BC8 6 HOH DJ .    ? HOH 0 7741 . ? 1_555 ? 
108  BC9 6 G   A  456  ? G   0 456  . ? 1_555 ? 
109  BC9 6 HOH DJ .    ? HOH 0 3941 . ? 1_555 ? 
110  BC9 6 HOH DJ .    ? HOH 0 7364 . ? 1_555 ? 
111  BC9 6 HOH DJ .    ? HOH 0 7723 . ? 1_555 ? 
112  BC9 6 HOH DJ .    ? HOH 0 9416 . ? 1_555 ? 
113  BC9 6 HOH HJ .    ? HOH C 8558 . ? 1_555 ? 
114  CC1 6 A   A  1291 ? A   0 1291 . ? 1_555 ? 
115  CC1 6 G   A  1292 ? G   0 1292 . ? 1_555 ? 
116  CC1 6 HOH DJ .    ? HOH 0 3223 . ? 1_555 ? 
117  CC1 6 HOH DJ .    ? HOH 0 3611 . ? 1_555 ? 
118  CC1 6 HOH DJ .    ? HOH 0 7434 . ? 1_555 ? 
119  CC1 6 HOH DJ .    ? HOH 0 7816 . ? 1_555 ? 
120  CC2 6 A   A  2011 ? A   0 2011 . ? 1_555 ? 
121  CC2 6 HOH DJ .    ? HOH 0 4146 . ? 1_555 ? 
122  CC2 6 HOH DJ .    ? HOH 0 7211 . ? 1_555 ? 
123  CC2 6 HOH DJ .    ? HOH 0 7742 . ? 1_555 ? 
124  CC2 6 HOH DJ .    ? HOH 0 7743 . ? 1_555 ? 
125  CC2 6 HOH DJ .    ? HOH 0 7744 . ? 1_555 ? 
126  CC3 6 C   A  1830 ? C   0 1830 . ? 1_555 ? 
127  CC3 6 HOH DJ .    ? HOH 0 7726 . ? 1_555 ? 
128  CC3 6 HOH DJ .    ? HOH 0 7745 . ? 1_555 ? 
129  CC3 6 HOH DJ .    ? HOH 0 9121 . ? 1_555 ? 
130  CC3 6 HOH DJ .    ? HOH 0 9124 . ? 1_555 ? 
131  CC3 6 HOH DJ .    ? HOH 0 9195 . ? 1_555 ? 
132  CC4 6 G   A  2304 ? G   0 2304 . ? 1_555 ? 
133  CC4 6 HOH DJ .    ? HOH 0 3635 . ? 1_555 ? 
134  CC4 6 HOH DJ .    ? HOH 0 3636 . ? 1_555 ? 
135  CC4 6 HOH DJ .    ? HOH 0 7729 . ? 1_555 ? 
136  CC4 6 HOH DJ .    ? HOH 0 7730 . ? 1_555 ? 
137  CC4 6 HOH DJ .    ? HOH 0 9969 . ? 1_555 ? 
138  CC5 6 G   A  2097 ? G   0 2097 . ? 1_555 ? 
139  CC5 6 G   A  2540 ? G   0 2540 . ? 1_555 ? 
140  CC5 6 HOH DJ .    ? HOH 0 3867 . ? 1_555 ? 
141  CC5 6 HOH DJ .    ? HOH 0 7734 . ? 1_555 ? 
142  CC5 6 HOH DJ .    ? HOH 0 9109 . ? 1_555 ? 
143  CC5 6 HOH DJ .    ? HOH 0 9458 . ? 1_555 ? 
144  CC6 7 G   A  2616 ? G   0 2616 . ? 1_555 ? 
145  CC6 7 G   A  2617 ? G   0 2617 . ? 1_555 ? 
146  CC6 7 G   A  2618 ? G   0 2618 . ? 1_555 ? 
147  CC6 7 HOH DJ .    ? HOH 0 3625 . ? 1_555 ? 
148  CC6 7 HOH DJ .    ? HOH 0 3819 . ? 1_555 ? 
149  CC6 7 HOH DJ .    ? HOH 0 7750 . ? 1_555 ? 
150  CC6 7 HOH DJ .    ? HOH 0 7751 . ? 1_555 ? 
151  CC7 5 A   A  1381 ? A   0 1381 . ? 1_555 ? 
152  CC7 5 HOH DJ .    ? HOH 0 5107 . ? 1_555 ? 
153  CC7 5 HOH DJ .    ? HOH 0 7817 . ? 1_555 ? 
154  CC7 5 HOH DJ .    ? HOH 0 7818 . ? 1_555 ? 
155  CC7 5 HOH DJ .    ? HOH 0 9942 . ? 1_555 ? 
156  CC8 6 U   A  1120 ? U   0 1120 . ? 1_555 ? 
157  CC8 6 G   A  1121 ? G   0 1121 . ? 1_555 ? 
158  CC8 6 HOH DJ .    ? HOH 0 4164 . ? 1_555 ? 
159  CC8 6 HOH DJ .    ? HOH 0 7752 . ? 1_555 ? 
160  CC8 6 HOH DJ .    ? HOH 0 7753 . ? 1_555 ? 
161  CC8 6 HOH DJ .    ? HOH 0 7819 . ? 1_555 ? 
162  CC9 7 C   A  2608 ? C   0 2608 . ? 1_555 ? 
163  CC9 7 G   A  2609 ? G   0 2609 . ? 1_555 ? 
164  CC9 7 U   A  2610 ? U   0 2610 . ? 1_555 ? 
165  CC9 7 HOH DJ .    ? HOH 0 7754 . ? 1_555 ? 
166  CC9 7 HOH DJ .    ? HOH 0 7755 . ? 1_555 ? 
167  CC9 7 HOH DJ .    ? HOH 0 7756 . ? 1_555 ? 
168  CC9 7 HOH DJ .    ? HOH 0 9395 . ? 1_555 ? 
169  DC1 6 C   A  240  ? C   0 240  . ? 1_555 ? 
170  DC1 6 G   A  269  ? G   0 269  . ? 1_555 ? 
171  DC1 6 HOH DJ .    ? HOH 0 3870 . ? 1_555 ? 
172  DC1 6 HOH DJ .    ? HOH 0 4011 . ? 1_555 ? 
173  DC1 6 HOH DJ .    ? HOH 0 4151 . ? 1_555 ? 
174  DC1 6 HOH DJ .    ? HOH 0 7820 . ? 1_555 ? 
175  DC2 6 A   A  1448 ? A   0 1448 . ? 1_555 ? 
176  DC2 6 U   A  1677 ? U   0 1677 . ? 1_555 ? 
177  DC2 6 HOH DJ .    ? HOH 0 3675 . ? 1_555 ? 
178  DC2 6 HOH DJ .    ? HOH 0 3696 . ? 1_555 ? 
179  DC2 6 HOH DJ .    ? HOH 0 3708 . ? 1_555 ? 
180  DC2 6 HOH XJ .    ? HOH S 8549 . ? 1_555 ? 
181  DC3 7 A   A  1502 ? A   0 1502 . ? 1_555 ? 
182  DC3 7 U   A  1503 ? U   0 1503 . ? 1_555 ? 
183  DC3 7 C   A  1679 ? C   0 1679 . ? 1_555 ? 
184  DC3 7 HOH DJ .    ? HOH 0 7758 . ? 1_555 ? 
185  DC3 7 HOH DJ .    ? HOH 0 7759 . ? 1_555 ? 
186  DC3 7 HOH DJ .    ? HOH 0 7760 . ? 1_555 ? 
187  DC3 7 HOH DJ .    ? HOH 0 7761 . ? 1_555 ? 
188  DC4 6 U   A  1748 ? U   0 1748 . ? 1_555 ? 
189  DC4 6 U   A  1749 ? U   0 1749 . ? 1_555 ? 
190  DC4 6 HOH DJ .    ? HOH 0 3637 . ? 1_555 ? 
191  DC4 6 HOH DJ .    ? HOH 0 7724 . ? 1_555 ? 
192  DC4 6 HOH DJ .    ? HOH 0 7725 . ? 1_555 ? 
193  DC4 6 HOH DJ .    ? HOH 0 7735 . ? 1_555 ? 
194  DC5 6 U   A  777  ? U   0 777  . ? 1_555 ? 
195  DC5 6 C   A  778  ? C   0 778  . ? 1_555 ? 
196  DC5 6 HOH DJ .    ? HOH 0 3278 . ? 1_555 ? 
197  DC5 6 HOH DJ .    ? HOH 0 7763 . ? 1_555 ? 
198  DC5 6 HOH DJ .    ? HOH 0 7764 . ? 1_555 ? 
199  DC5 6 HOH DJ .    ? HOH 0 7765 . ? 1_555 ? 
200  DC6 6 U   A  2115 ? U   0 2115 . ? 1_555 ? 
201  DC6 6 HOH DJ .    ? HOH 0 3786 . ? 1_555 ? 
202  DC6 6 HOH DJ .    ? HOH 0 4185 . ? 1_555 ? 
203  DC6 6 HOH DJ .    ? HOH 0 9993 . ? 1_555 ? 
204  DC6 6 HOH FJ .    ? HOH A 8848 . ? 1_555 ? 
205  DC6 6 HOH FJ .    ? HOH A 8926 . ? 1_555 ? 
206  DC7 6 A   A  1747 ? A   0 1747 . ? 1_555 ? 
207  DC7 6 U   A  1748 ? U   0 1748 . ? 1_555 ? 
208  DC7 6 U   A  1749 ? U   0 1749 . ? 1_555 ? 
209  DC7 6 G   A  2585 ? G   0 2585 . ? 1_555 ? 
210  DC7 6 HOH DJ .    ? HOH 0 3814 . ? 1_555 ? 
211  DC7 6 HOH DJ .    ? HOH 0 9679 . ? 1_555 ? 
212  DC8 6 A   A  2302 ? A   0 2302 . ? 1_555 ? 
213  DC8 6 A   A  2303 ? A   0 2303 . ? 1_555 ? 
214  DC8 6 HOH DJ .    ? HOH 0 3640 . ? 1_555 ? 
215  DC8 6 HOH DJ .    ? HOH 0 3767 . ? 1_555 ? 
216  DC8 6 HOH DJ .    ? HOH 0 4857 . ? 1_555 ? 
217  DC8 6 HOH DJ .    ? HOH 0 7766 . ? 1_555 ? 
218  DC9 6 G   A  1484 ? G   0 1484 . ? 1_555 ? 
219  DC9 6 HOH DJ .    ? HOH 0 3713 . ? 1_555 ? 
220  DC9 6 HOH DJ .    ? HOH 0 7767 . ? 1_555 ? 
221  DC9 6 HOH DJ .    ? HOH 0 7768 . ? 1_555 ? 
222  DC9 6 HOH DJ .    ? HOH 0 7822 . ? 1_555 ? 
223  DC9 6 HOH DJ .    ? HOH 0 7823 . ? 1_555 ? 
224  EC1 6 G   A  956  ? G   0 956  . ? 1_555 ? 
225  EC1 6 HOH DJ .    ? HOH 0 3667 . ? 1_555 ? 
226  EC1 6 HOH DJ .    ? HOH 0 7769 . ? 1_555 ? 
227  EC1 6 HOH DJ .    ? HOH 0 7770 . ? 1_555 ? 
228  EC1 6 HOH DJ .    ? HOH 0 7771 . ? 1_555 ? 
229  EC1 6 HOH DJ .    ? HOH 0 9370 . ? 1_555 ? 
230  EC2 7 A   A  2553 ? A   0 2553 . ? 1_555 ? 
231  EC2 7 A   A  2576 ? A   0 2576 . ? 1_555 ? 
232  EC2 7 HOH DJ .    ? HOH 0 3138 . ? 1_555 ? 
233  EC2 7 HOH DJ .    ? HOH 0 3213 . ? 1_555 ? 
234  EC2 7 HOH DJ .    ? HOH 0 3646 . ? 1_555 ? 
235  EC2 7 HOH DJ .    ? HOH 0 7824 . ? 1_555 ? 
236  EC2 7 HOH DJ .    ? HOH 0 9077 . ? 1_555 ? 
237  EC3 7 G   A  2271 ? G   0 2271 . ? 1_555 ? 
238  EC3 7 HOH DJ .    ? HOH 0 3623 . ? 1_555 ? 
239  EC3 7 HOH DJ .    ? HOH 0 3647 . ? 1_555 ? 
240  EC3 7 HOH DJ .    ? HOH 0 3668 . ? 1_555 ? 
241  EC3 7 HOH DJ .    ? HOH 0 3670 . ? 1_555 ? 
242  EC3 7 HOH DJ .    ? HOH 0 7773 . ? 1_555 ? 
243  EC3 7 HOH DJ .    ? HOH 0 9283 . ? 1_555 ? 
244  EC4 6 U   A  115  ? U   0 115  . ? 1_555 ? 
245  EC4 6 HOH DJ .    ? HOH 0 3962 . ? 1_555 ? 
246  EC4 6 HOH DJ .    ? HOH 0 5086 . ? 1_555 ? 
247  EC4 6 HOH DJ .    ? HOH 0 7774 . ? 1_555 ? 
248  EC4 6 HOH DJ .    ? HOH 0 7775 . ? 1_555 ? 
249  EC4 6 HOH DJ .    ? HOH 0 9916 . ? 1_555 ? 
250  EC5 6 U   A  392  ? U   0 392  . ? 1_555 ? 
251  EC5 6 HOH DJ .    ? HOH 0 3787 . ? 1_555 ? 
252  EC5 6 HOH DJ .    ? HOH 0 4636 . ? 1_555 ? 
253  EC5 6 HOH DJ .    ? HOH 0 7826 . ? 1_555 ? 
254  EC5 6 HOH DJ .    ? HOH 0 7827 . ? 1_555 ? 
255  EC5 6 HOH DJ .    ? HOH 0 9693 . ? 1_555 ? 
256  EC6 7 C   A  195  ? C   0 195  . ? 1_555 ? 
257  EC6 7 G   A  196  ? G   0 196  . ? 1_555 ? 
258  EC6 7 A   A  227  ? A   0 227  . ? 1_555 ? 
259  EC6 7 C   A  228  ? C   0 228  . ? 1_555 ? 
260  EC6 7 HOH DJ .    ? HOH 0 4103 . ? 1_555 ? 
261  EC6 7 HOH DJ .    ? HOH 0 4196 . ? 1_555 ? 
262  EC6 7 HOH DJ .    ? HOH 0 5362 . ? 1_555 ? 
263  EC7 6 U   A  1309 ? U   0 1309 . ? 1_555 ? 
264  EC7 6 U   A  1346 ? U   0 1346 . ? 1_555 ? 
265  EC7 6 HOH DJ .    ? HOH 0 3655 . ? 1_555 ? 
266  EC7 6 HOH DJ .    ? HOH 0 4415 . ? 1_555 ? 
267  EC7 6 HOH DJ .    ? HOH 0 7776 . ? 1_555 ? 
268  EC7 6 HOH DJ .    ? HOH 0 9438 . ? 1_555 ? 
269  EC8 6 G   A  816  ? G   0 816  . ? 1_555 ? 
270  EC8 6 G   A  817  ? G   0 817  . ? 1_555 ? 
271  EC8 6 HOH DJ .    ? HOH 0 7388 . ? 1_555 ? 
272  EC8 6 HOH DJ .    ? HOH 0 7828 . ? 1_555 ? 
273  EC8 6 MG  ZD .    ? MG  0 8105 . ? 1_555 ? 
274  EC8 6 HOH DJ .    ? HOH 0 9818 . ? 1_555 ? 
275  EC9 6 C   A  2048 ? C   0 2048 . ? 1_555 ? 
276  EC9 6 C   A  2088 ? C   0 2088 . ? 1_555 ? 
277  EC9 6 A   A  2089 ? A   0 2089 . ? 1_555 ? 
278  EC9 6 HOH DJ .    ? HOH 0 3297 . ? 1_555 ? 
279  EC9 6 GLY T  66   ? GLY R 65   . ? 1_555 ? 
280  EC9 6 HOH WJ .    ? HOH R 8886 . ? 1_555 ? 
281  FC1 5 G   A  1979 ? G   0 1979 . ? 1_555 ? 
282  FC1 5 HOH DJ .    ? HOH 0 7777 . ? 1_555 ? 
283  FC1 5 HOH DJ .    ? HOH 0 7829 . ? 1_555 ? 
284  FC1 5 HOH DJ .    ? HOH 0 7830 . ? 1_555 ? 
285  FC1 5 HOH DJ .    ? HOH 0 7831 . ? 1_555 ? 
286  FC2 4 G   A  1794 ? G   0 1794 . ? 1_555 ? 
287  FC2 4 HOH DJ .    ? HOH 0 7272 . ? 1_555 ? 
288  FC2 4 HOH DJ .    ? HOH 0 7832 . ? 1_555 ? 
289  FC2 4 HOH DJ .    ? HOH 0 7833 . ? 1_555 ? 
290  FC3 4 A   A  1098 ? A   0 1098 . ? 1_555 ? 
291  FC3 4 HOH DJ .    ? HOH 0 3132 . ? 1_555 ? 
292  FC3 4 HOH DJ .    ? HOH 0 6255 . ? 1_555 ? 
293  FC3 4 HOH DJ .    ? HOH 0 7847 . ? 1_555 ? 
294  FC4 6 A   A  2746 ? A   0 2746 . ? 1_555 ? 
295  FC4 6 U   A  2749 ? U   0 2749 . ? 1_555 ? 
296  FC4 6 G   A  2750 ? G   0 2750 . ? 1_555 ? 
297  FC4 6 HOH DJ .    ? HOH 0 5861 . ? 1_555 ? 
298  FC4 6 HOH DJ .    ? HOH 0 6247 . ? 1_555 ? 
299  FC4 6 HOH DJ .    ? HOH 0 7868 . ? 1_555 ? 
300  FC5 5 G   A  2421 ? G   0 2421 . ? 1_555 ? 
301  FC5 5 U   A  2422 ? U   0 2422 . ? 1_555 ? 
302  FC5 5 C   A  2423 ? C   0 2423 . ? 1_555 ? 
303  FC5 5 HOH DJ .    ? HOH 0 7835 . ? 1_555 ? 
304  FC5 5 HOH DJ .    ? HOH 0 7836 . ? 1_555 ? 
305  FC6 2 C   A  2248 ? C   0 2248 . ? 1_555 ? 
306  FC6 2 HOH DJ .    ? HOH 0 7295 . ? 1_555 ? 
307  FC7 4 G   A  641  ? G   0 641  . ? 1_555 ? 
308  FC7 4 HOH DJ .    ? HOH 0 4099 . ? 1_555 ? 
309  FC7 4 HOH DJ .    ? HOH 0 7778 . ? 1_555 ? 
310  FC7 4 HOH DJ .    ? HOH 0 7779 . ? 1_555 ? 
311  FC8 7 U   A  1125 ? U   0 1125 . ? 1_555 ? 
312  FC8 7 C   A  1129 ? C   0 1129 . ? 1_555 ? 
313  FC8 7 HOH DJ .    ? HOH 0 3621 . ? 1_555 ? 
314  FC8 7 HOH DJ .    ? HOH 0 7849 . ? 1_555 ? 
315  FC8 7 G   B  92   ? G   9 92   . ? 1_555 ? 
316  FC8 7 HOH EJ .    ? HOH 9 8590 . ? 1_555 ? 
317  FC8 7 HOH EJ .    ? HOH 9 8616 . ? 1_555 ? 
318  FC9 6 G   A  471  ? G   0 471  . ? 1_555 ? 
319  FC9 6 HOH DJ .    ? HOH 0 3045 . ? 1_555 ? 
320  FC9 6 HOH DJ .    ? HOH 0 4395 . ? 1_555 ? 
321  FC9 6 HOH DJ .    ? HOH 0 5600 . ? 1_555 ? 
322  FC9 6 HOH DJ .    ? HOH 0 9202 . ? 1_555 ? 
323  FC9 6 HOH DJ .    ? HOH 0 9241 . ? 1_555 ? 
324  GC1 6 C   A  162  ? C   0 162  . ? 1_555 ? 
325  GC1 6 U   A  2276 ? U   0 2276 . ? 1_555 ? 
326  GC1 6 HOH DJ .    ? HOH 0 7728 . ? 1_555 ? 
327  GC1 6 HOH DJ .    ? HOH 0 7780 . ? 1_555 ? 
328  GC1 6 HOH DJ .    ? HOH 0 7781 . ? 1_555 ? 
329  GC1 6 HOH DJ .    ? HOH 0 9434 . ? 1_555 ? 
330  GC2 6 A   A  2757 ? A   0 2757 . ? 1_555 ? 
331  GC2 6 HOH DJ .    ? HOH 0 3665 . ? 1_555 ? 
332  GC2 6 HOH DJ .    ? HOH 0 3971 . ? 1_555 ? 
333  GC2 6 HOH DJ .    ? HOH 0 7798 . ? 1_555 ? 
334  GC2 6 ASN D  336  ? ASN B 335  . ? 1_555 ? 
335  GC2 6 HOH GJ .    ? HOH B 8840 . ? 1_555 ? 
336  GC3 6 U   A  1883 ? U   0 1883 . ? 1_555 ? 
337  GC3 6 U   A  2012 ? U   0 2012 . ? 1_555 ? 
338  GC3 6 G   A  2013 ? G   0 2013 . ? 1_555 ? 
339  GC3 6 HOH DJ .    ? HOH 0 5000 . ? 1_555 ? 
340  GC3 6 GLN C  208  ? GLN A 207  . ? 1_555 ? 
341  GC3 6 HOH FJ .    ? HOH A 8929 . ? 1_555 ? 
342  GC4 6 G   A  2013 ? G   0 2013 . ? 1_555 ? 
343  GC4 6 HOH DJ .    ? HOH 0 3761 . ? 1_555 ? 
344  GC4 6 HOH DJ .    ? HOH 0 7782 . ? 1_555 ? 
345  GC4 6 HOH DJ .    ? HOH 0 7783 . ? 1_555 ? 
346  GC4 6 HOH FJ .    ? HOH A 8927 . ? 1_555 ? 
347  GC4 6 HOH FJ .    ? HOH A 8929 . ? 1_555 ? 
348  GC5 7 G   A  2618 ? G   0 2618 . ? 1_555 ? 
349  GC5 7 HOH DJ .    ? HOH 0 3719 . ? 1_555 ? 
350  GC5 7 HOH DJ .    ? HOH 0 4048 . ? 1_555 ? 
351  GC5 7 HOH DJ .    ? HOH 0 7736 . ? 1_555 ? 
352  GC5 7 MG  GD .    ? MG  0 8085 . ? 1_555 ? 
353  GC5 7 HOH DJ .    ? HOH 0 9036 . ? 1_555 ? 
354  GC5 7 HOH DJ .    ? HOH 0 9040 . ? 1_555 ? 
355  GC6 7 G   A  175  ? G   0 175  . ? 1_555 ? 
356  GC6 7 U   A  224  ? U   0 224  . ? 1_555 ? 
357  GC6 7 G   A  393  ? G   0 393  . ? 1_555 ? 
358  GC6 7 HOH DJ .    ? HOH 0 7784 . ? 1_555 ? 
359  GC6 7 HOH DJ .    ? HOH 0 7785 . ? 1_555 ? 
360  GC6 7 HOH DJ .    ? HOH 0 7786 . ? 1_555 ? 
361  GC6 7 HOH DJ .    ? HOH 0 9167 . ? 1_555 ? 
362  GC7 6 A   A  1369 ? A   0 1369 . ? 1_555 ? 
363  GC7 6 U   A  2650 ? U   0 2650 . ? 1_555 ? 
364  GC7 6 HOH DJ .    ? HOH 0 7787 . ? 1_555 ? 
365  GC7 6 HOH DJ .    ? HOH 0 7788 . ? 1_555 ? 
366  GC7 6 HOH DJ .    ? HOH 0 7789 . ? 1_555 ? 
367  GC7 6 HOH DJ .    ? HOH 0 9824 . ? 1_555 ? 
368  GC8 6 G   A  1489 ? G   0 1489 . ? 1_555 ? 
369  GC8 6 G   A  1491 ? G   0 1491 . ? 1_555 ? 
370  GC8 6 HOH DJ .    ? HOH 0 3630 . ? 1_555 ? 
371  GC8 6 HOH DJ .    ? HOH 0 3955 . ? 1_555 ? 
372  GC8 6 HOH DJ .    ? HOH 0 6157 . ? 1_555 ? 
373  GC8 6 HOH DJ .    ? HOH 0 9397 . ? 1_555 ? 
374  GC9 6 HOH DJ .    ? HOH 0 4176 . ? 1_555 ? 
375  GC9 6 HOH DJ .    ? HOH 0 6982 . ? 1_555 ? 
376  GC9 6 HOH DJ .    ? HOH 0 7405 . ? 1_555 ? 
377  GC9 6 HOH DJ .    ? HOH 0 7721 . ? 1_555 ? 
378  GC9 6 HOH DJ .    ? HOH 0 7797 . ? 1_555 ? 
379  GC9 6 HOH DJ .    ? HOH 0 7850 . ? 1_555 ? 
380  HC1 6 U   A  2277 ? U   0 2277 . ? 1_555 ? 
381  HC1 6 U   A  2278 ? U   0 2278 . ? 1_555 ? 
382  HC1 6 G   A  2471 ? G   0 2471 . ? 1_555 ? 
383  HC1 6 HOH DJ .    ? HOH 0 3750 . ? 1_555 ? 
384  HC1 6 HOH DJ .    ? HOH 0 3758 . ? 1_555 ? 
385  HC1 6 HOH DJ .    ? HOH 0 9591 . ? 1_555 ? 
386  HC2 4 C   A  1872 ? C   0 1872 . ? 1_555 ? 
387  HC2 4 G   A  1873 ? G   0 1873 . ? 1_555 ? 
388  HC2 4 HOH DJ .    ? HOH 0 7863 . ? 1_555 ? 
389  HC2 4 ASP C  27   ? ASP A 26   . ? 1_555 ? 
390  HC3 6 A   A  1845 ? A   0 1845 . ? 1_555 ? 
391  HC3 6 U   A  1846 ? U   0 1846 . ? 1_555 ? 
392  HC3 6 G   A  1884 ? G   0 1884 . ? 1_555 ? 
393  HC3 6 HOH DJ .    ? HOH 0 7791 . ? 1_555 ? 
394  HC3 6 ASN C  189  ? ASN A 188  . ? 1_555 ? 
395  HC3 6 ARG C  191  ? ARG A 190  . ? 1_555 ? 
396  HC4 6 A   A  2568 ? A   0 2568 . ? 1_555 ? 
397  HC4 6 HOH DJ .    ? HOH 0 3749 . ? 1_555 ? 
398  HC4 6 HOH DJ .    ? HOH 0 4811 . ? 1_555 ? 
399  HC4 6 HOH DJ .    ? HOH 0 6208 . ? 1_555 ? 
400  HC4 6 HOH DJ .    ? HOH 0 7851 . ? 1_555 ? 
401  HC4 6 HOH DJ .    ? HOH 0 9736 . ? 1_555 ? 
402  HC5 5 A   A  166  ? A   0 166  . ? 1_555 ? 
403  HC5 5 G   A  219  ? G   0 219  . ? 1_555 ? 
404  HC5 5 HOH DJ .    ? HOH 0 3815 . ? 1_555 ? 
405  HC5 5 HOH DJ .    ? HOH 0 4947 . ? 1_555 ? 
406  HC5 5 HOH DJ .    ? HOH 0 9122 . ? 1_555 ? 
407  HC6 6 HOH DJ .    ? HOH 0 4108 . ? 1_555 ? 
408  HC6 6 HOH DJ .    ? HOH 0 6035 . ? 1_555 ? 
409  HC6 6 HOH DJ .    ? HOH 0 7392 . ? 1_555 ? 
410  HC6 6 HOH DJ .    ? HOH 0 7524 . ? 1_555 ? 
411  HC6 6 HOH DJ .    ? HOH 0 7795 . ? 1_555 ? 
412  HC6 6 HOH DJ .    ? HOH 0 7796 . ? 1_555 ? 
413  HC7 6 U   A  954  ? U   0 954  . ? 1_555 ? 
414  HC7 6 HOH DJ .    ? HOH 0 3234 . ? 1_555 ? 
415  HC7 6 HOH DJ .    ? HOH 0 3993 . ? 1_555 ? 
416  HC7 6 HOH DJ .    ? HOH 0 7387 . ? 1_555 ? 
417  HC7 6 HOH DJ .    ? HOH 0 7794 . ? 1_555 ? 
418  HC7 6 HOH DJ .    ? HOH 0 7852 . ? 1_555 ? 
419  HC8 6 A   A  1286 ? A   0 1286 . ? 1_555 ? 
420  HC8 6 A   A  1287 ? A   0 1287 . ? 1_555 ? 
421  HC8 6 HOH DJ .    ? HOH 0 7792 . ? 1_555 ? 
422  HC8 6 HOH DJ .    ? HOH 0 7853 . ? 1_555 ? 
423  HC8 6 HOH BK .    ? HOH W 7804 . ? 1_555 ? 
424  HC8 6 HOH BK .    ? HOH W 7874 . ? 1_555 ? 
425  HC9 6 A   A  907  ? A   0 907  . ? 1_555 ? 
426  HC9 6 A   A  908  ? A   0 908  . ? 1_555 ? 
427  HC9 6 HOH DJ .    ? HOH 0 3634 . ? 1_555 ? 
428  HC9 6 HOH DJ .    ? HOH 0 3913 . ? 1_555 ? 
429  HC9 6 HOH DJ .    ? HOH 0 4926 . ? 1_555 ? 
430  HC9 6 HOH DJ .    ? HOH 0 7793 . ? 1_555 ? 
431  IC1 6 C   A  880  ? C   0 880  . ? 1_555 ? 
432  IC1 6 U   A  883  ? U   0 883  . ? 1_555 ? 
433  IC1 6 HOH DJ .    ? HOH 0 3620 . ? 1_555 ? 
434  IC1 6 HOH DJ .    ? HOH 0 7801 . ? 1_555 ? 
435  IC1 6 HOH DJ .    ? HOH 0 7802 . ? 1_555 ? 
436  IC1 6 HOH DJ .    ? HOH 0 9240 . ? 1_555 ? 
437  IC2 6 A   A  165  ? A   0 165  . ? 1_555 ? 
438  IC2 6 A   A  167  ? A   0 167  . ? 1_555 ? 
439  IC2 6 C   A  168  ? C   0 168  . ? 1_555 ? 
440  IC2 6 HOH DJ .    ? HOH 0 3608 . ? 1_555 ? 
441  IC2 6 HOH DJ .    ? HOH 0 3614 . ? 1_555 ? 
442  IC2 6 HOH DJ .    ? HOH 0 3626 . ? 1_555 ? 
443  IC3 6 A   A  1684 ? A   0 1684 . ? 1_555 ? 
444  IC3 6 U   A  1724 ? U   0 1724 . ? 1_555 ? 
445  IC3 6 HOH DJ .    ? HOH 0 4201 . ? 1_555 ? 
446  IC3 6 HOH DJ .    ? HOH 0 4488 . ? 1_555 ? 
447  IC3 6 HOH DJ .    ? HOH 0 7803 . ? 1_555 ? 
448  IC3 6 HOH DJ .    ? HOH 0 7856 . ? 1_555 ? 
449  IC4 5 C   A  1420 ? C   0 1420 . ? 1_555 ? 
450  IC4 5 C   A  1421 ? C   0 1421 . ? 1_555 ? 
451  IC4 5 G   A  1438 ? G   0 1438 . ? 1_555 ? 
452  IC4 5 HOH DJ .    ? HOH 0 4094 . ? 1_555 ? 
453  IC4 5 HOH DJ .    ? HOH 0 9613 . ? 1_555 ? 
454  IC5 6 C   A  1436 ? C   0 1436 . ? 1_555 ? 
455  IC5 6 A   A  1437 ? A   0 1437 . ? 1_555 ? 
456  IC5 6 HOH DJ .    ? HOH 0 5143 . ? 1_555 ? 
457  IC5 6 HOH DJ .    ? HOH 0 5230 . ? 1_555 ? 
458  IC5 6 HOH DJ .    ? HOH 0 7864 . ? 1_555 ? 
459  IC5 6 HOH UJ .    ? HOH P 214  . ? 1_555 ? 
460  IC6 6 A   A  1754 ? A   0 1754 . ? 1_555 ? 
461  IC6 6 HOH DJ .    ? HOH 0 3704 . ? 1_555 ? 
462  IC6 6 HOH DJ .    ? HOH 0 4147 . ? 1_555 ? 
463  IC6 6 HOH DJ .    ? HOH 0 6340 . ? 1_555 ? 
464  IC6 6 HOH DJ .    ? HOH 0 7804 . ? 1_555 ? 
465  IC6 6 HOH DJ .    ? HOH 0 7857 . ? 1_555 ? 
466  IC7 6 A   A  1742 ? A   0 1742 . ? 1_555 ? 
467  IC7 6 HOH DJ .    ? HOH 0 3632 . ? 1_555 ? 
468  IC7 6 HOH DJ .    ? HOH 0 7805 . ? 1_555 ? 
469  IC7 6 HOH DJ .    ? HOH 0 9249 . ? 1_555 ? 
470  IC7 6 HOH DJ .    ? HOH 0 9376 . ? 1_555 ? 
471  IC7 6 HOH DJ .    ? HOH 0 9754 . ? 1_555 ? 
472  IC8 8 G   A  2617 ? G   0 2617 . ? 1_555 ? 
473  IC8 8 G   A  2618 ? G   0 2618 . ? 1_555 ? 
474  IC8 8 HOH DJ .    ? HOH 0 3785 . ? 1_555 ? 
475  IC8 8 HOH DJ .    ? HOH 0 4354 . ? 1_555 ? 
476  IC8 8 HOH DJ .    ? HOH 0 4481 . ? 1_555 ? 
477  IC8 8 MG  LC .    ? MG  0 8059 . ? 1_555 ? 
478  IC8 8 HOH DJ .    ? HOH 0 9036 . ? 1_555 ? 
479  IC8 8 HOH DJ .    ? HOH 0 9603 . ? 1_555 ? 
480  IC9 6 A   A  532  ? A   0 532  . ? 1_555 ? 
481  IC9 6 U   A  533  ? U   0 533  . ? 1_555 ? 
482  IC9 6 HOH DJ .    ? HOH 0 3730 . ? 1_555 ? 
483  IC9 6 HOH DJ .    ? HOH 0 3972 . ? 1_555 ? 
484  IC9 6 HOH DJ .    ? HOH 0 7806 . ? 1_555 ? 
485  IC9 6 HOH DJ .    ? HOH 0 7807 . ? 1_555 ? 
486  JC1 3 A   A  682  ? A   0 682  . ? 1_555 ? 
487  JC1 3 G   A  683  ? G   0 683  . ? 1_555 ? 
488  JC1 3 HOH DJ .    ? HOH 0 7865 . ? 1_555 ? 
489  JC2 6 G   A  2540 ? G   0 2540 . ? 1_555 ? 
490  JC2 6 G   A  2611 ? G   0 2611 . ? 1_555 ? 
491  JC2 6 HOH DJ .    ? HOH 0 3049 . ? 1_555 ? 
492  JC2 6 HOH DJ .    ? HOH 0 4289 . ? 1_555 ? 
493  JC2 6 NA  SF .    ? NA  0 8539 . ? 1_555 ? 
494  JC2 6 HOH DJ .    ? HOH 0 9062 . ? 1_555 ? 
495  JC3 7 C   A  515  ? C   0 515  . ? 1_555 ? 
496  JC3 7 A   A  516  ? A   0 516  . ? 1_555 ? 
497  JC3 7 U   A  517  ? U   0 517  . ? 1_555 ? 
498  JC3 7 G   A  518  ? G   0 518  . ? 1_555 ? 
499  JC3 7 HOH DJ .    ? HOH 0 7808 . ? 1_555 ? 
500  JC3 7 HOH DJ .    ? HOH 0 7858 . ? 1_555 ? 
501  JC3 7 HOH DJ .    ? HOH 0 7859 . ? 1_555 ? 
502  JC4 4 A   A  2103 ? A   0 2103 . ? 1_555 ? 
503  JC4 4 U   A  2478 ? U   0 2478 . ? 1_555 ? 
504  JC4 4 HOH DJ .    ? HOH 0 3612 . ? 1_555 ? 
505  JC4 4 HOH DJ .    ? HOH 0 3794 . ? 1_555 ? 
506  JC5 6 G   A  918  ? G   0 918  . ? 1_555 ? 
507  JC5 6 HOH DJ .    ? HOH 0 3325 . ? 1_555 ? 
508  JC5 6 HOH DJ .    ? HOH 0 6465 . ? 1_555 ? 
509  JC5 6 HOH DJ .    ? HOH 0 7809 . ? 1_555 ? 
510  JC5 6 HOH DJ .    ? HOH 0 9091 . ? 1_555 ? 
511  JC5 6 HOH DJ .    ? HOH 0 9549 . ? 1_555 ? 
512  JC6 4 C   A  1844 ? C   0 1844 . ? 1_555 ? 
513  JC6 4 HOH DJ .    ? HOH 0 3642 . ? 1_555 ? 
514  JC6 4 HOH DJ .    ? HOH 0 3657 . ? 1_555 ? 
515  JC6 4 HOH DJ .    ? HOH 0 7860 . ? 1_555 ? 
516  JC7 6 A   A  1070 ? A   0 1070 . ? 1_555 ? 
517  JC7 6 G   A  1071 ? G   0 1071 . ? 1_555 ? 
518  JC7 6 HOH DJ .    ? HOH 0 3648 . ? 1_555 ? 
519  JC7 6 HOH DJ .    ? HOH 0 3679 . ? 1_555 ? 
520  JC7 6 HOH DJ .    ? HOH 0 3720 . ? 1_555 ? 
521  JC7 6 HOH DJ .    ? HOH 0 9685 . ? 1_555 ? 
522  JC8 4 U   A  1096 ? U   0 1096 . ? 1_555 ? 
523  JC8 4 C   A  1257 ? C   0 1257 . ? 1_555 ? 
524  JC8 4 HOH DJ .    ? HOH 0 7810 . ? 1_555 ? 
525  JC8 4 HOH DJ .    ? HOH 0 7861 . ? 1_555 ? 
526  JC9 7 G   A  1848 ? G   0 1848 . ? 1_555 ? 
527  JC9 7 G   A  1849 ? G   0 1849 . ? 1_555 ? 
528  JC9 7 HOH DJ .    ? HOH 0 3660 . ? 1_555 ? 
529  JC9 7 HOH DJ .    ? HOH 0 3697 . ? 1_555 ? 
530  JC9 7 HOH DJ .    ? HOH 0 3833 . ? 1_555 ? 
531  JC9 7 HOH DJ .    ? HOH 0 3862 . ? 1_555 ? 
532  JC9 7 MG  IE .    ? MG  0 8115 . ? 1_555 ? 
533  KC1 6 G   A  863  ? G   0 863  . ? 1_555 ? 
534  KC1 6 U   A  864  ? U   0 864  . ? 1_555 ? 
535  KC1 6 HOH DJ .    ? HOH 0 3340 . ? 1_555 ? 
536  KC1 6 HOH DJ .    ? HOH 0 3669 . ? 1_555 ? 
537  KC1 6 HOH DJ .    ? HOH 0 3673 . ? 1_555 ? 
538  KC1 6 HOH DJ .    ? HOH 0 5538 . ? 1_555 ? 
539  KC2 7 A   A  907  ? A   0 907  . ? 1_555 ? 
540  KC2 7 HOH DJ .    ? HOH 0 3369 . ? 1_555 ? 
541  KC2 7 HOH DJ .    ? HOH 0 3681 . ? 1_555 ? 
542  KC2 7 HOH DJ .    ? HOH 0 3745 . ? 1_555 ? 
543  KC2 7 HOH DJ .    ? HOH 0 9948 . ? 1_555 ? 
544  KC2 7 LYS AA 146  ? LYS Y 145  . ? 1_555 ? 
545  KC2 7 HOH DK .    ? HOH Y 8867 . ? 1_555 ? 
546  KC3 4 A   A  2612 ? A   0 2612 . ? 1_555 ? 
547  KC3 4 HOH DJ .    ? HOH 0 3018 . ? 1_555 ? 
548  KC3 4 HOH DJ .    ? HOH 0 3664 . ? 1_555 ? 
549  KC3 4 HOH DJ .    ? HOH 0 3676 . ? 1_555 ? 
550  KC4 5 G   A  2080 ? G   0 2080 . ? 1_555 ? 
551  KC4 5 HOH DJ .    ? HOH 0 3764 . ? 1_555 ? 
552  KC4 5 HOH DJ .    ? HOH 0 4247 . ? 1_555 ? 
553  KC4 5 HOH DJ .    ? HOH 0 5491 . ? 1_555 ? 
554  KC4 5 HOH DJ .    ? HOH 0 7811 . ? 1_555 ? 
555  KC5 6 U   A  2107 ? U   0 2107 . ? 1_555 ? 
556  KC5 6 C   A  2281 ? C   0 2281 . ? 1_555 ? 
557  KC5 6 U   A  2282 ? U   0 2282 . ? 1_555 ? 
558  KC5 6 HOH DJ .    ? HOH 0 3744 . ? 1_555 ? 
559  KC5 6 HOH DJ .    ? HOH 0 4614 . ? 1_555 ? 
560  KC5 6 HOH DJ .    ? HOH 0 6884 . ? 1_555 ? 
561  KC6 6 A   A  2434 ? A   0 2434 . ? 1_555 ? 
562  KC6 6 U   A  2458 ? U   0 2458 . ? 1_555 ? 
563  KC6 6 HOH DJ .    ? HOH 0 7869 . ? 1_555 ? 
564  KC6 6 HOH DJ .    ? HOH 0 9252 . ? 1_555 ? 
565  KC6 6 HOH DJ .    ? HOH 0 9898 . ? 1_555 ? 
566  KC6 6 HOH HK .    ? HOH 3 8824 . ? 1_555 ? 
567  KC7 4 A   A  2577 ? A   0 2577 . ? 1_555 ? 
568  KC7 4 G   A  2578 ? G   0 2578 . ? 1_555 ? 
569  KC7 4 G   A  2579 ? G   0 2579 . ? 1_555 ? 
570  KC7 4 HOH DJ .    ? HOH 0 7862 . ? 1_555 ? 
571  KC8 3 C   A  2104 ? C   0 2104 . ? 1_555 ? 
572  KC8 3 C   A  2105 ? C   0 2105 . ? 1_555 ? 
573  KC8 3 HOH DJ .    ? HOH 0 7718 . ? 1_555 ? 
574  KC9 7 G   A  817  ? G   0 817  . ? 1_555 ? 
575  KC9 7 HOH DJ .    ? HOH 0 3597 . ? 1_555 ? 
576  KC9 7 HOH DJ .    ? HOH 0 7388 . ? 1_555 ? 
577  KC9 7 HOH DJ .    ? HOH 0 7828 . ? 1_555 ? 
578  KC9 7 MG  WB .    ? MG  0 8043 . ? 1_555 ? 
579  KC9 7 HOH UJ .    ? HOH P 188  . ? 1_555 ? 
580  KC9 7 HOH UJ .    ? HOH P 208  . ? 1_555 ? 
581  LC1 6 A   A  1106 ? A   0 1106 . ? 1_555 ? 
582  LC1 6 A   A  1107 ? A   0 1107 . ? 1_555 ? 
583  LC1 6 HOH DJ .    ? HOH 0 7837 . ? 1_555 ? 
584  LC1 6 HOH DJ .    ? HOH 0 7838 . ? 1_555 ? 
585  LC1 6 HOH DJ .    ? HOH 0 7839 . ? 1_555 ? 
586  LC1 6 HOH DJ .    ? HOH 0 7840 . ? 1_555 ? 
587  LC2 7 G   A  2000 ? G   0 2000 . ? 1_555 ? 
588  LC2 7 G   A  2001 ? G   0 2001 . ? 1_555 ? 
589  LC2 7 HOH DJ .    ? HOH 0 6079 . ? 1_555 ? 
590  LC2 7 HOH DJ .    ? HOH 0 7462 . ? 1_555 ? 
591  LC2 7 HOH DJ .    ? HOH 0 7842 . ? 1_555 ? 
592  LC2 7 HOH DJ .    ? HOH 0 7843 . ? 1_555 ? 
593  LC2 7 HOH DJ .    ? HOH 0 7844 . ? 1_555 ? 
594  LC3 6 U   A  903  ? U   0 903  . ? 1_555 ? 
595  LC3 6 A   A  1357 ? A   0 1357 . ? 1_555 ? 
596  LC3 6 HOH DJ .    ? HOH 0 3923 . ? 1_555 ? 
597  LC3 6 HOH DJ .    ? HOH 0 5385 . ? 1_555 ? 
598  LC3 6 HOH DJ .    ? HOH 0 6014 . ? 1_555 ? 
599  LC3 6 HOH DJ .    ? HOH 0 9510 . ? 1_555 ? 
600  LC4 6 G   A  2609 ? G   0 2609 . ? 1_555 ? 
601  LC4 6 HOH DJ .    ? HOH 0 3301 . ? 1_555 ? 
602  LC4 6 HOH DJ .    ? HOH 0 3694 . ? 1_555 ? 
603  LC4 6 HOH DJ .    ? HOH 0 3718 . ? 1_555 ? 
604  LC4 6 HOH DJ .    ? HOH 0 5586 . ? 1_555 ? 
605  LC4 6 HOH DJ .    ? HOH 0 5733 . ? 1_555 ? 
606  LC5 6 A   A  187  ? A   0 187  . ? 1_555 ? 
607  LC5 6 HOH DJ .    ? HOH 0 3724 . ? 1_555 ? 
608  LC5 6 HOH DJ .    ? HOH 0 3765 . ? 1_555 ? 
609  LC5 6 HOH DJ .    ? HOH 0 9128 . ? 1_555 ? 
610  LC5 6 HOH DJ .    ? HOH 0 9331 . ? 1_555 ? 
611  LC5 6 HOH DJ .    ? HOH 0 9572 . ? 1_555 ? 
612  LC6 6 A   A  2112 ? A   0 2112 . ? 1_555 ? 
613  LC6 6 HOH DJ .    ? HOH 0 3750 . ? 1_555 ? 
614  LC6 6 HOH DJ .    ? HOH 0 3921 . ? 1_555 ? 
615  LC6 6 HOH DJ .    ? HOH 0 6113 . ? 1_555 ? 
616  LC6 6 HOH DJ .    ? HOH 0 6384 . ? 1_555 ? 
617  LC6 6 HOH DJ .    ? HOH 0 9591 . ? 1_555 ? 
618  LC7 6 A   A  2430 ? A   0 2430 . ? 1_555 ? 
619  LC7 6 HOH DJ .    ? HOH 0 3666 . ? 1_555 ? 
620  LC7 6 HOH DJ .    ? HOH 0 3961 . ? 1_555 ? 
621  LC7 6 HOH DJ .    ? HOH 0 4807 . ? 1_555 ? 
622  LC7 6 HOH DJ .    ? HOH 0 9351 . ? 1_555 ? 
623  LC7 6 HOH DJ .    ? HOH 0 9452 . ? 1_555 ? 
624  LC8 5 HOH DJ .    ? HOH 0 4282 . ? 1_555 ? 
625  LC8 5 HOH DJ .    ? HOH 0 4299 . ? 1_555 ? 
626  LC8 5 HOH DJ .    ? HOH 0 6583 . ? 1_555 ? 
627  LC8 5 HOH DJ .    ? HOH 0 6712 . ? 1_555 ? 
628  LC8 5 HOH FJ .    ? HOH A 8852 . ? 1_555 ? 
629  LC9 8 G   A  1849 ? G   0 1849 . ? 1_555 ? 
630  LC9 8 U   A  1850 ? U   0 1850 . ? 1_555 ? 
631  LC9 8 HOH DJ .    ? HOH 0 3660 . ? 1_555 ? 
632  LC9 8 HOH DJ .    ? HOH 0 3686 . ? 1_555 ? 
633  LC9 8 HOH DJ .    ? HOH 0 3862 . ? 1_555 ? 
634  LC9 8 HOH DJ .    ? HOH 0 6712 . ? 1_555 ? 
635  LC9 8 MG  QD .    ? MG  0 8096 . ? 1_555 ? 
636  LC9 8 HOH FJ .    ? HOH A 8852 . ? 1_555 ? 
637  MC1 6 A   A  1840 ? A   0 1840 . ? 1_555 ? 
638  MC1 6 C   A  1841 ? C   0 1841 . ? 1_555 ? 
639  MC1 6 A   A  2022 ? A   0 2022 . ? 1_555 ? 
640  MC1 6 HOH DJ .    ? HOH 0 4629 . ? 1_555 ? 
641  MC1 6 HOH DJ .    ? HOH 0 6541 . ? 1_555 ? 
642  MC1 6 HOH DJ .    ? HOH 0 9223 . ? 1_555 ? 
643  MC2 3 G   A  2102 ? G   0 2102 . ? 1_555 ? 
644  MC2 3 G   A  2482 ? G   0 2482 . ? 1_555 ? 
645  MC2 3 C   A  2536 ? C   0 2536 . ? 1_555 ? 
646  MC3 6 C   A  162  ? C   0 162  . ? 1_555 ? 
647  MC3 6 U   A  163  ? U   0 163  . ? 1_555 ? 
648  MC3 6 U   A  172  ? U   0 172  . ? 1_555 ? 
649  MC3 6 HOH DJ .    ? HOH 0 9014 . ? 1_555 ? 
650  MC3 6 HOH DJ .    ? HOH 0 9110 . ? 1_555 ? 
651  MC3 6 HOH DJ .    ? HOH 0 9145 . ? 1_555 ? 
652  MC4 5 C   A  1069 ? C   0 1069 . ? 1_555 ? 
653  MC4 5 G   A  1072 ? G   0 1072 . ? 1_555 ? 
654  MC4 5 G   A  1087 ? G   0 1087 . ? 1_555 ? 
655  MC4 5 HOH DJ .    ? HOH 0 3172 . ? 1_555 ? 
656  MC4 5 HOH DJ .    ? HOH 0 4959 . ? 1_555 ? 
657  MC5 7 G   A  1119 ? G   0 1119 . ? 1_555 ? 
658  MC5 7 U   A  1120 ? U   0 1120 . ? 1_555 ? 
659  MC5 7 G   A  1121 ? G   0 1121 . ? 1_555 ? 
660  MC5 7 U   A  1122 ? U   0 1122 . ? 1_555 ? 
661  MC5 7 HOH DJ .    ? HOH 0 4541 . ? 1_555 ? 
662  MC5 7 HOH DJ .    ? HOH 0 5668 . ? 1_555 ? 
663  MC5 7 HOH DJ .    ? HOH 0 7753 . ? 1_555 ? 
664  MC6 6 A   A  643  ? A   0 643  . ? 1_555 ? 
665  MC6 6 G   A  644  ? G   0 644  . ? 1_555 ? 
666  MC6 6 U   A  904  ? U   0 904  . ? 1_555 ? 
667  MC6 6 C   A  1353 ? C   0 1353 . ? 1_555 ? 
668  MC6 6 G   A  1354 ? G   0 1354 . ? 1_555 ? 
669  MC6 6 ARG N  9    ? ARG L 8    . ? 1_555 ? 
670  MC7 6 A   A  630  ? A   0 630  . ? 1_555 ? 
671  MC7 6 A   A  631  ? A   0 631  . ? 1_555 ? 
672  MC7 6 A   A  2074 ? A   0 2074 . ? 1_555 ? 
673  MC7 6 HOH DJ .    ? HOH 0 4085 . ? 1_555 ? 
674  MC7 6 HOH DJ .    ? HOH 0 4694 . ? 1_555 ? 
675  MC7 6 HOH DJ .    ? HOH 0 5767 . ? 1_555 ? 
676  MC8 5 G   A  2092 ? G   0 2092 . ? 1_555 ? 
677  MC8 5 G   A  2093 ? G   0 2093 . ? 1_555 ? 
678  MC8 5 G   A  2094 ? G   0 2094 . ? 1_555 ? 
679  MC8 5 A   A  2649 ? A   0 2649 . ? 1_555 ? 
680  MC8 5 HOH DJ .    ? HOH 0 9126 . ? 1_555 ? 
681  MC9 4 C   A  40   ? C   0 40   . ? 1_555 ? 
682  MC9 4 G   A  41   ? G   0 41   . ? 1_555 ? 
683  MC9 4 A   A  442  ? A   0 442  . ? 1_555 ? 
684  MC9 4 C   A  443  ? C   0 443  . ? 1_555 ? 
685  NC1 5 C   A  1394 ? C   0 1394 . ? 1_555 ? 
686  NC1 5 U   A  1432 ? U   0 1432 . ? 1_555 ? 
687  NC1 5 G   A  1433 ? G   0 1433 . ? 1_555 ? 
688  NC1 5 U   A  1724 ? U   0 1724 . ? 1_555 ? 
689  NC1 5 HOH DJ .    ? HOH 0 3409 . ? 1_555 ? 
690  NC2 4 A   A  2577 ? A   0 2577 . ? 1_555 ? 
691  NC2 4 G   A  2578 ? G   0 2578 . ? 1_555 ? 
692  NC2 4 G   A  2579 ? G   0 2579 . ? 1_555 ? 
693  NC2 4 HOH DJ .    ? HOH 0 4500 . ? 1_555 ? 
694  NC3 5 G   A  2524 ? G   0 2524 . ? 1_555 ? 
695  NC3 5 G   A  2525 ? G   0 2525 . ? 1_555 ? 
696  NC3 5 HOH DJ .    ? HOH 0 3571 . ? 1_555 ? 
697  NC3 5 HOH DJ .    ? HOH 0 4646 . ? 1_555 ? 
698  NC3 5 HOH DJ .    ? HOH 0 9181 . ? 1_555 ? 
699  NC4 5 G   A  2399 ? G   0 2399 . ? 1_555 ? 
700  NC4 5 HOH DJ .    ? HOH 0 3834 . ? 1_555 ? 
701  NC4 5 HOH DJ .    ? HOH 0 5058 . ? 1_555 ? 
702  NC4 5 HOH DJ .    ? HOH 0 5104 . ? 1_555 ? 
703  NC4 5 HOH DJ .    ? HOH 0 9958 . ? 1_555 ? 
704  NC5 5 U   A  2541 ? U   0 2541 . ? 1_555 ? 
705  NC5 5 U   A  2607 ? U   0 2607 . ? 1_555 ? 
706  NC5 5 HOH DJ .    ? HOH 0 3133 . ? 1_555 ? 
707  NC5 5 HOH DJ .    ? HOH 0 9332 . ? 1_555 ? 
708  NC5 5 TRP D  243  ? TRP B 242  . ? 1_555 ? 
709  NC6 4 A   A  165  ? A   0 165  . ? 1_555 ? 
710  NC6 4 A   A  166  ? A   0 166  . ? 1_555 ? 
711  NC6 4 A   A  167  ? A   0 167  . ? 1_555 ? 
712  NC6 4 HOH DJ .    ? HOH 0 9688 . ? 1_555 ? 
713  NC7 4 C   A  896  ? C   0 896  . ? 1_555 ? 
714  NC7 4 A   A  897  ? A   0 897  . ? 1_555 ? 
715  NC7 4 HOH DJ .    ? HOH 0 6298 . ? 1_555 ? 
716  NC7 4 HOH DJ .    ? HOH 0 7653 . ? 1_555 ? 
717  NC8 6 G   A  1416 ? G   0 1416 . ? 1_555 ? 
718  NC8 6 G   A  1417 ? G   0 1417 . ? 1_555 ? 
719  NC8 6 HOH DJ .    ? HOH 0 9278 . ? 1_555 ? 
720  NC8 6 TRP DA 43   ? TRP 2 42   . ? 1_555 ? 
721  NC8 6 ASN DA 46   ? ASN 2 45   . ? 1_555 ? 
722  NC8 6 HOH GK .    ? HOH 2 4135 . ? 1_555 ? 
723  NC9 6 G   A  2543 ? G   0 2543 . ? 1_555 ? 
724  NC9 6 G   A  2544 ? G   0 2544 . ? 1_555 ? 
725  NC9 6 HOH DJ .    ? HOH 0 3462 . ? 1_555 ? 
726  NC9 6 HOH DJ .    ? HOH 0 3927 . ? 1_555 ? 
727  NC9 6 NA  CF .    ? NA  0 8520 . ? 1_555 ? 
728  NC9 6 HOH DJ .    ? HOH 0 9210 . ? 1_555 ? 
729  OC1 6 A   A  2465 ? A   0 2465 . ? 1_555 ? 
730  OC1 6 G   A  2466 ? G   0 2466 . ? 1_555 ? 
731  OC1 6 HOH DJ .    ? HOH 0 4257 . ? 1_555 ? 
732  OC1 6 HOH DJ .    ? HOH 0 6029 . ? 1_555 ? 
733  OC1 6 HOH DJ .    ? HOH 0 9058 . ? 1_555 ? 
734  OC1 6 ASP N  37   ? ASP L 36   . ? 1_555 ? 
735  OC2 8 G   A  2543 ? G   0 2543 . ? 1_555 ? 
736  OC2 8 G   A  2544 ? G   0 2544 . ? 1_555 ? 
737  OC2 8 G   A  2611 ? G   0 2611 . ? 1_555 ? 
738  OC2 8 U   A  2615 ? U   0 2615 . ? 1_555 ? 
739  OC2 8 NA  AF .    ? NA  0 8518 . ? 1_555 ? 
740  OC2 8 HOH DJ .    ? HOH 0 9055 . ? 1_555 ? 
741  OC2 8 HOH DJ .    ? HOH 0 9086 . ? 1_555 ? 
742  OC2 8 HOH DJ .    ? HOH 0 9745 . ? 1_555 ? 
743  OC3 5 G   A  836  ? G   0 836  . ? 1_555 ? 
744  OC3 5 U   A  837  ? U   0 837  . ? 1_555 ? 
745  OC3 5 A   A  1736 ? A   0 1736 . ? 1_555 ? 
746  OC3 5 A   A  1737 ? A   0 1737 . ? 1_555 ? 
747  OC3 5 ARG D  230  ? ARG B 229  . ? 1_555 ? 
748  OC4 7 G   A  885  ? G   0 885  . ? 1_555 ? 
749  OC4 7 A   A  2112 ? A   0 2112 . ? 1_555 ? 
750  OC4 7 G   A  2113 ? G   0 2113 . ? 1_555 ? 
751  OC4 7 C   A  2475 ? C   0 2475 . ? 1_555 ? 
752  OC4 7 C   A  2476 ? C   0 2476 . ? 1_555 ? 
753  OC4 7 HOH DJ .    ? HOH 0 3654 . ? 1_555 ? 
754  OC4 7 HOH DJ .    ? HOH 0 4475 . ? 1_555 ? 
755  OC5 5 A   A  45   ? A   0 45   . ? 1_555 ? 
756  OC5 5 C   A  130  ? C   0 130  . ? 1_555 ? 
757  OC5 5 U   A  146  ? U   0 146  . ? 1_555 ? 
758  OC5 5 G   A  147  ? G   0 147  . ? 1_555 ? 
759  OC5 5 HOH DJ .    ? HOH 0 9496 . ? 1_555 ? 
760  OC6 6 A   A  776  ? A   0 776  . ? 1_555 ? 
761  OC6 6 U   A  777  ? U   0 777  . ? 1_555 ? 
762  OC6 6 U   A  779  ? U   0 779  . ? 1_555 ? 
763  OC6 6 HOH DJ .    ? HOH 0 3278 . ? 1_555 ? 
764  OC6 6 HOH DJ .    ? HOH 0 7629 . ? 1_555 ? 
765  OC6 6 HOH DJ .    ? HOH 0 9627 . ? 1_555 ? 
766  OC7 4 G   A  1971 ? G   0 1971 . ? 1_555 ? 
767  OC7 4 G   A  2009 ? G   0 2009 . ? 1_555 ? 
768  OC7 4 A   A  2010 ? A   0 2010 . ? 1_555 ? 
769  OC7 4 U   A  2012 ? U   0 2012 . ? 1_555 ? 
770  OC8 7 U   A  821  ? U   0 821  . ? 1_555 ? 
771  OC8 7 C   A  853  ? C   0 853  . ? 1_555 ? 
772  OC8 7 G   A  854  ? G   0 854  . ? 1_555 ? 
773  OC8 7 U   A  1831 ? U   0 1831 . ? 1_555 ? 
774  OC8 7 HOH DJ .    ? HOH 0 3207 . ? 1_555 ? 
775  OC8 7 HOH DJ .    ? HOH 0 9035 . ? 1_555 ? 
776  OC8 7 HOH DJ .    ? HOH 0 9732 . ? 1_555 ? 
777  OC9 5 G   A  56   ? G   0 56   . ? 1_555 ? 
778  OC9 5 A   A  59   ? A   0 59   . ? 1_555 ? 
779  OC9 5 G   A  61   ? G   0 61   . ? 1_555 ? 
780  OC9 5 HOH DJ .    ? HOH 0 5200 . ? 1_555 ? 
781  OC9 5 HOH DJ .    ? HOH 0 6460 . ? 1_555 ? 
782  PC1 4 G   A  66   ? G   0 66   . ? 1_555 ? 
783  PC1 4 U   A  107  ? U   0 107  . ? 1_555 ? 
784  PC1 4 U   A  108  ? U   0 108  . ? 1_555 ? 
785  PC1 4 HOH DJ .    ? HOH 0 6559 . ? 1_555 ? 
786  PC2 4 G   A  140  ? G   0 140  . ? 1_555 ? 
787  PC2 4 C   A  141  ? C   0 141  . ? 1_555 ? 
788  PC2 4 G   A  142  ? G   0 142  . ? 1_555 ? 
789  PC2 4 HOH DJ .    ? HOH 0 9234 . ? 1_555 ? 
790  PC3 5 U   A  170  ? U   0 170  . ? 1_555 ? 
791  PC3 5 C   A  171  ? C   0 171  . ? 1_555 ? 
792  PC3 5 C   A  218  ? C   0 218  . ? 1_555 ? 
793  PC3 5 G   A  221  ? G   0 221  . ? 1_555 ? 
794  PC3 5 HOH DJ .    ? HOH 0 9301 . ? 1_555 ? 
795  PC4 6 G   A  386  ? G   0 386  . ? 1_555 ? 
796  PC4 6 G   A  387  ? G   0 387  . ? 1_555 ? 
797  PC4 6 G   A  388  ? G   0 388  . ? 1_555 ? 
798  PC4 6 C   A  401  ? C   0 401  . ? 1_555 ? 
799  PC4 6 U   A  402  ? U   0 402  . ? 1_555 ? 
800  PC4 6 HOH DJ .    ? HOH 0 7049 . ? 1_555 ? 
801  PC5 4 C   A  1894 ? C   0 1894 . ? 1_555 ? 
802  PC5 4 U   A  1897 ? U   0 1897 . ? 1_555 ? 
803  PC5 4 G   A  1898 ? G   0 1898 . ? 1_555 ? 
804  PC5 4 U   A  1939 ? U   0 1939 . ? 1_555 ? 
805  PC6 5 C   A  1894 ? C   0 1894 . ? 1_555 ? 
806  PC6 5 A   A  1895 ? A   0 1895 . ? 1_555 ? 
807  PC6 5 G   A  1896 ? G   0 1896 . ? 1_555 ? 
808  PC6 5 U   A  1897 ? U   0 1897 . ? 1_555 ? 
809  PC6 5 HOH DJ .    ? HOH 0 5236 . ? 1_555 ? 
810  PC7 5 G   A  622  ? G   0 622  . ? 1_555 ? 
811  PC7 5 U   A  623  ? U   0 623  . ? 1_555 ? 
812  PC7 5 1MA A  628  ? 1MA 0 628  . ? 1_555 ? 
813  PC7 5 A   A  630  ? A   0 630  . ? 1_555 ? 
814  PC7 5 HOH DJ .    ? HOH 0 9878 . ? 1_555 ? 
815  PC8 6 G   A  1706 ? G   0 1706 . ? 1_555 ? 
816  PC8 6 G   A  1707 ? G   0 1707 . ? 1_555 ? 
817  PC8 6 HOH DJ .    ? HOH 0 5323 . ? 1_555 ? 
818  PC8 6 HOH DJ .    ? HOH 0 7323 . ? 1_555 ? 
819  PC8 6 HOH DJ .    ? HOH 0 7656 . ? 1_555 ? 
820  PC8 6 HOH DJ .    ? HOH 0 9931 . ? 1_555 ? 
821  PC9 7 G   A  2540 ? G   0 2540 . ? 1_555 ? 
822  PC9 7 G   A  2611 ? G   0 2611 . ? 1_555 ? 
823  PC9 7 G   A  2616 ? G   0 2616 . ? 1_555 ? 
824  PC9 7 U   A  2645 ? U   0 2645 . ? 1_555 ? 
825  PC9 7 HOH DJ .    ? HOH 0 3033 . ? 1_555 ? 
826  PC9 7 HOH DJ .    ? HOH 0 4289 . ? 1_555 ? 
827  PC9 7 MG  JD .    ? MG  0 8088 . ? 1_555 ? 
828  QC1 3 U   A  1740 ? U   0 1740 . ? 1_555 ? 
829  QC1 3 U   A  1741 ? U   0 1741 . ? 1_555 ? 
830  QC1 3 G   A  2033 ? G   0 2033 . ? 1_555 ? 
831  QC2 3 G   A  681  ? G   0 681  . ? 1_555 ? 
832  QC2 3 A   A  682  ? A   0 682  . ? 1_555 ? 
833  QC2 3 G   A  683  ? G   0 683  . ? 1_555 ? 
834  QC3 4 G   A  892  ? G   0 892  . ? 1_555 ? 
835  QC3 4 C   A  893  ? C   0 893  . ? 1_555 ? 
836  QC3 4 HOH DJ .    ? HOH 0 5610 . ? 1_555 ? 
837  QC3 4 HOH DJ .    ? HOH 0 6253 . ? 1_555 ? 
838  QC4 6 U   A  2663 ? U   0 2663 . ? 1_555 ? 
839  QC4 6 A   A  2811 ? A   0 2811 . ? 1_555 ? 
840  QC4 6 A   A  2812 ? A   0 2812 . ? 1_555 ? 
841  QC4 6 A   A  2816 ? A   0 2816 . ? 1_555 ? 
842  QC4 6 G   A  2817 ? G   0 2817 . ? 1_555 ? 
843  QC4 6 HOH DJ .    ? HOH 0 9222 . ? 1_555 ? 
844  QC5 5 A   A  914  ? A   0 914  . ? 1_555 ? 
845  QC5 5 C   A  915  ? C   0 915  . ? 1_555 ? 
846  QC5 5 C   A  1043 ? C   0 1043 . ? 1_555 ? 
847  QC5 5 C   A  1044 ? C   0 1044 . ? 1_555 ? 
848  QC5 5 G   A  1045 ? G   0 1045 . ? 1_555 ? 
849  QC6 4 U   A  623  ? U   0 623  . ? 1_555 ? 
850  QC6 4 U   A  624  ? U   0 624  . ? 1_555 ? 
851  QC6 4 G   A  901  ? G   0 901  . ? 1_555 ? 
852  QC6 4 HOH DJ .    ? HOH 0 6933 . ? 1_555 ? 
853  QC7 5 A   A  955  ? A   0 955  . ? 1_555 ? 
854  QC7 5 HOH DJ .    ? HOH 0 5244 . ? 1_555 ? 
855  QC7 5 HOH DJ .    ? HOH 0 6587 . ? 1_555 ? 
856  QC7 5 C   B  81   ? C   9 81   . ? 1_555 ? 
857  QC7 5 U   B  82   ? U   9 82   . ? 1_555 ? 
858  QC8 6 A   A  1040 ? A   0 1040 . ? 1_555 ? 
859  QC8 6 G   A  1295 ? G   0 1295 . ? 1_555 ? 
860  QC8 6 A   A  1296 ? A   0 1296 . ? 1_555 ? 
861  QC8 6 HOH DJ .    ? HOH 0 4865 . ? 1_555 ? 
862  QC8 6 HOH DJ .    ? HOH 0 9212 . ? 1_555 ? 
863  QC8 6 GLY N  15   ? GLY L 14   . ? 1_555 ? 
864  QC9 5 U   A  768  ? U   0 768  . ? 1_555 ? 
865  QC9 5 C   A  769  ? C   0 769  . ? 1_555 ? 
866  QC9 5 G   A  2111 ? G   0 2111 . ? 1_555 ? 
867  QC9 5 A   A  2112 ? A   0 2112 . ? 1_555 ? 
868  QC9 5 HOH DJ .    ? HOH 0 4808 . ? 1_555 ? 
869  RC1 4 G   A  1119 ? G   0 1119 . ? 1_555 ? 
870  RC1 4 C   A  1243 ? C   0 1243 . ? 1_555 ? 
871  RC1 4 THR L  47   ? THR J 47   . ? 1_555 ? 
872  RC1 4 HOH OJ .    ? HOH J 3661 . ? 1_555 ? 
873  RC2 5 C   A  920  ? C   0 920  . ? 1_555 ? 
874  RC2 5 U   A  2278 ? U   0 2278 . ? 1_555 ? 
875  RC2 5 G   A  2279 ? G   0 2279 . ? 1_555 ? 
876  RC2 5 A   A  2463 ? A   0 2463 . ? 1_555 ? 
877  RC2 5 HOH DJ .    ? HOH 0 9455 . ? 1_555 ? 
878  RC3 4 G   A  941  ? G   0 941  . ? 1_555 ? 
879  RC3 4 U   A  942  ? U   0 942  . ? 1_555 ? 
880  RC3 4 G   A  1024 ? G   0 1024 . ? 1_555 ? 
881  RC3 4 HOH DJ .    ? HOH 0 6259 . ? 1_555 ? 
882  RC4 7 G   A  2611 ? G   0 2611 . ? 1_555 ? 
883  RC4 7 HOH DJ .    ? HOH 0 3867 . ? 1_555 ? 
884  RC4 7 HOH DJ .    ? HOH 0 7398 . ? 1_555 ? 
885  RC4 7 HOH DJ .    ? HOH 0 7749 . ? 1_555 ? 
886  RC4 7 MG  OA .    ? MG  0 8009 . ? 1_555 ? 
887  RC4 7 HOH DJ .    ? HOH 0 9334 . ? 1_555 ? 
888  RC4 7 HOH DJ .    ? HOH 0 9487 . ? 1_555 ? 
889  RC5 5 G   A  898  ? G   0 898  . ? 1_555 ? 
890  RC5 5 A   A  922  ? A   0 922  . ? 1_555 ? 
891  RC5 5 A   A  923  ? A   0 923  . ? 1_555 ? 
