data_1YIT
# 
_entry.id   1YIT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1YIT         
NDB   RR0115       
RCSB  RCSB031561   
WWPDB D_1000031561 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1YHQ unspecified 
'CRYSTAL STRUCTURE OF AZITHROMYCIN BOUND TO THE G2099A MUTANT 50S RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI'        
PDB 1YI2 unspecified 
'CRYSTAL STRUCTURE OF ERYTHROMYCIN BOUND TO THE G2099A MUTANT 50S RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI'        
PDB 1YIJ unspecified 
'CRYSTAL STRUCTURE OF TELITHROMYCIN BOUND TO THE G2099A MUTANT 50S RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI'       
PDB 1YJ9 unspecified 
'CRYSTAL STRUCTURE OF THE MUTANT 50S RIBOSOMAL SUBUNIT OF HALOARCULA MARISMORTUI CONTAINING A THREE RESIDUE DELETION' 
PDB 1N8R unspecified 'CRYSTAL STRUCTURE OF LARGE RIBOSOMAL SUBUNIT IN COMPLEX WITH VIRGINIAMYCIN M' 
PDB 1KHR unspecified 'CRYSTAL STRUCTURE OF LARGE RIBOSOMAL SUBUNIT IN COMPLEX WITH VIRGINIAMYCIN M AND COENZYME A' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YIT 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tu, D.'       1 
'Blaha, G.'    2 
'Moore, P.B.'  3 
'Steitz, T.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            121 
_citation.page_first                257 
_citation.page_last                 ? 
_citation.year                      2005 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15851032 
_citation.pdbx_database_id_DOI      10.1016/J.CELL.2005.02.005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'TU, D.'       1 
primary 'Blaha, G.'    2 
primary 'Moore, P.B.'  3 
primary 'Steitz, T.A.' 4 
# 
_cell.entry_id           1YIT 
_cell.length_a           212.583 
_cell.length_b           299.758 
_cell.length_c           573.560 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1YIT 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn '23S RIBOSOMAL RNA'                   946157.375 1   ? ? ? 'ENCODED BY RRNA OPERON' 
2  polymer     nat '50S RIBOSOMAL PROTEIN L37E'          6330.203   1   ? ? ? ?                        
3  polymer     nat '50S RIBOSOMAL PROTEIN L39E'          6133.090   1   ? ? ? ?                        
4  polymer     nat '50S RIBOSOMAL PROTEIN L44E'          10815.245  1   ? ? ? ?                        
5  polymer     nat 'VIRGINIAMYCIN S1'                    841.907    1   ? ? ? ?                        
6  polymer     syn '5S RIBOSOMAL RNA'                    39303.402  1   ? ? ? ?                        
7  polymer     nat '50S RIBOSOMAL PROTEIN L2P'           25354.688  1   ? ? ? ?                        
8  polymer     nat '50S RIBOSOMAL PROTEIN L3P'           37396.395  1   ? ? ? ?                        
9  polymer     nat '50S RIBOSOMAL PROTEIN L4E'           26442.098  1   ? ? ? ?                        
10 polymer     nat '50S RIBOSOMAL PROTEIN L5P'           19551.693  1   ? ? ? ?                        
11 polymer     nat '50S RIBOSOMAL PROTEIN L6P'           19961.719  1   ? ? ? ?                        
12 polymer     nat '50S RIBOSOMAL PROTEIN L7AE'          12791.941  1   ? ? ? ?                        
13 polymer     nat 'ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG' 37213.805  1   ? ? ? ?                        
14 polymer     nat '50S RIBOSOMAL PROTEIN L10E'          19942.734  1   ? ? ? ?                        
15 polymer     nat '50S RIBOSOMAL PROTEIN L11P'          17097.547  1   ? ? ? ?                        
16 polymer     nat '50S RIBOSOMAL PROTEIN L13P'          16249.214  1   ? ? ? ?                        
17 polymer     nat '50S RIBOSOMAL PROTEIN L14P'          14191.243  1   ? ? ? ?                        
18 polymer     nat '50S RIBOSOMAL PROTEIN L15P'          18005.367  1   ? ? ? ?                        
19 polymer     nat '50S RIBOSOMAL PROTEIN L15E'          22275.055  1   ? ? ? ?                        
20 polymer     nat '50S RIBOSOMAL PROTEIN L18P'          20640.939  1   ? ? ? ?                        
21 polymer     nat '50S RIBOSOMAL PROTEIN L18E'          12438.915  1   ? ? ? ?                        
22 polymer     nat '50S RIBOSOMAL PROTEIN L19E'          16796.514  1   ? ? ? ?                        
23 polymer     nat '50S RIBOSOMAL PROTEIN L21E'          10567.801  1   ? ? ? ?                        
24 polymer     nat '50S RIBOSOMAL PROTEIN L22P'          16966.945  1   ? ? ? ?                        
25 polymer     nat '50S RIBOSOMAL PROTEIN L23P'          9612.537   1   ? ? ? ?                        
26 polymer     nat '50S RIBOSOMAL PROTEIN L24P'          13670.955  1   ? ? ? ?                        
27 polymer     nat '50S RIBOSOMAL PROTEIN L24E'          7233.720   1   ? ? ? ?                        
28 polymer     nat '50S RIBOSOMAL PROTEIN L29P'          7889.863   1   ? ? ? ?                        
29 polymer     nat '50S RIBOSOMAL PROTEIN L30P'          17062.885  1   ? ? ? ?                        
30 polymer     nat '50S RIBOSOMAL PROTEIN L31E'          10384.613  1   ? ? ? ?                        
31 polymer     nat '50S RIBOSOMAL PROTEIN L32E'          26455.727  1   ? ? ? ?                        
32 polymer     nat '50S RIBOSOMAL PROTEIN L37AE'         9409.338   1   ? ? ? ?                        
33 non-polymer syn 'MAGNESIUM ION'                       24.305     118 ? ? ? ?                        
34 non-polymer syn 'POTASSIUM ION'                       39.098     1   ? ? ? ?                        
35 non-polymer syn 'SODIUM ION'                          22.990     85  ? ? ? ?                        
36 non-polymer syn 'CHLORIDE ION'                        35.453     22  ? ? ? ?                        
37 non-polymer syn 'VIRGINIAMYCIN M1'                    525.593    1   ? ? ? ?                        
38 non-polymer syn 'CADMIUM ION'                         112.411    5   ? ? ? ?                        
# 
_entity_name_com.entity_id   5 
_entity_name_com.name        'VIRGINIAMYCIN FACTOR S1, VIRGINIAMYCIN S' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no yes 
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUG(1MA)AAAACGAG
CCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUG
CCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGA
AGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAA
GGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAG
AGCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCG
GGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUU
AAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGC
GUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACU
CAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAA
AAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUC
AGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAU
CAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGU
AAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCG
UACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAG
UUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUA
GUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUC
GUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGU
AGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGU
CUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAG
CAUAGGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGC
GACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCG
CCCUAUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAAC
GAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACC
CUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCC
UGCCCGUGCAGAAGCGGGCAAGGGUGAGGU(OMU)(OMG)UUCGCCUAUUAAAGGAGGUCGUGAGCUGGG(UR3)U
(PSU)AGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACG
AGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAA
GAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGA
CUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
;GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGA
GCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGA
ACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCC
AAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAG
AGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCC
CUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGC
UGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUU
GACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAG
GGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCG
AGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCG
UGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCC
CAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCG
ACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGA
UUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGU
GUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAA
CAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUA
CUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUC
CUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCU
GAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUG
CAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUG
GCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACC
GAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAG
UCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAA
CAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUAC
AAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCG
GCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGG
AGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUA
GGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACU
CUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCU
AUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGG
AACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAG
GGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCC
CGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGU
CGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCAC
UGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAA
ACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAA
CGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA
;
0 ? 
2  'polypeptide(L)'   no no  MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 1 ? 
3  'polypeptide(L)'   no no  MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE 
2 ? 
4  'polypeptide(L)'   no no  
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
3 ? 
5  'polypeptide(L)'   no yes '(MHW)T(DBB)P(MEA)(MHV)(004)' XTTPFXX 8 ? 
6  polyribonucleotide no no  
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC
;
9 ? 
7  'polypeptide(L)'   no no  
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDE
LQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVV
AGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
8  'polypeptide(L)'   no no  
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
;MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPM
RAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKP
DVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNL
GPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPND
QPRLDPEVRYVSNESNQG
;
B ? 
9  'polypeptide(L)'   no no  
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
10 'polypeptide(L)'   no no  
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
;MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEM
AEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNP
ADAVAFIESTYDVEVSE
;
D ? 
11 'polypeptide(L)'   no no  
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
;MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
WEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDV
RVFQDGVYITRKPNRGDA
;
E ? 
12 'polypeptide(L)'   no no  
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
;MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQ
QDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
;
F ? 
13 'polypeptide(L)'   no no  
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
14 'polypeptide(L)'   no no  
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
;MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKEL
GEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKI
TPSCRIKVERGEELLIA
;
H ? 
15 'polypeptide(L)'   no no  
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
;MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAG
FETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEA
QA
;
I ? 
16 'polypeptide(L)'   no no  
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
J ? 
17 'polypeptide(L)'   no no  
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
K ? 
18 'polypeptide(L)'   no no  
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
;MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAAD
DVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDA
DADEE
;
L ? 
19 'polypeptide(L)'   no no  
;MARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG
;
;MARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKA
GRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRV
FRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG
;
M ? 
20 'polypeptide(L)'   no no  
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
;MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMP
SAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLY
SGDFDAADLPEHFDELRETLLDGDIEL
;
N ? 
21 'polypeptide(L)'   no no  
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAV
DFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
O ? 
22 'polypeptide(L)'   no no  
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGS
RKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
P ? 
23 'polypeptide(L)'   no no  
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
;MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGG
KEKTIIVTAAHLRRQE
;
Q ? 
24 'polypeptide(L)'   no no  
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGR
YPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
R ? 
25 'polypeptide(L)'   no no  
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
;MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVAS
RIGVF
;
S ? 
26 'polypeptide(L)'   no no  
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTL
EKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
T ? 
27 'polypeptide(L)'   no no  PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA U ? 
28 'polypeptide(L)'   no no  MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE V ? 
29 'polypeptide(L)'   no no  
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
W ? 
30 'polypeptide(L)'   no no  
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
;MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEE
EGEAIVEAETAE
;
X ? 
31 'polypeptide(L)'   no no  
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
;MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAE
VEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKG
KGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVS
E
;
Y ? 
32 'polypeptide(L)'   no no  
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
;RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSE
DEE
;
Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    G   n 
1  2    U   n 
1  3    U   n 
1  4    G   n 
1  5    G   n 
1  6    C   n 
1  7    U   n 
1  8    A   n 
1  9    C   n 
1  10   U   n 
1  11   A   n 
1  12   U   n 
1  13   G   n 
1  14   C   n 
1  15   C   n 
1  16   A   n 
1  17   G   n 
1  18   C   n 
1  19   U   n 
1  20   G   n 
1  21   G   n 
1  22   U   n 
1  23   G   n 
1  24   G   n 
1  25   A   n 
1  26   U   n 
1  27   U   n 
1  28   G   n 
1  29   C   n 
1  30   U   n 
1  31   C   n 
1  32   G   n 
1  33   G   n 
1  34   C   n 
1  35   U   n 
1  36   C   n 
1  37   A   n 
1  38   G   n 
1  39   G   n 
1  40   C   n 
1  41   G   n 
1  42   C   n 
1  43   U   n 
1  44   G   n 
1  45   A   n 
1  46   U   n 
1  47   G   n 
1  48   A   n 
1  49   A   n 
1  50   G   n 
1  51   G   n 
1  52   A   n 
1  53   C   n 
1  54   G   n 
1  55   U   n 
1  56   G   n 
1  57   C   n 
1  58   C   n 
1  59   A   n 
1  60   A   n 
1  61   G   n 
1  62   C   n 
1  63   U   n 
1  64   G   n 
1  65   C   n 
1  66   G   n 
1  67   A   n 
1  68   U   n 
1  69   A   n 
1  70   A   n 
1  71   G   n 
1  72   C   n 
1  73   U   n 
1  74   G   n 
1  75   U   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   G   n 
1  80   A   n 
1  81   G   n 
1  82   C   n 
1  83   C   n 
1  84   G   n 
1  85   C   n 
1  86   A   n 
1  87   C   n 
1  88   G   n 
1  89   G   n 
1  90   A   n 
1  91   G   n 
1  92   G   n 
1  93   C   n 
1  94   G   n 
1  95   A   n 
1  96   A   n 
1  97   G   n 
1  98   A   n 
1  99   A   n 
1  100  C   n 
1  101  C   n 
1  102  A   n 
1  103  C   n 
1  104  A   n 
1  105  G   n 
1  106  A   n 
1  107  U   n 
1  108  U   n 
1  109  U   n 
1  110  C   n 
1  111  C   n 
1  112  G   n 
1  113  A   n 
1  114  A   n 
1  115  U   n 
1  116  G   n 
1  117  A   n 
1  118  G   n 
1  119  A   n 
1  120  A   n 
1  121  U   n 
1  122  C   n 
1  123  U   n 
1  124  C   n 
1  125  U   n 
1  126  C   n 
1  127  U   n 
1  128  A   n 
1  129  A   n 
1  130  C   n 
1  131  A   n 
1  132  A   n 
1  133  U   n 
1  134  U   n 
1  135  G   n 
1  136  C   n 
1  137  U   n 
1  138  U   n 
1  139  C   n 
1  140  G   n 
1  141  C   n 
1  142  G   n 
1  143  C   n 
1  144  A   n 
1  145  A   n 
1  146  U   n 
1  147  G   n 
1  148  A   n 
1  149  G   n 
1  150  G   n 
1  151  A   n 
1  152  A   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  C   n 
1  157  G   n 
1  158  A   n 
1  159  G   n 
1  160  A   n 
1  161  A   n 
1  162  C   n 
1  163  U   n 
1  164  G   n 
1  165  A   n 
1  166  A   n 
1  167  A   n 
1  168  C   n 
1  169  A   n 
1  170  U   n 
1  171  C   n 
1  172  U   n 
1  173  C   n 
1  174  A   n 
1  175  G   n 
1  176  U   n 
1  177  A   n 
1  178  U   n 
1  179  C   n 
1  180  G   n 
1  181  G   n 
1  182  G   n 
1  183  A   n 
1  184  G   n 
1  185  G   n 
1  186  A   n 
1  187  A   n 
1  188  C   n 
1  189  A   n 
1  190  G   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  A   n 
1  195  C   n 
1  196  G   n 
1  197  C   n 
1  198  A   n 
1  199  A   n 
1  200  C   n 
1  201  G   n 
1  202  U   n 
1  203  G   n 
1  204  A   n 
1  205  U   n 
1  206  G   n 
1  207  U   n 
1  208  C   n 
1  209  G   n 
1  210  U   n 
1  211  U   n 
1  212  A   n 
1  213  G   n 
1  214  U   n 
1  215  A   n 
1  216  A   n 
1  217  C   n 
1  218  C   n 
1  219  G   n 
1  220  C   n 
1  221  G   n 
1  222  A   n 
1  223  G   n 
1  224  U   n 
1  225  G   n 
1  226  A   n 
1  227  A   n 
1  228  C   n 
1  229  G   n 
1  230  C   n 
1  231  G   n 
1  232  A   n 
1  233  U   n 
1  234  A   n 
1  235  C   n 
1  236  A   n 
1  237  G   n 
1  238  C   n 
1  239  C   n 
1  240  C   n 
1  241  A   n 
1  242  A   n 
1  243  A   n 
1  244  C   n 
1  245  C   n 
1  246  G   n 
1  247  A   n 
1  248  A   n 
1  249  G   n 
1  250  C   n 
1  251  C   n 
1  252  C   n 
1  253  U   n 
1  254  C   n 
1  255  A   n 
1  256  C   n 
1  257  G   n 
1  258  G   n 
1  259  G   n 
1  260  C   n 
1  261  A   n 
1  262  A   n 
1  263  U   n 
1  264  G   n 
1  265  U   n 
1  266  G   n 
1  267  G   n 
1  268  U   n 
1  269  G   n 
1  270  U   n 
1  271  C   n 
1  272  A   n 
1  273  G   n 
1  274  G   n 
1  275  G   n 
1  276  C   n 
1  277  U   n 
1  278  A   n 
1  279  C   n 
1  280  C   n 
1  281  U   n 
1  282  C   n 
1  283  U   n 
1  284  C   n 
1  285  A   n 
1  286  U   n 
1  287  C   n 
1  288  A   n 
1  289  G   n 
1  290  C   n 
1  291  C   n 
1  292  G   n 
1  293  A   n 
1  294  C   n 
1  295  C   n 
1  296  G   n 
1  297  U   n 
1  298  C   n 
1  299  U   n 
1  300  U   n 
1  301  C   n 
1  302  A   n 
1  303  C   n 
1  304  G   n 
1  305  A   n 
1  306  A   n 
1  307  G   n 
1  308  U   n 
1  309  C   n 
1  310  U   n 
1  311  C   n 
1  312  U   n 
1  313  U   n 
1  314  G   n 
1  315  G   n 
1  316  A   n 
1  317  A   n 
1  318  U   n 
1  319  A   n 
1  320  G   n 
1  321  A   n 
1  322  G   n 
1  323  C   n 
1  324  G   n 
1  325  U   n 
1  326  G   n 
1  327  A   n 
1  328  U   n 
1  329  A   n 
1  330  C   n 
1  331  A   n 
1  332  G   n 
1  333  G   n 
1  334  G   n 
1  335  U   n 
1  336  G   n 
1  337  A   n 
1  338  C   n 
1  339  A   n 
1  340  A   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  C   n 
1  345  G   n 
1  346  U   n 
1  347  A   n 
1  348  C   n 
1  349  U   n 
1  350  G   n 
1  351  A   n 
1  352  A   n 
1  353  G   n 
1  354  A   n 
1  355  C   n 
1  356  C   n 
1  357  A   n 
1  358  G   n 
1  359  U   n 
1  360  A   n 
1  361  C   n 
1  362  G   n 
1  363  C   n 
1  364  U   n 
1  365  G   n 
1  366  U   n 
1  367  G   n 
1  368  C   n 
1  369  G   n 
1  370  G   n 
1  371  U   n 
1  372  A   n 
1  373  G   n 
1  374  U   n 
1  375  G   n 
1  376  C   n 
1  377  C   n 
1  378  A   n 
1  379  G   n 
1  380  A   n 
1  381  G   n 
1  382  U   n 
1  383  A   n 
1  384  G   n 
1  385  C   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  G   n 
1  391  U   n 
1  392  U   n 
1  393  G   n 
1  394  G   n 
1  395  A   n 
1  396  U   n 
1  397  A   n 
1  398  U   n 
1  399  C   n 
1  400  C   n 
1  401  C   n 
1  402  U   n 
1  403  C   n 
1  404  G   n 
1  405  C   n 
1  406  G   n 
1  407  A   n 
1  408  A   n 
1  409  U   n 
1  410  A   n 
1  411  A   n 
1  412  C   n 
1  413  G   n 
1  414  C   n 
1  415  A   n 
1  416  G   n 
1  417  G   n 
1  418  C   n 
1  419  A   n 
1  420  U   n 
1  421  C   n 
1  422  G   n 
1  423  A   n 
1  424  C   n 
1  425  U   n 
1  426  G   n 
1  427  C   n 
1  428  G   n 
1  429  A   n 
1  430  A   n 
1  431  G   n 
1  432  G   n 
1  433  C   n 
1  434  U   n 
1  435  A   n 
1  436  A   n 
1  437  A   n 
1  438  C   n 
1  439  A   n 
1  440  C   n 
1  441  A   n 
1  442  A   n 
1  443  C   n 
1  444  C   n 
1  445  U   n 
1  446  G   n 
1  447  A   n 
1  448  G   n 
1  449  A   n 
1  450  C   n 
1  451  C   n 
1  452  G   n 
1  453  A   n 
1  454  U   n 
1  455  A   n 
1  456  G   n 
1  457  U   n 
1  458  G   n 
1  459  A   n 
1  460  A   n 
1  461  C   n 
1  462  A   n 
1  463  A   n 
1  464  G   n 
1  465  U   n 
1  466  A   n 
1  467  G   n 
1  468  U   n 
1  469  G   n 
1  470  U   n 
1  471  G   n 
1  472  A   n 
1  473  A   n 
1  474  C   n 
1  475  G   n 
1  476  A   n 
1  477  A   n 
1  478  C   n 
1  479  G   n 
1  480  C   n 
1  481  U   n 
1  482  G   n 
1  483  C   n 
1  484  A   n 
1  485  A   n 
1  486  A   n 
1  487  G   n 
1  488  U   n 
1  489  A   n 
1  490  C   n 
1  491  C   n 
1  492  C   n 
1  493  U   n 
1  494  C   n 
1  495  A   n 
1  496  G   n 
1  497  A   n 
1  498  A   n 
1  499  G   n 
1  500  G   n 
1  501  G   n 
1  502  A   n 
1  503  G   n 
1  504  G   n 
1  505  C   n 
1  506  G   n 
1  507  A   n 
1  508  A   n 
1  509  A   n 
1  510  U   n 
1  511  A   n 
1  512  G   n 
1  513  A   n 
1  514  G   n 
1  515  C   n 
1  516  A   n 
1  517  U   n 
1  518  G   n 
1  519  A   n 
1  520  A   n 
1  521  A   n 
1  522  U   n 
1  523  C   n 
1  524  A   n 
1  525  G   n 
1  526  U   n 
1  527  U   n 
1  528  G   n 
1  529  G   n 
1  530  C   n 
1  531  G   n 
1  532  A   n 
1  533  U   n 
1  534  C   n 
1  535  G   n 
1  536  A   n 
1  537  G   n 
1  538  C   n 
1  539  G   n 
1  540  A   n 
1  541  C   n 
1  542  A   n 
1  543  G   n 
1  544  G   n 
1  545  G   n 
1  546  C   n 
1  547  A   n 
1  548  U   n 
1  549  A   n 
1  550  C   n 
1  551  A   n 
1  552  A   n 
1  553  G   n 
1  554  G   n 
1  555  U   n 
1  556  C   n 
1  557  C   n 
1  558  C   n 
1  559  U   n 
1  560  U   n 
1  561  G   n 
1  562  A   n 
1  563  C   n 
1  564  G   n 
1  565  A   n 
1  566  A   n 
1  567  U   n 
1  568  G   n 
1  569  A   n 
1  570  C   n 
1  571  C   n 
1  572  G   n 
1  573  A   n 
1  574  G   n 
1  575  A   n 
1  576  C   n 
1  577  G   n 
1  578  C   n 
1  579  G   n 
1  580  A   n 
1  581  G   n 
1  582  U   n 
1  583  C   n 
1  584  U   n 
1  585  C   n 
1  586  C   n 
1  587  A   n 
1  588  G   n 
1  589  U   n 
1  590  A   n 
1  591  A   n 
1  592  G   n 
1  593  A   n 
1  594  C   n 
1  595  U   n 
1  596  C   n 
1  597  A   n 
1  598  C   n 
1  599  G   n 
1  600  G   n 
1  601  G   n 
1  602  A   n 
1  603  A   n 
1  604  G   n 
1  605  C   n 
1  606  C   n 
1  607  G   n 
1  608  A   n 
1  609  U   n 
1  610  G   n 
1  611  U   n 
1  612  U   n 
1  613  C   n 
1  614  U   n 
1  615  G   n 
1  616  U   n 
1  617  C   n 
1  618  G   n 
1  619  U   n 
1  620  A   n 
1  621  C   n 
1  622  G   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  U   n 
1  627  G   n 
1  628  1MA n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  A   n 
1  633  C   n 
1  634  G   n 
1  635  A   n 
1  636  G   n 
1  637  C   n 
1  638  C   n 
1  639  A   n 
1  640  G   n 
1  641  G   n 
1  642  G   n 
1  643  A   n 
1  644  G   n 
1  645  U   n 
1  646  G   n 
1  647  U   n 
1  648  G   n 
1  649  U   n 
1  650  C   n 
1  651  U   n 
1  652  G   n 
1  653  U   n 
1  654  A   n 
1  655  U   n 
1  656  G   n 
1  657  G   n 
1  658  C   n 
1  659  A   n 
1  660  A   n 
1  661  G   n 
1  662  U   n 
1  663  C   n 
1  664  U   n 
1  665  A   n 
1  666  A   n 
1  667  C   n 
1  668  C   n 
1  669  G   n 
1  670  G   n 
1  671  A   n 
1  672  G   n 
1  673  U   n 
1  674  A   n 
1  675  U   n 
1  676  C   n 
1  677  C   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  G   n 
1  682  A   n 
1  683  G   n 
1  684  G   n 
1  685  C   n 
1  686  A   n 
1  687  C   n 
1  688  A   n 
1  689  G   n 
1  690  G   n 
1  691  G   n 
1  692  A   n 
1  693  A   n 
1  694  A   n 
1  695  C   n 
1  696  C   n 
1  697  G   n 
1  698  A   n 
1  699  C   n 
1  700  A   n 
1  701  U   n 
1  702  G   n 
1  703  G   n 
1  704  C   n 
1  705  C   n 
1  706  G   n 
1  707  C   n 
1  708  A   n 
1  709  G   n 
1  710  G   n 
1  711  G   n 
1  712  C   n 
1  713  U   n 
1  714  U   n 
1  715  U   n 
1  716  G   n 
1  717  C   n 
1  718  C   n 
1  719  C   n 
1  720  G   n 
1  721  A   n 
1  722  G   n 
1  723  G   n 
1  724  G   n 
1  725  C   n 
1  726  C   n 
1  727  G   n 
1  728  C   n 
1  729  C   n 
1  730  G   n 
1  731  U   n 
1  732  C   n 
1  733  U   n 
1  734  U   n 
1  735  C   n 
1  736  A   n 
1  737  A   n 
1  738  G   n 
1  739  G   n 
1  740  G   n 
1  741  C   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  G   n 
1  746  A   n 
1  747  G   n 
1  748  C   n 
1  749  C   n 
1  750  A   n 
1  751  U   n 
1  752  G   n 
1  753  U   n 
1  754  G   n 
1  755  G   n 
1  756  A   n 
1  757  C   n 
1  758  A   n 
1  759  C   n 
1  760  G   n 
1  761  A   n 
1  762  C   n 
1  763  C   n 
1  764  C   n 
1  765  G   n 
1  766  A   n 
1  767  A   n 
1  768  U   n 
1  769  C   n 
1  770  C   n 
1  771  G   n 
1  772  G   n 
1  773  A   n 
1  774  C   n 
1  775  G   n 
1  776  A   n 
1  777  U   n 
1  778  C   n 
1  779  U   n 
1  780  A   n 
1  781  C   n 
1  782  G   n 
1  783  C   n 
1  784  A   n 
1  785  U   n 
1  786  G   n 
1  787  G   n 
1  788  A   n 
1  789  C   n 
1  790  A   n 
1  791  A   n 
1  792  G   n 
1  793  A   n 
1  794  U   n 
1  795  G   n 
1  796  A   n 
1  797  A   n 
1  798  G   n 
1  799  C   n 
1  800  G   n 
1  801  U   n 
1  802  G   n 
1  803  C   n 
1  804  C   n 
1  805  G   n 
1  806  A   n 
1  807  A   n 
1  808  A   n 
1  809  G   n 
1  810  G   n 
1  811  C   n 
1  812  A   n 
1  813  C   n 
1  814  G   n 
1  815  U   n 
1  816  G   n 
1  817  G   n 
1  818  A   n 
1  819  A   n 
1  820  G   n 
1  821  U   n 
1  822  C   n 
1  823  U   n 
1  824  G   n 
1  825  U   n 
1  826  U   n 
1  827  A   n 
1  828  G   n 
1  829  A   n 
1  830  G   n 
1  831  U   n 
1  832  U   n 
1  833  G   n 
1  834  G   n 
1  835  U   n 
1  836  G   n 
1  837  U   n 
1  838  C   n 
1  839  C   n 
1  840  U   n 
1  841  A   n 
1  842  C   n 
1  843  A   n 
1  844  A   n 
1  845  U   n 
1  846  A   n 
1  847  C   n 
1  848  C   n 
1  849  C   n 
1  850  U   n 
1  851  C   n 
1  852  U   n 
1  853  C   n 
1  854  G   n 
1  855  U   n 
1  856  G   n 
1  857  A   n 
1  858  U   n 
1  859  C   n 
1  860  U   n 
1  861  A   n 
1  862  U   n 
1  863  G   n 
1  864  U   n 
1  865  G   n 
1  866  U   n 
1  867  A   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  G   n 
1  872  U   n 
1  873  G   n 
1  874  A   n 
1  875  A   n 
1  876  A   n 
1  877  G   n 
1  878  G   n 
1  879  C   n 
1  880  C   n 
1  881  C   n 
1  882  A   n 
1  883  U   n 
1  884  C   n 
1  885  G   n 
1  886  A   n 
1  887  G   n 
1  888  U   n 
1  889  C   n 
1  890  C   n 
1  891  G   n 
1  892  G   n 
1  893  C   n 
1  894  A   n 
1  895  A   n 
1  896  C   n 
1  897  A   n 
1  898  G   n 
1  899  C   n 
1  900  U   n 
1  901  G   n 
1  902  G   n 
1  903  U   n 
1  904  U   n 
1  905  C   n 
1  906  C   n 
1  907  A   n 
1  908  A   n 
1  909  U   n 
1  910  C   n 
1  911  G   n 
1  912  A   n 
1  913  A   n 
1  914  A   n 
1  915  C   n 
1  916  A   n 
1  917  U   n 
1  918  G   n 
1  919  U   n 
1  920  C   n 
1  921  G   n 
1  922  A   n 
1  923  A   n 
1  924  G   n 
1  925  C   n 
1  926  A   n 
1  927  U   n 
1  928  G   n 
1  929  A   n 
1  930  C   n 
1  931  C   n 
1  932  U   n 
1  933  C   n 
1  934  C   n 
1  935  G   n 
1  936  C   n 
1  937  C   n 
1  938  G   n 
1  939  A   n 
1  940  G   n 
1  941  G   n 
1  942  U   n 
1  943  A   n 
1  944  G   n 
1  945  U   n 
1  946  C   n 
1  947  U   n 
1  948  G   n 
1  949  U   n 
1  950  G   n 
1  951  A   n 
1  952  G   n 
1  953  G   n 
1  954  U   n 
1  955  A   n 
1  956  G   n 
1  957  A   n 
1  958  G   n 
1  959  C   n 
1  960  G   n 
1  961  A   n 
1  962  C   n 
1  963  C   n 
1  964  G   n 
1  965  A   n 
1  966  U   n 
1  967  U   n 
1  968  G   n 
1  969  G   n 
1  970  U   n 
1  971  G   n 
1  972  U   n 
1  973  G   n 
1  974  U   n 
1  975  C   n 
1  976  C   n 
1  977  G   n 
1  978  C   n 
1  979  C   n 
1  980  U   n 
1  981  C   n 
1  982  C   n 
1  983  G   n 
1  984  A   n 
1  985  G   n 
1  986  A   n 
1  987  G   n 
1  988  G   n 
1  989  A   n 
1  990  G   n 
1  991  U   n 
1  992  C   n 
1  993  G   n 
1  994  G   n 
1  995  C   n 
1  996  A   n 
1  997  C   n 
1  998  A   n 
1  999  C   n 
1  1000 C   n 
1  1001 U   n 
1  1002 G   n 
1  1003 U   n 
1  1004 C   n 
1  1005 A   n 
1  1006 A   n 
1  1007 A   n 
1  1008 C   n 
1  1009 U   n 
1  1010 C   n 
1  1011 C   n 
1  1012 A   n 
1  1013 A   n 
1  1014 A   n 
1  1015 C   n 
1  1016 U   n 
1  1017 U   n 
1  1018 A   n 
1  1019 C   n 
1  1020 A   n 
1  1021 G   n 
1  1022 A   n 
1  1023 C   n 
1  1024 G   n 
1  1025 C   n 
1  1026 U   n 
1  1027 G   n 
1  1028 U   n 
1  1029 U   n 
1  1030 U   n 
1  1031 G   n 
1  1032 A   n 
1  1033 C   n 
1  1034 G   n 
1  1035 C   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 G   n 
1  1040 A   n 
1  1041 U   n 
1  1042 U   n 
1  1043 C   n 
1  1044 C   n 
1  1045 G   n 
1  1046 G   n 
1  1047 U   n 
1  1048 G   n 
1  1049 C   n 
1  1050 G   n 
1  1051 C   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 G   n 
1  1056 U   n 
1  1057 A   n 
1  1058 A   n 
1  1059 G   n 
1  1060 C   n 
1  1061 C   n 
1  1062 U   n 
1  1063 G   n 
1  1064 U   n 
1  1065 G   n 
1  1066 U   n 
1  1067 A   n 
1  1068 C   n 
1  1069 C   n 
1  1070 A   n 
1  1071 G   n 
1  1072 G   n 
1  1073 A   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 G   n 
1  1078 A   n 
1  1079 A   n 
1  1080 C   n 
1  1081 A   n 
1  1082 A   n 
1  1083 C   n 
1  1084 C   n 
1  1085 C   n 
1  1086 A   n 
1  1087 G   n 
1  1088 A   n 
1  1089 G   n 
1  1090 A   n 
1  1091 U   n 
1  1092 A   n 
1  1093 G   n 
1  1094 G   n 
1  1095 U   n 
1  1096 U   n 
1  1097 A   n 
1  1098 A   n 
1  1099 G   n 
1  1100 G   n 
1  1101 U   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 C   n 
1  1106 A   n 
1  1107 A   n 
1  1108 G   n 
1  1109 U   n 
1  1110 G   n 
1  1111 U   n 
1  1112 G   n 
1  1113 G   n 
1  1114 A   n 
1  1115 U   n 
1  1116 U   n 
1  1117 A   n 
1  1118 A   n 
1  1119 G   n 
1  1120 U   n 
1  1121 G   n 
1  1122 U   n 
1  1123 A   n 
1  1124 A   n 
1  1125 U   n 
1  1126 C   n 
1  1127 C   n 
1  1128 U   n 
1  1129 C   n 
1  1130 U   n 
1  1131 G   n 
1  1132 A   n 
1  1133 A   n 
1  1134 G   n 
1  1135 G   n 
1  1136 U   n 
1  1137 G   n 
1  1138 G   n 
1  1139 U   n 
1  1140 C   n 
1  1141 U   n 
1  1142 C   n 
1  1143 G   n 
1  1144 A   n 
1  1145 G   n 
1  1146 C   n 
1  1147 C   n 
1  1148 C   n 
1  1149 U   n 
1  1150 A   n 
1  1151 G   n 
1  1152 A   n 
1  1153 C   n 
1  1154 A   n 
1  1155 G   n 
1  1156 C   n 
1  1157 C   n 
1  1158 G   n 
1  1159 G   n 
1  1160 G   n 
1  1161 A   n 
1  1162 G   n 
1  1163 G   n 
1  1164 U   n 
1  1165 G   n 
1  1166 A   n 
1  1167 G   n 
1  1168 C   n 
1  1169 U   n 
1  1170 U   n 
1  1171 A   n 
1  1172 G   n 
1  1173 A   n 
1  1174 A   n 
1  1175 G   n 
1  1176 C   n 
1  1177 A   n 
1  1178 G   n 
1  1179 C   n 
1  1180 U   n 
1  1181 A   n 
1  1182 C   n 
1  1183 C   n 
1  1184 C   n 
1  1185 U   n 
1  1186 C   n 
1  1187 U   n 
1  1188 A   n 
1  1189 A   n 
1  1190 G   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 A   n 
1  1195 G   n 
1  1196 C   n 
1  1197 G   n 
1  1198 U   n 
1  1199 A   n 
1  1200 A   n 
1  1201 C   n 
1  1202 A   n 
1  1203 G   n 
1  1204 C   n 
1  1205 U   n 
1  1206 U   n 
1  1207 A   n 
1  1208 C   n 
1  1209 C   n 
1  1210 G   n 
1  1211 G   n 
1  1212 C   n 
1  1213 C   n 
1  1214 G   n 
1  1215 A   n 
1  1216 G   n 
1  1217 G   n 
1  1218 U   n 
1  1219 U   n 
1  1220 U   n 
1  1221 G   n 
1  1222 A   n 
1  1223 G   n 
1  1224 G   n 
1  1225 C   n 
1  1226 G   n 
1  1227 C   n 
1  1228 C   n 
1  1229 C   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 A   n 
1  1234 U   n 
1  1235 G   n 
1  1236 A   n 
1  1237 U   n 
1  1238 C   n 
1  1239 G   n 
1  1240 G   n 
1  1241 G   n 
1  1242 A   n 
1  1243 C   n 
1  1244 U   n 
1  1245 C   n 
1  1246 A   n 
1  1247 A   n 
1  1248 A   n 
1  1249 U   n 
1  1250 C   n 
1  1251 C   n 
1  1252 A   n 
1  1253 C   n 
1  1254 C   n 
1  1255 A   n 
1  1256 C   n 
1  1257 C   n 
1  1258 G   n 
1  1259 A   n 
1  1260 G   n 
1  1261 A   n 
1  1262 C   n 
1  1263 C   n 
1  1264 U   n 
1  1265 G   n 
1  1266 U   n 
1  1267 C   n 
1  1268 C   n 
1  1269 G   n 
1  1270 U   n 
1  1271 A   n 
1  1272 C   n 
1  1273 C   n 
1  1274 A   n 
1  1275 C   n 
1  1276 U   n 
1  1277 C   n 
1  1278 A   n 
1  1279 U   n 
1  1280 A   n 
1  1281 C   n 
1  1282 U   n 
1  1283 G   n 
1  1284 G   n 
1  1285 U   n 
1  1286 A   n 
1  1287 A   n 
1  1288 U   n 
1  1289 C   n 
1  1290 G   n 
1  1291 A   n 
1  1292 G   n 
1  1293 U   n 
1  1294 A   n 
1  1295 G   n 
1  1296 A   n 
1  1297 U   n 
1  1298 U   n 
1  1299 G   n 
1  1300 G   n 
1  1301 C   n 
1  1302 G   n 
1  1303 C   n 
1  1304 U   n 
1  1305 C   n 
1  1306 U   n 
1  1307 A   n 
1  1308 A   n 
1  1309 U   n 
1  1310 U   n 
1  1311 G   n 
1  1312 G   n 
1  1313 A   n 
1  1314 U   n 
1  1315 G   n 
1  1316 G   n 
1  1317 A   n 
1  1318 A   n 
1  1319 G   n 
1  1320 C   n 
1  1321 A   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 G   n 
1  1326 C   n 
1  1327 G   n 
1  1328 A   n 
1  1329 G   n 
1  1330 A   n 
1  1331 G   n 
1  1332 C   n 
1  1333 U   n 
1  1334 C   n 
1  1335 C   n 
1  1336 U   n 
1  1337 G   n 
1  1338 U   n 
1  1339 G   n 
1  1340 G   n 
1  1341 A   n 
1  1342 C   n 
1  1343 C   n 
1  1344 G   n 
1  1345 A   n 
1  1346 U   n 
1  1347 U   n 
1  1348 A   n 
1  1349 G   n 
1  1350 U   n 
1  1351 G   n 
1  1352 A   n 
1  1353 C   n 
1  1354 G   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 A   n 
1  1359 U   n 
1  1360 C   n 
1  1361 C   n 
1  1362 U   n 
1  1363 G   n 
1  1364 G   n 
1  1365 C   n 
1  1366 C   n 
1  1367 A   n 
1  1368 U   n 
1  1369 A   n 
1  1370 G   n 
1  1371 U   n 
1  1372 A   n 
1  1373 G   n 
1  1374 C   n 
1  1375 A   n 
1  1376 G   n 
1  1377 C   n 
1  1378 G   n 
1  1379 A   n 
1  1380 U   n 
1  1381 A   n 
1  1382 G   n 
1  1383 U   n 
1  1384 C   n 
1  1385 G   n 
1  1386 G   n 
1  1387 G   n 
1  1388 U   n 
1  1389 G   n 
1  1390 A   n 
1  1391 G   n 
1  1392 A   n 
1  1393 A   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 C   n 
1  1398 G   n 
1  1399 A   n 
1  1400 C   n 
1  1401 G   n 
1  1402 G   n 
1  1403 C   n 
1  1404 C   n 
1  1405 U   n 
1  1406 A   n 
1  1407 A   n 
1  1408 U   n 
1  1409 G   n 
1  1410 G   n 
1  1411 A   n 
1  1412 U   n 
1  1413 A   n 
1  1414 A   n 
1  1415 G   n 
1  1416 G   n 
1  1417 G   n 
1  1418 U   n 
1  1419 U   n 
1  1420 C   n 
1  1421 C   n 
1  1422 U   n 
1  1423 C   n 
1  1424 A   n 
1  1425 G   n 
1  1426 C   n 
1  1427 A   n 
1  1428 C   n 
1  1429 U   n 
1  1430 G   n 
1  1431 C   n 
1  1432 U   n 
1  1433 G   n 
1  1434 A   n 
1  1435 U   n 
1  1436 C   n 
1  1437 A   n 
1  1438 G   n 
1  1439 C   n 
1  1440 U   n 
1  1441 G   n 
1  1442 A   n 
1  1443 G   n 
1  1444 G   n 
1  1445 G   n 
1  1446 U   n 
1  1447 U   n 
1  1448 A   n 
1  1449 G   n 
1  1450 C   n 
1  1451 C   n 
1  1452 G   n 
1  1453 G   n 
1  1454 U   n 
1  1455 C   n 
1  1456 C   n 
1  1457 U   n 
1  1458 A   n 
1  1459 A   n 
1  1460 G   n 
1  1461 U   n 
1  1462 C   n 
1  1463 U   n 
1  1464 C   n 
1  1465 A   n 
1  1466 C   n 
1  1467 C   n 
1  1468 G   n 
1  1469 C   n 
1  1470 A   n 
1  1471 A   n 
1  1472 C   n 
1  1473 U   n 
1  1474 C   n 
1  1475 G   n 
1  1476 A   n 
1  1477 C   n 
1  1478 U   n 
1  1479 G   n 
1  1480 A   n 
1  1481 G   n 
1  1482 A   n 
1  1483 C   n 
1  1484 G   n 
1  1485 A   n 
1  1486 A   n 
1  1487 A   n 
1  1488 U   n 
1  1489 G   n 
1  1490 G   n 
1  1491 G   n 
1  1492 A   n 
1  1493 A   n 
1  1494 A   n 
1  1495 C   n 
1  1496 A   n 
1  1497 G   n 
1  1498 G   n 
1  1499 U   n 
1  1500 U   n 
1  1501 A   n 
1  1502 A   n 
1  1503 U   n 
1  1504 A   n 
1  1505 U   n 
1  1506 U   n 
1  1507 C   n 
1  1508 C   n 
1  1509 U   n 
1  1510 G   n 
1  1511 U   n 
1  1512 G   n 
1  1513 C   n 
1  1514 C   n 
1  1515 A   n 
1  1516 U   n 
1  1517 C   n 
1  1518 A   n 
1  1519 U   n 
1  1520 G   n 
1  1521 C   n 
1  1522 A   n 
1  1523 G   n 
1  1524 U   n 
1  1525 G   n 
1  1526 A   n 
1  1527 A   n 
1  1528 A   n 
1  1529 G   n 
1  1530 U   n 
1  1531 U   n 
1  1532 G   n 
1  1533 A   n 
1  1534 C   n 
1  1535 G   n 
1  1536 C   n 
1  1537 C   n 
1  1538 C   n 
1  1539 U   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 G   n 
1  1544 U   n 
1  1545 C   n 
1  1546 G   n 
1  1547 A   n 
1  1548 U   n 
1  1549 C   n 
1  1550 A   n 
1  1551 C   n 
1  1552 G   n 
1  1553 C   n 
1  1554 C   n 
1  1555 G   n 
1  1556 G   n 
1  1557 G   n 
1  1558 C   n 
1  1559 A   n 
1  1560 U   n 
1  1561 U   n 
1  1562 C   n 
1  1563 G   n 
1  1564 C   n 
1  1565 C   n 
1  1566 C   n 
1  1567 G   n 
1  1568 G   n 
1  1569 U   n 
1  1570 C   n 
1  1571 G   n 
1  1572 A   n 
1  1573 A   n 
1  1574 C   n 
1  1575 C   n 
1  1576 G   n 
1  1577 U   n 
1  1578 C   n 
1  1579 C   n 
1  1580 A   n 
1  1581 A   n 
1  1582 C   n 
1  1583 U   n 
1  1584 C   n 
1  1585 C   n 
1  1586 G   n 
1  1587 U   n 
1  1588 G   n 
1  1589 G   n 
1  1590 A   n 
1  1591 A   n 
1  1592 G   n 
1  1593 C   n 
1  1594 C   n 
1  1595 G   n 
1  1596 U   n 
1  1597 A   n 
1  1598 A   n 
1  1599 U   n 
1  1600 G   n 
1  1601 G   n 
1  1602 C   n 
1  1603 A   n 
1  1604 G   n 
1  1605 G   n 
1  1606 A   n 
1  1607 A   n 
1  1608 G   n 
1  1609 C   n 
1  1610 G   n 
1  1611 G   n 
1  1612 A   n 
1  1613 C   n 
1  1614 G   n 
1  1615 A   n 
1  1616 A   n 
1  1617 C   n 
1  1618 G   n 
1  1619 G   n 
1  1620 C   n 
1  1621 G   n 
1  1622 G   n 
1  1623 C   n 
1  1624 A   n 
1  1625 U   n 
1  1626 A   n 
1  1627 G   n 
1  1628 G   n 
1  1629 G   n 
1  1630 A   n 
1  1631 A   n 
1  1632 A   n 
1  1633 C   n 
1  1634 G   n 
1  1635 U   n 
1  1636 G   n 
1  1637 A   n 
1  1638 U   n 
1  1639 U   n 
1  1640 C   n 
1  1641 A   n 
1  1642 A   n 
1  1643 C   n 
1  1644 C   n 
1  1645 U   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 G   n 
1  1650 C   n 
1  1651 C   n 
1  1652 C   n 
1  1653 A   n 
1  1654 U   n 
1  1655 G   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 A   n 
1  1660 G   n 
1  1661 A   n 
1  1662 C   n 
1  1663 G   n 
1  1664 A   n 
1  1665 G   n 
1  1666 C   n 
1  1667 A   n 
1  1668 U   n 
1  1669 G   n 
1  1670 A   n 
1  1671 U   n 
1  1672 G   n 
1  1673 U   n 
1  1674 C   n 
1  1675 C   n 
1  1676 G   n 
1  1677 U   n 
1  1678 A   n 
1  1679 C   n 
1  1680 C   n 
1  1681 G   n 
1  1682 A   n 
1  1683 G   n 
1  1684 A   n 
1  1685 A   n 
1  1686 C   n 
1  1687 C   n 
1  1688 G   n 
1  1689 A   n 
1  1690 C   n 
1  1691 A   n 
1  1692 C   n 
1  1693 A   n 
1  1694 G   n 
1  1695 G   n 
1  1696 U   n 
1  1697 G   n 
1  1698 U   n 
1  1699 C   n 
1  1700 C   n 
1  1701 A   n 
1  1702 U   n 
1  1703 G   n 
1  1704 G   n 
1  1705 C   n 
1  1706 G   n 
1  1707 G   n 
1  1708 C   n 
1  1709 G   n 
1  1710 A   n 
1  1711 A   n 
1  1712 A   n 
1  1713 G   n 
1  1714 C   n 
1  1715 C   n 
1  1716 A   n 
1  1717 A   n 
1  1718 G   n 
1  1719 G   n 
1  1720 C   n 
1  1721 C   n 
1  1722 U   n 
1  1723 G   n 
1  1724 U   n 
1  1725 C   n 
1  1726 G   n 
1  1727 G   n 
1  1728 G   n 
1  1729 A   n 
1  1730 G   n 
1  1731 C   n 
1  1732 A   n 
1  1733 A   n 
1  1734 C   n 
1  1735 C   n 
1  1736 A   n 
1  1737 A   n 
1  1738 C   n 
1  1739 G   n 
1  1740 U   n 
1  1741 U   n 
1  1742 A   n 
1  1743 G   n 
1  1744 G   n 
1  1745 G   n 
1  1746 A   n 
1  1747 A   n 
1  1748 U   n 
1  1749 U   n 
1  1750 C   n 
1  1751 G   n 
1  1752 G   n 
1  1753 C   n 
1  1754 A   n 
1  1755 A   n 
1  1756 G   n 
1  1757 U   n 
1  1758 U   n 
1  1759 A   n 
1  1760 G   n 
1  1761 U   n 
1  1762 C   n 
1  1763 C   n 
1  1764 C   n 
1  1765 G   n 
1  1766 U   n 
1  1767 A   n 
1  1768 C   n 
1  1769 C   n 
1  1770 U   n 
1  1771 U   n 
1  1772 C   n 
1  1773 G   n 
1  1774 G   n 
1  1775 A   n 
1  1776 A   n 
1  1777 G   n 
1  1778 A   n 
1  1779 A   n 
1  1780 G   n 
1  1781 G   n 
1  1782 G   n 
1  1783 A   n 
1  1784 U   n 
1  1785 G   n 
1  1786 C   n 
1  1787 C   n 
1  1788 U   n 
1  1789 G   n 
1  1790 C   n 
1  1791 U   n 
1  1792 C   n 
1  1793 C   n 
1  1794 G   n 
1  1795 G   n 
1  1796 A   n 
1  1797 A   n 
1  1798 C   n 
1  1799 G   n 
1  1800 G   n 
1  1801 A   n 
1  1802 G   n 
1  1803 C   n 
1  1804 A   n 
1  1805 G   n 
1  1806 G   n 
1  1807 U   n 
1  1808 C   n 
1  1809 G   n 
1  1810 C   n 
1  1811 A   n 
1  1812 G   n 
1  1813 U   n 
1  1814 G   n 
1  1815 A   n 
1  1816 C   n 
1  1817 U   n 
1  1818 C   n 
1  1819 G   n 
1  1820 G   n 
1  1821 A   n 
1  1822 A   n 
1  1823 G   n 
1  1824 C   n 
1  1825 U   n 
1  1826 C   n 
1  1827 G   n 
1  1828 G   n 
1  1829 A   n 
1  1830 C   n 
1  1831 U   n 
1  1832 G   n 
1  1833 U   n 
1  1834 C   n 
1  1835 U   n 
1  1836 A   n 
1  1837 G   n 
1  1838 U   n 
1  1839 A   n 
1  1840 A   n 
1  1841 C   n 
1  1842 A   n 