892  RC5 5 G   A  924  ? G   0 924  . ? 1_555 ? 
893  RC5 5 U   A  2109 ? U   0 2109 . ? 1_555 ? 
894  RC6 5 A   A  453  ? A   0 453  . ? 1_555 ? 
895  RC6 5 U   A  454  ? U   0 454  . ? 1_555 ? 
896  RC6 5 C   A  478  ? C   0 478  . ? 1_555 ? 
897  RC6 5 G   A  479  ? G   0 479  . ? 1_555 ? 
898  RC6 5 HOH DJ .    ? HOH 0 5941 . ? 1_555 ? 
899  RC7 5 U   A  837  ? U   0 837  . ? 1_555 ? 
900  RC7 5 HOH DJ .    ? HOH 0 4583 . ? 1_555 ? 
901  RC7 5 HOH DJ .    ? HOH 0 4894 . ? 1_555 ? 
902  RC7 5 HOH DJ .    ? HOH 0 7312 . ? 1_555 ? 
903  RC7 5 GLN D  231  ? GLN B 230  . ? 1_555 ? 
904  RC8 5 A   A  167  ? A   0 167  . ? 1_555 ? 
905  RC8 5 C   A  168  ? C   0 168  . ? 1_555 ? 
906  RC8 5 G   A  2110 ? G   0 2110 . ? 1_555 ? 
907  RC8 5 G   A  2111 ? G   0 2111 . ? 1_555 ? 
908  RC8 5 U   A  2277 ? U   0 2277 . ? 1_555 ? 
909  RC9 3 U   A  1359 ? U   0 1359 . ? 1_555 ? 
910  RC9 3 C   A  1360 ? C   0 1360 . ? 1_555 ? 
911  RC9 3 HOH DJ .    ? HOH 0 3475 . ? 1_555 ? 
912  SC1 5 G   A  636  ? G   0 636  . ? 1_555 ? 
913  SC1 5 U   A  2057 ? U   0 2057 . ? 1_555 ? 
914  SC1 5 G   A  2058 ? G   0 2058 . ? 1_555 ? 
915  SC1 5 HOH DJ .    ? HOH 0 9595 . ? 1_555 ? 
916  SC1 5 HOH DJ .    ? HOH 0 9821 . ? 1_555 ? 
917  SC2 6 U   A  391  ? U   0 391  . ? 1_555 ? 
918  SC2 6 U   A  392  ? U   0 392  . ? 1_555 ? 
919  SC2 6 U   A  398  ? U   0 398  . ? 1_555 ? 
920  SC2 6 C   A  399  ? C   0 399  . ? 1_555 ? 
921  SC2 6 LYS O  194  ? LYS M 193  . ? 1_555 ? 
922  SC2 6 GLY O  195  ? GLY M 194  . ? 1_555 ? 
923  SC3 7 G   A  544  ? G   0 544  . ? 1_555 ? 
924  SC3 7 G   A  545  ? G   0 545  . ? 1_555 ? 
925  SC3 7 G   A  610  ? G   0 610  . ? 1_555 ? 
926  SC3 7 U   A  611  ? U   0 611  . ? 1_555 ? 
927  SC3 7 HOH DJ .    ? HOH 0 3878 . ? 1_555 ? 
928  SC3 7 HOH DJ .    ? HOH 0 9872 . ? 1_555 ? 
929  SC3 7 HOH DJ .    ? HOH 0 9891 . ? 1_555 ? 
930  SC4 6 G   A  464  ? G   0 464  . ? 1_555 ? 
931  SC4 6 G   A  475  ? G   0 475  . ? 1_555 ? 
932  SC4 6 HOH DJ .    ? HOH 0 4474 . ? 1_555 ? 
933  SC4 6 HOH DJ .    ? HOH 0 4596 . ? 1_555 ? 
934  SC4 6 HOH DJ .    ? HOH 0 9833 . ? 1_555 ? 
935  SC4 6 ARG E  55   ? ARG C 55   . ? 1_555 ? 
936  SC5 5 G   A  798  ? G   0 798  . ? 1_555 ? 
937  SC5 5 C   A  799  ? C   0 799  . ? 1_555 ? 
938  SC5 5 G   A  814  ? G   0 814  . ? 1_555 ? 
939  SC5 5 U   A  815  ? U   0 815  . ? 1_555 ? 
940  SC5 5 HOH DJ .    ? HOH 0 3882 . ? 1_555 ? 
941  SC6 7 U   A  391  ? U   0 391  . ? 1_555 ? 
942  SC6 7 U   A  392  ? U   0 392  . ? 1_555 ? 
943  SC6 7 A   A  395  ? A   0 395  . ? 1_555 ? 
944  SC6 7 U   A  398  ? U   0 398  . ? 1_555 ? 
945  SC6 7 HOH DJ .    ? HOH 0 4411 . ? 1_555 ? 
946  SC6 7 HOH DJ .    ? HOH 0 6554 . ? 1_555 ? 
947  SC6 7 ARG EA 42   ? ARG 3 42   . ? 1_555 ? 
948  SC7 5 G   A  1832 ? G   0 1832 . ? 1_555 ? 
949  SC7 5 A   A  2022 ? A   0 2022 . ? 1_555 ? 
950  SC7 5 HOH DJ .    ? HOH 0 4098 . ? 1_555 ? 
951  SC7 5 HOH DJ .    ? HOH 0 6573 . ? 1_555 ? 
952  SC7 5 HOH DJ .    ? HOH 0 9103 . ? 1_555 ? 
953  SC8 5 G   A  2491 ? G   0 2491 . ? 1_555 ? 
954  SC8 5 U   A  2492 ? U   0 2492 . ? 1_555 ? 
955  SC8 5 G   A  2529 ? G   0 2529 . ? 1_555 ? 
956  SC8 5 C   A  2530 ? C   0 2530 . ? 1_555 ? 
957  SC8 5 HOH DJ .    ? HOH 0 9628 . ? 1_555 ? 
958  SC9 5 U   A  919  ? U   0 919  . ? 1_555 ? 
959  SC9 5 G   A  921  ? G   0 921  . ? 1_555 ? 
960  SC9 5 A   A  922  ? A   0 922  . ? 1_555 ? 
961  SC9 5 G   A  924  ? G   0 924  . ? 1_555 ? 
962  SC9 5 HOH DJ .    ? HOH 0 9274 . ? 1_555 ? 
963  TC1 7 G   A  1576 ? G   0 1576 . ? 1_555 ? 
964  TC1 7 U   A  1577 ? U   0 1577 . ? 1_555 ? 
965  TC1 7 G   A  1618 ? G   0 1618 . ? 1_555 ? 
966  TC1 7 G   A  1619 ? G   0 1619 . ? 1_555 ? 
967  TC1 7 C   A  1620 ? C   0 1620 . ? 1_555 ? 
968  TC1 7 HOH DJ .    ? HOH 0 3677 . ? 1_555 ? 
969  TC1 7 HOH DJ .    ? HOH 0 7276 . ? 1_555 ? 
970  TC2 4 C   A  195  ? C   0 195  . ? 1_555 ? 
971  TC2 4 G   A  196  ? G   0 196  . ? 1_555 ? 
972  TC2 4 A   A  415  ? A   0 415  . ? 1_555 ? 
973  TC2 4 G   A  416  ? G   0 416  . ? 1_555 ? 
974  TC3 5 G   A  868  ? G   0 868  . ? 1_555 ? 
975  TC3 5 G   A  869  ? G   0 869  . ? 1_555 ? 
976  TC3 5 A   A  886  ? A   0 886  . ? 1_555 ? 
977  TC3 5 G   A  887  ? G   0 887  . ? 1_555 ? 
978  TC3 5 HOH DJ .    ? HOH 0 9263 . ? 1_555 ? 
979  TC4 8 A   A  632  ? A   0 632  . ? 1_555 ? 
980  TC4 8 C   A  633  ? C   0 633  . ? 1_555 ? 
981  TC4 8 U   A  2535 ? U   0 2535 . ? 1_555 ? 
982  TC4 8 C   A  2536 ? C   0 2536 . ? 1_555 ? 
983  TC4 8 A   A  2538 ? A   0 2538 . ? 1_555 ? 
984  TC4 8 U   A  2539 ? U   0 2539 . ? 1_555 ? 
985  TC4 8 HOH DJ .    ? HOH 0 3644 . ? 1_555 ? 
986  TC4 8 HOH DJ .    ? HOH 0 4846 . ? 1_555 ? 
987  TC5 4 G   A  911  ? G   0 911  . ? 1_555 ? 
988  TC5 4 U   A  1293 ? U   0 1293 . ? 1_555 ? 
989  TC5 4 G   A  1295 ? G   0 1295 . ? 1_555 ? 
990  TC5 4 HOH DJ .    ? HOH 0 6327 . ? 1_555 ? 
991  TC6 6 C   A  762  ? C   0 762  . ? 1_555 ? 
992  TC6 6 G   A  902  ? G   0 902  . ? 1_555 ? 
993  TC6 6 U   A  903  ? U   0 903  . ? 1_555 ? 
994  TC6 6 HOH DJ .    ? HOH 0 3211 . ? 1_555 ? 
995  TC6 6 HIS N  19   ? HIS L 18   . ? 1_555 ? 
996  TC6 6 HOH QJ .    ? HOH L 8831 . ? 1_555 ? 
997  TC7 5 U   A  831  ? U   0 831  . ? 1_555 ? 
998  TC7 5 U   A  832  ? U   0 832  . ? 1_555 ? 
999  TC7 5 G   A  833  ? G   0 833  . ? 1_555 ? 
1000 TC7 5 HOH DJ .    ? HOH 0 3711 . ? 1_555 ? 
1001 TC7 5 HOH DJ .    ? HOH 0 4423 . ? 1_555 ? 
1002 TC8 8 G   A  2585 ? G   0 2585 . ? 1_555 ? 
1003 TC8 8 U   A  2586 ? U   0 2586 . ? 1_555 ? 
1004 TC8 8 OMU A  2587 ? OMU 0 2587 . ? 1_555 ? 
1005 TC8 8 G   A  2592 ? G   0 2592 . ? 1_555 ? 
1006 TC8 8 C   A  2593 ? C   0 2593 . ? 1_555 ? 
1007 TC8 8 HOH DJ .    ? HOH 0 3688 . ? 1_555 ? 
1008 TC8 8 HOH DJ .    ? HOH 0 7051 . ? 1_555 ? 
1009 TC8 8 HOH DJ .    ? HOH 0 9330 . ? 1_555 ? 
1010 TC9 3 G   A  2772 ? G   0 2772 . ? 1_555 ? 
1011 TC9 3 G   A  2773 ? G   0 2773 . ? 1_555 ? 
1012 TC9 3 HOH DJ .    ? HOH 0 4365 . ? 1_555 ? 
1013 UC1 4 C   A  197  ? C   0 197  . ? 1_555 ? 
1014 UC1 4 HOH DJ .    ? HOH 0 5008 . ? 1_555 ? 
1015 UC1 4 HOH DJ .    ? HOH 0 5240 . ? 1_555 ? 
1016 UC1 4 HOH DJ .    ? HOH 0 6553 . ? 1_555 ? 
1017 UC2 3 G   A  1077 ? G   0 1077 . ? 1_555 ? 
1018 UC2 3 A   A  1079 ? A   0 1079 . ? 1_555 ? 
1019 UC2 3 HOH DJ .    ? HOH 0 7649 . ? 1_555 ? 
1020 UC3 2 G   A  1676 ? G   0 1676 . ? 1_555 ? 
1021 UC3 2 LYS DA 3    ? LYS 2 2    . ? 1_555 ? 
1022 UC4 2 C   A  197  ? C   0 197  . ? 1_555 ? 
1023 UC4 2 G   A  201  ? G   0 201  . ? 1_555 ? 
1024 UC5 3 C   A  2388 ? C   0 2388 . ? 1_555 ? 
1025 UC5 3 PHE S  53   ? PHE Q 52   . ? 1_555 ? 
1026 UC5 3 HIS S  54   ? HIS Q 53   . ? 1_555 ? 
1027 UC6 5 G   A  2582 ? G   0 2582 . ? 1_555 ? 
1028 UC6 5 A   A  2596 ? A   0 2596 . ? 1_555 ? 
1029 UC6 5 HOH DJ .    ? HOH 0 5083 . ? 1_555 ? 
1030 UC6 5 LYS M  14   ? LYS K 14   . ? 1_555 ? 
1031 UC6 5 SER M  33   ? SER K 33   . ? 1_555 ? 
1032 UC7 4 G   A  1299 ? G   0 1299 . ? 1_555 ? 
1033 UC7 4 G   A  1300 ? G   0 1300 . ? 1_555 ? 
1034 UC7 4 A   A  1328 ? A   0 1328 . ? 1_555 ? 
1035 UC7 4 G   A  1329 ? G   0 1329 . ? 1_555 ? 
1036 UC8 2 G   A  644  ? G   0 644  . ? 1_555 ? 
1037 UC8 2 HIS N  14   ? HIS L 13   . ? 1_555 ? 
1038 UC9 3 A   A  1597 ? A   0 1597 . ? 1_555 ? 
1039 UC9 3 A   A  1598 ? A   0 1598 . ? 1_555 ? 
1040 UC9 3 G   A  1646 ? G   0 1646 . ? 1_555 ? 
1041 VC1 3 G   A  1119 ? G   0 1119 . ? 1_555 ? 
1042 VC1 3 C   A  1243 ? C   0 1243 . ? 1_555 ? 
1043 VC1 3 LYS L  56   ? LYS J 56   . ? 1_555 ? 
1044 VC2 4 C   A  594  ? C   0 594  . ? 1_555 ? 
1045 VC2 4 U   A  595  ? U   0 595  . ? 1_555 ? 
1046 VC2 4 ARG AA 116  ? ARG Y 115  . ? 1_555 ? 
1047 VC2 4 HOH DK .    ? HOH Y 8854 . ? 1_555 ? 
1048 VC3 3 G   A  1072 ? G   0 1072 . ? 1_555 ? 
1049 VC3 3 G   A  1087 ? G   0 1087 . ? 1_555 ? 
1050 VC3 3 HOH DJ .    ? HOH 0 5315 . ? 1_555 ? 
1051 VC4 4 G   B  21   ? G   9 21   . ? 1_555 ? 
1052 VC4 4 A   B  56   ? A   9 56   . ? 1_555 ? 
1053 VC4 4 A   B  57   ? A   9 57   . ? 1_555 ? 
1054 VC4 4 HOH EJ .    ? HOH 9 8712 . ? 1_555 ? 
1055 VC5 1 C   B  40   ? C   9 40   . ? 1_555 ? 
1056 VC6 5 G   B  21   ? G   9 21   . ? 1_555 ? 
1057 VC6 5 G   B  22   ? G   9 22   . ? 1_555 ? 
1058 VC6 5 U   B  55   ? U   9 55   . ? 1_555 ? 
1059 VC6 5 A   B  57   ? A   9 57   . ? 1_555 ? 
1060 VC6 5 G   B  58   ? G   9 58   . ? 1_555 ? 
1061 VC7 6 HOH DJ .    ? HOH 0 3966 . ? 1_555 ? 
1062 VC7 6 HOH DJ .    ? HOH 0 9932 . ? 1_555 ? 
1063 VC7 6 HOH FJ .    ? HOH A 8823 . ? 1_555 ? 
1064 VC7 6 HOH FJ .    ? HOH A 8849 . ? 1_555 ? 
1065 VC7 6 HOH FJ .    ? HOH A 8899 . ? 1_555 ? 
1066 VC7 6 HOH FJ .    ? HOH A 8928 . ? 1_555 ? 
1067 VC8 7 A   A  2633 ? A   0 2633 . ? 1_555 ? 
1068 VC8 7 PHE C  202  ? PHE A 201  . ? 1_555 ? 
1069 VC8 7 GLY C  203  ? GLY A 202  . ? 1_555 ? 
1070 VC8 7 GLY C  204  ? GLY A 203  . ? 1_555 ? 
1071 VC8 7 HIS C  209  ? HIS A 208  . ? 1_555 ? 
1072 VC8 7 HOH FJ .    ? HOH A 8855 . ? 1_555 ? 
1073 VC8 7 HOH FJ .    ? HOH A 8898 . ? 1_555 ? 
1074 VC9 1 LYS C  179  ? LYS A 178  . ? 1_555 ? 
1075 WC1 6 HOH DJ .    ? HOH 0 3755 . ? 1_555 ? 
1076 WC1 6 HOH DJ .    ? HOH 0 6402 . ? 1_555 ? 
1077 WC1 6 HOH DJ .    ? HOH 0 7680 . ? 1_555 ? 
1078 WC1 6 HOH GJ .    ? HOH B 8852 . ? 1_555 ? 
1079 WC1 6 HOH GJ .    ? HOH B 8968 . ? 1_555 ? 
1080 WC1 6 HOH GJ .    ? HOH B 8969 . ? 1_555 ? 
1081 WC2 3 ARG D  224  ? ARG B 223  . ? 1_555 ? 
1082 WC2 3 LYS D  225  ? LYS B 224  . ? 1_555 ? 
1083 WC2 3 HIS D  228  ? HIS B 227  . ? 1_555 ? 
1084 WC3 3 ASP E  45   ? ASP C 45   . ? 1_555 ? 
1085 WC3 3 THR E  94   ? THR C 94   . ? 1_555 ? 
1086 WC3 3 LYS E  96   ? LYS C 96   . ? 1_555 ? 
1087 WC4 6 A   A  1133 ? A   0 1133 . ? 1_555 ? 
1088 WC4 6 G   A  1134 ? G   0 1134 . ? 1_555 ? 
1089 WC4 6 TYR J  157  ? TYR H 157  . ? 1_555 ? 
1090 WC4 6 ILE J  160  ? ILE H 160  . ? 1_555 ? 
1091 WC4 6 THR J  161  ? THR H 161  . ? 1_555 ? 
1092 WC4 6 PRO J  162  ? PRO H 162  . ? 1_555 ? 
1093 WC5 2 C   A  2287 ? C   0 2287 . ? 1_555 ? 
1094 WC5 2 ARG J  117  ? ARG H 117  . ? 1_555 ? 
1095 WC6 6 HOH DJ .    ? HOH 0 5742 . ? 1_555 ? 
1096 WC6 6 HOH DJ .    ? HOH 0 9486 . ? 1_555 ? 
1097 WC6 6 ARG L  60   ? ARG J 60   . ? 1_555 ? 
1098 WC6 6 VAL L  61   ? VAL J 61   . ? 1_555 ? 
1099 WC6 6 ILE L  63   ? ILE J 63   . ? 1_555 ? 
1100 WC6 6 TYR L  69   ? TYR J 69   . ? 1_555 ? 
1101 WC7 3 ILE L  127  ? ILE J 127  . ? 1_555 ? 
1102 WC7 3 LYS L  128  ? LYS J 128  . ? 1_555 ? 
1103 WC7 3 HOH OJ .    ? HOH J 4193 . ? 1_555 ? 
1104 WC8 2 PRO L  88   ? PRO J 88   . ? 1_555 ? 
1105 WC8 2 LYS L  90   ? LYS J 90   . ? 1_555 ? 
1106 WC9 4 GLY L  64   ? GLY J 64   . ? 1_555 ? 
1107 WC9 4 ASN L  65   ? ASN J 65   . ? 1_555 ? 
1108 WC9 4 GLY L  68   ? GLY J 68   . ? 1_555 ? 
1109 WC9 4 TYR L  69   ? TYR J 69   . ? 1_555 ? 
1110 XC1 6 HOH DJ .    ? HOH 0 3419 . ? 1_555 ? 
1111 XC1 6 HOH DJ .    ? HOH 0 4237 . ? 1_555 ? 
1112 XC1 6 HOH DJ .    ? HOH 0 6027 . ? 1_555 ? 
1113 XC1 6 ASN M  42   ? ASN K 42   . ? 1_555 ? 
1114 XC1 6 HOH PJ .    ? HOH K 2121 . ? 1_555 ? 
1115 XC1 6 HOH PJ .    ? HOH K 7871 . ? 1_555 ? 
1116 XC2 6 ARG N  28   ? ARG L 27   . ? 1_555 ? 
1117 XC2 6 GLY N  29   ? GLY L 28   . ? 1_555 ? 
1118 XC2 6 GLY N  30   ? GLY L 29   . ? 1_555 ? 
1119 XC2 6 GLY N  32   ? GLY L 31   . ? 1_555 ? 
1120 XC2 6 ALA N  34   ? ALA L 33   . ? 1_555 ? 
1121 XC2 6 GLU N  40   ? GLU L 39   . ? 1_555 ? 
1122 XC3 1 ARG N  54   ? ARG L 53   . ? 1_555 ? 
1123 XC4 5 SER O  107  ? SER M 106  . ? 1_555 ? 
1124 XC4 5 PHE O  110  ? PHE M 109  . ? 1_555 ? 
1125 XC4 5 PRO O  111  ? PRO M 110  . ? 1_555 ? 
1126 XC4 5 LEU O  113  ? LEU M 112  . ? 1_555 ? 
1127 XC4 5 HOH RJ .    ? HOH M 8927 . ? 1_555 ? 
1128 XC5 5 SER O  107  ? SER M 106  . ? 1_555 ? 
1129 XC5 5 ARG O  114  ? ARG M 113  . ? 1_555 ? 
1130 XC5 5 VAL O  115  ? VAL M 114  . ? 1_555 ? 
1131 XC5 5 ARG O  159  ? ARG M 158  . ? 1_555 ? 
1132 XC5 5 VAL O  160  ? VAL M 159  . ? 1_555 ? 
1133 XC6 4 LYS F  147  ? LYS D 146  . ? 1_555 ? 
1134 XC6 4 ARG P  38   ? ARG N 37   . ? 1_555 ? 
1135 XC6 4 LYS P  39   ? LYS N 38   . ? 1_555 ? 
1136 XC6 4 ASN P  108  ? ASN N 107  . ? 1_555 ? 
1137 XC7 3 HOH DJ .    ? HOH 0 5998 . ? 1_555 ? 
1138 XC7 3 HIS Q  41   ? HIS O 40   . ? 1_555 ? 
1139 XC7 3 HOH TJ .    ? HOH O 5650 . ? 1_555 ? 
1140 XC8 1 ASN Q  45   ? ASN O 44   . ? 1_555 ? 
1141 XC9 5 ASP S  21   ? ASP Q 20   . ? 1_555 ? 
1142 XC9 5 GLY S  23   ? GLY Q 22   . ? 1_555 ? 
1143 XC9 5 SER S  25   ? SER Q 24   . ? 1_555 ? 
1144 XC9 5 SER S  47   ? SER Q 46   . ? 1_555 ? 
1145 XC9 5 HOH VJ .    ? HOH Q 1795 . ? 1_555 ? 
1146 YC1 5 HOH DJ .    ? HOH 0 5902 . ? 1_555 ? 
1147 YC1 5 SER T  71   ? SER R 70   . ? 1_555 ? 
1148 YC1 5 VAL T  73   ? VAL R 72   . ? 1_555 ? 
1149 YC1 5 HOH WJ .    ? HOH R 8822 . ? 1_555 ? 
1150 YC1 5 HOH WJ .    ? HOH R 8824 . ? 1_555 ? 
1151 YC2 6 U   A  2659 ? U   0 2659 . ? 1_555 ? 
1152 YC2 6 G   A  2660 ? G   0 2660 . ? 1_555 ? 
1153 YC2 6 VAL T  73   ? VAL R 72   . ? 1_555 ? 
1154 YC2 6 TRP T  76   ? TRP R 75   . ? 1_555 ? 
1155 YC2 6 HOH WJ .    ? HOH R 8813 . ? 1_555 ? 
1156 YC2 6 HOH WJ .    ? HOH R 8824 . ? 1_555 ? 
1157 YC3 3 U   A  12   ? U   0 12   . ? 1_555 ? 
1158 YC3 3 LYS T  61   ? LYS R 60   . ? 1_555 ? 
1159 YC3 3 ASN T  64   ? ASN R 63   . ? 1_555 ? 
1160 YC4 2 LYS T  119  ? LYS R 118  . ? 1_555 ? 
1161 YC4 2 HOH WJ .    ? HOH R 8809 . ? 1_555 ? 
1162 YC5 3 HIS U  8    ? HIS S 7    . ? 1_555 ? 
1163 YC5 3 GLU U  62   ? GLU S 61   . ? 1_555 ? 
1164 YC5 3 HOH XJ .    ? HOH S 8525 . ? 1_555 ? 
1165 YC6 6 GLN V  38   ? GLN T 37   . ? 1_555 ? 
1166 YC6 6 ARG V  112  ? ARG T 111  . ? 1_555 ? 
1167 YC6 6 LEU V  113  ? LEU T 112  . ? 1_555 ? 
1168 YC6 6 SER V  115  ? SER T 114  . ? 1_555 ? 
1169 YC6 6 ASP V  118  ? ASP T 117  . ? 1_555 ? 
1170 YC6 6 HOH YJ .    ? HOH T 2868 . ? 1_555 ? 
1171 YC7 7 U   A  308  ? U   0 308  . ? 1_555 ? 
1172 YC7 7 U   A  335  ? U   0 335  . ? 1_555 ? 
1173 YC7 7 A   A  339  ? A   0 339  . ? 1_555 ? 
1174 YC7 7 C   A  342  ? C   0 342  . ? 1_555 ? 
1175 YC7 7 SER V  95   ? SER T 94   . ? 1_555 ? 
1176 YC7 7 ASN V  96   ? ASN T 95   . ? 1_555 ? 
1177 YC7 7 HOH YJ .    ? HOH T 1124 . ? 1_555 ? 
1178 YC8 4 CYS W  6    ? CYS U 6    . ? 1_555 ? 
1179 YC8 4 CYS W  9    ? CYS U 9    . ? 1_555 ? 
1180 YC8 4 CYS W  32   ? CYS U 32   . ? 1_555 ? 
1181 YC8 4 CYS W  36   ? CYS U 36   . ? 1_555 ? 
1182 YC9 7 HIS AA 134  ? HIS Y 133  . ? 1_555 ? 
1183 YC9 7 LYS AA 137  ? LYS Y 136  . ? 1_555 ? 
1184 YC9 7 LYS AA 138  ? LYS Y 137  . ? 1_555 ? 
1185 YC9 7 VAL AA 140  ? VAL Y 139  . ? 1_555 ? 
1186 YC9 7 HOH DK .    ? HOH Y 8859 . ? 1_555 ? 
1187 YC9 7 HOH DK .    ? HOH Y 8880 . ? 1_555 ? 
1188 YC9 7 HOH DK .    ? HOH Y 8914 . ? 1_555 ? 
1189 ZC1 1 ARG AA 170  ? ARG Y 169  . ? 1_555 ? 
1190 ZC2 4 CYS BA 30   ? CYS Z 39   . ? 1_555 ? 
1191 ZC2 4 CYS BA 33   ? CYS Z 42   . ? 1_555 ? 
1192 ZC2 4 CYS BA 48   ? CYS Z 57   . ? 1_555 ? 
1193 ZC2 4 CYS BA 51   ? CYS Z 60   . ? 1_555 ? 
1194 ZC3 4 CYS CA 20   ? CYS 1 19   . ? 1_555 ? 
1195 ZC3 4 CYS CA 23   ? CYS 1 22   . ? 1_555 ? 
1196 ZC3 4 CYS CA 35   ? CYS 1 34   . ? 1_555 ? 
1197 ZC3 4 CYS CA 38   ? CYS 1 37   . ? 1_555 ? 
1198 ZC4 4 HOH DJ .    ? HOH 0 6827 . ? 1_555 ? 
1199 ZC4 4 HOH DJ .    ? HOH 0 7800 . ? 1_555 ? 
1200 ZC4 4 HOH DJ .    ? HOH 0 7854 . ? 1_555 ? 
1201 ZC4 4 HOH DJ .    ? HOH 0 7855 . ? 1_555 ? 
1202 ZC5 6 GLY EA 45   ? GLY 3 45   . ? 1_555 ? 
1203 ZC5 6 GLY EA 47   ? GLY 3 47   . ? 1_555 ? 
1204 ZC5 6 ASP EA 49   ? ASP 3 49   . ? 1_555 ? 
1205 ZC5 6 HOH HK .    ? HOH 3 8827 . ? 1_555 ? 
1206 ZC5 6 HOH HK .    ? HOH 3 8881 . ? 1_555 ? 
1207 ZC5 6 HOH HK .    ? HOH 3 8882 . ? 1_555 ? 
1208 ZC6 5 CYS EA 11   ? CYS 3 11   . ? 1_555 ? 
1209 ZC6 5 CYS EA 14   ? CYS 3 14   . ? 1_555 ? 
1210 ZC6 5 CYS EA 71   ? CYS 3 71   . ? 1_555 ? 
1211 ZC6 5 CYS EA 74   ? CYS 3 74   . ? 1_555 ? 
1212 ZC6 5 HOH HK .    ? HOH 3 8865 . ? 1_555 ? 
1213 ZC7 1 ASP EA 66   ? ASP 3 66   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1YI2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1YI2 
_atom_sites.fract_transf_matrix[1][1]   0.004707 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003333 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001742 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  10   ? 16.145  148.350 104.213 1.00 96.10  ? 10   U   0 "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  10   ? 16.876  149.563 104.034 1.00 95.46  ? 10   U   0 "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  10   ? 18.367  149.448 104.289 1.00 95.17  ? 10   U   0 "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  10   ? 18.607  148.925 105.622 1.00 96.74  ? 10   U   0 "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  10   ? 19.167  148.492 103.412 1.00 92.39  ? 10   U   0 "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  10   ? 19.373  149.084 102.119 1.00 85.49  ? 10   U   0 "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  10   ? 20.447  148.318 104.233 1.00 93.99  ? 10   U   0 "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  10   ? 21.331  149.409 104.108 1.00 95.71  ? 10   U   0 "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  10   ? 19.906  148.357 105.665 1.00 95.51  ? 10   U   0 "C1'" 1 
ATOM   10    N  N1    . U   A  1  10   ? 19.865  147.088 106.414 1.00 96.48  ? 10   U   0 N1    1 
ATOM   11    C  C2    . U   A  1  10   ? 19.765  147.169 107.803 1.00 97.27  ? 10   U   0 C2    1 
ATOM   12    O  O2    . U   A  1  10   ? 19.683  148.228 108.410 1.00 99.60  ? 10   U   0 O2    1 
ATOM   13    N  N3    . U   A  1  10   ? 19.763  145.966 108.457 1.00 96.19  ? 10   U   0 N3    1 
ATOM   14    C  C4    . U   A  1  10   ? 19.846  144.716 107.894 1.00 96.26  ? 10   U   0 C4    1 
ATOM   15    O  O4    . U   A  1  10   ? 19.891  143.735 108.633 1.00 96.88  ? 10   U   0 O4    1 
ATOM   16    C  C5    . U   A  1  10   ? 19.931  144.703 106.460 1.00 95.69  ? 10   U   0 C5    1 
ATOM   17    C  C6    . U   A  1  10   ? 19.936  145.859 105.785 1.00 95.65  ? 10   U   0 C6    1 
ATOM   18    P  P     . A   A  1  11   ? 20.626  148.651 101.201 1.00 77.70  ? 11   A   0 P     1 
ATOM   19    O  OP1   . A   A  1  11   ? 20.245  148.952 99.797  1.00 79.16  ? 11   A   0 OP1   1 
ATOM   20    O  OP2   . A   A  1  11   ? 21.089  147.288 101.552 1.00 77.60  ? 11   A   0 OP2   1 
ATOM   21    O  "O5'" . A   A  1  11   ? 21.745  149.698 101.625 1.00 73.14  ? 11   A   0 "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  11   ? 23.086  149.569 101.160 1.00 66.29  ? 11   A   0 "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  11   ? 24.026  150.325 102.065 1.00 61.95  ? 11   A   0 "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  11   ? 23.771  149.986 103.451 1.00 59.96  ? 11   A   0 "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  11   ? 25.482  149.979 101.829 1.00 59.46  ? 11   A   0 "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  11   ? 26.005  150.787 100.796 1.00 57.30  ? 11   A   0 "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  11   ? 26.110  150.212 103.193 1.00 58.32  ? 11   A   0 "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  11   ? 26.362  151.576 103.455 1.00 57.97  ? 11   A   0 "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  11   ? 24.992  149.719 104.115 1.00 57.80  ? 11   A   0 "C1'" 1 
ATOM   30    N  N9    . A   A  1  11   ? 25.031  148.282 104.403 1.00 56.70  ? 11   A   0 N9    1 
ATOM   31    C  C8    . A   A  1  11   ? 23.986  147.385 104.348 1.00 55.73  ? 11   A   0 C8    1 
ATOM   32    N  N7    . A   A  1  11   ? 24.322  146.161 104.673 1.00 54.92  ? 11   A   0 N7    1 
ATOM   33    C  C5    . A   A  1  11   ? 25.677  146.252 104.956 1.00 54.33  ? 11   A   0 C5    1 
ATOM   34    C  C6    . A   A  1  11   ? 26.622  145.298 105.360 1.00 53.95  ? 11   A   0 C6    1 
ATOM   35    N  N6    . A   A  1  11   ? 26.343  144.008 105.545 1.00 54.85  ? 11   A   0 N6    1 
ATOM   36    N  N1    . A   A  1  11   ? 27.886  145.719 105.567 1.00 54.86  ? 11   A   0 N1    1 
ATOM   37    C  C2    . A   A  1  11   ? 28.174  147.010 105.368 1.00 55.39  ? 11   A   0 C2    1 
ATOM   38    N  N3    . A   A  1  11   ? 27.377  148.000 104.983 1.00 54.46  ? 11   A   0 N3    1 
ATOM   39    C  C4    . A   A  1  11   ? 26.127  147.551 104.793 1.00 55.16  ? 11   A   0 C4    1 
ATOM   40    P  P     . U   A  1  12   ? 26.192  150.168 99.333  1.00 58.50  ? 12   U   0 P     1 
ATOM   41    O  OP1   . U   A  1  12   ? 26.599  151.295 98.462  1.00 60.07  ? 12   U   0 OP1   1 
ATOM   42    O  OP2   . U   A  1  12   ? 24.998  149.367 98.981  1.00 59.18  ? 12   U   0 OP2   1 
ATOM   43    O  "O5'" . U   A  1  12   ? 27.420  149.166 99.499  1.00 59.26  ? 12   U   0 "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  12   ? 28.744  149.668 99.759  1.00 57.05  ? 12   U   0 "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  12   ? 29.618  148.591 100.355 1.00 55.28  ? 12   U   0 "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  12   ? 29.083  148.172 101.638 1.00 54.99  ? 12   U   0 "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  12   ? 29.723  147.286 99.587  1.00 55.40  ? 12   U   0 "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  12   ? 30.608  147.355 98.483  1.00 55.12  ? 12   U   0 "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  12   ? 30.245  146.352 100.666 1.00 55.86  ? 12   U   0 "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  12   ? 31.617  146.552 100.948 1.00 57.79  ? 12   U   0 "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  12   ? 29.409  146.805 101.864 1.00 55.45  ? 12   U   0 "C1'" 1 
ATOM   52    N  N1    . U   A  1  12   ? 28.169  146.016 101.950 1.00 54.43  ? 12   U   0 N1    1 
ATOM   53    C  C2    . U   A  1  12   ? 28.271  144.710 102.410 1.00 55.17  ? 12   U   0 C2    1 
ATOM   54    O  O2    . U   A  1  12   ? 29.324  144.216 102.783 1.00 56.46  ? 12   U   0 O2    1 
ATOM   55    N  N3    . U   A  1  12   ? 27.097  144.002 102.413 1.00 54.26  ? 12   U   0 N3    1 
ATOM   56    C  C4    . U   A  1  12   ? 25.861  144.449 102.019 1.00 54.14  ? 12   U   0 C4    1 
ATOM   57    O  O4    . U   A  1  12   ? 24.921  143.660 101.992 1.00 55.32  ? 12   U   0 O4    1 
ATOM   58    C  C5    . U   A  1  12   ? 25.828  145.812 101.586 1.00 54.73  ? 12   U   0 C5    1 
ATOM   59    C  C6    . U   A  1  12   ? 26.953  146.532 101.569 1.00 54.08  ? 12   U   0 C6    1 
ATOM   60    P  P     . G   A  1  13   ? 30.108  146.878 97.032  1.00 55.17  ? 13   G   0 P     1 
ATOM   61    O  OP1   . G   A  1  13   ? 31.344  146.679 96.226  1.00 56.29  ? 13   G   0 OP1   1 
ATOM   62    O  OP2   . G   A  1  13   ? 29.068  147.838 96.569  1.00 57.58  ? 13   G   0 OP2   1 
ATOM   63    O  "O5'" . G   A  1  13   ? 29.417  145.458 97.265  1.00 52.91  ? 13   G   0 "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  13   ? 30.177  144.375 97.807  1.00 51.51  ? 13   G   0 "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  13   ? 29.292  143.209 98.203  1.00 50.13  ? 13   G   0 "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  13   ? 28.162  143.640 98.998  1.00 49.20  ? 13   G   0 "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  13   ? 28.577  142.406 97.133  1.00 48.27  ? 13   G   0 "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  13   ? 29.470  141.564 96.415  1.00 48.89  ? 13   G   0 "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  13   ? 27.658  141.554 98.004  1.00 48.64  ? 13   G   0 "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  13   ? 28.336  140.496 98.652  1.00 46.83  ? 13   G   0 "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  13   ? 27.247  142.559 99.081  1.00 47.94  ? 13   G   0 "C1'" 1 
ATOM   72    N  N9    . G   A  1  13   ? 25.884  143.038 98.882  1.00 47.76  ? 13   G   0 N9    1 
ATOM   73    C  C8    . G   A  1  13   ? 25.466  144.294 98.514  1.00 47.27  ? 13   G   0 C8    1 
ATOM   74    N  N7    . G   A  1  13   ? 24.167  144.392 98.421  1.00 47.11  ? 13   G   0 N7    1 
ATOM   75    C  C5    . G   A  1  13   ? 23.702  143.126 98.750  1.00 46.46  ? 13   G   0 C5    1 
ATOM   76    C  C6    . G   A  1  13   ? 22.382  142.622 98.829  1.00 45.62  ? 13   G   0 C6    1 
ATOM   77    O  O6    . G   A  1  13   ? 21.319  143.211 98.620  1.00 46.26  ? 13   G   0 O6    1 
ATOM   78    N  N1    . G   A  1  13   ? 22.367  141.285 99.194  1.00 44.92  ? 13   G   0 N1    1 
ATOM   79    C  C2    . G   A  1  13   ? 23.475  140.526 99.447  1.00 45.30  ? 13   G   0 C2    1 
ATOM   80    N  N2    . G   A  1  13   ? 23.253  139.250 99.767  1.00 45.66  ? 13   G   0 N2    1 
ATOM   81    N  N3    . G   A  1  13   ? 24.708  140.980 99.386  1.00 45.28  ? 13   G   0 N3    1 
ATOM   82    C  C4    . G   A  1  13   ? 24.748  142.280 99.034  1.00 46.48  ? 13   G   0 C4    1 
ATOM   83    P  P     . C   A  1  14   ? 29.013  140.927 95.014  1.00 46.97  ? 14   C   0 P     1 
ATOM   84    O  OP1   . C   A  1  14   ? 30.222  140.374 94.351  1.00 45.67  ? 14   C   0 OP1   1 
ATOM   85    O  OP2   . C   A  1  14   ? 28.177  141.930 94.302  1.00 47.50  ? 14   C   0 OP2   1 
ATOM   86    O  "O5'" . C   A  1  14   ? 28.095  139.704 95.447  1.00 46.23  ? 14   C   0 "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  14   ? 28.682  138.524 96.004  1.00 46.74  ? 14   C   0 "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  14   ? 27.653  137.436 96.123  1.00 48.28  ? 14   C   0 "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  14   ? 26.641  137.835 97.081  1.00 49.79  ? 14   C   0 "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  14   ? 26.875  137.127 94.857  1.00 49.10  ? 14   C   0 "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  14   ? 27.606  136.239 94.022  1.00 50.64  ? 14   C   0 "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  14   ? 25.620  136.483 95.421  1.00 50.00  ? 14   C   0 "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  14   ? 25.855  135.157 95.841  1.00 52.34  ? 14   C   0 "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  14   ? 25.378  137.344 96.664  1.00 49.80  ? 14   C   0 "C1'" 1 
ATOM   95    N  N1    . C   A  1  14   ? 24.492  138.494 96.411  1.00 48.79  ? 14   C   0 N1    1 
ATOM   96    C  C2    . C   A  1  14   ? 23.113  138.287 96.366  1.00 48.52  ? 14   C   0 C2    1 
ATOM   97    O  O2    . C   A  1  14   ? 22.669  137.134 96.529  1.00 49.66  ? 14   C   0 O2    1 
ATOM   98    N  N3    . C   A  1  14   ? 22.296  139.343 96.143  1.00 46.83  ? 14   C   0 N3    1 
ATOM   99    C  C4    . C   A  1  14   ? 22.810  140.561 95.968  1.00 45.84  ? 14   C   0 C4    1 
ATOM   100   N  N4    . C   A  1  14   ? 21.973  141.574 95.762  1.00 44.63  ? 14   C   0 N4    1 
ATOM   101   C  C5    . C   A  1  14   ? 24.207  140.795 95.998  1.00 48.16  ? 14   C   0 C5    1 
ATOM   102   C  C6    . C   A  1  14   ? 25.006  139.746 96.220  1.00 49.21  ? 14   C   0 C6    1 
ATOM   103   P  P     . C   A  1  15   ? 27.444  136.314 92.422  1.00 52.39  ? 15   C   0 P     1 
ATOM   104   O  OP1   . C   A  1  15   ? 28.484  135.409 91.865  1.00 51.49  ? 15   C   0 OP1   1 
ATOM   105   O  OP2   . C   A  1  15   ? 27.381  137.729 91.971  1.00 50.70  ? 15   C   0 OP2   1 
ATOM   106   O  "O5'" . C   A  1  15   ? 26.019  135.662 92.157  1.00 54.30  ? 15   C   0 "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  15   ? 25.760  134.291 92.502  1.00 54.18  ? 15   C   0 "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  15   ? 24.308  133.969 92.278  1.00 56.12  ? 15   C   0 "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  15   ? 23.494  134.700 93.233  1.00 57.18  ? 15   C   0 "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  15   ? 23.731  134.400 90.939  1.00 57.40  ? 15   C   0 "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  15   ? 24.055  133.515 89.881  1.00 59.62  ? 15   C   0 "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  15   ? 22.243  134.405 91.239  1.00 57.49  ? 15   C   0 "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  15   ? 21.718  133.096 91.317  1.00 58.78  ? 15   C   0 "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  15   ? 22.237  135.008 92.641  1.00 56.51  ? 15   C   0 "C1'" 1 
ATOM   115   N  N1    . C   A  1  15   ? 22.044  136.473 92.623  1.00 55.02  ? 15   C   0 N1    1 
ATOM   116   C  C2    . C   A  1  15   ? 20.736  136.975 92.613  1.00 54.03  ? 15   C   0 C2    1 
ATOM   117   O  O2    . C   A  1  15   ? 19.788  136.179 92.584  1.00 53.84  ? 15   C   0 O2    1 
ATOM   118   N  N3    . C   A  1  15   ? 20.538  138.312 92.632  1.00 53.58  ? 15   C   0 N3    1 
ATOM   119   C  C4    . C   A  1  15   ? 21.582  139.139 92.654  1.00 53.06  ? 15   C   0 C4    1 
ATOM   120   N  N4    . C   A  1  15   ? 21.338  140.451 92.691  1.00 52.50  ? 15   C   0 N4    1 
ATOM   121   C  C5    . C   A  1  15   ? 22.923  138.659 92.643  1.00 53.39  ? 15   C   0 C5    1 
ATOM   122   C  C6    . C   A  1  15   ? 23.108  137.331 92.626  1.00 53.75  ? 15   C   0 C6    1 
ATOM   123   P  P     . A   A  1  16   ? 24.236  134.094 88.393  1.00 61.84  ? 16   A   0 P     1 
ATOM   124   O  OP1   . A   A  1  16   ? 24.808  132.974 87.599  1.00 61.96  ? 16   A   0 OP1   1 
ATOM   125   O  OP2   . A   A  1  16   ? 24.961  135.391 88.460  1.00 61.95  ? 16   A   0 OP2   1 
ATOM   126   O  "O5'" . A   A  1  16   ? 22.748  134.399 87.900  1.00 61.96  ? 16   A   0 "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  16   ? 21.860  133.326 87.521  1.00 61.74  ? 16   A   0 "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  16   ? 20.452  133.840 87.325  1.00 61.63  ? 16   A   0 "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  16   ? 20.002  134.489 88.545  1.00 59.46  ? 16   A   0 "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  16   ? 20.237  134.897 86.251  1.00 62.35  ? 16   A   0 "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  16   ? 20.131  134.344 84.935  1.00 63.86  ? 16   A   0 "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  16   ? 18.923  135.524 86.697  1.00 61.39  ? 16   A   0 "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  16   ? 17.808  134.732 86.352  1.00 63.94  ? 16   A   0 "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  16   ? 19.097  135.534 88.219  1.00 59.34  ? 16   A   0 "C1'" 1 
ATOM   135   N  N9    . A   A  1  16   ? 19.660  136.806 88.676  1.00 57.34  ? 16   A   0 N9    1 
ATOM   136   C  C8    . A   A  1  16   ? 20.975  137.113 88.943  1.00 57.21  ? 16   A   0 C8    1 
ATOM   137   N  N7    . A   A  1  16   ? 21.166  138.365 89.287  1.00 55.44  ? 16   A   0 N7    1 
ATOM   138   C  C5    . A   A  1  16   ? 19.894  138.918 89.254  1.00 52.59  ? 16   A   0 C5    1 
ATOM   139   C  C6    . A   A  1  16   ? 19.421  140.213 89.509  1.00 50.17  ? 16   A   0 C6    1 
ATOM   140   N  N6    . A   A  1  16   ? 20.205  141.238 89.840  1.00 47.57  ? 16   A   0 N6    1 
ATOM   141   N  N1    . A   A  1  16   ? 18.096  140.426 89.403  1.00 49.59  ? 16   A   0 N1    1 
ATOM   142   C  C2    . A   A  1  16   ? 17.309  139.406 89.047  1.00 50.44  ? 16   A   0 C2    1 
ATOM   143   N  N3    . A   A  1  16   ? 17.633  138.150 88.767  1.00 51.22  ? 16   A   0 N3    1 
ATOM   144   C  C4    . A   A  1  16   ? 18.955  137.967 88.893  1.00 53.95  ? 16   A   0 C4    1 
ATOM   145   P  P     . G   A  1  17   ? 20.520  135.243 83.650  1.00 66.85  ? 17   G   0 P     1 
ATOM   146   O  OP1   . G   A  1  17   ? 20.406  134.365 82.449  1.00 67.05  ? 17   G   0 OP1   1 
ATOM   147   O  OP2   . G   A  1  17   ? 21.807  135.937 83.925  1.00 67.08  ? 17   G   0 OP2   1 
ATOM   148   O  "O5'" . G   A  1  17   ? 19.379  136.359 83.571  1.00 62.88  ? 17   G   0 "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  17   ? 18.030  136.000 83.245  1.00 59.71  ? 17   G   0 "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  17   ? 17.091  137.157 83.491  1.00 58.28  ? 17   G   0 "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  17   ? 17.339  137.708 84.807  1.00 58.05  ? 17   G   0 "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  17   ? 17.217  138.390 82.613  1.00 57.69  ? 17   G   0 "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  17   ? 16.602  138.190 81.342  1.00 56.98  ? 17   G   0 "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  17   ? 16.426  139.409 83.428  1.00 58.23  ? 17   G   0 "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  17   ? 15.029  139.224 83.299  1.00 58.18  ? 17   G   0 "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  17   ? 16.828  139.033 84.857  1.00 56.72  ? 17   G   0 "C1'" 1 
ATOM   157   N  N9    . G   A  1  17   ? 17.840  139.915 85.433  1.00 54.53  ? 17   G   0 N9    1 
ATOM   158   C  C8    . G   A  1  17   ? 19.154  139.614 85.703  1.00 54.26  ? 17   G   0 C8    1 
ATOM   159   N  N7    . G   A  1  17   ? 19.817  140.620 86.205  1.00 54.36  ? 17   G   0 N7    1 
ATOM   160   C  C5    . G   A  1  17   ? 18.887  141.647 86.272  1.00 53.62  ? 17   G   0 C5    1 
ATOM   161   C  C6    . G   A  1  17   ? 19.023  142.982 86.732  1.00 54.17  ? 17   G   0 C6    1 
ATOM   162   O  O6    . G   A  1  17   ? 20.029  143.547 87.176  1.00 55.71  ? 17   G   0 O6    1 
ATOM   163   N  N1    . G   A  1  17   ? 17.825  143.681 86.635  1.00 53.84  ? 17   G   0 N1    1 
ATOM   164   C  C2    . G   A  1  17   ? 16.648  143.170 86.160  1.00 54.05  ? 17   G   0 C2    1 
ATOM   165   N  N2    . G   A  1  17   ? 15.601  144.011 86.151  1.00 52.49  ? 17   G   0 N2    1 
ATOM   166   N  N3    . G   A  1  17   ? 16.505  141.926 85.724  1.00 55.33  ? 17   G   0 N3    1 
ATOM   167   C  C4    . G   A  1  17   ? 17.659  141.227 85.808  1.00 54.29  ? 17   G   0 C4    1 
ATOM   168   P  P     . C   A  1  18   ? 16.966  139.158 80.112  1.00 55.61  ? 18   C   0 P     1 
ATOM   169   O  OP1   . C   A  1  18   ? 16.217  138.664 78.928  1.00 56.69  ? 18   C   0 OP1   1 
ATOM   170   O  OP2   . C   A  1  18   ? 18.437  139.294 80.037  1.00 55.69  ? 18   C   0 OP2   1 
ATOM   171   O  "O5'" . C   A  1  18   ? 16.366  140.570 80.537  1.00 52.45  ? 18   C   0 "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  18   ? 14.953  140.822 80.488  1.00 48.78  ? 18   C   0 "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  18   ? 14.667  142.254 80.876  1.00 49.08  ? 18   C   0 "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  18   ? 15.083  142.468 82.252  1.00 48.19  ? 18   C   0 "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  18   ? 15.415  143.320 80.085  1.00 48.62  ? 18   C   0 "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  18   ? 14.754  143.640 78.868  1.00 48.64  ? 18   C   0 "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  18   ? 15.412  144.495 81.049  1.00 49.22  ? 18   C   0 "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  18   ? 14.177  145.179 81.047  1.00 51.68  ? 18   C   0 "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  18   ? 15.601  143.782 82.392  1.00 48.39  ? 18   C   0 "C1'" 1 
ATOM   180   N  N1    . C   A  1  18   ? 17.015  143.693 82.811  1.00 48.41  ? 18   C   0 N1    1 
ATOM   181   C  C2    . C   A  1  18   ? 17.600  144.799 83.436  1.00 50.27  ? 18   C   0 C2    1 
ATOM   182   O  O2    . C   A  1  18   ? 16.917  145.822 83.612  1.00 53.27  ? 18   C   0 O2    1 
ATOM   183   N  N3    . C   A  1  18   ? 18.896  144.725 83.832  1.00 49.87  ? 18   C   0 N3    1 
ATOM   184   C  C4    . C   A  1  18   ? 19.596  143.607 83.625  1.00 47.55  ? 18   C   0 C4    1 
ATOM   185   N  N4    . C   A  1  18   ? 20.858  143.575 84.049  1.00 44.96  ? 18   C   0 N4    1 
ATOM   186   C  C5    . C   A  1  18   ? 19.029  142.472 82.983  1.00 46.90  ? 18   C   0 C5    1 
ATOM   187   C  C6    . C   A  1  18   ? 17.748  142.556 82.598  1.00 48.63  ? 18   C   0 C6    1 
ATOM   188   P  P     . U   A  1  19   ? 15.611  144.016 77.560  1.00 47.24  ? 19   U   0 P     1 
ATOM   189   O  OP1   . U   A  1  19   ? 14.677  144.053 76.416  1.00 50.17  ? 19   U   0 OP1   1 
ATOM   190   O  OP2   . U   A  1  19   ? 16.789  143.121 77.499  1.00 50.04  ? 19   U   0 OP2   1 
ATOM   191   O  "O5'" . U   A  1  19   ? 16.098  145.504 77.841  1.00 47.17  ? 19   U   0 "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  19   ? 15.173  146.605 77.825  1.00 44.16  ? 19   U   0 "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  19   ? 15.875  147.893 78.195  1.00 43.85  ? 19   U   0 "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  19   ? 16.274  147.851 79.592  1.00 44.52  ? 19   U   0 "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  19   ? 17.177  148.194 77.470  1.00 44.17  ? 19   U   0 "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  19   ? 16.984  148.708 76.159  1.00 44.74  ? 19   U   0 "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  19   ? 17.822  149.199 78.411  1.00 43.68  ? 19   U   0 "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  19   ? 17.224  150.477 78.340  1.00 43.63  ? 19   U   0 "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  19   ? 17.482  148.581 79.766  1.00 44.40  ? 19   U   0 "C1'" 1 
ATOM   200   N  N1    . U   A  1  19   ? 18.536  147.657 80.220  1.00 46.21  ? 19   U   0 N1    1 
ATOM   201   C  C2    . U   A  1  19   ? 19.674  148.200 80.825  1.00 47.18  ? 19   U   0 C2    1 
ATOM   202   O  O2    . U   A  1  19   ? 19.823  149.396 81.031  1.00 45.49  ? 19   U   0 O2    1 
ATOM   203   N  N3    . U   A  1  19   ? 20.631  147.284 81.180  1.00 46.55  ? 19   U   0 N3    1 
ATOM   204   C  C4    . U   A  1  19   ? 20.578  145.920 81.010  1.00 46.85  ? 19   U   0 C4    1 
ATOM   205   O  O4    . U   A  1  19   ? 21.546  145.237 81.330  1.00 46.56  ? 19   U   0 O4    1 
ATOM   206   C  C5    . U   A  1  19   ? 19.373  145.436 80.405  1.00 47.44  ? 19   U   0 C5    1 
ATOM   207   C  C6    . U   A  1  19   ? 18.420  146.297 80.041  1.00 45.08  ? 19   U   0 C6    1 
ATOM   208   P  P     . G   A  1  20   ? 18.081  148.413 75.019  1.00 44.68  ? 20   G   0 P     1 
ATOM   209   O  OP1   . G   A  1  20   ? 17.597  149.052 73.780  1.00 44.36  ? 20   G   0 OP1   1 
ATOM   210   O  OP2   . G   A  1  20   ? 18.409  146.965 75.010  1.00 45.32  ? 20   G   0 OP2   1 
ATOM   211   O  "O5'" . G   A  1  20   ? 19.369  149.210 75.512  1.00 44.41  ? 20   G   0 "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  20   ? 19.392  150.644 75.504  1.00 43.60  ? 20   G   0 "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  20   ? 20.667  151.161 76.130  1.00 45.30  ? 20   G   0 "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  20   ? 20.732  150.749 77.523  1.00 45.25  ? 20   G   0 "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  20   ? 21.984  150.667 75.553  1.00 44.20  ? 20   G   0 "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  20   ? 22.348  151.352 74.362  1.00 44.89  ? 20   G   0 "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  20   ? 22.937  150.980 76.698  1.00 44.46  ? 20   G   0 "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  20   ? 23.244  152.356 76.790  1.00 44.56  ? 20   G   0 "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  20   ? 22.088  150.585 77.906  1.00 44.54  ? 20   G   0 "C1'" 1 
ATOM   220   N  N9    . G   A  1  20   ? 22.312  149.186 78.267  1.00 46.67  ? 20   G   0 N9    1 
ATOM   221   C  C8    . G   A  1  20   ? 21.530  148.100 77.953  1.00 46.02  ? 20   G   0 C8    1 
ATOM   222   N  N7    . G   A  1  20   ? 22.042  146.966 78.348  1.00 46.30  ? 20   G   0 N7    1 
ATOM   223   C  C5    . G   A  1  20   ? 23.226  147.324 78.978  1.00 48.24  ? 20   G   0 C5    1 
ATOM   224   C  C6    . G   A  1  20   ? 24.226  146.519 79.591  1.00 48.46  ? 20   G   0 C6    1 
ATOM   225   O  O6    . G   A  1  20   ? 24.271  145.284 79.686  1.00 48.56  ? 20   G   0 O6    1 
ATOM   226   N  N1    . G   A  1  20   ? 25.256  147.296 80.117  1.00 47.76  ? 20   G   0 N1    1 
ATOM   227   C  C2    . G   A  1  20   ? 25.327  148.665 80.052  1.00 47.83  ? 20   G   0 C2    1 
ATOM   228   N  N2    . G   A  1  20   ? 26.394  149.229 80.615  1.00 47.88  ? 20   G   0 N2    1 
ATOM   229   N  N3    . G   A  1  20   ? 24.414  149.426 79.474  1.00 48.35  ? 20   G   0 N3    1 
ATOM   230   C  C4    . G   A  1  20   ? 23.397  148.693 78.959  1.00 48.38  ? 20   G   0 C4    1 
ATOM   231   P  P     . G   A  1  21   ? 23.256  150.614 73.256  1.00 48.68  ? 21   G   0 P     1 
ATOM   232   O  OP1   . G   A  1  21   ? 23.467  151.610 72.174  1.00 46.92  ? 21   G   0 OP1   1 
ATOM   233   O  OP2   . G   A  1  21   ? 22.682  149.293 72.934  1.00 49.18  ? 21   G   0 OP2   1 
ATOM   234   O  "O5'" . G   A  1  21   ? 24.660  150.345 73.969  1.00 48.90  ? 21   G   0 "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  21   ? 25.506  151.439 74.323  1.00 45.76  ? 21   G   0 "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  21   ? 26.610  151.014 75.273  1.00 44.63  ? 21   G   0 "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  21   ? 26.122  150.100 76.289  1.00 43.74  ? 21   G   0 "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  21   ? 27.803  150.236 74.745  1.00 41.43  ? 21   G   0 "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  21   ? 28.688  151.082 74.005  1.00 40.35  ? 21   G   0 "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  21   ? 28.462  149.836 76.065  1.00 41.51  ? 21   G   0 "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  21   ? 29.147  150.917 76.672  1.00 39.05  ? 21   G   0 "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  21   ? 27.244  149.536 76.946  1.00 42.53  ? 21   G   0 "C1'" 1 
ATOM   243   N  N9    . G   A  1  21   ? 27.029  148.109 77.161  1.00 44.45  ? 21   G   0 N9    1 
ATOM   244   C  C8    . G   A  1  21   ? 25.978  147.340 76.727  1.00 45.71  ? 21   G   0 C8    1 
ATOM   245   N  N7    . G   A  1  21   ? 26.088  146.083 77.064  1.00 45.65  ? 21   G   0 N7    1 
ATOM   246   C  C5    . G   A  1  21   ? 27.282  146.019 77.768  1.00 46.05  ? 21   G   0 C5    1 
ATOM   247   C  C6    . G   A  1  21   ? 27.932  144.914 78.378  1.00 46.77  ? 21   G   0 C6    1 
ATOM   248   O  O6    . G   A  1  21   ? 27.572  143.732 78.420  1.00 46.49  ? 21   G   0 O6    1 
ATOM   249   N  N1    . G   A  1  21   ? 29.121  145.296 78.982  1.00 47.44  ? 21   G   0 N1    1 
ATOM   250   C  C2    . G   A  1  21   ? 29.626  146.568 79.000  1.00 46.38  ? 21   G   0 C2    1 
ATOM   251   N  N2    . G   A  1  21   ? 30.790  146.724 79.636  1.00 47.59  ? 21   G   0 N2    1 
ATOM   252   N  N3    . G   A  1  21   ? 29.035  147.605 78.438  1.00 44.56  ? 21   G   0 N3    1 
ATOM   253   C  C4    . G   A  1  21   ? 27.872  147.261 77.844  1.00 45.62  ? 21   G   0 C4    1 
ATOM   254   P  P     . U   A  1  22   ? 29.678  150.448 72.908  1.00 38.10  ? 22   U   0 P     1 
ATOM   255   O  OP1   . U   A  1  22   ? 30.477  151.539 72.316  1.00 38.74  ? 22   U   0 OP1   1 
ATOM   256   O  OP2   . U   A  1  22   ? 28.905  149.547 72.027  1.00 40.68  ? 22   U   0 OP2   1 
ATOM   257   O  "O5'" . U   A  1  22   ? 30.658  149.520 73.747  1.00 42.08  ? 22   U   0 "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  22   ? 31.678  150.076 74.597  1.00 41.41  ? 22   U   0 "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  22   ? 32.436  148.965 75.273  1.00 41.05  ? 22   U   0 "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  22   ? 31.519  148.215 76.108  1.00 42.34  ? 22   U   0 "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  22   ? 33.033  147.917 74.341  1.00 40.45  ? 22   U   0 "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  22   ? 34.311  148.324 73.877  1.00 39.61  ? 22   U   0 "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  22   ? 33.158  146.710 75.256  1.00 41.68  ? 22   U   0 "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  22   ? 34.271  146.840 76.117  1.00 43.42  ? 22   U   0 "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  22   ? 31.892  146.845 76.105  1.00 43.78  ? 22   U   0 "C1'" 1 
ATOM   266   N  N1    . U   A  1  22   ? 30.740  146.027 75.683  1.00 45.05  ? 22   U   0 N1    1 
ATOM   267   C  C2    . U   A  1  22   ? 30.692  144.718 76.132  1.00 45.28  ? 22   U   0 C2    1 
ATOM   268   O  O2    . U   A  1  22   ? 31.584  144.207 76.772  1.00 46.17  ? 22   U   0 O2    1 
ATOM   269   N  N3    . U   A  1  22   ? 29.560  144.027 75.794  1.00 46.99  ? 22   U   0 N3    1 
ATOM   270   C  C4    . U   A  1  22   ? 28.495  144.486 75.055  1.00 46.77  ? 22   U   0 C4    1 
ATOM   271   O  O4    . U   A  1  22   ? 27.494  143.774 74.940  1.00 47.99  ? 22   U   0 O4    1 
ATOM   272   C  C5    . U   A  1  22   ? 28.634  145.832 74.578  1.00 44.13  ? 22   U   0 C5    1 
ATOM   273   C  C6    . U   A  1  22   ? 29.724  146.538 74.898  1.00 44.04  ? 22   U   0 C6    1 
ATOM   274   P  P     . G   A  1  23   ? 34.793  147.929 72.397  1.00 39.91  ? 23   G   0 P     1 
ATOM   275   O  OP1   . G   A  1  23   ? 36.177  148.441 72.238  1.00 38.77  ? 23   G   0 OP1   1 
ATOM   276   O  OP2   . G   A  1  23   ? 33.736  148.361 71.451  1.00 42.48  ? 23   G   0 OP2   1 
ATOM   277   O  "O5'" . G   A  1  23   ? 34.833  146.336 72.389  1.00 39.77  ? 23   G   0 "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  23   ? 35.782  145.591 73.181  1.00 37.14  ? 23   G   0 "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  23   ? 35.461  144.117 73.105  1.00 38.30  ? 23   G   0 "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  23   ? 34.176  143.865 73.739  1.00 40.17  ? 23   G   0 "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  23   ? 35.307  143.586 71.688  1.00 37.36  ? 23   G   0 "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  23   ? 36.575  143.201 71.177  1.00 36.47  ? 23   G   0 "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  23   ? 34.362  142.409 71.871  1.00 37.48  ? 23   G   0 "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  23   ? 35.044  141.287 72.374  1.00 39.41  ? 23   G   0 "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  23   ? 33.432  142.931 72.970  1.00 38.89  ? 23   G   0 "C1'" 1 
ATOM   286   N  N9    . G   A  1  23   ? 32.230  143.613 72.493  1.00 40.24  ? 23   G   0 N9    1 
ATOM   287   C  C8    . G   A  1  23   ? 32.151  144.899 72.018  1.00 38.16  ? 23   G   0 C8    1 
ATOM   288   N  N7    . G   A  1  23   ? 30.938  145.256 71.706  1.00 39.14  ? 23   G   0 N7    1 
ATOM   289   C  C5    . G   A  1  23   ? 30.167  144.135 71.978  1.00 39.23  ? 23   G   0 C5    1 
ATOM   290   C  C6    . G   A  1  23   ? 28.773  143.927 71.837  1.00 39.59  ? 23   G   0 C6    1 
ATOM   291   O  O6    . G   A  1  23   ? 27.916  144.720 71.441  1.00 41.54  ? 23   G   0 O6    1 
ATOM   292   N  N1    . G   A  1  23   ? 28.404  142.644 72.220  1.00 39.11  ? 23   G   0 N1    1 
ATOM   293   C  C2    . G   A  1  23   ? 29.261  141.687 72.688  1.00 39.99  ? 23   G   0 C2    1 
ATOM   294   N  N2    . G   A  1  23   ? 28.710  140.512 73.012  1.00 38.68  ? 23   G   0 N2    1 
ATOM   295   N  N3    . G   A  1  23   ? 30.567  141.868 72.829  1.00 41.98  ? 23   G   0 N3    1 
ATOM   296   C  C4    . G   A  1  23   ? 30.948  143.108 72.456  1.00 40.33  ? 23   G   0 C4    1 
ATOM   297   P  P     . G   A  1  24   ? 36.910  143.410 69.621  1.00 35.97  ? 24   G   0 P     1 
ATOM   298   O  OP1   . G   A  1  24   ? 38.370  143.260 69.424  1.00 36.65  ? 24   G   0 OP1   1 
ATOM   299   O  OP2   . G   A  1  24   ? 36.243  144.665 69.200  1.00 37.21  ? 24   G   0 OP2   1 
ATOM   300   O  "O5'" . G   A  1  24   ? 36.196  142.184 68.899  1.00 34.91  ? 24   G   0 "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  24   ? 36.346  140.834 69.388  1.00 33.23  ? 24   G   0 "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  24   ? 35.231  139.969 68.852  1.00 34.82  ? 24   G   0 "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  24   ? 33.962  140.596 69.203  1.00 36.42  ? 24   G   0 "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  24   ? 35.202  139.812 67.332  1.00 34.41  ? 24   G   0 "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  24   ? 34.562  138.578 67.019  1.00 36.31  ? 24   G   0 "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  24   ? 34.309  140.968 66.916  1.00 35.44  ? 24   G   0 "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  24   ? 33.727  140.816 65.647  1.00 38.04  ? 24   G   0 "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  24   ? 33.258  140.926 68.020  1.00 36.85  ? 24   G   0 "C1'" 1 
ATOM   309   N  N9    . G   A  1  24   ? 32.547  142.187 68.208  1.00 37.08  ? 24   G   0 N9    1 
ATOM   310   C  C8    . G   A  1  24   ? 33.047  143.458 68.045  1.00 37.19  ? 24   G   0 C8    1 
ATOM   311   N  N7    . G   A  1  24   ? 32.143  144.389 68.196  1.00 38.01  ? 24   G   0 N7    1 
ATOM   312   C  C5    . G   A  1  24   ? 30.977  143.692 68.492  1.00 37.73  ? 24   G   0 C5    1 
ATOM   313   C  C6    . G   A  1  24   ? 29.666  144.162 68.727  1.00 37.05  ? 24   G   0 C6    1 
ATOM   314   O  O6    . G   A  1  24   ? 29.248  145.326 68.704  1.00 38.59  ? 24   G   0 O6    1 
ATOM   315   N  N1    . G   A  1  24   ? 28.792  143.119 69.009  1.00 37.75  ? 24   G   0 N1    1 
ATOM   316   C  C2    . G   A  1  24   ? 29.134  141.793 69.053  1.00 38.73  ? 24   G   0 C2    1 
ATOM   317   N  N2    . G   A  1  24   ? 28.148  140.942 69.374  1.00 38.17  ? 24   G   0 N2    1 
ATOM   318   N  N3    . G   A  1  24   ? 30.351  141.336 68.808  1.00 37.42  ? 24   G   0 N3    1 
ATOM   319   C  C4    . G   A  1  24   ? 31.216  142.334 68.537  1.00 37.32  ? 24   G   0 C4    1 
ATOM   320   P  P     . A   A  1  25   ? 34.940  137.779 65.675  1.00 38.94  ? 25   A   0 P     1 
ATOM   321   O  OP1   . A   A  1  25   ? 36.413  137.572 65.625  1.00 38.20  ? 25   A   0 OP1   1 
ATOM   322   O  OP2   . A   A  1  25   ? 34.254  138.403 64.527  1.00 39.77  ? 25   A   0 OP2   1 
ATOM   323   O  "O5'" . A   A  1  25   ? 34.253  136.362 65.899  1.00 38.22  ? 25   A   0 "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  25   ? 34.717  135.474 66.926  1.00 37.11  ? 25   A   0 "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  25   ? 33.548  134.800 67.604  1.00 38.52  ? 25   A   0 "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  25   ? 32.784  135.760 68.385  1.00 39.09  ? 25   A   0 "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  25   ? 32.520  134.179 66.679  1.00 37.80  ? 25   A   0 "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  25   ? 32.956  132.912 66.204  1.00 38.73  ? 25   A   0 "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  25   ? 31.303  134.082 67.588  1.00 38.61  ? 25   A   0 "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  25   ? 31.380  133.001 68.489  1.00 39.33  ? 25   A   0 "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  25   ? 31.414  135.387 68.382  1.00 40.89  ? 25   A   0 "C1'" 1 
ATOM   332   N  N9    . A   A  1  25   ? 30.627  136.475 67.792  1.00 45.47  ? 25   A   0 N9    1 
ATOM   333   C  C8    . A   A  1  25   ? 31.082  137.621 67.182  1.00 46.51  ? 25   A   0 C8    1 
ATOM   334   N  N7    . A   A  1  25   ? 30.124  138.400 66.742  1.00 47.72  ? 25   A   0 N7    1 
ATOM   335   C  C5    . A   A  1  25   ? 28.959  137.727 67.085  1.00 47.09  ? 25   A   0 C5    1 
ATOM   336   C  C6    . A   A  1  25   ? 27.598  138.026 66.889  1.00 48.02  ? 25   A   0 C6    1 
ATOM   337   N  N6    . A   A  1  25   ? 27.157  139.142 66.296  1.00 47.59  ? 25   A   0 N6    1 
ATOM   338   N  N1    . A   A  1  25   ? 26.690  137.129 67.334  1.00 48.01  ? 25   A   0 N1    1 
ATOM   339   C  C2    . A   A  1  25   ? 27.125  136.026 67.942  1.00 45.13  ? 25   A   0 C2    1 
ATOM   340   N  N3    . A   A  1  25   ? 28.367  135.640 68.196  1.00 46.23  ? 25   A   0 N3    1 
ATOM   341   C  C4    . A   A  1  25   ? 29.251  136.542 67.733  1.00 46.30  ? 25   A   0 C4    1 
ATOM   342   P  P     . U   A  1  26   ? 32.463  132.380 64.766  1.00 36.89  ? 26   U   0 P     1 
ATOM   343   O  OP1   . U   A  1  26   ? 32.890  130.959 64.644  1.00 35.76  ? 26   U   0 OP1   1 
ATOM   344   O  OP2   . U   A  1  26   ? 32.879  133.360 63.733  1.00 35.73  ? 26   U   0 OP2   1 
ATOM   345   O  "O5'" . U   A  1  26   ? 30.882  132.419 64.881  1.00 33.71  ? 26   U   0 "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  26   ? 30.180  131.520 65.748  1.00 32.91  ? 26   U   0 "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  26   ? 28.704  131.801 65.675  1.00 34.93  ? 26   U   0 "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  26   ? 28.448  133.148 66.148  1.00 36.50  ? 26   U   0 "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  26   ? 28.146  131.796 64.266  1.00 35.07  ? 26   U   0 "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  26   ? 27.830  130.488 63.861  1.00 34.84  ? 26   U   0 "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  26   ? 26.920  132.680 64.391  1.00 36.67  ? 26   U   0 "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  26   ? 25.832  132.016 65.003  1.00 37.78  ? 26   U   0 "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  26   ? 27.435  133.747 65.354  1.00 37.00  ? 26   U   0 "C1'" 1 
ATOM   354   N  N1    . U   A  1  26   ? 27.985  134.955 64.715  1.00 37.93  ? 26   U   0 N1    1 
ATOM   355   C  C2    . U   A  1  26   ? 27.090  135.908 64.263  1.00 37.58  ? 26   U   0 C2    1 
ATOM   356   O  O2    . U   A  1  26   ? 25.890  135.738 64.254  1.00 37.17  ? 26   U   0 O2    1 
ATOM   357   N  N3    . U   A  1  26   ? 27.659  137.065 63.802  1.00 38.38  ? 26   U   0 N3    1 
ATOM   358   C  C4    . U   A  1  26   ? 29.001  137.355 63.713  1.00 38.64  ? 26   U   0 C4    1 
ATOM   359   O  O4    . U   A  1  26   ? 29.348  138.499 63.414  1.00 38.46  ? 26   U   0 O4    1 
ATOM   360   C  C5    . U   A  1  26   ? 29.867  136.295 64.128  1.00 37.84  ? 26   U   0 C5    1 
ATOM   361   C  C6    . U   A  1  26   ? 29.344  135.161 64.602  1.00 37.99  ? 26   U   0 C6    1 
ATOM   362   P  P     . U   A  1  27   ? 28.114  130.047 62.354  1.00 40.90  ? 27   U   0 P     1 
ATOM   363   O  OP1   . U   A  1  27   ? 27.994  128.569 62.310  1.00 39.34  ? 27   U   0 OP1   1 
ATOM   364   O  OP2   . U   A  1  27   ? 29.369  130.695 61.898  1.00 39.51  ? 27   U   0 OP2   1 
ATOM   365   O  "O5'" . U   A  1  27   ? 26.906  130.692 61.543  1.00 40.90  ? 27   U   0 "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  27   ? 25.546  130.285 61.794  1.00 38.60  ? 27   U   0 "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  27   ? 24.586  131.220 61.105  1.00 36.85  ? 27   U   0 "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  27   ? 24.591  132.515 61.757  1.00 36.96  ? 27   U   0 "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  27   ? 24.917  131.539 59.661  1.00 37.31  ? 27   U   0 "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  27   ? 24.509  130.493 58.795  1.00 39.37  ? 27   U   0 "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  27   ? 24.151  132.834 59.451  1.00 37.84  ? 27   U   0 "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  27   ? 22.764  132.621 59.318  1.00 40.34  ? 27   U   0 "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  27   ? 24.386  133.533 60.789  1.00 38.40  ? 27   U   0 "C1'" 1 
ATOM   374   N  N1    . U   A  1  27   ? 25.558  134.428 60.770  1.00 40.16  ? 27   U   0 N1    1 
ATOM   375   C  C2    . U   A  1  27   ? 25.351  135.761 60.418  1.00 41.22  ? 27   U   0 C2    1 
ATOM   376   O  O2    . U   A  1  27   ? 24.253  136.216 60.151  1.00 42.32  ? 27   U   0 O2    1 
ATOM   377   N  N3    . U   A  1  27   ? 26.483  136.539 60.392  1.00 40.33  ? 27   U   0 N3    1 
ATOM   378   C  C4    . U   A  1  27   ? 27.769  136.140 60.682  1.00 39.67  ? 27   U   0 C4    1 
ATOM   379   O  O4    . U   A  1  27   ? 28.682  136.961 60.620  1.00 37.91  ? 27   U   0 O4    1 
ATOM   380   C  C5    . U   A  1  27   ? 27.902  134.760 61.044  1.00 39.16  ? 27   U   0 C5    1 
ATOM   381   C  C6    . U   A  1  27   ? 26.824  133.972 61.075  1.00 38.54  ? 27   U   0 C6    1 
ATOM   382   P  P     . G   A  1  28   ? 25.297  130.246 57.419  1.00 41.15  ? 28   G   0 P     1 
ATOM   383   O  OP1   . G   A  1  28   ? 24.722  129.036 56.785  1.00 39.94  ? 28   G   0 OP1   1 
ATOM   384   O  OP2   . G   A  1  28   ? 26.755  130.307 57.659  1.00 43.63  ? 28   G   0 OP2   1 
ATOM   385   O  "O5'" . G   A  1  28   ? 24.920  131.527 56.562  1.00 42.43  ? 28   G   0 "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  28   ? 23.553  131.833 56.244  1.00 42.43  ? 28   G   0 "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  28   ? 23.459  133.209 55.623  1.00 42.99  ? 28   G   0 "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  28   ? 23.747  134.224 56.620  1.00 44.19  ? 28   G   0 "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  28   ? 24.457  133.520 54.521  1.00 42.45  ? 28   G   0 "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  28   ? 24.076  132.976 53.280  1.00 42.29  ? 28   G   0 "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  28   ? 24.424  135.036 54.499  1.00 43.43  ? 28   G   0 "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  28   ? 23.261  135.540 53.882  1.00 46.40  ? 28   G   0 "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  28   ? 24.352  135.343 55.992  1.00 45.08  ? 28   G   0 "C1'" 1 
ATOM   394   N  N9    . G   A  1  28   ? 25.686  135.536 56.551  1.00 45.40  ? 28   G   0 N9    1 
ATOM   395   C  C8    . G   A  1  28   ? 26.478  134.602 57.173  1.00 45.17  ? 28   G   0 C8    1 
ATOM   396   N  N7    . G   A  1  28   ? 27.640  135.076 57.530  1.00 46.53  ? 28   G   0 N7    1 
ATOM   397   C  C5    . G   A  1  28   ? 27.610  136.405 57.128  1.00 46.51  ? 28   G   0 C5    1 
ATOM   398   C  C6    . G   A  1  28   ? 28.591  137.424 57.242  1.00 45.72  ? 28   G   0 C6    1 
ATOM   399   O  O6    . G   A  1  28   ? 29.716  137.355 57.740  1.00 47.16  ? 28   G   0 O6    1 
ATOM   400   N  N1    . G   A  1  28   ? 28.148  138.624 56.703  1.00 45.40  ? 28   G   0 N1    1 
ATOM   401   C  C2    . G   A  1  28   ? 26.916  138.830 56.134  1.00 46.67  ? 28   G   0 C2    1 
ATOM   402   N  N2    . G   A  1  28   ? 26.668  140.073 55.685  1.00 45.49  ? 28   G   0 N2    1 
ATOM   403   N  N3    . G   A  1  28   ? 25.993  137.888 56.017  1.00 46.90  ? 28   G   0 N3    1 
ATOM   404   C  C4    . G   A  1  28   ? 26.407  136.707 56.531  1.00 46.64  ? 28   G   0 C4    1 
ATOM   405   P  P     . C   A  1  29   ? 25.198  132.627 52.197  1.00 41.64  ? 29   C   0 P     1 
ATOM   406   O  OP1   . C   A  1  29   ? 24.500  132.153 50.982  1.00 43.75  ? 29   C   0 OP1   1 
ATOM   407   O  OP2   . C   A  1  29   ? 26.212  131.766 52.844  1.00 43.74  ? 29   C   0 OP2   1 
ATOM   408   O  "O5'" . C   A  1  29   ? 25.859  134.034 51.878  1.00 39.95  ? 29   C   0 "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  29   ? 25.103  135.066 51.253  1.00 37.89  ? 29   C   0 "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  29   ? 25.968  136.273 51.021  1.00 38.93  ? 29   C   0 "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  29   ? 26.401  136.816 52.295  1.00 39.13  ? 29   C   0 "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  29   ? 27.266  136.027 50.271  1.00 40.46  ? 29   C   0 "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  29   ? 27.052  135.977 48.869  1.00 43.45  ? 29   C   0 "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  29   ? 28.083  137.247 50.666  1.00 40.47  ? 29   C   0 "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  29   ? 27.711  138.399 49.942  1.00 39.54  ? 29   C   0 "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  29   ? 27.668  137.429 52.129  1.00 39.95  ? 29   C   0 "C1'" 1 
ATOM   417   N  N1    . C   A  1  29   ? 28.637  136.840 53.073  1.00 40.02  ? 29   C   0 N1    1 
ATOM   418   C  C2    . C   A  1  29   ? 29.750  137.600 53.431  1.00 40.79  ? 29   C   0 C2    1 
ATOM   419   O  O2    . C   A  1  29   ? 29.857  138.749 52.982  1.00 41.87  ? 29   C   0 O2    1 
ATOM   420   N  N3    . C   A  1  29   ? 30.679  137.072 54.257  1.00 40.51  ? 29   C   0 N3    1 
ATOM   421   C  C4    . C   A  1  29   ? 30.526  135.838 54.727  1.00 40.71  ? 29   C   0 C4    1 
ATOM   422   N  N4    . C   A  1  29   ? 31.482  135.357 55.518  1.00 40.86  ? 29   C   0 N4    1 
ATOM   423   C  C5    . C   A  1  29   ? 29.389  135.042 54.402  1.00 40.41  ? 29   C   0 C5    1 
ATOM   424   C  C6    . C   A  1  29   ? 28.475  135.578 53.579  1.00 41.39  ? 29   C   0 C6    1 
ATOM   425   P  P     . U   A  1  30   ? 27.967  135.031 47.947  1.00 47.46  ? 30   U   0 P     1 
ATOM   426   O  OP1   . U   A  1  30   ? 27.385  135.064 46.577  1.00 49.05  ? 30   U   0 OP1   1 
ATOM   427   O  OP2   . U   A  1  30   ? 28.146  133.730 48.634  1.00 46.29  ? 30   U   0 OP2   1 
ATOM   428   O  "O5'" . U   A  1  30   ? 29.377  135.771 47.876  1.00 46.88  ? 30   U   0 "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  30   ? 29.469  137.144 47.472  1.00 46.19  ? 30   U   0 "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  30   ? 30.911  137.611 47.486  1.00 46.55  ? 30   U   0 "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  30   ? 31.434  137.551 48.844  1.00 46.59  ? 30   U   0 "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  30   ? 31.905  136.850 46.608  1.00 45.00  ? 30   U   0 "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  30   ? 32.866  137.750 46.066  1.00 47.18  ? 30   U   0 "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  30   ? 32.632  135.965 47.609  1.00 44.51  ? 30   U   0 "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  30   ? 33.947  135.674 47.179  1.00 44.97  ? 30   U   0 "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  30   ? 32.670  136.874 48.835  1.00 45.96  ? 30   U   0 "C1'" 1 
ATOM   437   N  N1    . U   A  1  30   ? 32.856  136.187 50.125  1.00 47.55  ? 30   U   0 N1    1 
ATOM   438   C  C2    . U   A  1  30   ? 33.846  136.662 50.961  1.00 47.51  ? 30   U   0 C2    1 
ATOM   439   O  O2    . U   A  1  30   ? 34.517  137.644 50.706  1.00 48.22  ? 30   U   0 O2    1 
ATOM   440   N  N3    . U   A  1  30   ? 34.022  135.947 52.117  1.00 48.05  ? 30   U   0 N3    1 
ATOM   441   C  C4    . U   A  1  30   ? 33.324  134.837 52.523  1.00 47.64  ? 30   U   0 C4    1 
ATOM   442   O  O4    . U   A  1  30   ? 33.701  134.222 53.524  1.00 45.92  ? 30   U   0 O4    1 
ATOM   443   C  C5    . U   A  1  30   ? 32.290  134.431 51.630  1.00 48.14  ? 30   U   0 C5    1 
ATOM   444   C  C6    . U   A  1  30   ? 32.095  135.101 50.491  1.00 48.20  ? 30   U   0 C6    1 
ATOM   445   P  P     . C   A  1  31   ? 32.594  138.451 44.651  1.00 47.37  ? 31   C   0 P     1 
ATOM   446   O  OP1   . C   A  1  31   ? 32.119  139.829 44.949  1.00 47.61  ? 31   C   0 OP1   1 
ATOM   447   O  OP2   . C   A  1  31   ? 31.762  137.548 43.822  1.00 49.06  ? 31   C   0 OP2   1 
ATOM   448   O  "O5'" . C   A  1  31   ? 34.007  138.527 43.929  1.00 49.79  ? 31   C   0 "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  31   ? 35.227  138.299 44.643  1.00 54.56  ? 31   C   0 "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  31   ? 36.318  139.185 44.089  1.00 56.95  ? 31   C   0 "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  31   ? 35.885  140.573 44.131  1.00 61.32  ? 31   C   0 "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  31   ? 37.634  139.143 44.847  1.00 55.29  ? 31   C   0 "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  31   ? 38.659  139.470 43.923  1.00 46.38  ? 31   C   0 "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  31   ? 37.453  140.275 45.851  1.00 59.82  ? 31   C   0 "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  31   ? 38.664  140.784 46.370  1.00 61.41  ? 31   C   0 "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  31   ? 36.745  141.311 44.981  1.00 64.54  ? 31   C   0 "C1'" 1 
ATOM   457   N  N1    . C   A  1  31   ? 35.943  142.306 45.723  1.00 71.14  ? 31   C   0 N1    1 
ATOM   458   C  C2    . C   A  1  31   ? 36.553  143.518 46.117  1.00 74.26  ? 31   C   0 C2    1 
ATOM   459   O  O2    . C   A  1  31   ? 37.753  143.718 45.838  1.00 75.64  ? 31   C   0 O2    1 
ATOM   460   N  N3    . C   A  1  31   ? 35.816  144.437 46.789  1.00 76.41  ? 31   C   0 N3    1 
ATOM   461   C  C4    . C   A  1  31   ? 34.532  144.189 47.073  1.00 76.95  ? 31   C   0 C4    1 
ATOM   462   N  N4    . C   A  1  31   ? 33.847  145.122 47.744  1.00 77.82  ? 31   C   0 N4    1 
ATOM   463   C  C5    . C   A  1  31   ? 33.893  142.971 46.686  1.00 75.81  ? 31   C   0 C5    1 
ATOM   464   C  C6    . C   A  1  31   ? 34.628  142.068 46.024  1.00 73.38  ? 31   C   0 C6    1 
ATOM   465   P  P     . G   A  1  32   ? 39.675  138.340 43.431  1.00 42.38  ? 32   G   0 P     1 
ATOM   466   O  OP1   . G   A  1  32   ? 40.679  138.986 42.553  1.00 42.98  ? 32   G   0 OP1   1 
ATOM   467   O  OP2   . G   A  1  32   ? 38.898  137.178 42.930  1.00 43.18  ? 32   G   0 OP2   1 
ATOM   468   O  "O5'" . G   A  1  32   ? 40.394  137.865 44.764  1.00 43.24  ? 32   G   0 "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  32   ? 41.193  138.758 45.550  1.00 38.25  ? 32   G   0 "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  32   ? 41.762  138.011 46.725  1.00 38.61  ? 32   G   0 "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  32   ? 40.664  137.548 47.560  1.00 39.26  ? 32   G   0 "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  32   ? 42.514  136.737 46.361  1.00 38.30  ? 32   G   0 "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  32   ? 43.863  137.005 45.995  1.00 36.04  ? 32   G   0 "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  32   ? 42.389  135.918 47.638  1.00 39.01  ? 32   G   0 "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  32   ? 43.282  136.361 48.633  1.00 39.84  ? 32   G   0 "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  32   ? 40.960  136.258 48.071  1.00 40.65  ? 32   G   0 "C1'" 1 
ATOM   477   N  N9    . G   A  1  32   ? 39.964  135.315 47.560  1.00 43.93  ? 32   G   0 N9    1 
ATOM   478   C  C8    . G   A  1  32   ? 39.211  135.435 46.416  1.00 43.73  ? 32   G   0 C8    1 
ATOM   479   N  N7    . G   A  1  32   ? 38.431  134.410 46.204  1.00 46.13  ? 32   G   0 N7    1 
ATOM   480   C  C5    . G   A  1  32   ? 38.674  133.564 47.277  1.00 46.65  ? 32   G   0 C5    1 
ATOM   481   C  C6    . G   A  1  32   ? 38.123  132.291 47.594  1.00 46.83  ? 32   G   0 C6    1 
ATOM   482   O  O6    . G   A  1  32   ? 37.281  131.640 46.975  1.00 45.79  ? 32   G   0 O6    1 
ATOM   483   N  N1    . G   A  1  32   ? 38.657  131.783 48.772  1.00 47.92  ? 32   G   0 N1    1 
ATOM   484   C  C2    . G   A  1  32   ? 39.592  132.410 49.552  1.00 47.08  ? 32   G   0 C2    1 
ATOM   485   N  N2    . G   A  1  32   ? 39.986  131.747 50.643  1.00 47.98  ? 32   G   0 N2    1 
ATOM   486   N  N3    . G   A  1  32   ? 40.107  133.597 49.279  1.00 47.49  ? 32   G   0 N3    1 
ATOM   487   C  C4    . G   A  1  32   ? 39.610  134.111 48.130  1.00 46.66  ? 32   G   0 C4    1 
ATOM   488   P  P     . G   A  1  33   ? 44.782  135.824 45.419  1.00 38.60  ? 33   G   0 P     1 
ATOM   489   O  OP1   . G   A  1  33   ? 46.104  136.370 45.049  1.00 36.47  ? 33   G   0 OP1   1 
ATOM   490   O  OP2   . G   A  1  33   ? 43.990  135.083 44.407  1.00 38.68  ? 33   G   0 OP2   1 
ATOM   491   O  "O5'" . G   A  1  33   ? 44.996  134.881 46.685  1.00 40.58  ? 33   G   0 "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  33   ? 45.323  133.486 46.520  1.00 39.65  ? 33   G   0 "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  33   ? 44.894  132.699 47.733  1.00 38.07  ? 33   G   0 "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  33   ? 43.465  132.849 47.962  1.00 37.35  ? 33   G   0 "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  33   ? 45.100  131.201 47.620  1.00 35.95  ? 33   G   0 "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  33   ? 46.447  130.865 47.925  1.00 35.19  ? 33   G   0 "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  33   ? 44.116  130.675 48.655  1.00 37.24  ? 33   G   0 "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  33   ? 44.585  130.840 49.973  1.00 38.02  ? 33   G   0 "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  33   ? 42.934  131.630 48.466  1.00 39.25  ? 33   G   0 "C1'" 1 
ATOM   500   N  N9    . G   A  1  33   ? 41.922  131.135 47.529  1.00 42.64  ? 33   G   0 N9    1 
ATOM   501   C  C8    . G   A  1  33   ? 41.473  131.765 46.392  1.00 44.12  ? 33   G   0 C8    1 
ATOM   502   N  N7    . G   A  1  33   ? 40.580  131.076 45.742  1.00 43.89  ? 33   G   0 N7    1 
ATOM   503   C  C5    . G   A  1  33   ? 40.424  129.921 46.491  1.00 44.26  ? 33   G   0 C5    1 
ATOM   504   C  C6    . G   A  1  33   ? 39.595  128.794 46.271  1.00 44.72  ? 33   G   0 C6    1 
ATOM   505   O  O6    . G   A  1  33   ? 38.806  128.586 45.344  1.00 45.34  ? 33   G   0 O6    1 
ATOM   506   N  N1    . G   A  1  33   ? 39.746  127.848 47.272  1.00 45.37  ? 33   G   0 N1    1 
ATOM   507   C  C2    . G   A  1  33   ? 40.579  127.967 48.348  1.00 44.72  ? 33   G   0 C2    1 
ATOM   508   N  N2    . G   A  1  33   ? 40.577  126.940 49.203  1.00 44.57  ? 33   G   0 N2    1 
ATOM   509   N  N3    . G   A  1  33   ? 41.357  129.013 48.567  1.00 44.30  ? 33   G   0 N3    1 
ATOM   510   C  C4    . G   A  1  33   ? 41.233  129.944 47.603  1.00 42.79  ? 33   G   0 C4    1 
ATOM   511   P  P     . C   A  1  34   ? 47.290  129.943 46.917  1.00 36.87  ? 34   C   0 P     1 
ATOM   512   O  OP1   . C   A  1  34   ? 48.697  129.885 47.362  1.00 37.64  ? 34   C   0 OP1   1 
ATOM   513   O  OP2   . C   A  1  34   ? 46.981  130.379 45.540  1.00 40.21  ? 34   C   0 OP2   1 
ATOM   514   O  "O5'" . C   A  1  34   ? 46.682  128.492 47.133  1.00 39.37  ? 34   C   0 "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  34   ? 46.716  127.862 48.426  1.00 39.44  ? 34   C   0 "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  34   ? 45.821  126.648 48.437  1.00 39.38  ? 34   C   0 "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  34   ? 44.427  127.050 48.347  1.00 39.62  ? 34   C   0 "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  34   ? 45.998  125.699 47.266  1.00 36.86  ? 34   C   0 "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  34   ? 47.110  124.841 47.447  1.00 35.66  ? 34   C   0 "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  34   ? 44.677  124.958 47.282  1.00 38.60  ? 34   C   0 "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  34   ? 44.610  124.048 48.360  1.00 40.47  ? 34   C   0 "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  34   ? 43.710  126.102 47.579  1.00 39.14  ? 34   C   0 "C1'" 1 
ATOM   523   N  N1    . C   A  1  34   ? 43.208  126.771 46.363  1.00 42.89  ? 34   C   0 N1    1 
ATOM   524   C  C2    . C   A  1  34   ? 42.133  126.195 45.656  1.00 42.86  ? 34   C   0 C2    1 
ATOM   525   O  O2    . C   A  1  34   ? 41.678  125.107 46.029  1.00 45.63  ? 34   C   0 O2    1 
ATOM   526   N  N3    . C   A  1  34   ? 41.629  126.838 44.581  1.00 42.81  ? 34   C   0 N3    1 
ATOM   527   C  C4    . C   A  1  34   ? 42.161  127.998 44.186  1.00 45.21  ? 34   C   0 C4    1 
ATOM   528   N  N4    . C   A  1  34   ? 41.616  128.610 43.131  1.00 44.33  ? 34   C   0 N4    1 
ATOM   529   C  C5    . C   A  1  34   ? 43.275  128.587 44.858  1.00 45.29  ? 34   C   0 C5    1 
ATOM   530   C  C6    . C   A  1  34   ? 43.762  127.946 45.931  1.00 43.60  ? 34   C   0 C6    1 
ATOM   531   P  P     . U   A  1  35   ? 47.990  124.411 46.182  1.00 33.55  ? 35   U   0 P     1 
ATOM   532   O  OP1   . U   A  1  35   ? 49.202  123.713 46.662  1.00 34.15  ? 35   U   0 OP1   1 
ATOM   533   O  OP2   . U   A  1  35   ? 48.130  125.593 45.315  1.00 37.21  ? 35   U   0 OP2   1 
ATOM   534   O  "O5'" . U   A  1  35   ? 47.073  123.363 45.413  1.00 37.62  ? 35   U   0 "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  35   ? 46.687  122.119 46.025  1.00 36.48  ? 35   U   0 "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  35   ? 45.617  121.438 45.206  1.00 35.89  ? 35   U   0 "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  35   ? 44.390  122.219 45.241  1.00 38.04  ? 35   U   0 "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  35   ? 45.897  121.279 43.721  1.00 35.07  ? 35   U   0 "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  35   ? 46.744  120.172 43.464  1.00 35.27  ? 35   U   0 "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  35   ? 44.495  121.074 43.170  1.00 36.37  ? 35   U   0 "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  35   ? 43.999  119.780 43.450  1.00 37.69  ? 35   U   0 "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  35   ? 43.705  122.079 44.006  1.00 37.40  ? 35   U   0 "C1'" 1 
ATOM   543   N  N1    . U   A  1  35   ? 43.632  123.395 43.353  1.00 40.45  ? 35   U   0 N1    1 
ATOM   544   C  C2    . U   A  1  35   ? 42.648  123.582 42.392  1.00 42.14  ? 35   U   0 C2    1 
ATOM   545   O  O2    . U   A  1  35   ? 41.847  122.719 42.085  1.00 42.64  ? 35   U   0 O2    1 
ATOM   546   N  N3    . U   A  1  35   ? 42.643  124.820 41.801  1.00 43.71  ? 35   U   0 N3    1 
ATOM   547   C  C4    . U   A  1  35   ? 43.503  125.869 42.059  1.00 45.08  ? 35   U   0 C4    1 
ATOM   548   O  O4    . U   A  1  35   ? 43.393  126.915 41.414  1.00 45.66  ? 35   U   0 O4    1 
ATOM   549   C  C5    . U   A  1  35   ? 44.485  125.602 43.069  1.00 43.19  ? 35   U   0 C5    1 
ATOM   550   C  C6    . U   A  1  35   ? 44.512  124.408 43.668  1.00 40.73  ? 35   U   0 C6    1 
ATOM   551   P  P     . C   A  1  36   ? 47.459  120.024 42.032  1.00 35.45  ? 36   C   0 P     1 
ATOM   552   O  OP1   . C   A  1  36   ? 48.409  118.881 42.124  1.00 32.82  ? 36   C   0 OP1   1 
ATOM   553   O  OP2   . C   A  1  36   ? 47.951  121.354 41.611  1.00 35.79  ? 36   C   0 OP2   1 
ATOM   554   O  "O5'" . C   A  1  36   ? 46.279  119.631 41.040  1.00 35.34  ? 36   C   0 "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  36   ? 45.613  118.371 41.147  1.00 33.27  ? 36   C   0 "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  36   ? 44.435  118.337 40.214  1.00 35.73  ? 36   C   0 "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  36   ? 43.543  119.438 40.534  1.00 35.10  ? 36   C   0 "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  36   ? 44.735  118.564 38.740  1.00 36.80  ? 36   C   0 "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  36   ? 45.211  117.406 38.081  1.00 38.36  ? 36   C   0 "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  36   ? 43.375  118.980 38.216  1.00 36.15  ? 36   C   0 "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  36   ? 42.480  117.890 38.149  1.00 36.47  ? 36   C   0 "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  36   ? 42.914  119.893 39.344  1.00 36.86  ? 36   C   0 "C1'" 1 
ATOM   563   N  N1    . C   A  1  36   ? 43.310  121.287 39.090  1.00 38.79  ? 36   C   0 N1    1 
ATOM   564   C  C2    . C   A  1  36   ? 42.482  122.071 38.286  1.00 39.25  ? 36   C   0 C2    1 
ATOM   565   O  O2    . C   A  1  36   ? 41.477  121.556 37.779  1.00 39.04  ? 36   C   0 O2    1 
ATOM   566   N  N3    . C   A  1  36   ? 42.798  123.369 38.077  1.00 40.34  ? 36   C   0 N3    1 
ATOM   567   C  C4    . C   A  1  36   ? 43.893  123.887 38.635  1.00 39.81  ? 36   C   0 C4    1 
ATOM   568   N  N4    . C   A  1  36   ? 44.136  125.188 38.438  1.00 39.62  ? 36   C   0 N4    1 
ATOM   569   C  C5    . C   A  1  36   ? 44.779  123.099 39.429  1.00 39.20  ? 36   C   0 C5    1 
ATOM   570   C  C6    . C   A  1  36   ? 44.453  121.816 39.628  1.00 39.65  ? 36   C   0 C6    1 
ATOM   571   P  P     . A   A  1  37   ? 46.252  117.566 36.870  1.00 42.97  ? 37   A   0 P     1 
ATOM   572   O  OP1   . A   A  1  37   ? 46.714  116.198 36.544  1.00 41.41  ? 37   A   0 OP1   1 
ATOM   573   O  OP2   . A   A  1  37   ? 47.247  118.616 37.208  1.00 42.01  ? 37   A   0 OP2   1 
ATOM   574   O  "O5'" . A   A  1  37   ? 45.362  118.128 35.673  1.00 44.41  ? 37   A   0 "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  37   ? 44.264  117.362 35.163  1.00 44.84  ? 37   A   0 "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  37   ? 43.477  118.164 34.161  1.00 46.59  ? 37   A   0 "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  37   ? 42.900  119.331 34.804  1.00 46.25  ? 37   A   0 "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  37   ? 44.241  118.747 32.984  1.00 47.20  ? 37   A   0 "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  37   ? 44.501  117.777 31.972  1.00 46.71  ? 37   A   0 "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  37   ? 43.281  119.832 32.517  1.00 47.71  ? 37   A   0 "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  37   ? 42.168  119.292 31.833  1.00 46.74  ? 37   A   0 "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  37   ? 42.786  120.381 33.857  1.00 48.17  ? 37   A   0 "C1'" 1 
ATOM   583   N  N9    . A   A  1  37   ? 43.569  121.522 34.330  1.00 49.76  ? 37   A   0 N9    1 
ATOM   584   C  C8    . A   A  1  37   ? 44.549  121.542 35.291  1.00 50.48  ? 37   A   0 C8    1 
ATOM   585   N  N7    . A   A  1  37   ? 45.049  122.733 35.510  1.00 50.38  ? 37   A   0 N7    1 