1  1843 A   n 
1  1844 C   n 
1  1845 A   n 
1  1846 U   n 
1  1847 A   n 
1  1848 G   n 
1  1849 G   n 
1  1850 U   n 
1  1851 G   n 
1  1852 A   n 
1  1853 C   n 
1  1854 C   n 
1  1855 G   n 
1  1856 C   n 
1  1857 A   n 
1  1858 A   n 
1  1859 A   n 
1  1860 U   n 
1  1861 C   n 
1  1862 C   n 
1  1863 G   n 
1  1864 C   n 
1  1865 A   n 
1  1866 A   n 
1  1867 G   n 
1  1868 G   n 
1  1869 A   n 
1  1870 C   n 
1  1871 U   n 
1  1872 C   n 
1  1873 G   n 
1  1874 U   n 
1  1875 A   n 
1  1876 C   n 
1  1877 G   n 
1  1878 G   n 
1  1879 U   n 
1  1880 C   n 
1  1881 A   n 
1  1882 C   n 
1  1883 U   n 
1  1884 G   n 
1  1885 A   n 
1  1886 A   n 
1  1887 U   n 
1  1888 C   n 
1  1889 C   n 
1  1890 U   n 
1  1891 G   n 
1  1892 C   n 
1  1893 C   n 
1  1894 C   n 
1  1895 A   n 
1  1896 G   n 
1  1897 U   n 
1  1898 G   n 
1  1899 C   n 
1  1900 A   n 
1  1901 G   n 
1  1902 G   n 
1  1903 U   n 
1  1904 A   n 
1  1905 U   n 
1  1906 C   n 
1  1907 U   n 
1  1908 G   n 
1  1909 A   n 
1  1910 A   n 
1  1911 C   n 
1  1912 A   n 
1  1913 C   n 
1  1914 C   n 
1  1915 U   n 
1  1916 C   n 
1  1917 G   n 
1  1918 U   n 
1  1919 A   n 
1  1920 C   n 
1  1921 A   n 
1  1922 A   n 
1  1923 G   n 
1  1924 A   n 
1  1925 G   n 
1  1926 G   n 
1  1927 A   n 
1  1928 C   n 
1  1929 G   n 
1  1930 A   n 
1  1931 A   n 
1  1932 G   n 
1  1933 G   n 
1  1934 A   n 
1  1935 C   n 
1  1936 C   n 
1  1937 U   n 
1  1938 G   n 
1  1939 U   n 
1  1940 C   n 
1  1941 A   n 
1  1942 A   n 
1  1943 C   n 
1  1944 G   n 
1  1945 G   n 
1  1946 C   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 G   n 
1  1952 U   n 
1  1953 A   n 
1  1954 A   n 
1  1955 C   n 
1  1956 U   n 
1  1957 A   n 
1  1958 U   n 
1  1959 G   n 
1  1960 A   n 
1  1961 C   n 
1  1962 C   n 
1  1963 C   n 
1  1964 U   n 
1  1965 C   n 
1  1966 U   n 
1  1967 U   n 
1  1968 A   n 
1  1969 A   n 
1  1970 G   n 
1  1971 G   n 
1  1972 U   n 
1  1973 A   n 
1  1974 G   n 
1  1975 C   n 
1  1976 G   n 
1  1977 U   n 
1  1978 A   n 
1  1979 G   n 
1  1980 U   n 
1  1981 A   n 
1  1982 C   n 
1  1983 C   n 
1  1984 U   n 
1  1985 U   n 
1  1986 G   n 
1  1987 C   n 
1  1988 C   n 
1  1989 G   n 
1  1990 C   n 
1  1991 A   n 
1  1992 U   n 
1  1993 C   n 
1  1994 A   n 
1  1995 G   n 
1  1996 U   n 
1  1997 A   n 
1  1998 G   n 
1  1999 C   n 
1  2000 G   n 
1  2001 G   n 
1  2002 C   n 
1  2003 U   n 
1  2004 U   n 
1  2005 G   n 
1  2006 C   n 
1  2007 A   n 
1  2008 U   n 
1  2009 G   n 
1  2010 A   n 
1  2011 A   n 
1  2012 U   n 
1  2013 G   n 
1  2014 G   n 
1  2015 A   n 
1  2016 U   n 
1  2017 U   n 
1  2018 A   n 
1  2019 A   n 
1  2020 C   n 
1  2021 C   n 
1  2022 A   n 
1  2023 G   n 
1  2024 A   n 
1  2025 G   n 
1  2026 C   n 
1  2027 U   n 
1  2028 U   n 
1  2029 C   n 
1  2030 A   n 
1  2031 C   n 
1  2032 U   n 
1  2033 G   n 
1  2034 U   n 
1  2035 C   n 
1  2036 C   n 
1  2037 C   n 
1  2038 A   n 
1  2039 A   n 
1  2040 C   n 
1  2041 G   n 
1  2042 U   n 
1  2043 U   n 
1  2044 G   n 
1  2045 G   n 
1  2046 G   n 
1  2047 C   n 
1  2048 C   n 
1  2049 C   n 
1  2050 G   n 
1  2051 G   n 
1  2052 U   n 
1  2053 G   n 
1  2054 A   n 
1  2055 A   n 
1  2056 C   n 
1  2057 U   n 
1  2058 G   n 
1  2059 U   n 
1  2060 A   n 
1  2061 C   n 
1  2062 A   n 
1  2063 U   n 
1  2064 U   n 
1  2065 C   n 
1  2066 C   n 
1  2067 A   n 
1  2068 G   n 
1  2069 U   n 
1  2070 G   n 
1  2071 C   n 
1  2072 G   n 
1  2073 G   n 
1  2074 A   n 
1  2075 G   n 
1  2076 U   n 
1  2077 C   n 
1  2078 U   n 
1  2079 G   n 
1  2080 G   n 
1  2081 A   n 
1  2082 G   n 
1  2083 A   n 
1  2084 C   n 
1  2085 A   n 
1  2086 C   n 
1  2087 C   n 
1  2088 C   n 
1  2089 A   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 G   n 
1  2095 A   n 
1  2096 A   n 
1  2097 G   n 
1  2098 C   n 
1  2099 G   n 
1  2100 A   n 
1  2101 A   n 
1  2102 G   n 
1  2103 A   n 
1  2104 C   n 
1  2105 C   n 
1  2106 C   n 
1  2107 U   n 
1  2108 A   n 
1  2109 U   n 
1  2110 G   n 
1  2111 G   n 
1  2112 A   n 
1  2113 G   n 
1  2114 C   n 
1  2115 U   n 
1  2116 U   n 
1  2117 U   n 
1  2118 A   n 
1  2119 C   n 
1  2120 U   n 
1  2121 G   n 
1  2122 C   n 
1  2123 A   n 
1  2124 G   n 
1  2125 G   n 
1  2126 C   n 
1  2127 U   n 
1  2128 G   n 
1  2129 U   n 
1  2130 C   n 
1  2131 G   n 
1  2132 C   n 
1  2133 U   n 
1  2134 G   n 
1  2135 A   n 
1  2136 G   n 
1  2137 A   n 
1  2138 C   n 
1  2139 G   n 
1  2140 U   n 
1  2141 G   n 
1  2142 G   n 
1  2143 U   n 
1  2144 C   n 
1  2145 G   n 
1  2146 C   n 
1  2147 C   n 
1  2148 G   n 
1  2149 A   n 
1  2150 U   n 
1  2151 G   n 
1  2152 U   n 
1  2153 G   n 
1  2154 C   n 
1  2155 A   n 
1  2156 G   n 
1  2157 C   n 
1  2158 A   n 
1  2159 U   n 
1  2160 A   n 
1  2161 G   n 
1  2162 G   n 
1  2163 U   n 
1  2164 A   n 
1  2165 G   n 
1  2166 G   n 
1  2167 A   n 
1  2168 G   n 
1  2169 U   n 
1  2170 C   n 
1  2171 G   n 
1  2172 U   n 
1  2173 U   n 
1  2174 A   n 
1  2175 C   n 
1  2176 A   n 
1  2177 G   n 
1  2178 A   n 
1  2179 G   n 
1  2180 G   n 
1  2181 U   n 
1  2182 A   n 
1  2183 C   n 
1  2184 C   n 
1  2185 C   n 
1  2186 G   n 
1  2187 C   n 
1  2188 G   n 
1  2189 C   n 
1  2190 U   n 
1  2191 A   n 
1  2192 G   n 
1  2193 C   n 
1  2194 G   n 
1  2195 G   n 
1  2196 G   n 
1  2197 C   n 
1  2198 C   n 
1  2199 A   n 
1  2200 C   n 
1  2201 C   n 
1  2202 C   n 
1  2203 A   n 
1  2204 G   n 
1  2205 A   n 
1  2206 C   n 
1  2207 A   n 
1  2208 A   n 
1  2209 C   n 
1  2210 A   n 
1  2211 G   n 
1  2212 U   n 
1  2213 G   n 
1  2214 A   n 
1  2215 A   n 
1  2216 A   n 
1  2217 U   n 
1  2218 A   n 
1  2219 C   n 
1  2220 U   n 
1  2221 A   n 
1  2222 C   n 
1  2223 C   n 
1  2224 C   n 
1  2225 G   n 
1  2226 U   n 
1  2227 C   n 
1  2228 G   n 
1  2229 G   n 
1  2230 U   n 
1  2231 G   n 
1  2232 A   n 
1  2233 C   n 
1  2234 U   n 
1  2235 G   n 
1  2236 C   n 
1  2237 G   n 
1  2238 A   n 
1  2239 C   n 
1  2240 U   n 
1  2241 C   n 
1  2242 U   n 
1  2243 C   n 
1  2244 A   n 
1  2245 C   n 
1  2246 U   n 
1  2247 C   n 
1  2248 C   n 
1  2249 G   n 
1  2250 G   n 
1  2251 G   n 
1  2252 A   n 
1  2253 G   n 
1  2254 G   n 
1  2255 A   n 
1  2256 G   n 
1  2257 G   n 
1  2258 A   n 
1  2259 C   n 
1  2260 A   n 
1  2261 C   n 
1  2262 C   n 
1  2263 G   n 
1  2264 A   n 
1  2265 U   n 
1  2266 A   n 
1  2267 G   n 
1  2268 C   n 
1  2269 C   n 
1  2270 G   n 
1  2271 G   n 
1  2272 G   n 
1  2273 C   n 
1  2274 A   n 
1  2275 G   n 
1  2276 U   n 
1  2277 U   n 
1  2278 U   n 
1  2279 G   n 
1  2280 A   n 
1  2281 C   n 
1  2282 U   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 G   n 
1  2287 C   n 
1  2288 G   n 
1  2289 G   n 
1  2290 U   n 
1  2291 A   n 
1  2292 C   n 
1  2293 G   n 
1  2294 C   n 
1  2295 G   n 
1  2296 C   n 
1  2297 U   n 
1  2298 C   n 
1  2299 G   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 A   n 
1  2304 G   n 
1  2305 A   n 
1  2306 U   n 
1  2307 A   n 
1  2308 U   n 
1  2309 C   n 
1  2310 G   n 
1  2311 A   n 
1  2312 G   n 
1  2313 C   n 
1  2314 G   n 
1  2315 C   n 
1  2316 G   n 
1  2317 C   n 
1  2318 C   n 
1  2319 C   n 
1  2320 U   n 
1  2321 A   n 
1  2322 U   n 
1  2323 G   n 
1  2324 G   n 
1  2325 U   n 
1  2326 C   n 
1  2327 A   n 
1  2328 U   n 
1  2329 C   n 
1  2330 U   n 
1  2331 C   n 
1  2332 A   n 
1  2333 G   n 
1  2334 C   n 
1  2335 C   n 
1  2336 G   n 
1  2337 G   n 
1  2338 G   n 
1  2339 A   n 
1  2340 C   n 
1  2341 A   n 
1  2342 G   n 
1  2343 A   n 
1  2344 G   n 
1  2345 A   n 
1  2346 C   n 
1  2347 C   n 
1  2348 C   n 
1  2349 G   n 
1  2350 G   n 
1  2351 C   n 
1  2352 G   n 
1  2353 A   n 
1  2354 A   n 
1  2355 G   n 
1  2356 A   n 
1  2357 G   n 
1  2358 U   n 
1  2359 G   n 
1  2360 C   n 
1  2361 A   n 
1  2362 A   n 
1  2363 G   n 
1  2364 A   n 
1  2365 G   n 
1  2366 C   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 A   n 
1  2371 G   n 
1  2372 A   n 
1  2373 U   n 
1  2374 G   n 
1  2375 A   n 
1  2376 C   n 
1  2377 U   n 
1  2378 U   n 
1  2379 G   n 
1  2380 A   n 
1  2381 C   n 
1  2382 A   n 
1  2383 G   n 
1  2384 U   n 
1  2385 G   n 
1  2386 U   n 
1  2387 U   n 
1  2388 C   n 
1  2389 U   n 
1  2390 U   n 
1  2391 C   n 
1  2392 C   n 
1  2393 C   n 
1  2394 A   n 
1  2395 A   n 
1  2396 C   n 
1  2397 G   n 
1  2398 A   n 
1  2399 G   n 
1  2400 G   n 
1  2401 A   n 
1  2402 A   n 
1  2403 C   n 
1  2404 G   n 
1  2405 C   n 
1  2406 U   n 
1  2407 G   n 
1  2408 A   n 
1  2409 C   n 
1  2410 G   n 
1  2411 C   n 
1  2412 G   n 
1  2413 A   n 
1  2414 A   n 
1  2415 A   n 
1  2416 G   n 
1  2417 C   n 
1  2418 G   n 
1  2419 U   n 
1  2420 G   n 
1  2421 G   n 
1  2422 U   n 
1  2423 C   n 
1  2424 U   n 
1  2425 A   n 
1  2426 G   n 
1  2427 C   n 
1  2428 G   n 
1  2429 A   n 
1  2430 A   n 
1  2431 C   n 
1  2432 C   n 
1  2433 A   n 
1  2434 A   n 
1  2435 U   n 
1  2436 U   n 
1  2437 A   n 
1  2438 G   n 
1  2439 C   n 
1  2440 C   n 
1  2441 U   n 
1  2442 G   n 
1  2443 C   n 
1  2444 U   n 
1  2445 U   n 
1  2446 G   n 
1  2447 A   n 
1  2448 U   n 
1  2449 G   n 
1  2450 C   n 
1  2451 G   n 
1  2452 G   n 
1  2453 G   n 
1  2454 C   n 
1  2455 A   n 
1  2456 A   n 
1  2457 U   n 
1  2458 U   n 
1  2459 G   n 
1  2460 A   n 
1  2461 U   n 
1  2462 G   n 
1  2463 A   n 
1  2464 C   n 
1  2465 A   n 
1  2466 G   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 A   n 
1  2471 G   n 
1  2472 C   n 
1  2473 U   n 
1  2474 A   n 
1  2475 C   n 
1  2476 C   n 
1  2477 C   n 
1  2478 U   n 
1  2479 A   n 
1  2480 G   n 
1  2481 G   n 
1  2482 G   n 
1  2483 A   n 
1  2484 U   n 
1  2485 A   n 
1  2486 A   n 
1  2487 C   n 
1  2488 A   n 
1  2489 G   n 
1  2490 A   n 
1  2491 G   n 
1  2492 U   n 
1  2493 C   n 
1  2494 G   n 
1  2495 U   n 
1  2496 C   n 
1  2497 A   n 
1  2498 C   n 
1  2499 U   n 
1  2500 C   n 
1  2501 G   n 
1  2502 C   n 
1  2503 A   n 
1  2504 A   n 
1  2505 G   n 
1  2506 A   n 
1  2507 G   n 
1  2508 C   n 
1  2509 A   n 
1  2510 C   n 
1  2511 A   n 
1  2512 U   n 
1  2513 A   n 
1  2514 U   n 
1  2515 C   n 
1  2516 G   n 
1  2517 A   n 
1  2518 C   n 
1  2519 C   n 
1  2520 G   n 
1  2521 A   n 
1  2522 G   n 
1  2523 U   n 
1  2524 G   n 
1  2525 G   n 
1  2526 C   n 
1  2527 U   n 
1  2528 U   n 
1  2529 G   n 
1  2530 C   n 
1  2531 U   n 
1  2532 A   n 
1  2533 C   n 
1  2534 C   n 
1  2535 U   n 
1  2536 C   n 
1  2537 G   n 
1  2538 A   n 
1  2539 U   n 
1  2540 G   n 
1  2541 U   n 
1  2542 C   n 
1  2543 G   n 
1  2544 G   n 
1  2545 U   n 
1  2546 U   n 
1  2547 C   n 
1  2548 C   n 
1  2549 C   n 
1  2550 U   n 
1  2551 C   n 
1  2552 C   n 
1  2553 A   n 
1  2554 U   n 
1  2555 C   n 
1  2556 C   n 
1  2557 U   n 
1  2558 G   n 
1  2559 C   n 
1  2560 C   n 
1  2561 C   n 
1  2562 G   n 
1  2563 U   n 
1  2564 G   n 
1  2565 C   n 
1  2566 A   n 
1  2567 G   n 
1  2568 A   n 
1  2569 A   n 
1  2570 G   n 
1  2571 C   n 
1  2572 G   n 
1  2573 G   n 
1  2574 G   n 
1  2575 C   n 
1  2576 A   n 
1  2577 A   n 
1  2578 G   n 
1  2579 G   n 
1  2580 G   n 
1  2581 U   n 
1  2582 G   n 
1  2583 A   n 
1  2584 G   n 
1  2585 G   n 
1  2586 U   n 
1  2587 OMU n 
1  2588 OMG n 
1  2589 U   n 
1  2590 U   n 
1  2591 C   n 
1  2592 G   n 
1  2593 C   n 
1  2594 C   n 
1  2595 U   n 
1  2596 A   n 
1  2597 U   n 
1  2598 U   n 
1  2599 A   n 
1  2600 A   n 
1  2601 A   n 
1  2602 G   n 
1  2603 G   n 
1  2604 A   n 
1  2605 G   n 
1  2606 G   n 
1  2607 U   n 
1  2608 C   n 
1  2609 G   n 
1  2610 U   n 
1  2611 G   n 
1  2612 A   n 
1  2613 G   n 
1  2614 C   n 
1  2615 U   n 
1  2616 G   n 
1  2617 G   n 
1  2618 G   n 
1  2619 UR3 n 
1  2620 U   n 
1  2621 PSU n 
1  2622 A   n 
1  2623 G   n 
1  2624 A   n 
1  2625 C   n 
1  2626 C   n 
1  2627 G   n 
1  2628 U   n 
1  2629 C   n 
1  2630 G   n 
1  2631 U   n 
1  2632 G   n 
1  2633 A   n 
1  2634 G   n 
1  2635 A   n 
1  2636 C   n 
1  2637 A   n 
1  2638 G   n 
1  2639 G   n 
1  2640 U   n 
1  2641 C   n 
1  2642 G   n 
1  2643 G   n 
1  2644 C   n 
1  2645 U   n 
1  2646 G   n 
1  2647 C   n 
1  2648 U   n 
1  2649 A   n 
1  2650 U   n 
1  2651 C   n 
1  2652 U   n 
1  2653 A   n 
1  2654 C   n 
1  2655 U   n 
1  2656 G   n 
1  2657 G   n 
1  2658 G   n 
1  2659 U   n 
1  2660 G   n 
1  2661 U   n 
1  2662 G   n 
1  2663 U   n 
1  2664 A   n 
1  2665 A   n 
1  2666 U   n 
1  2667 G   n 
1  2668 G   n 
1  2669 U   n 
1  2670 G   n 
1  2671 U   n 
1  2672 C   n 
1  2673 U   n 
1  2674 G   n 
1  2675 A   n 
1  2676 C   n 
1  2677 A   n 
1  2678 A   n 
1  2679 G   n 
1  2680 A   n 
1  2681 A   n 
1  2682 C   n 
1  2683 G   n 
1  2684 A   n 
1  2685 C   n 
1  2686 C   n 
1  2687 G   n 
1  2688 U   n 
1  2689 A   n 
1  2690 U   n 
1  2691 A   n 
1  2692 G   n 
1  2693 U   n 
1  2694 A   n 
1  2695 C   n 
1  2696 G   n 
1  2697 A   n 
1  2698 G   n 
1  2699 A   n 
1  2700 G   n 
1  2701 G   n 
1  2702 A   n 
1  2703 A   n 
1  2704 C   n 
1  2705 U   n 
1  2706 A   n 
1  2707 C   n 
1  2708 G   n 
1  2709 G   n 
1  2710 U   n 
1  2711 U   n 
1  2712 G   n 
1  2713 G   n 
1  2714 U   n 
1  2715 G   n 
1  2716 G   n 
1  2717 C   n 
1  2718 C   n 
1  2719 A   n 
1  2720 C   n 
1  2721 U   n 
1  2722 G   n 
1  2723 G   n 
1  2724 U   n 
1  2725 G   n 
1  2726 U   n 
1  2727 A   n 
1  2728 C   n 
1  2729 C   n 
1  2730 G   n 
1  2731 G   n 
1  2732 U   n 
1  2733 U   n 
1  2734 G   n 
1  2735 U   n 
1  2736 U   n 
1  2737 C   n 
1  2738 G   n 
1  2739 A   n 
1  2740 G   n 
1  2741 A   n 
1  2742 G   n 
1  2743 A   n 
1  2744 G   n 
1  2745 C   n 
1  2746 A   n 
1  2747 C   n 
1  2748 G   n 
1  2749 U   n 
1  2750 G   n 
1  2751 C   n 
1  2752 C   n 
1  2753 G   n 
1  2754 G   n 
1  2755 G   n 
1  2756 U   n 
1  2757 A   n 
1  2758 G   n 
1  2759 C   n 
1  2760 C   n 
1  2761 A   n 
1  2762 C   n 
1  2763 G   n 
1  2764 C   n 
1  2765 C   n 
1  2766 A   n 
1  2767 C   n 
1  2768 A   n 
1  2769 C   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 G   n 
1  2774 U   n 
1  2775 A   n 
1  2776 A   n 
1  2777 G   n 
1  2778 A   n 
1  2779 G   n 
1  2780 C   n 
1  2781 U   n 
1  2782 G   n 
1  2783 A   n 
1  2784 A   n 
1  2785 C   n 
1  2786 G   n 
1  2787 C   n 
1  2788 A   n 
1  2789 U   n 
1  2790 C   n 
1  2791 U   n 
1  2792 A   n 
1  2793 A   n 
1  2794 G   n 
1  2795 C   n 
1  2796 U   n 
1  2797 C   n 
1  2798 G   n 
1  2799 A   n 
1  2800 A   n 
1  2801 A   n 
1  2802 C   n 
1  2803 C   n 
1  2804 C   n 
1  2805 A   n 
1  2806 C   n 
1  2807 U   n 
1  2808 U   n 
1  2809 G   n 
1  2810 G   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 A   n 
1  2815 G   n 
1  2816 A   n 
1  2817 G   n 
1  2818 A   n 
1  2819 C   n 
1  2820 A   n 
1  2821 C   n 
1  2822 C   n 
1  2823 G   n 
1  2824 C   n 
1  2825 C   n 
1  2826 G   n 
1  2827 A   n 
1  2828 G   n 
1  2829 G   n 
1  2830 U   n 
1  2831 C   n 
1  2832 C   n 
1  2833 C   n 
1  2834 G   n 
1  2835 C   n 
1  2836 G   n 
1  2837 U   n 
1  2838 A   n 
1  2839 C   n 
1  2840 A   n 
1  2841 A   n 
1  2842 G   n 
1  2843 A   n 
1  2844 C   n 
1  2845 G   n 
1  2846 C   n 
1  2847 G   n 
1  2848 G   n 
1  2849 U   n 
1  2850 C   n 
1  2851 G   n 
1  2852 A   n 
1  2853 U   n 
1  2854 A   n 
1  2855 G   n 
1  2856 A   n 
1  2857 C   n 
1  2858 U   n 
1  2859 C   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 G   n 
1  2864 U   n 
1  2865 G   n 
1  2866 U   n 
1  2867 G   n 
1  2868 C   n 
1  2869 G   n 
1  2870 C   n 
1  2871 G   n 
1  2872 U   n 
1  2873 C   n 
1  2874 G   n 
1  2875 A   n 
1  2876 G   n 
1  2877 G   n 
1  2878 U   n 
1  2879 A   n 
1  2880 A   n 
1  2881 C   n 
1  2882 G   n 
1  2883 A   n 
1  2884 G   n 
1  2885 A   n 
1  2886 C   n 
1  2887 G   n 
1  2888 U   n 
1  2889 U   n 
1  2890 A   n 
1  2891 A   n 
1  2892 G   n 
1  2893 C   n 
1  2894 C   n 
1  2895 C   n 
1  2896 A   n 
1  2897 C   n 
1  2898 G   n 
1  2899 A   n 
1  2900 G   n 
1  2901 C   n 
1  2902 A   n 
1  2903 C   n 
1  2904 U   n 
1  2905 A   n 
1  2906 A   n 
1  2907 C   n 
1  2908 A   n 
1  2909 G   n 
1  2910 A   n 
1  2911 C   n 
1  2912 C   n 
1  2913 A   n 
1  2914 A   n 
1  2915 A   n 
1  2916 G   n 
1  2917 C   n 
1  2918 C   n 
1  2919 A   n 
1  2920 U   n 
1  2921 C   n 
1  2922 A   n 
2  1    MET n 
2  2    THR n 
2  3    GLY n 
2  4    ALA n 
2  5    GLY n 
2  6    THR n 
2  7    PRO n 
2  8    SER n 
2  9    GLN n 
2  10   GLY n 
2  11   LYS n 
2  12   LYS n 
2  13   ASN n 
2  14   THR n 
2  15   THR n 
2  16   THR n 
2  17   HIS n 
2  18   THR n 
2  19   LYS n 
2  20   CYS n 
2  21   ARG n 
2  22   ARG n 
2  23   CYS n 
2  24   GLY n 
2  25   GLU n 
2  26   LYS n 
2  27   SER n 
2  28   TYR n 
2  29   HIS n 
2  30   THR n 
2  31   LYS n 
2  32   LYS n 
2  33   LYS n 
2  34   VAL n 
2  35   CYS n 
2  36   SER n 
2  37   SER n 
2  38   CYS n 
2  39   GLY n 
2  40   PHE n 
2  41   GLY n 
2  42   LYS n 
2  43   SER n 
2  44   ALA n 
2  45   LYS n 
2  46   ARG n 
2  47   ARG n 
2  48   ASP n 
2  49   TYR n 
2  50   GLU n 
2  51   TRP n 
2  52   GLN n 
2  53   SER n 
2  54   LYS n 
2  55   ALA n 
2  56   GLY n 
2  57   GLU n 
3  1    MET n 
3  2    GLY n 
3  3    LYS n 
3  4    LYS n 
3  5    SER n 
3  6    LYS n 
3  7    ALA n 
3  8    THR n 
3  9    LYS n 
3  10   LYS n 
3  11   ARG n 
3  12   LEU n 
3  13   ALA n 
3  14   LYS n 
3  15   LEU n 
3  16   ASP n 
3  17   ASN n 
3  18   GLN n 
3  19   ASN n 
3  20   SER n 
3  21   ARG n 
3  22   VAL n 
3  23   PRO n 
3  24   ALA n 
3  25   TRP n 
3  26   VAL n 
3  27   MET n 
3  28   LEU n 
3  29   LYS n 
3  30   THR n 
3  31   ASP n 
3  32   ARG n 
3  33   GLU n 
3  34   VAL n 
3  35   GLN n 
3  36   ARG n 
3  37   ASN n 
3  38   HIS n 
3  39   LYS n 
3  40   ARG n 
3  41   ARG n 
3  42   HIS n 
3  43   TRP n 
3  44   ARG n 
3  45   ARG n 
3  46   ASN n 
3  47   ASP n 
3  48   THR n 
3  49   ASP n 
3  50   GLU n 
4  1    MET n 
4  2    GLN n 
4  3    MET n 
4  4    PRO n 
4  5    ARG n 
4  6    ARG n 
4  7    PHE n 
4  8    ASN n 
4  9    THR n 
4  10   TYR n 
4  11   CYS n 
4  12   PRO n 
4  13   HIS n 
4  14   CYS n 
4  15   ASN n 
4  16   GLU n 
4  17   HIS n 
4  18   GLN n 
4  19   GLU n 
4  20   HIS n 
4  21   GLU n 
4  22   VAL n 
4  23   GLU n 
4  24   LYS n 
4  25   VAL n 
4  26   ARG n 
4  27   SER n 
4  28   GLY n 
4  29   ARG n 
4  30   GLN n 
4  31   THR n 
4  32   GLY n 
4  33   MET n 
4  34   LYS n 
4  35   TRP n 
4  36   ILE n 
4  37   ASP n 
4  38   ARG n 
4  39   GLN n 
4  40   ARG n 
4  41   GLU n 
4  42   ARG n 
4  43   ASN n 
4  44   SER n 
4  45   GLY n 
4  46   ILE n 
4  47   GLY n 
4  48   ASN n 
4  49   ASP n 
4  50   GLY n 
4  51   LYS n 
4  52   PHE n 
4  53   SER n 
4  54   LYS n 
4  55   VAL n 
4  56   PRO n 
4  57   GLY n 
4  58   GLY n 
4  59   ASP n 
4  60   LYS n 
4  61   PRO n 
4  62   THR n 
4  63   LYS n 
4  64   LYS n 
4  65   THR n 
4  66   ASP n 
4  67   LEU n 
4  68   LYS n 
4  69   TYR n 
4  70   ARG n 
4  71   CYS n 
4  72   GLY n 
4  73   GLU n 
4  74   CYS n 
4  75   GLY n 
4  76   LYS n 
4  77   ALA n 
4  78   HIS n 
4  79   LEU n 
4  80   ARG n 
4  81   GLU n 
4  82   GLY n 
4  83   TRP n 
4  84   ARG n 
4  85   ALA n 
4  86   GLY n 
4  87   ARG n 
4  88   LEU n 
4  89   GLU n 
4  90   PHE n 
4  91   GLN n 
4  92   GLU n 
5  1    MHW n 
5  2    THR n 
5  3    DBB n 
5  4    PRO n 
5  5    MEA n 
5  6    MHV n 
5  7    004 n 
6  1    U   n 
6  2    U   n 
6  3    A   n 
6  4    G   n 
6  5    G   n 
6  6    C   n 
6  7    G   n 
6  8    G   n 
6  9    C   n 
6  10   C   n 
6  11   A   n 
6  12   C   n 
6  13   A   n 
6  14   G   n 
6  15   C   n 
6  16   G   n 
6  17   G   n 
6  18   U   n 
6  19   G   n 
6  20   G   n 
6  21   G   n 
6  22   G   n 
6  23   U   n 
6  24   U   n 
6  25   G   n 
6  26   C   n 
6  27   C   n 
6  28   U   n 
6  29   C   n 
6  30   C   n 
6  31   C   n 
6  32   G   n 
6  33   U   n 
6  34   A   n 
6  35   C   n 
6  36   C   n 
6  37   C   n 
6  38   A   n 
6  39   U   n 
6  40   C   n 
6  41   C   n 
6  42   C   n 
6  43   G   n 
6  44   A   n 
6  45   A   n 
6  46   C   n 
6  47   A   n 
6  48   C   n 
6  49   G   n 
6  50   G   n 
6  51   A   n 
6  52   A   n 
6  53   G   n 
6  54   A   n 
6  55   U   n 
6  56   A   n 
6  57   A   n 
6  58   G   n 
6  59   C   n 
6  60   C   n 
6  61   C   n 
6  62   A   n 
6  63   C   n 
6  64   C   n 
6  65   A   n 
6  66   G   n 
6  67   C   n 
6  68   G   n 
6  69   U   n 
6  70   U   n 
6  71   C   n 
6  72   C   n 
6  73   A   n 
6  74   G   n 
6  75   G   n 
6  76   G   n 
6  77   A   n 
6  78   G   n 
6  79   U   n 
6  80   A   n 
6  81   C   n 
6  82   U   n 
6  83   G   n 
6  84   G   n 
6  85   A   n 
6  86   G   n 
6  87   U   n 
6  88   G   n 
6  89   C   n 
6  90   G   n 
6  91   C   n 
6  92   G   n 
6  93   A   n 
6  94   G   n 
6  95   C   n 
6  96   C   n 
6  97   U   n 
6  98   C   n 
6  99   U   n 
6  100  G   n 
6  101  G   n 
6  102  G   n 
6  103  A   n 
6  104  A   n 
6  105  A   n 
6  106  U   n 
6  107  C   n 
6  108  C   n 
6  109  G   n 
6  110  G   n 
6  111  U   n 
6  112  U   n 
6  113  C   n 
6  114  G   n 
6  115  C   n 
6  116  C   n 
6  117  G   n 
6  118  C   n 
6  119  C   n 
6  120  A   n 
6  121  C   n 
6  122  C   n 
7  1    MET n 
7  2    GLY n 
7  3    ARG n 
7  4    ARG n 
7  5    ILE n 
7  6    GLN n 
7  7    GLY n 
7  8    GLN n 
7  9    ARG n 
7  10   ARG n 
7  11   GLY n 
7  12   ARG n 
7  13   GLY n 
7  14   THR n 
7  15   SER n 
7  16   THR n 
7  17   PHE n 
7  18   ARG n 
7  19   ALA n 
7  20   PRO n 
7  21   SER n 
7  22   HIS n 
7  23   ARG n 
7  24   TYR n 
7  25   LYS n 
7  26   ALA n 
7  27   ASP n 
7  28   LEU n 
7  29   GLU n 
7  30   HIS n 
7  31   ARG n 
7  32   LYS n 
7  33   VAL n 
7  34   GLU n 
7  35   ASP n 
7  36   GLY n 
7  37   ASP n 
7  38   VAL n 
7  39   ILE n 
7  40   ALA n 
7  41   GLY n 
7  42   THR n 
7  43   VAL n 
7  44   VAL n 
7  45   ASP n 
7  46   ILE n 
7  47   GLU n 
7  48   HIS n 
7  49   ASP n 
7  50   PRO n 
7  51   ALA n 
7  52   ARG n 
7  53   SER n 
7  54   ALA n 
7  55   PRO n 
7  56   VAL n 
7  57   ALA n 
7  58   ALA n 
7  59   VAL n 
7  60   GLU n 
7  61   PHE n 
7  62   GLU n 
7  63   ASP n 
7  64   GLY n 
7  65   ASP n 
7  66   ARG n 
7  67   ARG n 
7  68   LEU n 
7  69   ILE n 
7  70   LEU n 
7  71   ALA n 
7  72   PRO n 
7  73   GLU n 
7  74   GLY n 
7  75   VAL n 
7  76   GLY n 
7  77   VAL n 
7  78   GLY n 
7  79   ASP n 
7  80   GLU n 
7  81   LEU n 
7  82   GLN n 
7  83   VAL n 
7  84   GLY n 
7  85   VAL n 
7  86   SER n 
7  87   ALA n 
7  88   GLU n 
7  89   ILE n 
7  90   ALA n 
7  91   PRO n 
7  92   GLY n 
7  93   ASN n 
7  94   THR n 
7  95   LEU n 
7  96   PRO n 
7  97   LEU n 
7  98   ALA n 
7  99   GLU n 
7  100  ILE n 
7  101  PRO n 
7  102  GLU n 
7  103  GLY n 
7  104  VAL n 
7  105  PRO n 
7  106  VAL n 
7  107  CYS n 
7  108  ASN n 
7  109  VAL n 
7  110  GLU n 
7  111  SER n 
7  112  SER n 
7  113  PRO n 
7  114  GLY n 
7  115  ASP n 
7  116  GLY n 
7  117  GLY n 
7  118  LYS n 
7  119  PHE n 
7  120  ALA n 
7  121  ARG n 
7  122  ALA n 
7  123  SER n 
7  124  GLY n 
7  125  VAL n 
7  126  ASN n 
7  127  ALA n 
7  128  GLN n 
7  129  LEU n 
7  130  LEU n 
7  131  THR n 
7  132  HIS n 
7  133  ASP n 
7  134  ARG n 
7  135  ASN n 
7  136  VAL n 
7  137  ALA n 
7  138  VAL n 
7  139  VAL n 
7  140  LYS n 
7  141  LEU n 
7  142  PRO n 
7  143  SER n 
7  144  GLY n 
7  145  GLU n 
7  146  MET n 
7  147  LYS n 
7  148  ARG n 
7  149  LEU n 
7  150  ASP n 
7  151  PRO n 
7  152  GLN n 
7  153  CYS n 
7  154  ARG n 
7  155  ALA n 
7  156  THR n 
7  157  ILE n 
7  158  GLY n 
7  159  VAL n 
7  160  VAL n 
7  161  ALA n 
7  162  GLY n 
7  163  GLY n 
7  164  GLY n 
7  165  ARG n 
7  166  THR n 
7  167  ASP n 
7  168  LYS n 
7  169  PRO n 
7  170  PHE n 
7  171  VAL n 
7  172  LYS n 
7  173  ALA n 
7  174  GLY n 
7  175  ASN n 
7  176  LYS n 
7  177  HIS n 
7  178  HIS n 
7  179  LYS n 
7  180  MET n 
7  181  LYS n 
7  182  ALA n 
7  183  ARG n 
7  184  GLY n 
7  185  THR n 
7  186  LYS n 
7  187  TRP n 
7  188  PRO n 
7  189  ASN n 
7  190  VAL n 
7  191  ARG n 
7  192  GLY n 
7  193  VAL n 
7  194  ALA n 
7  195  MET n 
7  196  ASN n 
7  197  ALA n 
7  198  VAL n 
7  199  ASP n 
7  200  HIS n 
7  201  PRO n 
7  202  PHE n 
7  203  GLY n 
7  204  GLY n 
7  205  GLY n 
7  206  GLY n 
7  207  ARG n 
7  208  GLN n 
7  209  HIS n 
7  210  PRO n 
7  211  GLY n 
7  212  LYS n 
7  213  PRO n 
7  214  LYS n 
7  215  SER n 
7  216  ILE n 
7  217  SER n 
7  218  ARG n 
7  219  ASN n 
7  220  ALA n 
7  221  PRO n 
7  222  PRO n 
7  223  GLY n 
7  224  ARG n 
7  225  LYS n 
7  226  VAL n 
7  227  GLY n 
7  228  ASP n 
7  229  ILE n 
7  230  ALA n 
7  231  SER n 
7  232  LYS n 
7  233  ARG n 
7  234  THR n 
7  235  GLY n 
7  236  ARG n 
7  237  GLY n 
7  238  GLY n 
7  239  ASN n 
7  240  GLU n 
8  1    MET n 
8  2    PRO n 
8  3    GLN n 
8  4    PRO n 
8  5    SER n 
8  6    ARG n 
8  7    PRO n 
8  8    ARG n 
8  9    LYS n 
8  10   GLY n 
8  11   SER n 
8  12   LEU n 
8  13   GLY n 
8  14   PHE n 
8  15   GLY n 
8  16   PRO n 
8  17   ARG n 
8  18   LYS n 
8  19   ARG n 
8  20   SER n 
8  21   THR n 
8  22   SER n 
8  23   GLU n 
8  24   THR n 
8  25   PRO n 
8  26   ARG n 
8  27   PHE n 
8  28   ASN n 
8  29   SER n 
8  30   TRP n 
8  31   PRO n 
8  32   SER n 
8  33   ASP n 
8  34   ASP n 
8  35   GLY n 
8  36   GLN n 
8  37   PRO n 
8  38   GLY n 
8  39   VAL n 
8  40   GLN n 
8  41   GLY n 
8  42   PHE n 
8  43   ALA n 
8  44   GLY n 
8  45   TYR n 
8  46   LYS n 
8  47   ALA n 
8  48   GLY n 
8  49   MET n 
8  50   THR n 
8  51   HIS n 
8  52   VAL n 
8  53   VAL n 
8  54   LEU n 
8  55   VAL n 
8  56   ASN n 
8  57   ASP n 
8  58   GLU n 
8  59   PRO n 
8  60   ASN n 
8  61   SER n 
8  62   PRO n 
8  63   ARG n 
8  64   GLU n 
8  65   GLY n 
8  66   MET n 
8  67   GLU n 
8  68   GLU n 
8  69   THR n 
8  70   VAL n 
8  71   PRO n 
8  72   VAL n 
8  73   THR n 
8  74   VAL n 
8  75   ILE n 
8  76   GLU n 
8  77   THR n 
8  78   PRO n 
8  79   PRO n 
8  80   MET n 
8  81   ARG n 
8  82   ALA n 
8  83   VAL n 
8  84   ALA n 
8  85   LEU n 
8  86   ARG n 
8  87   ALA n 
8  88   TYR n 
8  89   GLU n 
8  90   ASP n 
8  91   THR n 
8  92   PRO n 
8  93   TYR n 
8  94   GLY n 
8  95   GLN n 
8  96   ARG n 
8  97   PRO n 
8  98   LEU n 
8  99   THR n 
8  100  GLU n 
8  101  VAL n 
8  102  TRP n 
8  103  THR n 
8  104  ASP n 
8  105  GLU n 
8  106  PHE n 
8  107  HIS n 
8  108  SER n 
8  109  GLU n 
8  110  LEU n 
8  111  ASP n 
8  112  ARG n 
8  113  THR n 
8  114  LEU n 
8  115  ASP n 
8  116  VAL n 
8  117  PRO n 
8  118  GLU n 
8  119  ASP n 
8  120  HIS n 
8  121  ASP n 
8  122  PRO n 
8  123  ASP n 
8  124  ALA n 
8  125  ALA n 
8  126  GLU n 
8  127  GLU n 
8  128  GLN n 
8  129  ILE n 
8  130  ARG n 
8  131  ASP n 
8  132  ALA n 
8  133  HIS n 
8  134  GLU n 
8  135  ALA n 
8  136  GLY n 
8  137  ASP n 
8  138  LEU n 
8  139  GLY n 
8  140  ASP n 
8  141  LEU n 
8  142  ARG n 
8  143  LEU n 
8  144  ILE n 
8  145  THR n 
8  146  HIS n 
8  147  THR n 
8  148  VAL n 
8  149  PRO n 
8  150  ASP n 
8  151  ALA n 
8  152  VAL n 
8  153  PRO n 
8  154  SER n 
8  155  VAL n 
8  156  PRO n 
8  157  LYS n 
8  158  LYS n 
8  159  LYS n 
8  160  PRO n 
8  161  ASP n 
8  162  VAL n 
8  163  MET n 
8  164  GLU n 
8  165  THR n 
8  166  ARG n 
8  167  VAL n 
8  168  GLY n 
8  169  GLY n 
8  170  GLY n 
8  171  SER n 
8  172  VAL n 
8  173  SER n 
8  174  ASP n 
8  175  ARG n 
8  176  LEU n 
8  177  ASP n 
8  178  HIS n 
8  179  ALA n 
8  180  LEU n 
8  181  ASP n 
8  182  ILE n 
8  183  VAL n 
8  184  GLU n 
8  185  ASP n 
8  186  GLY n 
8  187  GLY n 
8  188  GLU n 
8  189  HIS n 
8  190  ALA n 
8  191  MET n 
8  192  ASN n 
8  193  ASP n 
8  194  ILE n 
8  195  PHE n 
8  196  ARG n 
8  197  ALA n 
8  198  GLY n 
8  199  GLU n 
8  200  TYR n 
8  201  ALA n 
8  202  ASP n 
8  203  VAL n 
8  204  ALA n 
8  205  GLY n 
8  206  VAL n 
8  207  THR n 
8  208  LYS n 
8  209  GLY n 
8  210  LYS n 
8  211  GLY n 
8  212  THR n 
8  213  GLN n 
8  214  GLY n 
8  215  PRO n 
8  216  VAL n 
8  217  LYS n 
8  218  ARG n 
8  219  TRP n 
8  220  GLY n 
8  221  VAL n 
8  222  GLN n 
8  223  LYS n 
8  224  ARG n 
8  225  LYS n 
8  226  GLY n 
8  227  LYS n 
8  228  HIS n 
8  229  ALA n 
8  230  ARG n 
8  231  GLN n 
8  232  GLY n 
8  233  TRP n 
8  234  ARG n 
8  235  ARG n 
8  236  ARG n 
8  237  ILE n 
8  238  GLY n 
8  239  ASN n 
8  240  LEU n 
8  241  GLY n 
8  242  PRO n 
8  243  TRP n 
8  244  ASN n 
8  245  PRO n 
8  246  SER n 
8  247  ARG n 
8  248  VAL n 
8  249  ARG n 
8  250  SER n 
8  251  THR n 
8  252  VAL n 
8  253  PRO n 
8  254  GLN n 
8  255  GLN n 
8  256  GLY n 
8  257  GLN n 
8  258  THR n 
8  259  GLY n 
8  260  TYR n 
8  261  HIS n 
8  262  GLN n 
8  263  ARG n 
8  264  THR n 
8  265  GLU n 
8  266  LEU n 
8  267  ASN n 
8  268  LYS n 
8  269  ARG n 
8  270  LEU n 
8  271  ILE n 
8  272  ASP n 
8  273  ILE n 
8  274  GLY n 
8  275  GLU n 
8  276  GLY n 
8  277  ASP n 
8  278  GLU n 
8  279  PRO n 
8  280  THR n 
8  281  VAL n 
8  282  ASP n 
8  283  GLY n 
8  284  GLY n 
8  285  PHE n 
8  286  VAL n 
8  287  ASN n 
8  288  TYR n 
8  289  GLY n 
8  290  GLU n 
8  291  VAL n 
8  292  ASP n 
8  293  GLY n 
8  294  PRO n 
8  295  TYR n 
8  296  THR n 
8  297  LEU n 
8  298  VAL n 
8  299  LYS n 
8  300  GLY n 
8  301  SER n 
8  302  VAL n 
8  303  PRO n 
8  304  GLY n 
8  305  PRO n 
8  306  ASP n 
8  307  LYS n 
8  308  ARG n 
8  309  LEU n 
8  310  VAL n 
8  311  ARG n 
8  312  PHE n 
8  313  ARG n 
8  314  PRO n 
8  315  ALA n 
8  316  VAL n 
8  317  ARG n 
8  318  PRO n 
8  319  ASN n 
8  320  ASP n 
8  321  GLN n 
8  322  PRO n 
8  323  ARG n 
8  324  LEU n 
8  325  ASP n 
8  326  PRO n 
8  327  GLU n 
8  328  VAL n 
8  329  ARG n 
8  330  TYR n 
8  331  VAL n 
8  332  SER n 
8  333  ASN n 
8  334  GLU n 
8  335  SER n 
8  336  ASN n 
8  337  GLN n 
8  338  GLY n 
9  1    MET n 
9  2    GLN n 
9  3    ALA n 
9  4    THR n 
9  5    ILE n 
9  6    TYR n 
9  7    ASP n 
9  8    LEU n 
9  9    ASP n 
9  10   GLY n 
9  11   ASN n 
9  12   THR n 
9  13   ASP n 
9  14   GLY n 
9  15   GLU n 
9  16   VAL n 
9  17   ASP n 
9  18   LEU n 
9  19   PRO n 
9  20   ASP n 
9  21   VAL n 
9  22   PHE n 
9  23   GLU n 
9  24   THR n 
9  25   PRO n 
9  26   VAL n 
9  27   ARG n 
9  28   SER n 
9  29   ASP n 
9  30   LEU n 
9  31   ILE n 
9  32   GLY n 
9  33   LYS n 
9  34   ALA n 
9  35   VAL n 
9  36   ARG n 
9  37   ALA n 
9  38   ALA n 
9  39   GLN n 
9  40   ALA n 
9  41   ASN n 
9  42   ARG n 
9  43   LYS n 
9  44   GLN n 
9  45   ASP n 
9  46   TYR n 
9  47   GLY n 
9  48   SER n 
9  49   ASP n 
9  50   GLU n 
9  51   TYR n 
9  52   ALA n 
9  53   GLY n 
9  54   LEU n 
9  55   ARG n 
9  56   THR n 
9  57   PRO n 
9  58   ALA n 
9  59   GLU n 
9  60   SER n 
9  61   PHE n 
9  62   GLY n 
9  63   SER n 
9  64   GLY n 
9  65   ARG n 
9  66   GLY n 
9  67   GLN n 
9  68   ALA n 
9  69   HIS n 
9  70   VAL n 
9  71   PRO n 
9  72   LYS n 
9  73   LEU n 
9  74   ASP n 
9  75   GLY n 
9  76   ARG n 
9  77   ALA n 
9  78   ARG n 
9  79   ARG n 
9  80   VAL n 
9  81   PRO n 
9  82   GLN n 
9  83   ALA n 
9  84   VAL n 
9  85   LYS n 
9  86   GLY n 
9  87   ARG n 
9  88   SER n 
9  89   ALA n 
9  90   HIS n 
9  91   PRO n 
9  92   PRO n 
9  93   LYS n 
9  94   THR n 
9  95   GLU n 
9  96   LYS n 
9  97   ASP n 
9  98   ARG n 
9  99   SER n 
9  100  LEU n 
9  101  ASP n 
9  102  LEU n 
9  103  ASN n 
9  104  ASP n 
9  105  LYS n 
9  106  GLU n 
9  107  ARG n 
9  108  GLN n 
9  109  LEU n 
9  110  ALA n 
9  111  VAL n 
9  112  ARG n 
9  113  SER n 
9  114  ALA n 
9  115  LEU n 
9  116  ALA n 
9  117  ALA n 
9  118  THR n 
9  119  ALA n 
9  120  ASP n 
9  121  ALA n 
9  122  ASP n 
9  123  LEU n 
9  124  VAL n 
9  125  ALA n 
9  126  ASP n 
9  127  ARG n 
9  128  GLY n 
9  129  HIS n 
9  130  GLU n 
9  131  PHE n 
9  132  ASP n 
9  133  ARG n 
9  134  ASP n 
9  135  GLU n 
9  136  VAL n 
9  137  PRO n 
9  138  VAL n 
9  139  VAL n 
9  140  VAL n 
9  141  SER n 
9  142  ASP n 
9  143  ASP n 
9  144  PHE n 
9  145  GLU n 
9  146  ASP n 
9  147  LEU n 
9  148  VAL n 
9  149  LYS n 
9  150  THR n 
9  151  GLN n 
9  152  GLU n 
9  153  VAL n 
9  154  VAL n 
9  155  SER n 
9  156  LEU n 
9  157  LEU n 
9  158  GLU n 
9  159  ALA n 
9  160  LEU n 
9  161  ASP n 
9  162  VAL n 
9  163  HIS n 
9  164  ALA n 
9  165  ASP n 
9  166  ILE n 
9  167  ASP n 
9  168  ARG n 
9  169  ALA n 
9  170  ASP n 
9  171  GLU n 
9  172  THR n 
9  173  LYS n 
9  174  ILE n 
9  175  LYS n 
9  176  ALA n 
9  177  GLY n 
9  178  GLN n 
9  179  GLY n 
9  180  SER n 
9  181  ALA n 
9  182  ARG n 
9  183  GLY n 
9  184  ARG n 
9  185  LYS n 
9  186  TYR n 
9  187  ARG n 
9  188  ARG n 
9  189  PRO n 
9  190  ALA n 
9  191  SER n 
9  192  ILE n 
9  193  LEU n 
9  194  PHE n 
9  195  VAL n 
9  196  THR n 
9  197  SER n 
9  198  ASP n 
9  199  GLU n 
9  200  PRO n 
9  201  SER n 
9  202  THR n 
9  203  ALA n 
9  204  ALA n 
9  205  ARG n 
9  206  ASN n 
9  207  LEU n 
9  208  ALA n 
9  209  GLY n 
9  210  ALA n 
9  211  ASP n 
9  212  VAL n 
9  213  ALA n 
9  214  THR n 
9  215  ALA n 
9  216  SER n 
9  217  GLU n 
9  218  VAL n 
9  219  ASN n 
9  220  THR n 
9  221  GLU n 
9  222  ASP n 
9  223  LEU n 
9  224  ALA n 
9  225  PRO n 
9  226  GLY n 
9  227  GLY n 
9  228  ALA n 
9  229  PRO n 
9  230  GLY n 
9  231  ARG n 
9  232  LEU n 
9  233  THR n 
9  234  VAL n 
9  235  PHE n 
9  236  THR n 
9  237  GLU n 
9  238  SER n 
9  239  ALA n 
9  240  LEU n 
9  241  ALA n 
9  242  GLU n 
9  243  VAL n 
9  244  ALA n 
9  245  GLU n 
9  246  ARG n 
10 1    MET n 
10 2    SER n 
10 3    SER n 
10 4    GLU n 
10 5    SER n 
10 6    GLU n 
10 7    SER n 
10 8    GLY n 
10 9    GLY n 
10 10   ASP n 
10 11   PHE n 
10 12   HIS n 
10 13   GLU n 
10 14   MET n 
10 15   ARG n 
10 16   GLU n 
10 17   PRO n 
10 18   ARG n 
10 19   ILE n 
10 20   GLU n 
10 21   LYS n 
10 22   VAL n 
10 23   VAL n 
10 24   VAL n 
10 25   HIS n 
10 26   MET n 
10 27   GLY n 
10 28   ILE n 
10 29   GLY n 
10 30   HIS n 
10 31   GLY n 
10 32   GLY n 
10 33   ARG n 
10 34   ASP n 
10 35   LEU n 
10 36   ALA n 
10 37   ASN n 
10 38   ALA n 
10 39   GLU n 
10 40   ASP n 
10 41   ILE n 
10 42   LEU n 
10 43   GLY n 
10 44   GLU n 
10 45   ILE n 
10 46   THR n 
10 47   GLY n 
10 48   GLN n 
10 49   MET n 
10 50   PRO n 
10 51   VAL n 
10 52   ARG n 
10 53   THR n 
10 54   LYS n 
10 55   ALA n 
10 56   LYS n 
10 57   ARG n 
10 58   THR n 
10 59   VAL n 
10 60   GLY n 
10 61   GLU n 
10 62   PHE n 
10 63   ASP n 
10 64   ILE n 
10 65   ARG n 
10 66   GLU n 
10 67   GLY n 
10 68   ASP n 
10 69   PRO n 
10 70   ILE n 
10 71   GLY n 
10 72   ALA n 
10 73   LYS n 
10 74   VAL n 
10 75   THR n 
10 76   LEU n 
10 77   ARG n 
10 78   ASP n 
10 79   GLU n 
10 80   MET n 
10 81   ALA n 
10 82   GLU n 
10 83   GLU n 
10 84   PHE n 
10 85   LEU n 
10 86   GLN n 
10 87   THR n 
10 88   ALA n 
10 89   LEU n 
10 90   PRO n 
10 91   LEU n 
10 92   ALA n 
10 93   GLU n 
10 94   LEU n 
10 95   ALA n 
10 96   THR n 
10 97   SER n 
10 98   GLN n 
10 99   PHE n 
10 100  ASP n 
10 101  ASP n 
10 102  THR n 
10 103  GLY n 
10 104  ASN n 
10 105  PHE n 
10 106  SER n 
10 107  PHE n 
10 108  GLY n 
10 109  VAL n 
10 110  GLU n 
10 111  GLU n 
10 112  HIS n 
10 113  THR n 
10 114  GLU n 
10 115  PHE n 
10 116  PRO n 
10 117  SER n 
10 118  GLN n 
10 119  GLU n 
10 120  TYR n 
10 121  ASP n 
10 122  PRO n 
10 123  SER n 
10 124  ILE n 
10 125  GLY n 
10 126  ILE n 
10 127  TYR n 
10 128  GLY n 
10 129  LEU n 
10 130  ASP n 
10 131  VAL n 
10 132  THR n 
10 133  VAL n 
10 134  ASN n 
10 135  LEU n 
10 136  VAL n 
10 137  ARG n 
10 138  PRO n 
10 139  GLY n 
10 140  TYR n 
10 141  ARG n 
10 142  VAL n 
10 143  ALA n 
10 144  LYS n 
10 145  ARG n 
10 146  ASP n 
10 147  LYS n 
10 148  ALA n 
10 149  SER n 
10 150  ARG n 
10 151  SER n 
10 152  ILE n 
10 153  PRO n 
10 154  THR n 
10 155  LYS n 
10 156  HIS n 
10 157  ARG n 
10 158  LEU n 
10 159  ASN n 
10 160  PRO n 
10 161  ALA n 
10 162  ASP n 
10 163  ALA n 
10 164  VAL n 
10 165  ALA n 
10 166  PHE n 
10 167  ILE n 
10 168  GLU n 
10 169  SER n 
10 170  THR n 
10 171  TYR n 
10 172  ASP n 
10 173  VAL n 
10 174  GLU n 
10 175  VAL n 
10 176  SER n 
10 177  GLU n 
11 1    MET n 
11 2    PRO n 
11 3    ARG n 
11 4    VAL n 
11 5    GLU n 
11 6    LEU n 
11 7    GLU n 
11 8    ILE n 
11 9    PRO n 
11 10   GLU n 
11 11   ASP n 
11 12   VAL n 
11 13   ASP n 
11 14   ALA n 
11 15   GLU n 
11 16   GLN n 
11 17   ASP n 
11 18   HIS n 
11 19   LEU n 
11 20   ASP n 
11 21   ILE n 
11 22   THR n 
11 23   VAL n 
11 24   GLU n 
11 25   GLY n 
11 26   ASP n 
11 27   ASN n 
11 28   GLY n 
11 29   SER n 
11 30   VAL n 
11 31   THR n 
11 32   ARG n 
11 33   ARG n 
11 34   LEU n 
11 35   TRP n 
11 36   TYR n 
11 37   PRO n 
11 38   ASP n 
11 39   ILE n 
11 40   ASP n 
11 41   VAL n 
11 42   SER n 
11 43   VAL n 
11 44   ASP n 
11 45   GLY n 
11 46   ASP n 
11 47   THR n 
11 48   VAL n 
11 49   VAL n 
11 50   ILE n 
11 51   GLU n 
11 52   SER n 
11 53   ASP n 
11 54   GLU n 
11 55   ASP n 
11 56   ASN n 
11 57   ALA n 
11 58   LYS n 
11 59   THR n 
11 60   MET n 
11 61   SER n 
11 62   THR n 
11 63   ILE n 
11 64   GLY n 
11 65   THR n 
11 66   PHE n 
11 67   GLN n 
11 68   SER n 
11 69   HIS n 
11 70   ILE n 
11 71   GLU n 
11 72   ASN n 
11 73   MET n 
11 74   PHE n 
11 75   HIS n 
11 76   GLY n 
11 77   VAL n 
11 78   THR n 
11 79   GLU n 
11 80   GLY n 
11 81   TRP n 
11 82   GLU n 
11 83   TYR n 
11 84   GLY n 
11 85   MET n 
11 86   GLU n 
11 87   VAL n 
11 88   PHE n 
11 89   TYR n 
11 90   SER n 
11 91   HIS n 
11 92   PHE n 
11 93   PRO n 
11 94   MET n 
11 95   GLN n 
11 96   VAL n 
11 97   ASN n 
11 98   VAL n 
11 99   GLU n 
11 100  GLY n 
11 101  ASP n 
11 102  GLU n 
11 103  VAL n 
11 104  VAL n 
11 105  ILE n 
11 106  GLU n 
11 107  ASN n 
11 108  PHE n 
11 109  LEU n 
11 110  GLY n 
11 111  GLU n 
11 112  LYS n 
11 113  ALA n 
11 114  PRO n 
11 115  ARG n 
11 116  ARG n 
11 117  THR n 
11 118  THR n 
11 119  ILE n 
11 120  HIS n 
11 121  GLY n 
11 122  ASP n 
11 123  THR n 
11 124  ASP n 
11 125  VAL n 
11 126  GLU n 
11 127  ILE n 
11 128  ASP n 
11 129  GLY n 
11 130  GLU n 
11 131  GLU n 
11 132  LEU n 
11 133  THR n 
11 134  VAL n 
11 135  SER n 
11 136  GLY n 
11 137  PRO n 
11 138  ASP n 
11 139  ILE n 
11 140  GLU n 
11 141  ALA n 
11 142  VAL n 
11 143  GLY n 
11 144  GLN n 
11 145  THR n 
11 146  ALA n 
11 147  ALA n 
11 148  ASP n 
11 149  ILE n 
11 150  GLU n 
11 151  GLN n 
11 152  LEU n 
11 153  THR n 
11 154  ARG n 
11 155  ILE n 
11 156  ASN n 
11 157  ASP n 
11 158  LYS n 
11 159  ASP n 
11 160  VAL n 
11 161  ARG n 
11 162  VAL n 
11 163  PHE n 
11 164  GLN n 
11 165  ASP n 
11 166  GLY n 
11 167  VAL n 
11 168  TYR n 
11 169  ILE n 
11 170  THR n 
11 171  ARG n 
11 172  LYS n 
11 173  PRO n 
11 174  ASN n 
11 175  ARG n 
11 176  GLY n 
11 177  ASP n 
11 178  ALA n 
12 1    MET n 
12 2    PRO n 
12 3    VAL n 
12 4    TYR n 
12 5    VAL n 
12 6    ASP n 
12 7    PHE n 
12 8    ASP n 
12 9    VAL n 
12 10   PRO n 
12 11   ALA n 
12 12   ASP n 
12 13   LEU n 
12 14   GLU n 
12 15   ASP n 
12 16   ASP n 
12 17   ALA n 
12 18   LEU n 
12 19   GLU n 
12 20   ALA n 
12 21   LEU n 
12 22   GLU n 
12 23   VAL n 
12 24   ALA n 
12 25   ARG n 
12 26   ASP n 
12 27   THR n 
12 28   GLY n 
12 29   ALA n 
12 30   VAL n 
12 31   LYS n 
12 32   LYS n 
12 33   GLY n 
12 34   THR n 
12 35   ASN n 
12 36   GLU n 
12 37   THR n 
12 38   THR n 
12 39   LYS n 
12 40   SER n 
12 41   ILE n 
12 42   GLU n 
12 43   ARG n 
12 44   GLY n 
12 45   SER n 
12 46   ALA n 
12 47   GLU n 
12 48   LEU n 
12 49   VAL n 
12 50   PHE n 
12 51   VAL n 
12 52   ALA n 
12 53   GLU n 
12 54   ASP n 
12 55   VAL n 
12 56   GLN n 
12 57   PRO n 
12 58   GLU n 
12 59   GLU n 
12 60   ILE n 
12 61   VAL n 
12 62   MET n 
12 63   HIS n 
12 64   ILE n 
12 65   PRO n 
12 66   GLU n 
12 67   LEU n 
12 68   ALA n 
12 69   ASP n 
12 70   GLU n 
12 71   LYS n 
12 72   GLY n 
12 73   VAL n 
12 74   PRO n 
12 75   PHE n 
12 76   ILE n 
12 77   PHE n 
12 78   VAL n 
12 79   GLU n 
12 80   GLN n 
12 81   GLN n 
12 82   ASP n 
12 83   ASP n 
12 84   LEU n 
12 85   GLY n 
12 86   HIS n 
12 87   ALA n 
12 88   ALA n 
12 89   GLY n 
12 90   LEU n 
12 91   GLU n 
12 92   VAL n 
12 93   GLY n 
12 94   SER n 
12 95   ALA n 
12 96   ALA n 
12 97   ALA n 
12 98   ALA n 
12 99   VAL n 
12 100  THR n 
12 101  ASP n 
12 102  ALA n 
12 103  GLY n 
12 104  GLU n 
12 105  ALA n 
12 106  ASP n 
12 107  ALA n 
12 108  ASP n 
12 109  VAL n 
12 110  GLU n 
12 111  ASP n 
12 112  ILE n 
12 113  ALA n 
12 114  ASP n 
12 115  LYS n 
12 116  VAL n 
12 117  GLU n 
12 118  GLU n 
12 119  LEU n 
12 120  ARG n 
13 1    MET n 
13 2    SER n 
13 3    ALA n 
13 4    GLU n 
13 5    SER n 
13 6    GLU n 
13 7    ARG n 
13 8    LYS n 
13 9    THR n 
13 10   GLU n 
13 11   THR n 
13 12   ILE n 
13 13   PRO n 
13 14   GLU n 
13 15   TRP n 
13 16   LYS n 
13 17   GLN n 
13 18   GLU n 
13 19   GLU n 
13 20   VAL n 
13 21   ASP n 
13 22   ALA n 
13 23   ILE n 
13 24   VAL n 
13 25   GLU n 
13 26   MET n 
13 27   ILE n 
13 28   GLU n 
13 29   SER n 
13 30   TYR n 
13 31   GLU n 
13 32   SER n 
13 33   VAL n 
13 34   GLY n 
13 35   VAL n 
13 36   VAL n 
13 37   ASN n 
13 38   ILE n 
13 39   ALA n 
13 40   GLY n 
13 41   ILE n 
13 42   PRO n 
13 43   SER n 
13 44   ARG n 
13 45   GLN n 
13 46   LEU n 
13 47   GLN n 
13 48   ASP n 
13 49   MET n 
13 50   ARG n 
13 51   ARG n 
13 52   ASP n 
13 53   LEU n 
13 54   HIS n 
13 55   GLY n 
13 56   THR n 
13 57   ALA n 
13 58   GLU n 
13 59   LEU n 
13 60   ARG n 
13 61   VAL n 
13 62   SER n 
13 63   ARG n 
13 64   ASN n 
13 65   THR n 
13 66   LEU n 
13 67   LEU n 
13 68   GLU n 
13 69   ARG n 
13 70   ALA n 
13 71   LEU n 
13 72   ASP n 
13 73   ASP n 
13 74   VAL n 
13 75   ASP n 
13 76   ASP n 
13 77   GLY n 
13 78   LEU n 
13 79   GLU n 
13 80   ASP n 
13 81   LEU n 
13 82   ASN n 
13 83   GLY n 
13 84   TYR n 
13 85   ILE n 
13 86   THR n 
13 87   GLY n 
13 88   GLN n 
13 89   VAL n 
13 90   GLY n 
13 91   LEU n 
13 92   ILE n 
13 93   GLY n 
13 94   THR n 
13 95   ASP n 
13 96   ASP n 
13 97   ASN n 
13 98   PRO n 
13 99   PHE n 
13 100  SER n 
13 101  LEU n 
13 102  PHE n 
13 103  GLN n 
13 104  GLU n 
13 105  LEU n 
13 106  GLU n 
13 107  ALA n 
13 108  SER n 
13 109  LYS n 
13 110  THR n 
13 111  PRO n 
13 112  ALA n 
13 113  PRO n 
13 114  ILE n 
13 115  GLY n 
13 116  ALA n 
13 117  GLY n 
13 118  GLU n 
13 119  VAL n 
13 120  ALA n 
13 121  PRO n 
13 122  ASN n 
13 123  ASP n 
13 124  ILE n 
13 125  VAL n 
13 126  ILE n 
13 127  PRO n 
13 128  GLU n 