ATOM   586   C  C5    . A   A  1  37   ? 44.355  123.554 34.633  1.00 50.72  ? 37   A   0 C5    1 
ATOM   587   C  C6    . A   A  1  37   ? 44.410  124.942 34.383  1.00 51.45  ? 37   A   0 C6    1 
ATOM   588   N  N6    . A   A  1  37   ? 45.228  125.780 35.023  1.00 50.62  ? 37   A   0 N6    1 
ATOM   589   N  N1    . A   A  1  37   ? 43.584  125.444 33.438  1.00 51.23  ? 37   A   0 N1    1 
ATOM   590   C  C2    . A   A  1  37   ? 42.767  124.603 32.792  1.00 51.99  ? 37   A   0 C2    1 
ATOM   591   N  N3    . A   A  1  37   ? 42.619  123.285 32.941  1.00 52.03  ? 37   A   0 N3    1 
ATOM   592   C  C4    . A   A  1  37   ? 43.449  122.818 33.890  1.00 50.38  ? 37   A   0 C4    1 
ATOM   593   P  P     . G   A  1  38   ? 45.792  117.942 31.026  1.00 48.53  ? 38   G   0 P     1 
ATOM   594   O  OP1   . G   A  1  38   ? 46.033  116.640 30.357  1.00 46.22  ? 38   G   0 OP1   1 
ATOM   595   O  OP2   . G   A  1  38   ? 46.887  118.565 31.805  1.00 48.83  ? 38   G   0 OP2   1 
ATOM   596   O  "O5'" . G   A  1  38   ? 45.319  119.008 29.942  1.00 48.00  ? 38   G   0 "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  38   ? 44.283  118.682 29.008  1.00 48.20  ? 38   G   0 "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  38   ? 43.844  119.911 28.253  1.00 48.52  ? 38   G   0 "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  38   ? 43.281  120.876 29.179  1.00 47.98  ? 38   G   0 "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  38   ? 44.926  120.706 27.544  1.00 49.44  ? 38   G   0 "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  38   ? 45.329  120.132 26.313  1.00 49.57  ? 38   G   0 "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  38   ? 44.233  122.042 27.355  1.00 48.90  ? 38   G   0 "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  38   ? 43.252  121.991 26.341  1.00 49.16  ? 38   G   0 "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  38   ? 43.539  122.189 28.707  1.00 48.96  ? 38   G   0 "C1'" 1 
ATOM   605   N  N9    . G   A  1  38   ? 44.409  122.864 29.665  1.00 49.99  ? 38   G   0 N9    1 
ATOM   606   C  C8    . G   A  1  38   ? 45.134  122.297 30.686  1.00 50.56  ? 38   G   0 C8    1 
ATOM   607   N  N7    . G   A  1  38   ? 45.829  123.169 31.366  1.00 50.56  ? 38   G   0 N7    1 
ATOM   608   C  C5    . G   A  1  38   ? 45.544  124.383 30.760  1.00 49.36  ? 38   G   0 C5    1 
ATOM   609   C  C6    . G   A  1  38   ? 46.002  125.686 31.061  1.00 48.56  ? 38   G   0 C6    1 
ATOM   610   O  O6    . G   A  1  38   ? 46.772  126.041 31.959  1.00 48.11  ? 38   G   0 O6    1 
ATOM   611   N  N1    . G   A  1  38   ? 45.468  126.627 30.189  1.00 48.83  ? 38   G   0 N1    1 
ATOM   612   C  C2    . G   A  1  38   ? 44.603  126.347 29.156  1.00 49.78  ? 38   G   0 C2    1 
ATOM   613   N  N2    . G   A  1  38   ? 44.200  127.383 28.418  1.00 51.07  ? 38   G   0 N2    1 
ATOM   614   N  N3    . G   A  1  38   ? 44.166  125.136 28.868  1.00 49.69  ? 38   G   0 N3    1 
ATOM   615   C  C4    . G   A  1  38   ? 44.671  124.210 29.706  1.00 49.89  ? 38   G   0 C4    1 
ATOM   616   P  P     . G   A  1  39   ? 46.813  120.410 25.760  1.00 50.74  ? 39   G   0 P     1 
ATOM   617   O  OP1   . G   A  1  39   ? 46.907  119.706 24.451  1.00 50.61  ? 39   G   0 OP1   1 
ATOM   618   O  OP2   . G   A  1  39   ? 47.802  120.101 26.824  1.00 49.15  ? 39   G   0 OP2   1 
ATOM   619   O  "O5'" . G   A  1  39   ? 46.837  121.984 25.504  1.00 49.76  ? 39   G   0 "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  39   ? 46.052  122.566 24.451  1.00 51.43  ? 39   G   0 "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  39   ? 46.229  124.066 24.425  1.00 53.04  ? 39   G   0 "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  39   ? 45.878  124.597 25.730  1.00 53.89  ? 39   G   0 "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  39   ? 47.636  124.600 24.174  1.00 52.87  ? 39   G   0 "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  39   ? 47.956  124.646 22.778  1.00 52.71  ? 39   G   0 "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  39   ? 47.540  125.997 24.774  1.00 52.94  ? 39   G   0 "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  39   ? 46.859  126.902 23.926  1.00 51.46  ? 39   G   0 "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  39   ? 46.680  125.732 26.014  1.00 53.36  ? 39   G   0 "C1'" 1 
ATOM   628   N  N9    . G   A  1  39   ? 47.473  125.448 27.209  1.00 53.65  ? 39   G   0 N9    1 
ATOM   629   C  C8    . G   A  1  39   ? 47.710  124.218 27.780  1.00 54.14  ? 39   G   0 C8    1 
ATOM   630   N  N7    . G   A  1  39   ? 48.476  124.282 28.835  1.00 54.42  ? 39   G   0 N7    1 
ATOM   631   C  C5    . G   A  1  39   ? 48.759  125.635 28.973  1.00 54.40  ? 39   G   0 C5    1 
ATOM   632   C  C6    . G   A  1  39   ? 49.548  126.316 29.935  1.00 54.22  ? 39   G   0 C6    1 
ATOM   633   O  O6    . G   A  1  39   ? 50.186  125.847 30.881  1.00 54.33  ? 39   G   0 O6    1 
ATOM   634   N  N1    . G   A  1  39   ? 49.559  127.686 29.708  1.00 54.32  ? 39   G   0 N1    1 
ATOM   635   C  C2    . G   A  1  39   ? 48.909  128.321 28.684  1.00 53.57  ? 39   G   0 C2    1 
ATOM   636   N  N2    . G   A  1  39   ? 49.049  129.650 28.631  1.00 53.14  ? 39   G   0 N2    1 
ATOM   637   N  N3    . G   A  1  39   ? 48.176  127.701 27.778  1.00 53.66  ? 39   G   0 N3    1 
ATOM   638   C  C4    . G   A  1  39   ? 48.143  126.368 27.982  1.00 53.63  ? 39   G   0 C4    1 
ATOM   639   P  P     . C   A  1  40   ? 49.486  124.467 22.285  1.00 52.56  ? 40   C   0 P     1 
ATOM   640   O  OP1   . C   A  1  40   ? 49.456  124.580 20.812  1.00 54.60  ? 40   C   0 OP1   1 
ATOM   641   O  OP2   . C   A  1  40   ? 50.078  123.253 22.906  1.00 51.04  ? 40   C   0 OP2   1 
ATOM   642   O  "O5'" . C   A  1  40   ? 50.255  125.741 22.862  1.00 51.63  ? 40   C   0 "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  40   ? 49.909  127.085 22.463  1.00 52.49  ? 40   C   0 "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  40   ? 50.582  128.092 23.379  1.00 52.36  ? 40   C   0 "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  40   ? 50.157  127.828 24.743  1.00 53.83  ? 40   C   0 "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  40   ? 52.103  128.031 23.437  1.00 52.93  ? 40   C   0 "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  40   ? 52.716  128.802 22.401  1.00 50.99  ? 40   C   0 "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  40   ? 52.407  128.591 24.822  1.00 53.48  ? 40   C   0 "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  40   ? 52.373  130.004 24.861  1.00 52.29  ? 40   C   0 "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  40   ? 51.242  128.023 25.639  1.00 53.83  ? 40   C   0 "C1'" 1 
ATOM   651   N  N1    . C   A  1  40   ? 51.539  126.734 26.303  1.00 55.01  ? 40   C   0 N1    1 
ATOM   652   C  C2    . C   A  1  40   ? 52.137  126.739 27.579  1.00 55.42  ? 40   C   0 C2    1 
ATOM   653   O  O2    . C   A  1  40   ? 52.403  127.824 28.119  1.00 55.67  ? 40   C   0 O2    1 
ATOM   654   N  N3    . C   A  1  40   ? 52.407  125.556 28.186  1.00 55.17  ? 40   C   0 N3    1 
ATOM   655   C  C4    . C   A  1  40   ? 52.110  124.407 27.573  1.00 55.87  ? 40   C   0 C4    1 
ATOM   656   N  N4    . C   A  1  40   ? 52.395  123.265 28.203  1.00 56.08  ? 40   C   0 N4    1 
ATOM   657   C  C5    . C   A  1  40   ? 51.506  124.374 26.283  1.00 55.22  ? 40   C   0 C5    1 
ATOM   658   C  C6    . C   A  1  40   ? 51.241  125.547 25.691  1.00 55.43  ? 40   C   0 C6    1 
ATOM   659   P  P     . G   A  1  41   ? 54.272  128.575 22.041  1.00 52.18  ? 41   G   0 P     1 
ATOM   660   O  OP1   . G   A  1  41   ? 54.635  129.615 21.041  1.00 52.67  ? 41   G   0 OP1   1 
ATOM   661   O  OP2   . G   A  1  41   ? 54.500  127.139 21.721  1.00 48.99  ? 41   G   0 OP2   1 
ATOM   662   O  "O5'" . G   A  1  41   ? 55.047  128.909 23.396  1.00 51.07  ? 41   G   0 "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  41   ? 55.356  130.270 23.770  1.00 49.64  ? 41   G   0 "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  41   ? 56.333  130.284 24.923  1.00 49.36  ? 41   G   0 "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  41   ? 55.700  129.706 26.096  1.00 50.97  ? 41   G   0 "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  41   ? 57.596  129.458 24.720  1.00 48.97  ? 41   G   0 "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  41   ? 58.596  130.216 24.046  1.00 47.97  ? 41   G   0 "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  41   ? 58.007  129.147 26.152  1.00 49.65  ? 41   G   0 "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  41   ? 58.643  130.245 26.773  1.00 51.81  ? 41   G   0 "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  41   ? 56.644  128.934 26.819  1.00 50.24  ? 41   G   0 "C1'" 1 
ATOM   671   N  N9    . G   A  1  41   ? 56.201  127.542 26.791  1.00 51.57  ? 41   G   0 N9    1 
ATOM   672   C  C8    . G   A  1  41   ? 55.671  126.865 25.717  1.00 52.22  ? 41   G   0 C8    1 
ATOM   673   N  N7    . G   A  1  41   ? 55.375  125.625 25.987  1.00 52.51  ? 41   G   0 N7    1 
ATOM   674   C  C5    . G   A  1  41   ? 55.728  125.470 27.321  1.00 51.78  ? 41   G   0 C5    1 
ATOM   675   C  C6    . G   A  1  41   ? 55.639  124.336 28.166  1.00 51.40  ? 41   G   0 C6    1 
ATOM   676   O  O6    . G   A  1  41   ? 55.212  123.205 27.897  1.00 50.06  ? 41   G   0 O6    1 
ATOM   677   N  N1    . G   A  1  41   ? 56.107  124.617 29.446  1.00 50.85  ? 41   G   0 N1    1 
ATOM   678   C  C2    . G   A  1  41   ? 56.587  125.831 29.861  1.00 50.36  ? 41   G   0 C2    1 
ATOM   679   N  N2    . G   A  1  41   ? 56.968  125.906 31.137  1.00 50.88  ? 41   G   0 N2    1 
ATOM   680   N  N3    . G   A  1  41   ? 56.679  126.896 29.084  1.00 50.85  ? 41   G   0 N3    1 
ATOM   681   C  C4    . G   A  1  41   ? 56.236  126.646 27.834  1.00 51.62  ? 41   G   0 C4    1 
ATOM   682   P  P     . C   A  1  42   ? 59.334  129.619 22.746  1.00 47.44  ? 42   C   0 P     1 
ATOM   683   O  OP1   . C   A  1  42   ? 59.271  130.728 21.763  1.00 49.78  ? 42   C   0 OP1   1 
ATOM   684   O  OP2   . C   A  1  42   ? 58.793  128.282 22.375  1.00 49.17  ? 42   C   0 OP2   1 
ATOM   685   O  "O5'" . C   A  1  42   ? 60.851  129.434 23.207  1.00 47.10  ? 42   C   0 "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  42   ? 61.776  130.553 23.201  1.00 45.54  ? 42   C   0 "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  42   ? 61.544  131.443 24.406  1.00 44.30  ? 42   C   0 "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  42   ? 61.840  130.717 25.630  1.00 43.16  ? 42   C   0 "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  42   ? 62.426  132.675 24.504  1.00 45.02  ? 42   C   0 "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  42   ? 61.926  133.736 23.686  1.00 49.45  ? 42   C   0 "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  42   ? 62.333  133.008 25.986  1.00 42.26  ? 42   C   0 "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  42   ? 61.121  133.652 26.306  1.00 40.83  ? 42   C   0 "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  42   ? 62.336  131.612 26.610  1.00 40.64  ? 42   C   0 "C1'" 1 
ATOM   694   N  N1    . C   A  1  42   ? 63.683  131.177 27.026  1.00 38.78  ? 42   C   0 N1    1 
ATOM   695   C  C2    . C   A  1  42   ? 64.249  131.757 28.168  1.00 39.64  ? 42   C   0 C2    1 
ATOM   696   O  O2    . C   A  1  42   ? 63.568  132.562 28.832  1.00 38.65  ? 42   C   0 O2    1 
ATOM   697   N  N3    . C   A  1  42   ? 65.517  131.426 28.522  1.00 38.31  ? 42   C   0 N3    1 
ATOM   698   C  C4    . C   A  1  42   ? 66.203  130.544 27.791  1.00 39.20  ? 42   C   0 C4    1 
ATOM   699   N  N4    . C   A  1  42   ? 67.458  130.265 28.158  1.00 38.31  ? 42   C   0 N4    1 
ATOM   700   C  C5    . C   A  1  42   ? 65.637  129.912 26.647  1.00 38.08  ? 42   C   0 C5    1 
ATOM   701   C  C6    . C   A  1  42   ? 64.387  130.251 26.306  1.00 38.23  ? 42   C   0 C6    1 
ATOM   702   P  P     . U   A  1  43   ? 62.949  134.796 23.027  1.00 49.70  ? 43   U   0 P     1 
ATOM   703   O  OP1   . U   A  1  43   ? 62.160  135.628 22.078  1.00 47.06  ? 43   U   0 OP1   1 
ATOM   704   O  OP2   . U   A  1  43   ? 64.160  134.067 22.547  1.00 48.55  ? 43   U   0 OP2   1 
ATOM   705   O  "O5'" . U   A  1  43   ? 63.379  135.722 24.249  1.00 48.52  ? 43   U   0 "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  43   ? 62.440  136.624 24.842  1.00 45.44  ? 43   U   0 "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  43   ? 63.095  137.399 25.958  1.00 46.76  ? 43   U   0 "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  43   ? 63.453  136.504 27.047  1.00 48.35  ? 43   U   0 "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  43   ? 64.414  138.071 25.630  1.00 44.92  ? 43   U   0 "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  43   ? 64.243  139.280 24.917  1.00 43.40  ? 43   U   0 "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  43   ? 64.983  138.319 27.017  1.00 44.55  ? 43   U   0 "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  43   ? 64.366  139.419 27.654  1.00 44.24  ? 43   U   0 "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  43   ? 64.590  137.022 27.726  1.00 44.71  ? 43   U   0 "C1'" 1 
ATOM   714   N  N1    . U   A  1  43   ? 65.673  136.028 27.676  1.00 41.69  ? 43   U   0 N1    1 
ATOM   715   C  C2    . U   A  1  43   ? 66.709  136.169 28.588  1.00 41.53  ? 43   U   0 C2    1 
ATOM   716   O  O2    . U   A  1  43   ? 66.738  137.056 29.430  1.00 41.62  ? 43   U   0 O2    1 
ATOM   717   N  N3    . U   A  1  43   ? 67.711  135.235 28.476  1.00 38.17  ? 43   U   0 N3    1 
ATOM   718   C  C4    . U   A  1  43   ? 67.780  134.202 27.575  1.00 38.03  ? 43   U   0 C4    1 
ATOM   719   O  O4    . U   A  1  43   ? 68.778  133.488 27.558  1.00 37.83  ? 43   U   0 O4    1 
ATOM   720   C  C5    . U   A  1  43   ? 66.668  134.111 26.680  1.00 39.35  ? 43   U   0 C5    1 
ATOM   721   C  C6    . U   A  1  43   ? 65.676  135.006 26.758  1.00 39.51  ? 43   U   0 C6    1 
ATOM   722   P  P     . G   A  1  44   ? 65.413  139.797 23.948  1.00 44.35  ? 44   G   0 P     1 
ATOM   723   O  OP1   . G   A  1  44   ? 64.906  141.093 23.401  1.00 43.11  ? 44   G   0 OP1   1 
ATOM   724   O  OP2   . G   A  1  44   ? 65.829  138.707 23.028  1.00 39.51  ? 44   G   0 OP2   1 
ATOM   725   O  "O5'" . G   A  1  44   ? 66.652  140.058 24.915  1.00 43.55  ? 44   G   0 "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  44   ? 66.663  141.165 25.820  1.00 41.86  ? 44   G   0 "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  44   ? 68.016  141.290 26.467  1.00 42.77  ? 44   G   0 "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  44   ? 68.225  140.203 27.408  1.00 43.40  ? 44   G   0 "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  44   ? 69.221  141.191 25.548  1.00 42.53  ? 44   G   0 "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  44   ? 69.464  142.403 24.835  1.00 44.85  ? 44   G   0 "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  44   ? 70.324  140.887 26.550  1.00 41.85  ? 44   G   0 "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  44   ? 70.660  142.037 27.295  1.00 39.83  ? 44   G   0 "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  44   ? 69.614  139.904 27.483  1.00 41.77  ? 44   G   0 "C1'" 1 
ATOM   734   N  N9    . G   A  1  44   ? 69.811  138.519 27.067  1.00 39.82  ? 44   G   0 N9    1 
ATOM   735   C  C8    . G   A  1  44   ? 68.923  137.739 26.365  1.00 39.47  ? 44   G   0 C8    1 
ATOM   736   N  N7    . G   A  1  44   ? 69.393  136.556 26.084  1.00 38.75  ? 44   G   0 N7    1 
ATOM   737   C  C5    . G   A  1  44   ? 70.663  136.545 26.642  1.00 35.68  ? 44   G   0 C5    1 
ATOM   738   C  C6    . G   A  1  44   ? 71.652  135.537 26.630  1.00 35.80  ? 44   G   0 C6    1 
ATOM   739   O  O6    . G   A  1  44   ? 71.610  134.421 26.095  1.00 38.30  ? 44   G   0 O6    1 
ATOM   740   N  N1    . G   A  1  44   ? 72.794  135.931 27.316  1.00 36.32  ? 44   G   0 N1    1 
ATOM   741   C  C2    . G   A  1  44   ? 72.966  137.144 27.924  1.00 38.12  ? 44   G   0 C2    1 
ATOM   742   N  N2    . G   A  1  44   ? 74.144  137.318 28.545  1.00 36.83  ? 44   G   0 N2    1 
ATOM   743   N  N3    . G   A  1  44   ? 72.052  138.110 27.927  1.00 37.02  ? 44   G   0 N3    1 
ATOM   744   C  C4    . G   A  1  44   ? 70.932  137.741 27.270  1.00 37.19  ? 44   G   0 C4    1 
ATOM   745   P  P     . A   A  1  45   ? 70.155  142.357 23.374  1.00 45.23  ? 45   A   0 P     1 
ATOM   746   O  OP1   . A   A  1  45   ? 69.106  142.705 22.386  1.00 45.56  ? 45   A   0 OP1   1 
ATOM   747   O  OP2   . A   A  1  45   ? 70.932  141.104 23.196  1.00 44.52  ? 45   A   0 OP2   1 
ATOM   748   O  "O5'" . A   A  1  45   ? 71.222  143.539 23.434  1.00 46.14  ? 45   A   0 "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  45   ? 72.172  143.613 24.510  1.00 44.69  ? 45   A   0 "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  45   ? 73.286  144.567 24.163  1.00 45.34  ? 45   A   0 "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  45   ? 74.182  144.685 25.300  1.00 45.02  ? 45   A   0 "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  45   ? 74.162  144.146 22.992  1.00 45.93  ? 45   A   0 "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  45   ? 74.682  145.328 22.396  1.00 51.05  ? 45   A   0 "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  45   ? 75.281  143.377 23.683  1.00 44.75  ? 45   A   0 "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  45   ? 76.485  143.321 22.948  1.00 41.26  ? 45   A   0 "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  45   ? 75.466  144.207 24.950  1.00 44.91  ? 45   A   0 "C1'" 1 
ATOM   757   N  N9    . A   A  1  45   ? 76.002  143.465 26.092  1.00 47.07  ? 45   A   0 N9    1 
ATOM   758   C  C8    . A   A  1  45   ? 77.089  143.810 26.846  1.00 47.87  ? 45   A   0 C8    1 
ATOM   759   N  N7    . A   A  1  45   ? 77.329  142.990 27.834  1.00 50.04  ? 45   A   0 N7    1 
ATOM   760   C  C5    . A   A  1  45   ? 76.337  142.030 27.723  1.00 49.97  ? 45   A   0 C5    1 
ATOM   761   C  C6    . A   A  1  45   ? 76.035  140.889 28.487  1.00 50.20  ? 45   A   0 C6    1 
ATOM   762   N  N6    . A   A  1  45   ? 76.726  140.517 29.567  1.00 47.78  ? 45   A   0 N6    1 
ATOM   763   N  N1    . A   A  1  45   ? 74.981  140.139 28.103  1.00 50.32  ? 45   A   0 N1    1 
ATOM   764   C  C2    . A   A  1  45   ? 74.281  140.520 27.030  1.00 50.25  ? 45   A   0 C2    1 
ATOM   765   N  N3    . A   A  1  45   ? 74.460  141.573 26.238  1.00 50.38  ? 45   A   0 N3    1 
ATOM   766   C  C4    . A   A  1  45   ? 75.518  142.299 26.645  1.00 49.54  ? 45   A   0 C4    1 
ATOM   767   P  P     . U   A  1  46   ? 74.530  145.568 20.819  1.00 49.84  ? 46   U   0 P     1 
ATOM   768   O  OP1   . U   A  1  46   ? 74.583  144.247 20.152  1.00 50.45  ? 46   U   0 OP1   1 
ATOM   769   O  OP2   . U   A  1  46   ? 75.514  146.615 20.465  1.00 50.04  ? 46   U   0 OP2   1 
ATOM   770   O  "O5'" . U   A  1  46   ? 73.064  146.157 20.647  1.00 49.34  ? 46   U   0 "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  46   ? 72.739  147.460 21.133  1.00 52.38  ? 46   U   0 "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  46   ? 71.247  147.672 21.080  1.00 56.18  ? 46   U   0 "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  46   ? 70.808  147.588 19.696  1.00 59.79  ? 46   U   0 "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  46   ? 70.398  146.666 21.849  1.00 57.38  ? 46   U   0 "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  46   ? 69.243  147.322 22.339  1.00 55.31  ? 46   U   0 "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  46   ? 69.976  145.682 20.764  1.00 60.48  ? 46   U   0 "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  46   ? 68.765  145.007 21.056  1.00 61.47  ? 46   U   0 "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  46   ? 69.788  146.621 19.577  1.00 61.23  ? 46   U   0 "C1'" 1 
ATOM   779   N  N1    . U   A  1  46   ? 69.916  145.961 18.271  1.00 64.30  ? 46   U   0 N1    1 
ATOM   780   C  C2    . U   A  1  46   ? 68.794  145.918 17.458  1.00 65.77  ? 46   U   0 C2    1 
ATOM   781   O  O2    . U   A  1  46   ? 67.722  146.423 17.768  1.00 64.93  ? 46   U   0 O2    1 
ATOM   782   N  N3    . U   A  1  46   ? 68.973  145.262 16.265  1.00 68.17  ? 46   U   0 N3    1 
ATOM   783   C  C4    . U   A  1  46   ? 70.136  144.662 15.809  1.00 70.34  ? 46   U   0 C4    1 
ATOM   784   O  O4    . U   A  1  46   ? 70.135  144.085 14.715  1.00 73.50  ? 46   U   0 O4    1 
ATOM   785   C  C5    . U   A  1  46   ? 71.252  144.765 16.702  1.00 68.69  ? 46   U   0 C5    1 
ATOM   786   C  C6    . U   A  1  46   ? 71.109  145.395 17.869  1.00 66.20  ? 46   U   0 C6    1 
ATOM   787   P  P     . G   A  1  47   ? 69.304  148.072 23.747  1.00 54.04  ? 47   G   0 P     1 
ATOM   788   O  OP1   . G   A  1  47   ? 67.918  148.197 24.265  1.00 52.59  ? 47   G   0 OP1   1 
ATOM   789   O  OP2   . G   A  1  47   ? 70.129  149.288 23.542  1.00 55.50  ? 47   G   0 OP2   1 
ATOM   790   O  "O5'" . G   A  1  47   ? 70.160  147.090 24.667  1.00 53.49  ? 47   G   0 "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  47   ? 69.591  145.904 25.248  1.00 47.66  ? 47   G   0 "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  47   ? 69.947  145.835 26.712  1.00 45.86  ? 47   G   0 "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  47   ? 71.393  145.703 26.839  1.00 45.15  ? 47   G   0 "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  47   ? 69.560  147.070 27.514  1.00 44.80  ? 47   G   0 "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  47   ? 69.166  146.723 28.833  1.00 46.02  ? 47   G   0 "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  47   ? 70.844  147.894 27.518  1.00 43.99  ? 47   G   0 "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  47   ? 70.945  148.769 28.624  1.00 41.44  ? 47   G   0 "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  47   ? 71.924  146.809 27.548  1.00 44.48  ? 47   G   0 "C1'" 1 
ATOM   799   N  N9    . G   A  1  47   ? 73.146  147.231 26.864  1.00 44.90  ? 47   G   0 N9    1 
ATOM   800   C  C8    . G   A  1  47   ? 73.217  147.884 25.655  1.00 46.37  ? 47   G   0 C8    1 
ATOM   801   N  N7    . G   A  1  47   ? 74.439  148.154 25.288  1.00 46.66  ? 47   G   0 N7    1 
ATOM   802   C  C5    . G   A  1  47   ? 75.227  147.648 26.309  1.00 45.10  ? 47   G   0 C5    1 
ATOM   803   C  C6    . G   A  1  47   ? 76.633  147.650 26.458  1.00 45.69  ? 47   G   0 C6    1 
ATOM   804   O  O6    . G   A  1  47   ? 77.484  148.118 25.699  1.00 45.54  ? 47   G   0 O6    1 
ATOM   805   N  N1    . G   A  1  47   ? 77.024  147.027 27.640  1.00 46.96  ? 47   G   0 N1    1 
ATOM   806   C  C2    . G   A  1  47   ? 76.165  146.479 28.563  1.00 46.53  ? 47   G   0 C2    1 
ATOM   807   N  N2    . G   A  1  47   ? 76.734  145.934 29.648  1.00 45.11  ? 47   G   0 N2    1 
ATOM   808   N  N3    . G   A  1  47   ? 74.846  146.470 28.432  1.00 46.30  ? 47   G   0 N3    1 
ATOM   809   C  C4    . G   A  1  47   ? 74.448  147.068 27.290  1.00 45.12  ? 47   G   0 C4    1 
ATOM   810   P  P     . A   A  1  48   ? 67.778  147.291 29.420  1.00 47.16  ? 48   A   0 P     1 
ATOM   811   O  OP1   . A   A  1  48   ? 67.147  148.140 28.379  1.00 46.86  ? 48   A   0 OP1   1 
ATOM   812   O  OP2   . A   A  1  48   ? 68.037  147.867 30.760  1.00 47.40  ? 48   A   0 OP2   1 
ATOM   813   O  "O5'" . A   A  1  48   ? 66.890  145.980 29.595  1.00 46.41  ? 48   A   0 "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  48   ? 66.426  145.237 28.450  1.00 45.68  ? 48   A   0 "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  48   ? 66.279  143.774 28.800  1.00 46.49  ? 48   A   0 "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  48   ? 67.584  143.156 28.919  1.00 47.88  ? 48   A   0 "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  48   ? 65.595  143.506 30.129  1.00 46.31  ? 48   A   0 "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  48   ? 64.188  143.510 29.964  1.00 43.23  ? 48   A   0 "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  48   ? 66.139  142.138 30.521  1.00 47.35  ? 48   A   0 "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  48   ? 65.485  141.075 29.861  1.00 49.78  ? 48   A   0 "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  48   ? 67.568  142.215 29.982  1.00 47.60  ? 48   A   0 "C1'" 1 
ATOM   822   N  N9    . A   A  1  48   ? 68.594  142.603 30.950  1.00 47.29  ? 48   A   0 N9    1 
ATOM   823   C  C8    . A   A  1  48   ? 69.248  143.805 31.034  1.00 46.13  ? 48   A   0 C8    1 
ATOM   824   N  N7    . A   A  1  48   ? 70.197  143.827 31.932  1.00 47.59  ? 48   A   0 N7    1 
ATOM   825   C  C5    . A   A  1  48   ? 70.153  142.560 32.496  1.00 46.90  ? 48   A   0 C5    1 
ATOM   826   C  C6    . A   A  1  48   ? 70.930  141.938 33.488  1.00 46.55  ? 48   A   0 C6    1 
ATOM   827   N  N6    . A   A  1  48   ? 71.966  142.527 34.100  1.00 43.83  ? 48   A   0 N6    1 
ATOM   828   N  N1    . A   A  1  48   ? 70.614  140.669 33.827  1.00 45.06  ? 48   A   0 N1    1 
ATOM   829   C  C2    . A   A  1  48   ? 69.602  140.074 33.199  1.00 46.87  ? 48   A   0 C2    1 
ATOM   830   N  N3    . A   A  1  48   ? 68.809  140.546 32.241  1.00 48.50  ? 48   A   0 N3    1 
ATOM   831   C  C4    . A   A  1  48   ? 69.145  141.809 31.926  1.00 47.74  ? 48   A   0 C4    1 
ATOM   832   P  P     . A   A  1  49   ? 63.269  144.266 31.033  1.00 46.66  ? 49   A   0 P     1 
ATOM   833   O  OP1   . A   A  1  49   ? 61.876  144.274 30.489  1.00 44.98  ? 49   A   0 OP1   1 
ATOM   834   O  OP2   . A   A  1  49   ? 63.926  145.553 31.394  1.00 45.58  ? 49   A   0 OP2   1 
ATOM   835   O  "O5'" . A   A  1  49   ? 63.333  143.320 32.313  1.00 45.73  ? 49   A   0 "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  49   ? 62.763  142.005 32.283  1.00 43.28  ? 49   A   0 "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  49   ? 63.257  141.195 33.452  1.00 42.90  ? 49   A   0 "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  49   ? 64.676  140.946 33.302  1.00 43.92  ? 49   A   0 "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  49   ? 63.143  141.853 34.817  1.00 42.73  ? 49   A   0 "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  49   ? 61.842  141.730 35.369  1.00 40.82  ? 49   A   0 "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  49   ? 64.168  141.073 35.622  1.00 43.55  ? 49   A   0 "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  49   ? 63.678  139.822 36.044  1.00 45.34  ? 49   A   0 "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  49   ? 65.281  140.883 34.586  1.00 45.55  ? 49   A   0 "C1'" 1 
ATOM   844   N  N9    . A   A  1  49   ? 66.264  141.961 34.697  1.00 48.04  ? 49   A   0 N9    1 
ATOM   845   C  C8    . A   A  1  49   ? 66.256  143.196 34.093  1.00 48.50  ? 49   A   0 C8    1 
ATOM   846   N  N7    . A   A  1  49   ? 67.227  143.984 34.490  1.00 49.75  ? 49   A   0 N7    1 
ATOM   847   C  C5    . A   A  1  49   ? 67.934  143.211 35.399  1.00 50.17  ? 49   A   0 C5    1 
ATOM   848   C  C6    . A   A  1  49   ? 69.061  143.479 36.199  1.00 50.33  ? 49   A   0 C6    1 
ATOM   849   N  N6    . A   A  1  49   ? 69.682  144.656 36.241  1.00 48.57  ? 49   A   0 N6    1 
ATOM   850   N  N1    . A   A  1  49   ? 69.525  142.480 36.981  1.00 52.52  ? 49   A   0 N1    1 
ATOM   851   C  C2    . A   A  1  49   ? 68.878  141.305 36.974  1.00 52.09  ? 49   A   0 C2    1 
ATOM   852   N  N3    . A   A  1  49   ? 67.798  140.941 36.287  1.00 50.96  ? 49   A   0 N3    1 
ATOM   853   C  C4    . A   A  1  49   ? 67.371  141.951 35.510  1.00 49.81  ? 49   A   0 C4    1 
ATOM   854   P  P     . G   A  1  50   ? 61.217  142.942 36.212  1.00 40.55  ? 50   G   0 P     1 
ATOM   855   O  OP1   . G   A  1  50   ? 59.972  142.460 36.846  1.00 42.71  ? 50   G   0 OP1   1 
ATOM   856   O  OP2   . G   A  1  50   ? 61.180  144.151 35.364  1.00 44.85  ? 50   G   0 OP2   1 
ATOM   857   O  "O5'" . G   A  1  50   ? 62.284  143.206 37.359  1.00 43.53  ? 50   G   0 "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  50   ? 62.471  142.271 38.428  1.00 42.69  ? 50   G   0 "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  50   ? 63.624  142.709 39.298  1.00 43.64  ? 50   G   0 "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  50   ? 64.843  142.757 38.503  1.00 44.03  ? 50   G   0 "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  50   ? 63.539  144.107 39.881  1.00 42.17  ? 50   G   0 "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  50   ? 62.710  144.183 41.028  1.00 43.58  ? 50   G   0 "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  50   ? 64.992  144.359 40.223  1.00 43.31  ? 50   G   0 "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  50   ? 65.382  143.607 41.355  1.00 42.72  ? 50   G   0 "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  50   ? 65.677  143.800 38.974  1.00 43.26  ? 50   G   0 "C1'" 1 
ATOM   866   N  N9    . G   A  1  50   ? 65.772  144.821 37.931  1.00 44.96  ? 50   G   0 N9    1 
ATOM   867   C  C8    . G   A  1  50   ? 64.981  144.944 36.815  1.00 44.87  ? 50   G   0 C8    1 
ATOM   868   N  N7    . G   A  1  50   ? 65.261  146.000 36.104  1.00 46.15  ? 50   G   0 N7    1 
ATOM   869   C  C5    . G   A  1  50   ? 66.310  146.608 36.783  1.00 46.37  ? 50   G   0 C5    1 
ATOM   870   C  C6    . G   A  1  50   ? 67.025  147.809 36.501  1.00 46.89  ? 50   G   0 C6    1 
ATOM   871   O  O6    . G   A  1  50   ? 66.866  148.606 35.567  1.00 48.78  ? 50   G   0 O6    1 
ATOM   872   N  N1    . G   A  1  50   ? 68.009  148.049 37.448  1.00 46.16  ? 50   G   0 N1    1 
ATOM   873   C  C2    . G   A  1  50   ? 68.276  147.250 38.525  1.00 46.18  ? 50   G   0 C2    1 
ATOM   874   N  N2    . G   A  1  50   ? 69.274  147.648 39.320  1.00 46.70  ? 50   G   0 N2    1 
ATOM   875   N  N3    . G   A  1  50   ? 67.617  146.142 38.804  1.00 46.41  ? 50   G   0 N3    1 
ATOM   876   C  C4    . G   A  1  50   ? 66.653  145.883 37.899  1.00 45.31  ? 50   G   0 C4    1 
ATOM   877   P  P     . G   A  1  51   ? 61.922  145.546 41.345  1.00 46.00  ? 51   G   0 P     1 
ATOM   878   O  OP1   . G   A  1  51   ? 61.057  145.297 42.530  1.00 45.46  ? 51   G   0 OP1   1 
ATOM   879   O  OP2   . G   A  1  51   ? 61.311  146.027 40.081  1.00 44.85  ? 51   G   0 OP2   1 
ATOM   880   O  "O5'" . G   A  1  51   ? 63.069  146.577 41.764  1.00 45.36  ? 51   G   0 "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  51   ? 63.808  146.401 42.992  1.00 44.73  ? 51   G   0 "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  51   ? 64.988  147.345 43.051  1.00 43.25  ? 51   G   0 "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  51   ? 65.781  147.180 41.845  1.00 43.54  ? 51   G   0 "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  51   ? 64.695  148.837 43.083  1.00 41.75  ? 51   G   0 "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  51   ? 64.364  149.299 44.388  1.00 39.83  ? 51   G   0 "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  51   ? 66.018  149.412 42.603  1.00 42.36  ? 51   G   0 "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  51   ? 67.017  149.408 43.594  1.00 43.53  ? 51   G   0 "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  51   ? 66.397  148.412 41.511  1.00 43.76  ? 51   G   0 "C1'" 1 
ATOM   889   N  N9    . G   A  1  51   ? 65.873  148.875 40.231  1.00 45.51  ? 51   G   0 N9    1 
ATOM   890   C  C8    . G   A  1  51   ? 64.839  148.352 39.492  1.00 45.34  ? 51   G   0 C8    1 
ATOM   891   N  N7    . G   A  1  51   ? 64.554  149.066 38.438  1.00 44.74  ? 51   G   0 N7    1 
ATOM   892   C  C5    . G   A  1  51   ? 65.468  150.110 38.475  1.00 45.88  ? 51   G   0 C5    1 
ATOM   893   C  C6    . G   A  1  51   ? 65.631  151.222 37.616  1.00 46.60  ? 51   G   0 C6    1 
ATOM   894   O  O6    . G   A  1  51   ? 64.973  151.527 36.616  1.00 47.67  ? 51   G   0 O6    1 
ATOM   895   N  N1    . G   A  1  51   ? 66.681  152.035 38.029  1.00 47.45  ? 51   G   0 N1    1 
ATOM   896   C  C2    . G   A  1  51   ? 67.464  151.813 39.134  1.00 46.00  ? 51   G   0 C2    1 
ATOM   897   N  N2    . G   A  1  51   ? 68.418  152.710 39.383  1.00 45.19  ? 51   G   0 N2    1 
ATOM   898   N  N3    . G   A  1  51   ? 67.317  150.788 39.941  1.00 46.76  ? 51   G   0 N3    1 
ATOM   899   C  C4    . G   A  1  51   ? 66.305  149.985 39.558  1.00 45.88  ? 51   G   0 C4    1 
ATOM   900   P  P     . A   A  1  52   ? 63.545  150.680 44.575  1.00 43.03  ? 52   A   0 P     1 
ATOM   901   O  OP1   . A   A  1  52   ? 63.256  150.818 46.029  1.00 43.63  ? 52   A   0 OP1   1 
ATOM   902   O  OP2   . A   A  1  52   ? 62.422  150.765 43.596  1.00 41.81  ? 52   A   0 OP2   1 
ATOM   903   O  "O5'" . A   A  1  52   ? 64.588  151.815 44.182  1.00 42.40  ? 52   A   0 "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  52   ? 65.818  151.976 44.901  1.00 43.37  ? 52   A   0 "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  52   ? 66.616  153.106 44.304  1.00 44.78  ? 52   A   0 "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  52   ? 66.977  152.780 42.934  1.00 45.42  ? 52   A   0 "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  52   ? 65.871  154.421 44.190  1.00 44.30  ? 52   A   0 "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  52   ? 65.904  155.130 45.422  1.00 44.37  ? 52   A   0 "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  52   ? 66.638  155.122 43.080  1.00 45.35  ? 52   A   0 "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  52   ? 67.854  155.669 43.541  1.00 46.25  ? 52   A   0 "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  52   ? 66.935  153.950 42.138  1.00 45.83  ? 52   A   0 "C1'" 1 
ATOM   912   N  N9    . A   A  1  52   ? 65.908  153.755 41.113  1.00 48.19  ? 52   A   0 N9    1 
ATOM   913   C  C8    . A   A  1  52   ? 64.943  152.782 41.078  1.00 48.96  ? 52   A   0 C8    1 
ATOM   914   N  N7    . A   A  1  52   ? 64.160  152.851 40.033  1.00 48.64  ? 52   A   0 N7    1 
ATOM   915   C  C5    . A   A  1  52   ? 64.639  153.943 39.331  1.00 49.09  ? 52   A   0 C5    1 
ATOM   916   C  C6    . A   A  1  52   ? 64.235  154.537 38.131  1.00 50.95  ? 52   A   0 C6    1 
ATOM   917   N  N6    . A   A  1  52   ? 63.206  154.101 37.395  1.00 51.76  ? 52   A   0 N6    1 
ATOM   918   N  N1    . A   A  1  52   ? 64.926  155.612 37.704  1.00 51.21  ? 52   A   0 N1    1 
ATOM   919   C  C2    . A   A  1  52   ? 65.944  156.054 38.444  1.00 50.91  ? 52   A   0 C2    1 
ATOM   920   N  N3    . A   A  1  52   ? 66.416  155.585 39.589  1.00 50.95  ? 52   A   0 N3    1 
ATOM   921   C  C4    . A   A  1  52   ? 65.713  154.513 39.984  1.00 49.40  ? 52   A   0 C4    1 
ATOM   922   P  P     . C   A  1  53   ? 64.634  156.003 45.874  1.00 45.54  ? 53   C   0 P     1 
ATOM   923   O  OP1   . C   A  1  53   ? 64.967  156.583 47.196  1.00 42.76  ? 53   C   0 OP1   1 
ATOM   924   O  OP2   . C   A  1  53   ? 63.393  155.200 45.719  1.00 45.66  ? 53   C   0 OP2   1 
ATOM   925   O  "O5'" . C   A  1  53   ? 64.592  157.175 44.796  1.00 46.93  ? 53   C   0 "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  53   ? 65.654  158.137 44.726  1.00 46.18  ? 53   C   0 "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  53   ? 65.540  158.972 43.477  1.00 46.60  ? 53   C   0 "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  53   ? 65.733  158.138 42.301  1.00 47.93  ? 53   C   0 "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  53   ? 64.209  159.647 43.205  1.00 47.37  ? 53   C   0 "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  53   ? 63.992  160.813 43.993  1.00 47.31  ? 53   C   0 "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  53   ? 64.344  159.962 41.724  1.00 47.74  ? 53   C   0 "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  53   ? 65.222  161.040 41.488  1.00 50.10  ? 53   C   0 "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  53   ? 64.998  158.679 41.211  1.00 47.89  ? 53   C   0 "C1'" 1 
ATOM   934   N  N1    . C   A  1  53   ? 63.968  157.709 40.787  1.00 49.49  ? 53   C   0 N1    1 
ATOM   935   C  C2    . C   A  1  53   ? 63.416  157.824 39.495  1.00 49.22  ? 53   C   0 C2    1 
ATOM   936   O  O2    . C   A  1  53   ? 63.865  158.681 38.716  1.00 50.35  ? 53   C   0 O2    1 
ATOM   937   N  N3    . C   A  1  53   ? 62.413  156.995 39.131  1.00 48.49  ? 53   C   0 N3    1 
ATOM   938   C  C4    . C   A  1  53   ? 61.971  156.063 39.981  1.00 49.04  ? 53   C   0 C4    1 
ATOM   939   N  N4    . C   A  1  53   ? 60.969  155.279 39.582  1.00 47.55  ? 53   C   0 N4    1 
ATOM   940   C  C5    . C   A  1  53   ? 62.538  155.896 41.280  1.00 49.31  ? 53   C   0 C5    1 
ATOM   941   C  C6    . C   A  1  53   ? 63.525  156.731 41.639  1.00 49.63  ? 53   C   0 C6    1 
ATOM   942   P  P     . G   A  1  54   ? 62.575  161.575 43.914  1.00 47.32  ? 54   G   0 P     1 
ATOM   943   O  OP1   . G   A  1  54   ? 62.560  162.606 44.972  1.00 48.95  ? 54   G   0 OP1   1 
ATOM   944   O  OP2   . G   A  1  54   ? 61.482  160.572 43.864  1.00 49.13  ? 54   G   0 OP2   1 
ATOM   945   O  "O5'" . G   A  1  54   ? 62.661  162.315 42.508  1.00 46.89  ? 54   G   0 "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  54   ? 61.483  162.745 41.812  1.00 45.56  ? 54   G   0 "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  54   ? 61.760  162.810 40.332  1.00 46.03  ? 54   G   0 "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  54   ? 62.276  161.536 39.871  1.00 46.92  ? 54   G   0 "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  54   ? 60.562  163.121 39.449  1.00 47.64  ? 54   G   0 "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  54   ? 60.453  164.522 39.250  1.00 48.94  ? 54   G   0 "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  54   ? 60.907  162.395 38.157  1.00 48.86  ? 54   G   0 "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  54   ? 61.857  163.106 37.391  1.00 48.92  ? 54   G   0 "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  54   ? 61.581  161.137 38.703  1.00 49.15  ? 54   G   0 "C1'" 1 
ATOM   954   N  N9    . G   A  1  54   ? 60.666  160.059 39.075  1.00 50.30  ? 54   G   0 N9    1 
ATOM   955   C  C8    . G   A  1  54   ? 60.549  159.486 40.319  1.00 49.86  ? 54   G   0 C8    1 
ATOM   956   N  N7    . G   A  1  54   ? 59.707  158.493 40.348  1.00 50.93  ? 54   G   0 N7    1 