13 129  GLY n 
13 130  ASP n 
13 131  THR n 
13 132  GLY n 
13 133  VAL n 
13 134  ASP n 
13 135  PRO n 
13 136  GLY n 
13 137  PRO n 
13 138  PHE n 
13 139  VAL n 
13 140  GLY n 
13 141  GLU n 
13 142  LEU n 
13 143  GLN n 
13 144  SER n 
13 145  VAL n 
13 146  GLY n 
13 147  ALA n 
13 148  ASP n 
13 149  ALA n 
13 150  ARG n 
13 151  ILE n 
13 152  GLN n 
13 153  GLU n 
13 154  GLY n 
13 155  SER n 
13 156  ILE n 
13 157  GLN n 
13 158  VAL n 
13 159  LEU n 
13 160  SER n 
13 161  ASP n 
13 162  SER n 
13 163  THR n 
13 164  VAL n 
13 165  LEU n 
13 166  ASP n 
13 167  THR n 
13 168  GLY n 
13 169  GLU n 
13 170  GLU n 
13 171  VAL n 
13 172  SER n 
13 173  GLN n 
13 174  GLU n 
13 175  LEU n 
13 176  SER n 
13 177  ASN n 
13 178  VAL n 
13 179  LEU n 
13 180  ASN n 
13 181  GLU n 
13 182  LEU n 
13 183  GLY n 
13 184  ILE n 
13 185  GLU n 
13 186  PRO n 
13 187  LYS n 
13 188  GLU n 
13 189  VAL n 
13 190  GLY n 
13 191  LEU n 
13 192  ASP n 
13 193  LEU n 
13 194  ARG n 
13 195  ALA n 
13 196  VAL n 
13 197  PHE n 
13 198  ALA n 
13 199  ASP n 
13 200  GLY n 
13 201  VAL n 
13 202  LEU n 
13 203  PHE n 
13 204  GLU n 
13 205  PRO n 
13 206  GLU n 
13 207  GLU n 
13 208  LEU n 
13 209  GLU n 
13 210  LEU n 
13 211  ASP n 
13 212  ILE n 
13 213  ASP n 
13 214  GLU n 
13 215  TYR n 
13 216  ARG n 
13 217  SER n 
13 218  ASP n 
13 219  ILE n 
13 220  GLN n 
13 221  ALA n 
13 222  ALA n 
13 223  ALA n 
13 224  GLY n 
13 225  ARG n 
13 226  ALA n 
13 227  PHE n 
13 228  ASN n 
13 229  LEU n 
13 230  SER n 
13 231  VAL n 
13 232  ASN n 
13 233  ALA n 
13 234  ASP n 
13 235  TYR n 
13 236  PRO n 
13 237  THR n 
13 238  ALA n 
13 239  THR n 
13 240  THR n 
13 241  ALA n 
13 242  PRO n 
13 243  THR n 
13 244  MET n 
13 245  LEU n 
13 246  GLN n 
13 247  SER n 
13 248  ASP n 
13 249  ARG n 
13 250  GLY n 
13 251  ASN n 
13 252  ALA n 
13 253  LYS n 
13 254  SER n 
13 255  LEU n 
13 256  ALA n 
13 257  LEU n 
13 258  GLN n 
13 259  ALA n 
13 260  ALA n 
13 261  ILE n 
13 262  GLU n 
13 263  ASP n 
13 264  PRO n 
13 265  GLU n 
13 266  VAL n 
13 267  VAL n 
13 268  PRO n 
13 269  ASP n 
13 270  LEU n 
13 271  VAL n 
13 272  SER n 
13 273  LYS n 
13 274  ALA n 
13 275  ASP n 
13 276  ALA n 
13 277  GLN n 
13 278  VAL n 
13 279  ARG n 
13 280  ALA n 
13 281  LEU n 
13 282  ALA n 
13 283  SER n 
13 284  GLN n 
13 285  ILE n 
13 286  ASP n 
13 287  ASP n 
13 288  GLU n 
13 289  GLU n 
13 290  ALA n 
13 291  LEU n 
13 292  PRO n 
13 293  GLU n 
13 294  GLU n 
13 295  LEU n 
13 296  GLN n 
13 297  GLY n 
13 298  VAL n 
13 299  GLU n 
13 300  ALA n 
13 301  ASP n 
13 302  VAL n 
13 303  ALA n 
13 304  THR n 
13 305  GLU n 
13 306  GLU n 
13 307  PRO n 
13 308  THR n 
13 309  ASP n 
13 310  ASP n 
13 311  GLN n 
13 312  ASP n 
13 313  ASP n 
13 314  ASP n 
13 315  THR n 
13 316  ALA n 
13 317  SER n 
13 318  GLU n 
13 319  ASP n 
13 320  ASP n 
13 321  ALA n 
13 322  ASP n 
13 323  ALA n 
13 324  ASP n 
13 325  ASP n 
13 326  ALA n 
13 327  ALA n 
13 328  GLU n 
13 329  GLU n 
13 330  ALA n 
13 331  ASP n 
13 332  ASP n 
13 333  ASP n 
13 334  ASP n 
13 335  ASP n 
13 336  ASP n 
13 337  ASP n 
13 338  GLU n 
13 339  ASP n 
13 340  ALA n 
13 341  GLY n 
13 342  ASP n 
13 343  ALA n 
13 344  LEU n 
13 345  GLY n 
13 346  ALA n 
13 347  MET n 
13 348  PHE n 
14 1    MET n 
14 2    SER n 
14 3    ASP n 
14 4    LYS n 
14 5    PRO n 
14 6    ALA n 
14 7    SER n 
14 8    MET n 
14 9    TYR n 
14 10   ARG n 
14 11   ASP n 
14 12   ILE n 
14 13   ASP n 
14 14   LYS n 
14 15   PRO n 
14 16   ALA n 
14 17   TYR n 
14 18   THR n 
14 19   ARG n 
14 20   ARG n 
14 21   GLU n 
14 22   TYR n 
14 23   ILE n 
14 24   THR n 
14 25   GLY n 
14 26   ILE n 
14 27   PRO n 
14 28   GLY n 
14 29   SER n 
14 30   LYS n 
14 31   ILE n 
14 32   ALA n 
14 33   GLN n 
14 34   HIS n 
14 35   LYS n 
14 36   MET n 
14 37   GLY n 
14 38   ARG n 
14 39   LYS n 
14 40   GLN n 
14 41   LYS n 
14 42   ASP n 
14 43   ALA n 
14 44   ASP n 
14 45   ASP n 
14 46   TYR n 
14 47   PRO n 
14 48   VAL n 
14 49   GLN n 
14 50   ILE n 
14 51   SER n 
14 52   LEU n 
14 53   ILE n 
14 54   VAL n 
14 55   GLU n 
14 56   GLU n 
14 57   THR n 
14 58   VAL n 
14 59   GLN n 
14 60   LEU n 
14 61   ARG n 
14 62   HIS n 
14 63   GLY n 
14 64   SER n 
14 65   LEU n 
14 66   GLU n 
14 67   ALA n 
14 68   SER n 
14 69   ARG n 
14 70   LEU n 
14 71   SER n 
14 72   ALA n 
14 73   ASN n 
14 74   ARG n 
14 75   HIS n 
14 76   LEU n 
14 77   ILE n 
14 78   LYS n 
14 79   GLU n 
14 80   LEU n 
14 81   GLY n 
14 82   GLU n 
14 83   GLU n 
14 84   GLY n 
14 85   ASP n 
14 86   TYR n 
14 87   LYS n 
14 88   MET n 
14 89   THR n 
14 90   LEU n 
14 91   ARG n 
14 92   LYS n 
14 93   PHE n 
14 94   PRO n 
14 95   HIS n 
14 96   GLN n 
14 97   VAL n 
14 98   LEU n 
14 99   ARG n 
14 100  GLU n 
14 101  ASN n 
14 102  LYS n 
14 103  GLN n 
14 104  ALA n 
14 105  THR n 
14 106  GLY n 
14 107  ALA n 
14 108  GLY n 
14 109  ALA n 
14 110  ASP n 
14 111  ARG n 
14 112  VAL n 
14 113  SER n 
14 114  ASP n 
14 115  GLY n 
14 116  MET n 
14 117  ARG n 
14 118  ALA n 
14 119  ALA n 
14 120  PHE n 
14 121  GLY n 
14 122  LYS n 
14 123  ILE n 
14 124  VAL n 
14 125  GLY n 
14 126  THR n 
14 127  ALA n 
14 128  ALA n 
14 129  ARG n 
14 130  VAL n 
14 131  GLN n 
14 132  ALA n 
14 133  GLY n 
14 134  GLU n 
14 135  GLN n 
14 136  LEU n 
14 137  PHE n 
14 138  THR n 
14 139  ALA n 
14 140  TYR n 
14 141  CYS n 
14 142  ASN n 
14 143  VAL n 
14 144  GLU n 
14 145  ASP n 
14 146  ALA n 
14 147  GLU n 
14 148  HIS n 
14 149  VAL n 
14 150  LYS n 
14 151  GLU n 
14 152  ALA n 
14 153  PHE n 
14 154  ARG n 
14 155  ARG n 
14 156  ALA n 
14 157  TYR n 
14 158  ASN n 
14 159  LYS n 
14 160  ILE n 
14 161  THR n 
14 162  PRO n 
14 163  SER n 
14 164  CYS n 
14 165  ARG n 
14 166  ILE n 
14 167  LYS n 
14 168  VAL n 
14 169  GLU n 
14 170  ARG n 
14 171  GLY n 
14 172  GLU n 
14 173  GLU n 
14 174  LEU n 
14 175  LEU n 
14 176  ILE n 
14 177  ALA n 
15 1    MET n 
15 2    ALA n 
15 3    GLY n 
15 4    THR n 
15 5    ILE n 
15 6    GLU n 
15 7    VAL n 
15 8    LEU n 
15 9    VAL n 
15 10   PRO n 
15 11   GLY n 
15 12   GLY n 
15 13   GLU n 
15 14   ALA n 
15 15   ASN n 
15 16   PRO n 
15 17   GLY n 
15 18   PRO n 
15 19   PRO n 
15 20   LEU n 
15 21   GLY n 
15 22   PRO n 
15 23   GLU n 
15 24   LEU n 
15 25   GLY n 
15 26   PRO n 
15 27   THR n 
15 28   PRO n 
15 29   VAL n 
15 30   ASP n 
15 31   VAL n 
15 32   GLN n 
15 33   ALA n 
15 34   VAL n 
15 35   VAL n 
15 36   GLN n 
15 37   GLU n 
15 38   ILE n 
15 39   ASN n 
15 40   ASP n 
15 41   GLN n 
15 42   THR n 
15 43   ALA n 
15 44   ALA n 
15 45   PHE n 
15 46   ASP n 
15 47   GLY n 
15 48   THR n 
15 49   GLU n 
15 50   VAL n 
15 51   PRO n 
15 52   VAL n 
15 53   THR n 
15 54   VAL n 
15 55   LYS n 
15 56   TYR n 
15 57   ASP n 
15 58   ASP n 
15 59   ASP n 
15 60   GLY n 
15 61   SER n 
15 62   PHE n 
15 63   GLU n 
15 64   ILE n 
15 65   GLU n 
15 66   VAL n 
15 67   GLY n 
15 68   VAL n 
15 69   PRO n 
15 70   PRO n 
15 71   THR n 
15 72   ALA n 
15 73   GLU n 
15 74   LEU n 
15 75   ILE n 
15 76   LYS n 
15 77   ASP n 
15 78   GLU n 
15 79   ALA n 
15 80   GLY n 
15 81   PHE n 
15 82   GLU n 
15 83   THR n 
15 84   GLY n 
15 85   SER n 
15 86   GLY n 
15 87   GLU n 
15 88   PRO n 
15 89   GLN n 
15 90   GLU n 
15 91   ASP n 
15 92   PHE n 
15 93   VAL n 
15 94   ALA n 
15 95   ASP n 
15 96   LEU n 
15 97   SER n 
15 98   VAL n 
15 99   ASP n 
15 100  GLN n 
15 101  VAL n 
15 102  LYS n 
15 103  GLN n 
15 104  ILE n 
15 105  ALA n 
15 106  GLU n 
15 107  GLN n 
15 108  LYS n 
15 109  HIS n 
15 110  PRO n 
15 111  ASP n 
15 112  LEU n 
15 113  LEU n 
15 114  SER n 
15 115  TYR n 
15 116  ASP n 
15 117  LEU n 
15 118  THR n 
15 119  ASN n 
15 120  ALA n 
15 121  ALA n 
15 122  LYS n 
15 123  GLU n 
15 124  VAL n 
15 125  VAL n 
15 126  GLY n 
15 127  THR n 
15 128  CYS n 
15 129  THR n 
15 130  SER n 
15 131  LEU n 
15 132  GLY n 
15 133  VAL n 
15 134  THR n 
15 135  ILE n 
15 136  GLU n 
15 137  GLY n 
15 138  GLU n 
15 139  ASN n 
15 140  PRO n 
15 141  ARG n 
15 142  GLU n 
15 143  PHE n 
15 144  LYS n 
15 145  GLU n 
15 146  ARG n 
15 147  ILE n 
15 148  ASP n 
15 149  ALA n 
15 150  GLY n 
15 151  GLU n 
15 152  TYR n 
15 153  ASP n 
15 154  ASP n 
15 155  VAL n 
15 156  PHE n 
15 157  ALA n 
15 158  ALA n 
15 159  GLU n 
15 160  ALA n 
15 161  GLN n 
15 162  ALA n 
16 1    MET n 
16 2    SER n 
16 3    VAL n 
16 4    ALA n 
16 5    GLU n 
16 6    PHE n 
16 7    ASP n 
16 8    ALA n 
16 9    ASP n 
16 10   VAL n 
16 11   ILE n 
16 12   VAL n 
16 13   ASP n 
16 14   ALA n 
16 15   ARG n 
16 16   ASP n 
16 17   CYS n 
16 18   ILE n 
16 19   MET n 
16 20   GLY n 
16 21   ARG n 
16 22   VAL n 
16 23   ALA n 
16 24   SER n 
16 25   GLN n 
16 26   VAL n 
16 27   ALA n 
16 28   GLU n 
16 29   GLN n 
16 30   ALA n 
16 31   LEU n 
16 32   ASP n 
16 33   GLY n 
16 34   GLU n 
16 35   THR n 
16 36   VAL n 
16 37   ALA n 
16 38   VAL n 
16 39   VAL n 
16 40   ASN n 
16 41   ALA n 
16 42   GLU n 
16 43   ARG n 
16 44   ALA n 
16 45   VAL n 
16 46   ILE n 
16 47   THR n 
16 48   GLY n 
16 49   ARG n 
16 50   GLU n 
16 51   GLU n 
16 52   GLN n 
16 53   ILE n 
16 54   VAL n 
16 55   GLU n 
16 56   LYS n 
16 57   TYR n 
16 58   GLU n 
16 59   LYS n 
16 60   ARG n 
16 61   VAL n 
16 62   ASP n 
16 63   ILE n 
16 64   GLY n 
16 65   ASN n 
16 66   ASP n 
16 67   ASN n 
16 68   GLY n 
16 69   TYR n 
16 70   PHE n 
16 71   TYR n 
16 72   PRO n 
16 73   LYS n 
16 74   ARG n 
16 75   PRO n 
16 76   ASP n 
16 77   GLY n 
16 78   ILE n 
16 79   PHE n 
16 80   LYS n 
16 81   ARG n 
16 82   THR n 
16 83   ILE n 
16 84   ARG n 
16 85   GLY n 
16 86   MET n 
16 87   LEU n 
16 88   PRO n 
16 89   HIS n 
16 90   LYS n 
16 91   LYS n 
16 92   GLN n 
16 93   ARG n 
16 94   GLY n 
16 95   ARG n 
16 96   GLU n 
16 97   ALA n 
16 98   PHE n 
16 99   GLU n 
16 100  SER n 
16 101  VAL n 
16 102  ARG n 
16 103  VAL n 
16 104  TYR n 
16 105  LEU n 
16 106  GLY n 
16 107  ASN n 
16 108  PRO n 
16 109  TYR n 
16 110  ASP n 
16 111  GLU n 
16 112  ASP n 
16 113  GLY n 
16 114  GLU n 
16 115  VAL n 
16 116  LEU n 
16 117  ASP n 
16 118  GLY n 
16 119  THR n 
16 120  SER n 
16 121  LEU n 
16 122  ASP n 
16 123  ARG n 
16 124  LEU n 
16 125  SER n 
16 126  ASN n 
16 127  ILE n 
16 128  LYS n 
16 129  PHE n 
16 130  VAL n 
16 131  THR n 
16 132  LEU n 
16 133  GLY n 
16 134  GLU n 
16 135  ILE n 
16 136  SER n 
16 137  GLU n 
16 138  THR n 
16 139  LEU n 
16 140  GLY n 
16 141  ALA n 
16 142  ASN n 
16 143  LYS n 
16 144  THR n 
16 145  TRP n 
17 1    MET n 
17 2    GLU n 
17 3    ALA n 
17 4    LEU n 
17 5    GLY n 
17 6    ALA n 
17 7    ASP n 
17 8    VAL n 
17 9    THR n 
17 10   GLN n 
17 11   GLY n 
17 12   LEU n 
17 13   GLU n 
17 14   LYS n 
17 15   GLY n 
17 16   SER n 
17 17   LEU n 
17 18   ILE n 
17 19   THR n 
17 20   CYS n 
17 21   ALA n 
17 22   ASP n 
17 23   ASN n 
17 24   THR n 
17 25   GLY n 
17 26   ALA n 
17 27   ARG n 
17 28   GLU n 
17 29   LEU n 
17 30   LYS n 
17 31   VAL n 
17 32   ILE n 
17 33   SER n 
17 34   VAL n 
17 35   HIS n 
17 36   GLY n 
17 37   TYR n 
17 38   SER n 
17 39   GLY n 
17 40   THR n 
17 41   LYS n 
17 42   ASN n 
17 43   ARG n 
17 44   LEU n 
17 45   PRO n 
17 46   LYS n 
17 47   ALA n 
17 48   GLY n 
17 49   LEU n 
17 50   GLY n 
17 51   ASP n 
17 52   LYS n 
17 53   ILE n 
17 54   THR n 
17 55   VAL n 
17 56   SER n 
17 57   VAL n 
17 58   THR n 
17 59   LYS n 
17 60   GLY n 
17 61   THR n 
17 62   PRO n 
17 63   GLU n 
17 64   MET n 
17 65   ARG n 
17 66   ARG n 
17 67   GLN n 
17 68   VAL n 
17 69   LEU n 
17 70   GLU n 
17 71   ALA n 
17 72   VAL n 
17 73   VAL n 
17 74   VAL n 
17 75   ARG n 
17 76   GLN n 
17 77   ARG n 
17 78   LYS n 
17 79   PRO n 
17 80   ILE n 
17 81   ARG n 
17 82   ARG n 
17 83   PRO n 
17 84   ASP n 
17 85   GLY n 
17 86   THR n 
17 87   ARG n 
17 88   VAL n 
17 89   LYS n 
17 90   PHE n 
17 91   GLU n 
17 92   ASP n 
17 93   ASN n 
17 94   ALA n 
17 95   ALA n 
17 96   VAL n 
17 97   ILE n 
17 98   VAL n 
17 99   ASP n 
17 100  GLU n 
17 101  ASN n 
17 102  GLU n 
17 103  ASP n 
17 104  PRO n 
17 105  ARG n 
17 106  GLY n 
17 107  THR n 
17 108  GLU n 
17 109  LEU n 
17 110  LYS n 
17 111  GLY n 
17 112  PRO n 
17 113  ILE n 
17 114  ALA n 
17 115  ARG n 
17 116  GLU n 
17 117  VAL n 
17 118  ALA n 
17 119  GLN n 
17 120  ARG n 
17 121  PHE n 
17 122  GLY n 
17 123  SER n 
17 124  VAL n 
17 125  ALA n 
17 126  SER n 
17 127  ALA n 
17 128  ALA n 
17 129  THR n 
17 130  MET n 
17 131  ILE n 
17 132  VAL n 
18 1    MET n 
18 2    THR n 
18 3    SER n 
18 4    LYS n 
18 5    LYS n 
18 6    LYS n 
18 7    ARG n 
18 8    GLN n 
18 9    ARG n 
18 10   GLY n 
18 11   SER n 
18 12   ARG n 
18 13   THR n 
18 14   HIS n 
18 15   GLY n 
18 16   GLY n 
18 17   GLY n 
18 18   SER n 
18 19   HIS n 
18 20   LYS n 
18 21   ASN n 
18 22   ARG n 
18 23   ARG n 
18 24   GLY n 
18 25   ALA n 
18 26   GLY n 
18 27   HIS n 
18 28   ARG n 
18 29   GLY n 
18 30   GLY n 
18 31   ARG n 
18 32   GLY n 
18 33   ASP n 
18 34   ALA n 
18 35   GLY n 
18 36   ARG n 
18 37   ASP n 
18 38   LYS n 
18 39   HIS n 
18 40   GLU n 
18 41   PHE n 
18 42   HIS n 
18 43   ASN n 
18 44   HIS n 
18 45   GLU n 
18 46   PRO n 
18 47   LEU n 
18 48   GLY n 
18 49   LYS n 
18 50   SER n 
18 51   GLY n 
18 52   PHE n 
18 53   LYS n 
18 54   ARG n 
18 55   PRO n 
18 56   GLN n 
18 57   LYS n 
18 58   VAL n 
18 59   GLN n 
18 60   GLU n 
18 61   GLU n 
18 62   ALA n 
18 63   ALA n 
18 64   THR n 
18 65   ILE n 
18 66   ASP n 
18 67   VAL n 
18 68   ARG n 
18 69   GLU n 
18 70   ILE n 
18 71   ASP n 
18 72   GLU n 
18 73   ASN n 
18 74   VAL n 
18 75   THR n 
18 76   LEU n 
18 77   LEU n 
18 78   ALA n 
18 79   ALA n 
18 80   ASP n 
18 81   ASP n 
18 82   VAL n 
18 83   ALA n 
18 84   GLU n 
18 85   VAL n 
18 86   GLU n 
18 87   ASP n 
18 88   GLY n 
18 89   GLY n 
18 90   PHE n 
18 91   ARG n 
18 92   VAL n 
18 93   ASP n 
18 94   VAL n 
18 95   ARG n 
18 96   ASP n 
18 97   VAL n 
18 98   VAL n 
18 99   GLU n 
18 100  GLU n 
18 101  ALA n 
18 102  ASP n 
18 103  ASP n 
18 104  ALA n 
18 105  ASP n 
18 106  TYR n 
18 107  VAL n 
18 108  LYS n 
18 109  VAL n 
18 110  LEU n 
18 111  GLY n 
18 112  ALA n 
18 113  GLY n 
18 114  GLN n 
18 115  VAL n 
18 116  ARG n 
18 117  HIS n 
18 118  GLU n 
18 119  LEU n 
18 120  THR n 
18 121  LEU n 
18 122  ILE n 
18 123  ALA n 
18 124  ASP n 
18 125  ASP n 
18 126  PHE n 
18 127  SER n 
18 128  GLU n 
18 129  GLY n 
18 130  ALA n 
18 131  ARG n 
18 132  GLU n 
18 133  LYS n 
18 134  VAL n 
18 135  GLU n 
18 136  GLY n 
18 137  ALA n 
18 138  GLY n 
18 139  GLY n 
18 140  SER n 
18 141  VAL n 
18 142  GLU n 
18 143  LEU n 
18 144  THR n 
18 145  ASP n 
18 146  LEU n 
18 147  GLY n 
18 148  GLU n 
18 149  GLU n 
18 150  ARG n 
18 151  GLN n 
18 152  ALA n 
18 153  GLU n 
18 154  ALA n 
18 155  GLU n 
18 156  GLU n 
18 157  THR n 
18 158  GLU n 
18 159  ASP n 
18 160  ALA n 
18 161  ASP n 
18 162  ALA n 
18 163  ASP n 
18 164  GLU n 
18 165  GLU n 
19 1    MET n 
19 2    ALA n 
19 3    ARG n 
19 4    SER n 
19 5    ALA n 
19 6    TYR n 
19 7    SER n 
19 8    TYR n 
19 9    ILE n 
19 10   ARG n 
19 11   ASP n 
19 12   ALA n 
19 13   TRP n 
19 14   GLU n 
19 15   ASN n 
19 16   PRO n 
19 17   GLY n 
19 18   ASP n 
19 19   GLY n 
19 20   GLN n 
19 21   LEU n 
19 22   ALA n 
19 23   GLU n 
19 24   LEU n 
19 25   GLN n 
19 26   TRP n 
19 27   GLN n 
19 28   ARG n 
19 29   GLN n 
19 30   GLN n 
19 31   GLU n 
19 32   TRP n 
19 33   ARG n 
19 34   ASN n 
19 35   GLU n 
19 36   GLY n 
19 37   ALA n 
19 38   VAL n 
19 39   GLU n 
19 40   ARG n 
19 41   ILE n 
19 42   GLU n 
19 43   ARG n 
19 44   PRO n 
19 45   THR n 
19 46   ARG n 
19 47   LEU n 
19 48   ASP n 
19 49   LYS n 
19 50   ALA n 
19 51   ARG n 
19 52   SER n 
19 53   GLN n 
19 54   GLY n 
19 55   TYR n 
19 56   LYS n 
19 57   ALA n 
19 58   LYS n 
19 59   GLN n 
19 60   GLY n 
19 61   VAL n 
19 62   ILE n 
19 63   VAL n 
19 64   ALA n 
19 65   ARG n 
19 66   VAL n 
19 67   SER n 
19 68   VAL n 
19 69   ARG n 
19 70   LYS n 
19 71   GLY n 
19 72   SER n 
19 73   ALA n 
19 74   ARG n 
19 75   LYS n 
19 76   ARG n 
19 77   ARG n 
19 78   HIS n 
19 79   LYS n 
19 80   ALA n 
19 81   GLY n 
19 82   ARG n 
19 83   ARG n 
19 84   SER n 
19 85   LYS n 
19 86   ARG n 
19 87   GLN n 
19 88   GLY n 
19 89   VAL n 
19 90   THR n 
19 91   ARG n 
19 92   ILE n 
19 93   THR n 
19 94   ARG n 
19 95   ARG n 
19 96   LYS n 
19 97   ASP n 
19 98   ILE n 
19 99   GLN n 
19 100  ARG n 
19 101  VAL n 
19 102  ALA n 
19 103  GLU n 
19 104  GLU n 
19 105  ARG n 
19 106  ALA n 
19 107  SER n 
19 108  ARG n 
19 109  THR n 
19 110  PHE n 
19 111  PRO n 
19 112  ASN n 
19 113  LEU n 
19 114  ARG n 
19 115  VAL n 
19 116  LEU n 
19 117  ASN n 
19 118  SER n 
19 119  TYR n 
19 120  SER n 
19 121  VAL n 
19 122  GLY n 
19 123  GLN n 
19 124  ASP n 
19 125  GLY n 
19 126  ARG n 
19 127  GLN n 
19 128  LYS n 
19 129  TRP n 
19 130  HIS n 
19 131  GLU n 
19 132  VAL n 
19 133  ILE n 
19 134  LEU n 
19 135  ILE n 
19 136  ASP n 
19 137  PRO n 
19 138  ASN n 
19 139  HIS n 
19 140  PRO n 
19 141  ALA n 
19 142  ILE n 
19 143  GLN n 
19 144  ASN n 
19 145  ASP n 
19 146  ASP n 
19 147  ASP n 
19 148  LEU n 
19 149  SER n 
19 150  TRP n 
19 151  ILE n 
19 152  CYS n 
19 153  ALA n 
19 154  ASP n 
19 155  ASP n 
19 156  GLN n 
19 157  ALA n 
19 158  ASP n 
19 159  ARG n 
19 160  VAL n 
19 161  PHE n 
19 162  ARG n 
19 163  GLY n 
19 164  LEU n 
19 165  THR n 
19 166  GLY n 
19 167  ALA n 
19 168  GLY n 
19 169  ARG n 
19 170  ARG n 
19 171  ASN n 
19 172  ARG n 
19 173  GLY n 
19 174  LEU n 
19 175  SER n 
19 176  GLY n 
19 177  LYS n 
19 178  GLY n 
19 179  LYS n 
19 180  GLY n 
19 181  SER n 
19 182  GLU n 
19 183  LYS n 
19 184  THR n 
19 185  ARG n 
19 186  PRO n 
19 187  SER n 
19 188  LEU n 
19 189  ARG n 
19 190  SER n 
19 191  ASN n 
19 192  GLY n 
19 193  GLY n 
19 194  LYS n 
19 195  GLY n 
20 1    MET n 
20 2    ALA n 
20 3    THR n 
20 4    GLY n 
20 5    PRO n 
20 6    ARG n 
20 7    TYR n 
20 8    LYS n 
20 9    VAL n 
20 10   PRO n 
20 11   MET n 
20 12   ARG n 
20 13   ARG n 
20 14   ARG n 
20 15   ARG n 
20 16   GLU n 
20 17   ALA n 
20 18   ARG n 
20 19   THR n 
20 20   ASP n 
20 21   TYR n 
20 22   HIS n 
20 23   GLN n 
20 24   ARG n 
20 25   LEU n 
20 26   ARG n 
20 27   LEU n 
20 28   LEU n 
20 29   LYS n 
20 30   SER n 
20 31   GLY n 
20 32   LYS n 
20 33   PRO n 
20 34   ARG n 
20 35   LEU n 
20 36   VAL n 
20 37   ALA n 
20 38   ARG n 
20 39   LYS n 
20 40   SER n 
20 41   ASN n 
20 42   LYS n 
20 43   HIS n 
20 44   VAL n 
20 45   ARG n 
20 46   ALA n 
20 47   GLN n 
20 48   LEU n 
20 49   VAL n 
20 50   THR n 
20 51   LEU n 
20 52   GLY n 
20 53   PRO n 
20 54   ASN n 
20 55   GLY n 
20 56   ASP n 
20 57   ASP n 
20 58   THR n 
20 59   LEU n 
20 60   ALA n 
20 61   SER n 
20 62   ALA n 
20 63   HIS n 
20 64   SER n 
20 65   SER n 
20 66   ASP n 
20 67   LEU n 
20 68   ALA n 
20 69   GLU n 
20 70   TYR n 
20 71   GLY n 
20 72   TRP n 
20 73   GLU n 
20 74   ALA n 
20 75   PRO n 
20 76   THR n 
20 77   GLY n 
20 78   ASN n 
20 79   MET n 
20 80   PRO n 
20 81   SER n 
20 82   ALA n 
20 83   TYR n 
20 84   LEU n 
20 85   THR n 
20 86   GLY n 
20 87   LEU n 
20 88   LEU n 
20 89   ALA n 
20 90   GLY n 
20 91   LEU n 
20 92   ARG n 
20 93   ALA n 
20 94   GLN n 
20 95   GLU n 
20 96   ALA n 
20 97   GLY n 
20 98   VAL n 
20 99   GLU n 
20 100  GLU n 
20 101  ALA n 
20 102  VAL n 
20 103  LEU n 
20 104  ASP n 
20 105  ILE n 
20 106  GLY n 
20 107  LEU n 
20 108  ASN n 
20 109  SER n 
20 110  PRO n 
20 111  THR n 
20 112  PRO n 
20 113  GLY n 
20 114  SER n 
20 115  LYS n 
20 116  VAL n 
20 117  PHE n 
20 118  ALA n 
20 119  ILE n 
20 120  GLN n 
20 121  GLU n 
20 122  GLY n 
20 123  ALA n 
20 124  ILE n 
20 125  ASP n 
20 126  ALA n 
20 127  GLY n 
20 128  LEU n 
20 129  ASP n 
20 130  ILE n 
20 131  PRO n 
20 132  HIS n 
20 133  ASN n 
20 134  ASP n 
20 135  ASP n 
20 136  VAL n 
20 137  LEU n 
20 138  ALA n 
20 139  ASP n 
20 140  TRP n 
20 141  GLN n 
20 142  ARG n 
20 143  THR n 
20 144  ARG n 
20 145  GLY n 
20 146  ALA n 
20 147  HIS n 
20 148  ILE n 
20 149  ALA n 
20 150  GLU n 
20 151  TYR n 
20 152  ASP n 
20 153  GLU n 
20 154  GLN n 
20 155  LEU n 
20 156  GLU n 
20 157  GLU n 
20 158  PRO n 
20 159  LEU n 
20 160  TYR n 
20 161  SER n 
20 162  GLY n 
20 163  ASP n 
20 164  PHE n 
20 165  ASP n 
20 166  ALA n 
20 167  ALA n 
20 168  ASP n 
20 169  LEU n 
20 170  PRO n 
20 171  GLU n 
20 172  HIS n 
20 173  PHE n 
20 174  ASP n 
20 175  GLU n 
20 176  LEU n 
20 177  ARG n 
20 178  GLU n 
20 179  THR n 
20 180  LEU n 
20 181  LEU n 
20 182  ASP n 
20 183  GLY n 
20 184  ASP n 
20 185  ILE n 
20 186  GLU n 
20 187  LEU n 
21 1    MET n 
21 2    SER n 
21 3    LYS n 
21 4    THR n 
21 5    ASN n 
21 6    PRO n 
21 7    ARG n 
21 8    LEU n 
21 9    SER n 
21 10   SER n 
21 11   LEU n 
21 12   ILE n 
21 13   ALA n 
21 14   ASP n 
21 15   LEU n 
21 16   LYS n 
21 17   SER n 
21 18   ALA n 
21 19   ALA n 
21 20   ARG n 
21 21   SER n 
21 22   SER n 
21 23   GLY n 
21 24   GLY n 
21 25   ALA n 
21 26   VAL n 
21 27   TRP n 
21 28   GLY n 
21 29   ASP n 
21 30   VAL n 
21 31   ALA n 
21 32   GLU n 
21 33   ARG n 
21 34   LEU n 
21 35   GLU n 
21 36   LYS n 
21 37   PRO n 
21 38   ARG n 
21 39   ARG n 
21 40   THR n 
21 41   HIS n 
21 42   ALA n 
21 43   GLU n 
21 44   VAL n 
21 45   ASN n 
21 46   LEU n 
21 47   GLY n 
21 48   ARG n 
21 49   ILE n 
21 50   GLU n 
21 51   ARG n 
21 52   TYR n 
21 53   ALA n 
21 54   GLN n 
21 55   GLU n 
21 56   ASP n 
21 57   GLU n 
21 58   THR n 
21 59   VAL n 
21 60   VAL n 
21 61   VAL n 
21 62   PRO n 
21 63   GLY n 
21 64   LYS n 
21 65   VAL n 
21 66   LEU n 
21 67   GLY n 
21 68   SER n 
21 69   GLY n 
21 70   VAL n 
21 71   LEU n 
21 72   GLN n 
21 73   LYS n 
21 74   ASP n 
21 75   VAL n 
21 76   THR n 
21 77   VAL n 
21 78   ALA n 
21 79   ALA n 
21 80   VAL n 
21 81   ASP n 
21 82   PHE n 
21 83   SER n 
21 84   GLY n 
21 85   THR n 
21 86   ALA n 
21 87   GLU n 
21 88   THR n 
21 89   LYS n 
21 90   ILE n 
21 91   ASP n 
21 92   GLN n 
21 93   VAL n 
21 94   GLY n 
21 95   GLU n 
21 96   ALA n 
21 97   VAL n 
21 98   SER n 
21 99   LEU n 
21 100  GLU n 
21 101  GLN n 
21 102  ALA n 
21 103  ILE n 
21 104  GLU n 
21 105  ASN n 
21 106  ASN n 
21 107  PRO n 
21 108  GLU n 
21 109  GLY n 
21 110  SER n 
21 111  HIS n 
21 112  VAL n 
21 113  ARG n 
21 114  VAL n 
21 115  ILE n 
21 116  ARG n 
22 1    MET n 
22 2    THR n 
22 3    ASP n 
22 4    LEU n 
22 5    SER n 
22 6    ALA n 
22 7    GLN n 
22 8    LYS n 
22 9    ARG n 
22 10   LEU n 
22 11   ALA n 
22 12   ALA n 
22 13   ASP n 
22 14   VAL n 
22 15   LEU n 
22 16   ASP n 
22 17   VAL n 
22 18   GLY n 
22 19   LYS n 
22 20   ASN n 
22 21   ARG n 
22 22   VAL n 
22 23   TRP n 
22 24   PHE n 
22 25   ASN n 
22 26   PRO n 
22 27   GLU n 
22 28   ARG n 
22 29   GLN n 
22 30   GLY n 
22 31   ASP n 
22 32   ILE n 
22 33   ALA n 
22 34   ASP n 
22 35   ALA n 
22 36   ILE n 
22 37   THR n 
22 38   ARG n 
22 39   GLU n 
22 40   ASP n 
22 41   VAL n 
22 42   ARG n 
22 43   GLU n 
22 44   LEU n 
22 45   VAL n 
22 46   ASP n 
22 47   GLU n 
22 48   GLY n 
22 49   ALA n 
22 50   ILE n 
22 51   GLN n 
22 52   ALA n 
22 53   LYS n 
22 54   ASP n 
22 55   LYS n 
22 56   LYS n 
22 57   GLY n 
22 58   ASN n 
22 59   SER n 
22 60   ARG n 
22 61   GLY n 
22 62   ARG n 
22 63   ALA n 
22 64   ARG n 
22 65   GLU n 
22 66   ARG n 
22 67   GLN n 
22 68   LYS n 
22 69   LYS n 
22 70   ARG n 
22 71   ALA n 
22 72   TYR n 
22 73   GLY n 
22 74   HIS n 
22 75   GLN n 
22 76   LYS n 
22 77   GLY n 
22 78   ALA n 
22 79   GLY n 
22 80   SER n 
22 81   ARG n 
22 82   LYS n 
22 83   GLY n 
22 84   LYS n 
22 85   ALA n 
22 86   GLY n 
22 87   ALA n 
22 88   ARG n 
22 89   GLN n 
22 90   ASN n 
22 91   SER n 
22 92   LYS n 
22 93   GLU n 
22 94   ASP n 
22 95   TRP n 
22 96   GLU n 
22 97   SER n 
22 98   ARG n 
22 99   ILE n 
22 100  ARG n 
22 101  ALA n 
22 102  GLN n 
22 103  ARG n 
22 104  THR n 
22 105  LYS n 
22 106  LEU n 
22 107  ARG n 
22 108  GLU n 
22 109  LEU n 
22 110  ARG n 
22 111  ASP n 
22 112  GLU n 
22 113  GLY n 
22 114  THR n 
22 115  LEU n 
22 116  SER n 
22 117  SER n 
22 118  SER n 
22 119  GLN n 
22 120  TYR n 
22 121  ARG n 
22 122  ASP n 
22 123  LEU n 
22 124  TYR n 
22 125  ASP n 
22 126  LYS n 
22 127  ALA n 
22 128  GLY n 
22 129  GLY n 
22 130  GLY n 
22 131  GLU n 
22 132  PHE n 
22 133  ASP n 
22 134  SER n 
22 135  VAL n 
22 136  ALA n 
22 137  ASP n 
22 138  LEU n 
22 139  GLU n 
22 140  ARG n 
22 141  TYR n 
22 142  ILE n 
22 143  ASP n 
22 144  ALA n 
22 145  ASN n 
22 146  HIS n 
22 147  GLY n 
22 148  ASP n 
22 149  ALA n 
23 1    MET n 
23 2    PRO n 
23 3    SER n 
23 4    SER n 
23 5    ASN n 
23 6    GLY n 
23 7    PRO n 
23 8    LEU n 
23 9    GLU n 
23 10   GLY n 
23 11   THR n 
23 12   ARG n 
23 13   GLY n 
23 14   LYS n 
23 15   LEU n 
23 16   LYS n 
23 17   ASN n 
23 18   LYS n 
23 19   PRO n 
23 20   ARG n 
23 21   ASP n 
23 22   ARG n 
23 23   GLY n 
23 24   THR n 
23 25   SER n 
23 26   PRO n 
23 27   PRO n 
23 28   GLN n 
23 29   ARG n 
23 30   ALA n 
23 31   VAL n 
23 32   GLU n 
23 33   GLU n 
23 34   PHE n 
23 35   ASP n 
23 36   ASP n 
23 37   GLY n 
23 38   GLU n 
23 39   LYS n 
23 40   VAL n 
23 41   HIS n 
23 42   LEU n 
23 43   LYS n 
23 44   ILE n 
23 45   ASP n 
23 46   PRO n 
23 47   SER n 
23 48   VAL n 
23 49   PRO n 
23 50   ASN n 
23 51   GLY n 
23 52   ARG n 
23 53   PHE n 
23 54   HIS n 
23 55   PRO n 
23 56   ARG n 
23 57   PHE n 
23 58   ASP n 
23 59   GLY n 
23 60   GLN n 
23 61   THR n 
23 62   GLY n 
23 63   THR n 
23 64   VAL n 
23 65   GLU n 
23 66   GLY n 
23 67   LYS n 
23 68   GLN n 
23 69   GLY n 
23 70   ASP n 
23 71   ALA n 
23 72   TYR n 
23 73   LYS n 
23 74   VAL n 
23 75   ASP n 
23 76   ILE n 
23 77   VAL n 
23 78   ASP n 
23 79   GLY n 
23 80   GLY n 
23 81   LYS n 
23 82   GLU n 
23 83   LYS n 
23 84   THR n 
23 85   ILE n 
23 86   ILE n 
23 87   VAL n 
23 88   THR n 
23 89   ALA n 
23 90   ALA n 
23 91   HIS n 
23 92   LEU n 
23 93   ARG n 
23 94   ARG n 
23 95   GLN n 
23 96   GLU n 
24 1    MET n 
24 2    GLY n 
24 3    ILE n 
24 4    SER n 
24 5    TYR n 
24 6    SER n 
24 7    VAL n 
24 8    GLU n 
24 9    ALA n 
24 10   ASP n 
24 11   PRO n 
24 12   ASP n 
24 13   THR n 
24 14   THR n 
24 15   ALA n 
24 16   LYS n 
24 17   ALA n 
24 18   MET n 
24 19   LEU n 
24 20   ARG n 
24 21   GLU n 
24 22   ARG n 
24 23   GLN n 
24 24   MET n 
24 25   SER n 
24 26   PHE n 
24 27   LYS n 
24 28   HIS n 
24 29   SER n 
24 30   LYS n 
24 31   ALA n 
24 32   ILE n 
24 33   ALA n 
24 34   ARG n 
24 35   GLU n 
24 36   ILE n 
24 37   LYS n 
24 38   GLY n 
24 39   LYS n 
24 40   THR n 
24 41   ALA n 
24 42   GLY n 
24 43   GLU n 
24 44   ALA n 
24 45   VAL n 
24 46   ASP n 
24 47   TYR n 
24 48   LEU n 
24 49   GLU n 
24 50   ALA n 
24 51   VAL n 
24 52   ILE n 
24 53   GLU n 
24 54   GLY n 
24 55   ASP n 
24 56   GLN n 
24 57   PRO n 
24 58   VAL n 
24 59   PRO n 
24 60   PHE n 
24 61   LYS n 
24 62   GLN n 
24 63   HIS n 
24 64   ASN n 
24 65   SER n 
24 66   GLY n 
24 67   VAL n 
24 68   GLY n 
24 69   HIS n 
24 70   LYS n 
24 71   SER n 
24 72   LYS n 
24 73   VAL n 
24 74   ASP n 
24 75   GLY n 
24 76   TRP n 
24 77   ASP n 
24 78   ALA n 
24 79   GLY n 
24 80   ARG n 
24 81   TYR n 
24 82   PRO n 
24 83   GLU n 
24 84   LYS n 
24 85   ALA n 
24 86   SER n 
24 87   LYS n 
24 88   ALA n 
24 89   PHE n 
24 90   LEU n 
24 91   ASP n 
24 92   LEU n 
24 93   LEU n 
24 94   GLU n 
24 95   ASN n 
24 96   ALA n 
24 97   VAL n 
24 98   GLY n 
24 99   ASN n 
24 100  ALA n 
24 101  ASP n 
24 102  HIS n 
24 103  GLN n 
24 104  GLY n 
24 105  PHE n 
24 106  ASP n 
24 107  GLY n 
24 108  GLU n 
24 109  ALA n 
24 110  MET n 
24 111  THR n 
24 112  ILE n 
24 113  LYS n 
24 114  HIS n 
24 115  VAL n 
24 116  ALA n 
24 117  ALA n 
24 118  HIS n 
24 119  LYS n 
24 120  VAL n 
24 121  GLY n 
24 122  GLU n 
24 123  GLN n 
24 124  GLN n 
24 125  GLY n 
24 126  ARG n 
24 127  LYS n 
24 128  PRO n 
24 129  ARG n 
24 130  ALA n 
24 131  MET n 
24 132  GLY n 
24 133  ARG n 
24 134  ALA n 
24 135  SER n 
24 136  ALA n 
24 137  TRP n 
24 138  ASN n 
24 139  SER n 
24 140  PRO n 
24 141  GLN n 
24 142  VAL n 
24 143  ASP n 
24 144  VAL n 
24 145  GLU n 
24 146  LEU n 
24 147  ILE n 
24 148  LEU n 
24 149  GLU n 
24 150  GLU n 
24 151  PRO n 
24 152  GLU n 
24 153  VAL n 
24 154  GLU n 
24 155  ASP n 
25 1    MET n 
25 2    SER n 
25 3    TRP n 
25 4    ASP n 
25 5    VAL n 
25 6    ILE n 
25 7    LYS n 
25 8    HIS n 
25 9    PRO n 
25 10   HIS n 
25 11   VAL n 
25 12   THR n 
25 13   GLU n 
25 14   LYS n 
25 15   ALA n 
25 16   MET n 
25 17   ASN n 
25 18   ASP n 
25 19   MET n 
25 20   ASP n 
25 21   PHE n 
25 22   GLN n 
25 23   ASN n 
25 24   LYS n 
25 25   LEU n 
25 26   GLN n 
25 27   PHE n 
25 28   ALA n 
25 29   VAL n 
25 30   ASP n 
25 31   ASP n 
25 32   ARG n 
25 33   ALA n 
25 34   SER n 
25 35   LYS n 
25 36   GLY n 
25 37   GLU n 
25 38   VAL n 
25 39   ALA n 
25 40   ASP n 
25 41   ALA n 
25 42   VAL n 
25 43   GLU n 
25 44   GLU n 
25 45   GLN n 
25 46   TYR n 
25 47   ASP n 
25 48   VAL n 
25 49   THR n 
25 50   VAL n 
25 51   GLU n 
25 52   GLN n 
25 53   VAL n 
25 54   ASN n 
25 55   THR n 
25 56   GLN n 
25 57   ASN n 
25 58   THR n 
25 59   MET n 
25 60   ASP n 
25 61   GLY n 
25 62   GLU n 
25 63   LYS n 
25 64   LYS n 
25 65   ALA n 
25 66   VAL n 
25 67   VAL n 
25 68   ARG n 
25 69   LEU n 
25 70   SER n 
25 71   GLU n 
25 72   ASP n 
25 73   ASP n 
25 74   ASP n 
25 75   ALA n 
25 76   GLN n 
25 77   GLU n 
25 78   VAL n 
25 79   ALA n 
25 80   SER n 
25 81   ARG n 
25 82   ILE n 
25 83   GLY n 
25 84   VAL n 
25 85   PHE n 
26 1    MET n 
26 2    SER n 
26 3    LYS n 
26 4    GLN n 
26 5    PRO n 
26 6    ASP n 
26 7    LYS n 
26 8    GLN n 
26 9    ARG n 
26 10   LYS n 
26 11   SER n 
26 12   GLN n 
26 13   ARG n 
26 14   ARG n 
26 15   ALA n 
26 16   PRO n 
26 17   LEU n 
26 18   HIS n 
26 19   GLU n 
26 20   ARG n 
26 21   HIS n 
26 22   LYS n 
26 23   GLN n 
26 24   VAL n 
26 25   ARG n 
26 26   ALA n 
26 27   THR n 
26 28   LEU n 
26 29   SER n 
26 30   ALA n 
26 31   ASP n 
26 32   LEU n 
26 33   ARG n 
26 34   GLU n 
26 35   GLU n 
26 36   TYR n 
26 37   GLY n 
26 38   GLN n 
26 39   ARG n 
26 40   ASN n 
26 41   VAL n 
26 42   ARG n 
26 43   VAL n 
26 44   ASN n 
26 45   ALA n 
26 46   GLY n 
26 47   ASP n 
26 48   THR n 
26 49   VAL n 
26 50   GLU n 
26 51   VAL n 
26 52   LEU n 
26 53   ARG n 
26 54   GLY n 
26 55   ASP n 
26 56   PHE n 
26 57   ALA n 
26 58   GLY n 
26 59   GLU n 
26 60   GLU n 
26 61   GLY n 
26 62   GLU n 
26 63   VAL n 
26 64   ILE n 
26 65   ASN n 
26 66   VAL n 
26 67   ASP n 
26 68   LEU n 
26 69   ASP n 
26 70   LYS n 
26 71   ALA n 
26 72   VAL n 
26 73   ILE n 
26 74   HIS n 
26 75   VAL n 
26 76   GLU n 
26 77   ASP n 
26 78   VAL n 
26 79   THR n 
26 80   LEU n 
26 81   GLU n 
26 82   LYS n 
26 83   THR n 
26 84   ASP n 
26 85   GLY n 
26 86   GLU n 
26 87   GLU n 
26 88   VAL n 
26 89   PRO n 
26 90   ARG n 
26 91   PRO n 
26 92   LEU n 
26 93   ASP n 
26 94   THR n 
26 95   SER n 
26 96   ASN n 
26 97   VAL n 
26 98   ARG n 
26 99   VAL n 
26 100  THR n 
26 101  ASP n 
26 102  LEU n 
26 103  ASP n 
26 104  LEU n 
26 105  GLU n 
26 106  ASP n 
26 107  GLU n 
26 108  LYS n 
26 109  ARG n 
26 110  GLU n 
26 111  ALA n 
26 112  ARG n 
26 113  LEU n 
26 114  GLU n 
26 115  SER n 
26 116  GLU n 
26 117  ASP n 
26 118  ASP n 
26 119  SER n 
26 120  ALA n 
27 1    PRO n 
27 2    ARG n 
27 3    THR n 
27 4    ARG n 
27 5    GLU n 
27 6    CYS n 
27 7    ASP n 
27 8    TYR n 
27 9    CYS n 
27 10   GLY n 
27 11   THR n 
27 12   ASP n 
27 13   ILE n 
27 14   GLU n 
27 15   PRO n 
27 16   GLY n 
27 17   THR n 
27 18   GLY n 
27 19   THR n 
27 20   MET n 
27 21   PHE n 
27 22   VAL n 
27 23   HIS n 
27 24   LYS n 
27 25   ASP n 
27 26   GLY n 
27 27   ALA n 
27 28   THR n 
27 29   THR n 
27 30   HIS n 
27 31   PHE n 
27 32   CYS n 
27 33   SER n 
27 34   SER n 
27 35   LYS n 
27 36   CYS n 
27 37   GLU n 
27 38   ASN n 
27 39   ASN n 
27 40   ALA n 
27 41   ASP n 
27 42   LEU n 
27 43   GLY n 
27 44   ARG n 
27 45   GLU n 
27 46   ALA n 
27 47   ARG n 
27 48   ASN n 
27 49   LEU n 
27 50   GLU n 
27 51   TRP n 
27 52   THR n 
27 53   ASP n 
27 54   THR n 
27 55   ALA n 
27 56   ARG n 
27 57   GLY n 
27 58   GLU n 
27 59   ALA n 
27 60   GLY n 
27 61   GLU n 
27 62   ALA n 
27 63   GLU n 
27 64   ASP n 
27 65   GLU n 
27 66   ALA n 
28 1    MET n 
28 2    THR n 
28 3    VAL n 
28 4    LEU n 
28 5    HIS n 
28 6    VAL n 
28 7    GLN n 
28 8    GLU n 
28 9    ILE n 
28 10   ARG n 
28 11   ASP n 
28 12   MET n 
28 13   THR n 
28 14   PRO n 
28 15   ALA n 
28 16   GLU n 
28 17   ARG n 
28 18   GLU n 
28 19   ALA n 
28 20   GLU n 
28 21   LEU n 
28 22   ASP n 
28 23   ASP n 
28 24   LEU n 
28 25   LYS n 
28 26   THR n 
28 27   GLU n 
28 28   LEU n 
28 29   LEU n 
28 30   ASN n 
28 31   ALA n 
28 32   ARG n 
28 33   ALA n 
28 34   VAL n 
28 35   GLN n 
28 36   ALA n 
28 37   ALA n 
28 38   GLY n 
28 39   GLY n 
28 40   ALA n 
28 41   PRO n 
28 42   GLU n 
28 43   ASN n 
28 44   PRO n 
28 45   GLY n 
28 46   ARG n 
28 47   ILE n 
28 48   LYS n 
28 49   GLU n 
28 50   LEU n 
28 51   ARG n 
28 52   LYS n 
28 53   ALA n 
28 54   ILE n 
28 55   ALA n 
28 56   ARG n 
28 57   ILE n 
28 58   LYS n 
28 59   THR n 
28 60   ILE n 
28 61   GLN n 
28 62   GLY n 
28 63   GLU n 
28 64   GLU n 
28 65   GLY n 
28 66   ASP n 
28 67   LEU n 
28 68   GLN n 
28 69   GLU n 
28 70   ASN n 
28 71   GLU n 
29 1    MET n 
29 2    HIS n 
29 3    ALA n 
29 4    LEU n 
29 5    VAL n 
29 6    GLN n 
29 7    LEU n 
29 8    ARG n 
29 9    GLY n 
29 10   GLU n 
29 11   VAL n 
29 12   ASN n 
29 13   MET n 
29 14   HIS n 
29 15   THR n 
29 16   ASP n 
29 17   ILE n 
29 18   GLN n 
29 19   ASP n 
29 20   THR n 
29 21   LEU n 
29 22   GLU n 
29 23   MET n 
29 24   LEU n 
29 25   ASN n 
29 26   ILE n 
29 27   HIS n 
29 28   HIS n 
29 29   VAL n 
29 30   ASN n 
29 31   HIS n 
29 32   CYS n 
29 33   THR n 
29 34   LEU n 
29 35   VAL n 
29 36   PRO n 
29 37   GLU n 
29 38   THR n 
29 39   ASP n 
29 40   ALA n 
29 41   TYR n 
29 42   ARG n 
29 43   GLY n 
29 44   MET n 
29 45   VAL n 
29 46   ALA n 
29 47   LYS n 
29 48   VAL n 
29 49   ASN n 
29 50   ASP n 
29 51   PHE n 
29 52   VAL n 
29 53   ALA n 
29 54   PHE n 
29 55   GLY n 
29 56   GLU n 
29 57   PRO n 
29 58   SER n 
29 59   GLN n 
29 60   GLU n 
29 61   THR n 
29 62   LEU n 
29 63   GLU n 
29 64   THR n 
29 65   VAL n 
29 66   LEU n 
29 67   ALA n 
29 68   THR n 
29 69   ARG n 
29 70   ALA n 
29 71   GLU n 
29 72   PRO n 
29 73   LEU n 
29 74   GLU n 
29 75   GLY n 
29 76   ASP n 
29 77   ALA n 
29 78   ASP n 
29 79   VAL n 
29 80   ASP n 
29 81   ASP n 
29 82   GLU n 
29 83   TRP n 
29 84   VAL n 
29 85   ALA n 
29 86   GLU n 
29 87   HIS n 
29 88   THR n 
29 89   ASP n 
29 90   TYR n 
29 91   ASP n 
29 92   ASP n 
29 93   ILE n 
29 94   SER n 
29 95   GLY n 
29 96   LEU n 
29 97   ALA n 
29 98   PHE n 
29 99   ALA n 
29 100  LEU n 
29 101  LEU n 
29 102  SER n 
29 103  GLU n 
29 104  GLU n 
29 105  THR n 
29 106  THR n 
29 107  LEU n 
29 108  ARG n 
29 109  GLU n 
29 110  GLN n 
29 111  GLY n 
29 112  LEU n 
29 113  SER n 
29 114  PRO n 
29 115  THR n 
29 116  LEU n 
29 117  ARG n 
29 118  LEU n 
29 119  HIS n 
29 120  PRO n 
29 121  PRO n 
29 122  ARG n 
29 123  GLY n 
29 124  GLY n 
29 125  HIS n 
29 126  ASP n 
29 127  GLY n 
29 128  VAL n 
29 129  LYS n 
29 130  HIS n 
29 131  PRO n 
29 132  VAL n 
29 133  LYS n 
29 134  GLU n 
29 135  GLY n 
29 136  GLY n 
29 137  GLN n 
29 138  LEU n 
29 139  GLY n 
29 140  LYS n 
29 141  HIS n 
29 142  ASP n 
29 143  THR n 
29 144  GLU n 
29 145  GLY n 
29 146  ILE n 
29 147  ASP n 
29 148  ASP n 
29 149  LEU n 
29 150  LEU n 
29 151  GLU n 
29 152  ALA n 
29 153  MET n 
29 154  ARG n 
30 1    MET n 
30 2    SER n 
30 3    ALA n 
30 4    SER n 
30 5    ASP n 
30 6    PHE n 
30 7    GLU n 
30 8    GLU n 
30 9    ARG n 
30 10   VAL n 
30 11   VAL n 
30 12   THR n 
30 13   ILE n 
30 14   PRO n 
30 15   LEU n 
30 16   ARG n 
30 17   ASP n 
30 18   ALA n 
30 19   ARG n 
30 20   ALA n 
30 21   GLU n 
30 22   PRO n 
30 23   ASN n 
30 24   HIS n 
30 25   LYS n 
30 26   ARG n 
30 27   ALA n 
30 28   ASP n 
30 29   LYS n 
30 30   ALA n 
30 31   MET n 
30 32   ILE n 
30 33   LEU n 
30 34   ILE n 
30 35   ARG n 
30 36   GLU n 
30 37   HIS n 
30 38   LEU n 
30 39   ALA n 
30 40   LYS n 
30 41   HIS n 
30 42   PHE n 
30 43   SER n 
30 44   VAL n 
30 45   ASP n 
30 46   GLU n 
30 47   ASP n 
30 48   ALA n 
30 49   VAL n 
30 50   ARG n 
30 51   LEU n 
30 52   ASP n 
30 53   PRO n 
30 54   SER n 
30 55   ILE n 
30 56   ASN n 
30 57   GLU n 
30 58   ALA n 
30 59   ALA n 
30 60   TRP n 
30 61   ALA n 
30 62   ARG n 
30 63   GLY n 
30 64   ARG n 
30 65   ALA n 
30 66   ASN n 
30 67   THR n 
30 68   PRO n 
30 69   SER n 
30 70   LYS n 
30 71   ILE n 
30 72   ARG n 
30 73   VAL n 
30 74   ARG n 
30 75   ALA n 
30 76   ALA n 
30 77   ARG n 
30 78   PHE n 
30 79   GLU n 
30 80   GLU n 
30 81   GLU n 
30 82   GLY n 
30 83   GLU n 
30 84   ALA n 
30 85   ILE n 
30 86   VAL n 
30 87   GLU n 
30 88   ALA n 
30 89   GLU n 
30 90   THR n 
30 91   ALA n 
30 92   GLU n 
31 1    MET n 
31 2    ALA n 
31 3    ASP n 
31 4    ASN n 
31 5    GLU n 
31 6    GLU n 
31 7    ASP n 
31 8    VAL n 
31 9    GLU n 
31 10   ALA n 
31 11   GLU n 
31 12   GLU n 
31 13   GLU n 
31 14   TYR n 
31 15   THR n 
31 16   GLU n 
31 17   LEU n 
31 18   THR n 
31 19   ASP n 
31 20   ILE n 
31 21   SER n 
31 22   GLY n 
31 23   VAL n 
31 24   GLY n 
31 25   PRO n 
31 26   SER n 
31 27   LYS n 
31 28   ALA n 
31 29   GLU n 
31 30   SER n 
31 31   LEU n 
31 32   ARG n 
31 33   GLU n 
31 34   ALA n 
31 35   GLY n 
31 36   PHE n 
31 37   GLU n 
31 38   SER n 
31 39   VAL n 
31 40   GLU n 
31 41   ASP n 
31 42   VAL n 
31 43   ARG n 
31 44   GLY n 
31 45   ALA n 
31 46   ASP n 
31 47   GLN n 
31 48   SER n 
31 49   ALA n 
31 50   LEU n 
31 51   ALA n 
31 52   ASP n 
31 53   VAL n 
31 54   SER n 
31 55   GLY n 
31 56   ILE n 
31 57   GLY n 
31 58   ASN n 
31 59   ALA n 
31 60   LEU n 
31 61   ALA n 
31 62   ALA n 
31 63   ARG n 
31 64   ILE n 
31 65   LYS n 
31 66   ALA n 
31 67   ASP n 
31 68   VAL n 
31 69   GLY n 
31 70   GLY n 
31 71   LEU n 
31 72   GLU n 
31 73   VAL n 
31 74   GLU n 
31 75   SER n 
31 76   GLU n 
31 77   THR n 
31 78   GLU n 
31 79   ALA n 
31 80   GLU n 
31 81   VAL n 
31 82   GLU n 
31 83   GLU n 
31 84   GLU n 
31 85   GLY n 
31 86   GLY n 
31 87   GLU n 
31 88   GLU n 
31 89   ALA n 
31 90   PRO n 
31 91   ASP n 
31 92   GLU n 
31 93   ASP n 
31 94   VAL n 
31 95   GLU n 
31 96   THR n 
31 97   GLU n 
31 98   LEU n 
31 99   GLN n 
31 100  ALA n 
31 101  ARG n 
31 102  GLY n 
31 103  LEU n 
31 104  THR n 
31 105  GLU n 
31 106  LYS n 
31 107  THR n 
31 108  PRO n 
31 109  ASP n 
31 110  LEU n 
31 111  SER n 
31 112  ASP n 
31 113  GLU n 
31 114  ASP n 
31 115  ALA n 
31 116  ARG n 
31 117  LEU n 
31 118  LEU n 
31 119  THR n 
31 120  GLN n 
31 121  ARG n 
31 122  HIS n 
31 123  ARG n 
31 124  VAL n 
31 125  GLY n 
31 126  LYS n 
31 127  PRO n 
31 128  GLN n 
31 129  PHE n 
31 130  ASN n 
31 131  ARG n 
31 132  GLN n 
31 133  ASP n 
31 134  HIS n 
31 135  HIS n 
31 136  LYS n 
31 137  LYS n 
31 138  LYS n 
31 139  ARG n 
31 140  VAL n 
31 141  SER n 
31 142  THR n 
31 143  SER n 
31 144  TRP n 
31 145  ARG n 
31 146  LYS n 
31 147  PRO n 
31 148  ARG n 
31 149  GLY n 
31 150  GLN n 
31 151  LEU n 
31 152  SER n 
31 153  LYS n 
31 154  GLN n 
31 155  ARG n 
31 156  ARG n 
31 157  GLY n 
31 158  ILE n 
31 159  LYS n 
31 160  GLY n 
31 161  LYS n 
31 162  GLY n 
31 163  ASP n 
31 164  THR n 
31 165  VAL n 
31 166  GLU n 
31 167  ALA n 
31 168  GLY n 
31 169  PHE n 
31 170  ARG n 
31 171  SER n 
31 172  PRO n 
31 173  THR n 
31 174  ALA n 
31 175  VAL n 
31 176  ARG n 
31 177  GLY n 
31 178  LYS n 
31 179  HIS n 
31 180  PRO n 
31 181  SER n 
31 182  GLY n 
31 183  PHE n 
31 184  GLU n 
31 185  GLU n 
31 186  VAL n 
31 187  ARG n 
31 188  VAL n 
31 189  HIS n 
31 190  ASN n 
31 191  VAL n 
31 192  ASP n 
31 193  ASP n 
31 194  LEU n 
31 195  GLU n 
31 196  GLY n 
31 197  VAL n 
31 198  ASP n 
31 199  GLY n 
31 200  ASP n 
31 201  THR n 
31 202  GLU n 
31 203  ALA n 
31 204  VAL n 
31 205  ARG n 
31 206  ILE n 
31 207  ALA n 
31 208  SER n 
31 209  LYS n 
31 210  VAL n 
31 211  GLY n 
31 212  ALA n 
31 213  ARG n 
31 214  LYS n 
31 215  ARG n 
31 216  GLU n 
31 217  ARG n 
31 218  ILE n 
31 219  GLU n 
31 220  GLU n 
31 221  GLU n 
31 222  ALA n 
31 223  GLU n 
31 224  ASP n 
31 225  ALA n 
31 226  GLY n 
31 227  ILE n 
31 228  ARG n 
31 229  VAL n 
31 230  LEU n 
31 231  ASN n 
31 232  PRO n 
31 233  THR n 
31 234  TYR n 
31 235  VAL n 
31 236  GLU n 
31 237  VAL n 
31 238  GLU n 
31 239  VAL n 
31 240  SER n 
31 241  GLU n 
32 1    ARG n 
32 2    SER n 
32 3    GLY n 
32 4    ARG n 
32 5    PHE n 
32 6    GLY n 
32 7    ALA n 
32 8    ARG n 
32 9    TYR n 
32 10   GLY n 
32 11   ARG n 
32 12   VAL n 
32 13   SER n 
32 14   ARG n 
32 15   ARG n 
32 16   ARG n 
32 17   VAL n 
32 18   ALA n 
32 19   GLU n 
32 20   ILE n 
32 21   GLU n 
32 22   SER n 
32 23   GLU n 
32 24   MET n 
32 25   ASN n 
32 26   GLU n 
32 27   ASP n 
32 28   HIS n 
32 29   ALA n 
32 30   CYS n 
32 31   PRO n 
32 32   ASN n 
32 33   CYS n 
32 34   GLY n 
32 35   GLU n 
32 36   ASP n 
32 37   ARG n 
32 38   VAL n 
32 39   ASP n 
32 40   ARG n 
32 41   GLN n 
32 42   GLY n 
32 43   THR n 
32 44   GLY n 
32 45   ILE n 
32 46   TRP n 
32 47   GLN n 
32 48   CYS n 
32 49   SER n 
32 50   TYR n 
32 51   CYS n 
32 52   ASP n 
32 53   TYR n 
32 54   LYS n 
32 55   PHE n 
32 56   THR n 
32 57   GLY n 
32 58   GLY n 
32 59   SER n 
32 60   TYR n 
32 61   LYS n 
32 62   PRO n 
32 63   GLU n 
32 64   THR n 
32 65   PRO n 
32 66   GLY n 
32 67   GLY n 
32 68   LYS n 
32 69   THR n 
32 70   VAL n 
32 71   ARG n 
32 72   ARG n 
32 73   SER n 
32 74   ILE n 
32 75   ARG n 
32 76   ALA n 
32 77   ALA n 
32 78   LEU n 
32 79   SER n 
32 80   GLU n 
32 81   ASP n 
32 82   GLU n 
32 83   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'STREPTOMYCES VIRGINIAE' 1961 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
31 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
32 1 sample ? ? ? 'HALOARCULA MARISMORTUI' 2238 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  GB  AY596297   1  ? ? 55229667 ? 