ATOM   957   C  C5    . G   A  1  54   ? 59.227  158.408 39.050  1.00 49.79  ? 54   G   0 C5    1 
ATOM   958   C  C6    . G   A  1  54   ? 58.308  157.498 38.474  1.00 49.59  ? 54   G   0 C6    1 
ATOM   959   O  O6    . G   A  1  54   ? 57.749  156.530 39.000  1.00 49.36  ? 54   G   0 O6    1 
ATOM   960   N  N1    . G   A  1  54   ? 58.079  157.786 37.136  1.00 48.84  ? 54   G   0 N1    1 
ATOM   961   C  C2    . G   A  1  54   ? 58.678  158.796 36.434  1.00 47.94  ? 54   G   0 C2    1 
ATOM   962   N  N2    . G   A  1  54   ? 58.316  158.903 35.154  1.00 47.55  ? 54   G   0 N2    1 
ATOM   963   N  N3    . G   A  1  54   ? 59.563  159.634 36.950  1.00 48.15  ? 54   G   0 N3    1 
ATOM   964   C  C4    . G   A  1  54   ? 59.786  159.386 38.255  1.00 49.02  ? 54   G   0 C4    1 
ATOM   965   P  P     . U   A  1  55   ? 59.100  165.280 39.646  1.00 51.50  ? 55   U   0 P     1 
ATOM   966   O  OP1   . U   A  1  55   ? 59.352  166.739 39.546  1.00 51.97  ? 55   U   0 OP1   1 
ATOM   967   O  OP2   . U   A  1  55   ? 58.586  164.710 40.919  1.00 52.39  ? 55   U   0 OP2   1 
ATOM   968   O  "O5'" . U   A  1  55   ? 58.087  164.869 38.493  1.00 51.77  ? 55   U   0 "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  55   ? 58.426  165.038 37.114  1.00 52.04  ? 55   U   0 "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  55   ? 57.496  164.214 36.264  1.00 54.12  ? 55   U   0 "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  55   ? 57.799  162.803 36.423  1.00 54.50  ? 55   U   0 "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  55   ? 56.029  164.337 36.645  1.00 53.28  ? 55   U   0 "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  55   ? 55.454  165.484 36.036  1.00 54.37  ? 55   U   0 "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  55   ? 55.446  163.038 36.108  1.00 54.75  ? 55   U   0 "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  55   ? 55.223  163.085 34.717  1.00 56.74  ? 55   U   0 "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  55   ? 56.592  162.056 36.373  1.00 55.56  ? 55   U   0 "C1'" 1 
ATOM   977   N  N1    . U   A  1  55   ? 56.456  161.274 37.616  1.00 55.25  ? 55   U   0 N1    1 
ATOM   978   C  C2    . U   A  1  55   ? 55.737  160.093 37.554  1.00 54.14  ? 55   U   0 C2    1 
ATOM   979   O  O2    . U   A  1  55   ? 55.216  159.688 36.536  1.00 53.76  ? 55   U   0 O2    1 
ATOM   980   N  N3    . U   A  1  55   ? 55.652  159.402 38.733  1.00 55.37  ? 55   U   0 N3    1 
ATOM   981   C  C4    . U   A  1  55   ? 56.196  159.756 39.944  1.00 55.45  ? 55   U   0 C4    1 
ATOM   982   O  O4    . U   A  1  55   ? 56.055  159.007 40.909  1.00 56.59  ? 55   U   0 O4    1 
ATOM   983   C  C5    . U   A  1  55   ? 56.919  160.990 39.935  1.00 56.02  ? 55   U   0 C5    1 
ATOM   984   C  C6    . U   A  1  55   ? 57.023  161.689 38.801  1.00 55.39  ? 55   U   0 C6    1 
ATOM   985   P  P     . G   A  1  56   ? 54.512  166.465 36.895  1.00 55.53  ? 56   G   0 P     1 
ATOM   986   O  OP1   . G   A  1  56   ? 54.267  167.663 36.055  1.00 55.66  ? 56   G   0 OP1   1 
ATOM   987   O  OP2   . G   A  1  56   ? 55.079  166.631 38.253  1.00 56.47  ? 56   G   0 OP2   1 
ATOM   988   O  "O5'" . G   A  1  56   ? 53.145  165.663 37.008  1.00 54.17  ? 56   G   0 "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  56   ? 52.467  165.235 35.825  1.00 52.30  ? 56   G   0 "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  56   ? 50.982  165.272 36.035  1.00 52.99  ? 56   G   0 "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  56   ? 50.596  164.166 36.888  1.00 54.29  ? 56   G   0 "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  56   ? 50.421  166.531 36.689  1.00 53.80  ? 56   G   0 "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  56   ? 49.148  166.801 36.114  1.00 54.92  ? 56   G   0 "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  56   ? 50.249  166.099 38.144  1.00 53.56  ? 56   G   0 "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  56   ? 49.239  166.820 38.818  1.00 52.43  ? 56   G   0 "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  56   ? 49.814  164.651 37.955  1.00 55.06  ? 56   G   0 "C1'" 1 
ATOM   997   N  N9    . G   A  1  56   ? 49.951  163.735 39.084  1.00 57.56  ? 56   G   0 N9    1 
ATOM   998   C  C8    . G   A  1  56   ? 50.636  163.923 40.265  1.00 58.27  ? 56   G   0 C8    1 
ATOM   999   N  N7    . G   A  1  56   ? 50.554  162.898 41.071  1.00 57.53  ? 56   G   0 N7    1 
ATOM   1000  C  C5    . G   A  1  56   ? 49.773  161.980 40.381  1.00 58.76  ? 56   G   0 C5    1 
ATOM   1001  C  C6    . G   A  1  56   ? 49.341  160.684 40.745  1.00 58.86  ? 56   G   0 C6    1 
ATOM   1002  O  O6    . G   A  1  56   ? 49.568  160.062 41.784  1.00 60.04  ? 56   G   0 O6    1 
ATOM   1003  N  N1    . G   A  1  56   ? 48.563  160.104 39.747  1.00 60.47  ? 56   G   0 N1    1 
ATOM   1004  C  C2    . G   A  1  56   ? 48.241  160.694 38.551  1.00 59.55  ? 56   G   0 C2    1 
ATOM   1005  N  N2    . G   A  1  56   ? 47.481  159.974 37.719  1.00 59.89  ? 56   G   0 N2    1 
ATOM   1006  N  N3    . G   A  1  56   ? 48.636  161.900 38.199  1.00 58.93  ? 56   G   0 N3    1 
ATOM   1007  C  C4    . G   A  1  56   ? 49.393  162.483 39.155  1.00 58.81  ? 56   G   0 C4    1 
ATOM   1008  P  P     . C   A  1  57   ? 48.895  168.198 35.365  1.00 55.25  ? 57   C   0 P     1 
ATOM   1009  O  OP1   . C   A  1  57   ? 47.578  168.133 34.680  1.00 57.22  ? 57   C   0 OP1   1 
ATOM   1010  O  OP2   . C   A  1  57   ? 50.126  168.488 34.577  1.00 54.53  ? 57   C   0 OP2   1 
ATOM   1011  O  "O5'" . C   A  1  57   ? 48.758  169.248 36.551  1.00 54.54  ? 57   C   0 "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  57   ? 49.193  170.605 36.394  1.00 54.39  ? 57   C   0 "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  57   ? 48.591  171.465 37.473  1.00 54.89  ? 57   C   0 "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  57   ? 47.156  171.565 37.282  1.00 54.77  ? 57   C   0 "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  57   ? 48.725  170.914 38.879  1.00 55.86  ? 57   C   0 "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  57   ? 50.011  171.177 39.410  1.00 58.72  ? 57   C   0 "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  57   ? 47.606  171.637 39.618  1.00 55.37  ? 57   C   0 "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  57   ? 47.934  172.975 39.953  1.00 53.83  ? 57   C   0 "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  57   ? 46.516  171.658 38.544  1.00 53.12  ? 57   C   0 "C1'" 1 
ATOM   1020  N  N1    . C   A  1  57   ? 45.503  170.588 38.652  1.00 50.91  ? 57   C   0 N1    1 
ATOM   1021  C  C2    . C   A  1  57   ? 44.493  170.720 39.618  1.00 50.57  ? 57   C   0 C2    1 
ATOM   1022  O  O2    . C   A  1  57   ? 44.541  171.673 40.407  1.00 51.45  ? 57   C   0 O2    1 
ATOM   1023  N  N3    . C   A  1  57   ? 43.501  169.799 39.674  1.00 48.36  ? 57   C   0 N3    1 
ATOM   1024  C  C4    . C   A  1  57   ? 43.504  168.766 38.829  1.00 47.90  ? 57   C   0 C4    1 
ATOM   1025  N  N4    . C   A  1  57   ? 42.487  167.903 38.898  1.00 46.53  ? 57   C   0 N4    1 
ATOM   1026  C  C5    . C   A  1  57   ? 44.548  168.576 37.869  1.00 47.56  ? 57   C   0 C5    1 
ATOM   1027  C  C6    . C   A  1  57   ? 45.519  169.502 37.817  1.00 49.41  ? 57   C   0 C6    1 
ATOM   1028  P  P     . C   A  1  58   ? 50.646  170.166 40.478  1.00 60.86  ? 58   C   0 P     1 
ATOM   1029  O  OP1   . C   A  1  58   ? 51.948  170.754 40.899  1.00 60.37  ? 58   C   0 OP1   1 
ATOM   1030  O  OP2   . C   A  1  58   ? 50.604  168.787 39.928  1.00 59.44  ? 58   C   0 OP2   1 
ATOM   1031  O  "O5'" . C   A  1  58   ? 49.638  170.244 41.700  1.00 58.68  ? 58   C   0 "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  58   ? 49.563  171.425 42.485  1.00 59.58  ? 58   C   0 "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  58   ? 48.509  171.274 43.536  1.00 61.61  ? 58   C   0 "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  58   ? 47.216  171.150 42.903  1.00 61.80  ? 58   C   0 "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  58   ? 48.594  170.001 44.349  1.00 63.33  ? 58   C   0 "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  58   ? 49.599  170.081 45.342  1.00 66.45  ? 58   C   0 "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  58   ? 47.195  169.926 44.942  1.00 63.59  ? 58   C   0 "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  58   ? 47.026  170.772 46.060  1.00 63.49  ? 58   C   0 "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  58   ? 46.351  170.437 43.769  1.00 62.26  ? 58   C   0 "C1'" 1 
ATOM   1040  N  N1    . C   A  1  58   ? 45.706  169.348 43.020  1.00 61.04  ? 58   C   0 N1    1 
ATOM   1041  C  C2    . C   A  1  58   ? 44.434  168.945 43.417  1.00 60.66  ? 58   C   0 C2    1 
ATOM   1042  O  O2    . C   A  1  58   ? 43.887  169.544 44.355  1.00 60.48  ? 58   C   0 O2    1 
ATOM   1043  N  N3    . C   A  1  58   ? 43.830  167.920 42.775  1.00 60.34  ? 58   C   0 N3    1 
ATOM   1044  C  C4    . C   A  1  58   ? 44.451  167.307 41.768  1.00 61.03  ? 58   C   0 C4    1 
ATOM   1045  N  N4    . C   A  1  58   ? 43.822  166.291 41.175  1.00 61.10  ? 58   C   0 N4    1 
ATOM   1046  C  C5    . C   A  1  58   ? 45.748  167.708 41.327  1.00 61.36  ? 58   C   0 C5    1 
ATOM   1047  C  C6    . C   A  1  58   ? 46.333  168.726 41.975  1.00 61.56  ? 58   C   0 C6    1 
ATOM   1048  P  P     . A   A  1  59   ? 50.885  169.124 45.239  1.00 69.65  ? 59   A   0 P     1 
ATOM   1049  O  OP1   . A   A  1  59   ? 51.633  169.283 46.522  1.00 68.83  ? 59   A   0 OP1   1 
ATOM   1050  O  OP2   . A   A  1  59   ? 51.577  169.377 43.943  1.00 68.60  ? 59   A   0 OP2   1 
ATOM   1051  O  "O5'" . A   A  1  59   ? 50.264  167.657 45.166  1.00 67.71  ? 59   A   0 "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  59   ? 49.751  167.017 46.342  1.00 62.20  ? 59   A   0 "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  59   ? 49.939  165.524 46.251  1.00 60.88  ? 59   A   0 "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  59   ? 48.857  164.935 45.478  1.00 59.91  ? 59   A   0 "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  59   ? 51.248  165.031 45.627  1.00 58.55  ? 59   A   0 "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  59   ? 51.764  163.934 46.370  1.00 57.95  ? 59   A   0 "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  59   ? 50.800  164.532 44.256  1.00 58.09  ? 59   A   0 "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  59   ? 51.614  163.483 43.775  1.00 56.12  ? 59   A   0 "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  59   ? 49.399  164.010 44.566  1.00 58.48  ? 59   A   0 "C1'" 1 
ATOM   1060  N  N9    . A   A  1  59   ? 48.507  163.919 43.412  1.00 59.52  ? 59   A   0 N9    1 
ATOM   1061  C  C8    . A   A  1  59   ? 48.368  164.800 42.368  1.00 59.31  ? 59   A   0 C8    1 
ATOM   1062  N  N7    . A   A  1  59   ? 47.504  164.415 41.461  1.00 60.32  ? 59   A   0 N7    1 
ATOM   1063  C  C5    . A   A  1  59   ? 47.032  163.201 41.943  1.00 61.51  ? 59   A   0 C5    1 
ATOM   1064  C  C6    . A   A  1  59   ? 46.097  162.275 41.436  1.00 61.80  ? 59   A   0 C6    1 
ATOM   1065  N  N6    . A   A  1  59   ? 45.461  162.426 40.272  1.00 61.47  ? 59   A   0 N6    1 
ATOM   1066  N  N1    . A   A  1  59   ? 45.844  161.170 42.173  1.00 61.55  ? 59   A   0 N1    1 
ATOM   1067  C  C2    . A   A  1  59   ? 46.499  161.007 43.328  1.00 59.94  ? 59   A   0 C2    1 
ATOM   1068  N  N3    . A   A  1  59   ? 47.406  161.793 43.901  1.00 60.87  ? 59   A   0 N3    1 
ATOM   1069  C  C4    . A   A  1  59   ? 47.632  162.889 43.151  1.00 61.19  ? 59   A   0 C4    1 
ATOM   1070  P  P     . A   A  1  60   ? 53.163  164.083 47.152  1.00 55.71  ? 60   A   0 P     1 
ATOM   1071  O  OP1   . A   A  1  60   ? 53.397  165.512 47.464  1.00 55.24  ? 60   A   0 OP1   1 
ATOM   1072  O  OP2   . A   A  1  60   ? 54.202  163.306 46.436  1.00 55.99  ? 60   A   0 OP2   1 
ATOM   1073  O  "O5'" . A   A  1  60   ? 52.863  163.359 48.531  1.00 55.70  ? 60   A   0 "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  60   ? 53.911  162.814 49.341  1.00 53.24  ? 60   A   0 "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  60   ? 53.385  161.619 50.091  1.00 52.64  ? 60   A   0 "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  60   ? 52.038  161.930 50.548  1.00 53.09  ? 60   A   0 "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  60   ? 53.201  160.371 49.246  1.00 51.04  ? 60   A   0 "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  60   ? 54.408  159.635 49.173  1.00 49.20  ? 60   A   0 "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  60   ? 52.116  159.629 50.004  1.00 52.22  ? 60   A   0 "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  60   ? 52.615  158.993 51.161  1.00 53.11  ? 60   A   0 "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  60   ? 51.208  160.788 50.416  1.00 53.78  ? 60   A   0 "C1'" 1 
ATOM   1082  N  N9    . A   A  1  60   ? 50.203  161.077 49.393  1.00 55.91  ? 60   A   0 N9    1 
ATOM   1083  C  C8    . A   A  1  60   ? 50.160  162.145 48.527  1.00 56.04  ? 60   A   0 C8    1 
ATOM   1084  N  N7    . A   A  1  60   ? 49.156  162.105 47.688  1.00 56.23  ? 60   A   0 N7    1 
ATOM   1085  C  C5    . A   A  1  60   ? 48.483  160.939 48.029  1.00 57.47  ? 60   A   0 C5    1 
ATOM   1086  C  C6    . A   A  1  60   ? 47.332  160.324 47.508  1.00 57.90  ? 60   A   0 C6    1 
ATOM   1087  N  N6    . A   A  1  60   ? 46.617  160.827 46.500  1.00 57.34  ? 60   A   0 N6    1 
ATOM   1088  N  N1    . A   A  1  60   ? 46.934  159.159 48.068  1.00 59.42  ? 60   A   0 N1    1 
ATOM   1089  C  C2    . A   A  1  60   ? 47.643  158.662 49.090  1.00 57.90  ? 60   A   0 C2    1 
ATOM   1090  N  N3    . A   A  1  60   ? 48.734  159.151 49.674  1.00 58.15  ? 60   A   0 N3    1 
ATOM   1091  C  C4    . A   A  1  60   ? 49.111  160.302 49.086  1.00 57.43  ? 60   A   0 C4    1 
ATOM   1092  P  P     . G   A  1  61   ? 54.614  158.560 48.005  1.00 51.30  ? 61   G   0 P     1 
ATOM   1093  O  OP1   . G   A  1  61   ? 55.958  157.967 48.205  1.00 53.91  ? 61   G   0 OP1   1 
ATOM   1094  O  OP2   . G   A  1  61   ? 54.277  159.174 46.695  1.00 51.04  ? 61   G   0 OP2   1 
ATOM   1095  O  "O5'" . G   A  1  61   ? 53.528  157.443 48.332  1.00 51.88  ? 61   G   0 "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  61   ? 53.646  156.621 49.507  1.00 49.62  ? 61   G   0 "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  61   ? 52.592  155.534 49.499  1.00 49.57  ? 61   G   0 "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  61   ? 51.273  156.136 49.584  1.00 47.90  ? 61   G   0 "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  61   ? 52.532  154.676 48.246  1.00 49.04  ? 61   G   0 "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  61   ? 53.499  153.632 48.250  1.00 49.08  ? 61   G   0 "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  61   ? 51.106  154.152 48.288  1.00 49.57  ? 61   G   0 "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  61   ? 50.948  153.079 49.194  1.00 51.10  ? 61   G   0 "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  61   ? 50.354  155.379 48.811  1.00 49.48  ? 61   G   0 "C1'" 1 
ATOM   1104  N  N9    . G   A  1  61   ? 49.833  156.237 47.747  1.00 50.95  ? 61   G   0 N9    1 
ATOM   1105  C  C8    . G   A  1  61   ? 50.258  157.504 47.415  1.00 51.36  ? 61   G   0 C8    1 
ATOM   1106  N  N7    . G   A  1  61   ? 49.593  158.025 46.422  1.00 51.26  ? 61   G   0 N7    1 
ATOM   1107  C  C5    . G   A  1  61   ? 48.678  157.044 46.069  1.00 52.02  ? 61   G   0 C5    1 
ATOM   1108  C  C6    . G   A  1  61   ? 47.699  157.028 45.046  1.00 51.00  ? 61   G   0 C6    1 
ATOM   1109  O  O6    . G   A  1  61   ? 47.437  157.906 44.220  1.00 49.44  ? 61   G   0 O6    1 
ATOM   1110  N  N1    . G   A  1  61   ? 46.992  155.831 45.036  1.00 50.74  ? 61   G   0 N1    1 
ATOM   1111  C  C2    . G   A  1  61   ? 47.204  154.780 45.895  1.00 51.22  ? 61   G   0 C2    1 
ATOM   1112  N  N2    . G   A  1  61   ? 46.424  153.703 45.724  1.00 51.53  ? 61   G   0 N2    1 
ATOM   1113  N  N3    . G   A  1  61   ? 48.115  154.782 46.849  1.00 51.25  ? 61   G   0 N3    1 
ATOM   1114  C  C4    . G   A  1  61   ? 48.812  155.935 46.879  1.00 51.21  ? 61   G   0 C4    1 
ATOM   1115  P  P     . C   A  1  62   ? 54.132  153.132 46.858  1.00 51.16  ? 62   C   0 P     1 
ATOM   1116  O  OP1   . C   A  1  62   ? 55.123  152.071 47.156  1.00 51.17  ? 62   C   0 OP1   1 
ATOM   1117  O  OP2   . C   A  1  62   ? 54.550  154.316 46.063  1.00 52.79  ? 62   C   0 OP2   1 
ATOM   1118  O  "O5'" . C   A  1  62   ? 52.901  152.448 46.118  1.00 52.13  ? 62   C   0 "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  62   ? 52.288  151.265 46.657  1.00 51.77  ? 62   C   0 "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  62   ? 51.101  150.867 45.825  1.00 52.06  ? 62   C   0 "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  62   ? 50.090  151.907 45.903  1.00 53.64  ? 62   C   0 "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  62   ? 51.344  150.723 44.335  1.00 51.64  ? 62   C   0 "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  62   ? 51.927  149.476 43.998  1.00 53.07  ? 62   C   0 "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  62   ? 49.936  150.857 43.783  1.00 53.46  ? 62   C   0 "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  62   ? 49.166  149.687 43.953  1.00 52.75  ? 62   C   0 "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  62   ? 49.374  151.961 44.680  1.00 54.35  ? 62   C   0 "C1'" 1 
ATOM   1127  N  N1    . C   A  1  62   ? 49.554  153.295 44.081  1.00 57.10  ? 62   C   0 N1    1 
ATOM   1128  C  C2    . C   A  1  62   ? 48.590  153.758 43.175  1.00 57.17  ? 62   C   0 C2    1 
ATOM   1129  O  O2    . C   A  1  62   ? 47.624  153.025 42.898  1.00 56.39  ? 62   C   0 O2    1 
ATOM   1130  N  N3    . C   A  1  62   ? 48.742  154.986 42.620  1.00 57.04  ? 62   C   0 N3    1 
ATOM   1131  C  C4    . C   A  1  62   ? 49.804  155.733 42.931  1.00 57.10  ? 62   C   0 C4    1 
ATOM   1132  N  N4    . C   A  1  62   ? 49.912  156.932 42.366  1.00 56.93  ? 62   C   0 N4    1 
ATOM   1133  C  C5    . C   A  1  62   ? 50.803  155.282 43.840  1.00 57.90  ? 62   C   0 C5    1 
ATOM   1134  C  C6    . C   A  1  62   ? 50.639  154.071 44.389  1.00 57.90  ? 62   C   0 C6    1 
ATOM   1135  P  P     . U   A  1  63   ? 52.886  149.368 42.712  1.00 55.15  ? 63   U   0 P     1 
ATOM   1136  O  OP1   . U   A  1  63   ? 53.316  147.953 42.584  1.00 55.04  ? 63   U   0 OP1   1 
ATOM   1137  O  OP2   . U   A  1  63   ? 53.915  150.436 42.795  1.00 53.96  ? 63   U   0 OP2   1 
ATOM   1138  O  "O5'" . U   A  1  63   ? 51.916  149.693 41.487  1.00 55.57  ? 63   U   0 "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  63   ? 50.883  148.767 41.095  1.00 52.55  ? 63   U   0 "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  63   ? 50.048  149.344 39.976  1.00 52.03  ? 63   U   0 "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  63   ? 49.392  150.552 40.443  1.00 51.74  ? 63   U   0 "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  63   ? 50.800  149.807 38.739  1.00 52.65  ? 63   U   0 "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  63   ? 51.135  148.756 37.855  1.00 52.17  ? 63   U   0 "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  63   ? 49.812  150.778 38.121  1.00 53.11  ? 63   U   0 "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  63   ? 48.747  150.113 37.478  1.00 53.30  ? 63   U   0 "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  63   ? 49.284  151.479 39.373  1.00 53.34  ? 63   U   0 "C1'" 1 
ATOM   1147  N  N1    . U   A  1  63   ? 50.067  152.682 39.706  1.00 54.07  ? 63   U   0 N1    1 
ATOM   1148  C  C2    . U   A  1  63   ? 49.686  153.885 39.121  1.00 52.84  ? 63   U   0 C2    1 
ATOM   1149  O  O2    . U   A  1  63   ? 48.745  153.984 38.352  1.00 53.10  ? 63   U   0 O2    1 
ATOM   1150  N  N3    . U   A  1  63   ? 50.452  154.966 39.471  1.00 51.59  ? 63   U   0 N3    1 
ATOM   1151  C  C4    . U   A  1  63   ? 51.534  154.980 40.319  1.00 51.29  ? 63   U   0 C4    1 
ATOM   1152  O  O4    . U   A  1  63   ? 52.105  156.044 40.545  1.00 50.69  ? 63   U   0 O4    1 
ATOM   1153  C  C5    . U   A  1  63   ? 51.871  153.708 40.882  1.00 52.81  ? 63   U   0 C5    1 
ATOM   1154  C  C6    . U   A  1  63   ? 51.146  152.630 40.567  1.00 53.14  ? 63   U   0 C6    1 
ATOM   1155  P  P     . G   A  1  64   ? 52.485  148.856 36.990  1.00 53.66  ? 64   G   0 P     1 
ATOM   1156  O  OP1   . G   A  1  64   ? 52.630  147.586 36.229  1.00 54.77  ? 64   G   0 OP1   1 
ATOM   1157  O  OP2   . G   A  1  64   ? 53.587  149.304 37.874  1.00 53.82  ? 64   G   0 OP2   1 
ATOM   1158  O  "O5'" . G   A  1  64   ? 52.182  150.026 35.955  1.00 54.39  ? 64   G   0 "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  64   ? 51.071  149.939 35.047  1.00 51.37  ? 64   G   0 "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  64   ? 50.913  151.238 34.297  1.00 53.34  ? 64   G   0 "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  64   ? 50.597  152.305 35.232  1.00 54.27  ? 64   G   0 "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  64   ? 52.155  151.753 33.590  1.00 52.75  ? 64   G   0 "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  64   ? 52.384  151.117 32.347  1.00 52.03  ? 64   G   0 "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  64   ? 51.836  153.230 33.428  1.00 53.63  ? 64   G   0 "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  64   ? 50.928  153.485 32.377  1.00 53.50  ? 64   G   0 "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  64   ? 51.155  153.525 34.763  1.00 54.51  ? 64   G   0 "C1'" 1 
ATOM   1167  N  N9    . G   A  1  64   ? 52.085  154.033 35.768  1.00 55.75  ? 64   G   0 N9    1 
ATOM   1168  C  C8    . G   A  1  64   ? 52.642  153.341 36.817  1.00 55.73  ? 64   G   0 C8    1 
ATOM   1169  N  N7    . G   A  1  64   ? 53.410  154.082 37.567  1.00 56.40  ? 64   G   0 N7    1 
ATOM   1170  C  C5    . G   A  1  64   ? 53.364  155.337 36.974  1.00 56.54  ? 64   G   0 C5    1 
ATOM   1171  C  C6    . G   A  1  64   ? 53.992  156.555 37.345  1.00 57.21  ? 64   G   0 C6    1 
ATOM   1172  O  O6    . G   A  1  64   ? 54.739  156.779 38.311  1.00 56.77  ? 64   G   0 O6    1 
ATOM   1173  N  N1    . G   A  1  64   ? 53.679  157.580 36.457  1.00 57.02  ? 64   G   0 N1    1 
ATOM   1174  C  C2    . G   A  1  64   ? 52.874  157.453 35.357  1.00 55.20  ? 64   G   0 C2    1 
ATOM   1175  N  N2    . G   A  1  64   ? 52.705  158.554 34.623  1.00 52.30  ? 64   G   0 N2    1 
ATOM   1176  N  N3    . G   A  1  64   ? 52.280  156.328 35.004  1.00 55.37  ? 64   G   0 N3    1 
ATOM   1177  C  C4    . G   A  1  64   ? 52.564  155.319 35.853  1.00 55.63  ? 64   G   0 C4    1 
ATOM   1178  P  P     . C   A  1  65   ? 53.888  150.826 31.884  1.00 52.09  ? 65   C   0 P     1 
ATOM   1179  O  OP1   . C   A  1  65   ? 53.848  150.005 30.650  1.00 53.34  ? 65   C   0 OP1   1 
ATOM   1180  O  OP2   . C   A  1  65   ? 54.629  150.330 33.069  1.00 52.68  ? 65   C   0 OP2   1 
ATOM   1181  O  "O5'" . C   A  1  65   ? 54.452  152.266 31.501  1.00 53.98  ? 65   C   0 "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  65   ? 53.817  153.068 30.482  1.00 52.82  ? 65   C   0 "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  65   ? 54.208  154.522 30.633  1.00 52.96  ? 65   C   0 "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  65   ? 53.803  154.987 31.946  1.00 52.99  ? 65   C   0 "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  65   ? 55.698  154.833 30.572  1.00 51.83  ? 65   C   0 "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  65   ? 56.145  154.993 29.238  1.00 52.05  ? 65   C   0 "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  65   ? 55.784  156.149 31.321  1.00 51.81  ? 65   C   0 "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  65   ? 55.394  157.238 30.510  1.00 49.72  ? 65   C   0 "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  65   ? 54.750  155.927 32.428  1.00 53.37  ? 65   C   0 "C1'" 1 
ATOM   1190  N  N1    . C   A  1  65   ? 55.334  155.417 33.684  1.00 54.46  ? 65   C   0 N1    1 
ATOM   1191  C  C2    . C   A  1  65   ? 55.906  156.331 34.582  1.00 55.70  ? 65   C   0 C2    1 
ATOM   1192  O  O2    . C   A  1  65   ? 55.916  157.540 34.292  1.00 57.22  ? 65   C   0 O2    1 
ATOM   1193  N  N3    . C   A  1  65   ? 56.433  155.877 35.739  1.00 54.38  ? 65   C   0 N3    1 
ATOM   1194  C  C4    . C   A  1  65   ? 56.408  154.576 36.017  1.00 53.82  ? 65   C   0 C4    1 
ATOM   1195  N  N4    . C   A  1  65   ? 56.924  154.181 37.177  1.00 54.63  ? 65   C   0 N4    1 
ATOM   1196  C  C5    . C   A  1  65   ? 55.847  153.623 35.120  1.00 54.17  ? 65   C   0 C5    1 
ATOM   1197  C  C6    . C   A  1  65   ? 55.325  154.082 33.978  1.00 54.41  ? 65   C   0 C6    1 
ATOM   1198  P  P     . G   A  1  66   ? 57.695  154.773 28.884  1.00 54.33  ? 66   G   0 P     1 
ATOM   1199  O  OP1   . G   A  1  66   ? 57.805  154.739 27.398  1.00 55.66  ? 66   G   0 OP1   1 
ATOM   1200  O  OP2   . G   A  1  66   ? 58.174  153.616 29.678  1.00 53.40  ? 66   G   0 OP2   1 
ATOM   1201  O  "O5'" . G   A  1  66   ? 58.433  156.080 29.424  1.00 51.75  ? 66   G   0 "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  66   ? 58.037  157.395 28.993  1.00 50.50  ? 66   G   0 "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  66   ? 58.946  158.442 29.601  1.00 49.82  ? 66   G   0 "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  66   ? 58.904  158.329 31.050  1.00 48.89  ? 66   G   0 "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  66   ? 60.419  158.343 29.222  1.00 49.88  ? 66   G   0 "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  66   ? 61.001  159.645 29.314  1.00 51.37  ? 66   G   0 "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  66   ? 60.980  157.488 30.353  1.00 49.31  ? 66   G   0 "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  66   ? 62.368  157.675 30.532  1.00 48.40  ? 66   G   0 "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  66   ? 60.198  158.037 31.545  1.00 49.27  ? 66   G   0 "C1'" 1 
ATOM   1210  N  N9    . G   A  1  66   ? 60.058  157.138 32.690  1.00 49.56  ? 66   G   0 N9    1 
ATOM   1211  C  C8    . G   A  1  66   ? 59.246  156.033 32.780  1.00 49.92  ? 66   G   0 C8    1 
ATOM   1212  N  N7    . G   A  1  66   ? 59.299  155.450 33.947  1.00 50.73  ? 66   G   0 N7    1 
ATOM   1213  C  C5    . G   A  1  66   ? 60.209  156.208 34.671  1.00 49.68  ? 66   G   0 C5    1 
ATOM   1214  C  C6    . G   A  1  66   ? 60.667  156.066 36.008  1.00 48.82  ? 66   G   0 C6    1 
ATOM   1215  O  O6    . G   A  1  66   ? 60.354  155.215 36.844  1.00 49.21  ? 66   G   0 O6    1 
ATOM   1216  N  N1    . G   A  1  66   ? 61.581  157.053 36.340  1.00 48.65  ? 66   G   0 N1    1 
ATOM   1217  C  C2    . G   A  1  66   ? 62.010  158.045 35.504  1.00 48.49  ? 66   G   0 C2    1 
ATOM   1218  N  N2    . G   A  1  66   ? 62.917  158.884 36.013  1.00 48.27  ? 66   G   0 N2    1 
ATOM   1219  N  N3    . G   A  1  66   ? 61.588  158.199 34.260  1.00 49.60  ? 66   G   0 N3    1 
ATOM   1220  C  C4    . G   A  1  66   ? 60.695  157.249 33.910  1.00 49.46  ? 66   G   0 C4    1 
ATOM   1221  P  P     . A   A  1  67   ? 60.878  160.686 28.091  1.00 49.47  ? 67   A   0 P     1 
ATOM   1222  O  OP1   . A   A  1  67   ? 60.065  160.063 27.007  1.00 48.29  ? 67   A   0 OP1   1 
ATOM   1223  O  OP2   . A   A  1  67   ? 62.239  161.194 27.796  1.00 45.64  ? 67   A   0 OP2   1 
ATOM   1224  O  "O5'" . A   A  1  67   ? 60.036  161.890 28.702  1.00 49.37  ? 67   A   0 "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  67   ? 60.442  162.522 29.928  1.00 51.22  ? 67   A   0 "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  67   ? 60.892  163.944 29.666  1.00 52.89  ? 67   A   0 "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  67   ? 61.361  164.518 30.917  1.00 53.32  ? 67   A   0 "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  67   ? 62.061  164.082 28.696  1.00 53.86  ? 67   A   0 "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  67   ? 62.017  165.376 28.086  1.00 53.28  ? 67   A   0 "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  67   ? 63.257  163.988 29.632  1.00 53.89  ? 67   A   0 "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  67   ? 64.429  164.556 29.098  1.00 57.13  ? 67   A   0 "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  67   ? 62.750  164.786 30.831  1.00 54.75  ? 67   A   0 "C1'" 1 
ATOM   1233  N  N9    . A   A  1  67   ? 63.368  164.423 32.109  1.00 57.46  ? 67   A   0 N9    1 
ATOM   1234  C  C8    . A   A  1  67   ? 64.001  165.264 32.992  1.00 57.60  ? 67   A   0 C8    1 
ATOM   1235  N  N7    . A   A  1  67   ? 64.452  164.664 34.064  1.00 58.02  ? 67   A   0 N7    1 
ATOM   1236  C  C5    . A   A  1  67   ? 64.097  163.336 33.876  1.00 58.37  ? 67   A   0 C5    1 
ATOM   1237  C  C6    . A   A  1  67   ? 64.299  162.189 34.654  1.00 58.41  ? 67   A   0 C6    1 
ATOM   1238  N  N6    . A   A  1  67   ? 64.930  162.196 35.826  1.00 57.97  ? 67   A   0 N6    1 
ATOM   1239  N  N1    . A   A  1  67   ? 63.827  161.019 34.181  1.00 59.16  ? 67   A   0 N1    1 
ATOM   1240  C  C2    . A   A  1  67   ? 63.193  161.013 33.004  1.00 59.43  ? 67   A   0 C2    1 
ATOM   1241  N  N3    . A   A  1  67   ? 62.940  162.023 32.180  1.00 58.69  ? 67   A   0 N3    1 
ATOM   1242  C  C4    . A   A  1  67   ? 63.427  163.172 32.679  1.00 58.26  ? 67   A   0 C4    1 
ATOM   1243  P  P     . U   A  1  68   ? 61.971  165.515 26.484  1.00 51.44  ? 68   U   0 P     1 
ATOM   1244  O  OP1   . U   A  1  68   ? 62.918  164.538 25.874  1.00 49.02  ? 68   U   0 OP1   1 
ATOM   1245  O  OP2   . U   A  1  68   ? 62.119  166.961 26.187  1.00 52.23  ? 68   U   0 OP2   1 
ATOM   1246  O  "O5'" . U   A  1  68   ? 60.473  165.115 26.119  1.00 51.14  ? 68   U   0 "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  68   ? 59.396  166.048 26.319  1.00 49.66  ? 68   U   0 "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  68   ? 58.072  165.392 26.014  1.00 50.20  ? 68   U   0 "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  68   ? 58.097  164.874 24.656  1.00 51.03  ? 68   U   0 "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  68   ? 57.692  164.205 26.894  1.00 50.53  ? 68   U   0 "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  68   ? 56.264  164.147 26.937  1.00 50.73  ? 68   U   0 "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  68   ? 58.209  163.031 26.075  1.00 50.24  ? 68   U   0 "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  68   ? 57.590  161.808 26.402  1.00 52.17  ? 68   U   0 "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  68   ? 57.811  163.493 24.678  1.00 51.20  ? 68   U   0 "C1'" 1 
ATOM   1255  N  N1    . U   A  1  68   ? 58.474  162.846 23.537  1.00 51.59  ? 68   U   0 N1    1 
ATOM   1256  C  C2    . U   A  1  68   ? 57.706  161.996 22.750  1.00 51.34  ? 68   U   0 C2    1 
ATOM   1257  O  O2    . U   A  1  68   ? 56.535  161.746 22.988  1.00 50.78  ? 68   U   0 O2    1 
ATOM   1258  N  N3    . U   A  1  68   ? 58.363  161.445 21.679  1.00 51.72  ? 68   U   0 N3    1 
ATOM   1259  C  C4    . U   A  1  68   ? 59.683  161.637 21.327  1.00 53.21  ? 68   U   0 C4    1 
ATOM   1260  O  O4    . U   A  1  68   ? 60.140  161.034 20.359  1.00 54.12  ? 68   U   0 O4    1 
ATOM   1261  C  C5    . U   A  1  68   ? 60.413  162.517 22.192  1.00 53.31  ? 68   U   0 C5    1 
ATOM   1262  C  C6    . U   A  1  68   ? 59.800  163.077 23.242  1.00 52.35  ? 68   U   0 C6    1 
ATOM   1263  P  P     . A   A  1  69   ? 55.479  164.503 28.294  1.00 52.09  ? 69   A   0 P     1 
ATOM   1264  O  OP1   . A   A  1  69   ? 54.164  165.086 27.938  1.00 52.54  ? 69   A   0 OP1   1 
ATOM   1265  O  OP2   . A   A  1  69   ? 56.398  165.270 29.187  1.00 51.12  ? 69   A   0 OP2   1 
ATOM   1266  O  "O5'" . A   A  1  69   ? 55.182  163.069 28.922  1.00 51.39  ? 69   A   0 "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  69   ? 56.254  162.167 29.148  1.00 50.73  ? 69   A   0 "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  69   ? 55.855  161.052 30.080  1.00 49.36  ? 69   A   0 "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  69   ? 57.125  160.513 30.535  1.00 50.03  ? 69   A   0 "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  69   ? 55.083  161.422 31.354  1.00 48.00  ? 69   A   0 "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  69   ? 53.693  161.091 31.241  1.00 47.78  ? 69   A   0 "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  69   ? 55.764  160.570 32.413  1.00 49.32  ? 69   A   0 "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  69   ? 55.320  159.231 32.363  1.00 47.74  ? 69   A   0 "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  69   ? 57.212  160.623 31.936  1.00 51.20  ? 69   A   0 "C1'" 1 
ATOM   1275  N  N9    . A   A  1  69   ? 57.907  161.876 32.267  1.00 52.47  ? 69   A   0 N9    1 
ATOM   1276  C  C8    . A   A  1  69   ? 57.686  163.139 31.769  1.00 50.68  ? 69   A   0 C8    1 
ATOM   1277  N  N7    . A   A  1  69   ? 58.451  164.059 32.302  1.00 51.57  ? 69   A   0 N7    1 
ATOM   1278  C  C5    . A   A  1  69   ? 59.235  163.360 33.210  1.00 51.51  ? 69   A   0 C5    1 
ATOM   1279  C  C6    . A   A  1  69   ? 60.237  163.767 34.108  1.00 50.58  ? 69   A   0 C6    1 
ATOM   1280  N  N6    . A   A  1  69   ? 60.626  165.031 34.268  1.00 49.05  ? 69   A   0 N6    1 
ATOM   1281  N  N1    . A   A  1  69   ? 60.830  162.816 34.857  1.00 51.84  ? 69   A   0 N1    1 
ATOM   1282  C  C2    . A   A  1  69   ? 60.428  161.552 34.724  1.00 52.45  ? 69   A   0 C2    1 
ATOM   1283  N  N3    . A   A  1  69   ? 59.490  161.046 33.932  1.00 53.42  ? 69   A   0 N3    1 
ATOM   1284  C  C4    . A   A  1  69   ? 58.923  162.013 33.188  1.00 53.15  ? 69   A   0 C4    1 
ATOM   1285  P  P     . A   A  1  70   ? 52.677  161.362 32.473  1.00 46.64  ? 70   A   0 P     1 
ATOM   1286  O  OP1   . A   A  1  70   ? 51.981  162.657 32.264  1.00 49.80  ? 70   A   0 OP1   1 
ATOM   1287  O  OP2   . A   A  1  70   ? 53.386  161.133 33.743  1.00 48.88  ? 70   A   0 OP2   1 
ATOM   1288  O  "O5'" . A   A  1  70   ? 51.587  160.207 32.317  1.00 48.38  ? 70   A   0 "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  70   ? 50.183  160.470 32.535  1.00 49.95  ? 70   A   0 "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  70   ? 49.388  159.180 32.500  1.00 52.47  ? 70   A   0 "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  70   ? 49.887  158.277 33.523  1.00 52.01  ? 70   A   0 "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  70   ? 47.897  159.335 32.778  1.00 54.17  ? 70   A   0 "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  70   ? 47.168  158.301 32.129  1.00 58.36  ? 70   A   0 "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  70   ? 47.817  159.101 34.279  1.00 54.39  ? 70   A   0 "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  70   ? 46.540  158.647 34.672  1.00 54.60  ? 70   A   0 "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  70   ? 48.866  158.007 34.463  1.00 54.21  ? 70   A   0 "C1'" 1 
ATOM   1297  N  N9    . A   A  1  70   ? 49.483  157.981 35.787  1.00 56.01  ? 70   A   0 N9    1 
ATOM   1298  C  C8    . A   A  1  70   ? 49.530  156.931 36.665  1.00 56.82  ? 70   A   0 C8    1 
ATOM   1299  N  N7    . A   A  1  70   ? 50.213  157.182 37.754  1.00 57.21  ? 70   A   0 N7    1 
ATOM   1300  C  C5    . A   A  1  70   ? 50.632  158.494 37.589  1.00 57.67  ? 70   A   0 C5    1 
ATOM   1301  C  C6    . A   A  1  70   ? 51.408  159.344 38.388  1.00 58.15  ? 70   A   0 C6    1 
ATOM   1302  N  N6    . A   A  1  70   ? 51.935  158.983 39.562  1.00 58.77  ? 70   A   0 N6    1 
ATOM   1303  N  N1    . A   A  1  70   ? 51.636  160.595 37.934  1.00 57.86  ? 70   A   0 N1    1 
ATOM   1304  C  C2    . A   A  1  70   ? 51.122  160.950 36.753  1.00 57.52  ? 70   A   0 C2    1 
ATOM   1305  N  N3    . A   A  1  70   ? 50.385  160.240 35.908  1.00 56.68  ? 70   A   0 N3    1 
ATOM   1306  C  C4    . A   A  1  70   ? 50.174  159.005 36.390  1.00 57.02  ? 70   A   0 C4    1 
ATOM   1307  P  P     . G   A  1  71   ? 46.668  158.500 30.617  1.00 61.29  ? 71   G   0 P     1 
ATOM   1308  O  OP1   . G   A  1  71   ? 45.997  159.831 30.511  1.00 60.20  ? 71   G   0 OP1   1 
ATOM   1309  O  OP2   . G   A  1  71   ? 45.931  157.264 30.214  1.00 60.83  ? 71   G   0 OP2   1 
ATOM   1310  O  "O5'" . G   A  1  71   ? 48.036  158.555 29.809  1.00 59.91  ? 71   G   0 "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  71   ? 48.104  159.100 28.492  1.00 58.16  ? 71   G   0 "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  71   ? 49.302  160.001 28.386  1.00 57.62  ? 71   G   0 "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  71   ? 50.401  159.430 29.142  1.00 55.79  ? 71   G   0 "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  71   ? 49.840  160.196 26.979  1.00 58.16  ? 71   G   0 "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  71   ? 49.116  161.229 26.294  1.00 59.10  ? 71   G   0 "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  71   ? 51.303  160.529 27.253  1.00 56.68  ? 71   G   0 "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  71   ? 51.456  161.854 27.725  1.00 58.90  ? 71   G   0 "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  71   ? 51.608  159.590 28.424  1.00 53.70  ? 71   G   0 "C1'" 1 
ATOM   1319  N  N9    . G   A  1  71   ? 52.074  158.257 28.053  1.00 50.45  ? 71   G   0 N9    1 
ATOM   1320  C  C8    . G   A  1  71   ? 51.412  157.071 28.264  1.00 48.61  ? 71   G   0 C8    1 
ATOM   1321  N  N7    . G   A  1  71   ? 52.075  156.031 27.841  1.00 47.50  ? 71   G   0 N7    1 
ATOM   1322  C  C5    . G   A  1  71   ? 53.244  156.559 27.315  1.00 49.00  ? 71   G   0 C5    1 
ATOM   1323  C  C6    . G   A  1  71   ? 54.352  155.913 26.712  1.00 49.65  ? 71   G   0 C6    1 
ATOM   1324  O  O6    . G   A  1  71   ? 54.522  154.707 26.506  1.00 52.48  ? 71   G   0 O6    1 
ATOM   1325  N  N1    . G   A  1  71   ? 55.328  156.820 26.332  1.00 49.54  ? 71   G   0 N1    1 
ATOM   1326  C  C2    . G   A  1  71   ? 55.252  158.178 26.504  1.00 50.66  ? 71   G   0 C2    1 
ATOM   1327  N  N2    . G   A  1  71   ? 56.309  158.887 26.075  1.00 50.11  ? 71   G   0 N2    1 
ATOM   1328  N  N3    . G   A  1  71   ? 54.221  158.797 27.057  1.00 50.90  ? 71   G   0 N3    1 
ATOM   1329  C  C4    . G   A  1  71   ? 53.260  157.932 27.438  1.00 49.64  ? 71   G   0 C4    1 
ATOM   1330  P  P     . C   A  1  72   ? 48.614  160.992 24.776  1.00 59.53  ? 72   C   0 P     1 
ATOM   1331  O  OP1   . C   A  1  72   ? 47.744  162.143 24.428  1.00 58.54  ? 72   C   0 OP1   1 
ATOM   1332  O  OP2   . C   A  1  72   ? 48.092  159.609 24.612  1.00 58.16  ? 72   C   0 OP2   1 
ATOM   1333  O  "O5'" . C   A  1  72   ? 49.949  161.105 23.918  1.00 58.58  ? 72   C   0 "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  72   ? 50.515  162.389 23.605  1.00 58.31  ? 72   C   0 "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  72   ? 51.494  162.257 22.468  1.00 59.12  ? 72   C   0 "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  72   ? 52.646  161.487 22.905  1.00 59.03  ? 72   C   0 "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  72   ? 50.977  161.492 21.263  1.00 58.25  ? 72   C   0 "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  72   ? 50.161  162.297 20.419  1.00 58.69  ? 72   C   0 "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  72   ? 52.267  161.022 20.611  1.00 57.01  ? 72   C   0 "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  72   ? 52.924  162.060 19.918  1.00 56.82  ? 72   C   0 "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  72   ? 53.094  160.654 21.843  1.00 58.85  ? 72   C   0 "C1'" 1 
ATOM   1342  N  N1    . C   A  1  72   ? 52.930  159.242 22.258  1.00 60.69  ? 72   C   0 N1    1 
ATOM   1343  C  C2    . C   A  1  72   ? 53.626  158.237 21.556  1.00 60.18  ? 72   C   0 C2    1 
ATOM   1344  O  O2    . C   A  1  72   ? 54.370  158.557 20.613  1.00 59.49  ? 72   C   0 O2    1 
ATOM   1345  N  N3    . C   A  1  72   ? 53.469  156.947 21.928  1.00 59.65  ? 72   C   0 N3    1 
ATOM   1346  C  C4    . C   A  1  72   ? 52.671  156.638 22.954  1.00 60.30  ? 72   C   0 C4    1 
ATOM   1347  N  N4    . C   A  1  72   ? 52.554  155.350 23.286  1.00 60.40  ? 72   C   0 N4    1 
ATOM   1348  C  C5    . C   A  1  72   ? 51.958  157.635 23.686  1.00 59.51  ? 72   C   0 C5    1 
ATOM   1349  C  C6    . C   A  1  72   ? 52.113  158.908 23.307  1.00 59.71  ? 72   C   0 C6    1 
ATOM   1350  P  P     . U   A  1  73   ? 48.996  161.605 19.549  1.00 60.11  ? 73   U   0 P     1 
ATOM   1351  O  OP1   . U   A  1  73   ? 48.201  162.678 18.893  1.00 58.26  ? 73   U   0 OP1   1 
ATOM   1352  O  OP2   . U   A  1  73   ? 48.308  160.611 20.414  1.00 59.42  ? 73   U   0 OP2   1 
ATOM   1353  O  "O5'" . U   A  1  73   ? 49.801  160.807 18.428  1.00 58.62  ? 73   U   0 "O5'" 1 
ATOM   1354  C  "C5'" . U   A  1  73   ? 50.678  161.505 17.530  1.00 58.10  ? 73   U   0 "C5'" 1 
ATOM   1355  C  "C4'" . U   A  1  73   ? 51.233  160.561 16.497  1.00 59.71  ? 73   U   0 "C4'" 1 
ATOM   1356  O  "O4'" . U   A  1  73   ? 52.153  159.632 17.119  1.00 60.10  ? 73   U   0 "O4'" 1 
ATOM   1357  C  "C3'" . U   A  1  73   ? 50.222  159.665 15.805  1.00 60.54  ? 73   U   0 "C3'" 1 
ATOM   1358  O  "O3'" . U   A  1  73   ? 49.548  160.348 14.763  1.00 61.01  ? 73   U   0 "O3'" 1 
ATOM   1359  C  "C2'" . U   A  1  73   ? 51.105  158.542 15.285  1.00 60.25  ? 73   U   0 "C2'" 1 
ATOM   1360  O  "O2'" . U   A  1  73   ? 51.822  158.929 14.132  1.00 58.83  ? 73   U   0 "O2'" 1 
ATOM   1361  C  "C1'" . U   A  1  73   ? 52.084  158.381 16.450  1.00 60.79  ? 73   U   0 "C1'" 1 
ATOM   1362  N  N1    . U   A  1  73   ? 51.681  157.354 17.426  1.00 61.49  ? 73   U   0 N1    1 
ATOM   1363  C  C2    . U   A  1  73   ? 51.816  156.021 17.062  1.00 62.20  ? 73   U   0 C2    1 
ATOM   1364  O  O2    . U   A  1  73   ? 52.210  155.663 15.963  1.00 64.28  ? 73   U   0 O2    1 
ATOM   1365  N  N3    . U   A  1  73   ? 51.467  155.119 18.034  1.00 62.66  ? 73   U   0 N3    1 
ATOM   1366  C  C4    . U   A  1  73   ? 50.995  155.398 19.297  1.00 62.08  ? 73   U   0 C4    1 
ATOM   1367  O  O4    . U   A  1  73   ? 50.767  154.471 20.072  1.00 62.51  ? 73   U   0 O4    1 
ATOM   1368  C  C5    . U   A  1  73   ? 50.857  156.792 19.590  1.00 62.07  ? 73   U   0 C5    1 
ATOM   1369  C  C6    . U   A  1  73   ? 51.196  157.699 18.670  1.00 61.90  ? 73   U   0 C6    1 
ATOM   1370  P  P     . G   A  1  74   ? 48.127  159.811 14.249  1.00 61.10  ? 74   G   0 P     1 
ATOM   1371  O  OP1   . G   A  1  74   ? 47.692  160.763 13.200  1.00 62.76  ? 74   G   0 OP1   1 
ATOM   1372  O  OP2   . G   A  1  74   ? 47.241  159.550 15.409  1.00 60.83  ? 74   G   0 OP2   1 
ATOM   1373  O  "O5'" . G   A  1  74   ? 48.485  158.425 13.554  1.00 61.63  ? 74   G   0 "O5'" 1 
ATOM   1374  C  "C5'" . G   A  1  74   ? 49.237  158.392 12.324  1.00 61.58  ? 74   G   0 "C5'" 1 
ATOM   1375  C  "C4'" . G   A  1  74   ? 49.339  156.975 11.809  1.00 63.05  ? 74   G   0 "C4'" 1 
ATOM   1376  O  "O4'" . G   A  1  74   ? 50.135  156.181 12.728  1.00 63.62  ? 74   G   0 "O4'" 1 
ATOM   1377  C  "C3'" . G   A  1  74   ? 48.023  156.221 11.697  1.00 63.12  ? 74   G   0 "C3'" 1 
ATOM   1378  O  "O3'" . G   A  1  74   ? 47.352  156.529 10.481  1.00 64.94  ? 74   G   0 "O3'" 1 
ATOM   1379  C  "C2'" . G   A  1  74   ? 48.474  154.770 11.772  1.00 62.61  ? 74   G   0 "C2'" 1 
ATOM   1380  O  "O2'" . G   A  1  74   ? 48.969  154.281 10.540  1.00 59.34  ? 74   G   0 "O2'" 1 
ATOM   1381  C  "C1'" . G   A  1  74   ? 49.612  154.865 12.796  1.00 63.27  ? 74   G   0 "C1'" 1 
ATOM   1382  N  N9    . G   A  1  74   ? 49.170  154.627 14.168  1.00 62.95  ? 74   G   0 N9    1 
ATOM   1383  C  C8    . G   A  1  74   ? 48.776  155.569 15.090  1.00 62.57  ? 74   G   0 C8    1 
ATOM   1384  N  N7    . G   A  1  74   ? 48.410  155.048 16.228  1.00 63.26  ? 74   G   0 N7    1 
ATOM   1385  C  C5    . G   A  1  74   ? 48.578  153.681 16.050  1.00 64.17  ? 74   G   0 C5    1 
ATOM   1386  C  C6    . G   A  1  74   ? 48.335  152.597 16.941  1.00 64.87  ? 74   G   0 C6    1 
ATOM   1387  O  O6    . G   A  1  74   ? 47.917  152.632 18.106  1.00 64.87  ? 74   G   0 O6    1 
ATOM   1388  N  N1    . G   A  1  74   ? 48.635  151.376 16.350  1.00 65.06  ? 74   G   0 N1    1 
ATOM   1389  C  C2    . G   A  1  74   ? 49.114  151.214 15.074  1.00 65.43  ? 74   G   0 C2    1 
ATOM   1390  N  N2    . G   A  1  74   ? 49.360  149.956 14.692  1.00 67.15  ? 74   G   0 N2    1 
ATOM   1391  N  N3    . G   A  1  74   ? 49.342  152.210 14.236  1.00 64.10  ? 74   G   0 N3    1 
ATOM   1392  C  C4    . G   A  1  74   ? 49.052  153.407 14.786  1.00 63.53  ? 74   G   0 C4    1 
ATOM   1393  P  P     . U   A  1  75   ? 45.759  156.352 10.378  1.00 65.85  ? 75   U   0 P     1 
ATOM   1394  O  OP1   . U   A  1  75   ? 45.368  156.867 9.037   1.00 66.36  ? 75   U   0 OP1   1 
ATOM   1395  O  OP2   . U   A  1  75   ? 45.121  156.921 11.592  1.00 63.66  ? 75   U   0 OP2   1 
ATOM   1396  O  "O5'" . U   A  1  75   ? 45.563  154.769 10.389  1.00 65.41  ? 75   U   0 "O5'" 1 
ATOM   1397  C  "C5'" . U   A  1  75   ? 46.083  153.957 9.319   1.00 65.14  ? 75   U   0 "C5'" 1 
ATOM   1398  C  "C4'" . U   A  1  75   ? 45.883  152.488 9.620   1.00 66.51  ? 75   U   0 "C4'" 1 
ATOM   1399  O  "O4'" . U   A  1  75   ? 46.763  152.074 10.699  1.00 66.83  ? 75   U   0 "O4'" 1 
ATOM   1400  C  "C3'" . U   A  1  75   ? 44.499  152.084 10.102  1.00 66.62  ? 75   U   0 "C3'" 1 
ATOM   1401  O  "O3'" . U   A  1  75   ? 43.555  151.950 9.056   1.00 66.88  ? 75   U   0 "O3'" 1 
ATOM   1402  C  "C2'" . U   A  1  75   ? 44.785  150.765 10.798  1.00 67.57  ? 75   U   0 "C2'" 1 
ATOM   1403  O  "O2'" . U   A  1  75   ? 44.966  149.692 9.896   1.00 67.62  ? 75   U   0 "O2'" 1 
ATOM   1404  C  "C1'" . U   A  1  75   ? 46.112  151.086 11.489  1.00 67.85  ? 75   U   0 "C1'" 1 
ATOM   1405  N  N1    . U   A  1  75   ? 45.891  151.630 12.842  1.00 68.19  ? 75   U   0 N1    1 
ATOM   1406  C  C2    . U   A  1  75   ? 45.795  150.729 13.897  1.00 68.43  ? 75   U   0 C2    1 
ATOM   1407  O  O2    . U   A  1  75   ? 45.899  149.514 13.752  1.00 69.01  ? 75   U   0 O2    1 
ATOM   1408  N  N3    . U   A  1  75   ? 45.567  151.302 15.128  1.00 67.24  ? 75   U   0 N3    1 
ATOM   1409  C  C4    . U   A  1  75   ? 45.421  152.646 15.406  1.00 66.11  ? 75   U   0 C4    1 
ATOM   1410  O  O4    . U   A  1  75   ? 45.189  153.006 16.561  1.00 64.69  ? 75   U   0 O4    1 
ATOM   1411  C  C5    . U   A  1  75   ? 45.539  153.505 14.271  1.00 66.66  ? 75   U   0 C5    1 
ATOM   1412  C  C6    . U   A  1  75   ? 45.766  152.985 13.062  1.00 66.99  ? 75   U   0 C6    1 
ATOM   1413  P  P     . G   A  1  76   ? 42.012  152.306 9.335   1.00 71.15  ? 76   G   0 P     1 
ATOM   1414  O  OP1   . G   A  1  76   ? 41.319  152.262 8.015   1.00 71.03  ? 76   G   0 OP1   1 
ATOM   1415  O  OP2   . G   A  1  76   ? 41.931  153.546 10.162  1.00 68.66  ? 76   G   0 OP2   1 
ATOM   1416  O  "O5'" . G   A  1  76   ? 41.492  151.083 10.216  1.00 69.37  ? 76   G   0 "O5'" 1 
ATOM   1417  C  "C5'" . G   A  1  76   ? 41.405  149.763 9.651   1.00 71.79  ? 76   G   0 "C5'" 1 
ATOM   1418  C  "C4'" . G   A  1  76   ? 41.195  148.724 10.732  1.00 73.15  ? 76   G   0 "C4'" 1 
ATOM   1419  O  "O4'" . G   A  1  76   ? 42.322  148.744 11.652  1.00 72.30  ? 76   G   0 "O4'" 1 
ATOM   1420  C  "C3'" . G   A  1  76   ? 39.990  148.895 11.645  1.00 73.19  ? 76   G   0 "C3'" 1 
ATOM   1421  O  "O3'" . G   A  1  76   ? 38.767  148.463 11.066  1.00 74.40  ? 76   G   0 "O3'" 1 
ATOM   1422  C  "C2'" . G   A  1  76   ? 40.388  148.035 12.831  1.00 72.15  ? 76   G   0 "C2'" 1 
ATOM   1423  O  "O2'" . G   A  1  76   ? 40.244  146.656 12.567  1.00 72.00  ? 76   G   0 "O2'" 1 
ATOM   1424  C  "C1'" . G   A  1  76   ? 41.874  148.384 12.951  1.00 71.80  ? 76   G   0 "C1'" 1 
ATOM   1425  N  N9    . G   A  1  76   ? 42.057  149.523 13.851  1.00 70.35  ? 76   G   0 N9    1 
ATOM   1426  C  C8    . G   A  1  76   ? 42.414  150.814 13.535  1.00 68.44  ? 76   G   0 C8    1 
ATOM   1427  N  N7    . G   A  1  76   ? 42.440  151.605 14.573  1.00 67.59  ? 76   G   0 N7    1 
ATOM   1428  C  C5    . G   A  1  76   ? 42.089  150.785 15.638  1.00 67.57  ? 76   G   0 C5    1 
ATOM   1429  C  C6    . G   A  1  76   ? 41.936  151.077 17.017  1.00 66.21  ? 76   G   0 C6    1 
ATOM   1430  O  O6    . G   A  1  76   ? 42.079  152.160 17.596  1.00 63.97  ? 76   G   0 O6    1 
ATOM   1431  N  N1    . G   A  1  76   ? 41.568  149.946 17.739  1.00 67.13  ? 76   G   0 N1    1 
ATOM   1432  C  C2    . G   A  1  76   ? 41.368  148.694 17.202  1.00 68.06  ? 76   G   0 C2    1 
ATOM   1433  N  N2    . G   A  1  76   ? 41.012  147.719 18.045  1.00 67.72  ? 76   G   0 N2    1 
ATOM   1434  N  N3    . G   A  1  76   ? 41.505  148.415 15.927  1.00 68.62  ? 76   G   0 N3    1 
ATOM   1435  C  C4    . G   A  1  76   ? 41.863  149.497 15.208  1.00 68.87  ? 76   G   0 C4    1 
ATOM   1436  P  P     . G   A  1  77   ? 37.408  149.264 11.399  1.00 77.46  ? 77   G   0 P     1 
ATOM   1437  O  OP1   . G   A  1  77   ? 36.397  148.823 10.407  1.00 77.35  ? 77   G   0 OP1   1 
ATOM   1438  O  OP2   . G   A  1  77   ? 37.711  150.716 11.548  1.00 75.32  ? 77   G   0 OP2   1 
ATOM   1439  O  "O5'" . G   A  1  77   ? 36.972  148.732 12.837  1.00 76.02  ? 77   G   0 "O5'" 1 
ATOM   1440  C  "C5'" . G   A  1  77   ? 36.843  147.328 13.096  1.00 73.27  ? 77   G   0 "C5'" 1 
ATOM   1441  C  "C4'" . G   A  1  77   ? 36.853  147.068 14.581  1.00 71.74  ? 77   G   0 "C4'" 1 
ATOM   1442  O  "O4'" . G   A  1  77   ? 38.092  147.567 15.153  1.00 72.40  ? 77   G   0 "O4'" 1 
ATOM   1443  C  "C3'" . G   A  1  77   ? 35.794  147.770 15.413  1.00 71.09  ? 77   G   0 "C3'" 1 
ATOM   1444  O  "O3'" . G   A  1  77   ? 34.531  147.121 15.351  1.00 69.76  ? 77   G   0 "O3'" 1 
ATOM   1445  C  "C2'" . G   A  1  77   ? 36.394  147.669 16.808  1.00 72.18  ? 77   G   0 "C2'" 1 
ATOM   1446  O  "O2'" . G   A  1  77   ? 36.245  146.381 17.376  1.00 73.39  ? 77   G   0 "O2'" 1 
ATOM   1447  C  "C1'" . G   A  1  77   ? 37.875  147.917 16.515  1.00 72.11  ? 77   G   0 "C1'" 1 
ATOM   1448  N  N9    . G   A  1  77   ? 38.249  149.314 16.728  1.00 71.55  ? 77   G   0 N9    1 
ATOM   1449  C  C8    . G   A  1  77   ? 38.565  150.258 15.779  1.00 70.58  ? 77   G   0 C8    1 
ATOM   1450  N  N7    . G   A  1  77   ? 38.826  151.431 16.291  1.00 70.34  ? 77   G   0 N7    1 
ATOM   1451  C  C5    . G   A  1  77   ? 38.680  151.251 17.661  1.00 70.61  ? 77   G   0 C5    1 
ATOM   1452  C  C6    . G   A  1  77   ? 38.822  152.175 18.735  1.00 70.32  ? 77   G   0 C6    1 
ATOM   1453  O  O6    . G   A  1  77   ? 39.103  153.378 18.691  1.00 70.82  ? 77   G   0 O6    1 
ATOM   1454  N  N1    . G   A  1  77   ? 38.584  151.570 19.961  1.00 69.74  ? 77   G   0 N1    1 
ATOM   1455  C  C2    . G   A  1  77   ? 38.245  150.256 20.141  1.00 69.90  ? 77   G   0 C2    1 
ATOM   1456  N  N2    . G   A  1  77   ? 38.050  149.867 21.409  1.00 69.56  ? 77   G   0 N2    1 
ATOM   1457  N  N3    . G   A  1  77   ? 38.104  149.387 19.154  1.00 70.04  ? 77   G   0 N3    1 
ATOM   1458  C  C4    . G   A  1  77   ? 38.334  149.950 17.949  1.00 70.88  ? 77   G   0 C4    1 
ATOM   1459  P  P     . G   A  1  78   ? 33.188  147.958 15.648  1.00 70.52  ? 78   G   0 P     1 
ATOM   1460  O  OP1   . G   A  1  78   ? 32.087  146.980 15.858  1.00 71.07  ? 78   G   0 OP1   1 
ATOM   1461  O  OP2   . G   A  1  78   ? 33.044  149.013 14.611  1.00 70.98  ? 78   G   0 OP2   1 
ATOM   1462  O  "O5'" . G   A  1  78   ? 33.476  148.704 17.026  1.00 68.83  ? 78   G   0 "O5'" 1 
ATOM   1463  C  "C5'" . G   A  1  78   ? 33.452  148.008 18.286  1.00 64.45  ? 78   G   0 "C5'" 1 
ATOM   1464  C  "C4'" . G   A  1  78   ? 33.542  149.003 19.416  1.00 62.83  ? 78   G   0 "C4'" 1 
ATOM   1465  O  "O4'" . G   A  1  78   ? 34.813  149.701 19.347  1.00 63.09  ? 78   G   0 "O4'" 1 
ATOM   1466  C  "C3'" . G   A  1  78   ? 32.498  150.101 19.350  1.00 62.02  ? 78   G   0 "C3'" 1 
ATOM   1467  O  "O3'" . G   A  1  78   ? 31.296  149.655 19.962  1.00 61.45  ? 78   G   0 "O3'" 1 
ATOM   1468  C  "C2'" . G   A  1  78   ? 33.164  151.254 20.092  1.00 62.21  ? 78   G   0 "C2'" 1 
ATOM   1469  O  "O2'" . G   A  1  78   ? 33.039  151.153 21.496  1.00 61.76  ? 78   G   0 "O2'" 1 
ATOM   1470  C  "C1'" . G   A  1  78   ? 34.634  151.064 19.696  1.00 63.68  ? 78   G   0 "C1'" 1 
ATOM   1471  N  N9    . G   A  1  78   ? 35.113  151.885 18.583  1.00 66.02  ? 78   G   0 N9    1 
ATOM   1472  C  C8    . G   A  1  78   ? 35.131  151.541 17.251  1.00 66.12  ? 78   G   0 C8    1 
ATOM   1473  N  N7    . G   A  1  78   ? 35.654  152.463 16.489  1.00 66.71  ? 78   G   0 N7    1 
ATOM   1474  C  C5    . G   A  1  78   ? 35.997  153.484 17.366  1.00 67.19  ? 78   G   0 C5    1 
ATOM   1475  C  C6    . G   A  1  78   ? 36.612  154.742 17.119  1.00 67.97  ? 78   G   0 C6    1 
ATOM   1476  O  O6    . G   A  1  78   ? 36.993  155.218 16.043  1.00 68.61  ? 78   G   0 O6    1 
ATOM   1477  N  N1    . G   A  1  78   ? 36.773  155.471 18.292  1.00 68.55  ? 78   G   0 N1    1 
ATOM   1478  C  C2    . G   A  1  78   ? 36.401  155.049 19.542  1.00 67.41  ? 78   G   0 C2    1 
ATOM   1479  N  N2    . G   A  1  78   ? 36.638  155.908 20.544  1.00 66.26  ? 78   G   0 N2    1 
ATOM   1480  N  N3    . G   A  1  78   ? 35.836  153.877 19.790  1.00 67.38  ? 78   G   0 N3    1 
ATOM   1481  C  C4    . G   A  1  78   ? 35.663  153.150 18.662  1.00 66.88  ? 78   G   0 C4    1 
ATOM   1482  P  P     . G   A  1  79   ? 29.878  150.159 19.405  1.00 62.73  ? 79   G   0 P     1 
ATOM   1483  O  OP1   . G   A  1  79   ? 28.812  149.340 20.048  1.00 62.54  ? 79   G   0 OP1   1 
ATOM   1484  O  OP2   . G   A  1  79   ? 29.976  150.208 17.917  1.00 64.11  ? 79   G   0 OP2   1 
ATOM   1485  O  "O5'" . G   A  1  79   ? 29.748  151.634 19.988  1.00 58.78  ? 79   G   0 "O5'" 1 
ATOM   1486  C  "C5'" . G   A  1  79   ? 29.779  151.859 21.408  1.00 56.68  ? 79   G   0 "C5'" 1 
ATOM   1487  C  "C4'" . G   A  1  79   ? 30.096  153.300 21.699  1.00 55.09  ? 79   G   0 "C4'" 1 
ATOM   1488  O  "O4'" . G   A  1  79   ? 31.405  153.619 21.173  1.00 55.61  ? 79   G   0 "O4'" 1 
ATOM   1489  C  "C3'" . G   A  1  79   ? 29.161  154.301 21.050  1.00 54.99  ? 79   G   0 "C3'" 1 
ATOM   1490  O  "O3'" . G   A  1  79   ? 27.997  154.451 21.862  1.00 55.09  ? 79   G   0 "O3'" 1 
ATOM   1491  C  "C2'" . G   A  1  79   ? 30.033  155.547 20.952  1.00 55.18  ? 79   G   0 "C2'" 1 
ATOM   1492  O  "O2'" . G   A  1  79   ? 30.133  156.244 22.174  1.00 55.42  ? 79   G   0 "O2'" 1 
ATOM   1493  C  "C1'" . G   A  1  79   ? 31.402  154.935 20.650  1.00 55.98  ? 79   G   0 "C1'" 1 
ATOM   1494  N  N9    . G   A  1  79   ? 31.774  154.858 19.239  1.00 57.90  ? 79   G   0 N9    1 
ATOM   1495  C  C8    . G   A  1  79   ? 31.333  153.944 18.312  1.00 58.68  ? 79   G   0 C8    1 
ATOM   1496  N  N7    . G   A  1  79   ? 31.905  154.079 17.145  1.00 59.87  ? 79   G   0 N7    1 
ATOM   1497  C  C5    . G   A  1  79   ? 32.764  155.159 17.304  1.00 59.69  ? 79   G   0 C5    1 
ATOM   1498  C  C6    . G   A  1  79   ? 33.664  155.766 16.383  1.00 59.66  ? 79   G   0 C6    1 
ATOM   1499  O  O6    . G   A  1  79   ? 33.898  155.453 15.207  1.00 59.29  ? 79   G   0 O6    1 
ATOM   1500  N  N1    . G   A  1  79   ? 34.338  156.836 16.960  1.00 60.55  ? 79   G   0 N1    1 
ATOM   1501  C  C2    . G   A  1  79   ? 34.178  157.268 18.254  1.00 61.35  ? 79   G   0 C2    1 
ATOM   1502  N  N2    . G   A  1  79   ? 34.929  158.320 18.628  1.00 61.38  ? 79   G   0 N2    1 
ATOM   1503  N  N3    . G   A  1  79   ? 33.349  156.710 19.121  1.00 60.95  ? 79   G   0 N3    1 
ATOM   1504  C  C4    . G   A  1  79   ? 32.680  155.666 18.584  1.00 59.33  ? 79   G   0 C4    1 
ATOM   1505  P  P     . A   A  1  80   ? 26.929  155.608 21.547  1.00 56.82  ? 80   A   0 P     1 
ATOM   1506  O  OP1   . A   A  1  80   ? 25.597  155.182 22.049  1.00 55.61  ? 80   A   0 OP1   1 
ATOM   1507  O  OP2   . A   A  1  80   ? 27.083  155.998 20.121  1.00 59.04  ? 80   A   0 OP2   1 
ATOM   1508  O  "O5'" . A   A  1  80   ? 27.425  156.833 22.436  1.00 55.95  ? 80   A   0 "O5'" 1 
ATOM   1509  C  "C5'" . A   A  1  80   ? 27.627  156.685 23.851  1.00 53.85  ? 80   A   0 "C5'" 1 
ATOM   1510  C  "C4'" . A   A  1  80   ? 28.057  157.998 24.465  1.00 53.58  ? 80   A   0 "C4'" 1 
ATOM   1511  O  "O4'" . A   A  1  80   ? 29.326  158.416 23.889  1.00 53.29  ? 80   A   0 "O4'" 1 
ATOM   1512  C  "C3'" . A   A  1  80   ? 27.108  159.175 24.280  1.00 51.59  ? 80   A   0 "C3'" 1 
ATOM   1513  O  "O3'" . A   A  1  80   ? 27.243  160.039 25.395  1.00 53.54  ? 80   A   0 "O3'" 1 
ATOM   1514  C  "C2'" . A   A  1  80   ? 27.705  159.889 23.076  1.00 52.38  ? 80   A   0 "C2'" 1 
ATOM   1515  O  "O2'" . A   A  1  80   ? 27.368  161.258 23.028  1.00 53.36  ? 80   A   0 "O2'" 1 
ATOM   1516  C  "C1'" . A   A  1  80   ? 29.194  159.719 23.357  1.00 52.97  ? 80   A   0 "C1'" 1 
ATOM   1517  N  N9    . A   A  1  80   ? 30.073  159.832 22.196  1.00 53.02  ? 80   A   0 N9    1 
ATOM   1518  C  C8    . A   A  1  80   ? 29.915  159.283 20.951  1.00 53.43  ? 80   A   0 C8    1 
ATOM   1519  N  N7    . A   A  1  80   ? 30.901  159.543 20.130  1.00 53.22  ? 80   A   0 N7    1 
ATOM   1520  C  C5    . A   A  1  80   ? 31.764  160.324 20.881  1.00 53.19  ? 80   A   0 C5    1 
ATOM   1521  C  C6    . A   A  1  80   ? 32.998  160.917 20.583  1.00 53.02  ? 80   A   0 C6    1 
ATOM   1522  N  N6    . A   A  1  80   ? 33.595  160.814 19.395  1.00 52.81  ? 80   A   0 N6    1 
ATOM   1523  N  N1    . A   A  1  80   ? 33.607  161.629 21.557  1.00 52.99  ? 80   A   0 N1    1 
ATOM   1524  C  C2    . A   A  1  80   ? 33.001  161.736 22.744  1.00 54.20  ? 80   A   0 C2    1 
ATOM   1525  N  N3    . A   A  1  80   ? 31.837  161.227 23.145  1.00 55.34  ? 80   A   0 N3    1 
ATOM   1526  C  C4    . A   A  1  80   ? 31.263  160.519 22.154  1.00 54.21  ? 80   A   0 C4    1 
ATOM   1527  P  P     . G   A  1  81   ? 26.367  159.789 26.710  1.00 56.37  ? 81   G   0 P     1 
ATOM   1528  O  OP1   . G   A  1  81   ? 25.144  159.031 26.319  1.00 55.94  ? 81   G   0 OP1   1 
ATOM   1529  O  OP2   . G   A  1  81   ? 26.239  161.082 27.420  1.00 52.60  ? 81   G   0 OP2   1 
ATOM   1530  O  "O5'" . G   A  1  81   ? 27.270  158.804 27.577  1.00 57.40  ? 81   G   0 "O5'" 1 
ATOM   1531  C  "C5'" . G   A  1  81   ? 28.362  159.295 28.381  1.00 56.03  ? 81   G   0 "C5'" 1 
ATOM   1532  C  "C4'" . G   A  1  81   ? 29.682  158.937 27.735  1.00 54.87  ? 81   G   0 "C4'" 1 
ATOM   1533  O  "O4'" . G   A  1  81   ? 29.848  159.721 26.517  1.00 53.11  ? 81   G   0 "O4'" 1 
ATOM   1534  C  "C3'" . G   A  1  81   ? 30.927  159.247 28.553  1.00 52.94  ? 81   G   0 "C3'" 1 
ATOM   1535  O  "O3'" . G   A  1  81   ? 31.222  158.217 29.492  1.00 52.40  ? 81   G   0 "O3'" 1 
ATOM   1536  C  "C2'" . G   A  1  81   ? 31.975  159.403 27.464  1.00 51.61  ? 81   G   0 "C2'" 1 
ATOM   1537  O  "O2'" . G   A  1  81   ? 32.353  158.164 26.897  1.00 51.63  ? 81   G   0 "O2'" 1 
ATOM   1538  C  "C1'" . G   A  1  81   ? 31.179  160.209 26.436  1.00 50.47  ? 81   G   0 "C1'" 1 
ATOM   1539  N  N9    . G   A  1  81   ? 31.163  161.628 26.792  1.00 48.07  ? 81   G   0 N9    1 
ATOM   1540  C  C8    . G   A  1  81   ? 30.090  162.361 27.239  1.00 45.87  ? 81   G   0 C8    1 
ATOM   1541  N  N7    . G   A  1  81   ? 30.400  163.593 27.537  1.00 45.10  ? 81   G   0 N7    1 
ATOM   1542  C  C5    . G   A  1  81   ? 31.756  163.684 27.261  1.00 45.75  ? 81   G   0 C5    1 
ATOM   1543  C  C6    . G   A  1  81   ? 32.654  164.778 27.403  1.00 47.50  ? 81   G   0 C6    1 
ATOM   1544  O  O6    . G   A  1  81   ? 32.419  165.923 27.829  1.00 50.40  ? 81   G   0 O6    1 
ATOM   1545  N  N1    . G   A  1  81   ? 33.941  164.439 26.996  1.00 44.47  ? 81   G   0 N1    1 
ATOM   1546  C  C2    . G   A  1  81   ? 34.317  163.208 26.517  1.00 45.45  ? 81   G   0 C2    1 
ATOM   1547  N  N2    . G   A  1  81   ? 35.603  163.074 26.161  1.00 46.09  ? 81   G   0 N2    1 
ATOM   1548  N  N3    . G   A  1  81   ? 33.494  162.180 26.390  1.00 45.86  ? 81   G   0 N3    1 
ATOM   1549  C  C4    . G   A  1  81   ? 32.238  162.487 26.779  1.00 46.80  ? 81   G   0 C4    1 
ATOM   1550  P  P     . C   A  1  82   ? 31.708  158.605 30.979  1.00 51.46  ? 82   C   0 P     1 
ATOM   1551  O  OP1   . C   A  1  82   ? 31.532  157.389 31.814  1.00 51.75  ? 82   C   0 OP1   1 
ATOM   1552  O  OP2   . C   A  1  82   ? 31.044  159.873 31.384  1.00 47.08  ? 82   C   0 OP2   1 
ATOM   1553  O  "O5'" . C   A  1  82   ? 33.273  158.872 30.821  1.00 49.47  ? 82   C   0 "O5'" 1 
ATOM   1554  C  "C5'" . C   A  1  82   ? 34.111  157.980 30.052  1.00 49.80  ? 82   C   0 "C5'" 1 
ATOM   1555  C  "C4'" . C   A  1  82   ? 35.381  158.691 29.618  1.00 51.65  ? 82   C   0 "C4'" 1 
ATOM   1556  O  "O4'" . C   A  1  82   ? 35.041  159.855 28.814  1.00 51.74  ? 82   C   0 "O4'" 1 
ATOM   1557  C  "C3'" . C   A  1  82   ? 36.234  159.265 30.740  1.00 51.64  ? 82   C   0 "C3'" 1 
ATOM   1558  O  "O3'" . C   A  1  82   ? 37.085  158.279 31.315  1.00 52.90  ? 82   C   0 "O3'" 1 
ATOM   1559  C  "C2'" . C   A  1  82   ? 37.020  160.366 30.037  1.00 48.94  ? 82   C   0 "C2'" 1 
ATOM   1560  O  "O2'" . C   A  1  82   ? 38.130  159.886 29.305  1.00 48.22  ? 82   C   0 "O2'" 1 
ATOM   1561  C  "C1'" . C   A  1  82   ? 35.968  160.904 29.067  1.00 47.49  ? 82   C   0 "C1'" 1 
ATOM   1562  N  N1    . C   A  1  82   ? 35.235  162.075 29.584  1.00 44.79  ? 82   C   0 N1    1 
ATOM   1563  C  C2    . C   A  1  82   ? 35.913  163.303 29.688  1.00 42.99  ? 82   C   0 C2    1 
ATOM   1564  O  O2    . C   A  1  82   ? 37.107  163.362 29.357  1.00 42.05  ? 82   C   0 O2    1 
ATOM   1565  N  N3    . C   A  1  82   ? 35.247  164.388 30.145  1.00 41.53  ? 82   C   0 N3    1 
ATOM   1566  C  C4    . C   A  1  82   ? 33.959  164.285 30.491  1.00 42.57  ? 82   C   0 C4    1 
ATOM   1567  N  N4    . C   A  1  82   ? 33.339  165.384 30.932  1.00 42.18  ? 82   C   0 N4    1 
ATOM   1568  C  C5    . C   A  1  82   ? 33.247  163.050 30.400  1.00 42.12  ? 82   C   0 C5    1 
ATOM   1569  C  C6    . C   A  1  82   ? 33.918  161.981 29.949  1.00 43.16  ? 82   C   0 C6    1 
ATOM   1570  P  P     . C   A  1  83   ? 37.561  158.438 32.837  1.00 51.65  ? 83   C   0 P     1 
ATOM   1571  O  OP1   . C   A  1  83   ? 38.302  157.198 33.150  1.00 54.01  ? 83   C   0 OP1   1 
ATOM   1572  O  OP2   . C   A  1  83   ? 36.395  158.841 33.671  1.00 51.76  ? 83   C   0 OP2   1 
ATOM   1573  O  "O5'" . C   A  1  83   ? 38.587  159.654 32.808  1.00 53.13  ? 83   C   0 "O5'" 1 
ATOM   1574  C  "C5'" . C   A  1  83   ? 39.911  159.491 32.262  1.00 53.28  ? 83   C   0 "C5'" 1 
ATOM   1575  C  "C4'" . C   A  1  83   ? 40.712  160.759 32.444  1.00 52.50  ? 83   C   0 "C4'" 1 
ATOM   1576  O  "O4'" . C   A  1  83   ? 40.063  161.845 31.733  1.00 53.29  ? 83   C   0 "O4'" 1 
ATOM   1577  C  "C3'" . C   A  1  83   ? 40.818  161.275 33.869  1.00 53.09  ? 83   C   0 "C3'" 1 
ATOM   1578  O  "O3'" . C   A  1  83   ? 41.842  160.598 34.590  1.00 53.15  ? 83   C   0 "O3'" 1 
ATOM   1579  C  "C2'" . C   A  1  83   ? 41.151  162.744 33.650  1.00 52.91  ? 83   C   0 "C2'" 1 
ATOM   1580  O  "O2'" . C   A  1  83   ? 42.505  162.952 33.320  1.00 52.87  ? 83   C   0 "O2'" 1 
ATOM   1581  C  "C1'" . C   A  1  83   ? 40.299  163.066 32.421  1.00 52.38  ? 83   C   0 "C1'" 1 
ATOM   1582  N  N1    . C   A  1  83   ? 39.009  163.701 32.758  1.00 50.27  ? 83   C   0 N1    1 
ATOM   1583  C  C2    . C   A  1  83   ? 38.992  165.077 32.999  1.00 49.62  ? 83   C   0 C2    1 
ATOM   1584  O  O2    . C   A  1  83   ? 40.050  165.712 32.912  1.00 50.37  ? 83   C   0 O2    1 
ATOM   1585  N  N3    . C   A  1  83   ? 37.828  165.682 33.321  1.00 48.57  ? 83   C   0 N3    1 
ATOM   1586  C  C4    . C   A  1  83   ? 36.706  164.967 33.401  1.00 48.84  ? 83   C   0 C4    1 
ATOM   1587  N  N4    . C   A  1  83   ? 35.579  165.613 33.719  1.00 49.61  ? 83   C   0 N4    1 
ATOM   1588  C  C5    . C   A  1  83   ? 36.688  163.562 33.157  1.00 48.50  ? 83   C   0 C5    1 
ATOM   1589  C  C6    . C   A  1  83   ? 37.853  162.974 32.841  1.00 49.88  ? 83   C   0 C6    1 
ATOM   1590  P  P     . G   A  1  84   ? 41.549  160.025 36.067  1.00 52.49  ? 84   G   0 P     1 
ATOM   1591  O  OP1   . G   A  1  84   ? 40.085  159.970 36.325  1.00 50.39  ? 84   G   0 OP1   1 
ATOM   1592  O  OP2   . G   A  1  84   ? 42.424  160.763 37.013  1.00 51.75  ? 84   G   0 OP2   1 
ATOM   1593  O  "O5'" . G   A  1  84   ? 42.065  158.523 35.968  1.00 52.02  ? 84   G   0 "O5'" 1 
ATOM   1594  C  "C5'" . G   A  1  84   ? 41.435  157.580 35.079  1.00 51.51  ? 84   G   0 "C5'" 1 
ATOM   1595  C  "C4'" . G   A  1  84   ? 41.711  156.170 35.536  1.00 51.90  ? 84   G   0 "C4'" 1 
ATOM   1596  O  "O4'" . G   A  1  84   ? 43.129  155.884 35.420  1.00 52.16  ? 84   G   0 "O4'" 1 
ATOM   1597  C  "C3'" . G   A  1  84   ? 41.388  155.907 36.994  1.00 52.42  ? 84   G   0 "C3'" 1 
ATOM   1598  O  "O3'" . G   A  1  84   ? 40.020  155.586 37.162  1.00 55.66  ? 84   G   0 "O3'" 1 
ATOM   1599  C  "C2'" . G   A  1  84   ? 42.296  154.737 37.315  1.00 52.55  ? 84   G   0 "C2'" 1 
ATOM   1600  O  "O2'" . G   A  1  84   ? 41.772  153.540 36.785  1.00 54.51  ? 84   G   0 "O2'" 1 
ATOM   1601  C  "C1'" . G   A  1  84   ? 43.556  155.119 36.535  1.00 52.44  ? 84   G   0 "C1'" 1 
ATOM   1602  N  N9    . G   A  1  84   ? 44.507  155.925 37.302  1.00 53.13  ? 84   G   0 N9    1 
ATOM   1603  C  C8    . G   A  1  84   ? 44.810  157.253 37.110  1.00 53.00  ? 84   G   0 C8    1 
ATOM   1604  N  N7    . G   A  1  84   ? 45.704  157.705 37.945  1.00 52.12  ? 84   G   0 N7    1 
ATOM   1605  C  C5    . G   A  1  84   ? 46.013  156.612 38.740  1.00 54.01  ? 84   G   0 C5    1 
ATOM   1606  C  C6    . G   A  1  84   ? 46.921  156.494 39.819  1.00 54.38  ? 84   G   0 C6    1 
ATOM   1607  O  O6    . G   A  1  84   ? 47.663  157.357 40.300  1.00 55.22  ? 84   G   0 O6    1 
ATOM   1608  N  N1    . G   A  1  84   ? 46.920  155.211 40.347  1.00 53.53  ? 84   G   0 N1    1 
ATOM   1609  C  C2    . G   A  1  84   ? 46.151  154.172 39.895  1.00 52.46  ? 84   G   0 C2    1 
ATOM   1610  N  N2    . G   A  1  84   ? 46.299  153.010 40.539  1.00 52.17  ? 84   G   0 N2    1 
ATOM   1611  N  N3    . G   A  1  84   ? 45.302  154.265 38.889  1.00 52.97  ? 84   G   0 N3    1 
ATOM   1612  C  C4    . G   A  1  84   ? 45.283  155.505 38.360  1.00 53.65  ? 84   G   0 C4    1 
ATOM   1613  P  P     . C   A  1  85   ? 39.304  155.889 38.564  1.00 59.02  ? 85   C   0 P     1 
ATOM   1614  O  OP1   . C   A  1  85   ? 37.878  155.495 38.430  1.00 59.24  ? 85   C   0 OP1   1 
ATOM   1615  O  OP2   . C   A  1  85   ? 39.646  157.277 38.977  1.00 58.85  ? 85   C   0 OP2   1 
ATOM   1616  O  "O5'" . C   A  1  85   ? 40.009  154.881 39.573  1.00 60.56  ? 85   C   0 "O5'" 1 
ATOM   1617  C  "C5'" . C   A  1  85   ? 39.911  153.460 39.383  1.00 62.49  ? 85   C   0 "C5'" 1 
ATOM   1618  C  "C4'" . C   A  1  85   ? 40.606  152.735 40.509  1.00 65.26  ? 85   C   0 "C4'" 1 
ATOM   1619  O  "O4'" . C   A  1  85   ? 42.042  152.943 40.424  1.00 64.66  ? 85   C   0 "O4'" 1 
ATOM   1620  C  "C3'" . C   A  1  85   ? 40.241  153.202 41.910  1.00 65.78  ? 85   C   0 "C3'" 1 
ATOM   1621  O  "O3'" . C   A  1  85   ? 39.018  152.623 42.357  1.00 67.63  ? 85   C   0 "O3'" 1 
ATOM   1622  C  "C2'" . C   A  1  85   ? 41.446  152.747 42.721  1.00 65.73  ? 85   C   0 "C2'" 1 
ATOM   1623  O  "O2'" . C   A  1  85   ? 41.406  151.370 43.032  1.00 65.93  ? 85   C   0 "O2'" 1 
ATOM   1624  C  "C1'" . C   A  1  85   ? 42.588  153.005 41.733  1.00 65.32  ? 85   C   0 "C1'" 1 
ATOM   1625  N  N1    . C   A  1  85   ? 43.240  154.316 41.912  1.00 66.34  ? 85   C   0 N1    1 
ATOM   1626  C  C2    . C   A  1  85   ? 44.279  154.433 42.851  1.00 66.89  ? 85   C   0 C2    1 
ATOM   1627  O  O2    . C   A  1  85   ? 44.605  153.435 43.519  1.00 68.65  ? 85   C   0 O2    1 
ATOM   1628  N  N3    . C   A  1  85   ? 44.899  155.629 43.007  1.00 65.80  ? 85   C   0 N3    1 
ATOM   1629  C  C4    . C   A  1  85   ? 44.517  156.679 42.279  1.00 64.54  ? 85   C   0 C4    1 
ATOM   1630  N  N4    . C   A  1  85   ? 45.160  157.831 42.462  1.00 63.22  ? 85   C   0 N4    1 
ATOM   1631  C  C5    . C   A  1  85   ? 43.457  156.593 41.328  1.00 65.35  ? 85   C   0 C5    1 
ATOM   1632  C  C6    . C   A  1  85   ? 42.852  155.406 41.179  1.00 66.46  ? 85   C   0 C6    1 
ATOM   1633  P  P     . A   A  1  86   ? 38.155  153.359 43.498  1.00 69.88  ? 86   A   0 P     1 
ATOM   1634  O  OP1   . A   A  1  86   ? 38.908  153.212 44.770  1.00 70.40  ? 86   A   0 OP1   1 
ATOM   1635  O  OP2   . A   A  1  86   ? 36.752  152.876 43.419  1.00 69.14  ? 86   A   0 OP2   1 
ATOM   1636  O  "O5'" . A   A  1  86   ? 38.182  154.894 43.069  1.00 70.39  ? 86   A   0 "O5'" 1 
ATOM   1637  C  "C5'" . A   A  1  86   ? 37.201  155.827 43.566  1.00 71.17  ? 86   A   0 "C5'" 1 
ATOM   1638  C  "C4'" . A   A  1  86   ? 37.712  157.244 43.437  1.00 72.87  ? 86   A   0 "C4'" 1 
ATOM   1639  O  "O4'" . A   A  1  86   ? 38.777  157.472 44.400  1.00 72.98  ? 86   A   0 "O4'" 1 
ATOM   1640  C  "C3'" . A   A  1  86   ? 38.296  157.615 42.077  1.00 73.84  ? 86   A   0 "C3'" 1 
ATOM   1641  O  "O3'" . A   A  1  86   ? 38.120  159.011 41.867  1.00 78.06  ? 86   A   0 "O3'" 1 
ATOM   1642  C  "C2'" . A   A  1  86   ? 39.782  157.367 42.286  1.00 72.83  ? 86   A   0 "C2'" 1 
ATOM   1643  O  "O2'" . A   A  1  86   ? 40.578  158.118 41.398  1.00 72.91  ? 86   A   0 "O2'" 1 
ATOM   1644  C  "C1'" . A   A  1  86   ? 39.952  157.869 43.719  1.00 72.22  ? 86   A   0 "C1'" 1 
ATOM   1645  N  N9    . A   A  1  86   ? 41.108  157.344 44.447  1.00 71.38  ? 86   A   0 N9    1 
ATOM   1646  C  C8    . A   A  1  86   ? 41.339  156.057 44.871  1.00 70.96  ? 86   A   0 C8    1 
ATOM   1647  N  N7    . A   A  1  86   ? 42.458  155.915 45.538  1.00 70.97  ? 86   A   0 N7    1 
ATOM   1648  C  C5    . A   A  1  86   ? 43.003  157.191 45.550  1.00 70.62  ? 86   A   0 C5    1 
ATOM   1649  C  C6    . A   A  1  86   ? 44.179  157.711 46.114  1.00 70.22  ? 86   A   0 C6    1 
ATOM   1650  N  N6    . A   A  1  86   ? 45.047  156.982 46.821  1.00 70.31  ? 86   A   0 N6    1 
ATOM   1651  N  N1    . A   A  1  86   ? 44.434  159.024 45.933  1.00 70.47  ? 86   A   0 N1    1 
ATOM   1652  C  C2    . A   A  1  86   ? 43.556  159.757 45.239  1.00 70.59  ? 86   A   0 C2    1 
ATOM   1653  N  N3    . A   A  1  86   ? 42.412  159.387 44.673  1.00 70.43  ? 86   A   0 N3    1 
ATOM   1654  C  C4    . A   A  1  86   ? 42.190  158.077 44.868  1.00 70.53  ? 86   A   0 C4    1 
ATOM   1655  P  P     . C   A  1  87   ? 36.960  159.539 40.893  1.00 81.58  ? 87   C   0 P     1 
ATOM   1656  O  OP1   . C   A  1  87   ? 36.529  158.433 39.991  1.00 80.48  ? 87   C   0 OP1   1 
ATOM   1657  O  OP2   . C   A  1  87   ? 37.437  160.826 40.307  1.00 78.67  ? 87   C   0 OP2   1 
ATOM   1658  O  "O5'" . C   A  1  87   ? 35.755  159.865 41.881  1.00 81.55  ? 87   C   0 "O5'" 1 
ATOM   1659  C  "C5'" . C   A  1  87   ? 34.568  160.477 41.371  1.00 84.89  ? 87   C   0 "C5'" 1 
ATOM   1660  C  "C4'" . C   A  1  87   ? 33.505  160.570 42.436  1.00 86.21  ? 87   C   0 "C4'" 1 
ATOM   1661  O  "O4'" . C   A  1  87   ? 33.184  159.236 42.914  1.00 87.45  ? 87   C   0 "O4'" 1 
ATOM   1662  C  "C3'" . C   A  1  87   ? 33.810  161.404 43.679  1.00 85.61  ? 87   C   0 "C3'" 1 
ATOM   1663  O  "O3'" . C   A  1  87   ? 32.692  162.251 43.913  1.00 83.58  ? 87   C   0 "O3'" 1 
ATOM   1664  C  "C2'" . C   A  1  87   ? 33.911  160.352 44.789  1.00 87.15  ? 87   C   0 "C2'" 1 
ATOM   1665  O  "O2'" . C   A  1  87   ? 33.500  160.831 46.054  1.00 86.40  ? 87   C   0 "O2'" 1 
ATOM   1666  C  "C1'" . C   A  1  87   ? 32.923  159.303 44.293  1.00 88.53  ? 87   C   0 "C1'" 1 
ATOM   1667  N  N1    . C   A  1  87   ? 33.066  157.950 44.864  1.00 91.37  ? 87   C   0 N1    1 
ATOM   1668  C  C2    . C   A  1  87   ? 31.911  157.282 45.313  1.00 92.85  ? 87   C   0 C2    1 
ATOM   1669  O  O2    . C   A  1  87   ? 30.809  157.855 45.235  1.00 93.82  ? 87   C   0 O2    1 
ATOM   1670  N  N3    . C   A  1  87   ? 32.027  156.033 45.822  1.00 93.71  ? 87   C   0 N3    1 
ATOM   1671  C  C4    . C   A  1  87   ? 33.227  155.452 45.900  1.00 93.61  ? 87   C   0 C4    1 
ATOM   1672  N  N4    . C   A  1  87   ? 33.290  154.219 46.407  1.00 93.91  ? 87   C   0 N4    1 
ATOM   1673  C  C5    . C   A  1  87   ? 34.415  156.110 45.462  1.00 93.34  ? 87   C   0 C5    1 
ATOM   1674  C  C6    . C   A  1  87   ? 34.290  157.344 44.955  1.00 92.19  ? 87   C   0 C6    1 
ATOM   1675  P  P     . G   A  1  88   ? 32.679  163.734 43.290  1.00 82.10  ? 88   G   0 P     1 
ATOM   1676  O  OP1   . G   A  1  88   ? 31.270  164.066 42.950  1.00 83.42  ? 88   G   0 OP1   1 
ATOM   1677  O  OP2   . G   A  1  88   ? 33.725  163.799 42.233  1.00 81.34  ? 88   G   0 OP2   1 
ATOM   1678  O  "O5'" . G   A  1  88   ? 33.125  164.668 44.500  1.00 80.76  ? 88   G   0 "O5'" 1 
ATOM   1679  C  "C5'" . G   A  1  88   ? 34.413  164.502 45.107  1.00 77.03  ? 88   G   0 "C5'" 1 
ATOM   1680  C  "C4'" . G   A  1  88   ? 34.810  165.739 45.876  1.00 73.91  ? 88   G   0 "C4'" 1 
ATOM   1681  O  "O4'" . G   A  1  88   ? 36.159  165.535 46.369  1.00 72.33  ? 88   G   0 "O4'" 1 
ATOM   1682  C  "C3'" . G   A  1  88   ? 34.855  167.038 45.077  1.00 73.71  ? 88   G   0 "C3'" 1 
ATOM   1683  O  "O3'" . G   A  1  88   ? 33.639  167.768 45.233  1.00 75.76  ? 88   G   0 "O3'" 1 
ATOM   1684  C  "C2'" . G   A  1  88   ? 36.053  167.770 45.669  1.00 71.13  ? 88   G   0 "C2'" 1 
ATOM   1685  O  "O2'" . G   A  1  88   ? 35.752  168.410 46.895  1.00 70.84  ? 88   G   0 "O2'" 1 
ATOM   1686  C  "C1'" . G   A  1  88   ? 36.989  166.598 45.951  1.00 68.28  ? 88   G   0 "C1'" 1 
ATOM   1687  N  N9    . G   A  1  88   ? 37.773  166.137 44.809  1.00 63.08  ? 88   G   0 N9    1 
ATOM   1688  C  C8    . G   A  1  88   ? 37.502  165.075 43.978  1.00 61.94  ? 88   G   0 C8    1 
ATOM   1689  N  N7    . G   A  1  88   ? 38.425  164.884 43.074  1.00 59.55  ? 88   G   0 N7    1 
ATOM   1690  C  C5    . G   A  1  88   ? 39.351  165.884 43.317  1.00 58.40  ? 88   G   0 C5    1 
ATOM   1691  C  C6    . G   A  1  88   ? 40.571  166.176 42.673  1.00 57.83  ? 88   G   0 C6    1 
ATOM   1692  O  O6    . G   A  1  88   ? 41.105  165.583 41.731  1.00 59.06  ? 88   G   0 O6    1 
ATOM   1693  N  N1    . G   A  1  88   ? 41.192  167.284 43.238  1.00 57.16  ? 88   G   0 N1    1 
ATOM   1694  C  C2    . G   A  1  88   ? 40.702  168.011 44.293  1.00 57.69  ? 88   G   0 C2    1 
ATOM   1695  N  N2    . G   A  1  88   ? 41.434  169.061 44.695  1.00 57.34  ? 88   G   0 N2    1 
ATOM   1696  N  N3    . G   A  1  88   ? 39.572  167.737 44.911  1.00 58.07  ? 88   G   0 N3    1 
ATOM   1697  C  C4    . G   A  1  88   ? 38.954  166.673 44.376  1.00 59.84  ? 88   G   0 C4    1 
ATOM   1698  P  P     . G   A  1  89   ? 33.175  168.818 44.103  1.00 77.15  ? 89   G   0 P     1 
ATOM   1699  O  OP1   . G   A  1  89   ? 31.892  169.386 44.598  1.00 76.17  ? 89   G   0 OP1   1 
ATOM   1700  O  OP2   . G   A  1  89   ? 33.226  168.150 42.768  1.00 75.63  ? 89   G   0 OP2   1 
ATOM   1701  O  "O5'" . G   A  1  89   ? 34.280  169.967 44.129  1.00 74.36  ? 89   G   0 "O5'" 1 
ATOM   1702  C  "C5'" . G   A  1  89   ? 34.245  171.015 45.119  1.00 72.70  ? 89   G   0 "C5'" 1 
ATOM   1703  C  "C4'" . G   A  1  89   ? 35.432  171.933 44.944  1.00 72.23  ? 89   G   0 "C4'" 1 
ATOM   1704  O  "O4'" . G   A  1  89   ? 36.653  171.152 45.079  1.00 70.86  ? 89   G   0 "O4'" 1 
ATOM   1705  C  "C3'" . G   A  1  89   ? 35.573  172.575 43.571  1.00 72.43  ? 89   G   0 "C3'" 1 
ATOM   1706  O  "O3'" . G   A  1  89   ? 34.755  173.723 43.390  1.00 74.08  ? 89   G   0 "O3'" 1 
ATOM   1707  C  "C2'" . G   A  1  89   ? 37.063  172.888 43.514  1.00 71.06  ? 89   G   0 "C2'" 1 
ATOM   1708  O  "O2'" . G   A  1  89   ? 37.445  174.038 44.248  1.00 70.32  ? 89   G   0 "O2'" 1 
ATOM   1709  C  "C1'" . G   A  1  89   ? 37.640  171.640 44.178  1.00 67.63  ? 89   G   0 "C1'" 1 
ATOM   1710  N  N9    . G   A  1  89   ? 37.938  170.595 43.202  1.00 62.07  ? 89   G   0 N9    1 
ATOM   1711  C  C8    . G   A  1  89   ? 37.138  169.540 42.826  1.00 60.38  ? 89   G   0 C8    1 
ATOM   1712  N  N7    . G   A  1  89   ? 37.699  168.764 41.938  1.00 59.24  ? 89   G   0 N7    1 
ATOM   1713  C  C5    . G   A  1  89   ? 38.941  169.344 41.714  1.00 57.69  ? 89   G   0 C5    1 
ATOM   1714  C  C6    . G   A  1  89   ? 40.002  168.944 40.867  1.00 56.67  ? 89   G   0 C6    1 