2  GB  AF034619   6  ? ? 3377778  ? 
3  UNP RL2_HALMA  7  ? ? P20276   ? 
4  GB  YP_136234  8  ? ? 55378384 ? 
5  UNP RL4_HALMA  9  ? ? P12735   ? 
6  UNP RL5_HALMA  10 ? ? P14124   ? 
7  UNP RL6_HALMA  11 ? ? P14135   ? 
8  UNP RL7A_HALMA 12 ? ? P12743   ? 
9  UNP RLA0_HALMA 13 ? ? P15825   ? 
10 GB  AAV47175   14 ? ? 55231756 ? 
11 GB  P14122     15 ? ? 132647   ? 
12 UNP RL13_HALMA 16 ? ? P29198   ? 
13 UNP RL14_HALMA 17 ? ? P22450   ? 
14 UNP RL15_HALMA 18 ? ? P12737   ? 
15 GB  AAV46920   19 ? ? 55231501 ? 
16 UNP RL18_HALMA 20 ? ? P14123   ? 
17 UNP R18E_HALMA 21 ? ? P12733   ? 
18 UNP RL19_HALMA 22 ? ? P14119   ? 
19 UNP RL21_HALMA 23 ? ? P12734   ? 
20 UNP RL22_HALMA 24 ? ? P10970   ? 
21 UNP RL23_HALMA 25 ? ? P12732   ? 
22 UNP RL24_HALMA 26 ? ? P10972   ? 
23 UNP R24E_HALMA 27 ? ? P14116   ? 
24 UNP RL29_HALMA 28 ? ? P10971   ? 
25 UNP RL30_HALMA 29 ? ? P14121   ? 
26 UNP RL31_HALMA 30 ? ? P18138   ? 
27 UNP RL32_HALMA 31 ? ? P12736   ? 
28 GB  AAV46581   32 ? ? 55231162 ? 
29 UNP RL37_HALMA 2  ? ? P32410   ? 
30 UNP RL39_HALMA 3  ? ? P22452   ? 
31 UNP RL44_HALMA 4  ? ? P32411   ? 
32 NOR NOR00679   5  ? ? NOR00679 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1YIT 0 1 ? 2922 ? 55229667 0    ? 2921 ? 1  2922 
2  2  1YIT 9 1 ? 122  ? 3377778  5581 ? 5702 ? 1  122  
3  3  1YIT A 1 ? 240  ? P20276   0    ? 239  ? 0  239  
4  4  1YIT B 1 ? 338  ? 55378384 1    ? 338  ? 0  337  
5  5  1YIT C 1 ? 246  ? P12735   1    ? 246  ? 1  246  
6  6  1YIT D 1 ? 177  ? P14124   0    ? 176  ? 0  176  
7  7  1YIT E 1 ? 178  ? P14135   0    ? 177  ? 0  177  
8  8  1YIT F 1 ? 120  ? P12743   0    ? 119  ? 0  119  
9  9  1YIT G 1 ? 348  ? P15825   1    ? 348  ? 1  348  
10 10 1YIT H 1 ? 177  ? 55231756 1    ? 177  ? 1  177  
11 11 1YIT I 1 ? 162  ? 132647   1    ? 162  ? 0  161  
12 12 1YIT J 1 ? 145  ? P29198   1    ? 145  ? 1  145  
13 13 1YIT K 1 ? 132  ? P22450   1    ? 132  ? 1  132  
14 14 1YIT L 1 ? 165  ? P12737   0    ? 164  ? 0  164  
15 15 1YIT M 1 ? 195  ? 55231501 1    ? 195  ? 0  194  
16 16 1YIT N 1 ? 187  ? P14123   0    ? 186  ? 0  186  
17 17 1YIT O 1 ? 116  ? P12733   0    ? 115  ? 0  115  
18 18 1YIT P 1 ? 149  ? P14119   0    ? 148  ? 0  148  
19 19 1YIT Q 1 ? 96   ? P12734   0    ? 95   ? 0  95   
20 20 1YIT R 1 ? 155  ? P10970   0    ? 154  ? 0  154  
21 21 1YIT S 1 ? 85   ? P12732   0    ? 84   ? 0  84   
22 22 1YIT T 1 ? 120  ? P10972   0    ? 119  ? 0  119  
23 23 1YIT U 1 ? 66   ? P14116   1    ? 66   ? 1  66   
24 24 1YIT V 1 ? 71   ? P10971   1    ? 71   ? 0  70   
25 25 1YIT W 1 ? 154  ? P14121   1    ? 154  ? 1  154  
26 26 1YIT X 1 ? 92   ? P18138   0    ? 91   ? 0  91   
27 27 1YIT Y 1 ? 241  ? P12736   0    ? 240  ? 0  240  
28 28 1YIT Z 1 ? 83   ? 55231162 34   ? 116  ? 10 92   
29 29 1YIT 1 1 ? 57   ? P32410   0    ? 56   ? 0  56   
30 30 1YIT 2 1 ? 50   ? P22452   0    ? 49   ? 0  49   
31 31 1YIT 3 1 ? 92   ? P32411   1    ? 92   ? 1  92   
32 32 1YIT 8 1 ? 7    ? NOR00679 1    ? 7    ? 1  7    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1YIT 1MA 0 628  ? GB  55229667 A   627  'MODIFIED RESIDUE' 628  1 
1  1YIT OMU 0 2587 ? GB  55229667 U   2586 'MODIFIED RESIDUE' 2587 2 
1  1YIT OMG 0 2588 ? GB  55229667 G   2587 'MODIFIED RESIDUE' 2588 3 
1  1YIT UR3 0 2619 ? GB  55229667 U   2618 'MODIFIED RESIDUE' 2619 4 
1  1YIT PSU 0 2621 ? GB  55229667 U   2620 'MODIFIED RESIDUE' 2621 5 
13 1YIT LEU K 44   ? UNP P22450   HIS 44   CONFLICT           44   6 
15 1YIT GLU M 14   ? GB  55231501 LYS 14   CONFLICT           13   7 
28 1YIT ARG Z 1    ? GB  55231162 SER 34   CONFLICT           10   8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
004 'L-peptide linking' . '(2S)-amino(phenyl)ethanoic acid'            L-Phenylglycine 'C8 H9 N O2'      151.163 
1MA 'RNA linking'       n "6-HYDRO-1-METHYLADENOSINE-5'-MONOPHOSPHATE" ?               'C11 H16 N5 O7 P' 361.248 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                 ?               'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                      ?               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                     ?               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ?               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ?               'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                  ?               'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                                ?               'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'                               ?               'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                     ?               'C3 H7 N O2 S'    121.158 
DBB 'D-peptide linking' . 'D-ALPHA-AMINOBUTYRIC ACID'                  ?               'C4 H9 N O2'      103.120 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                 ?               'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                    ?               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ?               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                      ?               'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ?               'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                   ?               'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                              ?               'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                      ?               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                       ?               'C6 H15 N2 O2 1'  147.195 
MEA 'L-peptide linking' n N-METHYLPHENYLALANINE                        ?               'C10 H13 N O2'    179.216 
MET 'L-peptide linking' y METHIONINE                                   ?               'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ?               'Mg 2'            24.305  
MHV 'L-peptide linking' . '4-OXO-L-PIPECOLIC ACID'                     ?               'C6 H9 N O3'      143.141 
MHW 'peptide linking'   . '3-HYDROXYPICOLINIC ACID'                    ?               'C6 H5 N O3'      139.109 
NA  non-polymer         . 'SODIUM ION'                                 ?               'Na 1'            22.990  
OMG 'RNA linking'       n "O2'-METHYLGUANOSINE-5'-MONOPHOSPHATE"       ?               'C11 H16 N5 O8 P' 377.247 
OMU 'RNA linking'       n 
;O2'-METHYLURIDINE 5'-MONOPHOSPHATE
;
?               'C10 H15 N2 O9 P' 338.208 
PHE 'L-peptide linking' y PHENYLALANINE                                ?               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                      ?               'C5 H9 N O2'      115.130 
PSU 'RNA linking'       n "PSEUDOURIDINE-5'-MONOPHOSPHATE"             ?               'C9 H13 N2 O9 P'  324.181 
SER 'L-peptide linking' y SERINE                                       ?               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                    ?               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ?               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                     ?               'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                   ?               'C9 H13 N2 O9 P'  324.181 
UR3 'RNA linking'       n "3-METHYLURIDINE-5'-MONOPHOSHATE"            ?               'C10 H15 N2 O9 P' 338.208 
VAL 'L-peptide linking' y VALINE                                       ?               'C5 H11 N O2'     117.146 
VIR non-polymer         . 'VIRGINIAMYCIN M1'                           ?               'C28 H35 N3 O7'   525.593 
# 
_exptl.entry_id          1YIT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.10 
_exptl_crystal.density_percent_sol   60.00 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'PEG 6000, KCL, NH4CL, MGCL2, KACETATE, PH 5.8, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 292K' 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 'PEG 6000' ? ? ? 
1 2  1 KCl        ? ? ? 
1 3  1 NH4Cl      ? ? ? 
1 4  1 MgCl2      ? ? ? 
1 5  1 Kacetate   ? ? ? 
1 6  1 H2O        ? ? ? 
1 7  2 'PEG 6000' ? ? ? 
1 8  2 KCl        ? ? ? 
1 9  2 NH4Cl      ? ? ? 
1 10 2 MgCl2      ? ? ? 
1 11 2 Kacetate   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-03-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.10 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.10 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1YIT 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.850 
_reflns.number_obs                   420273 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.08200 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.5000 
_reflns.B_iso_Wilson_estimate        72.00 
_reflns.pdbx_redundancy              3.500 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.85 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.59000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.200 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1YIT 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     417595 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               252771.940 
_refine.pdbx_data_cutoff_low_absF                0.0000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.99 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    93.9 
_refine.ls_R_factor_obs                          0.175 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.175 
_refine.ls_R_factor_R_free                       0.221 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.000 
_refine.ls_number_reflns_R_free                  4113 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               53.60 
_refine.aniso_B[1][1]                            11.58000 
_refine.aniso_B[2][2]                            -5.35000 
_refine.aniso_B[3][3]                            -6.23000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.32 
_refine.solvent_model_param_bsol                 36.08 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1YIT 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.48 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.53 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29437 
_refine_hist.pdbx_number_atoms_nucleic_acid   61620 
_refine_hist.pdbx_number_atoms_ligand         269 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               91326 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        29.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.00  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      15.40 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.32  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.120 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.950 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.470 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.250 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             60070 
_refine_ls_shell.R_factor_R_work                  0.3190 
_refine_ls_shell.percent_reflns_obs               82.50 
_refine_ls_shell.R_factor_R_free                  0.3470 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            1.00 
_refine_ls_shell.number_reflns_R_free             609 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM     PROTEIN.TOP             
'X-RAY DIFFRACTION' 2 RNA_RIBO_MODNTS.PARAM RNA_RIBO_MODNTS_DRUGS.T 
'X-RAY DIFFRACTION' 3 ION.PARAM             ION.TOP                 
'X-RAY DIFFRACTION' 4 WATER_REP.PARAM       WATER.TOP               
'X-RAY DIFFRACTION' 5 VIR.PAR               VIR.TOP                 
'X-RAY DIFFRACTION' 6 VRS.PAR               VRS.TOP                 
# 
_struct.entry_id                  1YIT 
_struct.title                     
'Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui' 
_struct.pdbx_descriptor           
;50S RIBOSOMAL PROTEIN L37E, 50S RIBOSOMAL PROTEIN L39E, 50S RIBOSOMAL PROTEIN L44E, VIRGINIAMYCIN S1, 50S RIBOSOMAL PROTEIN L2P, 50S RIBOSOMAL PROTEIN L3P, 50S RIBOSOMAL PROTEIN L4E, 50S RIBOSOMAL PROTEIN L5P, 50S RIBOSOMAL PROTEIN L6P, 50S RIBOSOMAL PROTEIN L7AE, ACIDIC RIBOSOMAL PROTEIN P0 HOMOLOG, 50S RIBOSOMAL PROTEIN L10E, 50S RIBOSOMAL PROTEIN L11P, 50S RIBOSOMAL PROTEIN L13P, 50S RIBOSOMAL PROTEIN L14P, 50S RIBOSOMAL PROTEIN L15P, 50S RIBOSOMAL PROTEIN L15E, 50S RIBOSOMAL PROTEIN L18P, 50S RIBOSOMAL PROTEIN L18E, 50S RIBOSOMAL PROTEIN L19E, 50S RIBOSOMAL PROTEIN L21E, 50S RIBOSOMAL PROTEIN L22P, 50S RIBOSOMAL PROTEIN L23P, 50S RIBOSOMAL PROTEIN L24P, 50S RIBOSOMAL PROTEIN L24E, 50S RIBOSOMAL PROTEIN L29P, 50S RIBOSOMAL PROTEIN L30P, 50S RIBOSOMAL PROTEIN L31E, 50S RIBOSOMAL PROTEIN L32E, 50S RIBOSOMAL PROTEIN L37AE/RNA Complex, VIRGINIAMYCIN M1
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YIT 
_struct_keywords.pdbx_keywords   RIBOSOME/ANTIBIOTIC 
_struct_keywords.text            
;VIRGINIAMYCIN M, VIRGINIAMYCIN S, PEPTIDYL TRANSFERASE, RIBOSOME, STREPTOGRAMIN, RIBOSOME-ANTIBIOTIC COMPLEX, ANTIBIOTIC, CYCLOHEXADEPSIPEPTIDE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 33 ? 
HA N N 33 ? 
IA N N 33 ? 
JA N N 33 ? 
KA N N 33 ? 
LA N N 33 ? 
MA N N 33 ? 
NA N N 33 ? 
OA N N 33 ? 
PA N N 33 ? 
QA N N 33 ? 
RA N N 33 ? 
SA N N 33 ? 
TA N N 33 ? 
UA N N 33 ? 
VA N N 33 ? 
WA N N 33 ? 
XA N N 33 ? 
YA N N 33 ? 
ZA N N 33 ? 
AB N N 33 ? 
BB N N 33 ? 
CB N N 33 ? 
DB N N 33 ? 
EB N N 33 ? 
FB N N 33 ? 
GB N N 33 ? 
HB N N 33 ? 
IB N N 33 ? 
JB N N 33 ? 
KB N N 33 ? 
LB N N 33 ? 
MB N N 33 ? 
NB N N 33 ? 
OB N N 33 ? 
PB N N 33 ? 
QB N N 33 ? 
RB N N 33 ? 
SB N N 33 ? 
TB N N 33 ? 
UB N N 33 ? 
VB N N 33 ? 
WB N N 33 ? 
XB N N 33 ? 
YB N N 33 ? 
ZB N N 33 ? 
AC N N 33 ? 
BC N N 33 ? 
CC N N 33 ? 
DC N N 33 ? 
EC N N 33 ? 
FC N N 33 ? 
GC N N 33 ? 
HC N N 33 ? 
IC N N 33 ? 
JC N N 33 ? 
KC N N 33 ? 
LC N N 33 ? 
MC N N 33 ? 
NC N N 33 ? 
OC N N 33 ? 
PC N N 33 ? 
QC N N 33 ? 
RC N N 33 ? 
SC N N 33 ? 
TC N N 33 ? 
UC N N 33 ? 
VC N N 33 ? 
WC N N 33 ? 
XC N N 33 ? 
YC N N 33 ? 
ZC N N 33 ? 
AD N N 33 ? 
BD N N 33 ? 
CD N N 33 ? 
DD N N 33 ? 
ED N N 33 ? 
FD N N 33 ? 
GD N N 33 ? 
HD N N 33 ? 
ID N N 33 ? 
JD N N 33 ? 
KD N N 33 ? 
LD N N 33 ? 
MD N N 33 ? 
ND N N 33 ? 
OD N N 33 ? 
PD N N 33 ? 
QD N N 33 ? 
RD N N 33 ? 
SD N N 33 ? 
TD N N 33 ? 
UD N N 33 ? 
VD N N 33 ? 
WD N N 33 ? 
XD N N 33 ? 
YD N N 33 ? 
ZD N N 33 ? 
AE N N 33 ? 
BE N N 33 ? 
CE N N 33 ? 
DE N N 33 ? 
EE N N 33 ? 
FE N N 33 ? 
GE N N 33 ? 
HE N N 33 ? 
IE N N 33 ? 
JE N N 33 ? 
KE N N 33 ? 
LE N N 34 ? 
ME N N 35 ? 
NE N N 35 ? 
OE N N 35 ? 
PE N N 35 ? 
QE N N 35 ? 
RE N N 35 ? 
SE N N 35 ? 
TE N N 35 ? 
UE N N 35 ? 
VE N N 35 ? 
WE N N 35 ? 
XE N N 35 ? 
YE N N 35 ? 
ZE N N 35 ? 
AF N N 35 ? 
BF N N 35 ? 
CF N N 35 ? 
DF N N 35 ? 
EF N N 35 ? 
FF N N 35 ? 
GF N N 35 ? 
HF N N 35 ? 
IF N N 35 ? 
JF N N 35 ? 
KF N N 35 ? 
LF N N 35 ? 
MF N N 35 ? 
NF N N 35 ? 
OF N N 35 ? 
PF N N 35 ? 
QF N N 35 ? 
RF N N 35 ? 
SF N N 35 ? 
TF N N 35 ? 
UF N N 35 ? 
VF N N 35 ? 
WF N N 35 ? 
XF N N 35 ? 
YF N N 35 ? 
ZF N N 35 ? 
AG N N 35 ? 
BG N N 35 ? 
CG N N 35 ? 
DG N N 35 ? 
EG N N 35 ? 
FG N N 35 ? 
GG N N 35 ? 
HG N N 35 ? 
IG N N 35 ? 
JG N N 35 ? 
KG N N 35 ? 
LG N N 35 ? 
MG N N 35 ? 
NG N N 35 ? 
OG N N 35 ? 
PG N N 35 ? 
QG N N 35 ? 
RG N N 35 ? 
SG N N 35 ? 
TG N N 35 ? 
UG N N 35 ? 
VG N N 35 ? 
WG N N 35 ? 
XG N N 35 ? 
YG N N 35 ? 
ZG N N 35 ? 
AH N N 35 ? 
BH N N 35 ? 
CH N N 35 ? 
DH N N 35 ? 
EH N N 35 ? 
FH N N 35 ? 
GH N N 35 ? 
HH N N 36 ? 
IH N N 36 ? 
JH N N 36 ? 
KH N N 36 ? 
LH N N 36 ? 
MH N N 36 ? 
NH N N 36 ? 
OH N N 36 ? 
PH N N 36 ? 
QH N N 36 ? 
RH N N 37 ? 
SH N N 38 ? 
TH N N 33 ? 
UH N N 33 ? 
VH N N 38 ? 
WH N N 36 ? 
XH N N 33 ? 
YH N N 35 ? 
ZH N N 35 ? 
AI N N 33 ? 
BI N N 35 ? 
CI N N 36 ? 
DI N N 33 ? 
EI N N 33 ? 
FI N N 36 ? 
GI N N 35 ? 
HI N N 35 ? 
II N N 35 ? 
JI N N 36 ? 
KI N N 36 ? 
LI N N 36 ? 
MI N N 33 ? 
NI N N 35 ? 
OI N N 36 ? 
PI N N 35 ? 
QI N N 36 ? 
RI N N 36 ? 
SI N N 38 ? 
TI N N 36 ? 
UI N N 35 ? 
VI N N 35 ? 
WI N N 35 ? 
XI N N 36 ? 
YI N N 35 ? 
ZI N N 33 ? 
AJ N N 38 ? 
BJ N N 33 ? 
CJ N N 36 ? 
DJ N N 38 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY B  5   ? GLY B  10  ? GLY 1 4   GLY 1 9   1 ? 6  
HELX_P HELX_P2   2   TYR B  49  ? SER B  53  ? TYR 1 48  SER 1 52  5 ? 5  
HELX_P HELX_P3   3   SER C  5   ? ASN C  19  ? SER 2 4   ASN 2 18  1 ? 15 
HELX_P HELX_P4   4   PRO C  23  ? THR C  30  ? PRO 2 22  THR 2 29  1 ? 8  
HELX_P HELX_P5   5   LYS D  34  ? SER D  44  ? LYS 3 34  SER 3 44  1 ? 11 
HELX_P HELX_P6   6   ASP D  49  ? LYS D  54  ? ASP 3 49  LYS 3 54  5 ? 6  
HELX_P HELX_P7   7   ILE G  5   ? ARG G  12  ? ILE A 4   ARG A 11  1 ? 8  
HELX_P HELX_P8   8   THR G  14  ? ARG G  18  ? THR A 13  ARG A 17  5 ? 5  
HELX_P HELX_P9   9   PRO G  20  ? TYR G  24  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P10  10  ALA G  98  ? ILE G  100 ? ALA A 97  ILE A 99  5 ? 3  
HELX_P HELX_P11  11  GLY G  164 ? LYS G  168 ? GLY A 163 LYS A 167 5 ? 5  
HELX_P HELX_P12  12  LYS G  172 ? LYS G  181 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P13  13  ARG G  191 ? MET G  195 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P14  14  ASN G  196 ? HIS G  200 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P15  15  GLU H  109 ? THR H  113 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P16  16  ASP H  121 ? ALA H  135 ? ASP B 120 ALA B 134 1 ? 15 
HELX_P HELX_P17  17  VAL H  148 ? VAL H  152 ? VAL B 147 VAL B 151 5 ? 5  
HELX_P HELX_P18  18  SER H  171 ? GLY H  186 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P19  19  ALA H  190 ? PHE H  195 ? ALA B 189 PHE B 194 1 ? 6  
HELX_P HELX_P20  20  GLY H  214 ? GLY H  220 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P21  21  LYS H  225 ? GLN H  231 ? LYS B 224 GLN B 230 5 ? 7  
HELX_P HELX_P22  22  PRO I  19  ? THR I  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P23  23  ARG I  27  ? ARG I  42  ? ARG C 27  ARG C 42  1 ? 16 
HELX_P HELX_P24  24  ASN I  103 ? ALA I  119 ? ASN C 103 ALA C 119 1 ? 17 
HELX_P HELX_P25  25  ASP I  120 ? GLY I  128 ? ASP C 120 GLY C 128 1 ? 9  
HELX_P HELX_P26  26  SER I  141 ? LEU I  147 ? SER C 141 LEU C 147 5 ? 7  
HELX_P HELX_P27  27  LYS I  149 ? ALA I  159 ? LYS C 149 ALA C 159 1 ? 11 
HELX_P HELX_P28  28  HIS I  163 ? ALA I  169 ? HIS C 163 ALA C 169 1 ? 7  
HELX_P HELX_P29  29  GLY I  177 ? GLY I  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P30  30  SER I  201 ? ASN I  206 ? SER C 201 ASN C 206 1 ? 6  
HELX_P HELX_P31  31  ASN I  219 ? ALA I  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P32  32  PRO I  225 ? ALA I  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P33  33  GLU I  237 ? ALA I  244 ? GLU C 237 ALA C 244 1 ? 8  
HELX_P HELX_P34  34  ALA J  38  ? GLY J  47  ? ALA D 37  GLY D 46  1 ? 10 
HELX_P HELX_P35  35  ASP J  78  ? LEU J  89  ? ASP D 77  LEU D 88  1 ? 12 
HELX_P HELX_P36  36  PRO J  90  ? ALA J  92  ? PRO D 89  ALA D 91  5 ? 3  
HELX_P HELX_P37  37  PRO J  153 ? ARG J  157 ? PRO D 152 ARG D 156 5 ? 5  
HELX_P HELX_P38  38  ASN J  159 ? SER J  169 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P39  39  ASN K  56  ? GLU K  79  ? ASN E 55  GLU E 78  1 ? 24 
HELX_P HELX_P40  40  ASN K  107 ? GLU K  111 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P41  41  ASP K  138 ? THR K  153 ? ASP E 137 THR E 152 1 ? 16 
HELX_P HELX_P42  42  PRO L  10  ? GLY L  28  ? PRO F 9   GLY F 27  1 ? 19 
HELX_P HELX_P43  43  GLY L  33  ? GLY L  44  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P44  44  GLU L  58  ? HIS L  63  ? GLU F 57  HIS F 62  1 ? 6  
HELX_P HELX_P45  45  HIS L  63  ? GLU L  70  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P46  46  GLN L  81  ? GLY L  89  ? GLN F 80  GLY F 88  1 ? 9  
HELX_P HELX_P47  47  ALA L  105 ? LEU L  119 ? ALA F 104 LEU F 118 1 ? 15 
HELX_P HELX_P48  48  PRO M  13  ? SER M  29  ? PRO G 13  SER G 29  1 ? 17 
HELX_P HELX_P49  49  ARG M  63  ? ASP M  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P50  50  PRO N  5   ? TYR N  9   ? PRO H 5   TYR H 9   5 ? 5  
HELX_P HELX_P51  51  ASP N  42  ? TYR N  46  ? ASP H 42  TYR H 46  5 ? 5  
HELX_P HELX_P52  52  HIS N  62  ? GLY N  81  ? HIS H 62  GLY H 81  1 ? 20 
HELX_P HELX_P53  53  ASP N  145 ? TYR N  157 ? ASP H 145 TYR H 157 1 ? 13 
HELX_P HELX_P54  54  PRO O  70  ? GLY O  80  ? PRO I 69  GLY I 79  1 ? 11 
HELX_P HELX_P55  55  SER O  97  ? LYS O  108 ? SER I 96  LYS I 107 1 ? 12 
HELX_P HELX_P56  56  ASP O  116 ? THR O  127 ? ASP I 115 THR I 126 1 ? 12 
HELX_P HELX_P57  57  ILE P  18  ? ASP P  32  ? ILE J 18  ASP J 32  1 ? 15 
HELX_P HELX_P58  58  ASN P  40  ? ARG P  43  ? ASN J 40  ARG J 43  5 ? 4  
HELX_P HELX_P59  59  ARG P  49  ? ILE P  63  ? ARG J 49  ILE J 63  1 ? 15 
HELX_P HELX_P60  60  ARG P  74  ? GLY P  85  ? ARG J 74  GLY J 85  1 ? 12 
HELX_P HELX_P61  61  LYS P  91  ? SER P  100 ? LYS J 91  SER J 100 1 ? 10 
HELX_P HELX_P62  62  ASP P  122 ? ASN P  126 ? ASP J 122 ASN J 126 5 ? 5  
HELX_P HELX_P63  63  LEU P  132 ? LEU P  139 ? LEU J 132 LEU J 139 1 ? 8  
HELX_P HELX_P64  64  ALA Q  114 ? PHE Q  121 ? ALA K 114 PHE K 121 1 ? 8  
HELX_P HELX_P65  65  PHE Q  121 ? SER Q  126 ? PHE K 121 SER K 126 1 ? 6  
HELX_P HELX_P66  66  LYS R  4   ? GLN R  8   ? LYS L 3   GLN L 7   5 ? 5  
HELX_P HELX_P67  67  GLY R  24  ? GLY R  29  ? GLY L 23  GLY L 28  5 ? 6  
HELX_P HELX_P68  68  PRO R  55  ? GLN R  59  ? PRO L 54  GLN L 58  5 ? 5  
HELX_P HELX_P69  69  VAL R  67  ? ASN R  73  ? VAL L 66  ASN L 72  1 ? 7  
HELX_P HELX_P70  70  ARG R  95  ? VAL R  97  ? ARG L 94  VAL L 96  5 ? 3  
HELX_P HELX_P71  71  SER R  127 ? GLY R  136 ? SER L 126 GLY L 135 1 ? 10 
HELX_P HELX_P72  72  SER S  4   ? TRP S  13  ? SER M 3   TRP M 12  1 ? 10 
HELX_P HELX_P73  73  ASP S  18  ? ARG S  33  ? ASP M 17  ARG M 32  1 ? 16 
HELX_P HELX_P74  74  ARG S  46  ? GLN S  53  ? ARG M 45  GLN M 52  1 ? 8  
HELX_P HELX_P75  75  ARG S  83  ? GLN S  87  ? ARG M 82  GLN M 86  5 ? 5  
HELX_P HELX_P76  76  ASP S  97  ? PHE S  110 ? ASP M 96  PHE M 109 1 ? 14 
HELX_P HELX_P77  77  HIS S  139 ? ASN S  144 ? HIS M 138 ASN M 143 1 ? 6  
HELX_P HELX_P78  78  LEU S  148 ? ALA S  153 ? LEU M 147 ALA M 152 5 ? 6  
HELX_P HELX_P79  79  ALA S  153 ? ALA S  157 ? ALA M 152 ALA M 156 5 ? 5  
HELX_P HELX_P80  80  ASP S  158 ? GLY S  163 ? ASP M 157 GLY M 162 5 ? 6  
HELX_P HELX_P81  81  THR S  165 ? ARG S  172 ? THR M 164 ARG M 171 1 ? 8  
HELX_P HELX_P82  82  LEU S  188 ? GLY S  192 ? LEU M 187 GLY M 191 5 ? 5  
HELX_P HELX_P83  83  MET T  11  ? GLU T  16  ? MET N 10  GLU N 15  1 ? 6  
HELX_P HELX_P84  84  ASP T  20  ? SER T  30  ? ASP N 19  SER N 29  1 ? 11 
HELX_P HELX_P85  85  SER T  64  ? GLY T  71  ? SER N 63  GLY N 70  5 ? 8  
HELX_P HELX_P86  86  ASN T  78  ? ALA T  96  ? ASN N 77  ALA N 95  1 ? 19 
HELX_P HELX_P87  87  SER T  114 ? ALA T  126 ? SER N 113 ALA N 125 1 ? 13 
HELX_P HELX_P88  88  ASN T  133 ? LEU T  137 ? ASN N 132 LEU N 136 5 ? 5  
HELX_P HELX_P89  89  ASP T  139 ? GLY T  145 ? ASP N 138 GLY N 144 1 ? 7  
HELX_P HELX_P90  90  GLY T  145 ? GLU T  153 ? GLY N 144 GLU N 152 1 ? 9  
HELX_P HELX_P91  91  LEU T  169 ? LEU T  181 ? LEU N 168 LEU N 180 1 ? 13 
HELX_P HELX_P92  92  ASN U  5   ? SER U  22  ? ASN O 4   SER O 21  1 ? 18 
HELX_P HELX_P93  93  ALA U  25  ? LYS U  36  ? ALA O 24  LYS O 35  1 ? 12 
HELX_P HELX_P94  94  PRO U  37  ? HIS U  41  ? PRO O 36  HIS O 40  5 ? 5  
HELX_P HELX_P95  95  LEU U  46  ? ALA U  53  ? LEU O 45  ALA O 52  1 ? 8  
HELX_P HELX_P96  96  SER U  83  ? GLY U  94  ? SER O 82  GLY O 93  1 ? 12 
HELX_P HELX_P97  97  LEU U  99  ? ASN U  106 ? LEU O 98  ASN O 105 1 ? 8  
HELX_P HELX_P98  98  LEU V  4   ? LEU V  15  ? LEU P 3   LEU P 14  1 ? 12 
HELX_P HELX_P99  99  GLY V  18  ? ASN V  20  ? GLY P 17  ASN P 19  5 ? 3  
HELX_P HELX_P100 100 ARG V  28  ? ALA V  35  ? ARG P 27  ALA P 34  1 ? 8  
HELX_P HELX_P101 101 THR V  37  ? GLU V  47  ? THR P 36  GLU P 46  1 ? 11 
HELX_P HELX_P102 102 ARG V  60  ? TYR V  72  ? ARG P 59  TYR P 71  1 ? 13 
HELX_P HELX_P103 103 GLY V  77  ? ARG V  81  ? GLY P 76  ARG P 80  5 ? 5  
HELX_P HELX_P104 104 LYS V  84  ? GLN V  89  ? LYS P 83  GLN P 88  1 ? 6  
HELX_P HELX_P105 105 ASN V  90  ? GLU V  112 ? ASN P 89  GLU P 111 1 ? 23 
HELX_P HELX_P106 106 SER V  118 ? GLY V  128 ? SER P 117 GLY P 127 1 ? 11 
HELX_P HELX_P107 107 SER V  134 ? ASP V  143 ? SER P 133 ASP P 142 1 ? 10 
HELX_P HELX_P108 108 LYS W  18  ? ARG W  22  ? LYS Q 17  ARG Q 21  5 ? 5  
HELX_P HELX_P109 109 PRO W  27  ? VAL W  31  ? PRO Q 26  VAL Q 30  5 ? 5  
HELX_P HELX_P110 110 HIS W  54  ? ASP W  58  ? HIS Q 53  ASP Q 57  5 ? 5  
HELX_P HELX_P111 111 THR W  88  ? ALA W  90  ? THR Q 87  ALA Q 89  5 ? 3  
HELX_P HELX_P112 112 ASP X  10  ? ASP X  12  ? ASP R 9   ASP R 11  5 ? 3  
HELX_P HELX_P113 113 SER X  25  ? LYS X  37  ? SER R 24  LYS R 36  1 ? 13 
HELX_P HELX_P114 114 THR X  40  ? GLY X  54  ? THR R 39  GLY R 53  1 ? 15 
HELX_P HELX_P115 115 PRO X  82  ? GLN X  103 ? PRO R 81  GLN R 102 1 ? 22 
HELX_P HELX_P116 116 ASP X  106 ? MET X  110 ? ASP R 105 MET R 109 5 ? 5  
HELX_P HELX_P117 117 ALA X  130 ? GLY X  132 ? ALA R 129 GLY R 131 5 ? 3  
HELX_P HELX_P118 118 THR Y  12  ? ASN Y  23  ? THR S 11  ASN S 22  1 ? 12 
HELX_P HELX_P119 119 SER Y  34  ? ASP Y  47  ? SER S 33  ASP S 46  1 ? 14 
HELX_P HELX_P120 120 ASP Y  74  ? ARG Y  81  ? ASP S 73  ARG S 80  1 ? 8  
HELX_P HELX_P121 121 GLN Z  4   ? ARG Z  14  ? GLN T 3   ARG T 13  1 ? 11 
HELX_P HELX_P122 122 PRO Z  16  ? GLN Z  23  ? PRO T 15  GLN T 22  5 ? 8  
HELX_P HELX_P123 123 SER Z  29  ? GLY Z  37  ? SER T 28  GLY T 36  1 ? 9  
HELX_P HELX_P124 124 ASP Z  93  ? SER Z  95  ? ASP T 92  SER T 94  5 ? 3  
HELX_P HELX_P125 125 ASP Z  106 ? SER Z  115 ? ASP T 105 SER T 114 1 ? 10 
HELX_P HELX_P126 126 SER AA 33  ? LEU AA 42  ? SER U 33  LEU U 42  1 ? 10 
HELX_P HELX_P127 127 GLU AA 45  ? LEU AA 49  ? GLU U 45  LEU U 49  5 ? 5  
HELX_P HELX_P128 128 HIS BA 5   ? MET BA 12  ? HIS V 4   MET V 11  1 ? 8  
HELX_P HELX_P129 129 THR BA 13  ? ALA BA 37  ? THR V 12  ALA V 36  1 ? 25 
HELX_P HELX_P130 130 ARG BA 46  ? GLY BA 65  ? ARG V 45  GLY V 64  1 ? 20 
HELX_P HELX_P131 131 HIS CA 14  ? LEU CA 24  ? HIS W 14  LEU W 24  1 ? 11 
HELX_P HELX_P132 132 THR CA 38  ? ASN CA 49  ? THR W 38  ASN W 49  1 ? 12 
HELX_P HELX_P133 133 SER CA 58  ? ALA CA 70  ? SER W 58  ALA W 70  1 ? 13 
HELX_P HELX_P134 134 ASP CA 80  ? THR CA 88  ? ASP W 80  THR W 88  1 ? 9  
HELX_P HELX_P135 135 ASP CA 92  ? SER CA 102 ? ASP W 92  SER W 102 1 ? 11 
HELX_P HELX_P136 136 VAL CA 132 ? GLY CA 135 ? VAL W 132 GLY W 135 5 ? 4  
HELX_P HELX_P137 137 ASP CA 142 ? MET CA 153 ? ASP W 142 MET W 153 1 ? 12 
HELX_P HELX_P138 138 ARG DA 16  ? GLU DA 21  ? ARG X 15  GLU X 20  5 ? 6  
HELX_P HELX_P139 139 PRO DA 22  ? HIS DA 24  ? PRO X 21  HIS X 23  5 ? 3  
HELX_P HELX_P140 140 LYS DA 25  ? PHE DA 42  ? LYS X 24  PHE X 41  1 ? 18 
HELX_P HELX_P141 141 ASP DA 45  ? ASP DA 47  ? ASP X 44  ASP X 46  5 ? 3  
HELX_P HELX_P142 142 ASP DA 52  ? ALA DA 61  ? ASP X 51  ALA X 60  1 ? 10 
HELX_P HELX_P143 143 SER EA 111 ? GLY EA 125 ? SER Y 110 GLY Y 124 1 ? 15 
HELX_P HELX_P144 144 GLU EA 166 ? ARG EA 170 ? GLU Y 165 ARG Y 169 5 ? 5  
HELX_P HELX_P145 145 ASN EA 190 ? GLU EA 195 ? ASN Y 189 GLU Y 194 5 ? 6  
HELX_P HELX_P146 146 GLY EA 211 ? ALA EA 225 ? GLY Y 210 ALA Y 224 1 ? 15 
HELX_P HELX_P147 147 SER FA 2   ? GLY FA 6   ? SER Z 11  GLY Z 15  5 ? 5  
HELX_P HELX_P148 148 GLY FA 10  ? GLU FA 26  ? GLY Z 19  GLU Z 35  1 ? 17 
HELX_P HELX_P149 149 GLY FA 66  ? SER FA 73  ? GLY Z 75  SER Z 82  1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1    covale ? ? A  G   627  "O3'" ? ? ? 1_555 A  1MA 628  P     ? ? 0 G   627  0 1MA 628  1_555 ? ? ? ? ? ? ? 1.606 ? 
covale2    covale ? ? A  1MA 628  "O3'" ? ? ? 1_555 A  A   629  P     ? ? 0 1MA 628  0 A   629  1_555 ? ? ? ? ? ? ? 1.604 ? 
covale3    covale ? ? A  U   2586 "O3'" ? ? ? 1_555 A  OMU 2587 P     ? ? 0 U   2586 0 OMU 2587 1_555 ? ? ? ? ? ? ? 1.604 ? 
covale4    covale ? ? A  OMU 2587 "O3'" ? ? ? 1_555 A  OMG 2588 P     ? ? 0 OMU 2587 0 OMG 2588 1_555 ? ? ? ? ? ? ? 1.609 ? 
covale5    covale ? ? A  OMG 2588 "O3'" ? ? ? 1_555 A  U   2589 P     ? ? 0 OMG 2588 0 U   2589 1_555 ? ? ? ? ? ? ? 1.607 ? 
covale6    covale ? ? A  G   2618 "O3'" ? ? ? 1_555 A  UR3 2619 P     ? ? 0 G   2618 0 UR3 2619 1_555 ? ? ? ? ? ? ? 1.608 ? 
covale7    covale ? ? A  UR3 2619 "O3'" ? ? ? 1_555 A  U   2620 P     ? ? 0 UR3 2619 0 U   2620 1_555 ? ? ? ? ? ? ? 1.599 ? 
covale8    covale ? ? A  U   2620 "O3'" ? ? ? 1_555 A  PSU 2621 P     ? ? 0 U   2620 0 PSU 2621 1_555 ? ? ? ? ? ? ? 1.603 ? 
covale9    covale ? ? A  PSU 2621 "O3'" ? ? ? 1_555 A  A   2622 P     ? ? 0 PSU 2621 0 A   2622 1_555 ? ? ? ? ? ? ? 1.609 ? 
metalc1    metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  A   2483 OP2   ? ? 0 MG  8001 0 A   2483 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc2    metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  C   2533 OP2   ? ? 0 MG  8001 0 C   2533 1_555 ? ? ? ? ? ? ? 1.827 ? 
metalc3    metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  C   2534 OP2   ? ? 0 MG  8001 0 C   2534 1_555 ? ? ? ? ? ? ? 2.021 ? 
metalc4    metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  G   627  O6    ? ? 0 MG  8002 0 G   627  1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc5    metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  A   2483 OP1   ? ? 0 MG  8002 0 A   2483 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc6    metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  C   2534 OP1   ? ? 0 MG  8002 0 C   2534 1_555 ? ? ? ? ? ? ? 2.242 ? 
metalc7    metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  A   876  OP2   ? ? 0 MG  8003 0 A   876  1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc8    metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  G   877  OP2   ? ? 0 MG  8003 0 G   877  1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc9    metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  A   2624 OP1   ? ? 0 MG  8003 0 A   2624 1_555 ? ? ? ? ? ? ? 1.905 ? 
metalc10   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  G   456  O6    ? ? 0 MG  8004 0 G   456  1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc11   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  A   459  OP1   ? ? 0 MG  8004 0 A   459  1_555 ? ? ? ? ? ? ? 1.858 ? 
metalc12   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  U   1838 OP1   ? ? 0 MG  8005 0 U   1838 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc13   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  A   1836 OP1   ? ? 0 MG  8005 0 A   1836 1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc14   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  A   1839 OP2   ? ? 0 MG  8005 0 A   1839 1_555 ? ? ? ? ? ? ? 1.877 ? 
metalc15   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  U   821  OP2   ? ? 0 MG  8006 0 U   821  1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc16   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  C   822  OP2   ? ? 0 MG  8006 0 C   822  1_555 ? ? ? ? ? ? ? 1.788 ? 
metalc17   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  G   854  OP1   ? ? 0 MG  8006 0 G   854  1_555 ? ? ? ? ? ? ? 1.978 ? 
metalc18   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  U   832  OP2   ? ? 0 MG  8007 0 U   832  1_555 ? ? ? ? ? ? ? 1.972 ? 
metalc19   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  A   1839 OP1   ? ? 0 MG  8007 0 A   1839 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc20   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  A   1840 OP2   ? ? 0 MG  8007 0 A   1840 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc21   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  U   919  OP1   ? ? 0 MG  8008 0 U   919  1_555 ? ? ? ? ? ? ? 1.811 ? 
metalc22   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  A   2465 OP1   ? ? 0 MG  8008 0 A   2465 1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc23   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  C   2464 OP1   ? ? 0 MG  8008 0 C   2464 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc24   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  G   2611 OP1   ? ? 0 MG  8009 0 G   2611 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc25   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  A   2612 OP1   ? ? 0 MG  8009 0 A   2612 1_555 ? ? ? ? ? ? ? 1.925 ? 
metalc26   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   836  OP1   ? ? 0 MG  8010 0 G   836  1_555 ? ? ? ? ? ? ? 1.868 ? 
metalc27   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  U   2615 OP1   ? ? 0 MG  8010 0 U   2615 1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc28   metalc ? ? PA MG  .    MG    ? ? ? 1_555 H  GLN 231  OE1   ? ? 0 MG  8010 B GLN 230  1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc29   metalc ? ? QA MG  .    MG    ? ? ? 1_555 A  G   824  N7    ? ? 0 MG  8011 0 G   824  1_555 ? ? ? ? ? ? ? 1.917 ? 
metalc30   metalc ? ? QA MG  .    MG    ? ? ? 1_555 A  G   854  N7    ? ? 0 MG  8011 0 G   854  1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc31   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  G   28   OP1   ? ? 0 MG  8012 0 G   28   1_555 ? ? ? ? ? ? ? 1.951 ? 
metalc32   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   2623 OP1   ? ? 0 MG  8013 0 G   2623 1_555 ? ? ? ? ? ? ? 1.730 ? 
metalc33   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   877  OP1   ? ? 0 MG  8013 0 G   877  1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc34   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  G   2537 OP2   ? ? 0 MG  8014 0 G   2537 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc35   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  G   2102 OP2   ? ? 0 MG  8014 0 G   2102 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc36   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  G   2102 "O5'" ? ? 0 MG  8014 0 G   2102 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc37   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  A   1689 OP1   ? ? 0 MG  8015 0 A   1689 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc38   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  A   844  OP1   ? ? 0 MG  8015 0 A   844  1_555 ? ? ? ? ? ? ? 1.814 ? 
metalc39   metalc ? ? VA MG  .    MG    ? ? ? 1_555 A  A   1678 OP1   ? ? 0 MG  8016 0 A   1678 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc40   metalc ? ? VA MG  .    MG    ? ? ? 1_555 A  C   1679 OP2   ? ? 0 MG  8016 0 C   1679 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc41   metalc ? ? VA MG  .    MG    ? ? ? 1_555 A  A   1504 OP1   ? ? 0 MG  8016 0 A   1504 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc42   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  G   456  OP2   ? ? 0 MG  8017 0 G   456  1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc43   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  A   1291 OP1   ? ? 0 MG  8018 0 A   1291 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc44   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  G   1292 OP2   ? ? 0 MG  8018 0 G   1292 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc45   metalc ? ? YA MG  .    MG    ? ? ? 1_555 A  A   2011 OP1   ? ? 0 MG  8019 0 A   2011 1_555 ? ? ? ? ? ? ? 2.844 ? 
metalc46   metalc ? ? YA MG  .    MG    ? ? ? 1_555 A  A   2011 OP2   ? ? 0 MG  8019 0 A   2011 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc47   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 A  C   1830 OP1   ? ? 0 MG  8020 0 C   1830 1_555 ? ? ? ? ? ? ? 1.980 ? 
metalc48   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   2304 OP2   ? ? 0 MG  8021 0 G   2304 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc49   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  G   2097 OP2   ? ? 0 MG  8022 0 G   2097 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc50   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  G   2540 OP1   ? ? 0 MG  8022 0 G   2540 1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc51   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  G   2618 OP2   ? ? 0 MG  8023 0 G   2618 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc52   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  G   2617 OP2   ? ? 0 MG  8023 0 G   2617 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc53   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  A   1381 N7    ? ? 0 MG  8024 0 A   1381 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc54   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  U   1120 OP2   ? ? 0 MG  8025 0 U   1120 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc55   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  G   1121 OP2   ? ? 0 MG  8025 0 G   1121 1_555 ? ? ? ? ? ? ? 1.897 ? 
metalc56   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  C   2608 OP1   ? ? 0 MG  8026 0 C   2608 1_555 ? ? ? ? ? ? ? 2.510 ? 
metalc57   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  U   2610 OP2   ? ? 0 MG  8026 0 U   2610 1_555 ? ? ? ? ? ? ? 1.897 ? 
metalc58   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  G   2609 OP1   ? ? 0 MG  8026 0 G   2609 1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc59   metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  C   240  OP1   ? ? 0 MG  8027 0 C   240  1_555 ? ? ? ? ? ? ? 1.886 ? 
metalc60   metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  G   269  O6    ? ? 0 MG  8027 0 G   269  1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc61   metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  A   1448 OP2   ? ? 0 MG  8028 0 A   1448 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc62   metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  U   1677 O4    ? ? 0 MG  8028 0 U   1677 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc63   metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  C   1679 OP1   ? ? 0 MG  8029 0 C   1679 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc64   metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  U   1503 OP1   ? ? 0 MG  8029 0 U   1503 1_555 ? ? ? ? ? ? ? 1.860 ? 
metalc65   metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  U   1748 OP1   ? ? 0 MG  8030 0 U   1748 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc66   metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  U   1749 OP2   ? ? 0 MG  8030 0 U   1749 1_555 ? ? ? ? ? ? ? 1.887 ? 
metalc67   metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  U   777  OP2   ? ? 0 MG  8031 0 U   777  1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc68   metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  C   778  OP2   ? ? 0 MG  8031 0 C   778  1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc69   metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  U   2115 OP1   ? ? 0 MG  8032 0 U   2115 1_555 ? ? ? ? ? ? ? 1.887 ? 
metalc70   metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  G   2585 OP1   ? ? 0 MG  8033 0 G   2585 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc71   metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  A   1747 OP2   ? ? 0 MG  8033 0 A   1747 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc72   metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  U   1748 OP2   ? ? 0 MG  8033 0 U   1748 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc73   metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  U   1749 O4    ? ? 0 MG  8033 0 U   1749 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc74   metalc ? ? NB MG  .    MG    ? ? ? 1_555 A  A   2303 OP1   ? ? 0 MG  8034 0 A   2303 1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc75   metalc ? ? NB MG  .    MG    ? ? ? 1_555 A  A   2302 OP1   ? ? 0 MG  8034 0 A   2302 1_555 ? ? ? ? ? ? ? 1.958 ? 
metalc76   metalc ? ? OB MG  .    MG    ? ? ? 1_555 A  G   1484 OP2   ? ? 0 MG  8035 0 G   1484 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc77   metalc ? ? PB MG  .    MG    ? ? ? 1_555 A  G   956  OP2   ? ? 0 MG  8036 0 G   956  1_555 ? ? ? ? ? ? ? 1.804 ? 
metalc78   metalc ? ? QB MG  .    MG    ? ? ? 1_555 A  A   2553 OP2   ? ? 0 MG  8037 0 A   2553 1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc79   metalc ? ? SB MG  .    MG    ? ? ? 1_555 A  U   115  OP2   ? ? 0 MG  8039 0 U   115  1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc80   metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  U   392  OP2   ? ? 0 MG  8040 0 U   392  1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc81   metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  G   196  OP1   ? ? 0 MG  8041 0 G   196  1_555 ? ? ? ? ? ? ? 2.577 ? 
metalc82   metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  A   227  "O2'" ? ? 0 MG  8041 0 A   227  1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc83   metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  C   228  "O4'" ? ? 0 MG  8041 0 C   228  1_555 ? ? ? ? ? ? ? 2.975 ? 
metalc84   metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  U   1309 O2    ? ? 0 MG  8042 0 U   1309 1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc85   metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  U   1346 O2    ? ? 0 MG  8042 0 U   1346 1_555 ? ? ? ? ? ? ? 2.542 ? 
metalc86   metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  G   817  O6    ? ? 0 MG  8043 0 G   817  1_555 ? ? ? ? ? ? ? 2.775 ? 
metalc87   metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? 0 MG  8043 0 G   816  1_555 ? ? ? ? ? ? ? 2.728 ? 
metalc88   metalc ? ? XB MG  .    MG    ? ? ? 1_555 A  A   2089 OP1   ? ? 0 MG  8044 0 A   2089 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc89   metalc ? ? XB MG  .    MG    ? ? ? 1_555 X  GLY 66   O     ? ? 0 MG  8044 R GLY 65   1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc90   metalc ? ? XB MG  .    MG    ? ? ? 1_555 A  C   2048 OP1   ? ? 0 MG  8044 0 C   2048 1_555 ? ? ? ? ? ? ? 2.576 ? 
metalc91   metalc ? ? YB MG  .    MG    ? ? ? 1_555 A  G   1979 OP2   ? ? 0 MG  8045 0 G   1979 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc92   metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  A   1098 OP2   ? ? 0 MG  8047 0 A   1098 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc93   metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  A   2746 OP2   ? ? 0 MG  8048 0 A   2746 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc94   metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  G   2750 OP2   ? ? 0 MG  8048 0 G   2750 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc95   metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  G   2421 OP1   ? ? 0 MG  8049 0 G   2421 1_555 ? ? ? ? ? ? ? 2.575 ? 
metalc96   metalc ? ? DC MG  .    MG    ? ? ? 1_555 A  C   2248 OP2   ? ? 0 MG  8050 0 C   2248 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc97   metalc ? ? EC MG  .    MG    ? ? ? 1_555 A  G   641  OP2   ? ? 0 MG  8051 0 G   641  1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc98   metalc ? ? FC MG  .    MG    ? ? ? 1_555 A  U   1125 OP1   ? ? 0 MG  8052 0 U   1125 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc99   metalc ? ? FC MG  .    MG    ? ? ? 1_555 F  G   92   OP1   ? ? 0 MG  8052 9 G   92   1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc100  metalc ? ? GC MG  .    MG    ? ? ? 1_555 A  G   471  O6    ? ? 0 MG  8053 0 G   471  1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc101  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  C   162  OP1   ? ? 0 MG  8054 0 C   162  1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc102  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  U   2276 OP1   ? ? 0 MG  8054 0 U   2276 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc103  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   2012 "O2'" ? ? 0 MG  8057 0 U   2012 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc104  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   1883 OP1   ? ? 0 MG  8057 0 U   1883 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc105  metalc ? ? IC MG  .    MG    ? ? ? 1_555 G  GLN 208  O     ? ? 0 MG  8057 A GLN 207  1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc106  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  G   2013 OP2   ? ? 0 MG  8057 0 G   2013 1_555 ? ? ? ? ? ? ? 2.965 ? 
metalc107  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   2012 "O3'" ? ? 0 MG  8057 0 U   2012 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc108  metalc ? ? JC MG  .    MG    ? ? ? 1_555 A  G   2013 OP2   ? ? 0 MG  8058 0 G   2013 1_555 ? ? ? ? ? ? ? 1.963 ? 
metalc109  metalc ? ? KC MG  .    MG    ? ? ? 1_555 A  G   2618 OP1   ? ? 0 MG  8059 0 G   2618 1_555 ? ? ? ? ? ? ? 2.812 ? 
metalc110  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  G   175  OP2   ? ? 0 MG  8060 0 G   175  1_555 ? ? ? ? ? ? ? 2.908 ? 
metalc111  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  U   2650 OP2   ? ? 0 MG  8061 0 U   2650 1_555 ? ? ? ? ? ? ? 2.981 ? 
metalc112  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  A   1369 OP2   ? ? 0 MG  8061 0 A   1369 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc113  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  U   2650 OP1   ? ? 0 MG  8061 0 U   2650 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc114  metalc ? ? NC MG  .    MG    ? ? ? 1_555 A  G   1491 O6    ? ? 0 MG  8062 0 G   1491 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc115  metalc ? ? NC MG  .    MG    ? ? ? 1_555 A  G   1489 OP2   ? ? 0 MG  8062 0 G   1489 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc116  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  U   2277 O4    ? ? 0 MG  8064 0 U   2277 1_555 ? ? ? ? ? ? ? 2.741 ? 
metalc117  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  U   2278 O4    ? ? 0 MG  8064 0 U   2278 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc118  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  G   2471 O6    ? ? 0 MG  8064 0 G   2471 1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc119  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  G   1873 OP2   ? ? 0 MG  8066 0 G   1873 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc120  metalc ? ? QC MG  .    MG    ? ? ? 1_555 G  ASP 27   OD1   ? ? 0 MG  8066 A ASP 26   1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc121  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  A   1845 OP1   ? ? 0 MG  8067 0 A   1845 1_555 ? ? ? ? ? ? ? 2.743 ? 
metalc122  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  G   1884 O6    ? ? 0 MG  8067 0 G   1884 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc123  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  U   1846 OP2   ? ? 0 MG  8067 0 U   1846 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc124  metalc ? ? RC MG  .    MG    ? ? ? 1_555 G  ASN 189  O     ? ? 0 MG  8067 A ASN 188  1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc125  metalc ? ? SC MG  .    MG    ? ? ? 1_555 A  A   2568 OP2   ? ? 0 MG  8068 0 A   2568 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc126  metalc ? ? TC MG  .    MG    ? ? ? 1_555 A  A   166  OP1   ? ? 0 MG  8070 0 A   166  1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc127  metalc ? ? TC MG  .    MG    ? ? ? 1_555 A  G   219  O6    ? ? 0 MG  8070 0 G   219  1_555 ? ? ? ? ? ? ? 2.465 ? 
metalc128  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   1286 OP1   ? ? 0 MG  8074 0 A   1286 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc129  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   1287 OP1   ? ? 0 MG  8074 0 A   1287 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc130  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  A   908  "O4'" ? ? 0 MG  8075 0 A   908  1_555 ? ? ? ? ? ? ? 2.441 ? 
metalc131  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  A   907  "O2'" ? ? 0 MG  8075 0 A   907  1_555 ? ? ? ? ? ? ? 2.441 ? 
metalc132  metalc ? ? YC MG  .    MG    ? ? ? 1_555 A  C   880  OP1   ? ? 0 MG  8077 0 C   880  1_555 ? ? ? ? ? ? ? 1.944 ? 
metalc133  metalc ? ? YC MG  .    MG    ? ? ? 1_555 A  U   883  OP2   ? ? 0 MG  8077 0 U   883  1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc134  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  A   165  N7    ? ? 0 MG  8079 0 A   165  1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc135  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  A   167  OP1   ? ? 0 MG  8079 0 A   167  1_555 ? ? ? ? ? ? ? 1.962 ? 
metalc136  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  C   168  OP2   ? ? 0 MG  8079 0 C   168  1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc137  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  U   1724 OP2   ? ? 0 MG  8080 0 U   1724 1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc138  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  A   1684 OP2   ? ? 0 MG  8080 0 A   1684 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc139  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  C   1420 OP1   ? ? 0 MG  8081 0 C   1420 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc140  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  G   1438 OP1   ? ? 0 MG  8081 0 G   1438 1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc141  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  C   1421 OP2   ? ? 0 MG  8081 0 C   1421 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc142  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  A   1437 OP2   ? ? 0 MG  8082 0 A   1437 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc143  metalc ? ? DD MG  .    MG    ? ? ? 1_555 A  A   1754 OP2   ? ? 0 MG  8083 0 A   1754 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc144  metalc ? ? ED MG  .    MG    ? ? ? 1_555 A  A   1742 OP2   ? ? 0 MG  8084 0 A   1742 1_555 ? ? ? ? ? ? ? 1.939 ? 
metalc145  metalc ? ? FD MG  .    MG    ? ? ? 1_555 A  G   2618 OP1   ? ? 0 MG  8085 0 G   2618 1_555 ? ? ? ? ? ? ? 2.961 ? 
metalc146  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  A   532  OP1   ? ? 0 MG  8086 0 A   532  1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc147  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  U   533  OP1   ? ? 0 MG  8086 0 U   533  1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc148  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  A   682  OP2   ? ? 0 MG  8087 0 A   682  1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc149  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  G   683  OP2   ? ? 0 MG  8087 0 G   683  1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc150  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  G   2540 O6    ? ? 0 MG  8088 0 G   2540 1_555 ? ? ? ? ? ? ? 2.592 ? 
metalc151  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  G   2611 "O2'" ? ? 0 MG  8088 0 G   2611 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc152  metalc ? ? ID MG  .    MG    ? ? ? 1_555 UF NA  .    NA    ? ? 0 MG  8088 0 NA  8539 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc153  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  C   515  "O3'" ? ? 0 MG  8089 0 C   515  1_555 ? ? ? ? ? ? ? 2.941 ? 
metalc154  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  A   516  OP1   ? ? 0 MG  8089 0 A   516  1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc155  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  U   517  OP2   ? ? 0 MG  8089 0 U   517  1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc156  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  A   2103 OP1   ? ? 0 MG  8090 0 A   2103 1_555 ? ? ? ? ? ? ? 2.988 ? 
metalc157  metalc ? ? LD MG  .    MG    ? ? ? 1_555 A  G   918  OP1   ? ? 0 MG  8091 0 G   918  1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc158  metalc ? ? MD MG  .    MG    ? ? ? 1_555 A  C   1844 OP2   ? ? 0 MG  8092 0 C   1844 1_555 ? ? ? ? ? ? ? 2.533 ? 
metalc159  metalc ? ? ND MG  .    MG    ? ? ? 1_555 A  A   1070 "O2'" ? ? 0 MG  8093 0 A   1070 1_555 ? ? ? ? ? ? ? 2.682 ? 
metalc160  metalc ? ? ND MG  .    MG    ? ? ? 1_555 A  G   1071 OP1   ? ? 0 MG  8093 0 G   1071 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc161  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  C   1257 OP2   ? ? 0 MG  8094 0 C   1257 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc162  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  U   1096 OP2   ? ? 0 MG  8094 0 U   1096 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc163  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  G   1848 O6    ? ? 0 MG  8096 0 G   1848 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc164  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  G   1849 O6    ? ? 0 MG  8096 0 G   1849 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc165  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  U   864  O4    ? ? 0 MG  8097 0 U   864  1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc166  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  G   863  O6    ? ? 0 MG  8097 0 G   863  1_555 ? ? ? ? ? ? ? 2.627 ? 
metalc167  metalc ? ? SD MG  .    MG    ? ? ? 1_555 A  A   2612 "O2'" ? ? 0 MG  8099 0 A   2612 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc168  metalc ? ? UD MG  .    MG    ? ? ? 1_555 A  C   2281 OP2   ? ? 0 MG  8101 0 C   2281 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc169  metalc ? ? UD MG  .    MG    ? ? ? 1_555 A  U   2282 O4    ? ? 0 MG  8101 0 U   2282 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc170  metalc ? ? VD MG  .    MG    ? ? ? 1_555 A  A   2434 N3    ? ? 0 MG  8102 0 A   2434 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc171  metalc ? ? WD MG  .    MG    ? ? ? 1_555 A  G   2578 OP2   ? ? 0 MG  8103 0 G   2578 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc172  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  C   2104 OP1   ? ? 0 MG  8104 0 C   2104 1_555 ? ? ? ? ? ? ? 2.682 ? 
metalc173  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  C   2105 OP2   ? ? 0 MG  8104 0 C   2105 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc174  metalc ? ? YD MG  .    MG    ? ? ? 1_555 A  G   817  O6    ? ? 0 MG  8105 0 G   817  1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc175  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 A  A   1106 OP2   ? ? 0 MG  8106 0 A   1106 1_555 ? ? ? ? ? ? ? 1.963 ? 
metalc176  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 A  A   1107 OP2   ? ? 0 MG  8106 0 A   1107 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc177  metalc ? ? BE MG  .    MG    ? ? ? 1_555 A  A   1357 N7    ? ? 0 MG  8109 0 A   1357 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc178  metalc ? ? BE MG  .    MG    ? ? ? 1_555 A  U   903  OP1   ? ? 0 MG  8109 0 U   903  1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc179  metalc ? ? CE MG  .    MG    ? ? ? 1_555 A  G   2609 N7    ? ? 0 MG  8110 0 G   2609 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc180  metalc ? ? HE MG  .    MG    ? ? ? 1_555 A  U   1850 O4    ? ? 0 MG  8115 0 U   1850 1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc181  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  A   1840 "O3'" ? ? 0 MG  8116 0 A   1840 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc182  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  A   1840 "O2'" ? ? 0 MG  8116 0 A   1840 1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc183  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  A   2022 N7    ? ? 0 MG  8116 0 A   2022 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc184  metalc ? ? LE K   .    K     ? ? ? 1_555 A  U   172  O4    ? ? 0 K   8402 0 U   172  1_555 ? ? ? ? ? ? ? 3.034 ? 
metalc185  metalc ? ? LE K   .    K     ? ? ? 1_555 A  U   163  O4    ? ? 0 K   8402 0 U   163  1_555 ? ? ? ? ? ? ? 3.092 ? 
metalc186  metalc ? ? LE K   .    K     ? ? ? 1_555 A  C   162  OP2   ? ? 0 K   8402 0 C   162  1_555 ? ? ? ? ? ? ? 3.248 ? 
metalc187  metalc ? ? ME NA  .    NA    ? ? ? 1_555 A  G   1072 N7    ? ? 0 NA  8501 0 G   1072 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc188  metalc ? ? ME NA  .    NA    ? ? ? 1_555 A  C   1069 OP2   ? ? 0 NA  8501 0 C   1069 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc189  metalc ? ? NE NA  .    NA    ? ? ? 1_555 A  G   1121 O6    ? ? 0 NA  8502 0 G   1121 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc190  metalc ? ? NE NA  .    NA    ? ? ? 1_555 A  U   1120 OP2   ? ? 0 NA  8502 0 U   1120 1_555 ? ? ? ? ? ? ? 3.162 ? 
metalc191  metalc ? ? NE NA  .    NA    ? ? ? 1_555 A  G   1119 "O3'" ? ? 0 NA  8502 0 G   1119 1_555 ? ? ? ? ? ? ? 3.164 ? 
metalc192  metalc ? ? NE NA  .    NA    ? ? ? 1_555 A  G   1119 "O2'" ? ? 0 NA  8502 0 G   1119 1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc193  metalc ? ? OE NA  .    NA    ? ? ? 1_555 A  G   1354 OP1   ? ? 0 NA  8503 0 G   1354 1_555 ? ? ? ? ? ? ? 3.054 ? 
metalc194  metalc ? ? OE NA  .    NA    ? ? ? 1_555 A  A   643  OP2   ? ? 0 NA  8503 0 A   643  1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc195  metalc ? ? PE NA  .    NA    ? ? ? 1_555 A  A   630  N3    ? ? 0 NA  8505 0 A   630  1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc196  metalc ? ? PE NA  .    NA    ? ? ? 1_555 A  A   630  "O2'" ? ? 0 NA  8505 0 A   630  1_555 ? ? ? ? ? ? ? 3.074 ? 
metalc197  metalc ? ? PE NA  .    NA    ? ? ? 1_555 A  A   631  "O2'" ? ? 0 NA  8505 0 A   631  1_555 ? ? ? ? ? ? ? 2.798 ? 
metalc198  metalc ? ? PE NA  .    NA    ? ? ? 1_555 A  A   2074 OP2   ? ? 0 NA  8505 0 A   2074 1_555 ? ? ? ? ? ? ? 3.078 ? 
metalc199  metalc ? ? QE NA  .    NA    ? ? ? 1_555 A  G   2093 N7    ? ? 0 NA  8506 0 G   2093 1_555 ? ? ? ? ? ? ? 2.965 ? 
metalc200  metalc ? ? QE NA  .    NA    ? ? ? 1_555 A  G   2094 N7    ? ? 0 NA  8506 0 G   2094 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc201  metalc ? ? QE NA  .    NA    ? ? ? 1_555 A  G   2092 "O2'" ? ? 0 NA  8506 0 G   2092 1_555 ? ? ? ? ? ? ? 3.151 ? 
metalc202  metalc ? ? QE NA  .    NA    ? ? ? 1_555 A  A   2649 N1    ? ? 0 NA  8506 0 A   2649 1_555 ? ? ? ? ? ? ? 2.987 ? 
metalc203  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  C   40   "O2'" ? ? 0 NA  8507 0 C   40   1_555 ? ? ? ? ? ? ? 2.743 ? 
metalc204  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  C   40   O2    ? ? 0 NA  8507 0 C   40   1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc205  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  G   41   "O4'" ? ? 0 NA  8507 0 G   41   1_555 ? ? ? ? ? ? ? 2.744 ? 
metalc206  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  A   442  N1    ? ? 0 NA  8507 0 A   442  1_555 ? ? ? ? ? ? ? 3.023 ? 
metalc207  metalc ? ? SE NA  .    NA    ? ? ? 1_555 A  C   1394 O2    ? ? 0 NA  8508 0 C   1394 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc208  metalc ? ? SE NA  .    NA    ? ? ? 1_555 A  U   1432 O4    ? ? 0 NA  8508 0 U   1432 1_555 ? ? ? ? ? ? ? 2.644 ? 
metalc209  metalc ? ? SE NA  .    NA    ? ? ? 1_555 A  U   1724 O2    ? ? 0 NA  8508 0 U   1724 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc210  metalc ? ? TE NA  .    NA    ? ? ? 1_555 A  A   1133 "O3'" ? ? 0 NA  8509 0 A   1133 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc211  metalc ? ? TE NA  .    NA    ? ? ? 1_555 N  PRO 162  O     ? ? 0 NA  8509 H PRO 162  1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc212  metalc ? ? TE NA  .    NA    ? ? ? 1_555 A  G   1134 OP1   ? ? 0 NA  8509 0 G   1134 1_555 ? ? ? ? ? ? ? 2.875 ? 
metalc213  metalc ? ? TE NA  .    NA    ? ? ? 1_555 N  ILE 160  O     ? ? 0 NA  8509 H ILE 160  1_555 ? ? ? ? ? ? ? 2.822 ? 
metalc214  metalc ? ? TE NA  .    NA    ? ? ? 1_555 N  TYR 157  O     ? ? 0 NA  8509 H TYR 157  1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc215  metalc ? ? UE NA  .    NA    ? ? ? 1_555 A  A   2577 "O4'" ? ? 0 NA  8510 0 A   2577 1_555 ? ? ? ? ? ? ? 2.967 ? 
metalc216  metalc ? ? UE NA  .    NA    ? ? ? 1_555 A  A   2577 N3    ? ? 0 NA  8510 0 A   2577 1_555 ? ? ? ? ? ? ? 2.961 ? 
metalc217  metalc ? ? UE NA  .    NA    ? ? ? 1_555 A  G   2579 N7    ? ? 0 NA  8510 0 G   2579 1_555 ? ? ? ? ? ? ? 3.111 ? 
metalc218  metalc ? ? UE NA  .    NA    ? ? ? 1_555 A  G   2579 O6    ? ? 0 NA  8510 0 G   2579 1_555 ? ? ? ? ? ? ? 2.804 ? 
metalc219  metalc ? ? VE NA  .    NA    ? ? ? 1_555 A  G   2524 N7    ? ? 0 NA  8511 0 G   2524 1_555 ? ? ? ? ? ? ? 2.650 ? 
metalc220  metalc ? ? VE NA  .    NA    ? ? ? 1_555 A  G   2525 O6    ? ? 0 NA  8511 0 G   2525 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc221  metalc ? ? WE NA  .    NA    ? ? ? 1_555 A  G   2399 O6    ? ? 0 NA  8513 0 G   2399 1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc222  metalc ? ? WE NA  .    NA    ? ? ? 1_555 A  A   2398 OP2   ? ? 0 NA  8513 0 A   2398 1_555 ? ? ? ? ? ? ? 3.079 ? 
metalc223  metalc ? ? WE NA  .    NA    ? ? ? 1_555 A  G   2399 N7    ? ? 0 NA  8513 0 G   2399 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc224  metalc ? ? XE NA  .    NA    ? ? ? 1_555 A  U   2607 "O2'" ? ? 0 NA  8514 0 U   2607 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc225  metalc ? ? XE NA  .    NA    ? ? ? 1_555 A  U   2607 O2    ? ? 0 NA  8514 0 U   2607 1_555 ? ? ? ? ? ? ? 3.074 ? 
metalc226  metalc ? ? YE NA  .    NA    ? ? ? 1_555 A  A   166  "O3'" ? ? 0 NA  8515 0 A   166  1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc227  metalc ? ? YE NA  .    NA    ? ? ? 1_555 A  A   166  "O2'" ? ? 0 NA  8515 0 A   166  1_555 ? ? ? ? ? ? ? 2.895 ? 
metalc228  metalc ? ? YE NA  .    NA    ? ? ? 1_555 A  A   167  OP1   ? ? 0 NA  8515 0 A   167  1_555 ? ? ? ? ? ? ? 3.162 ? 
metalc229  metalc ? ? YE NA  .    NA    ? ? ? 1_555 A  A   165  OP2   ? ? 0 NA  8515 0 A   165  1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc230  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 A  A   897  "O4'" ? ? 0 NA  8516 0 A   897  1_555 ? ? ? ? ? ? ? 2.969 ? 
metalc231  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 A  C   896  "O2'" ? ? 0 NA  8516 0 C   896  1_555 ? ? ? ? ? ? ? 2.955 ? 
metalc232  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 A  C   896  O2    ? ? 0 NA  8516 0 C   896  1_555 ? ? ? ? ? ? ? 2.953 ? 
metalc233  metalc ? ? AF NA  .    NA    ? ? ? 1_555 C  TRP 43   O     ? ? 0 NA  8517 2 TRP 42   1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc234  metalc ? ? AF NA  .    NA    ? ? ? 1_555 A  G   1416 "O3'" ? ? 0 NA  8517 0 G   1416 1_555 ? ? ? ? ? ? ? 2.740 ? 
metalc235  metalc ? ? AF NA  .    NA    ? ? ? 1_555 A  G   1417 OP1   ? ? 0 NA  8517 0 G   1417 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc236  metalc ? ? AF NA  .    NA    ? ? ? 1_555 C  ASN 46   O     ? ? 0 NA  8517 2 ASN 45   1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc237  metalc ? ? BF NA  .    NA    ? ? ? 1_555 A  G   2544 N7    ? ? 0 NA  8518 0 G   2544 1_555 ? ? ? ? ? ? ? 3.038 ? 
metalc238  metalc ? ? BF NA  .    NA    ? ? ? 1_555 A  G   2543 N7    ? ? 0 NA  8518 0 G   2543 1_555 ? ? ? ? ? ? ? 3.128 ? 
metalc239  metalc ? ? CF NA  .    NA    ? ? ? 1_555 A  A   2465 "O3'" ? ? 0 NA  8519 0 A   2465 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc240  metalc ? ? CF NA  .    NA    ? ? ? 1_555 R  ASP 37   O     ? ? 0 NA  8519 L ASP 36   1_555 ? ? ? ? ? ? ? 2.927 ? 
metalc241  metalc ? ? CF NA  .    NA    ? ? ? 1_555 A  G   2466 OP2   ? ? 0 NA  8519 0 G   2466 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc242  metalc ? ? DF NA  .    NA    ? ? ? 1_555 A  G   2543 O6    ? ? 0 NA  8520 0 G   2543 1_555 ? ? ? ? ? ? ? 2.846 ? 
metalc243  metalc ? ? DF NA  .    NA    ? ? ? 1_555 A  U   2615 O4    ? ? 0 NA  8520 0 U   2615 1_555 ? ? ? ? ? ? ? 2.888 ? 
metalc244  metalc ? ? EF NA  .    NA    ? ? ? 1_555 A  U   837  OP1   ? ? 0 NA  8521 0 U   837  1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc245  metalc ? ? EF NA  .    NA    ? ? ? 1_555 A  A   1736 OP1   ? ? 0 NA  8521 0 A   1736 1_555 ? ? ? ? ? ? ? 3.129 ? 
metalc246  metalc ? ? EF NA  .    NA    ? ? ? 1_555 A  G   836  "O3'" ? ? 0 NA  8521 0 G   836  1_555 ? ? ? ? ? ? ? 2.530 ? 
metalc247  metalc ? ? EF NA  .    NA    ? ? ? 1_555 H  ARG 230  O     ? ? 0 NA  8521 B ARG 229  1_555 ? ? ? ? ? ? ? 3.089 ? 
metalc248  metalc ? ? FF NA  .    NA    ? ? ? 1_555 A  A   2112 N3    ? ? 0 NA  8523 0 A   2112 1_555 ? ? ? ? ? ? ? 2.594 ? 
metalc249  metalc ? ? FF NA  .    NA    ? ? ? 1_555 A  C   2475 N4    ? ? 0 NA  8523 0 C   2475 1_555 ? ? ? ? ? ? ? 2.641 ? 
metalc250  metalc ? ? GF NA  .    NA    ? ? ? 1_555 A  U   146  O4    ? ? 0 NA  8524 0 U   146  1_555 ? ? ? ? ? ? ? 2.862 ? 
metalc251  metalc ? ? GF NA  .    NA    ? ? ? 1_555 A  C   130  O2    ? ? 0 NA  8524 0 C   130  1_555 ? ? ? ? ? ? ? 3.106 ? 
metalc252  metalc ? ? HF NA  .    NA    ? ? ? 1_555 A  U   777  OP2   ? ? 0 NA  8525 0 U   777  1_555 ? ? ? ? ? ? ? 2.959 ? 
metalc253  metalc ? ? HF NA  .    NA    ? ? ? 1_555 A  A   776  "O2'" ? ? 0 NA  8525 0 A   776  1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc254  metalc ? ? HF NA  .    NA    ? ? ? 1_555 A  U   779  O4    ? ? 0 NA  8525 0 U   779  1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc255  metalc ? ? HF NA  .    NA    ? ? ? 1_555 A  A   776  "O3'" ? ? 0 NA  8525 0 A   776  1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc256  metalc ? ? IF NA  .    NA    ? ? ? 1_555 A  G   1971 O6    ? ? 0 NA  8526 0 G   1971 1_555 ? ? ? ? ? ? ? 3.088 ? 
metalc257  metalc ? ? IF NA  .    NA    ? ? ? 1_555 A  U   2012 O4    ? ? 0 NA  8526 0 U   2012 1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc258  metalc ? ? IF NA  .    NA    ? ? ? 1_555 A  A   2010 OP2   ? ? 0 NA  8526 0 A   2010 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc259  metalc ? ? JF NA  .    NA    ? ? ? 1_555 A  C   853  "O3'" ? ? 0 NA  8527 0 C   853  1_555 ? ? ? ? ? ? ? 2.858 ? 
metalc260  metalc ? ? JF NA  .    NA    ? ? ? 1_555 A  G   854  OP1   ? ? 0 NA  8527 0 G   854  1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc261  metalc ? ? JF NA  .    NA    ? ? ? 1_555 A  U   1831 "O2'" ? ? 0 NA  8527 0 U   1831 1_555 ? ? ? ? ? ? ? 2.987 ? 
metalc262  metalc ? ? JF NA  .    NA    ? ? ? 1_555 A  U   1831 "O3'" ? ? 0 NA  8527 0 U   1831 1_555 ? ? ? ? ? ? ? 3.113 ? 
metalc263  metalc ? ? JF NA  .    NA    ? ? ? 1_555 A  U   821  OP2   ? ? 0 NA  8527 0 U   821  1_555 ? ? ? ? ? ? ? 3.005 ? 
metalc264  metalc ? ? KF NA  .    NA    ? ? ? 1_555 A  G   56   O6    ? ? 0 NA  8528 0 G   56   1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc265  metalc ? ? KF NA  .    NA    ? ? ? 1_555 A  A   59   N3    ? ? 0 NA  8528 0 A   59   1_555 ? ? ? ? ? ? ? 2.965 ? 
metalc266  metalc ? ? KF NA  .    NA    ? ? ? 1_555 A  G   61   N7    ? ? 0 NA  8528 0 G   61   1_555 ? ? ? ? ? ? ? 2.733 ? 
metalc267  metalc ? ? LF NA  .    NA    ? ? ? 1_555 A  G   66   OP1   ? ? 0 NA  8529 0 G   66   1_555 ? ? ? ? ? ? ? 2.924 ? 
metalc268  metalc ? ? LF NA  .    NA    ? ? ? 1_555 A  G   66   OP2   ? ? 0 NA  8529 0 G   66   1_555 ? ? ? ? ? ? ? 3.051 ? 
metalc269  metalc ? ? LF NA  .    NA    ? ? ? 1_555 A  U   107  O4    ? ? 0 NA  8529 0 U   107  1_555 ? ? ? ? ? ? ? 2.888 ? 
metalc270  metalc ? ? LF NA  .    NA    ? ? ? 1_555 A  U   108  O2    ? ? 0 NA  8529 0 U   108  1_555 ? ? ? ? ? ? ? 2.865 ? 
metalc271  metalc ? ? MF NA  .    NA    ? ? ? 1_555 A  C   141  "O4'" ? ? 0 NA  8530 0 C   141  1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc272  metalc ? ? MF NA  .    NA    ? ? ? 1_555 A  G   142  O6    ? ? 0 NA  8530 0 G   142  1_555 ? ? ? ? ? ? ? 3.029 ? 
metalc273  metalc ? ? MF NA  .    NA    ? ? ? 1_555 A  C   141  O2    ? ? 0 NA  8530 0 C   141  1_555 ? ? ? ? ? ? ? 2.954 ? 
metalc274  metalc ? ? MF NA  .    NA    ? ? ? 1_555 A  G   142  N7    ? ? 0 NA  8530 0 G   142  1_555 ? ? ? ? ? ? ? 2.905 ? 
metalc275  metalc ? ? NF NA  .    NA    ? ? ? 1_555 A  G   221  O6    ? ? 0 NA  8531 0 G   221  1_555 ? ? ? ? ? ? ? 3.000 ? 
metalc276  metalc ? ? NF NA  .    NA    ? ? ? 1_555 A  C   218  "O3'" ? ? 0 NA  8531 0 C   218  1_555 ? ? ? ? ? ? ? 3.097 ? 
metalc277  metalc ? ? NF NA  .    NA    ? ? ? 1_555 A  U   170  O2    ? ? 0 NA  8531 0 U   170  1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc278  metalc ? ? NF NA  .    NA    ? ? ? 1_555 A  C   218  "O2'" ? ? 0 NA  8531 0 C   218  1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc279  metalc ? ? OF NA  .    NA    ? ? ? 1_555 A  G   386  O6    ? ? 0 NA  8532 0 G   386  1_555 ? ? ? ? ? ? ? 2.942 ? 
metalc280  metalc ? ? OF NA  .    NA    ? ? ? 1_555 A  G   387  O6    ? ? 0 NA  8532 0 G   387  1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc281  metalc ? ? OF NA  .    NA    ? ? ? 1_555 A  G   388  O6    ? ? 0 NA  8532 0 G   388  1_555 ? ? ? ? ? ? ? 3.105 ? 
metalc282  metalc ? ? OF NA  .    NA    ? ? ? 1_555 A  U   402  O4    ? ? 0 NA  8532 0 U   402  1_555 ? ? ? ? ? ? ? 2.742 ? 
metalc283  metalc ? ? PF NA  .    NA    ? ? ? 1_555 A  C   1894 O2    ? ? 0 NA  8533 0 C   1894 1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc284  metalc ? ? PF NA  .    NA    ? ? ? 1_555 A  G   1898 O6    ? ? 0 NA  8533 0 G   1898 1_555 ? ? ? ? ? ? ? 2.849 ? 
metalc285  metalc ? ? PF NA  .    NA    ? ? ? 1_555 A  U   1939 O4    ? ? 0 NA  8533 0 U   1939 1_555 ? ? ? ? ? ? ? 3.057 ? 
metalc286  metalc ? ? PF NA  .    NA    ? ? ? 1_555 A  U   1897 O4    ? ? 0 NA  8533 0 U   1897 1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc287  metalc ? ? QF NA  .    NA    ? ? ? 1_555 A  G   1896 N7    ? ? 0 NA  8534 0 G   1896 1_555 ? ? ? ? ? ? ? 2.719 ? 
metalc288  metalc ? ? QF NA  .    NA    ? ? ? 1_555 A  G   1896 O6    ? ? 0 NA  8534 0 G   1896 1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc289  metalc ? ? QF NA  .    NA    ? ? ? 1_555 A  C   1894 O2    ? ? 0 NA  8534 0 C   1894 1_555 ? ? ? ? ? ? ? 2.856 ? 
metalc290  metalc ? ? QF NA  .    NA    ? ? ? 1_555 A  C   1894 "O4'" ? ? 0 NA  8534 0 C   1894 1_555 ? ? ? ? ? ? ? 3.053 ? 
metalc291  metalc ? ? QF NA  .    NA    ? ? ? 1_555 A  U   1897 O4    ? ? 0 NA  8534 0 U   1897 1_555 ? ? ? ? ? ? ? 3.076 ? 
metalc292  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  U   623  O4    ? ? 0 NA  8535 0 U   623  1_555 ? ? ? ? ? ? ? 2.787 ? 
metalc293  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  G   622  O6    ? ? 0 NA  8535 0 G   622  1_555 ? ? ? ? ? ? ? 2.875 ? 
metalc294  metalc ? ? SF NA  .    NA    ? ? ? 1_555 A  G   1706 O6    ? ? 0 NA  8536 0 G   1706 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc295  metalc ? ? SF NA  .    NA    ? ? ? 1_555 A  G   1707 O6    ? ? 0 NA  8536 0 G   1707 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc296  metalc ? ? TF NA  .    NA    ? ? ? 1_555 X  VAL 73   O     ? ? 0 NA  8538 R VAL 72   1_555 ? ? ? ? ? ? ? 2.464 ? 
metalc297  metalc ? ? TF NA  .    NA    ? ? ? 1_555 X  TRP 76   O     ? ? 0 NA  8538 R TRP 75   1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc298  metalc ? ? TF NA  .    NA    ? ? ? 1_555 A  U   2659 "O3'" ? ? 0 NA  8538 0 U   2659 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc299  metalc ? ? TF NA  .    NA    ? ? ? 1_555 A  G   2660 OP1   ? ? 0 NA  8538 0 G   2660 1_555 ? ? ? ? ? ? ? 2.628 ? 
metalc300  metalc ? ? UF NA  .    NA    ? ? ? 1_555 A  U   2645 O2    ? ? 0 NA  8539 0 U   2645 1_555 ? ? ? ? ? ? ? 3.089 ? 
metalc301  metalc ? ? UF NA  .    NA    ? ? ? 1_555 A  G   2540 O6    ? ? 0 NA  8539 0 G   2540 1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc302  metalc ? ? UF NA  .    NA    ? ? ? 1_555 A  U   2645 "O2'" ? ? 0 NA  8539 0 U   2645 1_555 ? ? ? ? ? ? ? 2.935 ? 
metalc303  metalc ? ? VF NA  .    NA    ? ? ? 1_555 A  G   2033 "O2'" ? ? 0 NA  8540 0 G   2033 1_555 ? ? ? ? ? ? ? 3.011 ? 
metalc304  metalc ? ? VF NA  .    NA    ? ? ? 1_555 A  U   1740 O4    ? ? 0 NA  8540 0 U   1740 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc305  metalc ? ? VF NA  .    NA    ? ? ? 1_555 A  U   1741 O4    ? ? 0 NA  8540 0 U   1741 1_555 ? ? ? ? ? ? ? 3.041 ? 
metalc306  metalc ? ? WF NA  .    NA    ? ? ? 1_555 A  G   683  O6    ? ? 0 NA  8541 0 G   683  1_555 ? ? ? ? ? ? ? 2.733 ? 
metalc307  metalc ? ? WF NA  .    NA    ? ? ? 1_555 A  G   683  N7    ? ? 0 NA  8541 0 G   683  1_555 ? ? ? ? ? ? ? 2.627 ? 
metalc308  metalc ? ? WF NA  .    NA    ? ? ? 1_555 A  G   681  "O3'" ? ? 0 NA  8541 0 G   681  1_555 ? ? ? ? ? ? ? 2.882 ? 
metalc309  metalc ? ? XF NA  .    NA    ? ? ? 1_555 A  G   892  N7    ? ? 0 NA  8542 0 G   892  1_555 ? ? ? ? ? ? ? 2.826 ? 
metalc310  metalc ? ? YF NA  .    NA    ? ? ? 1_555 Z  SER 95   OG    ? ? 0 NA  8543 T SER 94   1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc311  metalc ? ? YF NA  .    NA    ? ? ? 1_555 A  U   335  "O2'" ? ? 0 NA  8543 0 U   335  1_555 ? ? ? ? ? ? ? 2.991 ? 
metalc312  metalc ? ? YF NA  .    NA    ? ? ? 1_555 A  C   342  O2    ? ? 0 NA  8543 0 C   342  1_555 ? ? ? ? ? ? ? 2.993 ? 
metalc313  metalc ? ? YF NA  .    NA    ? ? ? 1_555 A  U   308  O4    ? ? 0 NA  8543 0 U   308  1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc314  metalc ? ? YF NA  .    NA    ? ? ? 1_555 Z  ASN 96   OD1   ? ? 0 NA  8543 T ASN 95   1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc315  metalc ? ? YF NA  .    NA    ? ? ? 1_555 A  U   335  O2    ? ? 0 NA  8543 0 U   335  1_555 ? ? ? ? ? ? ? 3.109 ? 
metalc316  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 A  G   2817 OP2   ? ? 0 NA  8544 0 G   2817 1_555 ? ? ? ? ? ? ? 2.938 ? 
metalc317  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 A  A   2816 "O2'" ? ? 0 NA  8544 0 A   2816 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc318  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 A  A   2811 "O3'" ? ? 0 NA  8544 0 A   2811 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc319  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 A  A   2812 OP2   ? ? 0 NA  8544 0 A   2812 1_555 ? ? ? ? ? ? ? 3.009 ? 
metalc320  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 A  A   2811 "O2'" ? ? 0 NA  8544 0 A   2811 1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc321  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 A  U   2663 O2    ? ? 0 NA  8544 0 U   2663 1_555 ? ? ? ? ? ? ? 2.658 ? 
metalc322  metalc ? ? AG NA  .    NA    ? ? ? 1_555 A  A   914  "O3'" ? ? 0 NA  8549 0 A   914  1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc323  metalc ? ? AG NA  .    NA    ? ? ? 1_555 A  C   915  OP2   ? ? 0 NA  8549 0 C   915  1_555 ? ? ? ? ? ? ? 2.766 ? 
metalc324  metalc ? ? AG NA  .    NA    ? ? ? 1_555 A  G   1045 OP2   ? ? 0 NA  8549 0 G   1045 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc325  metalc ? ? AG NA  .    NA    ? ? ? 1_555 A  A   914  "O2'" ? ? 0 NA  8549 0 A   914  1_555 ? ? ? ? ? ? ? 2.982 ? 
metalc326  metalc ? ? BG NA  .    NA    ? ? ? 1_555 A  G   901  OP1   ? ? 0 NA  8550 0 G   901  1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc327  metalc ? ? BG NA  .    NA    ? ? ? 1_555 A  U   623  "O2'" ? ? 0 NA  8550 0 U   623  1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc328  metalc ? ? BG NA  .    NA    ? ? ? 1_555 A  U   623  O2    ? ? 0 NA  8550 0 U   623  1_555 ? ? ? ? ? ? ? 3.147 ? 
metalc329  metalc ? ? CG NA  .    NA    ? ? ? 1_555 A  A   955  "O2'" ? ? 0 NA  8552 0 A   955  1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc330  metalc ? ? CG NA  .    NA    ? ? ? 1_555 A  A   955  "O3'" ? ? 0 NA  8552 0 A   955  1_555 ? ? ? ? ? ? ? 2.925 ? 
metalc331  metalc ? ? DG NA  .    NA    ? ? ? 1_555 A  G   1295 "O3'" ? ? 0 NA  8553 0 G   1295 1_555 ? ? ? ? ? ? ? 3.158 ? 
metalc332  metalc ? ? DG NA  .    NA    ? ? ? 1_555 A  A   1296 OP1   ? ? 0 NA  8553 0 A   1296 1_555 ? ? ? ? ? ? ? 2.693 ? 
metalc333  metalc ? ? DG NA  .    NA    ? ? ? 1_555 A  A   1040 "O2'" ? ? 0 NA  8553 0 A   1040 1_555 ? ? ? ? ? ? ? 2.932 ? 
metalc334  metalc ? ? DG NA  .    NA    ? ? ? 1_555 A  A   1040 "O3'" ? ? 0 NA  8553 0 A   1040 1_555 ? ? ? ? ? ? ? 3.195 ? 
metalc335  metalc ? ? DG NA  .    NA    ? ? ? 1_555 R  GLY 15   O     ? ? 0 NA  8553 L GLY 14   1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc336  metalc ? ? EG NA  .    NA    ? ? ? 1_555 A  U   768  "O2'" ? ? 0 NA  8554 0 U   768  1_555 ? ? ? ? ? ? ? 3.053 ? 
metalc337  metalc ? ? EG NA  .    NA    ? ? ? 1_555 A  A   2112 OP1   ? ? 0 NA  8554 0 A   2112 1_555 ? ? ? ? ? ? ? 3.194 ? 
metalc338  metalc ? ? EG NA  .    NA    ? ? ? 1_555 A  C   769  "O4'" ? ? 0 NA  8554 0 C   769  1_555 ? ? ? ? ? ? ? 3.081 ? 
metalc339  metalc ? ? FG NA  .    NA    ? ? ? 1_555 A  G   1119 O6    ? ? 0 NA  8555 0 G   1119 1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc340  metalc ? ? FG NA  .    NA    ? ? ? 1_555 A  C   1243 OP2   ? ? 0 NA  8555 0 C   1243 1_555 ? ? ? ? ? ? ? 3.154 ? 
metalc341  metalc ? ? GG NA  .    NA    ? ? ? 1_555 A  C   920  N3    ? ? 0 NA  8556 0 C   920  1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc342  metalc ? ? GG NA  .    NA    ? ? ? 1_555 A  C   920  O2    ? ? 0 NA  8556 0 C   920  1_555 ? ? ? ? ? ? ? 3.046 ? 
metalc343  metalc ? ? GG NA  .    NA    ? ? ? 1_555 A  U   2278 OP1   ? ? 0 NA  8556 0 U   2278 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc344  metalc ? ? HG NA  .    NA    ? ? ? 1_555 A  G   1024 O6    ? ? 0 NA  8557 0 G   1024 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc345  metalc ? ? HG NA  .    NA    ? ? ? 1_555 A  G   941  O6    ? ? 0 NA  8557 0 G   941  1_555 ? ? ? ? ? ? ? 2.921 ? 
metalc346  metalc ? ? HG NA  .    NA    ? ? ? 1_555 A  U   942  O4    ? ? 0 NA  8557 0 U   942  1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc347  metalc ? ? IG NA  .    NA    ? ? ? 1_555 A  A   923  "O2'" ? ? 0 NA  8558 0 A   923  1_555 ? ? ? ? ? ? ? 2.849 ? 
metalc348  metalc ? ? IG NA  .    NA    ? ? ? 1_555 A  A   922  OP1   ? ? 0 NA  8558 0 A   922  1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc349  metalc ? ? IG NA  .    NA    ? ? ? 1_555 A  G   924  "O4'" ? ? 0 NA  8558 0 G   924  1_555 ? ? ? ? ? ? ? 3.127 ? 
metalc350  metalc ? ? IG NA  .    NA    ? ? ? 1_555 A  U   2109 OP2   ? ? 0 NA  8558 0 U   2109 1_555 ? ? ? ? ? ? ? 2.867 ? 
metalc351  metalc ? ? JG NA  .    NA    ? ? ? 1_555 A  A   453  "O2'" ? ? 0 NA  8559 0 A   453  1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc352  metalc ? ? JG NA  .    NA    ? ? ? 1_555 A  A   453  "O3'" ? ? 0 NA  8559 0 A   453  1_555 ? ? ? ? ? ? ? 2.965 ? 
metalc353  metalc ? ? JG NA  .    NA    ? ? ? 1_555 A  U   454  OP2   ? ? 0 NA  8559 0 U   454  1_555 ? ? ? ? ? ? ? 3.005 ? 
metalc354  metalc ? ? JG NA  .    NA    ? ? ? 1_555 A  G   479  OP2   ? ? 0 NA  8559 0 G   479  1_555 ? ? ? ? ? ? ? 2.977 ? 
metalc355  metalc ? ? KG NA  .    NA    ? ? ? 1_555 A  U   837  OP1   ? ? 0 NA  8560 0 U   837  1_555 ? ? ? ? ? ? ? 2.691 ? 
metalc356  metalc ? ? KG NA  .    NA    ? ? ? 1_555 A  U   837  OP2   ? ? 0 NA  8560 0 U   837  1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc357  metalc ? ? KG NA  .    NA    ? ? ? 1_555 H  GLN 231  O     ? ? 0 NA  8560 B GLN 230  1_555 ? ? ? ? ? ? ? 2.917 ? 
metalc358  metalc ? ? LG NA  .    NA    ? ? ? 1_555 A  U   2277 OP1   ? ? 0 NA  8561 0 U   2277 1_555 ? ? ? ? ? ? ? 2.612 ? 
metalc359  metalc ? ? LG NA  .    NA    ? ? ? 1_555 A  G   2110 OP2   ? ? 0 NA  8561 0 G   2110 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc360  metalc ? ? LG NA  .    NA    ? ? ? 1_555 A  G   2111 OP1   ? ? 0 NA  8561 0 G   2111 1_555 ? ? ? ? ? ? ? 3.112 ? 
metalc361  metalc ? ? MG NA  .    NA    ? ? ? 1_555 A  C   1360 OP1   ? ? 0 NA  8562 0 C   1360 1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc362  metalc ? ? NG NA  .    NA    ? ? ? 1_555 A  G   2058 O6    ? ? 0 NA  8563 0 G   2058 1_555 ? ? ? ? ? ? ? 2.884 ? 
metalc363  metalc ? ? NG NA  .    NA    ? ? ? 1_555 A  U   2057 O4    ? ? 0 NA  8563 0 U   2057 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc364  metalc ? ? OG NA  .    NA    ? ? ? 1_555 A  U   391  O2    ? ? 0 NA  8564 0 U   391  1_555 ? ? ? ? ? ? ? 3.083 ? 
metalc365  metalc ? ? OG NA  .    NA    ? ? ? 1_555 A  C   399  O2    ? ? 0 NA  8564 0 C   399  1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc366  metalc ? ? OG NA  .    NA    ? ? ? 1_555 A  U   392  "O4'" ? ? 0 NA  8564 0 U   392  1_555 ? ? ? ? ? ? ? 3.163 ? 
metalc367  metalc ? ? OG NA  .    NA    ? ? ? 1_555 A  U   391  "O2'" ? ? 0 NA  8564 0 U   391  1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc368  metalc ? ? OG NA  .    NA    ? ? ? 1_555 A  U   398  O2    ? ? 0 NA  8564 0 U   398  1_555 ? ? ? ? ? ? ? 3.071 ? 
metalc369  metalc ? ? OG NA  .    NA    ? ? ? 1_555 S  LYS 194  O     ? ? 0 NA  8564 M LYS 193  1_555 ? ? ? ? ? ? ? 2.927 ? 
metalc370  metalc ? ? PG NA  .    NA    ? ? ? 1_555 A  G   544  O6    ? ? 0 NA  8565 0 G   544  1_555 ? ? ? ? ? ? ? 3.172 ? 
metalc371  metalc ? ? PG NA  .    NA    ? ? ? 1_555 A  G   545  O6    ? ? 0 NA  8565 0 G   545  1_555 ? ? ? ? ? ? ? 2.574 ? 
metalc372  metalc ? ? PG NA  .    NA    ? ? ? 1_555 A  U   611  O4    ? ? 0 NA  8565 0 U   611  1_555 ? ? ? ? ? ? ? 3.048 ? 
metalc373  metalc ? ? QG NA  .    NA    ? ? ? 1_555 A  G   475  OP2   ? ? 0 NA  8566 0 G   475  1_555 ? ? ? ? ? ? ? 3.133 ? 
metalc374  metalc ? ? QG NA  .    NA    ? ? ? 1_555 I  ARG 55   O     ? ? 0 NA  8566 C ARG 55   1_555 ? ? ? ? ? ? ? 2.805 ? 
metalc375  metalc ? ? QG NA  .    NA    ? ? ? 1_555 A  G   464  O6    ? ? 0 NA  8566 0 G   464  1_555 ? ? ? ? ? ? ? 2.725 ? 
metalc376  metalc ? ? RG NA  .    NA    ? ? ? 1_555 A  U   815  O4    ? ? 0 NA  8567 0 U   815  1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc377  metalc ? ? RG NA  .    NA    ? ? ? 1_555 A  G   798  O6    ? ? 0 NA  8567 0 G   798  1_555 ? ? ? ? ? ? ? 2.957 ? 
metalc378  metalc ? ? RG NA  .    NA    ? ? ? 1_555 A  G   814  O6    ? ? 0 NA  8567 0 G   814  1_555 ? ? ? ? ? ? ? 2.764 ? 
metalc379  metalc ? ? SG NA  .    NA    ? ? ? 1_555 A  A   395  OP1   ? ? 0 NA  8568 0 A   395  1_555 ? ? ? ? ? ? ? 3.171 ? 
metalc380  metalc ? ? SG NA  .    NA    ? ? ? 1_555 A  U   391  O4    ? ? 0 NA  8568 0 U   391  1_555 ? ? ? ? ? ? ? 3.156 ? 
metalc381  metalc ? ? SG NA  .    NA    ? ? ? 1_555 A  U   392  O4    ? ? 0 NA  8568 0 U   392  1_555 ? ? ? ? ? ? ? 2.885 ? 
metalc382  metalc ? ? TG NA  .    NA    ? ? ? 1_555 A  G   1832 OP2   ? ? 0 NA  8569 0 G   1832 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc383  metalc ? ? UG NA  .    NA    ? ? ? 1_555 A  G   2529 O6    ? ? 0 NA  8570 0 G   2529 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc384  metalc ? ? UG NA  .    NA    ? ? ? 1_555 A  U   2492 O4    ? ? 0 NA  8570 0 U   2492 1_555 ? ? ? ? ? ? ? 3.138 ? 
metalc385  metalc ? ? VG NA  .    NA    ? ? ? 1_555 A  G   921  "O2'" ? ? 0 NA  8571 0 G   921  1_555 ? ? ? ? ? ? ? 3.184 ? 
metalc386  metalc ? ? VG NA  .    NA    ? ? ? 1_555 A  U   919  O4    ? ? 0 NA  8571 0 U   919  1_555 ? ? ? ? ? ? ? 3.116 ? 
metalc387  metalc ? ? VG NA  .    NA    ? ? ? 1_555 A  G   924  O6    ? ? 0 NA  8571 0 G   924  1_555 ? ? ? ? ? ? ? 2.835 ? 
metalc388  metalc ? ? WG NA  .    NA    ? ? ? 1_555 A  G   1619 O6    ? ? 0 NA  8572 0 G   1619 1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc389  metalc ? ? WG NA  .    NA    ? ? ? 1_555 A  G   1618 O6    ? ? 0 NA  8572 0 G   1618 1_555 ? ? ? ? ? ? ? 2.642 ? 
metalc390  metalc ? ? WG NA  .    NA    ? ? ? 1_555 A  G   1576 O6    ? ? 0 NA  8572 0 G   1576 1_555 ? ? ? ? ? ? ? 3.019 ? 
metalc391  metalc ? ? XG NA  .    NA    ? ? ? 1_555 A  G   416  "O4'" ? ? 0 NA  8573 0 G   416  1_555 ? ? ? ? ? ? ? 2.998 ? 
metalc392  metalc ? ? XG NA  .    NA    ? ? ? 1_555 A  A   415  "O2'" ? ? 0 NA  8573 0 A   415  1_555 ? ? ? ? ? ? ? 3.005 ? 
metalc393  metalc ? ? XG NA  .    NA    ? ? ? 1_555 A  G   196  O6    ? ? 0 NA  8573 0 G   196  1_555 ? ? ? ? ? ? ? 3.054 ? 
metalc394  metalc ? ? XG NA  .    NA    ? ? ? 1_555 A  G   196  N7    ? ? 0 NA  8573 0 G   196  1_555 ? ? ? ? ? ? ? 2.924 ? 
metalc395  metalc ? ? YG NA  .    NA    ? ? ? 1_555 A  A   886  "O2'" ? ? 0 NA  8574 0 A   886  1_555 ? ? ? ? ? ? ? 3.155 ? 
metalc396  metalc ? ? YG NA  .    NA    ? ? ? 1_555 A  G   868  "O3'" ? ? 0 NA  8574 0 G   868  1_555 ? ? ? ? ? ? ? 3.057 ? 
metalc397  metalc ? ? YG NA  .    NA    ? ? ? 1_555 A  G   868  "O2'" ? ? 0 NA  8574 0 G   868  1_555 ? ? ? ? ? ? ? 3.023 ? 
metalc398  metalc ? ? YG NA  .    NA    ? ? ? 1_555 A  G   887  OP2   ? ? 0 NA  8574 0 G   887  1_555 ? ? ? ? ? ? ? 2.955 ? 
metalc399  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 A  A   2538 OP1   ? ? 0 NA  8575 0 A   2538 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc400  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 A  A   2538 "O5'" ? ? 0 NA  8575 0 A   2538 1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc401  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 A  A   632  "O3'" ? ? 0 NA  8575 0 A   632  1_555 ? ? ? ? ? ? ? 3.171 ? 
metalc402  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 A  C   633  OP1   ? ? 0 NA  8575 0 C   633  1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc403  metalc ? ? AH NA  .    NA    ? ? ? 1_555 A  G   1295 O6    ? ? 0 NA  8576 0 G   1295 1_555 ? ? ? ? ? ? ? 2.978 ? 
metalc404  metalc ? ? AH NA  .    NA    ? ? ? 1_555 A  U   1293 OP2   ? ? 0 NA  8576 0 U   1293 1_555 ? ? ? ? ? ? ? 2.497 ? 
metalc405  metalc ? ? BH NA  .    NA    ? ? ? 1_555 A  U   903  O4    ? ? 0 NA  8577 0 U   903  1_555 ? ? ? ? ? ? ? 3.011 ? 
metalc406  metalc ? ? BH NA  .    NA    ? ? ? 1_555 A  C   762  N4    ? ? 0 NA  8577 0 C   762  1_555 ? ? ? ? ? ? ? 3.023 ? 
metalc407  metalc ? ? BH NA  .    NA    ? ? ? 1_555 A  G   902  O6    ? ? 0 NA  8577 0 G   902  1_555 ? ? ? ? ? ? ? 2.837 ? 
metalc408  metalc ? ? BH NA  .    NA    ? ? ? 1_555 R  HIS 19   O     ? ? 0 NA  8577 L HIS 18   1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc409  metalc ? ? DH NA  .    NA    ? ? ? 1_555 A  G   2592 O6    ? ? 0 NA  8580 0 G   2592 1_555 ? ? ? ? ? ? ? 2.570 ? 
metalc410  metalc ? ? DH NA  .    NA    ? ? ? 1_555 A  U   2586 O4    ? ? 0 NA  8580 0 U   2586 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc411  metalc ? ? EH NA  .    NA    ? ? ? 1_555 A  G   2773 O6    ? ? 0 NA  8581 0 G   2773 1_555 ? ? ? ? ? ? ? 2.599 ? 
metalc412  metalc ? ? EH NA  .    NA    ? ? ? 1_555 A  G   2772 O6    ? ? 0 NA  8581 0 G   2772 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc413  metalc ? ? FH NA  .    NA    ? ? ? 1_555 A  C   197  N3    ? ? 0 NA  8583 0 C   197  1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc414  metalc ? ? GH NA  .    NA    ? ? ? 1_555 A  A   1079 OP1   ? ? 0 NA  8584 0 A   1079 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc415  metalc ? ? GH NA  .    NA    ? ? ? 1_555 A  G   1077 O6    ? ? 0 NA  8584 0 G   1077 1_555 ? ? ? ? ? ? ? 3.137 ? 
metalc416  metalc ? ? GH NA  .    NA    ? ? ? 1_555 A  G   1077 N7    ? ? 0 NA  8584 0 G   1077 1_555 ? ? ? ? ? ? ? 2.759 ? 
metalc417  metalc ? ? SH CD  .    CD    ? ? ? 1_555 B  CYS 35   SG    ? ? 1 CD  8702 1 CYS 34   1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc418  metalc ? ? SH CD  .    CD    ? ? ? 1_555 B  CYS 20   SG    ? ? 1 CD  8702 1 CYS 19   1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc419  metalc ? ? SH CD  .    CD    ? ? ? 1_555 B  CYS 38   SG    ? ? 1 CD  8702 1 CYS 37   1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc420  metalc ? ? SH CD  .    CD    ? ? ? 1_555 B  CYS 23   SG    ? ? 1 CD  8702 1 CYS 22   1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc421  metalc ? ? UH MG  .    MG    ? ? ? 1_555 D  ASP 49   OD2   ? ? 3 MG  8078 3 ASP 49   1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc422  metalc ? ? UH MG  .    MG    ? ? ? 1_555 D  ASP 49   OD1   ? ? 3 MG  8078 3 ASP 49   1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc423  metalc ? ? UH MG  .    MG    ? ? ? 1_555 D  GLY 47   O     ? ? 3 MG  8078 3 GLY 47   1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc424  metalc ? ? UH MG  .    MG    ? ? ? 1_555 D  GLY 45   O     ? ? 3 MG  8078 3 GLY 45   1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc425  metalc ? ? VH CD  .    CD    ? ? ? 1_555 D  CYS 71   SG    ? ? 3 CD  8704 3 CYS 71   1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc426  metalc ? ? VH CD  .    CD    ? ? ? 1_555 D  CYS 74   SG    ? ? 3 CD  8704 3 CYS 74   1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc427  metalc ? ? VH CD  .    CD    ? ? ? 1_555 D  CYS 11   SG    ? ? 3 CD  8704 3 CYS 11   1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc428  metalc ? ? VH CD  .    CD    ? ? ? 1_555 D  CYS 14   SG    ? ? 3 CD  8704 3 CYS 14   1_555 ? ? ? ? ? ? ? 2.465 ? 
metalc429  metalc ? ? E  MHW 1    OG1   ? ? ? 1_555 KE MG  .    MG    ? ? 8 MHW 1    0 MG  8118 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc430  metalc ? ? E  MHW 1    O     ? ? ? 1_555 KE MG  .    MG    ? ? 8 MHW 1    0 MG  8118 1_555 ? ? ? ? ? ? ? 2.070 ? 
covale10   covale ? ? E  MHW 1    C     ? ? ? 1_555 E  THR 2    N     ? ? 8 MHW 1    8 THR 2    1_555 ? ? ? ? ? ? ? 1.327 ? 
covale11   covale ? ? E  THR 2    C     ? ? ? 1_555 E  DBB 3    N     ? ? 8 THR 2    8 DBB 3    1_555 ? ? ? ? ? ? ? 1.350 ? 
covale12   covale ? ? E  THR 2    OG1   ? ? ? 1_555 E  004 7    C     ? ? 8 THR 2    8 004 7    1_555 ? ? ? ? ? ? ? 1.326 ? 
covale13   covale ? ? E  DBB 3    C     ? ? ? 1_555 E  PRO 4    N     ? ? 8 DBB 3    8 PRO 4    1_555 ? ? ? ? ? ? ? 1.394 ? 
covale14   covale ? ? E  PRO 4    C     ? ? ? 1_555 E  MEA 5    N     ? ? 8 PRO 4    8 MEA 5    1_555 ? ? ? ? ? ? ? 1.366 ? 
covale15   covale ? ? E  MEA 5    C     ? ? ? 1_555 E  MHV 6    N     ? ? 8 MEA 5    8 MHV 6    1_555 ? ? ? ? ? ? ? 1.386 ? 
covale16   covale ? ? E  MHV 6    C     ? ? ? 1_555 E  004 7    N     ? ? 8 MHV 6    8 004 7    1_555 ? ? ? ? ? ? ? 1.341 ? 
metalc431  metalc ? ? XH MG  .    MG    ? ? ? 1_555 F  A   57   OP2   ? ? 9 MG  8095 9 A   57   1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc432  metalc ? ? XH MG  .    MG    ? ? ? 1_555 F  A   56   OP2   ? ? 9 MG  8095 9 A   56   1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc433  metalc ? ? YH NA  .    NA    ? ? ? 1_555 F  C   40   O2    ? ? 9 NA  8551 9 C   40   1_555 ? ? ? ? ? ? ? 2.975 ? 
metalc434  metalc ? ? YH NA  .    NA    ? ? ? 1_555 F  C   40   N3    ? ? 9 NA  8551 9 C   40   1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc435  metalc ? ? ZH NA  .    NA    ? ? ? 1_555 F  G   21   O6    ? ? 9 NA  8582 9 G   21   1_555 ? ? ? ? ? ? ? 3.061 ? 