ATOM   1715  O  O6    . G   A  1  89   ? 40.063  167.964 40.120  1.00 56.72  ? 89   G   0 O6    1 
ATOM   1716  N  N1    . G   A  1  89   ? 41.077  169.819 40.948  1.00 55.72  ? 89   G   0 N1    1 
ATOM   1717  C  C2    . G   A  1  89   ? 41.123  170.938 41.741  1.00 57.70  ? 89   G   0 C2    1 
ATOM   1718  N  N2    . G   A  1  89   ? 42.237  171.672 41.669  1.00 58.12  ? 89   G   0 N2    1 
ATOM   1719  N  N3    . G   A  1  89   ? 40.147  171.315 42.542  1.00 57.89  ? 89   G   0 N3    1 
ATOM   1720  C  C4    . G   A  1  89   ? 39.095  170.479 42.479  1.00 58.62  ? 89   G   0 C4    1 
ATOM   1721  P  P     . A   A  1  90   ? 34.134  174.031 41.936  1.00 75.78  ? 90   A   0 P     1 
ATOM   1722  O  OP1   . A   A  1  90   ? 33.244  175.212 42.099  1.00 75.69  ? 90   A   0 OP1   1 
ATOM   1723  O  OP2   . A   A  1  90   ? 33.586  172.761 41.381  1.00 74.18  ? 90   A   0 OP2   1 
ATOM   1724  O  "O5'" . A   A  1  90   ? 35.387  174.455 41.042  1.00 74.54  ? 90   A   0 "O5'" 1 
ATOM   1725  C  "C5'" . A   A  1  90   ? 36.126  175.658 41.327  1.00 72.87  ? 90   A   0 "C5'" 1 
ATOM   1726  C  "C4'" . A   A  1  90   ? 37.410  175.705 40.521  1.00 72.31  ? 90   A   0 "C4'" 1 
ATOM   1727  O  "O4'" . A   A  1  90   ? 38.259  174.572 40.864  1.00 70.16  ? 90   A   0 "O4'" 1 
ATOM   1728  C  "C3'" . A   A  1  90   ? 37.298  175.596 39.009  1.00 72.15  ? 90   A   0 "C3'" 1 
ATOM   1729  O  "O3'" . A   A  1  90   ? 36.891  176.807 38.387  1.00 73.75  ? 90   A   0 "O3'" 1 
ATOM   1730  C  "C2'" . A   A  1  90   ? 38.724  175.220 38.630  1.00 70.25  ? 90   A   0 "C2'" 1 
ATOM   1731  O  "O2'" . A   A  1  90   ? 39.614  176.317 38.670  1.00 71.05  ? 90   A   0 "O2'" 1 
ATOM   1732  C  "C1'" . A   A  1  90   ? 39.075  174.236 39.748  1.00 67.48  ? 90   A   0 "C1'" 1 
ATOM   1733  N  N9    . A   A  1  90   ? 38.776  172.865 39.325  1.00 63.10  ? 90   A   0 N9    1 
ATOM   1734  C  C8    . A   A  1  90   ? 37.610  172.150 39.479  1.00 61.49  ? 90   A   0 C8    1 
ATOM   1735  N  N7    . A   A  1  90   ? 37.631  170.974 38.897  1.00 59.01  ? 90   A   0 N7    1 
ATOM   1736  C  C5    . A   A  1  90   ? 38.900  170.902 38.338  1.00 57.93  ? 90   A   0 C5    1 
ATOM   1737  C  C6    . A   A  1  90   ? 39.538  169.915 37.571  1.00 56.81  ? 90   A   0 C6    1 
ATOM   1738  N  N6    . A   A  1  90   ? 38.950  168.777 37.197  1.00 57.36  ? 90   A   0 N6    1 
ATOM   1739  N  N1    . A   A  1  90   ? 40.813  170.145 37.186  1.00 56.09  ? 90   A   0 N1    1 
ATOM   1740  C  C2    . A   A  1  90   ? 41.394  171.297 37.547  1.00 56.08  ? 90   A   0 C2    1 
ATOM   1741  N  N3    . A   A  1  90   ? 40.895  172.305 38.254  1.00 56.62  ? 90   A   0 N3    1 
ATOM   1742  C  C4    . A   A  1  90   ? 39.627  172.045 38.620  1.00 59.36  ? 90   A   0 C4    1 
ATOM   1743  P  P     . G   A  1  91   ? 36.052  176.751 37.013  1.00 75.64  ? 91   G   0 P     1 
ATOM   1744  O  OP1   . G   A  1  91   ? 35.882  178.163 36.578  1.00 75.96  ? 91   G   0 OP1   1 
ATOM   1745  O  OP2   . G   A  1  91   ? 34.849  175.896 37.224  1.00 74.02  ? 91   G   0 OP2   1 
ATOM   1746  O  "O5'" . G   A  1  91   ? 37.022  176.023 35.974  1.00 71.17  ? 91   G   0 "O5'" 1 
ATOM   1747  C  "C5'" . G   A  1  91   ? 38.232  176.663 35.535  1.00 67.81  ? 91   G   0 "C5'" 1 
ATOM   1748  C  "C4'" . G   A  1  91   ? 39.174  175.661 34.906  1.00 66.60  ? 91   G   0 "C4'" 1 
ATOM   1749  O  "O4'" . G   A  1  91   ? 39.255  174.491 35.766  1.00 64.80  ? 91   G   0 "O4'" 1 
ATOM   1750  C  "C3'" . G   A  1  91   ? 38.793  175.055 33.562  1.00 66.70  ? 91   G   0 "C3'" 1 
ATOM   1751  O  "O3'" . G   A  1  91   ? 39.056  175.910 32.448  1.00 68.34  ? 91   G   0 "O3'" 1 
ATOM   1752  C  "C2'" . G   A  1  91   ? 39.680  173.819 33.535  1.00 65.17  ? 91   G   0 "C2'" 1 
ATOM   1753  O  "O2'" . G   A  1  91   ? 41.036  174.117 33.261  1.00 66.78  ? 91   G   0 "O2'" 1 
ATOM   1754  C  "C1'" . G   A  1  91   ? 39.553  173.344 34.982  1.00 62.65  ? 91   G   0 "C1'" 1 
ATOM   1755  N  N9    . G   A  1  91   ? 38.470  172.372 35.112  1.00 58.74  ? 91   G   0 N9    1 
ATOM   1756  C  C8    . G   A  1  91   ? 37.221  172.559 35.659  1.00 57.54  ? 91   G   0 C8    1 
ATOM   1757  N  N7    . G   A  1  91   ? 36.461  171.499 35.572  1.00 56.26  ? 91   G   0 N7    1 
ATOM   1758  C  C5    . G   A  1  91   ? 37.261  170.555 34.938  1.00 55.28  ? 91   G   0 C5    1 
ATOM   1759  C  C6    . G   A  1  91   ? 36.982  169.213 34.557  1.00 55.28  ? 91   G   0 C6    1 
ATOM   1760  O  O6    . G   A  1  91   ? 35.929  168.568 34.698  1.00 55.31  ? 91   G   0 O6    1 
ATOM   1761  N  N1    . G   A  1  91   ? 38.083  168.619 33.947  1.00 52.99  ? 91   G   0 N1    1 
ATOM   1762  C  C2    . G   A  1  91   ? 39.287  169.232 33.726  1.00 52.79  ? 91   G   0 C2    1 
ATOM   1763  N  N2    . G   A  1  91   ? 40.225  168.495 33.124  1.00 51.95  ? 91   G   0 N2    1 
ATOM   1764  N  N3    . G   A  1  91   ? 39.556  170.475 34.068  1.00 53.78  ? 91   G   0 N3    1 
ATOM   1765  C  C4    . G   A  1  91   ? 38.506  171.074 34.664  1.00 55.64  ? 91   G   0 C4    1 
ATOM   1766  P  P     . G   A  1  92   ? 38.237  175.704 31.066  1.00 68.39  ? 92   G   0 P     1 
ATOM   1767  O  OP1   . G   A  1  92   ? 38.614  176.841 30.185  1.00 67.08  ? 92   G   0 OP1   1 
ATOM   1768  O  OP2   . G   A  1  92   ? 36.801  175.466 31.386  1.00 65.25  ? 92   G   0 OP2   1 
ATOM   1769  O  "O5'" . G   A  1  92   ? 38.836  174.362 30.437  1.00 65.48  ? 92   G   0 "O5'" 1 
ATOM   1770  C  "C5'" . G   A  1  92   ? 40.237  174.263 30.122  1.00 62.52  ? 92   G   0 "C5'" 1 
ATOM   1771  C  "C4'" . G   A  1  92   ? 40.630  172.828 29.844  1.00 60.78  ? 92   G   0 "C4'" 1 
ATOM   1772  O  "O4'" . G   A  1  92   ? 40.203  171.974 30.943  1.00 60.36  ? 92   G   0 "O4'" 1 
ATOM   1773  C  "C3'" . G   A  1  92   ? 40.015  172.146 28.637  1.00 60.14  ? 92   G   0 "C3'" 1 
ATOM   1774  O  "O3'" . G   A  1  92   ? 40.622  172.555 27.415  1.00 59.72  ? 92   G   0 "O3'" 1 
ATOM   1775  C  "C2'" . G   A  1  92   ? 40.267  170.674 28.965  1.00 58.35  ? 92   G   0 "C2'" 1 
ATOM   1776  O  "O2'" . G   A  1  92   ? 41.614  170.271 28.805  1.00 57.77  ? 92   G   0 "O2'" 1 
ATOM   1777  C  "C1'" . G   A  1  92   ? 39.963  170.656 30.459  1.00 56.48  ? 92   G   0 "C1'" 1 
ATOM   1778  N  N9    . G   A  1  92   ? 38.576  170.285 30.738  1.00 53.30  ? 92   G   0 N9    1 
ATOM   1779  C  C8    . G   A  1  92   ? 37.566  171.099 31.193  1.00 51.85  ? 92   G   0 C8    1 
ATOM   1780  N  N7    . G   A  1  92   ? 36.433  170.471 31.347  1.00 49.62  ? 92   G   0 N7    1 
ATOM   1781  C  C5    . G   A  1  92   ? 36.707  169.166 30.968  1.00 48.45  ? 92   G   0 C5    1 
ATOM   1782  C  C6    . G   A  1  92   ? 35.862  168.031 30.919  1.00 48.42  ? 92   G   0 C6    1 
ATOM   1783  O  O6    . G   A  1  92   ? 34.658  167.951 31.210  1.00 50.35  ? 92   G   0 O6    1 
ATOM   1784  N  N1    . G   A  1  92   ? 36.548  166.904 30.482  1.00 46.06  ? 92   G   0 N1    1 
ATOM   1785  C  C2    . G   A  1  92   ? 37.875  166.871 30.140  1.00 48.07  ? 92   G   0 C2    1 
ATOM   1786  N  N2    . G   A  1  92   ? 38.366  165.676 29.769  1.00 47.89  ? 92   G   0 N2    1 
ATOM   1787  N  N3    . G   A  1  92   ? 38.670  167.928 30.168  1.00 49.15  ? 92   G   0 N3    1 
ATOM   1788  C  C4    . G   A  1  92   ? 38.024  169.032 30.591  1.00 50.03  ? 92   G   0 C4    1 
ATOM   1789  P  P     . C   A  1  93   ? 39.819  172.383 26.027  1.00 60.95  ? 93   C   0 P     1 
ATOM   1790  O  OP1   . C   A  1  93   ? 40.625  173.060 24.973  1.00 60.70  ? 93   C   0 OP1   1 
ATOM   1791  O  OP2   . C   A  1  93   ? 38.394  172.767 26.229  1.00 58.02  ? 93   C   0 OP2   1 
ATOM   1792  O  "O5'" . C   A  1  93   ? 39.851  170.816 25.741  1.00 59.66  ? 93   C   0 "O5'" 1 
ATOM   1793  C  "C5'" . C   A  1  93   ? 41.096  170.110 25.612  1.00 58.50  ? 93   C   0 "C5'" 1 
ATOM   1794  C  "C4'" . C   A  1  93   ? 40.842  168.626 25.500  1.00 59.50  ? 93   C   0 "C4'" 1 
ATOM   1795  O  "O4'" . C   A  1  93   ? 40.221  168.134 26.722  1.00 58.95  ? 93   C   0 "O4'" 1 
ATOM   1796  C  "C3'" . C   A  1  93   ? 39.854  168.211 24.425  1.00 60.01  ? 93   C   0 "C3'" 1 
ATOM   1797  O  "O3'" . C   A  1  93   ? 40.412  168.213 23.117  1.00 61.71  ? 93   C   0 "O3'" 1 
ATOM   1798  C  "C2'" . C   A  1  93   ? 39.428  166.830 24.904  1.00 58.54  ? 93   C   0 "C2'" 1 
ATOM   1799  O  "O2'" . C   A  1  93   ? 40.392  165.822 24.651  1.00 58.02  ? 93   C   0 "O2'" 1 
ATOM   1800  C  "C1'" . C   A  1  93   ? 39.327  167.072 26.409  1.00 56.38  ? 93   C   0 "C1'" 1 
ATOM   1801  N  N1    . C   A  1  93   ? 37.963  167.454 26.826  1.00 54.06  ? 93   C   0 N1    1 
ATOM   1802  C  C2    . C   A  1  93   ? 36.966  166.466 26.856  1.00 52.89  ? 93   C   0 C2    1 
ATOM   1803  O  O2    . C   A  1  93   ? 37.252  165.314 26.507  1.00 52.63  ? 93   C   0 O2    1 
ATOM   1804  N  N3    . C   A  1  93   ? 35.716  166.795 27.259  1.00 52.16  ? 93   C   0 N3    1 
ATOM   1805  C  C4    . C   A  1  93   ? 35.439  168.051 27.614  1.00 52.64  ? 93   C   0 C4    1 
ATOM   1806  N  N4    . C   A  1  93   ? 34.193  168.330 28.013  1.00 52.91  ? 93   C   0 N4    1 
ATOM   1807  C  C5    . C   A  1  93   ? 36.426  169.079 27.578  1.00 53.01  ? 93   C   0 C5    1 
ATOM   1808  C  C6    . C   A  1  93   ? 37.664  168.740 27.183  1.00 53.51  ? 93   C   0 C6    1 
ATOM   1809  P  P     . G   A  1  94   ? 39.471  168.575 21.865  1.00 61.56  ? 94   G   0 P     1 
ATOM   1810  O  OP1   . G   A  1  94   ? 40.307  168.568 20.638  1.00 60.69  ? 94   G   0 OP1   1 
ATOM   1811  O  OP2   . G   A  1  94   ? 38.671  169.782 22.208  1.00 60.65  ? 94   G   0 OP2   1 
ATOM   1812  O  "O5'" . G   A  1  94   ? 38.462  167.350 21.788  1.00 61.17  ? 94   G   0 "O5'" 1 
ATOM   1813  C  "C5'" . G   A  1  94   ? 38.931  166.029 21.494  1.00 59.51  ? 94   G   0 "C5'" 1 
ATOM   1814  C  "C4'" . G   A  1  94   ? 37.778  165.062 21.508  1.00 59.67  ? 94   G   0 "C4'" 1 
ATOM   1815  O  "O4'" . G   A  1  94   ? 37.238  164.961 22.853  1.00 58.69  ? 94   G   0 "O4'" 1 
ATOM   1816  C  "C3'" . G   A  1  94   ? 36.562  165.482 20.705  1.00 60.47  ? 94   G   0 "C3'" 1 
ATOM   1817  O  "O3'" . G   A  1  94   ? 36.729  165.298 19.310  1.00 64.56  ? 94   G   0 "O3'" 1 
ATOM   1818  C  "C2'" . G   A  1  94   ? 35.490  164.585 21.300  1.00 57.68  ? 94   G   0 "C2'" 1 
ATOM   1819  O  "O2'" . G   A  1  94   ? 35.630  163.243 20.881  1.00 57.81  ? 94   G   0 "O2'" 1 
ATOM   1820  C  "C1'" . G   A  1  94   ? 35.848  164.672 22.781  1.00 55.80  ? 94   G   0 "C1'" 1 
ATOM   1821  N  N9    . G   A  1  94   ? 35.103  165.739 23.439  1.00 51.76  ? 94   G   0 N9    1 
ATOM   1822  C  C8    . G   A  1  94   ? 35.552  166.988 23.798  1.00 50.66  ? 94   G   0 C8    1 
ATOM   1823  N  N7    . G   A  1  94   ? 34.625  167.723 24.350  1.00 49.69  ? 94   G   0 N7    1 
ATOM   1824  C  C5    . G   A  1  94   ? 33.500  166.909 24.356  1.00 48.80  ? 94   G   0 C5    1 
ATOM   1825  C  C6    . G   A  1  94   ? 32.184  167.163 24.815  1.00 49.08  ? 94   G   0 C6    1 
ATOM   1826  O  O6    . G   A  1  94   ? 31.730  168.198 25.312  1.00 51.98  ? 94   G   0 O6    1 
ATOM   1827  N  N1    . G   A  1  94   ? 31.357  166.056 24.640  1.00 48.57  ? 94   G   0 N1    1 
ATOM   1828  C  C2    . G   A  1  94   ? 31.747  164.860 24.083  1.00 48.59  ? 94   G   0 C2    1 
ATOM   1829  N  N2    . G   A  1  94   ? 30.810  163.895 24.004  1.00 47.24  ? 94   G   0 N2    1 
ATOM   1830  N  N3    . G   A  1  94   ? 32.967  164.623 23.638  1.00 48.21  ? 94   G   0 N3    1 
ATOM   1831  C  C4    . G   A  1  94   ? 33.784  165.681 23.807  1.00 49.19  ? 94   G   0 C4    1 
ATOM   1832  P  P     . A   A  1  95   ? 36.415  166.517 18.310  1.00 65.04  ? 95   A   0 P     1 
ATOM   1833  O  OP1   . A   A  1  95   ? 37.726  167.105 17.923  1.00 63.52  ? 95   A   0 OP1   1 
ATOM   1834  O  OP2   . A   A  1  95   ? 35.369  167.383 18.921  1.00 63.49  ? 95   A   0 OP2   1 
ATOM   1835  O  "O5'" . A   A  1  95   ? 35.750  165.804 17.051  1.00 67.73  ? 95   A   0 "O5'" 1 
ATOM   1836  C  "C5'" . A   A  1  95   ? 34.577  164.974 17.203  1.00 69.58  ? 95   A   0 "C5'" 1 
ATOM   1837  C  "C4'" . A   A  1  95   ? 33.716  165.065 15.968  1.00 71.15  ? 95   A   0 "C4'" 1 
ATOM   1838  O  "O4'" . A   A  1  95   ? 32.604  164.133 16.071  1.00 71.20  ? 95   A   0 "O4'" 1 
ATOM   1839  C  "C3'" . A   A  1  95   ? 33.101  166.437 15.723  1.00 72.90  ? 95   A   0 "C3'" 1 
ATOM   1840  O  "O3'" . A   A  1  95   ? 33.010  166.686 14.325  1.00 75.66  ? 95   A   0 "O3'" 1 
ATOM   1841  C  "C2'" . A   A  1  95   ? 31.705  166.288 16.314  1.00 72.84  ? 95   A   0 "C2'" 1 
ATOM   1842  O  "O2'" . A   A  1  95   ? 30.783  167.196 15.738  1.00 72.11  ? 95   A   0 "O2'" 1 
ATOM   1843  C  "C1'" . A   A  1  95   ? 31.384  164.837 15.954  1.00 72.64  ? 95   A   0 "C1'" 1 
ATOM   1844  N  N9    . A   A  1  95   ? 30.390  164.197 16.821  1.00 73.66  ? 95   A   0 N9    1 
ATOM   1845  C  C8    . A   A  1  95   ? 29.189  163.658 16.431  1.00 73.79  ? 95   A   0 C8    1 
ATOM   1846  N  N7    . A   A  1  95   ? 28.484  163.161 17.417  1.00 73.45  ? 95   A   0 N7    1 
ATOM   1847  C  C5    . A   A  1  95   ? 29.274  163.383 18.536  1.00 74.71  ? 95   A   0 C5    1 
ATOM   1848  C  C6    . A   A  1  95   ? 29.083  163.093 19.900  1.00 74.90  ? 95   A   0 C6    1 
ATOM   1849  N  N6    . A   A  1  95   ? 27.995  162.486 20.381  1.00 74.83  ? 95   A   0 N6    1 
ATOM   1850  N  N1    . A   A  1  95   ? 30.060  163.453 20.762  1.00 74.12  ? 95   A   0 N1    1 
ATOM   1851  C  C2    . A   A  1  95   ? 31.153  164.058 20.275  1.00 73.87  ? 95   A   0 C2    1 
ATOM   1852  N  N3    . A   A  1  95   ? 31.448  164.382 19.017  1.00 74.54  ? 95   A   0 N3    1 
ATOM   1853  C  C4    . A   A  1  95   ? 30.455  164.017 18.185  1.00 74.61  ? 95   A   0 C4    1 
ATOM   1854  P  P     . A   A  1  96   ? 33.748  167.968 13.696  1.00 76.55  ? 96   A   0 P     1 
ATOM   1855  O  OP1   . A   A  1  96   ? 33.722  169.072 14.700  1.00 75.70  ? 96   A   0 OP1   1 
ATOM   1856  O  OP2   . A   A  1  96   ? 33.143  168.181 12.354  1.00 77.89  ? 96   A   0 OP2   1 
ATOM   1857  O  "O5'" . A   A  1  96   ? 35.256  167.491 13.497  1.00 74.23  ? 96   A   0 "O5'" 1 
ATOM   1858  C  "C5'" . A   A  1  96   ? 35.593  166.536 12.479  1.00 72.60  ? 96   A   0 "C5'" 1 
ATOM   1859  C  "C4'" . A   A  1  96   ? 37.050  166.162 12.575  1.00 73.38  ? 96   A   0 "C4'" 1 
ATOM   1860  O  "O4'" . A   A  1  96   ? 37.853  167.364 12.413  1.00 73.86  ? 96   A   0 "O4'" 1 
ATOM   1861  C  "C3'" . A   A  1  96   ? 37.500  165.532 13.895  1.00 73.67  ? 96   A   0 "C3'" 1 
ATOM   1862  O  "O3'" . A   A  1  96   ? 38.550  164.603 13.636  1.00 72.94  ? 96   A   0 "O3'" 1 
ATOM   1863  C  "C2'" . A   A  1  96   ? 38.091  166.722 14.643  1.00 74.60  ? 96   A   0 "C2'" 1 
ATOM   1864  O  "O2'" . A   A  1  96   ? 39.054  166.359 15.616  1.00 74.17  ? 96   A   0 "O2'" 1 
ATOM   1865  C  "C1'" . A   A  1  96   ? 38.757  167.462 13.490  1.00 75.28  ? 96   A   0 "C1'" 1 
ATOM   1866  N  N9    . A   A  1  96   ? 39.086  168.866 13.727  1.00 76.19  ? 96   A   0 N9    1 
ATOM   1867  C  C8    . A   A  1  96   ? 38.359  169.852 14.354  1.00 76.27  ? 96   A   0 C8    1 
ATOM   1868  N  N7    . A   A  1  96   ? 38.981  171.007 14.416  1.00 76.82  ? 96   A   0 N7    1 
ATOM   1869  C  C5    . A   A  1  96   ? 40.195  170.767 13.778  1.00 77.42  ? 96   A   0 C5    1 
ATOM   1870  C  C6    . A   A  1  96   ? 41.314  171.591 13.510  1.00 78.05  ? 96   A   0 C6    1 
ATOM   1871  N  N6    . A   A  1  96   ? 41.402  172.874 13.878  1.00 78.45  ? 96   A   0 N6    1 
ATOM   1872  N  N1    . A   A  1  96   ? 42.356  171.037 12.846  1.00 77.31  ? 96   A   0 N1    1 
ATOM   1873  C  C2    . A   A  1  96   ? 42.278  169.746 12.490  1.00 76.67  ? 96   A   0 C2    1 
ATOM   1874  N  N3    . A   A  1  96   ? 41.293  168.874 12.691  1.00 76.10  ? 96   A   0 N3    1 
ATOM   1875  C  C4    . A   A  1  96   ? 40.268  169.455 13.346  1.00 76.92  ? 96   A   0 C4    1 
ATOM   1876  P  P     . G   A  1  97   ? 38.260  163.029 13.729  1.00 72.47  ? 97   G   0 P     1 
ATOM   1877  O  OP1   . G   A  1  97   ? 39.534  162.317 14.039  1.00 70.59  ? 97   G   0 OP1   1 
ATOM   1878  O  OP2   . G   A  1  97   ? 37.496  162.661 12.511  1.00 72.76  ? 97   G   0 OP2   1 
ATOM   1879  O  "O5'" . G   A  1  97   ? 37.249  162.906 14.955  1.00 71.75  ? 97   G   0 "O5'" 1 
ATOM   1880  C  "C5'" . G   A  1  97   ? 37.694  163.033 16.319  1.00 69.83  ? 97   G   0 "C5'" 1 
ATOM   1881  C  "C4'" . G   A  1  97   ? 37.116  161.911 17.150  1.00 68.10  ? 97   G   0 "C4'" 1 
ATOM   1882  O  "O4'" . G   A  1  97   ? 35.663  161.977 17.078  1.00 68.55  ? 97   G   0 "O4'" 1 
ATOM   1883  C  "C3'" . G   A  1  97   ? 37.490  160.514 16.670  1.00 66.96  ? 97   G   0 "C3'" 1 
ATOM   1884  O  "O3'" . G   A  1  97   ? 37.531  159.630 17.783  1.00 65.06  ? 97   G   0 "O3'" 1 
ATOM   1885  C  "C2'" . G   A  1  97   ? 36.342  160.172 15.725  1.00 67.20  ? 97   G   0 "C2'" 1 
ATOM   1886  O  "O2'" . G   A  1  97   ? 36.151  158.790 15.507  1.00 64.97  ? 97   G   0 "O2'" 1 
ATOM   1887  C  "C1'" . G   A  1  97   ? 35.156  160.811 16.449  1.00 68.60  ? 97   G   0 "C1'" 1 
ATOM   1888  N  N9    . G   A  1  97   ? 34.074  161.217 15.556  1.00 70.83  ? 97   G   0 N9    1 
ATOM   1889  C  C8    . G   A  1  97   ? 34.188  161.950 14.397  1.00 71.23  ? 97   G   0 C8    1 
ATOM   1890  N  N7    . G   A  1  97   ? 33.044  162.157 13.806  1.00 71.86  ? 97   G   0 N7    1 
ATOM   1891  C  C5    . G   A  1  97   ? 32.116  161.524 14.620  1.00 72.83  ? 97   G   0 C5    1 
ATOM   1892  C  C6    . G   A  1  97   ? 30.707  161.406 14.487  1.00 73.49  ? 97   G   0 C6    1 
ATOM   1893  O  O6    . G   A  1  97   ? 29.976  161.843 13.588  1.00 74.87  ? 97   G   0 O6    1 
ATOM   1894  N  N1    . G   A  1  97   ? 30.153  160.690 15.541  1.00 72.87  ? 97   G   0 N1    1 
ATOM   1895  C  C2    . G   A  1  97   ? 30.859  160.149 16.585  1.00 72.38  ? 97   G   0 C2    1 
ATOM   1896  N  N2    . G   A  1  97   ? 30.138  159.491 17.501  1.00 71.78  ? 97   G   0 N2    1 
ATOM   1897  N  N3    . G   A  1  97   ? 32.173  160.246 16.719  1.00 72.07  ? 97   G   0 N3    1 
ATOM   1898  C  C4    . G   A  1  97   ? 32.733  160.942 15.708  1.00 72.01  ? 97   G   0 C4    1 
ATOM   1899  P  P     . A   A  1  98   ? 38.885  158.836 18.121  1.00 64.35  ? 98   A   0 P     1 
ATOM   1900  O  OP1   . A   A  1  98   ? 39.944  159.276 17.172  1.00 65.62  ? 98   A   0 OP1   1 
ATOM   1901  O  OP2   . A   A  1  98   ? 38.560  157.396 18.229  1.00 64.74  ? 98   A   0 OP2   1 
ATOM   1902  O  "O5'" . A   A  1  98   ? 39.271  159.360 19.572  1.00 62.94  ? 98   A   0 "O5'" 1 
ATOM   1903  C  "C5'" . A   A  1  98   ? 40.054  160.552 19.747  1.00 59.79  ? 98   A   0 "C5'" 1 
ATOM   1904  C  "C4'" . A   A  1  98   ? 39.833  161.113 21.125  1.00 58.64  ? 98   A   0 "C4'" 1 
ATOM   1905  O  "O4'" . A   A  1  98   ? 38.466  161.598 21.239  1.00 59.35  ? 98   A   0 "O4'" 1 
ATOM   1906  C  "C3'" . A   A  1  98   ? 39.958  160.105 22.253  1.00 57.49  ? 98   A   0 "C3'" 1 
ATOM   1907  O  "O3'" . A   A  1  98   ? 41.306  159.868 22.632  1.00 56.20  ? 98   A   0 "O3'" 1 
ATOM   1908  C  "C2'" . A   A  1  98   ? 39.140  160.764 23.351  1.00 58.08  ? 98   A   0 "C2'" 1 
ATOM   1909  O  "O2'" . A   A  1  98   ? 39.838  161.824 23.970  1.00 57.75  ? 98   A   0 "O2'" 1 
ATOM   1910  C  "C1'" . A   A  1  98   ? 37.970  161.328 22.543  1.00 58.35  ? 98   A   0 "C1'" 1 
ATOM   1911  N  N9    . A   A  1  98   ? 36.872  160.368 22.424  1.00 58.85  ? 98   A   0 N9    1 
ATOM   1912  C  C8    . A   A  1  98   ? 36.490  159.656 21.311  1.00 58.93  ? 98   A   0 C8    1 
ATOM   1913  N  N7    . A   A  1  98   ? 35.474  158.855 21.519  1.00 59.19  ? 98   A   0 N7    1 
ATOM   1914  C  C5    . A   A  1  98   ? 35.161  159.051 22.856  1.00 59.83  ? 98   A   0 C5    1 
ATOM   1915  C  C6    . A   A  1  98   ? 34.176  158.485 23.693  1.00 60.21  ? 98   A   0 C6    1 
ATOM   1916  N  N6    . A   A  1  98   ? 33.295  157.567 23.287  1.00 61.03  ? 98   A   0 N6    1 
ATOM   1917  N  N1    . A   A  1  98   ? 34.131  158.897 24.980  1.00 60.14  ? 98   A   0 N1    1 
ATOM   1918  C  C2    . A   A  1  98   ? 35.021  159.814 25.390  1.00 60.98  ? 98   A   0 C2    1 
ATOM   1919  N  N3    . A   A  1  98   ? 35.996  160.417 24.701  1.00 61.19  ? 98   A   0 N3    1 
ATOM   1920  C  C4    . A   A  1  98   ? 36.011  159.985 23.425  1.00 60.13  ? 98   A   0 C4    1 
ATOM   1921  P  P     . A   A  1  99   ? 41.746  158.394 23.097  1.00 56.00  ? 99   A   0 P     1 
ATOM   1922  O  OP1   . A   A  1  99   ? 43.104  158.476 23.688  1.00 57.12  ? 99   A   0 OP1   1 
ATOM   1923  O  OP2   . A   A  1  99   ? 41.500  157.460 21.971  1.00 55.67  ? 99   A   0 OP2   1 
ATOM   1924  O  "O5'" . A   A  1  99   ? 40.726  158.055 24.275  1.00 56.01  ? 99   A   0 "O5'" 1 
ATOM   1925  C  "C5'" . A   A  1  99   ? 40.733  158.827 25.493  1.00 55.04  ? 99   A   0 "C5'" 1 
ATOM   1926  C  "C4'" . A   A  1  99   ? 39.676  158.330 26.453  1.00 55.36  ? 99   A   0 "C4'" 1 
ATOM   1927  O  "O4'" . A   A  1  99   ? 38.365  158.411 25.833  1.00 55.73  ? 99   A   0 "O4'" 1 
ATOM   1928  C  "C3'" . A   A  1  99   ? 39.765  156.880 26.905  1.00 55.62  ? 99   A   0 "C3'" 1 
ATOM   1929  O  "O3'" . A   A  1  99   ? 40.718  156.714 27.949  1.00 55.04  ? 99   A   0 "O3'" 1 
ATOM   1930  C  "C2'" . A   A  1  99   ? 38.349  156.640 27.417  1.00 56.69  ? 99   A   0 "C2'" 1 
ATOM   1931  O  "O2'" . A   A  1  99   ? 38.127  157.226 28.684  1.00 57.34  ? 99   A   0 "O2'" 1 
ATOM   1932  C  "C1'" . A   A  1  99   ? 37.523  157.406 26.379  1.00 56.71  ? 99   A   0 "C1'" 1 
ATOM   1933  N  N9    . A   A  1  99   ? 37.055  156.538 25.295  1.00 56.57  ? 99   A   0 N9    1 
ATOM   1934  C  C8    . A   A  1  99   ? 37.616  156.336 24.059  1.00 56.92  ? 99   A   0 C8    1 
ATOM   1935  N  N7    . A   A  1  99   ? 36.974  155.461 23.323  1.00 57.00  ? 99   A   0 N7    1 
ATOM   1936  C  C5    . A   A  1  99   ? 35.911  155.068 24.124  1.00 57.32  ? 99   A   0 C5    1 
ATOM   1937  C  C6    . A   A  1  99   ? 34.855  154.153 23.924  1.00 57.12  ? 99   A   0 C6    1 
ATOM   1938  N  N6    . A   A  1  99   ? 34.690  153.435 22.810  1.00 55.66  ? 99   A   0 N6    1 
ATOM   1939  N  N1    . A   A  1  99   ? 33.963  153.998 24.925  1.00 56.71  ? 99   A   0 N1    1 
ATOM   1940  C  C2    . A   A  1  99   ? 34.127  154.711 26.046  1.00 56.28  ? 99   A   0 C2    1 
ATOM   1941  N  N3    . A   A  1  99   ? 35.074  155.593 26.353  1.00 56.42  ? 99   A   0 N3    1 
ATOM   1942  C  C4    . A   A  1  99   ? 35.945  155.728 25.339  1.00 56.97  ? 99   A   0 C4    1 
ATOM   1943  P  P     . C   A  1  100  ? 41.958  155.706 27.757  1.00 53.99  ? 100  C   0 P     1 
ATOM   1944  O  OP1   . C   A  1  100  ? 42.739  155.776 29.017  1.00 54.36  ? 100  C   0 OP1   1 
ATOM   1945  O  OP2   . C   A  1  100  ? 42.629  155.977 26.465  1.00 55.17  ? 100  C   0 OP2   1 
ATOM   1946  O  "O5'" . C   A  1  100  ? 41.283  154.272 27.639  1.00 55.75  ? 100  C   0 "O5'" 1 
ATOM   1947  C  "C5'" . C   A  1  100  ? 40.318  153.822 28.601  1.00 57.22  ? 100  C   0 "C5'" 1 
ATOM   1948  C  "C4'" . C   A  1  100  ? 39.435  152.771 27.981  1.00 59.10  ? 100  C   0 "C4'" 1 
ATOM   1949  O  "O4'" . C   A  1  100  ? 38.579  153.384 26.978  1.00 60.98  ? 100  C   0 "O4'" 1 
ATOM   1950  C  "C3'" . C   A  1  100  ? 40.175  151.687 27.214  1.00 58.06  ? 100  C   0 "C3'" 1 
ATOM   1951  O  "O3'" . C   A  1  100  ? 40.702  150.687 28.069  1.00 55.93  ? 100  C   0 "O3'" 1 
ATOM   1952  C  "C2'" . C   A  1  100  ? 39.092  151.173 26.275  1.00 60.52  ? 100  C   0 "C2'" 1 
ATOM   1953  O  "O2'" . C   A  1  100  ? 38.153  150.338 26.928  1.00 60.07  ? 100  C   0 "O2'" 1 
ATOM   1954  C  "C1'" . C   A  1  100  ? 38.399  152.483 25.892  1.00 61.59  ? 100  C   0 "C1'" 1 
ATOM   1955  N  N1    . C   A  1  100  ? 38.948  153.101 24.665  1.00 64.25  ? 100  C   0 N1    1 
ATOM   1956  C  C2    . C   A  1  100  ? 38.419  152.723 23.416  1.00 64.52  ? 100  C   0 C2    1 
ATOM   1957  O  O2    . C   A  1  100  ? 37.531  151.859 23.371  1.00 65.61  ? 100  C   0 O2    1 
ATOM   1958  N  N3    . C   A  1  100  ? 38.894  153.308 22.293  1.00 64.15  ? 100  C   0 N3    1 
ATOM   1959  C  C4    . C   A  1  100  ? 39.864  154.220 22.373  1.00 63.43  ? 100  C   0 C4    1 
ATOM   1960  N  N4    . C   A  1  100  ? 40.300  154.765 21.239  1.00 62.32  ? 100  C   0 N4    1 
ATOM   1961  C  C5    . C   A  1  100  ? 40.431  154.612 23.623  1.00 63.46  ? 100  C   0 C5    1 
ATOM   1962  C  C6    . C   A  1  100  ? 39.949  154.034 24.732  1.00 63.63  ? 100  C   0 C6    1 
ATOM   1963  P  P     . C   A  1  101  ? 42.152  150.062 27.763  1.00 55.98  ? 101  C   0 P     1 
ATOM   1964  O  OP1   . C   A  1  101  ? 42.553  149.285 28.959  1.00 56.54  ? 101  C   0 OP1   1 
ATOM   1965  O  OP2   . C   A  1  101  ? 43.045  151.130 27.259  1.00 56.44  ? 101  C   0 OP2   1 
ATOM   1966  O  "O5'" . C   A  1  101  ? 41.878  149.036 26.580  1.00 54.79  ? 101  C   0 "O5'" 1 
ATOM   1967  C  "C5'" . C   A  1  101  ? 41.119  147.838 26.812  1.00 55.92  ? 101  C   0 "C5'" 1 
ATOM   1968  C  "C4'" . C   A  1  101  ? 40.947  147.067 25.526  1.00 58.17  ? 101  C   0 "C4'" 1 
ATOM   1969  O  "O4'" . C   A  1  101  ? 40.154  147.851 24.601  1.00 58.03  ? 101  C   0 "O4'" 1 
ATOM   1970  C  "C3'" . C   A  1  101  ? 42.215  146.748 24.750  1.00 57.98  ? 101  C   0 "C3'" 1 
ATOM   1971  O  "O3'" . C   A  1  101  ? 42.861  145.586 25.243  1.00 58.28  ? 101  C   0 "O3'" 1 
ATOM   1972  C  "C2'" . C   A  1  101  ? 41.680  146.526 23.347  1.00 58.57  ? 101  C   0 "C2'" 1 
ATOM   1973  O  "O2'" . C   A  1  101  ? 41.096  145.250 23.207  1.00 59.48  ? 101  C   0 "O2'" 1 
ATOM   1974  C  "C1'" . C   A  1  101  ? 40.581  147.590 23.276  1.00 58.63  ? 101  C   0 "C1'" 1 
ATOM   1975  N  N1    . C   A  1  101  ? 41.021  148.855 22.658  1.00 58.90  ? 101  C   0 N1    1 
ATOM   1976  C  C2    . C   A  1  101  ? 41.273  148.871 21.286  1.00 58.92  ? 101  C   0 C2    1 
ATOM   1977  O  O2    . C   A  1  101  ? 41.128  147.819 20.642  1.00 59.41  ? 101  C   0 O2    1 
ATOM   1978  N  N3    . C   A  1  101  ? 41.668  150.024 20.697  1.00 58.92  ? 101  C   0 N3    1 
ATOM   1979  C  C4    . C   A  1  101  ? 41.809  151.132 21.428  1.00 59.35  ? 101  C   0 C4    1 
ATOM   1980  N  N4    . C   A  1  101  ? 42.185  152.253 20.803  1.00 58.55  ? 101  C   0 N4    1 
ATOM   1981  C  C5    . C   A  1  101  ? 41.565  151.143 22.833  1.00 59.91  ? 101  C   0 C5    1 
ATOM   1982  C  C6    . C   A  1  101  ? 41.178  149.995 23.401  1.00 59.62  ? 101  C   0 C6    1 
ATOM   1983  P  P     . A   A  1  102  ? 44.418  145.354 24.931  1.00 61.49  ? 102  A   0 P     1 
ATOM   1984  O  OP1   . A   A  1  102  ? 44.856  144.161 25.700  1.00 62.08  ? 102  A   0 OP1   1 
ATOM   1985  O  OP2   . A   A  1  102  ? 45.131  146.647 25.116  1.00 60.06  ? 102  A   0 OP2   1 
ATOM   1986  O  "O5'" . A   A  1  102  ? 44.444  144.985 23.382  1.00 61.68  ? 102  A   0 "O5'" 1 
ATOM   1987  C  "C5'" . A   A  1  102  ? 43.927  143.726 22.911  1.00 63.63  ? 102  A   0 "C5'" 1 
ATOM   1988  C  "C4'" . A   A  1  102  ? 44.136  143.601 21.419  1.00 64.48  ? 102  A   0 "C4'" 1 
ATOM   1989  O  "O4'" . A   A  1  102  ? 43.324  144.581 20.725  1.00 65.30  ? 102  A   0 "O4'" 1 
ATOM   1990  C  "C3'" . A   A  1  102  ? 45.545  143.897 20.949  1.00 64.44  ? 102  A   0 "C3'" 1 
ATOM   1991  O  "O3'" . A   A  1  102  ? 46.388  142.776 21.113  1.00 65.90  ? 102  A   0 "O3'" 1 
ATOM   1992  C  "C2'" . A   A  1  102  ? 45.330  144.276 19.494  1.00 64.78  ? 102  A   0 "C2'" 1 
ATOM   1993  O  "O2'" . A   A  1  102  ? 45.114  143.152 18.671  1.00 65.41  ? 102  A   0 "O2'" 1 
ATOM   1994  C  "C1'" . A   A  1  102  ? 44.026  145.066 19.592  1.00 65.46  ? 102  A   0 "C1'" 1 
ATOM   1995  N  N9    . A   A  1  102  ? 44.222  146.506 19.765  1.00 66.49  ? 102  A   0 N9    1 
ATOM   1996  C  C8    . A   A  1  102  ? 44.172  147.224 20.935  1.00 66.14  ? 102  A   0 C8    1 
ATOM   1997  N  N7    . A   A  1  102  ? 44.350  148.511 20.773  1.00 66.49  ? 102  A   0 N7    1 
ATOM   1998  C  C5    . A   A  1  102  ? 44.537  148.653 19.406  1.00 66.58  ? 102  A   0 C5    1 
ATOM   1999  C  C6    . A   A  1  102  ? 44.766  149.777 18.598  1.00 66.77  ? 102  A   0 C6    1 
ATOM   2000  N  N6    . A   A  1  102  ? 44.825  151.025 19.068  1.00 65.79  ? 102  A   0 N6    1 
ATOM   2001  N  N1    . A   A  1  102  ? 44.927  149.573 17.271  1.00 67.06  ? 102  A   0 N1    1 
ATOM   2002  C  C2    . A   A  1  102  ? 44.849  148.322 16.800  1.00 66.08  ? 102  A   0 C2    1 
ATOM   2003  N  N3    . A   A  1  102  ? 44.625  147.187 17.458  1.00 65.62  ? 102  A   0 N3    1 
ATOM   2004  C  C4    . A   A  1  102  ? 44.476  147.424 18.773  1.00 66.66  ? 102  A   0 C4    1 
ATOM   2005  P  P     . C   A  1  103  ? 47.926  142.998 21.505  1.00 68.18  ? 103  C   0 P     1 
ATOM   2006  O  OP1   . C   A  1  103  ? 48.458  141.693 21.977  1.00 69.39  ? 103  C   0 OP1   1 
ATOM   2007  O  OP2   . C   A  1  103  ? 48.004  144.191 22.396  1.00 66.91  ? 103  C   0 OP2   1 
ATOM   2008  O  "O5'" . C   A  1  103  ? 48.617  143.327 20.108  1.00 68.00  ? 103  C   0 "O5'" 1 
ATOM   2009  C  "C5'" . C   A  1  103  ? 48.553  142.381 19.028  1.00 67.68  ? 103  C   0 "C5'" 1 
ATOM   2010  C  "C4'" . C   A  1  103  ? 48.844  143.058 17.711  1.00 68.57  ? 103  C   0 "C4'" 1 
ATOM   2011  O  "O4'" . C   A  1  103  ? 47.838  144.069 17.436  1.00 68.53  ? 103  C   0 "O4'" 1 
ATOM   2012  C  "C3'" . C   A  1  103  ? 50.151  143.820 17.628  1.00 69.09  ? 103  C   0 "C3'" 1 
ATOM   2013  O  "O3'" . C   A  1  103  ? 51.254  142.965 17.380  1.00 70.31  ? 103  C   0 "O3'" 1 
ATOM   2014  C  "C2'" . C   A  1  103  ? 49.895  144.765 16.466  1.00 69.72  ? 103  C   0 "C2'" 1 
ATOM   2015  O  "O2'" . C   A  1  103  ? 50.033  144.125 15.216  1.00 71.18  ? 103  C   0 "O2'" 1 
ATOM   2016  C  "C1'" . C   A  1  103  ? 48.427  145.133 16.701  1.00 69.48  ? 103  C   0 "C1'" 1 
ATOM   2017  N  N1    . C   A  1  103  ? 48.273  146.389 17.463  1.00 69.72  ? 103  C   0 N1    1 
ATOM   2018  C  C2    . C   A  1  103  ? 48.174  147.600 16.756  1.00 69.17  ? 103  C   0 C2    1 
ATOM   2019  O  O2    . C   A  1  103  ? 48.210  147.580 15.517  1.00 69.71  ? 103  C   0 O2    1 
ATOM   2020  N  N3    . C   A  1  103  ? 48.043  148.757 17.444  1.00 68.22  ? 103  C   0 N3    1 
ATOM   2021  C  C4    . C   A  1  103  ? 48.016  148.739 18.779  1.00 68.20  ? 103  C   0 C4    1 
ATOM   2022  N  N4    . C   A  1  103  ? 47.896  149.903 19.418  1.00 67.86  ? 103  C   0 N4    1 
ATOM   2023  C  C5    . C   A  1  103  ? 48.112  147.525 19.521  1.00 68.33  ? 103  C   0 C5    1 
ATOM   2024  C  C6    . C   A  1  103  ? 48.236  146.386 18.831  1.00 68.90  ? 103  C   0 C6    1 
ATOM   2025  P  P     . A   A  1  104  ? 52.691  143.331 17.999  1.00 74.50  ? 104  A   0 P     1 
ATOM   2026  O  OP1   . A   A  1  104  ? 53.601  142.183 17.725  1.00 73.28  ? 104  A   0 OP1   1 
ATOM   2027  O  OP2   . A   A  1  104  ? 52.476  143.781 19.406  1.00 73.09  ? 104  A   0 OP2   1 
ATOM   2028  O  "O5'" . A   A  1  104  ? 53.175  144.587 17.135  1.00 74.07  ? 104  A   0 "O5'" 1 
ATOM   2029  C  "C5'" . A   A  1  104  ? 53.483  144.444 15.732  1.00 72.24  ? 104  A   0 "C5'" 1 
ATOM   2030  C  "C4'" . A   A  1  104  ? 53.600  145.795 15.059  1.00 70.94  ? 104  A   0 "C4'" 1 
ATOM   2031  O  "O4'" . A   A  1  104  ? 52.348  146.526 15.183  1.00 70.62  ? 104  A   0 "O4'" 1 
ATOM   2032  C  "C3'" . A   A  1  104  ? 54.614  146.778 15.615  1.00 71.19  ? 104  A   0 "C3'" 1 
ATOM   2033  O  "O3'" . A   A  1  104  ? 55.953  146.489 15.232  1.00 70.95  ? 104  A   0 "O3'" 1 
ATOM   2034  C  "C2'" . A   A  1  104  ? 54.125  148.090 15.013  1.00 70.70  ? 104  A   0 "C2'" 1 
ATOM   2035  O  "O2'" . A   A  1  104  ? 54.465  148.235 13.647  1.00 69.85  ? 104  A   0 "O2'" 1 
ATOM   2036  C  "C1'" . A   A  1  104  ? 52.610  147.927 15.144  1.00 69.99  ? 104  A   0 "C1'" 1 
ATOM   2037  N  N9    . A   A  1  104  ? 52.099  148.547 16.371  1.00 69.50  ? 104  A   0 N9    1 
ATOM   2038  C  C8    . A   A  1  104  ? 51.649  147.927 17.510  1.00 69.15  ? 104  A   0 C8    1 
ATOM   2039  N  N7    . A   A  1  104  ? 51.280  148.757 18.455  1.00 68.55  ? 104  A   0 N7    1 
ATOM   2040  C  C5    . A   A  1  104  ? 51.497  150.010 17.903  1.00 67.80  ? 104  A   0 C5    1 
ATOM   2041  C  C6    . A   A  1  104  ? 51.315  151.310 18.411  1.00 67.20  ? 104  A   0 C6    1 
ATOM   2042  N  N6    . A   A  1  104  ? 50.871  151.565 19.643  1.00 66.88  ? 104  A   0 N6    1 
ATOM   2043  N  N1    . A   A  1  104  ? 51.617  152.349 17.603  1.00 67.16  ? 104  A   0 N1    1 
ATOM   2044  C  C2    . A   A  1  104  ? 52.086  152.088 16.375  1.00 68.50  ? 104  A   0 C2    1 
ATOM   2045  N  N3    . A   A  1  104  ? 52.312  150.911 15.788  1.00 68.74  ? 104  A   0 N3    1 
ATOM   2046  C  C4    . A   A  1  104  ? 51.992  149.899 16.616  1.00 68.73  ? 104  A   0 C4    1 
ATOM   2047  P  P     . G   A  1  105  ? 57.164  146.915 16.208  1.00 70.92  ? 105  G   0 P     1 
ATOM   2048  O  OP1   . G   A  1  105  ? 58.409  146.395 15.581  1.00 70.75  ? 105  G   0 OP1   1 
ATOM   2049  O  OP2   . G   A  1  105  ? 56.820  146.526 17.605  1.00 69.78  ? 105  G   0 OP2   1 
ATOM   2050  O  "O5'" . G   A  1  105  ? 57.191  148.509 16.157  1.00 67.00  ? 105  G   0 "O5'" 1 
ATOM   2051  C  "C5'" . G   A  1  105  ? 57.615  149.185 14.976  1.00 63.88  ? 105  G   0 "C5'" 1 
ATOM   2052  C  "C4'" . G   A  1  105  ? 57.347  150.668 15.074  1.00 62.39  ? 105  G   0 "C4'" 1 
ATOM   2053  O  "O4'" . G   A  1  105  ? 55.974  150.900 15.485  1.00 61.16  ? 105  G   0 "O4'" 1 
ATOM   2054  C  "C3'" . G   A  1  105  ? 58.106  151.484 16.104  1.00 61.40  ? 105  G   0 "C3'" 1 
ATOM   2055  O  "O3'" . G   A  1  105  ? 59.456  151.734 15.725  1.00 61.52  ? 105  G   0 "O3'" 1 
ATOM   2056  C  "C2'" . G   A  1  105  ? 57.293  152.773 16.084  1.00 61.39  ? 105  G   0 "C2'" 1 
ATOM   2057  O  "O2'" . G   A  1  105  ? 57.550  153.564 14.940  1.00 61.12  ? 105  G   0 "O2'" 1 
ATOM   2058  C  "C1'" . G   A  1  105  ? 55.866  152.224 15.997  1.00 60.89  ? 105  G   0 "C1'" 1 
ATOM   2059  N  N9    . G   A  1  105  ? 55.251  152.185 17.321  1.00 59.61  ? 105  G   0 N9    1 
ATOM   2060  C  C8    . G   A  1  105  ? 54.914  151.076 18.059  1.00 59.46  ? 105  G   0 C8    1 
ATOM   2061  N  N7    . G   A  1  105  ? 54.439  151.373 19.240  1.00 59.69  ? 105  G   0 N7    1 
ATOM   2062  C  C5    . G   A  1  105  ? 54.452  152.761 19.279  1.00 58.26  ? 105  G   0 C5    1 
ATOM   2063  C  C6    . G   A  1  105  ? 54.073  153.654 20.312  1.00 58.00  ? 105  G   0 C6    1 
ATOM   2064  O  O6    . G   A  1  105  ? 53.654  153.390 21.442  1.00 57.73  ? 105  G   0 O6    1 
ATOM   2065  N  N1    . G   A  1  105  ? 54.239  154.979 19.928  1.00 58.85  ? 105  G   0 N1    1 
ATOM   2066  C  C2    . G   A  1  105  ? 54.723  155.396 18.713  1.00 58.56  ? 105  G   0 C2    1 
ATOM   2067  N  N2    . G   A  1  105  ? 54.816  156.725 18.538  1.00 57.05  ? 105  G   0 N2    1 
ATOM   2068  N  N3    . G   A  1  105  ? 55.091  154.573 17.745  1.00 57.98  ? 105  G   0 N3    1 
ATOM   2069  C  C4    . G   A  1  105  ? 54.930  153.279 18.095  1.00 58.70  ? 105  G   0 C4    1 
ATOM   2070  P  P     . A   A  1  106  ? 60.515  152.255 16.824  1.00 61.23  ? 106  A   0 P     1 
ATOM   2071  O  OP1   . A   A  1  106  ? 61.784  152.540 16.106  1.00 61.53  ? 106  A   0 OP1   1 
ATOM   2072  O  OP2   . A   A  1  106  ? 60.520  151.313 17.978  1.00 62.00  ? 106  A   0 OP2   1 
ATOM   2073  O  "O5'" . A   A  1  106  ? 59.920  153.648 17.315  1.00 56.96  ? 106  A   0 "O5'" 1 
ATOM   2074  C  "C5'" . A   A  1  106  ? 59.954  154.791 16.455  1.00 54.84  ? 106  A   0 "C5'" 1 
ATOM   2075  C  "C4'" . A   A  1  106  ? 59.649  156.046 17.231  1.00 54.41  ? 106  A   0 "C4'" 1 
ATOM   2076  O  "O4'" . A   A  1  106  ? 58.275  156.025 17.694  1.00 54.50  ? 106  A   0 "O4'" 1 
ATOM   2077  C  "C3'" . A   A  1  106  ? 60.453  156.265 18.500  1.00 53.37  ? 106  A   0 "C3'" 1 
ATOM   2078  O  "O3'" . A   A  1  106  ? 61.753  156.770 18.231  1.00 54.37  ? 106  A   0 "O3'" 1 
ATOM   2079  C  "C2'" . A   A  1  106  ? 59.581  157.258 19.250  1.00 51.87  ? 106  A   0 "C2'" 1 
ATOM   2080  O  "O2'" . A   A  1  106  ? 59.696  158.567 18.746  1.00 49.27  ? 106  A   0 "O2'" 1 
ATOM   2081  C  "C1'" . A   A  1  106  ? 58.184  156.721 18.930  1.00 53.37  ? 106  A   0 "C1'" 1 
ATOM   2082  N  N9    . A   A  1  106  ? 57.722  155.788 19.956  1.00 53.57  ? 106  A   0 N9    1 
ATOM   2083  C  C8    . A   A  1  106  ? 57.736  154.413 19.935  1.00 53.19  ? 106  A   0 C8    1 
ATOM   2084  N  N7    . A   A  1  106  ? 57.275  153.864 21.031  1.00 54.26  ? 106  A   0 N7    1 
ATOM   2085  C  C5    . A   A  1  106  ? 56.931  154.951 21.827  1.00 54.63  ? 106  A   0 C5    1 
ATOM   2086  C  C6    . A   A  1  106  ? 56.385  155.045 23.123  1.00 54.39  ? 106  A   0 C6    1 
ATOM   2087  N  N6    . A   A  1  106  ? 56.079  153.992 23.880  1.00 54.12  ? 106  A   0 N6    1 
ATOM   2088  N  N1    . A   A  1  106  ? 56.162  156.279 23.621  1.00 55.23  ? 106  A   0 N1    1 
ATOM   2089  C  C2    . A   A  1  106  ? 56.470  157.339 22.865  1.00 54.80  ? 106  A   0 C2    1 
ATOM   2090  N  N3    . A   A  1  106  ? 56.985  157.380 21.639  1.00 54.76  ? 106  A   0 N3    1 
ATOM   2091  C  C4    . A   A  1  106  ? 57.194  156.139 21.172  1.00 53.60  ? 106  A   0 C4    1 
ATOM   2092  P  P     . U   A  1  107  ? 62.983  156.325 19.161  1.00 54.83  ? 107  U   0 P     1 
ATOM   2093  O  OP1   . U   A  1  107  ? 64.221  156.891 18.572  1.00 56.03  ? 107  U   0 OP1   1 
ATOM   2094  O  OP2   . U   A  1  107  ? 62.886  154.862 19.369  1.00 56.39  ? 107  U   0 OP2   1 
ATOM   2095  O  "O5'" . U   A  1  107  ? 62.682  157.050 20.551  1.00 54.42  ? 107  U   0 "O5'" 1 
ATOM   2096  C  "C5'" . U   A  1  107  ? 62.452  158.469 20.604  1.00 51.33  ? 107  U   0 "C5'" 1 
ATOM   2097  C  "C4'" . U   A  1  107  ? 61.795  158.863 21.913  1.00 51.19  ? 107  U   0 "C4'" 1 
ATOM   2098  O  "O4'" . U   A  1  107  ? 60.468  158.281 22.019  1.00 51.10  ? 107  U   0 "O4'" 1 
ATOM   2099  C  "C3'" . U   A  1  107  ? 62.467  158.432 23.209  1.00 48.96  ? 107  U   0 "C3'" 1 
ATOM   2100  O  "O3'" . U   A  1  107  ? 63.559  159.263 23.550  1.00 47.60  ? 107  U   0 "O3'" 1 
ATOM   2101  C  "C2'" . U   A  1  107  ? 61.335  158.616 24.206  1.00 49.03  ? 107  U   0 "C2'" 1 
ATOM   2102  O  "O2'" . U   A  1  107  ? 61.130  159.974 24.538  1.00 48.23  ? 107  U   0 "O2'" 1 
ATOM   2103  C  "C1'" . U   A  1  107  ? 60.141  158.107 23.394  1.00 49.44  ? 107  U   0 "C1'" 1 