metalc436  metalc ? ? ZH NA  .    NA    ? ? ? 1_555 F  G   22   O6    ? ? 9 NA  8582 9 G   22   1_555 ? ? ? ? ? ? ? 3.125 ? 
metalc437  metalc ? ? BI NA  .    NA    ? ? ? 1_555 G  PHE 202  O     ? ? A NA  8545 A PHE 201  1_555 ? ? ? ? ? ? ? 3.042 ? 
metalc438  metalc ? ? BI NA  .    NA    ? ? ? 1_555 A  A   2633 OP1   ? ? A NA  8545 0 A   2633 1_555 ? ? ? ? ? ? ? 2.826 ? 
metalc439  metalc ? ? BI NA  .    NA    ? ? ? 1_555 G  GLY 204  O     ? ? A NA  8545 A GLY 203  1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc440  metalc ? ? BI NA  .    NA    ? ? ? 1_555 G  HIS 209  O     ? ? A NA  8545 A HIS 208  1_555 ? ? ? ? ? ? ? 2.759 ? 
metalc441  metalc ? ? EI MG  .    MG    ? ? ? 1_555 H  ASN 336  O     ? ? B MG  8056 B ASN 335  1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc442  metalc ? ? EI MG  .    MG    ? ? ? 1_555 A  A   2757 OP1   ? ? B MG  8056 0 A   2757 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc443  metalc ? ? GI NA  .    NA    ? ? ? 1_555 I  THR 94   O     ? ? C NA  8504 C THR 94   1_555 ? ? ? ? ? ? ? 2.841 ? 
metalc444  metalc ? ? GI NA  .    NA    ? ? ? 1_555 I  LYS 96   O     ? ? C NA  8504 C LYS 96   1_555 ? ? ? ? ? ? ? 2.658 ? 
metalc445  metalc ? ? GI NA  .    NA    ? ? ? 1_555 I  ASP 45   OD2   ? ? C NA  8504 C ASP 45   1_555 ? ? ? ? ? ? ? 3.046 ? 
metalc446  metalc ? ? GI NA  .    NA    ? ? ? 1_555 I  ASP 45   OD1   ? ? C NA  8504 C ASP 45   1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc447  metalc ? ? II NA  .    NA    ? ? ? 1_555 P  VAL 61   O     ? ? J NA  8546 J VAL 61   1_555 ? ? ? ? ? ? ? 2.643 ? 
metalc448  metalc ? ? II NA  .    NA    ? ? ? 1_555 P  ILE 63   O     ? ? J NA  8546 J ILE 63   1_555 ? ? ? ? ? ? ? 2.697 ? 
metalc449  metalc ? ? II NA  .    NA    ? ? ? 1_555 P  TYR 69   O     ? ? J NA  8546 J TYR 69   1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc450  metalc ? ? II NA  .    NA    ? ? ? 1_555 P  ARG 60   O     ? ? J NA  8546 J ARG 60   1_555 ? ? ? ? ? ? ? 3.170 ? 
metalc451  metalc ? ? MI MG  .    MG    ? ? ? 1_555 Q  ASN 42   OD1   ? ? K MG  8069 K ASN 42   1_555 ? ? ? ? ? ? ? 2.589 ? 
metalc452  metalc ? ? NI NA  .    NA    ? ? ? 1_555 R  GLY 30   O     ? ? L NA  8579 L GLY 29   1_555 ? ? ? ? ? ? ? 3.095 ? 
metalc453  metalc ? ? NI NA  .    NA    ? ? ? 1_555 R  GLU 40   OE1   ? ? L NA  8579 L GLU 39   1_555 ? ? ? ? ? ? ? 2.796 ? 
metalc454  metalc ? ? NI NA  .    NA    ? ? ? 1_555 R  ALA 34   O     ? ? L NA  8579 L ALA 33   1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc455  metalc ? ? NI NA  .    NA    ? ? ? 1_555 R  GLY 32   O     ? ? L NA  8579 L GLY 31   1_555 ? ? ? ? ? ? ? 3.047 ? 
metalc456  metalc ? ? PI NA  .    NA    ? ? ? 1_555 S  PHE 110  O     ? ? M NA  8547 M PHE 109  1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc457  metalc ? ? PI NA  .    NA    ? ? ? 1_555 S  SER 107  O     ? ? M NA  8547 M SER 106  1_555 ? ? ? ? ? ? ? 2.611 ? 
metalc458  metalc ? ? PI NA  .    NA    ? ? ? 1_555 S  SER 107  OG    ? ? M NA  8547 M SER 106  1_555 ? ? ? ? ? ? ? 2.914 ? 
metalc459  metalc ? ? PI NA  .    NA    ? ? ? 1_555 S  LEU 113  O     ? ? M NA  8547 M LEU 112  1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc460  metalc ? ? SI CD  .    CD    ? ? ? 1_555 U  HIS 41   ND1   ? ? O CD  8705 O HIS 40   1_555 ? ? ? ? ? ? ? 2.631 ? 
metalc461  metalc ? ? UI NA  .    NA    ? ? ? 1_555 W  SER 47   OG    ? ? Q NA  8548 Q SER 46   1_555 ? ? ? ? ? ? ? 2.836 ? 
metalc462  metalc ? ? UI NA  .    NA    ? ? ? 1_555 W  ASP 21   O     ? ? Q NA  8548 Q ASP 20   1_555 ? ? ? ? ? ? ? 2.607 ? 
metalc463  metalc ? ? UI NA  .    NA    ? ? ? 1_555 W  GLY 23   O     ? ? Q NA  8548 Q GLY 22   1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc464  metalc ? ? UI NA  .    NA    ? ? ? 1_555 W  SER 25   OG    ? ? Q NA  8548 Q SER 24   1_555 ? ? ? ? ? ? ? 2.882 ? 
metalc465  metalc ? ? VI NA  .    NA    ? ? ? 1_555 X  SER 71   O     ? ? R NA  8537 R SER 70   1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc466  metalc ? ? VI NA  .    NA    ? ? ? 1_555 X  VAL 73   O     ? ? R NA  8537 R VAL 72   1_555 ? ? ? ? ? ? ? 2.612 ? 
metalc467  metalc ? ? WI NA  .    NA    ? ? ? 1_555 X  ASN 64   OD1   ? ? R NA  8585 R ASN 63   1_555 ? ? ? ? ? ? ? 3.027 ? 
metalc468  metalc ? ? WI NA  .    NA    ? ? ? 1_555 X  LYS 61   O     ? ? R NA  8585 R LYS 60   1_555 ? ? ? ? ? ? ? 3.140 ? 
metalc469  metalc ? ? YI NA  .    NA    ? ? ? 1_555 Y  HIS 8    NE2   ? ? S NA  8512 S HIS 7    1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc470  metalc ? ? YI NA  .    NA    ? ? ? 1_555 Y  GLU 62   OE2   ? ? S NA  8512 S GLU 61   1_555 ? ? ? ? ? ? ? 2.280 ? 
metalc471  metalc ? ? YI NA  .    NA    ? ? ? 1_555 Y  GLU 62   OE1   ? ? S NA  8512 S GLU 61   1_555 ? ? ? ? ? ? ? 3.003 ? 
metalc472  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 Z  GLN 38   OE1   ? ? T MG  8073 T GLN 37   1_555 ? ? ? ? ? ? ? 2.853 ? 
metalc473  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 Z  ASP 118  O     ? ? T MG  8073 T ASP 117  1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc474  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 Z  SER 115  O     ? ? T MG  8073 T SER 114  1_555 ? ? ? ? ? ? ? 2.599 ? 
metalc475  metalc ? ? AJ CD  .    CD    ? ? ? 1_555 AA CYS 36   SG    ? ? U CD  8701 U CYS 36   1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc476  metalc ? ? AJ CD  .    CD    ? ? ? 1_555 AA CYS 6    SG    ? ? U CD  8701 U CYS 6    1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc477  metalc ? ? AJ CD  .    CD    ? ? ? 1_555 AA CYS 32   SG    ? ? U CD  8701 U CYS 32   1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc478  metalc ? ? AJ CD  .    CD    ? ? ? 1_555 AA CYS 9    SG    ? ? U CD  8701 U CYS 9    1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc479  metalc ? ? BJ MG  .    MG    ? ? ? 1_555 EA LYS 137  O     ? ? Y MG  8108 Y LYS 136  1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc480  metalc ? ? BJ MG  .    MG    ? ? ? 1_555 EA HIS 134  O     ? ? Y MG  8108 Y HIS 133  1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc481  metalc ? ? BJ MG  .    MG    ? ? ? 1_555 EA VAL 140  O     ? ? Y MG  8108 Y VAL 139  1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc482  metalc ? ? DJ CD  .    CD    ? ? ? 1_555 FA CYS 30   SG    ? ? Z CD  8703 Z CYS 39   1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc483  metalc ? ? DJ CD  .    CD    ? ? ? 1_555 FA CYS 33   SG    ? ? Z CD  8703 Z CYS 42   1_555 ? ? ? ? ? ? ? 3.021 ? 
metalc484  metalc ? ? DJ CD  .    CD    ? ? ? 1_555 FA CYS 48   SG    ? ? Z CD  8703 Z CYS 57   1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc485  metalc ? ? DJ CD  .    CD    ? ? ? 1_555 FA CYS 51   SG    ? ? Z CD  8703 Z CYS 60   1_555 ? ? ? ? ? ? ? 2.393 ? 
hydrog1    hydrog ? ? A  U   12   O4    ? ? ? 1_555 A  G   531  N2    ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2    hydrog ? ? A  G   13   N1    ? ? ? 1_555 A  C   530  N3    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3    hydrog ? ? A  G   13   N2    ? ? ? 1_555 A  C   530  O2    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4    hydrog ? ? A  G   13   O6    ? ? ? 1_555 A  C   530  N4    ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5    hydrog ? ? A  C   14   N3    ? ? ? 1_555 A  G   529  N1    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6    hydrog ? ? A  C   14   N4    ? ? ? 1_555 A  G   529  O6    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7    hydrog ? ? A  C   14   O2    ? ? ? 1_555 A  G   529  N2    ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8    hydrog ? ? A  C   15   N3    ? ? ? 1_555 A  G   528  N1    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9    hydrog ? ? A  C   15   N4    ? ? ? 1_555 A  G   528  O6    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10   hydrog ? ? A  C   15   O2    ? ? ? 1_555 A  G   528  N2    ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11   hydrog ? ? A  A   16   N1    ? ? ? 1_555 A  U   527  N3    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12   hydrog ? ? A  A   16   N6    ? ? ? 1_555 A  U   527  O4    ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13   hydrog ? ? A  G   17   N1    ? ? ? 1_555 A  U   526  O2    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog14   hydrog ? ? A  G   17   O6    ? ? ? 1_555 A  U   526  N3    ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog15   hydrog ? ? A  C   18   N3    ? ? ? 1_555 A  G   525  N1    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16   hydrog ? ? A  C   18   N4    ? ? ? 1_555 A  G   525  O6    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17   hydrog ? ? A  C   18   O2    ? ? ? 1_555 A  G   525  N2    ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18   hydrog ? ? A  U   19   N3    ? ? ? 1_555 A  A   524  N1    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19   hydrog ? ? A  U   19   O4    ? ? ? 1_555 A  A   524  N6    ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20   hydrog ? ? A  G   20   N1    ? ? ? 1_555 A  C   523  N3    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21   hydrog ? ? A  G   20   N2    ? ? ? 1_555 A  C   523  O2    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22   hydrog ? ? A  G   20   O6    ? ? ? 1_555 A  C   523  N4    ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23   hydrog ? ? A  G   21   N1    ? ? ? 1_555 A  U   522  O2    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog24   hydrog ? ? A  G   21   O6    ? ? ? 1_555 A  U   522  N3    ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog25   hydrog ? ? A  U   22   O2    ? ? ? 1_555 A  A   521  N6    ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog26   hydrog ? ? A  G   23   N2    ? ? ? 1_555 A  A   520  N7    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog27   hydrog ? ? A  G   23   N3    ? ? ? 1_555 A  A   520  N6    ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog28   hydrog ? ? A  G   24   N2    ? ? ? 1_555 A  A   519  N7    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog29   hydrog ? ? A  G   24   N3    ? ? ? 1_555 A  A   519  N6    ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog30   hydrog ? ? A  A   25   N6    ? ? ? 1_555 A  G   518  N3    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog31   hydrog ? ? A  A   25   N7    ? ? ? 1_555 A  G   518  N2    ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog32   hydrog ? ? A  U   26   N3    ? ? ? 1_555 A  U   517  O2    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog33   hydrog ? ? A  U   26   O4    ? ? ? 1_555 A  U   517  N3    ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog34   hydrog ? ? A  U   27   N3    ? ? ? 1_555 A  A   516  N1    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35   hydrog ? ? A  U   27   O4    ? ? ? 1_555 A  A   516  N6    ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36   hydrog ? ? A  G   28   N1    ? ? ? 1_555 A  C   480  N3    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37   hydrog ? ? A  G   28   N2    ? ? ? 1_555 A  C   480  O2    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38   hydrog ? ? A  G   28   O6    ? ? ? 1_555 A  C   480  N4    ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39   hydrog ? ? A  C   29   N3    ? ? ? 1_555 A  G   479  N1    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40   hydrog ? ? A  C   29   N4    ? ? ? 1_555 A  G   479  O6    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41   hydrog ? ? A  C   29   O2    ? ? ? 1_555 A  G   479  N2    ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42   hydrog ? ? A  U   30   N3    ? ? ? 1_555 A  A   453  N7    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog43   hydrog ? ? A  U   30   O2    ? ? ? 1_555 A  A   453  N6    ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog44   hydrog ? ? A  G   32   N1    ? ? ? 1_555 A  C   451  N3    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  C   451  O2    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46   hydrog ? ? A  G   32   O6    ? ? ? 1_555 A  C   451  N4    ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  A   455  N1    ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog48   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  G   456  N3    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog49   hydrog ? ? A  G   32   N3    ? ? ? 1_555 A  G   456  N2    ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog50   hydrog ? ? A  G   33   N1    ? ? ? 1_555 A  C   450  N3    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51   hydrog ? ? A  G   33   N2    ? ? ? 1_555 A  C   450  O2    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52   hydrog ? ? A  G   33   O6    ? ? ? 1_555 A  C   450  N4    ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53   hydrog ? ? A  C   34   N3    ? ? ? 1_555 A  G   448  N1    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54   hydrog ? ? A  C   34   N4    ? ? ? 1_555 A  G   448  O6    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55   hydrog ? ? A  C   34   O2    ? ? ? 1_555 A  G   448  N2    ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56   hydrog ? ? A  U   35   N3    ? ? ? 1_555 A  A   447  N1    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57   hydrog ? ? A  U   35   O4    ? ? ? 1_555 A  A   447  N6    ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58   hydrog ? ? A  C   36   N3    ? ? ? 1_555 A  G   446  N1    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59   hydrog ? ? A  C   36   N4    ? ? ? 1_555 A  G   446  O6    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60   hydrog ? ? A  C   36   O2    ? ? ? 1_555 A  G   446  N2    ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61   hydrog ? ? A  C   36   O2    ? ? ? 1_555 A  A   674  N6    ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog62   hydrog ? ? A  A   37   N1    ? ? ? 1_555 A  U   445  N3    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63   hydrog ? ? A  A   37   N6    ? ? ? 1_555 A  U   445  O4    ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64   hydrog ? ? A  G   38   N1    ? ? ? 1_555 A  C   444  N3    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65   hydrog ? ? A  G   38   N2    ? ? ? 1_555 A  C   444  O2    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66   hydrog ? ? A  G   38   O6    ? ? ? 1_555 A  C   444  N4    ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67   hydrog ? ? A  G   39   N1    ? ? ? 1_555 A  C   443  N3    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68   hydrog ? ? A  G   39   N2    ? ? ? 1_555 A  C   443  O2    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69   hydrog ? ? A  G   39   O6    ? ? ? 1_555 A  C   443  N4    ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70   hydrog ? ? A  C   40   N4    ? ? ? 1_555 A  A   441  N1    ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog71   hydrog ? ? A  C   40   O2    ? ? ? 1_555 A  A   442  N6    ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog72   hydrog ? ? A  G   41   N2    ? ? ? 1_555 A  A   151  N1    ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog73   hydrog ? ? A  G   41   N1    ? ? ? 1_555 A  C   440  N3    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74   hydrog ? ? A  G   41   N2    ? ? ? 1_555 A  C   440  O2    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75   hydrog ? ? A  G   41   O6    ? ? ? 1_555 A  C   440  N4    ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76   hydrog ? ? A  C   42   N3    ? ? ? 1_555 A  G   149  N1    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77   hydrog ? ? A  C   42   N4    ? ? ? 1_555 A  G   149  O6    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78   hydrog ? ? A  C   42   O2    ? ? ? 1_555 A  G   149  N2    ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79   hydrog ? ? A  U   43   N3    ? ? ? 1_555 A  A   148  N1    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80   hydrog ? ? A  U   43   O4    ? ? ? 1_555 A  A   148  N6    ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81   hydrog ? ? A  G   44   N2    ? ? ? 1_555 A  A   45   N1    ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog82   hydrog ? ? A  A   45   N6    ? ? ? 1_555 A  U   115  O4    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog83   hydrog ? ? A  A   45   N7    ? ? ? 1_555 A  U   115  N3    ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog84   hydrog ? ? A  G   47   N2    ? ? ? 1_555 A  A   113  N7    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog85   hydrog ? ? A  G   47   N3    ? ? ? 1_555 A  A   113  N6    ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog86   hydrog ? ? A  A   48   N7    ? ? ? 1_555 A  A   114  N6    ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog87   hydrog ? ? A  A   49   N6    ? ? ? 1_555 A  G   112  N3    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog88   hydrog ? ? A  A   49   N7    ? ? ? 1_555 A  G   112  N2    ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog89   hydrog ? ? A  G   50   N1    ? ? ? 1_555 A  C   111  N3    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  C   111  O2    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91   hydrog ? ? A  G   50   O6    ? ? ? 1_555 A  C   111  N4    ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92   hydrog ? ? A  G   51   N1    ? ? ? 1_555 A  C   110  N3    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93   hydrog ? ? A  G   51   N2    ? ? ? 1_555 A  C   110  O2    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94   hydrog ? ? A  G   51   O6    ? ? ? 1_555 A  C   110  N4    ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95   hydrog ? ? A  G   51   N2    ? ? ? 1_555 A  U   121  O2    ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog96   hydrog ? ? A  A   52   N1    ? ? ? 1_555 A  U   109  N3    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97   hydrog ? ? A  A   52   N6    ? ? ? 1_555 A  U   109  O4    ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98   hydrog ? ? A  C   53   N3    ? ? ? 1_555 A  G   66   N1    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99   hydrog ? ? A  C   53   N4    ? ? ? 1_555 A  G   66   O6    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100  hydrog ? ? A  C   53   O2    ? ? ? 1_555 A  G   66   N2    ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101  hydrog ? ? A  G   54   N1    ? ? ? 1_555 A  C   65   N3    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102  hydrog ? ? A  G   54   N2    ? ? ? 1_555 A  C   65   O2    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103  hydrog ? ? A  G   54   O6    ? ? ? 1_555 A  C   65   N4    ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104  hydrog ? ? A  G   54   N2    ? ? ? 1_555 A  A   69   N3    ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog105  hydrog ? ? A  U   55   N3    ? ? ? 1_555 A  G   64   O6    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog106  hydrog ? ? A  U   55   O2    ? ? ? 1_555 A  G   64   N1    ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog107  hydrog ? ? A  G   56   O6    ? ? ? 1_555 A  C   62   N4    ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog108  hydrog ? ? A  G   56   N1    ? ? ? 1_555 A  G   84   O6    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog109  hydrog ? ? A  G   56   N2    ? ? ? 1_555 A  G   84   N7    ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog110  hydrog ? ? A  C   57   N3    ? ? ? 1_555 A  G   89   N1    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111  hydrog ? ? A  C   57   N4    ? ? ? 1_555 A  G   89   O6    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112  hydrog ? ? A  C   57   O2    ? ? ? 1_555 A  G   89   N2    ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113  hydrog ? ? A  C   58   N3    ? ? ? 1_555 A  G   88   N1    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114  hydrog ? ? A  C   58   N4    ? ? ? 1_555 A  G   88   O6    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115  hydrog ? ? A  C   58   O2    ? ? ? 1_555 A  G   88   N2    ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116  hydrog ? ? A  A   59   N3    ? ? ? 1_555 A  A   60   N6    ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog117  hydrog ? ? A  A   59   N1    ? ? ? 1_555 A  C   85   N4    ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog118  hydrog ? ? A  A   60   N1    ? ? ? 1_555 A  A   86   N6    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog119  hydrog ? ? A  A   60   N6    ? ? ? 1_555 A  A   86   N1    ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog120  hydrog ? ? A  G   61   N1    ? ? ? 1_555 A  C   85   N3    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121  hydrog ? ? A  G   61   N2    ? ? ? 1_555 A  C   85   O2    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122  hydrog ? ? A  G   61   O6    ? ? ? 1_555 A  C   85   N4    ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123  hydrog ? ? A  C   62   N3    ? ? ? 1_555 A  G   84   N1    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124  hydrog ? ? A  C   62   N4    ? ? ? 1_555 A  G   84   O6    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125  hydrog ? ? A  C   62   O2    ? ? ? 1_555 A  G   84   N2    ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126  hydrog ? ? A  U   63   N3    ? ? ? 1_555 A  A   70   N7    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog127  hydrog ? ? A  U   63   O4    ? ? ? 1_555 A  A   70   N6    ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog128  hydrog ? ? A  G   66   N2    ? ? ? 1_555 A  A   67   N1    ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog129  hydrog ? ? A  G   71   N1    ? ? ? 1_555 A  A   106  N1    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog130  hydrog ? ? A  G   71   O6    ? ? ? 1_555 A  A   106  N6    ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog131  hydrog ? ? A  G   71   N1    ? ? ? 1_555 A  U   107  O2    ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog132  hydrog ? ? A  C   72   N3    ? ? ? 1_555 A  G   105  N1    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133  hydrog ? ? A  C   72   N4    ? ? ? 1_555 A  G   105  O6    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134  hydrog ? ? A  C   72   O2    ? ? ? 1_555 A  G   105  N2    ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135  hydrog ? ? A  U   73   N3    ? ? ? 1_555 A  A   104  N1    ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136  hydrog ? ? A  U   73   O4    ? ? ? 1_555 A  A   104  N6    ? ? 0 U   73   0 A   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137  hydrog ? ? A  G   74   N1    ? ? ? 1_555 A  C   103  N3    ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138  hydrog ? ? A  G   74   N2    ? ? ? 1_555 A  C   103  O2    ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139  hydrog ? ? A  G   74   O6    ? ? ? 1_555 A  C   103  N4    ? ? 0 G   74   0 C   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140  hydrog ? ? A  U   75   N3    ? ? ? 1_555 A  A   102  N1    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141  hydrog ? ? A  U   75   O4    ? ? ? 1_555 A  A   102  N6    ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142  hydrog ? ? A  G   76   N1    ? ? ? 1_555 A  C   101  N3    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143  hydrog ? ? A  G   76   N2    ? ? ? 1_555 A  C   101  O2    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144  hydrog ? ? A  G   76   O6    ? ? ? 1_555 A  C   101  N4    ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145  hydrog ? ? A  G   77   N1    ? ? ? 1_555 A  C   100  N3    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146  hydrog ? ? A  G   77   N2    ? ? ? 1_555 A  C   100  O2    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147  hydrog ? ? A  G   77   O6    ? ? ? 1_555 A  C   100  N4    ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148  hydrog ? ? A  G   78   N2    ? ? ? 1_555 A  A   99   N7    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog149  hydrog ? ? A  G   78   N3    ? ? ? 1_555 A  A   99   N6    ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog150  hydrog ? ? A  G   79   N2    ? ? ? 1_555 A  A   98   N7    ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog151  hydrog ? ? A  A   80   N3    ? ? ? 1_555 A  G   94   N2    ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog152  hydrog ? ? A  A   80   N6    ? ? ? 1_555 A  G   97   N3    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog153  hydrog ? ? A  A   80   N7    ? ? ? 1_555 A  G   97   N2    ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog154  hydrog ? ? A  G   81   N1    ? ? ? 1_555 A  C   93   N3    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155  hydrog ? ? A  G   81   N2    ? ? ? 1_555 A  C   93   O2    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156  hydrog ? ? A  G   81   O6    ? ? ? 1_555 A  C   93   N4    ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157  hydrog ? ? A  G   81   N2    ? ? ? 1_555 A  A   98   N3    ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog158  hydrog ? ? A  C   82   N3    ? ? ? 1_555 A  G   92   N1    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159  hydrog ? ? A  C   82   N4    ? ? ? 1_555 A  G   92   O6    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160  hydrog ? ? A  C   82   O2    ? ? ? 1_555 A  G   92   N2    ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161  hydrog ? ? A  C   83   N3    ? ? ? 1_555 A  G   91   N1    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162  hydrog ? ? A  C   83   N4    ? ? ? 1_555 A  G   91   O6    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163  hydrog ? ? A  C   83   O2    ? ? ? 1_555 A  G   91   N2    ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164  hydrog ? ? A  G   116  N1    ? ? ? 1_555 A  C   124  N3    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165  hydrog ? ? A  G   116  N2    ? ? ? 1_555 A  C   124  O2    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166  hydrog ? ? A  G   116  O6    ? ? ? 1_555 A  C   124  N4    ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167  hydrog ? ? A  A   117  N1    ? ? ? 1_555 A  U   123  N3    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168  hydrog ? ? A  A   117  N6    ? ? ? 1_555 A  U   123  O4    ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169  hydrog ? ? A  G   118  N1    ? ? ? 1_555 A  C   122  N3    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170  hydrog ? ? A  G   118  N2    ? ? ? 1_555 A  C   122  O2    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171  hydrog ? ? A  G   118  O6    ? ? ? 1_555 A  C   122  N4    ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172  hydrog ? ? A  U   125  N3    ? ? ? 1_555 A  A   129  N1    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173  hydrog ? ? A  U   125  O4    ? ? ? 1_555 A  A   129  N6    ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174  hydrog ? ? A  C   130  N3    ? ? ? 1_555 A  A   144  N6    ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog175  hydrog ? ? A  C   130  N4    ? ? ? 1_555 A  A   144  N7    ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog176  hydrog ? ? A  A   131  N6    ? ? ? 1_555 A  G   147  N7    ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog177  hydrog ? ? A  A   132  N1    ? ? ? 1_555 A  U   146  N3    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178  hydrog ? ? A  A   132  N6    ? ? ? 1_555 A  U   146  O4    ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179  hydrog ? ? A  U   133  N3    ? ? ? 1_555 A  A   145  N1    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  A   145  N6    ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181  hydrog ? ? A  U   134  O4    ? ? ? 1_555 A  C   141  N4    ? ? 0 U   134  0 C   141  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog182  hydrog ? ? A  U   134  N3    ? ? ? 1_555 A  A   144  N1    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183  hydrog ? ? A  U   134  O4    ? ? ? 1_555 A  A   144  N6    ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184  hydrog ? ? A  G   135  N1    ? ? ? 1_555 A  C   143  N3    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185  hydrog ? ? A  G   135  N2    ? ? ? 1_555 A  C   143  O2    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186  hydrog ? ? A  G   135  O6    ? ? ? 1_555 A  C   143  N4    ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187  hydrog ? ? A  C   136  N3    ? ? ? 1_555 A  G   142  N1    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188  hydrog ? ? A  C   136  N4    ? ? ? 1_555 A  G   142  O6    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189  hydrog ? ? A  C   136  O2    ? ? ? 1_555 A  G   142  N2    ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190  hydrog ? ? A  U   137  O2    ? ? ? 1_555 A  G   140  N1    ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog191  hydrog ? ? A  C   141  O2    ? ? ? 1_555 A  C   143  N4    ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog192  hydrog ? ? A  C   141  N3    ? ? ? 1_555 A  A   144  N6    ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog193  hydrog ? ? A  A   152  N1    ? ? ? 1_555 A  G   185  N1    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog194  hydrog ? ? A  A   152  N6    ? ? ? 1_555 A  G   185  O6    ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog195  hydrog ? ? A  C   153  N3    ? ? ? 1_555 A  G   184  N1    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196  hydrog ? ? A  C   153  N4    ? ? ? 1_555 A  G   184  O6    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197  hydrog ? ? A  C   153  O2    ? ? ? 1_555 A  G   184  N2    ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198  hydrog ? ? A  C   154  N3    ? ? ? 1_555 A  G   182  N1    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199  hydrog ? ? A  C   154  N4    ? ? ? 1_555 A  G   182  O6    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200  hydrog ? ? A  C   154  O2    ? ? ? 1_555 A  G   182  N2    ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201  hydrog ? ? A  C   155  N3    ? ? ? 1_555 A  G   181  N1    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202  hydrog ? ? A  C   155  N4    ? ? ? 1_555 A  G   181  O6    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203  hydrog ? ? A  C   155  O2    ? ? ? 1_555 A  G   181  N2    ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204  hydrog ? ? A  C   156  N3    ? ? ? 1_555 A  G   180  N1    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205  hydrog ? ? A  C   156  N4    ? ? ? 1_555 A  G   180  O6    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206  hydrog ? ? A  C   156  O2    ? ? ? 1_555 A  G   180  N2    ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207  hydrog ? ? A  G   157  N1    ? ? ? 1_555 A  C   179  N3    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208  hydrog ? ? A  G   157  N2    ? ? ? 1_555 A  C   179  O2    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209  hydrog ? ? A  G   157  O6    ? ? ? 1_555 A  C   179  N4    ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210  hydrog ? ? A  G   157  N2    ? ? ? 1_555 A  A   1470 N1    ? ? 0 G   157  0 A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog211  hydrog ? ? A  A   158  N1    ? ? ? 1_555 A  U   178  N3    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212  hydrog ? ? A  A   158  N6    ? ? ? 1_555 A  U   178  O4    ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213  hydrog ? ? A  G   159  N2    ? ? ? 1_555 A  A   177  N7    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog214  hydrog ? ? A  G   159  N3    ? ? ? 1_555 A  A   177  N6    ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog215  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  U   176  O2    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog216  hydrog ? ? A  A   160  N7    ? ? ? 1_555 A  U   176  N3    ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog217  hydrog ? ? A  A   161  N6    ? ? ? 1_555 A  A   174  N7    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog218  hydrog ? ? A  A   161  N7    ? ? ? 1_555 A  A   174  N6    ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog219  hydrog ? ? A  A   161  N3    ? ? ? 1_555 A  G   892  N2    ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog220  hydrog ? ? A  C   162  N4    ? ? ? 1_555 A  C   173  O2    ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog221  hydrog ? ? A  C   162  O2    ? ? ? 1_555 A  C   893  N4    ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog222  hydrog ? ? A  U   163  N3    ? ? ? 1_555 A  U   172  O2    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog223  hydrog ? ? A  U   163  O4    ? ? ? 1_555 A  U   172  N3    ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog224  hydrog ? ? A  G   164  N1    ? ? ? 1_555 A  C   171  N3    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225  hydrog ? ? A  G   164  N2    ? ? ? 1_555 A  C   171  O2    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226  hydrog ? ? A  G   164  O6    ? ? ? 1_555 A  C   171  N4    ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227  hydrog ? ? A  G   164  N2    ? ? ? 1_555 A  A   222  N3    ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog228  hydrog ? ? A  A   165  N3    ? ? ? 1_555 A  G   221  N2    ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog229  hydrog ? ? A  A   166  N1    ? ? ? 1_555 A  G   924  N2    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog230  hydrog ? ? A  A   166  N6    ? ? ? 1_555 A  G   924  N3    ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog231  hydrog ? ? A  C   168  N3    ? ? ? 1_555 A  G   219  N1    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232  hydrog ? ? A  C   168  N4    ? ? ? 1_555 A  G   219  O6    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233  hydrog ? ? A  C   168  O2    ? ? ? 1_555 A  G   219  N2    ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234  hydrog ? ? A  U   170  N3    ? ? ? 1_555 A  G   221  O6    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog235  hydrog ? ? A  U   170  O4    ? ? ? 1_555 A  G   221  N1    ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog236  hydrog ? ? A  C   171  O2    ? ? ? 1_555 A  G   221  N1    ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog237  hydrog ? ? A  G   175  N2    ? ? ? 1_555 A  U   176  O4    ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog238  hydrog ? ? A  G   185  N2    ? ? ? 1_555 A  A   439  N1    ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog239  hydrog ? ? A  G   190  N2    ? ? ? 1_555 A  A   435  N7    ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog240  hydrog ? ? A  A   191  N6    ? ? ? 1_555 A  A   236  N3    ? ? 0 A   191  0 A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog241  hydrog ? ? A  A   191  N6    ? ? ? 1_555 A  U   434  O2    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog242  hydrog ? ? A  A   191  N7    ? ? ? 1_555 A  U   434  N3    ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog243  hydrog ? ? A  A   192  N6    ? ? ? 1_555 A  G   203  N3    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog244  hydrog ? ? A  A   192  N7    ? ? ? 1_555 A  G   203  N2    ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog245  hydrog ? ? A  A   193  N3    ? ? ? 1_555 A  G   413  N2    ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog246  hydrog ? ? A  A   194  N1    ? ? ? 1_555 A  U   202  N3    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247  hydrog ? ? A  A   194  N6    ? ? ? 1_555 A  U   202  O4    ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248  hydrog ? ? A  C   195  N3    ? ? ? 1_555 A  G   201  N1    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249  hydrog ? ? A  C   195  N4    ? ? ? 1_555 A  G   201  O6    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250  hydrog ? ? A  C   195  O2    ? ? ? 1_555 A  G   201  N2    ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251  hydrog ? ? A  G   196  N2    ? ? ? 1_555 A  A   199  N7    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog252  hydrog ? ? A  G   196  N3    ? ? ? 1_555 A  A   199  N6    ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog253  hydrog ? ? A  G   196  N1    ? ? ? 1_555 A  U   425  O2    ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog254  hydrog ? ? A  A   198  N1    ? ? ? 1_555 A  G   416  N2    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog255  hydrog ? ? A  A   198  N6    ? ? ? 1_555 A  G   416  N3    ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog256  hydrog ? ? A  A   204  N1    ? ? ? 1_555 A  A   436  N6    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog257  hydrog ? ? A  A   204  N6    ? ? ? 1_555 A  A   436  N1    ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog258  hydrog ? ? A  U   205  N3    ? ? ? 1_555 A  A   437  N1    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog259  hydrog ? ? A  U   205  O2    ? ? ? 1_555 A  A   437  N6    ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog260  hydrog ? ? A  G   206  N1    ? ? ? 1_555 A  U   233  O2    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog261  hydrog ? ? A  G   206  O6    ? ? ? 1_555 A  U   233  N3    ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog262  hydrog ? ? A  U   207  N3    ? ? ? 1_555 A  A   232  N1    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263  hydrog ? ? A  U   207  O4    ? ? ? 1_555 A  A   232  N6    ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264  hydrog ? ? A  C   208  N3    ? ? ? 1_555 A  G   231  N1    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265  hydrog ? ? A  C   208  N4    ? ? ? 1_555 A  G   231  O6    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266  hydrog ? ? A  C   208  O2    ? ? ? 1_555 A  G   231  N2    ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267  hydrog ? ? A  G   209  N1    ? ? ? 1_555 A  C   230  N3    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268  hydrog ? ? A  G   209  N2    ? ? ? 1_555 A  C   230  O2    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269  hydrog ? ? A  G   209  O6    ? ? ? 1_555 A  C   230  N4    ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270  hydrog ? ? A  U   210  N3    ? ? ? 1_555 A  G   229  O6    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog271  hydrog ? ? A  U   210  O2    ? ? ? 1_555 A  G   229  N1    ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog272  hydrog ? ? A  U   211  O2    ? ? ? 1_555 A  C   228  N4    ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog273  hydrog ? ? A  A   212  N6    ? ? ? 1_555 A  A   227  N7    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog274  hydrog ? ? A  A   212  N7    ? ? ? 1_555 A  A   227  N6    ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog275  hydrog ? ? A  G   213  N2    ? ? ? 1_555 A  U   214  O4    ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog276  hydrog ? ? A  U   214  N3    ? ? ? 1_555 A  A   226  N7    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog277  hydrog ? ? A  U   214  O2    ? ? ? 1_555 A  A   226  N6    ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog278  hydrog ? ? A  A   215  N6    ? ? ? 1_555 A  G   225  N3    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog279  hydrog ? ? A  A   215  N7    ? ? ? 1_555 A  G   225  N2    ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog280  hydrog ? ? A  A   216  N1    ? ? ? 1_555 A  U   224  N3    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281  hydrog ? ? A  A   216  N6    ? ? ? 1_555 A  U   224  O4    ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282  hydrog ? ? A  C   217  N3    ? ? ? 1_555 A  G   223  N1    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283  hydrog ? ? A  C   217  N4    ? ? ? 1_555 A  G   223  O6    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284  hydrog ? ? A  C   217  O2    ? ? ? 1_555 A  G   223  N2    ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285  hydrog ? ? A  C   218  O2    ? ? ? 1_555 A  A   222  N6    ? ? 0 C   218  0 A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog286  hydrog ? ? A  G   231  N2    ? ? ? 1_555 A  A   666  N3    ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog287  hydrog ? ? A  G   237  N1    ? ? ? 1_555 A  C   433  N3    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288  hydrog ? ? A  G   237  N2    ? ? ? 1_555 A  C   433  O2    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289  hydrog ? ? A  G   237  O6    ? ? ? 1_555 A  C   433  N4    ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290  hydrog ? ? A  C   238  N3    ? ? ? 1_555 A  G   432  N1    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291  hydrog ? ? A  C   238  N4    ? ? ? 1_555 A  G   432  O6    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292  hydrog ? ? A  C   238  O2    ? ? ? 1_555 A  G   432  N2    ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293  hydrog ? ? A  C   239  N3    ? ? ? 1_555 A  G   431  N1    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294  hydrog ? ? A  C   239  N4    ? ? ? 1_555 A  G   431  O6    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295  hydrog ? ? A  C   239  O2    ? ? ? 1_555 A  G   431  N2    ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296  hydrog ? ? A  C   240  N3    ? ? ? 1_555 A  G   379  N1    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297  hydrog ? ? A  C   240  N4    ? ? ? 1_555 A  G   379  O6    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298  hydrog ? ? A  C   240  O2    ? ? ? 1_555 A  G   379  N2    ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299  hydrog ? ? A  A   241  N6    ? ? ? 1_555 A  U   270  O2    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog300  hydrog ? ? A  A   241  N7    ? ? ? 1_555 A  U   270  N3    ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog301  hydrog ? ? A  A   242  N6    ? ? ? 1_555 A  G   269  N3    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog302  hydrog ? ? A  A   242  N7    ? ? ? 1_555 A  G   269  N2    ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog303  hydrog ? ? A  A   243  N6    ? ? ? 1_555 A  U   268  O2    ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog304  hydrog ? ? A  A   243  N3    ? ? ? 1_555 A  G   274  N2    ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog305  hydrog ? ? A  C   244  N3    ? ? ? 1_555 A  G   267  N1    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306  hydrog ? ? A  C   244  N4    ? ? ? 1_555 A  G   267  O6    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307  hydrog ? ? A  C   244  O2    ? ? ? 1_555 A  G   267  N2    ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308  hydrog ? ? A  C   245  N3    ? ? ? 1_555 A  G   266  N1    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309  hydrog ? ? A  C   245  N4    ? ? ? 1_555 A  G   266  O6    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310  hydrog ? ? A  C   245  O2    ? ? ? 1_555 A  G   266  N2    ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311  hydrog ? ? A  G   246  N2    ? ? ? 1_555 A  U   265  O4    ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog312  hydrog ? ? A  A   247  N6    ? ? ? 1_555 A  G   264  N3    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog313  hydrog ? ? A  A   247  N7    ? ? ? 1_555 A  G   264  N2    ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog314  hydrog ? ? A  A   248  N1    ? ? ? 1_555 A  U   265  N3    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315  hydrog ? ? A  A   248  N6    ? ? ? 1_555 A  U   265  O4    ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316  hydrog ? ? A  G   249  N1    ? ? ? 1_555 A  C   260  N3    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317  hydrog ? ? A  G   249  N2    ? ? ? 1_555 A  C   260  O2    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318  hydrog ? ? A  G   249  O6    ? ? ? 1_555 A  C   260  N4    ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319  hydrog ? ? A  C   250  N3    ? ? ? 1_555 A  G   259  N1    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320  hydrog ? ? A  C   250  N4    ? ? ? 1_555 A  G   259  O6    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321  hydrog ? ? A  C   250  O2    ? ? ? 1_555 A  G   259  N2    ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322  hydrog ? ? A  C   251  N3    ? ? ? 1_555 A  G   258  N1    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323  hydrog ? ? A  C   251  N4    ? ? ? 1_555 A  G   258  O6    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324  hydrog ? ? A  C   251  O2    ? ? ? 1_555 A  G   258  N2    ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325  hydrog ? ? A  C   251  N3    ? ? ? 1_555 A  G   259  N1    ? ? 0 C   251  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326  hydrog ? ? A  C   251  N4    ? ? ? 1_555 A  G   259  O6    ? ? 0 C   251  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327  hydrog ? ? A  C   251  O2    ? ? ? 1_555 A  G   259  N2    ? ? 0 C   251  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328  hydrog ? ? A  C   252  N3    ? ? ? 1_555 A  G   257  N1    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329  hydrog ? ? A  C   252  N4    ? ? ? 1_555 A  G   257  O6    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog330  hydrog ? ? A  C   252  O2    ? ? ? 1_555 A  G   257  N2    ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331  hydrog ? ? A  U   253  O2    ? ? ? 1_555 A  C   256  N4    ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog332  hydrog ? ? A  U   253  N3    ? ? ? 1_555 A  G   257  O6    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog333  hydrog ? ? A  U   253  O2    ? ? ? 1_555 A  G   257  N1    ? ? 0 U   253  0 G   257  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog334  hydrog ? ? A  C   271  N4    ? ? ? 1_555 A  A   378  N1    ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog335  hydrog ? ? A  G   273  N1    ? ? ? 1_555 A  C   377  N3    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336  hydrog ? ? A  G   273  N2    ? ? ? 1_555 A  C   377  O2    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337  hydrog ? ? A  G   273  O6    ? ? ? 1_555 A  C   377  N4    ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog338  hydrog ? ? A  G   274  N1    ? ? ? 1_555 A  C   376  N3    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog339  hydrog ? ? A  G   274  N2    ? ? ? 1_555 A  C   376  O2    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340  hydrog ? ? A  G   274  O6    ? ? ? 1_555 A  C   376  N4    ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341  hydrog ? ? A  G   275  N1    ? ? ? 1_555 A  U   374  O2    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog342  hydrog ? ? A  G   275  O6    ? ? ? 1_555 A  U   374  N3    ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog343  hydrog ? ? A  C   276  N3    ? ? ? 1_555 A  G   373  N1    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344  hydrog ? ? A  C   276  N4    ? ? ? 1_555 A  G   373  O6    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345  hydrog ? ? A  C   276  O2    ? ? ? 1_555 A  G   373  N2    ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346  hydrog ? ? A  U   277  N3    ? ? ? 1_555 A  A   372  N1    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347  hydrog ? ? A  U   277  O4    ? ? ? 1_555 A  A   372  N6    ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348  hydrog ? ? A  A   278  N1    ? ? ? 1_555 A  U   371  N3    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349  hydrog ? ? A  A   278  N6    ? ? ? 1_555 A  U   371  O4    ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350  hydrog ? ? A  C   279  N3    ? ? ? 1_555 A  G   370  N1    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351  hydrog ? ? A  C   279  N4    ? ? ? 1_555 A  G   370  O6    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352  hydrog ? ? A  C   279  O2    ? ? ? 1_555 A  G   370  N2    ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353  hydrog ? ? A  C   280  N3    ? ? ? 1_555 A  G   369  N1    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog354  hydrog ? ? A  C   280  N4    ? ? ? 1_555 A  G   369  O6    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog355  hydrog ? ? A  C   280  O2    ? ? ? 1_555 A  G   369  N2    ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog356  hydrog ? ? A  U   281  O2    ? ? ? 1_555 A  C   368  N4    ? ? 0 U   281  0 C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog357  hydrog ? ? A  C   282  O2    ? ? ? 1_555 A  C   368  N4    ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog358  hydrog ? ? A  C   284  O2    ? ? ? 1_555 A  G   367  N1    ? ? 0 C   284  0 G   367  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog359  hydrog ? ? A  A   285  N6    ? ? ? 1_555 A  U   366  O2    ? ? 0 A   285  0 U   366  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog360  hydrog ? ? A  A   285  N6    ? ? ? 1_555 A  G   367  N3    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog361  hydrog ? ? A  A   285  N7    ? ? ? 1_555 A  G   367  N2    ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog362  hydrog ? ? A  U   286  N3    ? ? ? 1_555 A  U   366  O2    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog363  hydrog ? ? A  U   286  O4    ? ? ? 1_555 A  U   366  N3    ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog364  hydrog ? ? A  C   287  N3    ? ? ? 1_555 A  G   365  N1    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog365  hydrog ? ? A  C   287  N4    ? ? ? 1_555 A  G   365  O6    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog366  hydrog ? ? A  C   287  O2    ? ? ? 1_555 A  G   365  N2    ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog367  hydrog ? ? A  A   288  N1    ? ? ? 1_555 A  U   364  N3    ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog368  hydrog ? ? A  A   288  N6    ? ? ? 1_555 A  U   364  O4    ? ? 0 A   288  0 U   364  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog369  hydrog ? ? A  G   289  N1    ? ? ? 1_555 A  C   363  N3    ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog370  hydrog ? ? A  G   289  N2    ? ? ? 1_555 A  C   363  O2    ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog371  hydrog ? ? A  G   289  O6    ? ? ? 1_555 A  C   363  N4    ? ? 0 G   289  0 C   363  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog372  hydrog ? ? A  C   290  N3    ? ? ? 1_555 A  G   362  N1    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog373  hydrog ? ? A  C   290  N4    ? ? ? 1_555 A  G   362  O6    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374  hydrog ? ? A  C   290  O2    ? ? ? 1_555 A  G   362  N2    ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375  hydrog ? ? A  C   291  N3    ? ? ? 1_555 A  C   361  N4    ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog376  hydrog ? ? A  G   292  N2    ? ? ? 1_555 A  A   360  N7    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog377  hydrog ? ? A  G   292  N3    ? ? ? 1_555 A  A   360  N6    ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog378  hydrog ? ? A  A   293  N6    ? ? ? 1_555 A  U   359  O2    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog379  hydrog ? ? A  A   293  N7    ? ? ? 1_555 A  U   359  N3    ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog380  hydrog ? ? A  C   295  N4    ? ? ? 1_555 A  C   356  O2    ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog381  hydrog ? ? A  G   296  N1    ? ? ? 1_555 A  C   355  N3    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382  hydrog ? ? A  G   296  N2    ? ? ? 1_555 A  C   355  O2    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog383  hydrog ? ? A  G   296  O6    ? ? ? 1_555 A  C   355  N4    ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog384  hydrog ? ? A  U   297  N3    ? ? ? 1_555 A  A   354  N1    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog385  hydrog ? ? A  U   297  O4    ? ? ? 1_555 A  A   354  N6    ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog386  hydrog ? ? A  C   298  N3    ? ? ? 1_555 A  G   353  N1    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog387  hydrog ? ? A  C   298  N4    ? ? ? 1_555 A  G   353  O6    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog388  hydrog ? ? A  C   298  O2    ? ? ? 1_555 A  G   353  N2    ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog389  hydrog ? ? A  U   299  N3    ? ? ? 1_555 A  A   352  N1    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog390  hydrog ? ? A  U   299  O4    ? ? ? 1_555 A  A   352  N6    ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog391  hydrog ? ? A  U   300  N3    ? ? ? 1_555 A  A   351  N1    ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog392  hydrog ? ? A  U   300  O4    ? ? ? 1_555 A  A   351  N6    ? ? 0 U   300  0 A   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog393  hydrog ? ? A  C   301  N3    ? ? ? 1_555 A  G   350  N1    ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog394  hydrog ? ? A  C   301  N4    ? ? ? 1_555 A  G   350  O6    ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog395  hydrog ? ? A  C   301  O2    ? ? ? 1_555 A  G   350  N2    ? ? 0 C   301  0 G   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog396  hydrog ? ? A  A   302  N1    ? ? ? 1_555 A  U   349  N3    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397  hydrog ? ? A  A   302  N6    ? ? ? 1_555 A  U   349  O4    ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398  hydrog ? ? A  C   303  O2    ? ? ? 1_555 A  C   348  N4    ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog399  hydrog ? ? A  G   304  N2    ? ? ? 1_555 A  A   347  N7    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog400  hydrog ? ? A  G   304  N3    ? ? ? 1_555 A  A   347  N6    ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog401  hydrog ? ? A  A   305  N6    ? ? ? 1_555 A  G   345  O6    ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog402  hydrog ? ? A  A   306  N6    ? ? ? 1_555 A  G   345  O6    ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog403  hydrog ? ? A  G   307  N1    ? ? ? 1_555 A  C   323  N3    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog404  hydrog ? ? A  G   307  N2    ? ? ? 1_555 A  C   323  O2    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog405  hydrog ? ? A  G   307  O6    ? ? ? 1_555 A  C   323  N4    ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog406  hydrog ? ? A  U   308  N3    ? ? ? 1_555 A  A   339  N1    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog407  hydrog ? ? A  U   308  O4    ? ? ? 1_555 A  A   339  N6    ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog408  hydrog ? ? A  C   309  N3    ? ? ? 1_555 A  G   322  N1    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog409  hydrog ? ? A  C   309  N4    ? ? ? 1_555 A  G   322  O6    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog410  hydrog ? ? A  C   309  O2    ? ? ? 1_555 A  G   322  N2    ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog411  hydrog ? ? A  U   310  N3    ? ? ? 1_555 A  A   321  N1    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog412  hydrog ? ? A  U   310  O4    ? ? ? 1_555 A  A   321  N6    ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog413  hydrog ? ? A  C   311  N3    ? ? ? 1_555 A  G   320  N1    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog414  hydrog ? ? A  C   311  N4    ? ? ? 1_555 A  G   320  O6    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog415  hydrog ? ? A  C   311  O2    ? ? ? 1_555 A  G   320  N2    ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog416  hydrog ? ? A  U   312  N3    ? ? ? 1_555 A  A   319  N1    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog417  hydrog ? ? A  U   312  O4    ? ? ? 1_555 A  A   319  N6    ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog418  hydrog ? ? A  U   313  N3    ? ? ? 1_555 A  A   317  N7    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog419  hydrog ? ? A  U   313  O2    ? ? ? 1_555 A  A   317  N6    ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog420  hydrog ? ? A  G   314  N2    ? ? ? 1_555 A  A   337  N1    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog421  hydrog ? ? A  G   314  N3    ? ? ? 1_555 A  A   337  N6    ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog422  hydrog ? ? A  G   315  N2    ? ? ? 1_555 A  G   336  N3    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog423  hydrog ? ? A  G   315  N3    ? ? ? 1_555 A  G   336  N2    ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog424  hydrog ? ? A  A   316  N6    ? ? ? 1_555 A  U   1314 O2    ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog425  hydrog ? ? A  G   324  N1    ? ? ? 1_555 A  C   341  N3    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog426  hydrog ? ? A  G   324  N2    ? ? ? 1_555 A  C   341  O2    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog427  hydrog ? ? A  G   324  O6    ? ? ? 1_555 A  C   341  N4    ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog428  hydrog ? ? A  U   325  N3    ? ? ? 1_555 A  A   340  N1    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog429  hydrog ? ? A  U   325  O4    ? ? ? 1_555 A  A   340  N6    ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog430  hydrog ? ? A  G   326  N1    ? ? ? 1_555 A  C   330  N3    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog431  hydrog ? ? A  G   326  N2    ? ? ? 1_555 A  C   330  O2    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog432  hydrog ? ? A  G   326  O6    ? ? ? 1_555 A  C   330  N4    ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog433  hydrog ? ? A  A   329  N3    ? ? ? 1_555 A  U   346  N3    ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog434  hydrog ? ? A  A   331  N6    ? ? ? 1_555 A  G   345  N3    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog435  hydrog ? ? A  A   331  N7    ? ? ? 1_555 A  G   345  N2    ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog436  hydrog ? ? A  G   332  N1    ? ? ? 1_555 A  C   344  N3    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog437  hydrog ? ? A  G   332  N2    ? ? ? 1_555 A  C   344  O2    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog438  hydrog ? ? A  G   332  O6    ? ? ? 1_555 A  C   344  N4    ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog439  hydrog ? ? A  G   333  N1    ? ? ? 1_555 A  C   343  N3    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog440  hydrog ? ? A  G   333  N2    ? ? ? 1_555 A  C   343  O2    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog441  hydrog ? ? A  G   333  O6    ? ? ? 1_555 A  C   343  N4    ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog442  hydrog ? ? A  G   334  N1    ? ? ? 1_555 A  C   342  N3    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog443  hydrog ? ? A  G   334  N2    ? ? ? 1_555 A  C   342  O2    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog444  hydrog ? ? A  G   334  O6    ? ? ? 1_555 A  C   342  N4    ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog445  hydrog ? ? A  U   335  N3    ? ? ? 1_555 A  A   339  N7    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog446  hydrog ? ? A  U   335  O2    ? ? ? 1_555 A  A   339  N6    ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog447  hydrog ? ? A  G   358  N2    ? ? ? 1_555 A  U   359  O4    ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog448  hydrog ? ? A  A   380  N6    ? ? ? 1_555 A  A   408  N7    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog449  hydrog ? ? A  A   380  N7    ? ? ? 1_555 A  A   408  N6    ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog450  hydrog ? ? A  A   380  N6    ? ? ? 1_555 A  U   409  O4    ? ? 0 A   380  0 U   409  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog451  hydrog ? ? A  G   381  N2    ? ? ? 1_555 A  U   382  O4    ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog452  hydrog ? ? A  U   382  N3    ? ? ? 1_555 A  A   407  N7    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog453  hydrog ? ? A  U   382  O2    ? ? ? 1_555 A  A   407  N6    ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog454  hydrog ? ? A  A   383  N6    ? ? ? 1_555 A  G   406  N3    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog455  hydrog ? ? A  A   383  N7    ? ? ? 1_555 A  G   406  N2    ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog456  hydrog ? ? A  G   384  N1    ? ? ? 1_555 A  C   405  N3    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog457  hydrog ? ? A  G   384  N2    ? ? ? 1_555 A  C   405  O2    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog458  hydrog ? ? A  G   384  O6    ? ? ? 1_555 A  C   405  N4    ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog459  hydrog ? ? A  C   385  N3    ? ? ? 1_555 A  G   404  N1    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog460  hydrog ? ? A  C   385  N4    ? ? ? 1_555 A  G   404  O6    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog461  hydrog ? ? A  C   385  O2    ? ? ? 1_555 A  G   404  N2    ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog462  hydrog ? ? A  G   386  N1    ? ? ? 1_555 A  C   403  N3    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog463  hydrog ? ? A  G   386  N2    ? ? ? 1_555 A  C   403  O2    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog464  hydrog ? ? A  G   386  O6    ? ? ? 1_555 A  C   403  N4    ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog465  hydrog ? ? A  G   387  N1    ? ? ? 1_555 A  U   402  O2    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog466  hydrog ? ? A  G   387  O6    ? ? ? 1_555 A  U   402  N3    ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog467  hydrog ? ? A  G   388  N1    ? ? ? 1_555 A  C   401  N3    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog468  hydrog ? ? A  G   388  N2    ? ? ? 1_555 A  C   401  O2    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog469  hydrog ? ? A  G   388  O6    ? ? ? 1_555 A  C   401  N4    ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog470  hydrog ? ? A  G   389  N1    ? ? ? 1_555 A  C   400  N3    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog471  hydrog ? ? A  G   389  N2    ? ? ? 1_555 A  C   400  O2    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog472  hydrog ? ? A  G   389  O6    ? ? ? 1_555 A  C   400  N4    ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog473  hydrog ? ? A  G   390  N1    ? ? ? 1_555 A  C   399  N3    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog474  hydrog ? ? A  G   390  N2    ? ? ? 1_555 A  C   399  O2    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog475  hydrog ? ? A  G   390  O6    ? ? ? 1_555 A  C   399  N4    ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog476  hydrog ? ? A  U   391  N3    ? ? ? 1_555 A  U   398  O4    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog477  hydrog ? ? A  U   391  O2    ? ? ? 1_555 A  U   398  N3    ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog478  hydrog ? ? A  U   396  O4    ? ? ? 1_555 A  G   2442 N2    ? ? 0 U   396  0 G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog479  hydrog ? ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1    ? ? 0 A   407  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog480  hydrog ? ? A  A   408  N1    ? ? ? 1_555 A  A   429  N6    ? ? 0 A   408  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog481  hydrog ? ? A  A   408  N6    ? ? ? 1_555 A  A   430  N1    ? ? 0 A   408  0 A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog482  hydrog ? ? A  C   412  N3    ? ? ? 1_555 A  G   428  N1    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog483  hydrog ? ? A  C   412  N4    ? ? ? 1_555 A  G   428  O6    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog484  hydrog ? ? A  C   412  O2    ? ? ? 1_555 A  G   428  N2    ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog485  hydrog ? ? A  G   413  N1    ? ? ? 1_555 A  C   427  N3    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog486  hydrog ? ? A  G   413  N2    ? ? ? 1_555 A  C   427  O2    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog487  hydrog ? ? A  G   413  O6    ? ? ? 1_555 A  C   427  N4    ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog488  hydrog ? ? A  C   414  N3    ? ? ? 1_555 A  G   426  N1    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog489  hydrog ? ? A  C   414  N4    ? ? ? 1_555 A  G   426  O6    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog490  hydrog ? ? A  C   414  O2    ? ? ? 1_555 A  G   426  N2    ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog491  hydrog ? ? A  A   415  N1    ? ? ? 1_555 A  U   425  N3    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog492  hydrog ? ? A  A   415  N6    ? ? ? 1_555 A  U   425  O4    ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog493  hydrog ? ? A  G   416  N1    ? ? ? 1_555 A  C   424  N3    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog494  hydrog ? ? A  G   416  N2    ? ? ? 1_555 A  C   424  O2    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog495  hydrog ? ? A  G   416  O6    ? ? ? 1_555 A  C   424  N4    ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog496  hydrog ? ? A  C   418  N3    ? ? ? 1_555 A  G   2449 N1    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog497  hydrog ? ? A  C   418  N4    ? ? ? 1_555 A  G   2449 O6    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog498  hydrog ? ? A  C   418  O2    ? ? ? 1_555 A  G   2449 N2    ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog499  hydrog ? ? A  A   419  N3    ? ? ? 1_555 A  C   1920 N4    ? ? 0 A   419  0 C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog500  hydrog ? ? A  A   419  N1    ? ? ? 1_555 A  U   2448 N3    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog501  hydrog ? ? A  A   419  N6    ? ? ? 1_555 A  U   2448 O4    ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog502  hydrog ? ? A  U   420  N3    ? ? ? 1_555 A  A   2447 N1    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog503  hydrog ? ? A  U   420  O4    ? ? ? 1_555 A  A   2447 N6    ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog504  hydrog ? ? A  C   421  N3    ? ? ? 1_555 A  G   2446 N1    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog505  hydrog ? ? A  C   421  N4    ? ? ? 1_555 A  G   2446 O6    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog506  hydrog ? ? A  C   421  O2    ? ? ? 1_555 A  G   2446 N2    ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog507  hydrog ? ? A  G   422  N1    ? ? ? 1_555 A  U   2445 O2    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog508  hydrog ? ? A  G   422  O6    ? ? ? 1_555 A  U   2445 N3    ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog509  hydrog ? ? A  A   423  N1    ? ? ? 1_555 A  U   2444 N3    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog510  hydrog ? ? A  A   423  N6    ? ? ? 1_555 A  U   2444 O4    ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog511  hydrog ? ? A  A   441  N3    ? ? ? 1_555 A  A   442  N6    ? ? 0 A   441  0 A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog512  hydrog ? ? A  A   449  N3    ? ? ? 1_555 A  G   1349 N2    ? ? 0 A   449  0 G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog513  hydrog ? ? A  G   452  N2    ? ? ? 1_555 A  A   460  N1    ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog514  hydrog ? ? A  U   454  N3    ? ? ? 1_555 A  U   1362 O2    ? ? 0 U   454  0 U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog515  hydrog ? ? A  A   455  N1    ? ? ? 1_555 A  A   460  N6    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog516  hydrog ? ? A  A   455  N6    ? ? ? 1_555 A  A   460  N7    ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog517  hydrog ? ? A  G   458  N2    ? ? ? 1_555 A  A   463  N3    ? ? 0 G   458  0 A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog518  hydrog ? ? A  A   463  N6    ? ? ? 1_555 A  A   477  N7    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog519  hydrog ? ? A  A   463  N7    ? ? ? 1_555 A  A   477  N6    ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog520  hydrog ? ? A  G   464  N2    ? ? ? 1_555 A  U   465  O4    ? ? 0 G   464  0 U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog521  hydrog ? ? A  U   465  N3    ? ? ? 1_555 A  A   476  N7    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog522  hydrog ? ? A  U   465  O2    ? ? ? 1_555 A  A   476  N6    ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog523  hydrog ? ? A  U   465  O2    ? ? ? 1_555 A  A   477  N6    ? ? 0 U   465  0 A   477  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog524  hydrog ? ? A  A   466  N6    ? ? ? 1_555 A  G   475  N3    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog525  hydrog ? ? A  A   466  N7    ? ? ? 1_555 A  G   475  N2    ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog526  hydrog ? ? A  G   467  N1    ? ? ? 1_555 A  C   474  N3    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog527  hydrog ? ? A  G   467  N2    ? ? ? 1_555 A  C   474  O2    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog528  hydrog ? ? A  G   467  O6    ? ? ? 1_555 A  C   474  N4    ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog529  hydrog ? ? A  U   468  N3    ? ? ? 1_555 A  A   473  N1    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog530  hydrog ? ? A  U   468  O4    ? ? ? 1_555 A  A   473  N6    ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog531  hydrog ? ? A  G   469  N2    ? ? ? 1_555 A  A   472  N7    ? ? 0 G   469  0 A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog532  hydrog ? ? A  G   471  N2    ? ? ? 1_555 A  C   774  O2    ? ? 0 G   471  0 C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog533  hydrog ? ? A  U   481  N3    ? ? ? 1_555 A  A   485  N7    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog534  hydrog ? ? A  U   481  O2    ? ? ? 1_555 A  A   485  N6    ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog535  hydrog ? ? A  G   482  N2    ? ? ? 1_555 A  A   486  N7    ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog536  hydrog ? ? A  A   485  N1    ? ? ? 1_555 A  A   509  N6    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog537  hydrog ? ? A  A   485  N6    ? ? ? 1_555 A  A   509  N1    ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog538  hydrog ? ? A  A   486  N1    ? ? ? 1_555 A  A   511  N6    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog539  hydrog ? ? A  A   486  N6    ? ? ? 1_555 A  A   511  N1    ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog540  hydrog ? ? A  G   487  N2    ? ? ? 1_555 A  G   512  N3    ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog541  hydrog ? ? A  G   487  N3    ? ? ? 1_555 A  G   512  N2    ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog542  hydrog ? ? A  G   487  N1    ? ? ? 1_555 A  C   515  N3    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog543  hydrog ? ? A  G   487  N2    ? ? ? 1_555 A  C   515  O2    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog544  hydrog ? ? A  G   487  O6    ? ? ? 1_555 A  C   515  N4    ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog545  hydrog ? ? A  U   488  O2    ? ? ? 1_555 A  G   503  N1    ? ? 0 U   488  0 G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog546  hydrog ? ? A  A   489  N6    ? ? ? 1_555 A  G   503  N3    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog547  hydrog ? ? A  A   489  N7    ? ? ? 1_555 A  G   503  N2    ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog548  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  A   502  N1    ? ? 0 C   490  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog549  hydrog ? ? A  C   491  N3    ? ? ? 1_555 A  G   501  N1    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog550  hydrog ? ? A  C   491  N4    ? ? ? 1_555 A  G   501  O6    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog551  hydrog ? ? A  C   491  O2    ? ? ? 1_555 A  G   501  N2    ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog552  hydrog ? ? A  C   492  N3    ? ? ? 1_555 A  G   500  N1    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog553  hydrog ? ? A  C   492  N4    ? ? ? 1_555 A  G   500  O6    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog554  hydrog ? ? A  C   492  O2    ? ? ? 1_555 A  G   500  N2    ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog555  hydrog ? ? A  U   493  N3    ? ? ? 1_555 A  G   499  O6    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog556  hydrog ? ? A  U   493  O2    ? ? ? 1_555 A  G   499  N1    ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog557  hydrog ? ? A  C   494  O2    ? ? ? 1_555 A  A   498  N6    ? ? 0 C   494  0 A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog558  hydrog ? ? A  G   504  N1    ? ? ? 1_555 A  G   512  O6    ? ? 0 G   504  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog559  hydrog ? ? A  C   505  O2    ? ? ? 1_555 A  A   509  N6    ? ? 0 C   505  0 A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog560  hydrog ? ? A  G   506  N2    ? ? ? 1_555 A  A   511  N7    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog561  hydrog ? ? A  G   506  N3    ? ? ? 1_555 A  A   511  N6    ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog562  hydrog ? ? A  A   521  N3    ? ? ? 1_555 A  G   1364 N2    ? ? 0 A   521  0 G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog563  hydrog ? ? A  A   532  N3    ? ? ? 1_555 A  G   2660 N2    ? ? 0 A   532  0 G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog564  hydrog ? ? A  G   535  N7    ? ? ? 1_555 A  G   2082 N1    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog565  hydrog ? ? A  G   535  O6    ? ? ? 1_555 A  G   2082 N2    ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog566  hydrog ? ? A  A   536  N3    ? ? ? 1_555 A  G   2075 N2    ? ? 0 A   536  0 G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog567  hydrog ? ? A  G   537  N1    ? ? ? 1_555 A  U   2059 O2    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog568  hydrog ? ? A  G   537  O6    ? ? ? 1_555 A  U   2059 N3    ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog569  hydrog ? ? A  C   538  N4    ? ? ? 1_555 A  A   2060 N3    ? ? 0 C   538  0 A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog570  hydrog ? ? A  G   539  N1    ? ? ? 1_555 A  C   617  N3    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog571  hydrog ? ? A  G   539  N2    ? ? ? 1_555 A  C   617  O2    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog572  hydrog ? ? A  G   539  O6    ? ? ? 1_555 A  C   617  N4    ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog573  hydrog ? ? A  A   540  N1    ? ? ? 1_555 A  U   616  N3    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog574  hydrog ? ? A  A   540  N6    ? ? ? 1_555 A  U   616  O4    ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog575  hydrog ? ? A  C   541  N3    ? ? ? 1_555 A  G   615  N1    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog576  hydrog ? ? A  C   541  N4    ? ? ? 1_555 A  G   615  O6    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog577  hydrog ? ? A  C   541  O2    ? ? ? 1_555 A  G   615  N2    ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog578  hydrog ? ? A  A   542  N1    ? ? ? 1_555 A  U   614  N3    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog579  hydrog ? ? A  A   542  N6    ? ? ? 1_555 A  U   614  O4    ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog580  hydrog ? ? A  G   543  N1    ? ? ? 1_555 A  C   613  N3    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog581  hydrog ? ? A  G   543  N2    ? ? ? 1_555 A  C   613  O2    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog582  hydrog ? ? A  G   543  O6    ? ? ? 1_555 A  C   613  N4    ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog583  hydrog ? ? A  G   544  N1    ? ? ? 1_555 A  U   612  O2    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog584  hydrog ? ? A  G   544  O6    ? ? ? 1_555 A  U   612  N3    ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog585  hydrog ? ? A  G   545  N1    ? ? ? 1_555 A  U   611  O2    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog586  hydrog ? ? A  G   545  O6    ? ? ? 1_555 A  U   611  N3    ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog587  hydrog ? ? A  C   546  N3    ? ? ? 1_555 A  G   610  N1    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog588  hydrog ? ? A  C   546  N4    ? ? ? 1_555 A  G   610  O6    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog589  hydrog ? ? A  C   546  O2    ? ? ? 1_555 A  G   610  N2    ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog590  hydrog ? ? A  A   547  N1    ? ? ? 1_555 A  U   609  N3    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog591  hydrog ? ? A  A   547  N6    ? ? ? 1_555 A  U   609  O4    ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog592  hydrog ? ? A  U   548  N3    ? ? ? 1_555 A  A   608  N1    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog593  hydrog ? ? A  U   548  O4    ? ? ? 1_555 A  A   608  N6    ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog594  hydrog ? ? A  A   552  N3    ? ? ? 1_555 A  G   1323 N2    ? ? 0 A   552  0 G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog595  hydrog ? ? A  G   553  N1    ? ? ? 1_555 A  C   606  N3    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog596  hydrog ? ? A  G   553  N2    ? ? ? 1_555 A  C   606  O2    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog597  hydrog ? ? A  G   553  O6    ? ? ? 1_555 A  C   606  N4    ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog598  hydrog ? ? A  G   554  N1    ? ? ? 1_555 A  C   605  N3    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog599  hydrog ? ? A  G   554  N2    ? ? ? 1_555 A  C   605  O2    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog600  hydrog ? ? A  G   554  O6    ? ? ? 1_555 A  C   605  N4    ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog601  hydrog ? ? A  U   555  N3    ? ? ? 1_555 A  A   602  N1    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog602  hydrog ? ? A  U   555  O4    ? ? ? 1_555 A  A   602  N6    ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog603  hydrog ? ? A  C   556  N3    ? ? ? 1_555 A  G   601  N1    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog604  hydrog ? ? A  C   556  N4    ? ? ? 1_555 A  G   601  O6    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog605  hydrog ? ? A  C   556  O2    ? ? ? 1_555 A  G   601  N2    ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog606  hydrog ? ? A  C   557  N3    ? ? ? 1_555 A  G   600  N1    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog607  hydrog ? ? A  C   557  N4    ? ? ? 1_555 A  G   600  O6    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog608  hydrog ? ? A  C   557  O2    ? ? ? 1_555 A  G   600  N2    ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog609  hydrog ? ? A  C   558  N3    ? ? ? 1_555 A  G   599  N1    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog610  hydrog ? ? A  C   558  N4    ? ? ? 1_555 A  G   599  O6    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog611  hydrog ? ? A  C   558  O2    ? ? ? 1_555 A  G   599  N2    ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog612  hydrog ? ? A  C   558  O2    ? ? ? 1_555 A  G   600  N2    ? ? 0 C   558  0 G   600  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog613  hydrog ? ? A  U   559  O4    ? ? ? 1_555 A  C   598  N4    ? ? 0 U   559  0 C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog614  hydrog ? ? A  U   559  O4    ? ? ? 1_555 A  G   599  N1    ? ? 0 U   559  0 G   599  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog615  hydrog ? ? A  U   560  N3    ? ? ? 1_555 A  A   597  N1    ? ? 0 U   560  0 A   597  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog616  hydrog ? ? A  U   560  O4    ? ? ? 1_555 A  A   597  N6    ? ? 0 U   560  0 A   597  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog617  hydrog ? ? A  G   561  N1    ? ? ? 1_555 A  C   596  N3    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog618  hydrog ? ? A  G   561  N2    ? ? ? 1_555 A  C   596  O2    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog619  hydrog ? ? A  G   561  O6    ? ? ? 1_555 A  C   596  N4    ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog620  hydrog ? ? A  A   562  N1    ? ? ? 1_555 A  U   595  N3    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog621  hydrog ? ? A  A   562  N6    ? ? ? 1_555 A  U   595  O4    ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog622  hydrog ? ? A  C   563  N3    ? ? ? 1_555 A  C   594  N4    ? ? 0 C   563  0 C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog623  hydrog ? ? A  A   566  N6    ? ? ? 1_555 A  G   592  N3    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog624  hydrog ? ? A  A   566  N7    ? ? ? 1_555 A  G   592  N2    ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog625  hydrog ? ? A  A   566  N3    ? ? ? 1_555 A  G   1093 N2    ? ? 0 A   566  0 G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog626  hydrog ? ? A  U   567  N3    ? ? ? 1_555 A  A   591  N1    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog627  hydrog ? ? A  U   567  O4    ? ? ? 1_555 A  A   591  N6    ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog628  hydrog ? ? A  G   568  N2    ? ? ? 1_555 A  A   590  N7    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog629  hydrog ? ? A  G   568  N3    ? ? ? 1_555 A  A   590  N6    ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog630  hydrog ? ? A  A   569  N6    ? ? ? 1_555 A  U   589  O2    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog631  hydrog ? ? A  A   569  N7    ? ? ? 1_555 A  U   589  N3    ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog632  hydrog ? ? A  C   571  N4    ? ? ? 1_555 A  C   586  O2    ? ? 0 C   571  0 C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog633  hydrog ? ? A  G   572  N1    ? ? ? 1_555 A  C   585  N3    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog634  hydrog ? ? A  G   572  N2    ? ? ? 1_555 A  C   585  O2    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog635  hydrog ? ? A  G   572  O6    ? ? ? 1_555 A  C   585  N4    ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog636  hydrog ? ? A  A   573  N1    ? ? ? 1_555 A  U   584  N3    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog637  hydrog ? ? A  A   573  N6    ? ? ? 1_555 A  U   584  O4    ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog638  hydrog ? ? A  G   574  N1    ? ? ? 1_555 A  C   583  N3    ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog639  hydrog ? ? A  G   574  N2    ? ? ? 1_555 A  C   583  O2    ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog640  hydrog ? ? A  G   574  O6    ? ? ? 1_555 A  C   583  N4    ? ? 0 G   574  0 C   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog641  hydrog ? ? A  A   575  N1    ? ? ? 1_555 A  U   582  N3    ? ? 0 A   575  0 U   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog642  hydrog ? ? A  A   575  N6    ? ? ? 1_555 A  U   582  O4    ? ? 0 A   575  0 U   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog643  hydrog ? ? A  C   576  N3    ? ? ? 1_555 A  G   581  N1    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog644  hydrog ? ? A  C   576  N4    ? ? ? 1_555 A  G   581  O6    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog645  hydrog ? ? A  C   576  O2    ? ? ? 1_555 A  G   581  N2    ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog646  hydrog ? ? A  G   577  N2    ? ? ? 1_555 A  A   580  N7    ? ? 0 G   577  0 A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog647  hydrog ? ? A  G   579  N2    ? ? ? 1_555 A  U   1111 O2    ? ? 0 G   579  0 U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog648  hydrog ? ? A  A   580  N3    ? ? ? 1_555 A  G   1110 N2    ? ? 0 A   580  0 G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog649  hydrog ? ? A  G   588  N2    ? ? ? 1_555 A  U   589  O4    ? ? 0 G   588  0 U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog650  hydrog ? ? A  G   604  N1    ? ? ? 1_555 A  G   607  O6    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog651  hydrog ? ? A  G   604  N2    ? ? ? 1_555 A  G   607  N7    ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog652  hydrog ? ? A  U   619  N3    ? ? ? 1_555 A  A   2074 N1    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog653  hydrog ? ? A  U   619  O4    ? ? ? 1_555 A  A   2074 N6    ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog654  hydrog ? ? A  A   620  N6    ? ? ? 1_555 A  A   635  N1    ? ? 0 A   620  0 A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog655  hydrog ? ? A  C   621  N3    ? ? ? 1_555 A  G   634  N1    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog656  hydrog ? ? A  C   621  N4    ? ? ? 1_555 A  G   634  O6    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog657  hydrog ? ? A  C   621  O2    ? ? ? 1_555 A  G   634  N2    ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog658  hydrog ? ? A  G   622  N1    ? ? ? 1_555 A  C   633  N3    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog659  hydrog ? ? A  G   622  N2    ? ? ? 1_555 A  C   633  O2    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog660  hydrog ? ? A  G   622  O6    ? ? ? 1_555 A  C   633  N4    ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog661  hydrog ? ? A  U   623  N3    ? ? ? 1_555 A  A   632  N1    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog662  hydrog ? ? A  U   623  O4    ? ? ? 1_555 A  A   632  N6    ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog663  hydrog ? ? A  U   624  N3    ? ? ? 1_555 A  1MA 628  N7    ? ? 0 U   624  0 1MA 628  1_555 ? ? ? ? ? ? 'U-1MA PAIR' ? ? 
hydrog664  hydrog ? ? A  U   625  O2    ? ? ? 1_555 A  C   2071 N4    ? ? 0 U   625  0 C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog665  hydrog ? ? A  U   626  O2    ? ? ? 1_555 A  A   1081 N6    ? ? 0 U   626  0 A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog666  hydrog ? ? A  A   629  N1    ? ? ? 1_555 A  G   2070 N2    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog667  hydrog ? ? A  A   629  N6    ? ? ? 1_555 A  G   2070 N3    ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog668  hydrog ? ? A  G   636  N1    ? ? ? 1_555 A  C   1365 N3    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog669  hydrog ? ? A  G   636  N2    ? ? ? 1_555 A  C   1365 O2    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog670  hydrog ? ? A  G   636  O6    ? ? ? 1_555 A  C   1365 N4    ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog671  hydrog ? ? A  C   637  N3    ? ? ? 1_555 A  G   1364 N1    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog672  hydrog ? ? A  C   637  N4    ? ? ? 1_555 A  G   1364 O6    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog673  hydrog ? ? A  C   637  O2    ? ? ? 1_555 A  G   1364 N2    ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog674  hydrog ? ? A  C   638  N3    ? ? ? 1_555 A  G   1363 N1    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog675  hydrog ? ? A  C   638  N4    ? ? ? 1_555 A  G   1363 O6    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog676  hydrog ? ? A  C   638  O2    ? ? ? 1_555 A  G   1363 N2    ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog677  hydrog ? ? A  A   639  N1    ? ? ? 1_555 A  U   1362 N3    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog678  hydrog ? ? A  A   639  N6    ? ? ? 1_555 A  U   1362 O4    ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog679  hydrog ? ? A  G   640  N1    ? ? ? 1_555 A  C   1361 N3    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog680  hydrog ? ? A  G   640  N2    ? ? ? 1_555 A  C   1361 O2    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog681  hydrog ? ? A  G   640  O6    ? ? ? 1_555 A  C   1361 N4    ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog682  hydrog ? ? A  G   641  N1    ? ? ? 1_555 A  C   1360 N3    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog683  hydrog ? ? A  G   641  N2    ? ? ? 1_555 A  C   1360 O2    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog684  hydrog ? ? A  G   641  O6    ? ? ? 1_555 A  C   1360 N4    ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog685  hydrog ? ? A  G   642  N2    ? ? ? 1_555 A  A   1358 N7    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog686  hydrog ? ? A  G   642  N3    ? ? ? 1_555 A  A   1358 N6    ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog687  hydrog ? ? A  A   643  N3    ? ? ? 1_555 A  G   902  N2    ? ? 0 A   643  0 G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog688  hydrog ? ? A  A   643  N6    ? ? ? 1_555 A  A   1355 N7    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog689  hydrog ? ? A  A   643  N7    ? ? ? 1_555 A  A   1355 N6    ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog690  hydrog ? ? A  G   644  N1    ? ? ? 1_555 A  U   903  O2    ? ? 0 G   644  0 U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog691  hydrog ? ? A  U   645  N3    ? ? ? 1_555 A  A   761  N3    ? ? 0 U   645  0 A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog692  hydrog ? ? A  G   646  N1    ? ? ? 1_555 A  C   759  N3    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog693  hydrog ? ? A  G   646  N2    ? ? ? 1_555 A  C   759  O2    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog694  hydrog ? ? A  G   646  O6    ? ? ? 1_555 A  C   759  N4    ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog695  hydrog ? ? A  U   647  N3    ? ? ? 1_555 A  A   758  N1    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog696  hydrog ? ? A  U   647  O4    ? ? ? 1_555 A  A   758  N6    ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog697  hydrog ? ? A  G   648  N1    ? ? ? 1_555 A  C   757  N3    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog698  hydrog ? ? A  G   648  N2    ? ? ? 1_555 A  C   757  O2    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog699  hydrog ? ? A  G   648  O6    ? ? ? 1_555 A  C   757  N4    ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog700  hydrog ? ? A  U   649  N3    ? ? ? 1_555 A  A   756  N1    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog701  hydrog ? ? A  U   649  O4    ? ? ? 1_555 A  A   756  N6    ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog702  hydrog ? ? A  C   650  N3    ? ? ? 1_555 A  G   755  N1    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog703  hydrog ? ? A  C   650  N4    ? ? ? 1_555 A  G   755  O6    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog704  hydrog ? ? A  C   650  O2    ? ? ? 1_555 A  G   755  N2    ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog705  hydrog ? ? A  U   651  N3    ? ? ? 1_555 A  G   754  O6    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog706  hydrog ? ? A  U   651  O2    ? ? ? 1_555 A  G   754  N1    ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog707  hydrog ? ? A  G   652  N1    ? ? ? 1_555 A  U   753  O2    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog708  hydrog ? ? A  G   652  O6    ? ? ? 1_555 A  U   753  N3    ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog709  hydrog ? ? A  U   653  N3    ? ? ? 1_555 A  G   752  O6    ? ? 0 U   653  0 G   752  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog710  hydrog ? ? A  U   653  O2    ? ? ? 1_555 A  G   752  N1    ? ? 0 U   653  0 G   752  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog711  hydrog ? ? A  A   654  N1    ? ? ? 1_555 A  U   751  N3    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog712  hydrog ? ? A  A   654  N6    ? ? ? 1_555 A  U   751  O4    ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog713  hydrog ? ? A  U   655  N3    ? ? ? 1_555 A  A   750  N1    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog714  hydrog ? ? A  U   655  O4    ? ? ? 1_555 A  A   750  N6    ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog715  hydrog ? ? A  G   656  N1    ? ? ? 1_555 A  C   749  N3    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog716  hydrog ? ? A  G   656  N2    ? ? ? 1_555 A  C   749  O2    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog717  hydrog ? ? A  G   656  O6    ? ? ? 1_555 A  C   749  N4    ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog718  hydrog ? ? A  G   657  N1    ? ? ? 1_555 A  C   748  N3    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog719  hydrog ? ? A  G   657  N2    ? ? ? 1_555 A  C   748  O2    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog720  hydrog ? ? A  G   657  O6    ? ? ? 1_555 A  C   748  N4    ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog721  hydrog ? ? A  C   658  N3    ? ? ? 1_555 A  G   747  N1    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog722  hydrog ? ? A  C   658  N4    ? ? ? 1_555 A  G   747  O6    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog723  hydrog ? ? A  C   658  O2    ? ? ? 1_555 A  G   747  N2    ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog724  hydrog ? ? A  G   661  N1    ? ? ? 1_555 A  C   685  N3    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog725  hydrog ? ? A  G   661  N2    ? ? ? 1_555 A  C   685  O2    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog726  hydrog ? ? A  G   661  O6    ? ? ? 1_555 A  C   685  N4    ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog727  hydrog ? ? A  U   662  N3    ? ? ? 1_555 A  G   684  O6    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog728  hydrog ? ? A  U   662  O2    ? ? ? 1_555 A  G   684  N1    ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog729  hydrog ? ? A  C   663  N3    ? ? ? 1_555 A  G   683  N1    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog730  hydrog ? ? A  C   663  N4    ? ? ? 1_555 A  G   683  O6    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog731  hydrog ? ? A  C   663  O2    ? ? ? 1_555 A  G   683  N2    ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog732  hydrog ? ? A  U   664  N3    ? ? ? 1_555 A  A   682  N7    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog733  hydrog ? ? A  U   664  O2    ? ? ? 1_555 A  A   682  N6    ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog734  hydrog ? ? A  A   666  N6    ? ? ? 1_555 A  G   680  N3    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog735  hydrog ? ? A  A   666  N7    ? ? ? 1_555 A  G   680  N2    ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog736  hydrog ? ? A  C   667  N3    ? ? ? 1_555 A  G   679  N1    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog737  hydrog ? ? A  C   667  N4    ? ? ? 1_555 A  G   679  O6    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog738  hydrog ? ? A  C   667  O2    ? ? ? 1_555 A  G   679  N2    ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog739  hydrog ? ? A  C   668  N3    ? ? ? 1_555 A  G   678  N1    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog740  hydrog ? ? A  C   668  N4    ? ? ? 1_555 A  G   678  O6    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog741  hydrog ? ? A  C   668  O2    ? ? ? 1_555 A  G   678  N2    ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog742  hydrog ? ? A  G   669  N1    ? ? ? 1_555 A  C   677  N3    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog743  hydrog ? ? A  G   669  N2    ? ? ? 1_555 A  C   677  O2    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog744  hydrog ? ? A  G   669  O6    ? ? ? 1_555 A  C   677  N4    ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog745  hydrog ? ? A  G   670  N1    ? ? ? 1_555 A  C   676  N3    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog746  hydrog ? ? A  G   670  N2    ? ? ? 1_555 A  C   676  O2    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog747  hydrog ? ? A  G   670  O6    ? ? ? 1_555 A  C   676  N4    ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog748  hydrog ? ? A  G   689  N1    ? ? ? 1_555 A  C   696  N3    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog749  hydrog ? ? A  G   689  N2    ? ? ? 1_555 A  C   696  O2    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog750  hydrog ? ? A  G   689  O6    ? ? ? 1_555 A  C   696  N4    ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog751  hydrog ? ? A  G   690  N1    ? ? ? 1_555 A  C   695  N3    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog752  hydrog ? ? A  G   690  N2    ? ? ? 1_555 A  C   695  O2    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog753  hydrog ? ? A  G   690  O6    ? ? ? 1_555 A  C   695  N4    ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog754  hydrog ? ? A  G   691  N2    ? ? ? 1_555 A  A   694  N7    ? ? 0 G   691  0 A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog755  hydrog ? ? A  A   692  N1    ? ? ? 1_555 A  G   2453 N2    ? ? 0 A   692  0 G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog756  hydrog ? ? A  A   698  N3    ? ? ? 1_555 A  G   742  N2    ? ? 0 A   698  0 G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog757  hydrog ? ? A  C   699  N3    ? ? ? 1_555 A  G   727  N1    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog758  hydrog ? ? A  C   699  N4    ? ? ? 1_555 A  G   727  O6    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog759  hydrog ? ? A  C   699  O2    ? ? ? 1_555 A  G   727  N2    ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog760  hydrog ? ? A  G   702  N1    ? ? ? 1_555 A  C   726  N3    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog761  hydrog ? ? A  G   702  N2    ? ? ? 1_555 A  C   726  O2    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog762  hydrog ? ? A  G   702  O6    ? ? ? 1_555 A  C   726  N4    ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog763  hydrog ? ? A  G   702  N7    ? ? ? 1_555 A  G   744  N2    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog764  hydrog ? ? A  G   702  O6    ? ? ? 1_555 A  G   744  N1    ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog765  hydrog ? ? A  G   703  N1    ? ? ? 1_555 A  C   725  N3    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog766  hydrog ? ? A  G   703  N2    ? ? ? 1_555 A  C   725  O2    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog767  hydrog ? ? A  G   703  O6    ? ? ? 1_555 A  C   725  N4    ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog768  hydrog ? ? A  C   704  N3    ? ? ? 1_555 A  G   724  N1    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog769  hydrog ? ? A  C   704  N4    ? ? ? 1_555 A  G   724  O6    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog770  hydrog ? ? A  C   704  O2    ? ? ? 1_555 A  G   724  N2    ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog771  hydrog ? ? A  C   705  N3    ? ? ? 1_555 A  G   723  N1    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog772  hydrog ? ? A  C   705  N4    ? ? ? 1_555 A  G   723  O6    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog773  hydrog ? ? A  C   705  O2    ? ? ? 1_555 A  G   723  N2    ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog774  hydrog ? ? A  G   706  N2    ? ? ? 1_555 A  G   722  O6    ? ? 0 G   706  0 G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog775  hydrog ? ? A  C   707  N3    ? ? ? 1_555 A  A   721  N6    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog776  hydrog ? ? A  C   707  N4    ? ? ? 1_555 A  A   721  N7    ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog777  hydrog ? ? A  A   708  N6    ? ? ? 1_555 A  G   720  N3    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog778  hydrog ? ? A  A   708  N7    ? ? ? 1_555 A  G   720  N2    ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog779  hydrog ? ? A  G   709  N1    ? ? ? 1_555 A  C   719  N3    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog780  hydrog ? ? A  G   709  N2    ? ? ? 1_555 A  C   719  O2    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog781  hydrog ? ? A  G   709  O6    ? ? ? 1_555 A  C   719  N4    ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog782  hydrog ? ? A  G   710  N1    ? ? ? 1_555 A  C   718  N3    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog783  hydrog ? ? A  G   710  N2    ? ? ? 1_555 A  C   718  O2    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog784  hydrog ? ? A  G   710  O6    ? ? ? 1_555 A  C   718  N4    ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog785  hydrog ? ? A  G   711  N1    ? ? ? 1_555 A  C   717  N3    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog786  hydrog ? ? A  G   711  N2    ? ? ? 1_555 A  C   717  O2    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog787  hydrog ? ? A  G   711  O6    ? ? ? 1_555 A  C   717  N4    ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog788  hydrog ? ? A  C   712  N3    ? ? ? 1_555 A  G   716  N1    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog789  hydrog ? ? A  C   712  N4    ? ? ? 1_555 A  G   716  O6    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog790  hydrog ? ? A  C   712  O2    ? ? ? 1_555 A  G   716  N2    ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog791  hydrog ? ? A  C   726  N4    ? ? ? 1_555 A  G   744  O6    ? ? 0 C   726  0 G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog792  hydrog ? ? A  C   728  N3    ? ? ? 1_555 A  G   743  N1    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog793  hydrog ? ? A  C   728  N4    ? ? ? 1_555 A  G   743  O6    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog794  hydrog ? ? A  C   728  O2    ? ? ? 1_555 A  G   743  N2    ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog795  hydrog ? ? A  C   729  N3    ? ? ? 1_555 A  G   742  N1    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog796  hydrog ? ? A  C   729  N4    ? ? ? 1_555 A  G   742  O6    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog797  hydrog ? ? A  C   729  O2    ? ? ? 1_555 A  G   742  N2    ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog798  hydrog ? ? A  G   730  N1    ? ? ? 1_555 A  C   741  N3    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog799  hydrog ? ? A  G   730  N2    ? ? ? 1_555 A  C   741  O2    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog800  hydrog ? ? A  G   730  O6    ? ? ? 1_555 A  C   741  N4    ? ? 0 G   730  0 C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog801  hydrog ? ? A  U   731  N3    ? ? ? 1_555 A  G   740  O6    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog802  hydrog ? ? A  U   731  O2    ? ? ? 1_555 A  G   740  N1    ? ? 0 U   731  0 G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog803  hydrog ? ? A  C   732  N3    ? ? ? 1_555 A  G   739  N1    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog804  hydrog ? ? A  C   732  N4    ? ? ? 1_555 A  G   739  O6    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog805  hydrog ? ? A  C   732  O2    ? ? ? 1_555 A  G   739  N2    ? ? 0 C   732  0 G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog806  hydrog ? ? A  U   733  N3    ? ? ? 1_555 A  G   738  O6    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog807  hydrog ? ? A  U   733  O2    ? ? ? 1_555 A  G   738  N1    ? ? 0 U   733  0 G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog808  hydrog ? ? A  C   762  N3    ? ? ? 1_555 A  G   902  N1    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog809  hydrog ? ? A  C   762  N4    ? ? ? 1_555 A  G   902  O6    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog810  hydrog ? ? A  C   762  O2    ? ? ? 1_555 A  G   902  N2    ? ? 0 C   762  0 G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog811  hydrog ? ? A  C   763  N3    ? ? ? 1_555 A  G   901  N1    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog812  hydrog ? ? A  C   763  N4    ? ? ? 1_555 A  G   901  O6    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog813  hydrog ? ? A  C   763  O2    ? ? ? 1_555 A  G   901  N2    ? ? 0 C   763  0 G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog814  hydrog ? ? A  C   764  N4    ? ? ? 1_555 A  U   900  O4    ? ? 0 C   764  0 U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog815  hydrog ? ? A  G   765  N1    ? ? ? 1_555 A  C   899  N3    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog816  hydrog ? ? A  G   765  N2    ? ? ? 1_555 A  C   899  O2    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog817  hydrog ? ? A  G   765  O6    ? ? ? 1_555 A  C   899  N4    ? ? 0 G   765  0 C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog818  hydrog ? ? A  A   766  N6    ? ? ? 1_555 A  C   896  N3    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog819  hydrog ? ? A  A   766  N7    ? ? ? 1_555 A  C   896  N4    ? ? 0 A   766  0 C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog820  hydrog ? ? A  A   767  N6    ? ? ? 1_555 A  A   895  N1    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog821  hydrog ? ? A  A   767  N7    ? ? ? 1_555 A  A   895  N6    ? ? 0 A   767  0 A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog822  hydrog ? ? A  A   767  N3    ? ? ? 1_555 A  G   2110 N2    ? ? 0 A   767  0 G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog823  hydrog ? ? A  U   768  O4    ? ? ? 1_555 A  C   893  N4    ? ? 0 U   768  0 C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog824  hydrog ? ? A  C   769  N3    ? ? ? 1_555 A  G   892  N1    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog825  hydrog ? ? A  C   769  N4    ? ? ? 1_555 A  G   892  O6    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog826  hydrog ? ? A  C   769  O2    ? ? ? 1_555 A  G   892  N2    ? ? 0 C   769  0 G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog827  hydrog ? ? A  C   770  N3    ? ? ? 1_555 A  G   891  N1    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog828  hydrog ? ? A  C   770  N4    ? ? ? 1_555 A  G   891  O6    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog829  hydrog ? ? A  C   770  O2    ? ? ? 1_555 A  G   891  N2    ? ? 0 C   770  0 G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog830  hydrog ? ? A  G   771  N1    ? ? ? 1_555 A  C   890  N3    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog831  hydrog ? ? A  G   771  N2    ? ? ? 1_555 A  C   890  O2    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog832  hydrog ? ? A  G   771  O6    ? ? ? 1_555 A  C   890  N4    ? ? 0 G   771  0 C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog833  hydrog ? ? A  G   772  N1    ? ? ? 1_555 A  C   889  N3    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog834  hydrog ? ? A  G   772  N2    ? ? ? 1_555 A  C   889  O2    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog835  hydrog ? ? A  G   772  O6    ? ? ? 1_555 A  C   889  N4    ? ? 0 G   772  0 C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog836  hydrog ? ? A  A   773  N1    ? ? ? 1_555 A  U   888  N3    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog837  hydrog ? ? A  A   773  N6    ? ? ? 1_555 A  U   888  O4    ? ? 0 A   773  0 U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog838  hydrog ? ? A  C   774  N3    ? ? ? 1_555 A  G   887  N1    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog839  hydrog ? ? A  C   774  N4    ? ? ? 1_555 A  G   887  O6    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog840  hydrog ? ? A  C   774  O2    ? ? ? 1_555 A  G   887  N2    ? ? 0 C   774  0 G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog841  hydrog ? ? A  G   775  N1    ? ? ? 1_555 A  G   868  N7    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog842  hydrog ? ? A  G   775  N2    ? ? ? 1_555 A  G   868  O6    ? ? 0 G   775  0 G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog843  hydrog ? ? A  A   776  N3    ? ? ? 1_555 A  U   779  N3    ? ? 0 A   776  0 U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog844  hydrog ? ? A  A   776  N1    ? ? ? 1_555 A  G   871  N2    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog845  hydrog ? ? A  A   776  N6    ? ? ? 1_555 A  G   871  N3    ? ? 0 A   776  0 G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog846  hydrog ? ? A  C   778  O2    ? ? ? 1_555 A  A   1836 N6    ? ? 0 C   778  0 A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog847  hydrog ? ? A  A   780  N1    ? ? ? 1_555 A  U   866  N3    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog848  hydrog ? ? A  A   780  N6    ? ? ? 1_555 A  U   866  O4    ? ? 0 A   780  0 U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog849  hydrog ? ? A  C   781  N3    ? ? ? 1_555 A  G   865  N1    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog850  hydrog ? ? A  C   781  N4    ? ? ? 1_555 A  G   865  O6    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog851  hydrog ? ? A  C   781  O2    ? ? ? 1_555 A  G   865  N2    ? ? 0 C   781  0 G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog852  hydrog ? ? A  G   782  N1    ? ? ? 1_555 A  U   864  O2    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog853  hydrog ? ? A  G   782  O6    ? ? ? 1_555 A  U   864  N3    ? ? 0 G   782  0 U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog854  hydrog ? ? A  C   783  N3    ? ? ? 1_555 A  G   863  N1    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog855  hydrog ? ? A  C   783  N4    ? ? ? 1_555 A  G   863  O6    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog856  hydrog ? ? A  C   783  O2    ? ? ? 1_555 A  G   863  N2    ? ? 0 C   783  0 G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog857  hydrog ? ? A  A   784  N1    ? ? ? 1_555 A  U   862  N3    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog858  hydrog ? ? A  A   784  N6    ? ? ? 1_555 A  U   862  O4    ? ? 0 A   784  0 U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog859  hydrog ? ? A  U   785  N3    ? ? ? 1_555 A  A   861  N1    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog860  hydrog ? ? A  U   785  O4    ? ? ? 1_555 A  A   861  N6    ? ? 0 U   785  0 A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog861  hydrog ? ? A  G   786  N1    ? ? ? 1_555 A  U   860  O2    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog862  hydrog ? ? A  G   786  O6    ? ? ? 1_555 A  U   860  N3    ? ? 0 G   786  0 U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog863  hydrog ? ? A  G   787  N1    ? ? ? 1_555 A  C   859  N3    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog864  hydrog ? ? A  G   787  N2    ? ? ? 1_555 A  C   859  O2    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog865  hydrog ? ? A  G   787  O6    ? ? ? 1_555 A  C   859  N4    ? ? 0 G   787  0 C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog866  hydrog ? ? A  A   788  N1    ? ? ? 1_555 A  U   858  N3    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog867  hydrog ? ? A  A   788  N6    ? ? ? 1_555 A  U   858  O4    ? ? 0 A   788  0 U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog868  hydrog ? ? A  C   789  N3    ? ? ? 1_555 A  G   856  N1    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog869  hydrog ? ? A  C   789  N4    ? ? ? 1_555 A  G   856  O6    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog870  hydrog ? ? A  C   789  O2    ? ? ? 1_555 A  G   856  N2    ? ? 0 C   789  0 G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog871  hydrog ? ? A  A   790  N6    ? ? ? 1_555 A  G   824  N3    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog872  hydrog ? ? A  A   790  N7    ? ? ? 1_555 A  G   824  N2    ? ? 0 A   790  0 G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog873  hydrog ? ? A  A   790  N1    ? ? ? 1_555 A  G   1709 N2    ? ? 0 A   790  0 G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog874  hydrog ? ? A  A   791  N1    ? ? ? 1_555 A  U   823  N3    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog875  hydrog ? ? A  A   791  N6    ? ? ? 1_555 A  U   823  O4    ? ? 0 A   791  0 U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog876  hydrog ? ? A  G   792  N1    ? ? ? 1_555 A  C   822  N3    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog877  hydrog ? ? A  G   792  N2    ? ? ? 1_555 A  C   822  O2    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog878  hydrog ? ? A  G   792  O6    ? ? ? 1_555 A  C   822  N4    ? ? 0 G   792  0 C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog879  hydrog ? ? A  A   793  N1    ? ? ? 1_555 A  U   821  N3    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog880  hydrog ? ? A  A   793  N6    ? ? ? 1_555 A  U   821  O4    ? ? 0 A   793  0 U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog881  hydrog ? ? A  U   794  O2    ? ? ? 1_555 A  A   818  N6    ? ? 0 U   794  0 A   818  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog882  hydrog ? ? A  U   794  N3    ? ? ? 1_555 A  A   819  N1    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog883  hydrog ? ? A  U   794  O4    ? ? ? 1_555 A  A   819  N6    ? ? 0 U   794  0 A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog884  hydrog ? ? A  G   795  N2    ? ? ? 1_555 A  A   818  N7    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog885  hydrog ? ? A  G   795  N3    ? ? ? 1_555 A  A   818  N6    ? ? 0 G   795  0 A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog886  hydrog ? ? A  A   796  N6    ? ? ? 1_555 A  G   817  N3    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog887  hydrog ? ? A  A   796  N7    ? ? ? 1_555 A  G   817  N2    ? ? 0 A   796  0 G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog888  hydrog ? ? A  A   797  N6    ? ? ? 1_555 A  G   816  N3    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog889  hydrog ? ? A  A   797  N7    ? ? ? 1_555 A  G   816  N2    ? ? 0 A   797  0 G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog890  hydrog ? ? A  G   798  N1    ? ? ? 1_555 A  U   815  O2    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog891  hydrog ? ? A  G   798  O6    ? ? ? 1_555 A  U   815  N3    ? ? 0 G   798  0 U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog892  hydrog ? ? A  C   799  N3    ? ? ? 1_555 A  G   814  N1    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog893  hydrog ? ? A  C   799  N4    ? ? ? 1_555 A  G   814  O6    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog894  hydrog ? ? A  C   799  O2    ? ? ? 1_555 A  G   814  N2    ? ? 0 C   799  0 G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog895  hydrog ? ? A  G   800  N1    ? ? ? 1_555 A  C   813  N3    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog896  hydrog ? ? A  G   800  N2    ? ? ? 1_555 A  C   813  O2    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog897  hydrog ? ? A  G   800  O6    ? ? ? 1_555 A  C   813  N4    ? ? 0 G   800  0 C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog898  hydrog ? ? A  U   801  N3    ? ? ? 1_555 A  A   812  N1    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog899  hydrog ? ? A  U   801  O4    ? ? ? 1_555 A  A   812  N6    ? ? 0 U   801  0 A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog900  hydrog ? ? A  G   802  N1    ? ? ? 1_555 A  C   811  N3    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog901  hydrog ? ? A  G   802  N2    ? ? ? 1_555 A  C   811  O2    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog902  hydrog ? ? A  G   802  O6    ? ? ? 1_555 A  C   811  N4    ? ? 0 G   802  0 C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog903  hydrog ? ? A  C   803  N3    ? ? ? 1_555 A  G   810  N1    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog904  hydrog ? ? A  C   803  N4    ? ? ? 1_555 A  G   810  O6    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog905  hydrog ? ? A  C   803  O2    ? ? ? 1_555 A  G   810  N2    ? ? 0 C   803  0 G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog906  hydrog ? ? A  C   804  N3    ? ? ? 1_555 A  G   809  N1    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog907  hydrog ? ? A  C   804  N4    ? ? ? 1_555 A  G   809  O6    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog908  hydrog ? ? A  C   804  O2    ? ? ? 1_555 A  G   809  N2    ? ? 0 C   804  0 G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog909  hydrog ? ? A  G   805  N2    ? ? ? 1_555 A  A   808  N7    ? ? 0 G   805  0 A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog910  hydrog ? ? A  G   820  N1    ? ? ? 1_555 A  C   1830 N3    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog911  hydrog ? ? A  G   820  N2    ? ? ? 1_555 A  C   1830 O2    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog912  hydrog ? ? A  G   820  O6    ? ? ? 1_555 A  C   1830 N4    ? ? 0 G   820  0 C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog913  hydrog ? ? A  A   827  N6    ? ? ? 1_555 A  G   854  N3    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog914  hydrog ? ? A  A   827  N7    ? ? ? 1_555 A  G   854  N2    ? ? 0 A   827  0 G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog915  hydrog ? ? A  G   828  N1    ? ? ? 1_555 A  C   853  N3    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog916  hydrog ? ? A  G   828  N2    ? ? ? 1_555 A  C   853  O2    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog917  hydrog ? ? A  G   828  O6    ? ? ? 1_555 A  C   853  N4    ? ? 0 G   828  0 C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog918  hydrog ? ? A  A   829  N1    ? ? ? 1_555 A  U   852  N3    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog919  hydrog ? ? A  A   829  N6    ? ? ? 1_555 A  U   852  O4    ? ? 0 A   829  0 U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog920  hydrog ? ? A  G   830  N1    ? ? ? 1_555 A  C   851  N3    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog921  hydrog ? ? A  G   830  N2    ? ? ? 1_555 A  C   851  O2    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog922  hydrog ? ? A  G   830  O6    ? ? ? 1_555 A  C   851  N4    ? ? 0 G   830  0 C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog923  hydrog ? ? A  G   830  N2    ? ? ? 1_555 A  A   2022 N1    ? ? 0 G   830  0 A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog924  hydrog ? ? A  U   832  N3    ? ? ? 1_555 A  U   850  O2    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog925  hydrog ? ? A  U   832  O4    ? ? ? 1_555 A  U   850  N3    ? ? 0 U   832  0 U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog926  hydrog ? ? A  G   833  N1    ? ? ? 1_555 A  C   849  N3    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog927  hydrog ? ? A  G   833  N2    ? ? ? 1_555 A  C   849  O2    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog928  hydrog ? ? A  G   833  O6    ? ? ? 1_555 A  C   849  N4    ? ? 0 G   833  0 C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog929  hydrog ? ? A  G   834  N1    ? ? ? 1_555 A  C   848  N3    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog930  hydrog ? ? A  G   834  N2    ? ? ? 1_555 A  C   848  O2    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog931  hydrog ? ? A  G   834  O6    ? ? ? 1_555 A  C   848  N4    ? ? 0 G   834  0 C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog932  hydrog ? ? A  G   836  N1    ? ? ? 1_555 A  C   847  N3    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog933  hydrog ? ? A  G   836  N2    ? ? ? 1_555 A  C   847  O2    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog934  hydrog ? ? A  G   836  O6    ? ? ? 1_555 A  C   847  N4    ? ? 0 G   836  0 C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog935  hydrog ? ? A  U   837  N3    ? ? ? 1_555 A  A   846  N1    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog936  hydrog ? ? A  U   837  O4    ? ? ? 1_555 A  A   846  N6    ? ? 0 U   837  0 A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog937  hydrog ? ? A  C   838  O2    ? ? ? 1_555 A  A   843  N6    ? ? 0 C   838  0 A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog938  hydrog ? ? A  U   840  N3    ? ? ? 1_555 A  A   2055 N3    ? ? 0 U   840  0 A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog939  hydrog ? ? A  C   842  N4    ? ? ? 1_555 A  A   846  N3    ? ? 0 C   842  0 A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog940  hydrog ? ? A  A   857  N6    ? ? ? 1_555 A  U   1831 O4    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog941  hydrog ? ? A  A   857  N7    ? ? ? 1_555 A  U   1831 N3    ? ? 0 A   857  0 U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog942  hydrog ? ? A  A   857  N6    ? ? ? 1_555 A  A   1845 N3    ? ? 0 A   857  0 A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog943  hydrog ? ? A  A   861  N3    ? ? ? 1_555 A  U   1488 N3    ? ? 0 A   861  0 U   1488 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog944  hydrog ? ? A  G   863  N2    ? ? ? 1_555 A  A   1459 N3    ? ? 0 G   863  0 A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog945  hydrog ? ? A  A   867  N3    ? ? ? 1_555 A  G   870  N2    ? ? 0 A   867  0 G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog946  hydrog ? ? A  G   868  N1    ? ? ? 1_555 A  C   884  N3    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog947  hydrog ? ? A  G   868  N2    ? ? ? 1_555 A  C   884  O2    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog948  hydrog ? ? A  G   868  O6    ? ? ? 1_555 A  C   884  N4    ? ? 0 G   868  0 C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog949  hydrog ? ? A  G   870  N1    ? ? ? 1_555 A  C   880  N3    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog950  hydrog ? ? A  G   870  N2    ? ? ? 1_555 A  C   880  O2    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog951  hydrog ? ? A  G   870  O6    ? ? ? 1_555 A  C   880  N4    ? ? 0 G   870  0 C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog952  hydrog ? ? A  G   871  N1    ? ? ? 1_555 A  C   879  N3    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog953  hydrog ? ? A  G   871  N2    ? ? ? 1_555 A  C   879  O2    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog954  hydrog ? ? A  G   871  O6    ? ? ? 1_555 A  C   879  N4    ? ? 0 G   871  0 C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog955  hydrog ? ? A  U   872  N3    ? ? ? 1_555 A  G   878  O6    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog956  hydrog ? ? A  U   872  O2    ? ? ? 1_555 A  G   878  N1    ? ? 0 U   872  0 G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog957  hydrog ? ? A  G   873  N2    ? ? ? 1_555 A  A   876  N1    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog958  hydrog ? ? A  G   873  N3    ? ? ? 1_555 A  A   876  N6    ? ? 0 G   873  0 A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog959  hydrog ? ? A  A   874  N3    ? ? ? 1_555 A  G   1832 N2    ? ? 0 A   874  0 G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog960  hydrog ? ? A  G   885  N2    ? ? ? 1_555 A  G   2113 N3    ? ? 0 G   885  0 G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog961  hydrog ? ? A  U   900  O2    ? ? ? 1_555 A  A   2101 N6    ? ? 0 U   900  0 A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog962  hydrog ? ? A  G   901  N2    ? ? ? 1_555 A  A   1358 N3    ? ? 0 G   901  0 A   1358 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog963  hydrog ? ? A  C   905  N3    ? ? ? 1_555 A  G   1300 N1    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog964  hydrog ? ? A  C   905  N4    ? ? ? 1_555 A  G   1300 O6    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog965  hydrog ? ? A  C   905  O2    ? ? ? 1_555 A  G   1300 N2    ? ? 0 C   905  0 G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog966  hydrog ? ? A  C   906  N3    ? ? ? 1_555 A  G   1299 N1    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog967  hydrog ? ? A  C   906  N4    ? ? ? 1_555 A  G   1299 O6    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog968  hydrog ? ? A  C   906  O2    ? ? ? 1_555 A  G   1299 N2    ? ? 0 C   906  0 G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog969  hydrog ? ? A  C   906  O2    ? ? ? 1_555 A  G   1329 N2    ? ? 0 C   906  0 G   1329 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog970  hydrog ? ? A  A   907  N1    ? ? ? 1_555 A  U   1298 N3    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog971  hydrog ? ? A  A   907  N6    ? ? ? 1_555 A  U   1298 O4    ? ? 0 A   907  0 U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog972  hydrog ? ? A  A   908  N1    ? ? ? 1_555 A  U   1297 N3    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog973  hydrog ? ? A  A   908  N6    ? ? ? 1_555 A  U   1297 O4    ? ? 0 A   908  0 U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog974  hydrog ? ? A  U   909  N3    ? ? ? 1_555 A  A   1296 N1    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog975  hydrog ? ? A  U   909  O4    ? ? ? 1_555 A  A   1296 N6    ? ? 0 U   909  0 A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog976  hydrog ? ? A  C   910  N3    ? ? ? 1_555 A  G   1295 N1    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog977  hydrog ? ? A  C   910  N4    ? ? ? 1_555 A  G   1295 O6    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog978  hydrog ? ? A  C   910  O2    ? ? ? 1_555 A  G   1295 N2    ? ? 0 C   910  0 G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog979  hydrog ? ? A  G   911  N2    ? ? ? 1_555 A  A   1294 N7    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog980  hydrog ? ? A  G   911  N3    ? ? ? 1_555 A  A   1294 N6    ? ? 0 G   911  0 A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog981  hydrog ? ? A  A   912  N6    ? ? ? 1_555 A  U   1293 O2    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog982  hydrog ? ? A  A   912  N7    ? ? ? 1_555 A  U   1293 N3    ? ? 0 A   912  0 U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog983  hydrog ? ? A  A   913  N6    ? ? ? 1_555 A  G   1071 O6    ? ? 0 A   913  0 G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog984  hydrog ? ? A  A   914  N6    ? ? ? 1_555 A  A   1070 N3    ? ? 0 A   914  0 A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog985  hydrog ? ? A  C   915  N3    ? ? ? 1_555 A  G   928  N1    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog986  hydrog ? ? A  C   915  N4    ? ? ? 1_555 A  G   928  O6    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog987  hydrog ? ? A  C   915  O2    ? ? ? 1_555 A  G   928  N2    ? ? 0 C   915  0 G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog988  hydrog ? ? A  C   915  N4    ? ? ? 1_555 A  U   1042 O2    ? ? 0 C   915  0 U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog989  hydrog ? ? A  A   916  N1    ? ? ? 1_555 A  U   927  N3    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog990  hydrog ? ? A  A   916  N6    ? ? ? 1_555 A  U   927  O4    ? ? 0 A   916  0 U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog991  hydrog ? ? A  U   917  N3    ? ? ? 1_555 A  A   926  N1    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog992  hydrog ? ? A  U   917  O4    ? ? ? 1_555 A  A   926  N6    ? ? 0 U   917  0 A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog993  hydrog ? ? A  G   918  N1    ? ? ? 1_555 A  C   925  N3    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog994  hydrog ? ? A  G   918  N2    ? ? ? 1_555 A  C   925  O2    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog995  hydrog ? ? A  G   918  O6    ? ? ? 1_555 A  C   925  N4    ? ? 0 G   918  0 C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog996  hydrog ? ? A  U   919  N3    ? ? ? 1_555 A  G   924  O6    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog997  hydrog ? ? A  U   919  O2    ? ? ? 1_555 A  G   924  N1    ? ? 0 U   919  0 G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog998  hydrog ? ? A  G   921  O6    ? ? ? 1_555 A  G   2279 N2    ? ? 0 G   921  0 G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog999  hydrog ? ? A  A   923  N6    ? ? ? 1_555 A  U   2107 O2    ? ? 0 A   923  0 U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1000 hydrog ? ? A  A   923  N6    ? ? ? 1_555 A  G   2480 N3    ? ? 0 A   923  0 G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1001 hydrog ? ? A  A   926  N6    ? ? ? 1_555 A  C   1043 N3    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1002 hydrog ? ? A  A   926  N7    ? ? ? 1_555 A  C   1043 N4    ? ? 0 A   926  0 C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1003 hydrog ? ? A  G   928  N2    ? ? ? 1_555 A  A   2394 N1    ? ? 0 G   928  0 A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1004 hydrog ? ? A  A   929  N6    ? ? ? 1_555 A  U   1041 O4    ? ? 0 A   929  0 U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1005 hydrog ? ? A  C   930  O2    ? ? ? 1_555 A  A   1040 N6    ? ? 0 C   930  0 A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1006 hydrog ? ? A  C   931  N3    ? ? ? 1_555 A  G   1039 N1    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1007 hydrog ? ? A  C   931  N4    ? ? ? 1_555 A  G   1039 O6    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1008 hydrog ? ? A  C   931  O2    ? ? ? 1_555 A  G   1039 N2    ? ? 0 C   931  0 G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1009 hydrog ? ? A  U   932  N3    ? ? ? 1_555 A  G   1038 O6    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1010 hydrog ? ? A  U   932  O2    ? ? ? 1_555 A  G   1038 N1    ? ? 0 U   932  0 G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1011 hydrog ? ? A  C   933  N3    ? ? ? 1_555 A  G   1037 N1    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1012 hydrog ? ? A  C   933  N4    ? ? ? 1_555 A  G   1037 O6    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1013 hydrog ? ? A  C   933  O2    ? ? ? 1_555 A  G   1037 N2    ? ? 0 C   933  0 G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1014 hydrog ? ? A  C   934  N3    ? ? ? 1_555 A  G   1036 N1    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1015 hydrog ? ? A  C   934  N4    ? ? ? 1_555 A  G   1036 O6    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1016 hydrog ? ? A  C   934  O2    ? ? ? 1_555 A  G   1036 N2    ? ? 0 C   934  0 G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1017 hydrog ? ? A  G   935  N1    ? ? ? 1_555 A  C   1035 N3    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1018 hydrog ? ? A  G   935  N2    ? ? ? 1_555 A  C   1035 O2    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1019 hydrog ? ? A  G   935  O6    ? ? ? 1_555 A  C   1035 N4    ? ? 0 G   935  0 C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1020 hydrog ? ? A  C   936  N3    ? ? ? 1_555 A  G   1034 N1    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1021 hydrog ? ? A  C   936  N4    ? ? ? 1_555 A  G   1034 O6    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1022 hydrog ? ? A  C   936  O2    ? ? ? 1_555 A  G   1034 N2    ? ? 0 C   936  0 G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1023 hydrog ? ? A  C   937  O2    ? ? ? 1_555 A  C   1033 N4    ? ? 0 C   937  0 C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1024 hydrog ? ? A  G   938  N2    ? ? ? 1_555 A  A   1032 N7    ? ? 0 G   938  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1025 hydrog ? ? A  A   939  N3    ? ? ? 1_555 A  G   1027 N2    ? ? 0 A   939  0 G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1026 hydrog ? ? A  A   939  N6    ? ? ? 1_555 A  G   1031 N3    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1027 hydrog ? ? A  A   939  N7    ? ? ? 1_555 A  G   1031 N2    ? ? 0 A   939  0 G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1028 hydrog ? ? A  G   940  N1    ? ? ? 1_555 A  U   1026 O2    ? ? 0 G   940  0 U   1026 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1029 hydrog ? ? A  G   940  O6    ? ? ? 1_555 A  U   1026 N3    ? ? 0 G   940  0 U   1026 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1030 hydrog ? ? A  G   940  N2    ? ? ? 1_555 A  A   1032 N3    ? ? 0 G   940  0 A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1031 hydrog ? ? A  G   941  N1    ? ? ? 1_555 A  C   1025 N3    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1032 hydrog ? ? A  G   941  N2    ? ? ? 1_555 A  C   1025 O2    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1033 hydrog ? ? A  G   941  O6    ? ? ? 1_555 A  C   1025 N4    ? ? 0 G   941  0 C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1034 hydrog ? ? A  U   942  N3    ? ? ? 1_555 A  G   1024 O6    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1035 hydrog ? ? A  U   942  O2    ? ? ? 1_555 A  G   1024 N1    ? ? 0 U   942  0 G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1036 hydrog ? ? A  A   943  N6    ? ? ? 1_555 A  C   1025 O2    ? ? 0 A   943  0 C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1037 hydrog ? ? A  G   944  N1    ? ? ? 1_555 A  C   1023 N3    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1038 hydrog ? ? A  G   944  N2    ? ? ? 1_555 A  C   1023 O2    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1039 hydrog ? ? A  G   944  O6    ? ? ? 1_555 A  C   1023 N4    ? ? 0 G   944  0 C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1040 hydrog ? ? A  U   945  N3    ? ? ? 1_555 A  A   1022 N1    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1041 hydrog ? ? A  U   945  O4    ? ? ? 1_555 A  A   1022 N6    ? ? 0 U   945  0 A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1042 hydrog ? ? A  C   946  N3    ? ? ? 1_555 A  G   1021 N1    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1043 hydrog ? ? A  C   946  N4    ? ? ? 1_555 A  G   1021 O6    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1044 hydrog ? ? A  C   946  O2    ? ? ? 1_555 A  G   1021 N2    ? ? 0 C   946  0 G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1045 hydrog ? ? A  U   947  N3    ? ? ? 1_555 A  A   1020 N1    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1046 hydrog ? ? A  U   947  O4    ? ? ? 1_555 A  A   1020 N6    ? ? 0 U   947  0 A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1047 hydrog ? ? A  G   948  N1    ? ? ? 1_555 A  C   1019 N3    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1048 hydrog ? ? A  G   948  N2    ? ? ? 1_555 A  C   1019 O2    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1049 hydrog ? ? A  G   948  O6    ? ? ? 1_555 A  C   1019 N4    ? ? 0 G   948  0 C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1050 hydrog ? ? A  U   949  N3    ? ? ? 1_555 A  A   1018 N1    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1051 hydrog ? ? A  U   949  O4    ? ? ? 1_555 A  A   1018 N6    ? ? 0 U   949  0 A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1052 hydrog ? ? A  G   950  N1    ? ? ? 1_555 A  U   1017 O2    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1053 hydrog ? ? A  G   950  O6    ? ? ? 1_555 A  U   1017 N3    ? ? 0 G   950  0 U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1054 hydrog ? ? A  A   951  N1    ? ? ? 1_555 A  U   1016 N3    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1055 hydrog ? ? A  A   951  N6    ? ? ? 1_555 A  U   1016 O4    ? ? 0 A   951  0 U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1056 hydrog ? ? A  G   952  N1    ? ? ? 1_555 A  C   1015 N3    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1057 hydrog ? ? A  G   952  N2    ? ? ? 1_555 A  C   1015 O2    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1058 hydrog ? ? A  G   952  O6    ? ? ? 1_555 A  C   1015 N4    ? ? 0 G   952  0 C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1059 hydrog ? ? A  G   953  N2    ? ? ? 1_555 A  U   954  O4    ? ? 0 G   953  0 U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1060 hydrog ? ? A  U   954  N3    ? ? ? 1_555 A  A   1013 N7    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1061 hydrog ? ? A  U   954  O2    ? ? ? 1_555 A  A   1013 N6    ? ? 0 U   954  0 A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1062 hydrog ? ? A  A   955  N6    ? ? ? 1_555 A  A   1012 N3    ? ? 0 A   955  0 A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1063 hydrog ? ? A  G   956  N1    ? ? ? 1_555 A  C   1011 N3    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1064 hydrog ? ? A  G   956  N2    ? ? ? 1_555 A  C   1011 O2    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1065 hydrog ? ? A  G   956  O6    ? ? ? 1_555 A  C   1011 N4    ? ? 0 G   956  0 C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1066 hydrog ? ? A  A   957  N1    ? ? ? 1_555 A  U   1009 N3    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1067 hydrog ? ? A  A   957  N6    ? ? ? 1_555 A  U   1009 O4    ? ? 0 A   957  0 U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1068 hydrog ? ? A  G   958  N2    ? ? ? 1_555 A  A   961  N1    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1069 hydrog ? ? A  G   958  N3    ? ? ? 1_555 A  A   961  N6    ? ? 0 G   958  0 A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1070 hydrog ? ? A  G   958  N1    ? ? ? 1_555 A  C   1008 N3    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1071 hydrog ? ? A  G   958  N2    ? ? ? 1_555 A  C   1008 O2    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1072 hydrog ? ? A  G   958  O6    ? ? ? 1_555 A  C   1008 N4    ? ? 0 G   958  0 C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1073 hydrog ? ? A  C   959  O2    ? ? ? 1_555 A  C   963  N4    ? ? 0 C   959  0 C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1074 hydrog ? ? A  C   959  N3    ? ? ? 1_555 A  A   1005 N6    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1075 hydrog ? ? A  C   959  N4    ? ? ? 1_555 A  A   1005 N7    ? ? 0 C   959  0 A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1076 hydrog ? ? A  C   962  N4    ? ? ? 1_555 A  C   1008 O2    ? ? 0 C   962  0 C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1077 hydrog ? ? A  C   963  O2    ? ? ? 1_555 A  A   1005 N6    ? ? 0 C   963  0 A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1078 hydrog ? ? A  G   964  N1    ? ? ? 1_555 A  C   1004 N3    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1079 hydrog ? ? A  G   964  N2    ? ? ? 1_555 A  C   1004 O2    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1080 hydrog ? ? A  G   964  O6    ? ? ? 1_555 A  C   1004 N4    ? ? 0 G   964  0 C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1081 hydrog ? ? A  A   965  N1    ? ? ? 1_555 A  U   1003 N3    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1082 hydrog ? ? A  A   965  N6    ? ? ? 1_555 A  U   1003 O4    ? ? 0 A   965  0 U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1083 hydrog ? ? A  U   966  O2    ? ? ? 1_555 A  G   1002 N1    ? ? 0 U   966  0 G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1084 hydrog ? ? A  U   967  N3    ? ? ? 1_555 A  U   1001 O2    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1085 hydrog ? ? A  U   967  O4    ? ? ? 1_555 A  U   1001 N3    ? ? 0 U   967  0 U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1086 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   1000 N3    ? ? 0 G   968  0 C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1087 hydrog ? ? A  G   969  N2    ? ? ? 1_555 A  C   999  N3    ? ? 0 G   969  0 C   999  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1088 hydrog ? ? A  U   1009 O2    ? ? ? 1_555 A  C   1010 N4    ? ? 0 U   1009 0 C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1089 hydrog ? ? A  A   1014 N6    ? ? ? 1_555 A  A   2302 N7    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1090 hydrog ? ? A  A   1014 N7    ? ? ? 1_555 A  A   2302 N6    ? ? 0 A   1014 0 A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1091 hydrog ? ? A  G   1045 N1    ? ? ? 1_555 A  C   1069 N3    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1092 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  C   1069 O2    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1093 hydrog ? ? A  G   1045 O6    ? ? ? 1_555 A  C   1069 N4    ? ? 0 G   1045 0 C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1094 hydrog ? ? A  G   1046 N1    ? ? ? 1_555 A  C   1068 N3    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1095 hydrog ? ? A  G   1046 N2    ? ? ? 1_555 A  C   1068 O2    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1096 hydrog ? ? A  G   1046 O6    ? ? ? 1_555 A  C   1068 N4    ? ? 0 G   1046 0 C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1097 hydrog ? ? A  G   1046 N2    ? ? ? 1_555 A  A   1082 N3    ? ? 0 G   1046 0 A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1098 hydrog ? ? A  U   1047 N3    ? ? ? 1_555 A  A   1067 N1    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1099 hydrog ? ? A  U   1047 O4    ? ? ? 1_555 A  A   1067 N6    ? ? 0 U   1047 0 A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1100 hydrog ? ? A  G   1048 N1    ? ? ? 