ATOM   2104  N  N1    . U   A  1  107  ? 59.884  156.681 23.655  1.00 47.60  ? 107  U   0 N1    1 
ATOM   2105  C  C2    . U   A  1  107  ? 59.132  156.353 24.775  1.00 47.20  ? 107  U   0 C2    1 
ATOM   2106  O  O2    . U   A  1  107  ? 58.634  157.183 25.520  1.00 44.88  ? 107  U   0 O2    1 
ATOM   2107  N  N3    . U   A  1  107  ? 58.977  155.011 24.989  1.00 48.98  ? 107  U   0 N3    1 
ATOM   2108  C  C4    . U   A  1  107  ? 59.466  153.986 24.217  1.00 48.80  ? 107  U   0 C4    1 
ATOM   2109  O  O4    . U   A  1  107  ? 59.264  152.824 24.565  1.00 51.89  ? 107  U   0 O4    1 
ATOM   2110  C  C5    . U   A  1  107  ? 60.205  154.402 23.069  1.00 47.64  ? 107  U   0 C5    1 
ATOM   2111  C  C6    . U   A  1  107  ? 60.386  155.701 22.834  1.00 47.28  ? 107  U   0 C6    1 
ATOM   2112  P  P     . U   A  1  108  ? 64.968  158.603 23.935  1.00 49.45  ? 108  U   0 P     1 
ATOM   2113  O  OP1   . U   A  1  108  ? 65.890  159.734 24.208  1.00 49.11  ? 108  U   0 OP1   1 
ATOM   2114  O  OP2   . U   A  1  108  ? 65.334  157.593 22.904  1.00 46.79  ? 108  U   0 OP2   1 
ATOM   2115  O  "O5'" . U   A  1  108  ? 64.674  157.829 25.298  1.00 51.06  ? 108  U   0 "O5'" 1 
ATOM   2116  C  "C5'" . U   A  1  108  ? 64.007  158.479 26.399  1.00 53.27  ? 108  U   0 "C5'" 1 
ATOM   2117  C  "C4'" . U   A  1  108  ? 63.456  157.450 27.360  1.00 53.95  ? 108  U   0 "C4'" 1 
ATOM   2118  O  "O4'" . U   A  1  108  ? 62.387  156.698 26.727  1.00 55.13  ? 108  U   0 "O4'" 1 
ATOM   2119  C  "C3'" . U   A  1  108  ? 64.443  156.384 27.804  1.00 54.24  ? 108  U   0 "C3'" 1 
ATOM   2120  O  "O3'" . U   A  1  108  ? 65.268  156.850 28.863  1.00 52.15  ? 108  U   0 "O3'" 1 
ATOM   2121  C  "C2'" . U   A  1  108  ? 63.523  155.250 28.238  1.00 55.43  ? 108  U   0 "C2'" 1 
ATOM   2122  O  "O2'" . U   A  1  108  ? 62.980  155.445 29.524  1.00 55.62  ? 108  U   0 "O2'" 1 
ATOM   2123  C  "C1'" . U   A  1  108  ? 62.401  155.358 27.201  1.00 56.42  ? 108  U   0 "C1'" 1 
ATOM   2124  N  N1    . U   A  1  108  ? 62.593  154.446 26.061  1.00 58.79  ? 108  U   0 N1    1 
ATOM   2125  C  C2    . U   A  1  108  ? 62.081  153.165 26.172  1.00 59.39  ? 108  U   0 C2    1 
ATOM   2126  O  O2    . U   A  1  108  ? 61.475  152.774 27.153  1.00 60.91  ? 108  U   0 O2    1 
ATOM   2127  N  N3    . U   A  1  108  ? 62.306  152.355 25.088  1.00 60.17  ? 108  U   0 N3    1 
ATOM   2128  C  C4    . U   A  1  108  ? 62.971  152.685 23.924  1.00 60.21  ? 108  U   0 C4    1 
ATOM   2129  O  O4    . U   A  1  108  ? 63.071  151.845 23.024  1.00 62.33  ? 108  U   0 O4    1 
ATOM   2130  C  C5    . U   A  1  108  ? 63.467  154.026 23.880  1.00 58.00  ? 108  U   0 C5    1 
ATOM   2131  C  C6    . U   A  1  108  ? 63.266  154.840 24.920  1.00 58.82  ? 108  U   0 C6    1 
ATOM   2132  P  P     . U   A  1  109  ? 66.767  156.295 29.007  1.00 50.74  ? 109  U   0 P     1 
ATOM   2133  O  OP1   . U   A  1  109  ? 67.475  156.481 27.718  1.00 51.11  ? 109  U   0 OP1   1 
ATOM   2134  O  OP2   . U   A  1  109  ? 66.700  154.942 29.608  1.00 50.70  ? 109  U   0 OP2   1 
ATOM   2135  O  "O5'" . U   A  1  109  ? 67.410  157.275 30.080  1.00 49.79  ? 109  U   0 "O5'" 1 
ATOM   2136  C  "C5'" . U   A  1  109  ? 67.671  158.651 29.774  1.00 48.35  ? 109  U   0 "C5'" 1 
ATOM   2137  C  "C4'" . U   A  1  109  ? 67.863  159.423 31.053  1.00 48.40  ? 109  U   0 "C4'" 1 
ATOM   2138  O  "O4'" . U   A  1  109  ? 66.584  159.569 31.713  1.00 49.58  ? 109  U   0 "O4'" 1 
ATOM   2139  C  "C3'" . U   A  1  109  ? 68.755  158.724 32.066  1.00 47.83  ? 109  U   0 "C3'" 1 
ATOM   2140  O  "O3'" . U   A  1  109  ? 70.117  159.044 31.834  1.00 45.57  ? 109  U   0 "O3'" 1 
ATOM   2141  C  "C2'" . U   A  1  109  ? 68.242  159.269 33.387  1.00 49.33  ? 109  U   0 "C2'" 1 
ATOM   2142  O  "O2'" . U   A  1  109  ? 68.746  160.559 33.657  1.00 50.84  ? 109  U   0 "O2'" 1 
ATOM   2143  C  "C1'" . U   A  1  109  ? 66.739  159.377 33.106  1.00 49.97  ? 109  U   0 "C1'" 1 
ATOM   2144  N  N1    . U   A  1  109  ? 65.913  158.221 33.503  1.00 51.05  ? 109  U   0 N1    1 
ATOM   2145  C  C2    . U   A  1  109  ? 65.923  157.822 34.832  1.00 51.37  ? 109  U   0 C2    1 
ATOM   2146  O  O2    . U   A  1  109  ? 66.636  158.343 35.677  1.00 51.61  ? 109  U   0 O2    1 
ATOM   2147  N  N3    . U   A  1  109  ? 65.068  156.782 35.131  1.00 50.03  ? 109  U   0 N3    1 
ATOM   2148  C  C4    . U   A  1  109  ? 64.238  156.104 34.258  1.00 49.00  ? 109  U   0 C4    1 
ATOM   2149  O  O4    . U   A  1  109  ? 63.488  155.226 34.686  1.00 47.03  ? 109  U   0 O4    1 
ATOM   2150  C  C5    . U   A  1  109  ? 64.310  156.551 32.904  1.00 49.62  ? 109  U   0 C5    1 
ATOM   2151  C  C6    . U   A  1  109  ? 65.122  157.563 32.579  1.00 51.06  ? 109  U   0 C6    1 
ATOM   2152  P  P     . C   A  1  110  ? 71.197  157.871 31.652  1.00 45.97  ? 110  C   0 P     1 
ATOM   2153  O  OP1   . C   A  1  110  ? 72.426  158.484 31.096  1.00 46.57  ? 110  C   0 OP1   1 
ATOM   2154  O  OP2   . C   A  1  110  ? 70.578  156.722 30.953  1.00 46.17  ? 110  C   0 OP2   1 
ATOM   2155  O  "O5'" . C   A  1  110  ? 71.529  157.460 33.148  1.00 46.95  ? 110  C   0 "O5'" 1 
ATOM   2156  C  "C5'" . C   A  1  110  ? 72.135  158.407 34.042  1.00 43.59  ? 110  C   0 "C5'" 1 
ATOM   2157  C  "C4'" . C   A  1  110  ? 72.049  157.910 35.458  1.00 43.80  ? 110  C   0 "C4'" 1 
ATOM   2158  O  "O4'" . C   A  1  110  ? 70.668  157.896 35.897  1.00 45.51  ? 110  C   0 "O4'" 1 
ATOM   2159  C  "C3'" . C   A  1  110  ? 72.522  156.485 35.673  1.00 41.64  ? 110  C   0 "C3'" 1 
ATOM   2160  O  "O3'" . C   A  1  110  ? 73.920  156.466 35.822  1.00 40.29  ? 110  C   0 "O3'" 1 
ATOM   2161  C  "C2'" . C   A  1  110  ? 71.816  156.112 36.963  1.00 44.56  ? 110  C   0 "C2'" 1 
ATOM   2162  O  "O2'" . C   A  1  110  ? 72.436  156.696 38.093  1.00 43.85  ? 110  C   0 "O2'" 1 
ATOM   2163  C  "C1'" . C   A  1  110  ? 70.460  156.788 36.759  1.00 45.98  ? 110  C   0 "C1'" 1 
ATOM   2164  N  N1    . C   A  1  110  ? 69.439  155.906 36.160  1.00 48.15  ? 110  C   0 N1    1 
ATOM   2165  C  C2    . C   A  1  110  ? 68.737  155.024 36.999  1.00 49.70  ? 110  C   0 C2    1 
ATOM   2166  O  O2    . C   A  1  110  ? 69.018  154.991 38.207  1.00 48.06  ? 110  C   0 O2    1 
ATOM   2167  N  N3    . C   A  1  110  ? 67.771  154.233 36.469  1.00 50.89  ? 110  C   0 N3    1 
ATOM   2168  C  C4    . C   A  1  110  ? 67.501  154.294 35.162  1.00 49.67  ? 110  C   0 C4    1 
ATOM   2169  N  N4    . C   A  1  110  ? 66.534  153.511 34.690  1.00 47.78  ? 110  C   0 N4    1 
ATOM   2170  C  C5    . C   A  1  110  ? 68.211  155.167 34.284  1.00 49.39  ? 110  C   0 C5    1 
ATOM   2171  C  C6    . C   A  1  110  ? 69.163  155.945 34.819  1.00 48.38  ? 110  C   0 C6    1 
ATOM   2172  P  P     . C   A  1  111  ? 74.745  155.187 35.356  1.00 42.41  ? 111  C   0 P     1 
ATOM   2173  O  OP1   . C   A  1  111  ? 76.191  155.536 35.406  1.00 39.78  ? 111  C   0 OP1   1 
ATOM   2174  O  OP2   . C   A  1  111  ? 74.148  154.706 34.086  1.00 44.42  ? 111  C   0 OP2   1 
ATOM   2175  O  "O5'" . C   A  1  111  ? 74.436  154.101 36.477  1.00 42.51  ? 111  C   0 "O5'" 1 
ATOM   2176  C  "C5'" . C   A  1  111  ? 74.933  154.246 37.816  1.00 40.01  ? 111  C   0 "C5'" 1 
ATOM   2177  C  "C4'" . C   A  1  111  ? 74.299  153.212 38.718  1.00 40.76  ? 111  C   0 "C4'" 1 
ATOM   2178  O  "O4'" . C   A  1  111  ? 72.852  153.369 38.687  1.00 40.57  ? 111  C   0 "O4'" 1 
ATOM   2179  C  "C3'" . C   A  1  111  ? 74.518  151.753 38.336  1.00 38.13  ? 111  C   0 "C3'" 1 
ATOM   2180  O  "O3'" . C   A  1  111  ? 75.776  151.271 38.801  1.00 35.09  ? 111  C   0 "O3'" 1 
ATOM   2181  C  "C2'" . C   A  1  111  ? 73.355  151.066 39.041  1.00 40.17  ? 111  C   0 "C2'" 1 
ATOM   2182  O  "O2'" . C   A  1  111  ? 73.570  150.862 40.416  1.00 39.38  ? 111  C   0 "O2'" 1 
ATOM   2183  C  "C1'" . C   A  1  111  ? 72.240  152.103 38.881  1.00 42.84  ? 111  C   0 "C1'" 1 
ATOM   2184  N  N1    . C   A  1  111  ? 71.351  151.803 37.743  1.00 46.44  ? 111  C   0 N1    1 
ATOM   2185  C  C2    . C   A  1  111  ? 70.393  150.784 37.892  1.00 46.90  ? 111  C   0 C2    1 
ATOM   2186  O  O2    . C   A  1  111  ? 70.312  150.190 38.976  1.00 46.55  ? 111  C   0 O2    1 
ATOM   2187  N  N3    . C   A  1  111  ? 69.582  150.481 36.853  1.00 48.28  ? 111  C   0 N3    1 
ATOM   2188  C  C4    . C   A  1  111  ? 69.690  151.150 35.703  1.00 48.42  ? 111  C   0 C4    1 
ATOM   2189  N  N4    . C   A  1  111  ? 68.870  150.813 34.709  1.00 48.62  ? 111  C   0 N4    1 
ATOM   2190  C  C5    . C   A  1  111  ? 70.646  152.193 35.524  1.00 48.88  ? 111  C   0 C5    1 
ATOM   2191  C  C6    . C   A  1  111  ? 71.449  152.485 36.560  1.00 47.67  ? 111  C   0 C6    1 
ATOM   2192  P  P     . G   A  1  112  ? 76.469  150.006 38.092  1.00 33.93  ? 112  G   0 P     1 
ATOM   2193  O  OP1   . G   A  1  112  ? 77.469  149.460 39.024  1.00 33.31  ? 112  G   0 OP1   1 
ATOM   2194  O  OP2   . G   A  1  112  ? 76.881  150.370 36.726  1.00 34.93  ? 112  G   0 OP2   1 
ATOM   2195  O  "O5'" . G   A  1  112  ? 75.296  148.935 37.997  1.00 40.31  ? 112  G   0 "O5'" 1 
ATOM   2196  C  "C5'" . G   A  1  112  ? 74.854  148.205 39.165  1.00 38.12  ? 112  G   0 "C5'" 1 
ATOM   2197  C  "C4'" . G   A  1  112  ? 73.729  147.276 38.797  1.00 39.71  ? 112  G   0 "C4'" 1 
ATOM   2198  O  "O4'" . G   A  1  112  ? 72.645  148.050 38.222  1.00 40.59  ? 112  G   0 "O4'" 1 
ATOM   2199  C  "C3'" . G   A  1  112  ? 74.054  146.237 37.735  1.00 38.32  ? 112  G   0 "C3'" 1 
ATOM   2200  O  "O3'" . G   A  1  112  ? 74.636  145.095 38.325  1.00 36.40  ? 112  G   0 "O3'" 1 
ATOM   2201  C  "C2'" . G   A  1  112  ? 72.680  145.912 37.169  1.00 40.42  ? 112  G   0 "C2'" 1 
ATOM   2202  O  "O2'" . G   A  1  112  ? 71.939  145.038 37.996  1.00 40.37  ? 112  G   0 "O2'" 1 
ATOM   2203  C  "C1'" . G   A  1  112  ? 72.008  147.286 37.208  1.00 43.05  ? 112  G   0 "C1'" 1 
ATOM   2204  N  N9    . G   A  1  112  ? 72.083  148.029 35.953  1.00 45.57  ? 112  G   0 N9    1 
ATOM   2205  C  C8    . G   A  1  112  ? 73.063  148.912 35.563  1.00 45.31  ? 112  G   0 C8    1 
ATOM   2206  N  N7    . G   A  1  112  ? 72.815  149.475 34.413  1.00 46.29  ? 112  G   0 N7    1 
ATOM   2207  C  C5    . G   A  1  112  ? 71.606  148.922 34.012  1.00 46.46  ? 112  G   0 C5    1 
ATOM   2208  C  C6    . G   A  1  112  ? 70.825  149.164 32.855  1.00 46.53  ? 112  G   0 C6    1 
ATOM   2209  O  O6    . G   A  1  112  ? 71.035  149.958 31.938  1.00 48.49  ? 112  G   0 O6    1 
ATOM   2210  N  N1    . G   A  1  112  ? 69.686  148.368 32.830  1.00 46.76  ? 112  G   0 N1    1 
ATOM   2211  C  C2    . G   A  1  112  ? 69.336  147.460 33.797  1.00 46.05  ? 112  G   0 C2    1 
ATOM   2212  N  N2    . G   A  1  112  ? 68.213  146.763 33.571  1.00 43.38  ? 112  G   0 N2    1 
ATOM   2213  N  N3    . G   A  1  112  ? 70.040  147.247 34.897  1.00 45.82  ? 112  G   0 N3    1 
ATOM   2214  C  C4    . G   A  1  112  ? 71.156  148.006 34.937  1.00 46.03  ? 112  G   0 C4    1 
ATOM   2215  P  P     . A   A  1  113  ? 76.039  144.549 37.791  1.00 38.76  ? 113  A   0 P     1 
ATOM   2216  O  OP1   . A   A  1  113  ? 76.581  143.625 38.822  1.00 36.74  ? 113  A   0 OP1   1 
ATOM   2217  O  OP2   . A   A  1  113  ? 76.838  145.721 37.368  1.00 39.28  ? 113  A   0 OP2   1 
ATOM   2218  O  "O5'" . A   A  1  113  ? 75.658  143.693 36.501  1.00 38.86  ? 113  A   0 "O5'" 1 
ATOM   2219  C  "C5'" . A   A  1  113  ? 75.254  142.321 36.637  1.00 40.26  ? 113  A   0 "C5'" 1 
ATOM   2220  C  "C4'" . A   A  1  113  ? 75.797  141.478 35.506  1.00 39.47  ? 113  A   0 "C4'" 1 
ATOM   2221  O  "O4'" . A   A  1  113  ? 74.930  141.546 34.347  1.00 41.20  ? 113  A   0 "O4'" 1 
ATOM   2222  C  "C3'" . A   A  1  113  ? 77.140  141.880 34.934  1.00 39.01  ? 113  A   0 "C3'" 1 
ATOM   2223  O  "O3'" . A   A  1  113  ? 78.212  141.502 35.787  1.00 38.03  ? 113  A   0 "O3'" 1 
ATOM   2224  C  "C2'" . A   A  1  113  ? 77.158  141.121 33.607  1.00 38.96  ? 113  A   0 "C2'" 1 
ATOM   2225  O  "O2'" . A   A  1  113  ? 77.584  139.784 33.769  1.00 34.43  ? 113  A   0 "O2'" 1 
ATOM   2226  C  "C1'" . A   A  1  113  ? 75.674  141.154 33.202  1.00 41.85  ? 113  A   0 "C1'" 1 
ATOM   2227  N  N9    . A   A  1  113  ? 75.309  142.036 32.088  1.00 45.30  ? 113  A   0 N9    1 
ATOM   2228  C  C8    . A   A  1  113  ? 75.921  143.191 31.670  1.00 45.99  ? 113  A   0 C8    1 
ATOM   2229  N  N7    . A   A  1  113  ? 75.332  143.761 30.646  1.00 46.58  ? 113  A   0 N7    1 
ATOM   2230  C  C5    . A   A  1  113  ? 74.263  142.924 30.368  1.00 47.46  ? 113  A   0 C5    1 
ATOM   2231  C  C6    . A   A  1  113  ? 73.249  142.972 29.393  1.00 48.28  ? 113  A   0 C6    1 
ATOM   2232  N  N6    . A   A  1  113  ? 73.137  143.943 28.480  1.00 47.77  ? 113  A   0 N6    1 
ATOM   2233  N  N1    . A   A  1  113  ? 72.338  141.976 29.388  1.00 47.72  ? 113  A   0 N1    1 
ATOM   2234  C  C2    . A   A  1  113  ? 72.443  141.011 30.296  1.00 46.18  ? 113  A   0 C2    1 
ATOM   2235  N  N3    . A   A  1  113  ? 73.344  140.854 31.259  1.00 47.88  ? 113  A   0 N3    1 
ATOM   2236  C  C4    . A   A  1  113  ? 74.239  141.856 31.243  1.00 46.75  ? 113  A   0 C4    1 
ATOM   2237  P  P     . A   A  1  114  ? 79.694  142.039 35.484  1.00 37.74  ? 114  A   0 P     1 
ATOM   2238  O  OP1   . A   A  1  114  ? 80.390  141.081 34.571  1.00 36.92  ? 114  A   0 OP1   1 
ATOM   2239  O  OP2   . A   A  1  114  ? 80.307  142.373 36.792  1.00 38.15  ? 114  A   0 OP2   1 
ATOM   2240  O  "O5'" . A   A  1  114  ? 79.447  143.388 34.678  1.00 37.41  ? 114  A   0 "O5'" 1 
ATOM   2241  C  "C5'" . A   A  1  114  ? 79.087  144.608 35.348  1.00 38.54  ? 114  A   0 "C5'" 1 
ATOM   2242  C  "C4'" . A   A  1  114  ? 78.998  145.725 34.346  1.00 38.87  ? 114  A   0 "C4'" 1 
ATOM   2243  O  "O4'" . A   A  1  114  ? 77.825  145.511 33.510  1.00 39.54  ? 114  A   0 "O4'" 1 
ATOM   2244  C  "C3'" . A   A  1  114  ? 78.857  147.135 34.920  1.00 40.59  ? 114  A   0 "C3'" 1 
ATOM   2245  O  "O3'" . A   A  1  114  ? 79.550  148.063 34.081  1.00 40.10  ? 114  A   0 "O3'" 1 
ATOM   2246  C  "C2'" . A   A  1  114  ? 77.360  147.390 34.773  1.00 41.27  ? 114  A   0 "C2'" 1 
ATOM   2247  O  "O2'" . A   A  1  114  ? 77.009  148.752 34.698  1.00 43.99  ? 114  A   0 "O2'" 1 
ATOM   2248  C  "C1'" . A   A  1  114  ? 77.092  146.711 33.438  1.00 41.29  ? 114  A   0 "C1'" 1 
ATOM   2249  N  N9    . A   A  1  114  ? 75.688  146.412 33.172  1.00 42.56  ? 114  A   0 N9    1 
ATOM   2250  C  C8    . A   A  1  114  ? 74.861  145.524 33.805  1.00 43.93  ? 114  A   0 C8    1 
ATOM   2251  N  N7    . A   A  1  114  ? 73.636  145.518 33.336  1.00 46.21  ? 114  A   0 N7    1 
ATOM   2252  C  C5    . A   A  1  114  ? 73.662  146.459 32.319  1.00 44.25  ? 114  A   0 C5    1 
ATOM   2253  C  C6    . A   A  1  114  ? 72.673  146.923 31.426  1.00 44.92  ? 114  A   0 C6    1 
ATOM   2254  N  N6    . A   A  1  114  ? 71.415  146.476 31.406  1.00 44.13  ? 114  A   0 N6    1 
ATOM   2255  N  N1    . A   A  1  114  ? 73.029  147.877 30.540  1.00 45.24  ? 114  A   0 N1    1 
ATOM   2256  C  C2    . A   A  1  114  ? 74.289  148.320 30.550  1.00 45.99  ? 114  A   0 C2    1 
ATOM   2257  N  N3    . A   A  1  114  ? 75.307  147.956 31.329  1.00 46.22  ? 114  A   0 N3    1 
ATOM   2258  C  C4    . A   A  1  114  ? 74.921  147.014 32.204  1.00 43.95  ? 114  A   0 C4    1 
ATOM   2259  P  P     . U   A  1  115  ? 81.159  148.136 34.102  1.00 40.44  ? 115  U   0 P     1 
ATOM   2260  O  OP1   . U   A  1  115  ? 81.740  146.877 34.623  1.00 41.32  ? 115  U   0 OP1   1 
ATOM   2261  O  OP2   . U   A  1  115  ? 81.537  149.423 34.715  1.00 42.85  ? 115  U   0 OP2   1 
ATOM   2262  O  "O5'" . U   A  1  115  ? 81.503  148.215 32.554  1.00 45.24  ? 115  U   0 "O5'" 1 
ATOM   2263  C  "C5'" . U   A  1  115  ? 82.850  148.364 32.070  1.00 45.86  ? 115  U   0 "C5'" 1 
ATOM   2264  C  "C4'" . U   A  1  115  ? 82.866  148.209 30.565  1.00 46.66  ? 115  U   0 "C4'" 1 
ATOM   2265  O  "O4'" . U   A  1  115  ? 82.693  146.811 30.212  1.00 46.70  ? 115  U   0 "O4'" 1 
ATOM   2266  C  "C3'" . U   A  1  115  ? 81.749  148.956 29.850  1.00 48.33  ? 115  U   0 "C3'" 1 
ATOM   2267  O  "O3'" . U   A  1  115  ? 82.180  149.347 28.555  1.00 52.72  ? 115  U   0 "O3'" 1 
ATOM   2268  C  "C2'" . U   A  1  115  ? 80.667  147.892 29.733  1.00 47.64  ? 115  U   0 "C2'" 1 
ATOM   2269  O  "O2'" . U   A  1  115  ? 79.751  148.145 28.686  1.00 48.02  ? 115  U   0 "O2'" 1 
ATOM   2270  C  "C1'" . U   A  1  115  ? 81.504  146.642 29.464  1.00 46.76  ? 115  U   0 "C1'" 1 
ATOM   2271  N  N1    . U   A  1  115  ? 80.853  145.399 29.910  1.00 48.41  ? 115  U   0 N1    1 
ATOM   2272  C  C2    . U   A  1  115  ? 79.915  144.804 29.068  1.00 48.77  ? 115  U   0 C2    1 
ATOM   2273  O  O2    . U   A  1  115  ? 79.630  145.239 27.960  1.00 50.17  ? 115  U   0 O2    1 
ATOM   2274  N  N3    . U   A  1  115  ? 79.321  143.677 29.574  1.00 48.33  ? 115  U   0 N3    1 
ATOM   2275  C  C4    . U   A  1  115  ? 79.556  143.086 30.795  1.00 48.46  ? 115  U   0 C4    1 
ATOM   2276  O  O4    . U   A  1  115  ? 78.854  142.138 31.149  1.00 46.04  ? 115  U   0 O4    1 
ATOM   2277  C  C5    . U   A  1  115  ? 80.554  143.736 31.591  1.00 49.35  ? 115  U   0 C5    1 
ATOM   2278  C  C6    . U   A  1  115  ? 81.150  144.841 31.135  1.00 48.39  ? 115  U   0 C6    1 
ATOM   2279  P  P     . G   A  1  116  ? 82.336  150.906 28.203  1.00 53.05  ? 116  G   0 P     1 
ATOM   2280  O  OP1   . G   A  1  116  ? 81.305  151.704 28.929  1.00 51.87  ? 116  G   0 OP1   1 
ATOM   2281  O  OP2   . G   A  1  116  ? 82.405  150.969 26.719  1.00 53.67  ? 116  G   0 OP2   1 
ATOM   2282  O  "O5'" . G   A  1  116  ? 83.762  151.278 28.800  1.00 50.16  ? 116  G   0 "O5'" 1 
ATOM   2283  C  "C5'" . G   A  1  116  ? 84.953  150.684 28.269  1.00 49.85  ? 116  G   0 "C5'" 1 
ATOM   2284  C  "C4'" . G   A  1  116  ? 86.157  151.456 28.730  1.00 48.82  ? 116  G   0 "C4'" 1 
ATOM   2285  O  "O4'" . G   A  1  116  ? 86.004  152.839 28.325  1.00 47.90  ? 116  G   0 "O4'" 1 
ATOM   2286  C  "C3'" . G   A  1  116  ? 86.336  151.507 30.235  1.00 48.11  ? 116  G   0 "C3'" 1 
ATOM   2287  O  "O3'" . G   A  1  116  ? 87.086  150.380 30.655  1.00 50.33  ? 116  G   0 "O3'" 1 
ATOM   2288  C  "C2'" . G   A  1  116  ? 87.091  152.816 30.422  1.00 48.30  ? 116  G   0 "C2'" 1 
ATOM   2289  O  "O2'" . G   A  1  116  ? 88.453  152.694 30.052  1.00 47.67  ? 116  G   0 "O2'" 1 
ATOM   2290  C  "C1'" . G   A  1  116  ? 86.406  153.697 29.379  1.00 46.07  ? 116  G   0 "C1'" 1 
ATOM   2291  N  N9    . G   A  1  116  ? 85.219  154.419 29.828  1.00 44.12  ? 116  G   0 N9    1 
ATOM   2292  C  C8    . G   A  1  116  ? 83.921  154.140 29.474  1.00 43.69  ? 116  G   0 C8    1 
ATOM   2293  N  N7    . G   A  1  116  ? 83.061  154.990 29.956  1.00 44.00  ? 116  G   0 N7    1 
ATOM   2294  C  C5    . G   A  1  116  ? 83.831  155.879 30.689  1.00 41.65  ? 116  G   0 C5    1 
ATOM   2295  C  C6    . G   A  1  116  ? 83.446  157.019 31.416  1.00 41.68  ? 116  G   0 C6    1 
ATOM   2296  O  O6    . G   A  1  116  ? 82.314  157.491 31.556  1.00 42.91  ? 116  G   0 O6    1 
ATOM   2297  N  N1    . G   A  1  116  ? 84.536  157.635 32.014  1.00 41.89  ? 116  G   0 N1    1 
ATOM   2298  C  C2    . G   A  1  116  ? 85.833  157.205 31.919  1.00 43.05  ? 116  G   0 C2    1 
ATOM   2299  N  N2    . G   A  1  116  ? 86.737  157.931 32.580  1.00 43.39  ? 116  G   0 N2    1 
ATOM   2300  N  N3    . G   A  1  116  ? 86.213  156.139 31.228  1.00 42.88  ? 116  G   0 N3    1 
ATOM   2301  C  C4    . G   A  1  116  ? 85.165  155.529 30.640  1.00 42.79  ? 116  G   0 C4    1 
ATOM   2302  P  P     . A   A  1  117  ? 87.014  149.892 32.181  1.00 51.99  ? 117  A   0 P     1 
ATOM   2303  O  OP1   . A   A  1  117  ? 88.051  148.839 32.322  1.00 50.41  ? 117  A   0 OP1   1 
ATOM   2304  O  OP2   . A   A  1  117  ? 85.603  149.590 32.519  1.00 53.64  ? 117  A   0 OP2   1 
ATOM   2305  O  "O5'" . A   A  1  117  ? 87.445  151.164 33.036  1.00 51.12  ? 117  A   0 "O5'" 1 
ATOM   2306  C  "C5'" . A   A  1  117  ? 88.829  151.507 33.216  1.00 48.90  ? 117  A   0 "C5'" 1 
ATOM   2307  C  "C4'" . A   A  1  117  ? 88.955  152.641 34.202  1.00 47.73  ? 117  A   0 "C4'" 1 
ATOM   2308  O  "O4'" . A   A  1  117  ? 88.328  153.832 33.662  1.00 46.61  ? 117  A   0 "O4'" 1 
ATOM   2309  C  "C3'" . A   A  1  117  ? 88.220  152.432 35.510  1.00 48.59  ? 117  A   0 "C3'" 1 
ATOM   2310  O  "O3'" . A   A  1  117  ? 88.935  151.600 36.404  1.00 50.80  ? 117  A   0 "O3'" 1 
ATOM   2311  C  "C2'" . A   A  1  117  ? 88.062  153.857 36.012  1.00 46.89  ? 117  A   0 "C2'" 1 
ATOM   2312  O  "O2'" . A   A  1  117  ? 89.270  154.375 36.538  1.00 49.65  ? 117  A   0 "O2'" 1 
ATOM   2313  C  "C1'" . A   A  1  117  ? 87.727  154.578 34.710  1.00 43.57  ? 117  A   0 "C1'" 1 
ATOM   2314  N  N9    . A   A  1  117  ? 86.291  154.641 34.453  1.00 40.88  ? 117  A   0 N9    1 
ATOM   2315  C  C8    . A   A  1  117  ? 85.536  153.794 33.677  1.00 40.78  ? 117  A   0 C8    1 
ATOM   2316  N  N7    . A   A  1  117  ? 84.266  154.118 33.621  1.00 39.28  ? 117  A   0 N7    1 
ATOM   2317  C  C5    . A   A  1  117  ? 84.178  155.254 34.411  1.00 39.29  ? 117  A   0 C5    1 
ATOM   2318  C  C6    . A   A  1  117  ? 83.096  156.088 34.751  1.00 38.24  ? 117  A   0 C6    1 
ATOM   2319  N  N6    . A   A  1  117  ? 81.855  155.913 34.301  1.00 36.61  ? 117  A   0 N6    1 
ATOM   2320  N  N1    . A   A  1  117  ? 83.341  157.127 35.575  1.00 38.82  ? 117  A   0 N1    1 
ATOM   2321  C  C2    . A   A  1  117  ? 84.594  157.313 36.016  1.00 41.74  ? 117  A   0 C2    1 
ATOM   2322  N  N3    . A   A  1  117  ? 85.696  156.606 35.759  1.00 41.59  ? 117  A   0 N3    1 
ATOM   2323  C  C4    . A   A  1  117  ? 85.416  155.579 34.941  1.00 40.27  ? 117  A   0 C4    1 
ATOM   2324  P  P     . G   A  1  118  ? 88.126  150.594 37.357  1.00 51.75  ? 118  G   0 P     1 
ATOM   2325  O  OP1   . G   A  1  118  ? 89.140  149.722 38.013  1.00 51.29  ? 118  G   0 OP1   1 
ATOM   2326  O  OP2   . G   A  1  118  ? 87.024  149.985 36.560  1.00 51.60  ? 118  G   0 OP2   1 
ATOM   2327  O  "O5'" . G   A  1  118  ? 87.492  151.544 38.468  1.00 47.39  ? 118  G   0 "O5'" 1 
ATOM   2328  C  "C5'" . G   A  1  118  ? 88.331  152.100 39.479  1.00 45.25  ? 118  G   0 "C5'" 1 
ATOM   2329  C  "C4'" . G   A  1  118  ? 87.703  153.321 40.088  1.00 43.87  ? 118  G   0 "C4'" 1 
ATOM   2330  O  "O4'" . G   A  1  118  ? 87.219  154.204 39.042  1.00 42.91  ? 118  G   0 "O4'" 1 
ATOM   2331  C  "C3'" . G   A  1  118  ? 86.469  153.126 40.940  1.00 42.88  ? 118  G   0 "C3'" 1 
ATOM   2332  O  "O3'" . G   A  1  118  ? 86.797  152.646 42.227  1.00 43.73  ? 118  G   0 "O3'" 1 
ATOM   2333  C  "C2'" . G   A  1  118  ? 85.936  154.548 41.002  1.00 41.59  ? 118  G   0 "C2'" 1 
ATOM   2334  O  "O2'" . G   A  1  118  ? 86.716  155.354 41.861  1.00 40.87  ? 118  G   0 "O2'" 1 
ATOM   2335  C  "C1'" . G   A  1  118  ? 86.162  155.004 39.558  1.00 40.03  ? 118  G   0 "C1'" 1 
ATOM   2336  N  N9    . G   A  1  118  ? 84.965  154.787 38.752  1.00 38.14  ? 118  G   0 N9    1 
ATOM   2337  C  C8    . G   A  1  118  ? 84.781  153.878 37.737  1.00 36.35  ? 118  G   0 C8    1 
ATOM   2338  N  N7    . G   A  1  118  ? 83.573  153.903 37.243  1.00 35.82  ? 118  G   0 N7    1 
ATOM   2339  C  C5    . G   A  1  118  ? 82.926  154.894 37.968  1.00 35.23  ? 118  G   0 C5    1 
ATOM   2340  C  C6    . G   A  1  118  ? 81.586  155.364 37.899  1.00 35.60  ? 118  G   0 C6    1 
ATOM   2341  O  O6    . G   A  1  118  ? 80.675  155.000 37.146  1.00 35.24  ? 118  G   0 O6    1 
ATOM   2342  N  N1    . G   A  1  118  ? 81.351  156.363 38.834  1.00 33.92  ? 118  G   0 N1    1 
ATOM   2343  C  C2    . G   A  1  118  ? 82.282  156.852 39.714  1.00 34.78  ? 118  G   0 C2    1 
ATOM   2344  N  N2    . G   A  1  118  ? 81.875  157.821 40.535  1.00 35.99  ? 118  G   0 N2    1 
ATOM   2345  N  N3    . G   A  1  118  ? 83.525  156.426 39.785  1.00 34.94  ? 118  G   0 N3    1 
ATOM   2346  C  C4    . G   A  1  118  ? 83.776  155.453 38.894  1.00 35.61  ? 118  G   0 C4    1 
ATOM   2347  P  P     . A   A  1  119  ? 85.749  151.716 43.013  1.00 46.74  ? 119  A   0 P     1 
ATOM   2348  O  OP1   . A   A  1  119  ? 86.441  151.321 44.271  1.00 46.66  ? 119  A   0 OP1   1 
ATOM   2349  O  OP2   . A   A  1  119  ? 85.249  150.667 42.083  1.00 45.61  ? 119  A   0 OP2   1 
ATOM   2350  O  "O5'" . A   A  1  119  ? 84.522  152.675 43.369  1.00 42.40  ? 119  A   0 "O5'" 1 
ATOM   2351  C  "C5'" . A   A  1  119  ? 84.650  153.667 44.395  1.00 40.09  ? 119  A   0 "C5'" 1 
ATOM   2352  C  "C4'" . A   A  1  119  ? 83.404  154.508 44.479  1.00 38.29  ? 119  A   0 "C4'" 1 
ATOM   2353  O  "O4'" . A   A  1  119  ? 83.105  155.062 43.174  1.00 39.05  ? 119  A   0 "O4'" 1 
ATOM   2354  C  "C3'" . A   A  1  119  ? 82.127  153.790 44.866  1.00 39.42  ? 119  A   0 "C3'" 1 
ATOM   2355  O  "O3'" . A   A  1  119  ? 82.055  153.641 46.276  1.00 40.52  ? 119  A   0 "O3'" 1 
ATOM   2356  C  "C2'" . A   A  1  119  ? 81.061  154.744 44.343  1.00 38.73  ? 119  A   0 "C2'" 1 
ATOM   2357  O  "O2'" . A   A  1  119  ? 80.879  155.854 45.195  1.00 38.11  ? 119  A   0 "O2'" 1 
ATOM   2358  C  "C1'" . A   A  1  119  ? 81.701  155.216 43.036  1.00 38.34  ? 119  A   0 "C1'" 1 
ATOM   2359  N  N9    . A   A  1  119  ? 81.269  154.435 41.880  1.00 37.67  ? 119  A   0 N9    1 
ATOM   2360  C  C8    . A   A  1  119  ? 81.996  153.527 41.149  1.00 37.25  ? 119  A   0 C8    1 
ATOM   2361  N  N7    . A   A  1  119  ? 81.325  152.990 40.160  1.00 36.70  ? 119  A   0 N7    1 
ATOM   2362  C  C5    . A   A  1  119  ? 80.072  153.581 40.248  1.00 35.41  ? 119  A   0 C5    1 
ATOM   2363  C  C6    . A   A  1  119  ? 78.902  153.430 39.490  1.00 35.83  ? 119  A   0 C6    1 
ATOM   2364  N  N6    . A   A  1  119  ? 78.798  152.613 38.435  1.00 33.03  ? 119  A   0 N6    1 
ATOM   2365  N  N1    . A   A  1  119  ? 77.824  154.159 39.852  1.00 37.13  ? 119  A   0 N1    1 
ATOM   2366  C  C2    . A   A  1  119  ? 77.929  154.985 40.900  1.00 36.19  ? 119  A   0 C2    1 
ATOM   2367  N  N3    . A   A  1  119  ? 78.975  155.218 41.683  1.00 35.49  ? 119  A   0 N3    1 
ATOM   2368  C  C4    . A   A  1  119  ? 80.026  154.473 41.301  1.00 35.99  ? 119  A   0 C4    1 
ATOM   2369  P  P     . A   A  1  120  ? 81.123  152.497 46.920  1.00 39.49  ? 120  A   0 P     1 
ATOM   2370  O  OP1   . A   A  1  120  ? 81.604  152.288 48.302  1.00 40.20  ? 120  A   0 OP1   1 
ATOM   2371  O  OP2   . A   A  1  120  ? 81.080  151.345 45.977  1.00 36.55  ? 120  A   0 OP2   1 
ATOM   2372  O  "O5'" . A   A  1  120  ? 79.692  153.192 47.029  1.00 37.43  ? 120  A   0 "O5'" 1 
ATOM   2373  C  "C5'" . A   A  1  120  ? 78.720  153.042 45.996  1.00 38.12  ? 120  A   0 "C5'" 1 
ATOM   2374  C  "C4'" . A   A  1  120  ? 77.333  152.971 46.594  1.00 39.89  ? 120  A   0 "C4'" 1 
ATOM   2375  O  "O4'" . A   A  1  120  ? 77.401  152.253 47.858  1.00 39.58  ? 120  A   0 "O4'" 1 
ATOM   2376  C  "C3'" . A   A  1  120  ? 76.637  154.275 46.959  1.00 38.68  ? 120  A   0 "C3'" 1 
ATOM   2377  O  "O3'" . A   A  1  120  ? 76.020  154.854 45.805  1.00 40.25  ? 120  A   0 "O3'" 1 
ATOM   2378  C  "C2'" . A   A  1  120  ? 75.596  153.776 47.954  1.00 37.99  ? 120  A   0 "C2'" 1 
ATOM   2379  O  "O2'" . A   A  1  120  ? 74.562  153.061 47.312  1.00 40.04  ? 120  A   0 "O2'" 1 
ATOM   2380  C  "C1'" . A   A  1  120  ? 76.407  152.746 48.741  1.00 36.95  ? 120  A   0 "C1'" 1 
ATOM   2381  N  N9    . A   A  1  120  ? 77.073  153.299 49.921  1.00 35.50  ? 120  A   0 N9    1 
ATOM   2382  C  C8    . A   A  1  120  ? 78.326  152.999 50.405  1.00 34.44  ? 120  A   0 C8    1 
ATOM   2383  N  N7    . A   A  1  120  ? 78.646  153.666 51.486  1.00 33.40  ? 120  A   0 N7    1 
ATOM   2384  C  C5    . A   A  1  120  ? 77.532  154.457 51.732  1.00 32.66  ? 120  A   0 C5    1 
ATOM   2385  C  C6    . A   A  1  120  ? 77.238  155.383 52.742  1.00 33.01  ? 120  A   0 C6    1 
ATOM   2386  N  N6    . A   A  1  120  ? 78.071  155.684 53.734  1.00 33.39  ? 120  A   0 N6    1 
ATOM   2387  N  N1    . A   A  1  120  ? 76.036  155.997 52.703  1.00 33.90  ? 120  A   0 N1    1 
ATOM   2388  C  C2    . A   A  1  120  ? 75.192  155.685 51.717  1.00 34.64  ? 120  A   0 C2    1 
ATOM   2389  N  N3    . A   A  1  120  ? 75.351  154.825 50.714  1.00 36.12  ? 120  A   0 N3    1 
ATOM   2390  C  C4    . A   A  1  120  ? 76.557  154.239 50.780  1.00 33.64  ? 120  A   0 C4    1 
ATOM   2391  P  P     . U   A  1  121  ? 75.511  156.385 45.833  1.00 41.40  ? 121  U   0 P     1 
ATOM   2392  O  OP1   . U   A  1  121  ? 76.689  157.255 45.570  1.00 43.52  ? 121  U   0 OP1   1 
ATOM   2393  O  OP2   . U   A  1  121  ? 74.716  156.597 47.059  1.00 39.29  ? 121  U   0 OP2   1 
ATOM   2394  O  "O5'" . U   A  1  121  ? 74.544  156.490 44.568  1.00 41.41  ? 121  U   0 "O5'" 1 
ATOM   2395  C  "C5'" . U   A  1  121  ? 75.072  156.462 43.216  1.00 42.69  ? 121  U   0 "C5'" 1 
ATOM   2396  C  "C4'" . U   A  1  121  ? 73.974  156.145 42.225  1.00 42.90  ? 121  U   0 "C4'" 1 
ATOM   2397  O  "O4'" . U   A  1  121  ? 73.541  154.783 42.419  1.00 44.41  ? 121  U   0 "O4'" 1 
ATOM   2398  C  "C3'" . U   A  1  121  ? 72.709  156.985 42.355  1.00 44.66  ? 121  U   0 "C3'" 1 
ATOM   2399  O  "O3'" . U   A  1  121  ? 72.843  158.180 41.576  1.00 45.64  ? 121  U   0 "O3'" 1 
ATOM   2400  C  "C2'" . U   A  1  121  ? 71.616  156.076 41.794  1.00 44.36  ? 121  U   0 "C2'" 1 
ATOM   2401  O  "O2'" . U   A  1  121  ? 71.416  156.192 40.404  1.00 45.98  ? 121  U   0 "O2'" 1 
ATOM   2402  C  "C1'" . U   A  1  121  ? 72.164  154.681 42.111  1.00 45.98  ? 121  U   0 "C1'" 1 
ATOM   2403  N  N1    . U   A  1  121  ? 71.477  153.954 43.187  1.00 47.93  ? 121  U   0 N1    1 
ATOM   2404  C  C2    . U   A  1  121  ? 70.487  153.053 42.817  1.00 48.92  ? 121  U   0 C2    1 
ATOM   2405  O  O2    . U   A  1  121  ? 70.180  152.837 41.652  1.00 49.97  ? 121  U   0 O2    1 
ATOM   2406  N  N3    . U   A  1  121  ? 69.869  152.412 43.860  1.00 47.84  ? 121  U   0 N3    1 
ATOM   2407  C  C4    . U   A  1  121  ? 70.127  152.572 45.200  1.00 47.90  ? 121  U   0 C4    1 
ATOM   2408  O  O4    . U   A  1  121  ? 69.418  151.990 46.017  1.00 49.19  ? 121  U   0 O4    1 
ATOM   2409  C  C5    . U   A  1  121  ? 71.170  153.507 45.506  1.00 48.62  ? 121  U   0 C5    1 
ATOM   2410  C  C6    . U   A  1  121  ? 71.793  154.152 44.514  1.00 47.69  ? 121  U   0 C6    1 
ATOM   2411  P  P     . C   A  1  122  ? 71.943  159.473 41.903  1.00 47.63  ? 122  C   0 P     1 
ATOM   2412  O  OP1   . C   A  1  122  ? 71.001  159.162 43.016  1.00 48.26  ? 122  C   0 OP1   1 
ATOM   2413  O  OP2   . C   A  1  122  ? 71.402  159.988 40.622  1.00 45.54  ? 122  C   0 OP2   1 
ATOM   2414  O  "O5'" . C   A  1  122  ? 73.022  160.513 42.435  1.00 47.08  ? 122  C   0 "O5'" 1 
ATOM   2415  C  "C5'" . C   A  1  122  ? 73.950  161.135 41.530  1.00 45.79  ? 122  C   0 "C5'" 1 
ATOM   2416  C  "C4'" . C   A  1  122  ? 75.350  161.009 42.062  1.00 45.18  ? 122  C   0 "C4'" 1 
ATOM   2417  O  "O4'" . C   A  1  122  ? 75.736  159.609 42.066  1.00 42.94  ? 122  C   0 "O4'" 1 
ATOM   2418  C  "C3'" . C   A  1  122  ? 76.438  161.659 41.229  1.00 45.47  ? 122  C   0 "C3'" 1 
ATOM   2419  O  "O3'" . C   A  1  122  ? 76.535  163.053 41.461  1.00 48.07  ? 122  C   0 "O3'" 1 
ATOM   2420  C  "C2'" . C   A  1  122  ? 77.675  160.935 41.729  1.00 43.84  ? 122  C   0 "C2'" 1 
ATOM   2421  O  "O2'" . C   A  1  122  ? 78.088  161.408 42.995  1.00 45.54  ? 122  C   0 "O2'" 1 
ATOM   2422  C  "C1'" . C   A  1  122  ? 77.138  159.510 41.866  1.00 40.59  ? 122  C   0 "C1'" 1 
ATOM   2423  N  N1    . C   A  1  122  ? 77.411  158.702 40.661  1.00 36.96  ? 122  C   0 N1    1 
ATOM   2424  C  C2    . C   A  1  122  ? 78.719  158.247 40.459  1.00 35.85  ? 122  C   0 C2    1 
ATOM   2425  O  O2    . C   A  1  122  ? 79.587  158.550 41.286  1.00 37.63  ? 122  C   0 O2    1 
ATOM   2426  N  N3    . C   A  1  122  ? 79.005  157.496 39.375  1.00 32.72  ? 122  C   0 N3    1 
ATOM   2427  C  C4    . C   A  1  122  ? 78.043  157.186 38.511  1.00 34.14  ? 122  C   0 C4    1 
ATOM   2428  N  N4    . C   A  1  122  ? 78.366  156.407 37.482  1.00 33.32  ? 122  C   0 N4    1 
ATOM   2429  C  C5    . C   A  1  122  ? 76.701  157.651 38.675  1.00 33.95  ? 122  C   0 C5    1 
ATOM   2430  C  C6    . C   A  1  122  ? 76.431  158.397 39.756  1.00 35.01  ? 122  C   0 C6    1 
ATOM   2431  P  P     . U   A  1  123  ? 76.942  164.030 40.253  1.00 50.55  ? 123  U   0 P     1 
ATOM   2432  O  OP1   . U   A  1  123  ? 76.893  165.389 40.845  1.00 49.87  ? 123  U   0 OP1   1 
ATOM   2433  O  OP2   . U   A  1  123  ? 76.092  163.718 39.070  1.00 51.35  ? 123  U   0 OP2   1 
ATOM   2434  O  "O5'" . U   A  1  123  ? 78.442  163.612 39.881  1.00 47.44  ? 123  U   0 "O5'" 1 
ATOM   2435  C  "C5'" . U   A  1  123  ? 79.523  163.886 40.782  1.00 48.52  ? 123  U   0 "C5'" 1 
ATOM   2436  C  "C4'" . U   A  1  123  ? 80.786  163.154 40.370  1.00 49.65  ? 123  U   0 "C4'" 1 
ATOM   2437  O  "O4'" . U   A  1  123  ? 80.479  161.769 40.086  1.00 48.88  ? 123  U   0 "O4'" 1 
ATOM   2438  C  "C3'" . U   A  1  123  ? 81.518  163.555 39.097  1.00 51.01  ? 123  U   0 "C3'" 1 
ATOM   2439  O  "O3'" . U   A  1  123  ? 82.285  164.752 39.280  1.00 57.10  ? 123  U   0 "O3'" 1 
ATOM   2440  C  "C2'" . U   A  1  123  ? 82.457  162.362 38.922  1.00 48.66  ? 123  U   0 "C2'" 1 
ATOM   2441  O  "O2'" . U   A  1  123  ? 83.560  162.410 39.804  1.00 47.93  ? 123  U   0 "O2'" 1 
ATOM   2442  C  "C1'" . U   A  1  123  ? 81.567  161.202 39.374  1.00 45.93  ? 123  U   0 "C1'" 1 
ATOM   2443  N  N1    . U   A  1  123  ? 81.058  160.387 38.260  1.00 41.44  ? 123  U   0 N1    1 
ATOM   2444  C  C2    . U   A  1  123  ? 81.948  159.509 37.657  1.00 39.45  ? 123  U   0 C2    1 
ATOM   2445  O  O2    . U   A  1  123  ? 83.108  159.381 38.020  1.00 36.27  ? 123  U   0 O2    1 
ATOM   2446  N  N3    . U   A  1  123  ? 81.428  158.784 36.616  1.00 39.01  ? 123  U   0 N3    1 
ATOM   2447  C  C4    . U   A  1  123  ? 80.134  158.834 36.128  1.00 41.77  ? 123  U   0 C4    1 
ATOM   2448  O  O4    . U   A  1  123  ? 79.805  158.080 35.203  1.00 43.50  ? 123  U   0 O4    1 
ATOM   2449  C  C5    . U   A  1  123  ? 79.273  159.762 36.805  1.00 39.72  ? 123  U   0 C5    1 
ATOM   2450  C  C6    . U   A  1  123  ? 79.751  160.486 37.821  1.00 41.00  ? 123  U   0 C6    1 
ATOM   2451  P  P     . C   A  1  124  ? 82.863  165.555 38.000  1.00 59.12  ? 124  C   0 P     1 
ATOM   2452  O  OP1   . C   A  1  124  ? 83.473  166.802 38.544  1.00 60.41  ? 124  C   0 OP1   1 
ATOM   2453  O  OP2   . C   A  1  124  ? 81.806  165.646 36.951  1.00 55.75  ? 124  C   0 OP2   1 
ATOM   2454  O  "O5'" . C   A  1  124  ? 84.071  164.660 37.478  1.00 57.75  ? 124  C   0 "O5'" 1 
ATOM   2455  C  "C5'" . C   A  1  124  ? 85.277  164.544 38.258  1.00 59.20  ? 124  C   0 "C5'" 1 
ATOM   2456  C  "C4'" . C   A  1  124  ? 86.272  163.649 37.559  1.00 62.13  ? 124  C   0 "C4'" 1 
ATOM   2457  O  "O4'" . C   A  1  124  ? 85.735  162.301 37.461  1.00 60.70  ? 124  C   0 "O4'" 1 
ATOM   2458  C  "C3'" . C   A  1  124  ? 86.597  164.015 36.119  1.00 64.44  ? 124  C   0 "C3'" 1 
ATOM   2459  O  "O3'" . C   A  1  124  ? 87.564  165.058 36.033  1.00 69.11  ? 124  C   0 "O3'" 1 
ATOM   2460  C  "C2'" . C   A  1  124  ? 87.121  162.695 35.576  1.00 62.63  ? 124  C   0 "C2'" 1 
ATOM   2461  O  "O2'" . C   A  1  124  ? 88.436  162.424 36.025  1.00 63.70  ? 124  C   0 "O2'" 1 
ATOM   2462  C  "C1'" . C   A  1  124  ? 86.164  161.706 36.245  1.00 58.91  ? 124  C   0 "C1'" 1 
ATOM   2463  N  N1    . C   A  1  124  ? 84.977  161.388 35.420  1.00 54.28  ? 124  C   0 N1    1 
ATOM   2464  C  C2    . C   A  1  124  ? 85.057  160.328 34.502  1.00 52.12  ? 124  C   0 C2    1 
ATOM   2465  O  O2    . C   A  1  124  ? 86.129  159.712 34.382  1.00 51.58  ? 124  C   0 O2    1 
ATOM   2466  N  N3    . C   A  1  124  ? 83.966  160.004 33.768  1.00 50.22  ? 124  C   0 N3    1 
ATOM   2467  C  C4    . C   A  1  124  ? 82.830  160.689 33.922  1.00 49.41  ? 124  C   0 C4    1 
ATOM   2468  N  N4    . C   A  1  124  ? 81.772  160.308 33.206  1.00 46.97  ? 124  C   0 N4    1 
ATOM   2469  C  C5    . C   A  1  124  ? 82.727  161.788 34.824  1.00 49.20  ? 124  C   0 C5    1 
ATOM   2470  C  C6    . C   A  1  124  ? 83.813  162.100 35.547  1.00 52.07  ? 124  C   0 C6    1 
ATOM   2471  P  P     . U   A  1  125  ? 87.553  166.052 34.767  1.00 72.93  ? 125  U   0 P     1 
ATOM   2472  O  OP1   . U   A  1  125  ? 88.576  167.081 35.084  1.00 72.52  ? 125  U   0 OP1   1 
ATOM   2473  O  OP2   . U   A  1  125  ? 86.154  166.476 34.447  1.00 70.76  ? 125  U   0 OP2   1 
ATOM   2474  O  "O5'" . U   A  1  125  ? 88.075  165.141 33.565  1.00 73.31  ? 125  U   0 "O5'" 1 
ATOM   2475  C  "C5'" . U   A  1  125  ? 89.457  164.745 33.490  1.00 74.08  ? 125  U   0 "C5'" 1 
ATOM   2476  C  "C4'" . U   A  1  125  ? 89.733  164.001 32.203  1.00 74.84  ? 125  U   0 "C4'" 1 
ATOM   2477  O  "O4'" . U   A  1  125  ? 89.189  162.656 32.265  1.00 74.88  ? 125  U   0 "O4'" 1 
ATOM   2478  C  "C3'" . U   A  1  125  ? 89.136  164.564 30.921  1.00 75.70  ? 125  U   0 "C3'" 1 
ATOM   2479  O  "O3'" . U   A  1  125  ? 89.850  165.697 30.418  1.00 75.80  ? 125  U   0 "O3'" 1 
ATOM   2480  C  "C2'" . U   A  1  125  ? 89.242  163.359 29.992  1.00 75.69  ? 125  U   0 "C2'" 1 
ATOM   2481  O  "O2'" . U   A  1  125  ? 90.558  163.152 29.510  1.00 77.26  ? 125  U   0 "O2'" 1 
ATOM   2482  C  "C1'" . U   A  1  125  ? 88.893  162.212 30.946  1.00 74.09  ? 125  U   0 "C1'" 1 
ATOM   2483  N  N1    . U   A  1  125  ? 87.480  161.799 30.866  1.00 70.91  ? 125  U   0 N1    1 
ATOM   2484  C  C2    . U   A  1  125  ? 87.188  160.662 30.123  1.00 69.65  ? 125  U   0 C2    1 
ATOM   2485  O  O2    . U   A  1  125  ? 88.044  159.992 29.567  1.00 69.87  ? 125  U   0 O2    1 
ATOM   2486  N  N3    . U   A  1  125  ? 85.855  160.339 30.052  1.00 67.59  ? 125  U   0 N3    1 
ATOM   2487  C  C4    . U   A  1  125  ? 84.804  161.015 30.633  1.00 66.24  ? 125  U   0 C4    1 
ATOM   2488  O  O4    . U   A  1  125  ? 83.648  160.642 30.413  1.00 63.70  ? 125  U   0 O4    1 
ATOM   2489  C  C5    . U   A  1  125  ? 85.185  162.165 31.398  1.00 66.23  ? 125  U   0 C5    1 
ATOM   2490  C  C6    . U   A  1  125  ? 86.475  162.510 31.487  1.00 68.21  ? 125  U   0 C6    1 
ATOM   2491  O  "O5'" . A   A  1  128  ? 85.708  161.160 21.188  1.00 96.29  ? 128  A   0 "O5'" 1 
ATOM   2492  C  "C5'" . A   A  1  128