1_555 A  U   1066 O2    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1101 hydrog ? ? A  G   1048 O6    ? ? ? 1_555 A  U   1066 N3    ? ? 0 G   1048 0 U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1102 hydrog ? ? A  C   1049 N3    ? ? ? 1_555 A  G   1065 N1    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1103 hydrog ? ? A  C   1049 N4    ? ? ? 1_555 A  G   1065 O6    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1104 hydrog ? ? A  C   1049 O2    ? ? ? 1_555 A  G   1065 N2    ? ? 0 C   1049 0 G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1105 hydrog ? ? A  G   1050 N1    ? ? ? 1_555 A  U   1064 O2    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1106 hydrog ? ? A  G   1050 O6    ? ? ? 1_555 A  U   1064 N3    ? ? 0 G   1050 0 U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1107 hydrog ? ? A  C   1051 N3    ? ? ? 1_555 A  G   1063 N1    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1108 hydrog ? ? A  C   1051 N4    ? ? ? 1_555 A  G   1063 O6    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1109 hydrog ? ? A  C   1051 O2    ? ? ? 1_555 A  G   1063 N2    ? ? 0 C   1051 0 G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1110 hydrog ? ? A  G   1052 N1    ? ? ? 1_555 A  U   1062 O2    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1111 hydrog ? ? A  G   1052 O6    ? ? ? 1_555 A  U   1062 N3    ? ? 0 G   1052 0 U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1112 hydrog ? ? A  G   1053 N1    ? ? ? 1_555 A  C   1061 N3    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1113 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  C   1061 O2    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1114 hydrog ? ? A  G   1053 O6    ? ? ? 1_555 A  C   1061 N4    ? ? 0 G   1053 0 C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1115 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  U   2308 O2    ? ? 0 G   1053 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1116 hydrog ? ? A  G   1054 N1    ? ? ? 1_555 A  C   1060 N3    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1117 hydrog ? ? A  G   1054 N2    ? ? ? 1_555 A  C   1060 O2    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1118 hydrog ? ? A  G   1054 O6    ? ? ? 1_555 A  C   1060 N4    ? ? 0 G   1054 0 C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1119 hydrog ? ? A  G   1054 N2    ? ? ? 1_555 A  G   2283 O6    ? ? 0 G   1054 0 G   2283 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1120 hydrog ? ? A  G   1055 N2    ? ? ? 1_555 A  A   1058 N7    ? ? 0 G   1055 0 A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1121 hydrog ? ? A  U   1056 O4    ? ? ? 1_555 A  G   2529 N2    ? ? 0 U   1056 0 G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1122 hydrog ? ? A  A   1057 N1    ? ? ? 1_555 A  G   2529 N2    ? ? 0 A   1057 0 G   2529 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1123 hydrog ? ? A  A   1058 N3    ? ? ? 1_555 A  G   2491 N2    ? ? 0 A   1058 0 G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1124 hydrog ? ? A  G   1063 N2    ? ? ? 1_555 A  A   2301 N7    ? ? 0 G   1063 0 A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1125 hydrog ? ? A  G   1072 N2    ? ? ? 1_555 A  A   1088 N7    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1126 hydrog ? ? A  G   1072 N3    ? ? ? 1_555 A  A   1088 N6    ? ? 0 G   1072 0 A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1127 hydrog ? ? A  A   1073 N6    ? ? ? 1_555 A  A   1086 N3    ? ? 0 A   1073 0 A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1128 hydrog ? ? A  A   1073 N7    ? ? ? 1_555 A  G   1087 N2    ? ? 0 A   1073 0 G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1129 hydrog ? ? A  G   1074 N1    ? ? ? 1_555 A  C   1085 N3    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1130 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  C   1085 O2    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1131 hydrog ? ? A  G   1074 O6    ? ? ? 1_555 A  C   1085 N4    ? ? 0 G   1074 0 C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1132 hydrog ? ? A  G   1075 N1    ? ? ? 1_555 A  C   1084 N3    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1133 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 A  C   1084 O2    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1134 hydrog ? ? A  G   1075 O6    ? ? ? 1_555 A  C   1084 N4    ? ? 0 G   1075 0 C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1135 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 A  A   1098 N3    ? ? 0 G   1075 0 A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1136 hydrog ? ? A  G   1076 N1    ? ? ? 1_555 A  C   1083 N3    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1137 hydrog ? ? A  G   1076 N2    ? ? ? 1_555 A  C   1083 O2    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1138 hydrog ? ? A  G   1076 O6    ? ? ? 1_555 A  C   1083 N4    ? ? 0 G   1076 0 C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1139 hydrog ? ? A  G   1076 N2    ? ? ? 1_555 F  U   87   O4    ? ? 0 G   1076 9 U   87   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1140 hydrog ? ? A  A   1079 N3    ? ? ? 1_555 A  G   2068 N2    ? ? 0 A   1079 0 G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1141 hydrog ? ? A  C   1083 O2    ? ? ? 1_555 A  A   1124 N6    ? ? 0 C   1083 0 A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1142 hydrog ? ? A  G   1089 N1    ? ? ? 1_555 A  C   1267 N3    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1143 hydrog ? ? A  G   1089 N2    ? ? ? 1_555 A  C   1267 O2    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1144 hydrog ? ? A  G   1089 O6    ? ? ? 1_555 A  C   1267 N4    ? ? 0 G   1089 0 C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1145 hydrog ? ? A  A   1090 N1    ? ? ? 1_555 A  U   1266 N3    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1146 hydrog ? ? A  A   1090 N6    ? ? ? 1_555 A  U   1266 O4    ? ? 0 A   1090 0 U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1147 hydrog ? ? A  U   1091 N3    ? ? ? 1_555 A  G   1265 O6    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1148 hydrog ? ? A  U   1091 O2    ? ? ? 1_555 A  G   1265 N1    ? ? 0 U   1091 0 G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1149 hydrog ? ? A  A   1092 N1    ? ? ? 1_555 A  U   1264 N3    ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1150 hydrog ? ? A  A   1092 N6    ? ? ? 1_555 A  U   1264 O4    ? ? 0 A   1092 0 U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1151 hydrog ? ? A  G   1093 N1    ? ? ? 1_555 A  C   1263 N3    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1152 hydrog ? ? A  G   1093 N2    ? ? ? 1_555 A  C   1263 O2    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1153 hydrog ? ? A  G   1093 O6    ? ? ? 1_555 A  C   1263 N4    ? ? 0 G   1093 0 C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1154 hydrog ? ? A  G   1094 N1    ? ? ? 1_555 A  C   1262 N3    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1155 hydrog ? ? A  G   1094 N2    ? ? ? 1_555 A  C   1262 O2    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1156 hydrog ? ? A  G   1094 O6    ? ? ? 1_555 A  C   1262 N4    ? ? 0 G   1094 0 C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1157 hydrog ? ? A  U   1095 N3    ? ? ? 1_555 A  A   1261 N1    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1158 hydrog ? ? A  U   1095 O4    ? ? ? 1_555 A  A   1261 N6    ? ? 0 U   1095 0 A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1159 hydrog ? ? A  U   1096 N3    ? ? ? 1_555 A  A   1259 N7    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1160 hydrog ? ? A  U   1096 O2    ? ? ? 1_555 A  A   1259 N6    ? ? 0 U   1096 0 A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1161 hydrog ? ? A  A   1098 N6    ? ? ? 1_555 A  G   1258 N3    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1162 hydrog ? ? A  A   1098 N7    ? ? ? 1_555 A  G   1258 N2    ? ? 0 A   1098 0 G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1163 hydrog ? ? A  G   1099 N1    ? ? ? 1_555 A  C   1257 N3    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1164 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  C   1257 O2    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1165 hydrog ? ? A  G   1099 O6    ? ? ? 1_555 A  C   1257 N4    ? ? 0 G   1099 0 C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1166 hydrog ? ? A  G   1100 N2    ? ? ? 1_555 A  A   1107 N3    ? ? 0 G   1100 0 A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1167 hydrog ? ? A  G   1100 N1    ? ? ? 1_555 A  C   1256 N3    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1168 hydrog ? ? A  G   1100 N2    ? ? ? 1_555 A  C   1256 O2    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1169 hydrog ? ? A  G   1100 O6    ? ? ? 1_555 A  C   1256 N4    ? ? 0 G   1100 0 C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1170 hydrog ? ? A  U   1101 N3    ? ? ? 1_555 A  A   1255 N1    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1171 hydrog ? ? A  U   1101 O4    ? ? ? 1_555 A  A   1255 N6    ? ? 0 U   1101 0 A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1172 hydrog ? ? A  C   1102 N3    ? ? ? 1_555 A  G   1241 N1    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1173 hydrog ? ? A  C   1102 N4    ? ? ? 1_555 A  G   1241 O6    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1174 hydrog ? ? A  C   1102 O2    ? ? ? 1_555 A  G   1241 N2    ? ? 0 C   1102 0 G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1175 hydrog ? ? A  C   1103 N3    ? ? ? 1_555 A  G   1240 N1    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1176 hydrog ? ? A  C   1103 N4    ? ? ? 1_555 A  G   1240 O6    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1177 hydrog ? ? A  C   1103 O2    ? ? ? 1_555 A  G   1240 N2    ? ? 0 C   1103 0 G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1178 hydrog ? ? A  C   1104 N3    ? ? ? 1_555 A  G   1239 N1    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1179 hydrog ? ? A  C   1104 N4    ? ? ? 1_555 A  G   1239 O6    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1180 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  G   1239 N2    ? ? 0 C   1104 0 G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1181 hydrog ? ? A  C   1105 O2    ? ? ? 1_555 A  A   1106 N6    ? ? 0 C   1105 0 A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1182 hydrog ? ? A  G   1108 N1    ? ? ? 1_555 A  C   1254 N3    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1183 hydrog ? ? A  G   1108 N2    ? ? ? 1_555 A  C   1254 O2    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1184 hydrog ? ? A  G   1108 O6    ? ? ? 1_555 A  C   1254 N4    ? ? 0 G   1108 0 C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1185 hydrog ? ? A  U   1109 N3    ? ? ? 1_555 A  A   1247 N7    ? ? 0 U   1109 0 A   1247 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1186 hydrog ? ? A  G   1110 N1    ? ? ? 1_555 A  C   1253 N3    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1187 hydrog ? ? A  G   1110 N2    ? ? ? 1_555 A  C   1253 O2    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1188 hydrog ? ? A  G   1110 O6    ? ? ? 1_555 A  C   1253 N4    ? ? 0 G   1110 0 C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1189 hydrog ? ? A  U   1111 N3    ? ? ? 1_555 A  A   1252 N1    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1190 hydrog ? ? A  U   1111 O4    ? ? ? 1_555 A  A   1252 N6    ? ? 0 U   1111 0 A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1191 hydrog ? ? A  G   1112 N1    ? ? ? 1_555 A  C   1251 N3    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1192 hydrog ? ? A  G   1112 N2    ? ? ? 1_555 A  C   1251 O2    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1193 hydrog ? ? A  G   1112 O6    ? ? ? 1_555 A  C   1251 N4    ? ? 0 G   1112 0 C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1194 hydrog ? ? A  G   1113 N1    ? ? ? 1_555 A  C   1250 N3    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1195 hydrog ? ? A  G   1113 N2    ? ? ? 1_555 A  C   1250 O2    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1196 hydrog ? ? A  G   1113 O6    ? ? ? 1_555 A  C   1250 N4    ? ? 0 G   1113 0 C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1197 hydrog ? ? A  A   1114 N1    ? ? ? 1_555 A  U   1249 N3    ? ? 0 A   1114 0 U   1249 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1198 hydrog ? ? A  U   1115 N3    ? ? ? 1_555 A  A   1248 N1    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1199 hydrog ? ? A  U   1115 O4    ? ? ? 1_555 A  A   1248 N6    ? ? 0 U   1115 0 A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1200 hydrog ? ? A  U   1116 O2    ? ? ? 1_555 A  A   1246 N6    ? ? 0 U   1116 0 A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1201 hydrog ? ? A  A   1118 N6    ? ? ? 1_555 A  U   1244 O2    ? ? 0 A   1118 0 U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1202 hydrog ? ? A  G   1119 N2    ? ? ? 1_555 A  U   1120 O4    ? ? 0 G   1119 0 U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1203 hydrog ? ? A  G   1121 N1    ? ? ? 1_555 A  C   1243 N3    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1204 hydrog ? ? A  G   1121 N2    ? ? ? 1_555 A  C   1243 O2    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1205 hydrog ? ? A  G   1121 O6    ? ? ? 1_555 A  C   1243 N4    ? ? 0 G   1121 0 C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1206 hydrog ? ? A  U   1122 N3    ? ? ? 1_555 A  A   1242 N1    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1207 hydrog ? ? A  U   1122 O4    ? ? ? 1_555 A  A   1242 N6    ? ? 0 U   1122 0 A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1208 hydrog ? ? A  A   1132 N6    ? ? ? 1_555 A  A   1230 N7    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1209 hydrog ? ? A  A   1132 N7    ? ? ? 1_555 A  A   1230 N6    ? ? 0 A   1132 0 A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1210 hydrog ? ? A  A   1133 N6    ? ? ? 1_555 A  C   1229 O2    ? ? 0 A   1133 0 C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1211 hydrog ? ? A  A   1133 N3    ? ? ? 1_555 A  G   2520 N2    ? ? 0 A   1133 0 G   2520 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1212 hydrog ? ? A  G   1134 N1    ? ? ? 1_555 A  C   1228 N3    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1213 hydrog ? ? A  G   1134 N2    ? ? ? 1_555 A  C   1228 O2    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1214 hydrog ? ? A  G   1134 O6    ? ? ? 1_555 A  C   1228 N4    ? ? 0 G   1134 0 C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1215 hydrog ? ? A  G   1135 N1    ? ? ? 1_555 A  C   1227 N3    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1216 hydrog ? ? A  G   1135 N2    ? ? ? 1_555 A  C   1227 O2    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1217 hydrog ? ? A  G   1135 O6    ? ? ? 1_555 A  C   1227 N4    ? ? 0 G   1135 0 C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1218 hydrog ? ? A  U   1136 N3    ? ? ? 1_555 A  G   1226 O6    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1219 hydrog ? ? A  U   1136 O2    ? ? ? 1_555 A  G   1226 N1    ? ? 0 U   1136 0 G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1220 hydrog ? ? A  G   1138 N1    ? ? ? 1_555 A  C   1225 N3    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1221 hydrog ? ? A  G   1138 N2    ? ? ? 1_555 A  C   1225 O2    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1222 hydrog ? ? A  G   1138 O6    ? ? ? 1_555 A  C   1225 N4    ? ? 0 G   1138 0 C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1223 hydrog ? ? A  U   1139 N3    ? ? ? 1_555 A  G   1224 O6    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1224 hydrog ? ? A  U   1139 O2    ? ? ? 1_555 A  G   1224 N1    ? ? 0 U   1139 0 G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1225 hydrog ? ? A  C   1140 N3    ? ? ? 1_555 A  G   1223 N1    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1226 hydrog ? ? A  C   1140 N4    ? ? ? 1_555 A  G   1223 O6    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1227 hydrog ? ? A  C   1140 O2    ? ? ? 1_555 A  G   1223 N2    ? ? 0 C   1140 0 G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1228 hydrog ? ? A  U   1141 N3    ? ? ? 1_555 A  A   1222 N1    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1229 hydrog ? ? A  U   1141 O4    ? ? ? 1_555 A  A   1222 N6    ? ? 0 U   1141 0 A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1230 hydrog ? ? A  C   1142 N3    ? ? ? 1_555 A  G   1221 N1    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1231 hydrog ? ? A  C   1142 N4    ? ? ? 1_555 A  G   1221 O6    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1232 hydrog ? ? A  C   1142 O2    ? ? ? 1_555 A  G   1221 N2    ? ? 0 C   1142 0 G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1233 hydrog ? ? A  G   1143 N1    ? ? ? 1_555 A  U   1220 O2    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1234 hydrog ? ? A  G   1143 O6    ? ? ? 1_555 A  U   1220 N3    ? ? 0 G   1143 0 U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1235 hydrog ? ? A  A   1144 N1    ? ? ? 1_555 A  U   1219 N3    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1236 hydrog ? ? A  A   1144 N6    ? ? ? 1_555 A  U   1219 O4    ? ? 0 A   1144 0 U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1237 hydrog ? ? A  G   1145 N1    ? ? ? 1_555 A  U   1218 O2    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1238 hydrog ? ? A  G   1145 O6    ? ? ? 1_555 A  U   1218 N3    ? ? 0 G   1145 0 U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1239 hydrog ? ? A  C   1146 N3    ? ? ? 1_555 A  G   1217 N1    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1240 hydrog ? ? A  C   1146 N4    ? ? ? 1_555 A  G   1217 O6    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1241 hydrog ? ? A  C   1146 O2    ? ? ? 1_555 A  G   1217 N2    ? ? 0 C   1146 0 G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1242 hydrog ? ? A  C   1147 N3    ? ? ? 1_555 A  G   1216 N1    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1243 hydrog ? ? A  C   1147 N4    ? ? ? 1_555 A  G   1216 O6    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1244 hydrog ? ? A  C   1147 O2    ? ? ? 1_555 A  G   1216 N2    ? ? 0 C   1147 0 G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1245 hydrog ? ? A  G   1151 N2    ? ? ? 1_555 A  A   1215 N7    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1246 hydrog ? ? A  G   1151 N3    ? ? ? 1_555 A  A   1215 N6    ? ? 0 G   1151 0 A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1247 hydrog ? ? A  A   1152 N7    ? ? ? 1_555 A  G   1214 N2    ? ? 0 A   1152 0 G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1248 hydrog ? ? A  A   1152 N3    ? ? ? 1_555 A  G   1216 N2    ? ? 0 A   1152 0 G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1249 hydrog ? ? A  A   1152 N6    ? ? ? 1_555 A  G   2786 O6    ? ? 0 A   1152 0 G   2786 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1250 hydrog ? ? A  C   1153 N4    ? ? ? 1_555 A  G   2786 O6    ? ? 0 C   1153 0 G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1251 hydrog ? ? A  A   1154 N6    ? ? ? 1_555 A  C   1213 O2    ? ? 0 A   1154 0 C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1252 hydrog ? ? A  G   1155 N1    ? ? ? 1_555 A  C   1212 N3    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1253 hydrog ? ? A  G   1155 N2    ? ? ? 1_555 A  C   1212 O2    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1254 hydrog ? ? A  G   1155 O6    ? ? ? 1_555 A  C   1212 N4    ? ? 0 G   1155 0 C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1255 hydrog ? ? A  C   1156 N3    ? ? ? 1_555 A  G   1211 N1    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1256 hydrog ? ? A  C   1156 N4    ? ? ? 1_555 A  G   1211 O6    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1257 hydrog ? ? A  C   1156 O2    ? ? ? 1_555 A  G   1211 N2    ? ? 0 C   1156 0 G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1258 hydrog ? ? A  C   1157 N3    ? ? ? 1_555 A  G   1210 N1    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1259 hydrog ? ? A  C   1157 N4    ? ? ? 1_555 A  G   1210 O6    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1260 hydrog ? ? A  C   1157 O2    ? ? ? 1_555 A  G   1210 N2    ? ? 0 C   1157 0 G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1261 hydrog ? ? A  G   1158 N1    ? ? ? 1_555 A  C   1209 N3    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1262 hydrog ? ? A  G   1158 N2    ? ? ? 1_555 A  C   1209 O2    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1263 hydrog ? ? A  G   1158 O6    ? ? ? 1_555 A  C   1209 N4    ? ? 0 G   1158 0 C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1264 hydrog ? ? A  G   1159 N1    ? ? ? 1_555 A  C   1208 N3    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1265 hydrog ? ? A  G   1159 N2    ? ? ? 1_555 A  C   1208 O2    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1266 hydrog ? ? A  G   1159 O6    ? ? ? 1_555 A  C   1208 N4    ? ? 0 G   1159 0 C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1267 hydrog ? ? A  G   1160 N2    ? ? ? 1_555 A  A   1207 N7    ? ? 0 G   1160 0 A   1207 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1268 hydrog ? ? A  A   1161 N1    ? ? ? 1_555 A  U   1185 N3    ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1269 hydrog ? ? A  A   1161 N6    ? ? ? 1_555 A  U   1185 O4    ? ? 0 A   1161 0 U   1185 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1270 hydrog ? ? A  G   1162 N1    ? ? ? 1_555 A  C   1184 N3    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1271 hydrog ? ? A  G   1162 N2    ? ? ? 1_555 A  C   1184 O2    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1272 hydrog ? ? A  G   1162 O6    ? ? ? 1_555 A  C   1184 N4    ? ? 0 G   1162 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1273 hydrog ? ? A  G   1163 N1    ? ? ? 1_555 A  C   1184 N3    ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1274 hydrog ? ? A  G   1163 N2    ? ? ? 1_555 A  C   1184 O2    ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1275 hydrog ? ? A  G   1163 O6    ? ? ? 1_555 A  C   1184 N4    ? ? 0 G   1163 0 C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1276 hydrog ? ? A  A   1166 N6    ? ? ? 1_555 A  U   1180 O4    ? ? 0 A   1166 0 U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1277 hydrog ? ? A  G   1167 N1    ? ? ? 1_555 A  C   1179 N3    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1278 hydrog ? ? A  G   1167 N2    ? ? ? 1_555 A  C   1179 O2    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1279 hydrog ? ? A  G   1167 O6    ? ? ? 1_555 A  C   1179 N4    ? ? 0 G   1167 0 C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1280 hydrog ? ? A  C   1168 O2    ? ? ? 1_555 A  G   1178 N2    ? ? 0 C   1168 0 G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1281 hydrog ? ? A  U   1169 O2    ? ? ? 1_555 A  A   1177 N6    ? ? 0 U   1169 0 A   1177 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1282 hydrog ? ? A  G   1175 O6    ? ? ? 1_555 A  C   1204 N4    ? ? 0 G   1175 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1283 hydrog ? ? A  C   1176 N3    ? ? ? 1_555 A  C   1196 N4    ? ? 0 C   1176 0 C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1284 hydrog ? ? A  C   1176 N4    ? ? ? 1_555 A  G   1203 O6    ? ? 0 C   1176 0 G   1203 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1285 hydrog ? ? A  C   1186 N3    ? ? ? 1_555 A  G   1190 N2    ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1286 hydrog ? ? A  C   1186 O2    ? ? ? 1_555 A  G   1190 N1    ? ? 0 C   1186 0 G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1287 hydrog ? ? A  A   1193 N3    ? ? ? 1_555 A  A   1194 N6    ? ? 0 A   1193 0 A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1288 hydrog ? ? A  A   1194 N1    ? ? ? 1_555 A  U   1205 N3    ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1289 hydrog ? ? A  A   1194 N6    ? ? ? 1_555 A  U   1205 O4    ? ? 0 A   1194 0 U   1205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1290 hydrog ? ? A  G   1195 N1    ? ? ? 1_555 A  C   1204 N3    ? ? 0 G   1195 0 C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1291 hydrog ? ? A  G   1195 N1    ? ? ? 1_555 A  U   1205 O4    ? ? 0 G   1195 0 U   1205 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1292 hydrog ? ? A  C   1196 N3    ? ? ? 1_555 A  G   1203 N1    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1293 hydrog ? ? A  C   1196 N4    ? ? ? 1_555 A  G   1203 O6    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1294 hydrog ? ? A  C   1196 O2    ? ? ? 1_555 A  G   1203 N2    ? ? 0 C   1196 0 G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1295 hydrog ? ? A  C   1196 N4    ? ? ? 1_555 A  C   1204 N3    ? ? 0 C   1196 0 C   1204 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1296 hydrog ? ? A  G   1197 N2    ? ? ? 1_555 A  A   1202 N7    ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1297 hydrog ? ? A  G   1197 N3    ? ? ? 1_555 A  A   1202 N6    ? ? 0 G   1197 0 A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1298 hydrog ? ? A  A   1231 N6    ? ? ? 1_555 A  C   2498 O2    ? ? 0 A   1231 0 C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1299 hydrog ? ? A  A   1231 N6    ? ? ? 1_555 A  U   2523 O2    ? ? 0 A   1231 0 U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1300 hydrog ? ? A  G   1235 N2    ? ? ? 1_555 A  A   1236 N7    ? ? 0 G   1235 0 A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1301 hydrog ? ? A  G   1235 O6    ? ? ? 1_555 A  G   2080 N2    ? ? 0 G   1235 0 G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1302 hydrog ? ? A  C   1238 N4    ? ? ? 1_555 A  G   1241 N7    ? ? 0 C   1238 0 G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1303 hydrog ? ? A  C   1268 N3    ? ? ? 1_555 A  G   1290 N1    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1304 hydrog ? ? A  C   1268 N4    ? ? ? 1_555 A  G   1290 O6    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1305 hydrog ? ? A  C   1268 O2    ? ? ? 1_555 A  G   1290 N2    ? ? 0 C   1268 0 G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1306 hydrog ? ? A  G   1269 N1    ? ? ? 1_555 A  C   1289 N3    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1307 hydrog ? ? A  G   1269 N2    ? ? ? 1_555 A  C   1289 O2    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1308 hydrog ? ? A  G   1269 O6    ? ? ? 1_555 A  C   1289 N4    ? ? 0 G   1269 0 C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1309 hydrog ? ? A  U   1270 N3    ? ? ? 1_555 A  A   1286 N1    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1310 hydrog ? ? A  U   1270 O4    ? ? ? 1_555 A  A   1286 N6    ? ? 0 U   1270 0 A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1311 hydrog ? ? A  A   1271 N1    ? ? ? 1_555 A  U   1285 N3    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1312 hydrog ? ? A  A   1271 N6    ? ? ? 1_555 A  U   1285 O4    ? ? 0 A   1271 0 U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1313 hydrog ? ? A  C   1272 N3    ? ? ? 1_555 A  G   1284 N1    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1314 hydrog ? ? A  C   1272 N4    ? ? ? 1_555 A  G   1284 O6    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1315 hydrog ? ? A  C   1272 O2    ? ? ? 1_555 A  G   1284 N2    ? ? 0 C   1272 0 G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1316 hydrog ? ? A  C   1273 N3    ? ? ? 1_555 A  G   1283 N1    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1317 hydrog ? ? A  C   1273 N4    ? ? ? 1_555 A  G   1283 O6    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1318 hydrog ? ? A  C   1273 O2    ? ? ? 1_555 A  G   1283 N2    ? ? 0 C   1273 0 G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1319 hydrog ? ? A  A   1274 N1    ? ? ? 1_555 A  U   1282 N3    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1320 hydrog ? ? A  A   1274 N6    ? ? ? 1_555 A  U   1282 O4    ? ? 0 A   1274 0 U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1321 hydrog ? ? A  C   1275 O2    ? ? ? 1_555 A  C   1281 N4    ? ? 0 C   1275 0 C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1322 hydrog ? ? A  U   1276 O2    ? ? ? 1_555 A  A   1280 N6    ? ? 0 U   1276 0 A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1323 hydrog ? ? A  G   1292 N2    ? ? ? 1_555 A  U   1293 O4    ? ? 0 G   1292 0 U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1324 hydrog ? ? A  G   1300 N2    ? ? ? 1_555 A  A   1330 N3    ? ? 0 G   1300 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1325 hydrog ? ? A  C   1301 N3    ? ? ? 1_555 A  G   1354 N1    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1326 hydrog ? ? A  C   1301 N4    ? ? ? 1_555 A  G   1354 O6    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1327 hydrog ? ? A  C   1301 O2    ? ? ? 1_555 A  G   1354 N2    ? ? 0 C   1301 0 G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1328 hydrog ? ? A  G   1302 N1    ? ? ? 1_555 A  C   1353 O2    ? ? 0 G   1302 0 C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1329 hydrog ? ? A  C   1303 N3    ? ? ? 1_555 A  G   1351 N1    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1330 hydrog ? ? A  C   1303 N4    ? ? ? 1_555 A  G   1351 O6    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1331 hydrog ? ? A  C   1303 O2    ? ? ? 1_555 A  G   1351 N2    ? ? 0 C   1303 0 G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1332 hydrog ? ? A  U   1304 N3    ? ? ? 1_555 A  U   1350 O2    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1333 hydrog ? ? A  U   1304 O4    ? ? ? 1_555 A  U   1350 N3    ? ? 0 U   1304 0 U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1334 hydrog ? ? A  C   1305 N3    ? ? ? 1_555 A  G   1349 N1    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1335 hydrog ? ? A  C   1305 N4    ? ? ? 1_555 A  G   1349 O6    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1336 hydrog ? ? A  C   1305 O2    ? ? ? 1_555 A  G   1349 N2    ? ? 0 C   1305 0 G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1337 hydrog ? ? A  U   1306 N3    ? ? ? 1_555 A  A   1348 N1    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1338 hydrog ? ? A  U   1306 O4    ? ? ? 1_555 A  A   1348 N6    ? ? 0 U   1306 0 A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1339 hydrog ? ? A  A   1307 N1    ? ? ? 1_555 A  U   1347 N3    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1340 hydrog ? ? A  A   1307 N6    ? ? ? 1_555 A  U   1347 O4    ? ? 0 A   1307 0 U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1341 hydrog ? ? A  A   1308 N1    ? ? ? 1_555 A  U   1346 N3    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1342 hydrog ? ? A  A   1308 N6    ? ? ? 1_555 A  U   1346 O4    ? ? 0 A   1308 0 U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1343 hydrog ? ? A  U   1309 N3    ? ? ? 1_555 A  A   1345 N1    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1344 hydrog ? ? A  U   1309 O4    ? ? ? 1_555 A  A   1345 N6    ? ? 0 U   1309 0 A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1345 hydrog ? ? A  U   1310 N3    ? ? ? 1_555 A  G   1344 O6    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1346 hydrog ? ? A  U   1310 O2    ? ? ? 1_555 A  G   1344 N1    ? ? 0 U   1310 0 G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1347 hydrog ? ? A  G   1311 N1    ? ? ? 1_555 A  C   1343 N3    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1348 hydrog ? ? A  G   1311 N2    ? ? ? 1_555 A  C   1343 O2    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1349 hydrog ? ? A  G   1311 O6    ? ? ? 1_555 A  C   1343 N4    ? ? 0 G   1311 0 C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1350 hydrog ? ? A  G   1312 N1    ? ? ? 1_555 A  C   1342 N3    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1351 hydrog ? ? A  G   1312 N2    ? ? ? 1_555 A  C   1342 O2    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1352 hydrog ? ? A  G   1312 O6    ? ? ? 1_555 A  C   1342 N4    ? ? 0 G   1312 0 C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1353 hydrog ? ? A  G   1316 N2    ? ? ? 1_555 A  A   1341 N7    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1354 hydrog ? ? A  G   1316 N3    ? ? ? 1_555 A  A   1341 N6    ? ? 0 G   1316 0 A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1355 hydrog ? ? A  A   1317 N7    ? ? ? 1_555 A  G   1340 N2    ? ? 0 A   1317 0 G   1340 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1356 hydrog ? ? A  A   1318 N6    ? ? ? 1_555 A  G   1339 N3    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1357 hydrog ? ? A  A   1318 N7    ? ? ? 1_555 A  G   1339 N2    ? ? 0 A   1318 0 G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1358 hydrog ? ? A  G   1319 N1    ? ? ? 1_555 A  U   1338 O2    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1359 hydrog ? ? A  G   1319 O6    ? ? ? 1_555 A  U   1338 N3    ? ? 0 G   1319 0 U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1360 hydrog ? ? A  C   1320 N3    ? ? ? 1_555 A  G   1337 N1    ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1361 hydrog ? ? A  C   1320 N4    ? ? ? 1_555 A  G   1337 O6    ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1362 hydrog ? ? A  C   1320 O2    ? ? ? 1_555 A  G   1337 N2    ? ? 0 C   1320 0 G   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1363 hydrog ? ? A  A   1321 N1    ? ? ? 1_555 A  U   1336 N3    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1364 hydrog ? ? A  A   1321 N6    ? ? ? 1_555 A  U   1336 O4    ? ? 0 A   1321 0 U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1365 hydrog ? ? A  G   1322 N1    ? ? ? 1_555 A  C   1335 N3    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1366 hydrog ? ? A  G   1322 N2    ? ? ? 1_555 A  C   1335 O2    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1367 hydrog ? ? A  G   1322 O6    ? ? ? 1_555 A  C   1335 N4    ? ? 0 G   1322 0 C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1368 hydrog ? ? A  G   1323 N1    ? ? ? 1_555 A  C   1334 N3    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1369 hydrog ? ? A  G   1323 N2    ? ? ? 1_555 A  C   1334 O2    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1370 hydrog ? ? A  G   1323 O6    ? ? ? 1_555 A  C   1334 N4    ? ? 0 G   1323 0 C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1371 hydrog ? ? A  G   1324 N1    ? ? ? 1_555 A  U   1333 O2    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1372 hydrog ? ? A  G   1324 O6    ? ? ? 1_555 A  U   1333 N3    ? ? 0 G   1324 0 U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1373 hydrog ? ? A  G   1325 N1    ? ? ? 1_555 A  C   1332 N3    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1374 hydrog ? ? A  G   1325 N2    ? ? ? 1_555 A  C   1332 O2    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1375 hydrog ? ? A  G   1325 O6    ? ? ? 1_555 A  C   1332 N4    ? ? 0 G   1325 0 C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1376 hydrog ? ? A  C   1326 N3    ? ? ? 1_555 A  G   1331 N1    ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1377 hydrog ? ? A  C   1326 N4    ? ? ? 1_555 A  G   1331 O6    ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1378 hydrog ? ? A  C   1326 O2    ? ? ? 1_555 A  G   1331 N2    ? ? 0 C   1326 0 G   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1379 hydrog ? ? A  G   1327 N2    ? ? ? 1_555 A  A   1330 N7    ? ? 0 G   1327 0 A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1380 hydrog ? ? A  C   1366 N3    ? ? ? 1_555 A  G   2058 N1    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1381 hydrog ? ? A  C   1366 N4    ? ? ? 1_555 A  G   2058 O6    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1382 hydrog ? ? A  C   1366 O2    ? ? ? 1_555 A  G   2058 N2    ? ? 0 C   1366 0 G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1383 hydrog ? ? A  A   1367 N1    ? ? ? 1_555 A  U   2057 N3    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1384 hydrog ? ? A  A   1367 N6    ? ? ? 1_555 A  U   2057 O4    ? ? 0 A   1367 0 U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1385 hydrog ? ? A  U   1368 O2    ? ? ? 1_555 A  C   2056 N4    ? ? 0 U   1368 0 C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1386 hydrog ? ? A  A   1369 N6    ? ? ? 1_555 A  A   2055 N7    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1387 hydrog ? ? A  A   1369 N7    ? ? ? 1_555 A  A   2055 N6    ? ? 0 A   1369 0 A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1388 hydrog ? ? A  G   1370 N2    ? ? ? 1_555 A  U   1371 O4    ? ? 0 G   1370 0 U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1389 hydrog ? ? A  U   1371 N3    ? ? ? 1_555 A  A   2054 N7    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1390 hydrog ? ? A  U   1371 O2    ? ? ? 1_555 A  A   2054 N6    ? ? 0 U   1371 0 A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1391 hydrog ? ? A  A   1372 N6    ? ? ? 1_555 A  G   2053 N3    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1392 hydrog ? ? A  A   1372 N7    ? ? ? 1_555 A  G   2053 N2    ? ? 0 A   1372 0 G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1393 hydrog ? ? A  G   1373 N2    ? ? ? 1_555 A  C   1431 O2    ? ? 0 G   1373 0 C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1394 hydrog ? ? A  G   1373 N1    ? ? ? 1_555 A  U   2052 O2    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1395 hydrog ? ? A  G   1373 O6    ? ? ? 1_555 A  U   2052 N3    ? ? 0 G   1373 0 U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1396 hydrog ? ? A  C   1374 N3    ? ? ? 1_555 A  G   2051 N1    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1397 hydrog ? ? A  C   1374 N4    ? ? ? 1_555 A  G   2051 O6    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1398 hydrog ? ? A  C   1374 O2    ? ? ? 1_555 A  G   2051 N2    ? ? 0 C   1374 0 G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1399 hydrog ? ? A  C   1377 N3    ? ? ? 1_555 A  G   1683 N2    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1400 hydrog ? ? A  C   1377 O2    ? ? ? 1_555 A  G   1683 N1    ? ? 0 C   1377 0 G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1401 hydrog ? ? A  A   1381 N3    ? ? ? 1_555 A  G   1401 N2    ? ? 0 A   1381 0 G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1402 hydrog ? ? A  G   1382 N1    ? ? ? 1_555 A  C   1400 N3    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1403 hydrog ? ? A  G   1382 N2    ? ? ? 1_555 A  C   1400 O2    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1404 hydrog ? ? A  G   1382 O6    ? ? ? 1_555 A  C   1400 N4    ? ? 0 G   1382 0 C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1405 hydrog ? ? A  U   1383 N3    ? ? ? 1_555 A  A   1399 N1    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1406 hydrog ? ? A  U   1383 O4    ? ? ? 1_555 A  A   1399 N6    ? ? 0 U   1383 0 A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1407 hydrog ? ? A  C   1384 N3    ? ? ? 1_555 A  G   1398 N1    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1408 hydrog ? ? A  C   1384 N4    ? ? ? 1_555 A  G   1398 O6    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1409 hydrog ? ? A  C   1384 O2    ? ? ? 1_555 A  G   1398 N2    ? ? 0 C   1384 0 G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1410 hydrog ? ? A  G   1385 N1    ? ? ? 1_555 A  C   1397 N3    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1411 hydrog ? ? A  G   1385 N2    ? ? ? 1_555 A  C   1397 O2    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1412 hydrog ? ? A  G   1385 O6    ? ? ? 1_555 A  C   1397 N4    ? ? 0 G   1385 0 C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1413 hydrog ? ? A  G   1386 N1    ? ? ? 1_555 A  C   1396 N3    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1414 hydrog ? ? A  G   1386 N2    ? ? ? 1_555 A  C   1396 O2    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1415 hydrog ? ? A  G   1386 O6    ? ? ? 1_555 A  C   1396 N4    ? ? 0 G   1386 0 C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1416 hydrog ? ? A  G   1387 N1    ? ? ? 1_555 A  C   1395 N3    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1417 hydrog ? ? A  G   1387 N2    ? ? ? 1_555 A  C   1395 O2    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1418 hydrog ? ? A  G   1387 O6    ? ? ? 1_555 A  C   1395 N4    ? ? 0 G   1387 0 C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1419 hydrog ? ? A  U   1388 N3    ? ? ? 1_555 A  A   1392 N7    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1420 hydrog ? ? A  U   1388 O2    ? ? ? 1_555 A  A   1392 N6    ? ? 0 U   1388 0 A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1421 hydrog ? ? A  G   1389 N2    ? ? ? 1_555 A  U   1435 O4    ? ? 0 G   1389 0 U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1422 hydrog ? ? A  A   1393 N6    ? ? ? 1_555 A  C   1725 O2    ? ? 0 A   1393 0 C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1423 hydrog ? ? A  C   1394 N3    ? ? ? 1_555 A  U   1432 N3    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1424 hydrog ? ? A  C   1394 N4    ? ? ? 1_555 A  U   1432 O2    ? ? 0 C   1394 0 U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1425 hydrog ? ? A  G   1401 N1    ? ? ? 1_555 A  C   1721 N3    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1426 hydrog ? ? A  G   1401 N2    ? ? ? 1_555 A  C   1721 O2    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1427 hydrog ? ? A  G   1401 O6    ? ? ? 1_555 A  C   1721 N4    ? ? 0 G   1401 0 C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1428 hydrog ? ? A  G   1402 N1    ? ? ? 1_555 A  C   1720 N3    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1429 hydrog ? ? A  G   1402 N2    ? ? ? 1_555 A  C   1720 O2    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1430 hydrog ? ? A  G   1402 O6    ? ? ? 1_555 A  C   1720 N4    ? ? 0 G   1402 0 C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1431 hydrog ? ? A  C   1403 N3    ? ? ? 1_555 A  G   1719 N1    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1432 hydrog ? ? A  C   1403 N4    ? ? ? 1_555 A  G   1719 O6    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1433 hydrog ? ? A  C   1403 O2    ? ? ? 1_555 A  G   1719 N2    ? ? 0 C   1403 0 G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1434 hydrog ? ? A  C   1404 N3    ? ? ? 1_555 A  G   1718 N1    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1435 hydrog ? ? A  C   1404 N4    ? ? ? 1_555 A  G   1718 O6    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1436 hydrog ? ? A  C   1404 O2    ? ? ? 1_555 A  G   1718 N2    ? ? 0 C   1404 0 G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1437 hydrog ? ? A  U   1405 N3    ? ? ? 1_555 A  A   1716 N7    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1438 hydrog ? ? A  U   1405 O2    ? ? ? 1_555 A  A   1716 N6    ? ? 0 U   1405 0 A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1439 hydrog ? ? A  A   1407 N1    ? ? ? 1_555 A  A   1717 N6    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1440 hydrog ? ? A  A   1407 N6    ? ? ? 1_555 A  A   1717 N1    ? ? 0 A   1407 0 A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1441 hydrog ? ? A  G   1409 N1    ? ? ? 1_555 A  C   1700 N3    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1442 hydrog ? ? A  G   1409 N2    ? ? ? 1_555 A  C   1700 O2    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1443 hydrog ? ? A  G   1409 O6    ? ? ? 1_555 A  C   1700 N4    ? ? 0 G   1409 0 C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1444 hydrog ? ? A  G   1410 N1    ? ? ? 1_555 A  C   1699 N3    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1445 hydrog ? ? A  G   1410 N2    ? ? ? 1_555 A  C   1699 O2    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1446 hydrog ? ? A  G   1410 O6    ? ? ? 1_555 A  C   1699 N4    ? ? 0 G   1410 0 C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1447 hydrog ? ? A  A   1411 N1    ? ? ? 1_555 A  U   1698 N3    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1448 hydrog ? ? A  A   1411 N6    ? ? ? 1_555 A  U   1698 O4    ? ? 0 A   1411 0 U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1449 hydrog ? ? A  U   1412 N3    ? ? ? 1_555 A  G   1697 O6    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1450 hydrog ? ? A  U   1412 O2    ? ? ? 1_555 A  G   1697 N1    ? ? 0 U   1412 0 G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1451 hydrog ? ? A  A   1414 N6    ? ? ? 1_555 A  G   1681 N3    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1452 hydrog ? ? A  A   1414 N7    ? ? ? 1_555 A  G   1681 N2    ? ? 0 A   1414 0 G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1453 hydrog ? ? A  A   1414 N1    ? ? ? 1_555 A  A   1682 N6    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1454 hydrog ? ? A  A   1414 N6    ? ? ? 1_555 A  A   1682 N1    ? ? 0 A   1414 0 A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1455 hydrog ? ? A  G   1415 N1    ? ? ? 1_555 A  C   1680 N3    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1456 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  C   1680 O2    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1457 hydrog ? ? A  G   1415 O6    ? ? ? 1_555 A  C   1680 N4    ? ? 0 G   1415 0 C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1458 hydrog ? ? A  G   1416 N1    ? ? ? 1_555 A  C   1679 N3    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1459 hydrog ? ? A  G   1416 N2    ? ? ? 1_555 A  C   1679 O2    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1460 hydrog ? ? A  G   1416 O6    ? ? ? 1_555 A  C   1679 N4    ? ? 0 G   1416 0 C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1461 hydrog ? ? A  G   1416 N2    ? ? ? 1_555 A  A   1685 N3    ? ? 0 G   1416 0 A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1462 hydrog ? ? A  U   1418 N3    ? ? ? 1_555 A  U   1446 O4    ? ? 0 U   1418 0 U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1463 hydrog ? ? A  U   1419 N3    ? ? ? 1_555 A  A   1678 N1    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1464 hydrog ? ? A  U   1419 O4    ? ? ? 1_555 A  A   1678 N6    ? ? 0 U   1419 0 A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1465 hydrog ? ? A  C   1420 N3    ? ? ? 1_555 A  G   1444 N1    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1466 hydrog ? ? A  C   1420 N4    ? ? ? 1_555 A  G   1444 O6    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1467 hydrog ? ? A  C   1420 O2    ? ? ? 1_555 A  G   1444 N2    ? ? 0 C   1420 0 G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1468 hydrog ? ? A  C   1421 N3    ? ? ? 1_555 A  G   1443 N1    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1469 hydrog ? ? A  C   1421 N4    ? ? ? 1_555 A  G   1443 O6    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1470 hydrog ? ? A  C   1421 O2    ? ? ? 1_555 A  G   1443 N2    ? ? 0 C   1421 0 G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1471 hydrog ? ? A  U   1422 N3    ? ? ? 1_555 A  A   1442 N1    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1472 hydrog ? ? A  U   1422 O4    ? ? ? 1_555 A  A   1442 N6    ? ? 0 U   1422 0 A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1473 hydrog ? ? A  C   1423 N3    ? ? ? 1_555 A  G   1441 N1    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1474 hydrog ? ? A  C   1423 N4    ? ? ? 1_555 A  G   1441 O6    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1475 hydrog ? ? A  C   1423 O2    ? ? ? 1_555 A  G   1441 N2    ? ? 0 C   1423 0 G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1476 hydrog ? ? A  A   1424 N1    ? ? ? 1_555 A  U   1440 N3    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1477 hydrog ? ? A  A   1424 N6    ? ? ? 1_555 A  U   1440 O4    ? ? 0 A   1424 0 U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1478 hydrog ? ? A  G   1425 N1    ? ? ? 1_555 A  C   1439 N3    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1479 hydrog ? ? A  G   1425 N2    ? ? ? 1_555 A  C   1439 O2    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1480 hydrog ? ? A  G   1425 O6    ? ? ? 1_555 A  C   1439 N4    ? ? 0 G   1425 0 C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1481 hydrog ? ? A  C   1426 N3    ? ? ? 1_555 A  A   1437 N6    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1482 hydrog ? ? A  C   1426 N4    ? ? ? 1_555 A  A   1437 N7    ? ? 0 C   1426 0 A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1483 hydrog ? ? A  C   1428 N4    ? ? ? 1_555 A  C   1439 O2    ? ? 0 C   1428 0 C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1484 hydrog ? ? A  U   1429 N3    ? ? ? 1_555 A  A   1437 N1    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1485 hydrog ? ? A  U   1429 O4    ? ? ? 1_555 A  A   1437 N6    ? ? 0 U   1429 0 A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1486 hydrog ? ? A  G   1430 N1    ? ? ? 1_555 A  C   1436 N3    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1487 hydrog ? ? A  G   1430 N2    ? ? ? 1_555 A  C   1436 O2    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1488 hydrog ? ? A  G   1430 O6    ? ? ? 1_555 A  C   1436 N4    ? ? 0 G   1430 0 C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1489 hydrog ? ? A  G   1430 N3    ? ? ? 1_555 A  A   1691 N6    ? ? 0 G   1430 0 A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1490 hydrog ? ? A  A   1448 N6    ? ? ? 1_555 A  U   1677 O2    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1491 hydrog ? ? A  A   1448 N7    ? ? ? 1_555 A  U   1677 N3    ? ? 0 A   1448 0 U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1492 hydrog ? ? A  G   1449 N2    ? ? ? 1_555 A  A   1493 N3    ? ? 0 G   1449 0 A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1493 hydrog ? ? A  G   1449 N1    ? ? ? 1_555 A  C   1513 N3    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1494 hydrog ? ? A  G   1449 N2    ? ? ? 1_555 A  C   1513 O2    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1495 hydrog ? ? A  G   1449 O6    ? ? ? 1_555 A  C   1513 N4    ? ? 0 G   1449 0 C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1496 hydrog ? ? A  C   1450 N3    ? ? ? 1_555 A  G   1512 N1    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1497 hydrog ? ? A  C   1450 N4    ? ? ? 1_555 A  G   1512 O6    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1498 hydrog ? ? A  C   1450 O2    ? ? ? 1_555 A  G   1512 N2    ? ? 0 C   1450 0 G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1499 hydrog ? ? A  C   1451 N3    ? ? ? 1_555 A  G   1676 N1    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1500 hydrog ? ? A  C   1451 N4    ? ? ? 1_555 A  G   1676 O6    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1501 hydrog ? ? A  C   1451 O2    ? ? ? 1_555 A  G   1676 N2    ? ? 0 C   1451 0 G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1502 hydrog ? ? A  G   1452 N2    ? ? ? 1_555 A  A   1486 N1    ? ? 0 G   1452 0 A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1503 hydrog ? ? A  G   1452 N1    ? ? ? 1_555 A  C   1675 N3    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1504 hydrog ? ? A  G   1452 N2    ? ? ? 1_555 A  C   1675 O2    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1505 hydrog ? ? A  G   1452 O6    ? ? ? 1_555 A  C   1675 N4    ? ? 0 G   1452 0 C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1506 hydrog ? ? A  G   1453 N1    ? ? ? 1_555 A  C   1674 N3    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1507 hydrog ? ? A  G   1453 N2    ? ? ? 1_555 A  C   1674 O2    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1508 hydrog ? ? A  G   1453 O6    ? ? ? 1_555 A  C   1674 N4    ? ? 0 G   1453 0 C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1509 hydrog ? ? A  U   1454 O4    ? ? ? 1_555 A  G   1491 N2    ? ? 0 U   1454 0 G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1510 hydrog ? ? A  C   1455 N3    ? ? ? 1_555 A  G   1490 N1    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1511 hydrog ? ? A  C   1455 N4    ? ? ? 1_555 A  G   1490 O6    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1512 hydrog ? ? A  C   1455 O2    ? ? ? 1_555 A  G   1490 N2    ? ? 0 C   1455 0 G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1513 hydrog ? ? A  C   1456 N3    ? ? ? 1_555 A  G   1489 N1    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1514 hydrog ? ? A  C   1456 N4    ? ? ? 1_555 A  G   1489 O6    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1515 hydrog ? ? A  C   1456 O2    ? ? ? 1_555 A  G   1489 N2    ? ? 0 C   1456 0 G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1516 hydrog ? ? A  U   1457 N3    ? ? ? 1_555 A  A   1485 N7    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1517 hydrog ? ? A  U   1457 O2    ? ? ? 1_555 A  A   1485 N6    ? ? 0 U   1457 0 A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1518 hydrog ? ? A  A   1459 N6    ? ? ? 1_555 A  G   1484 N3    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1519 hydrog ? ? A  A   1459 N7    ? ? ? 1_555 A  G   1484 N2    ? ? 0 A   1459 0 G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1520 hydrog ? ? A  G   1460 N1    ? ? ? 1_555 A  C   1483 N3    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1521 hydrog ? ? A  G   1460 N2    ? ? ? 1_555 A  C   1483 O2    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1522 hydrog ? ? A  G   1460 O6    ? ? ? 1_555 A  C   1483 N4    ? ? 0 G   1460 0 C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1523 hydrog ? ? A  U   1461 N3    ? ? ? 1_555 A  A   1482 N1    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1524 hydrog ? ? A  U   1461 O4    ? ? ? 1_555 A  A   1482 N6    ? ? 0 U   1461 0 A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1525 hydrog ? ? A  C   1462 N3    ? ? ? 1_555 A  G   1481 N1    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1526 hydrog ? ? A  C   1462 N4    ? ? ? 1_555 A  G   1481 O6    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1527 hydrog ? ? A  C   1462 O2    ? ? ? 1_555 A  G   1481 N2    ? ? 0 C   1462 0 G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1528 hydrog ? ? A  U   1463 N3    ? ? ? 1_555 A  A   1480 N1    ? ? 0 U   1463 0 A   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1529 hydrog ? ? A  U   1463 O4    ? ? ? 1_555 A  A   1480 N6    ? ? 0 U   1463 0 A   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1530 hydrog ? ? A  C   1464 N3    ? ? ? 1_555 A  G   1479 N1    ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1531 hydrog ? ? A  C   1464 N4    ? ? ? 1_555 A  G   1479 O6    ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1532 hydrog ? ? A  C   1464 O2    ? ? ? 1_555 A  G   1479 N2    ? ? 0 C   1464 0 G   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1533 hydrog ? ? A  A   1465 N1    ? ? ? 1_555 A  U   1478 N3    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1534 hydrog ? ? A  A   1465 N6    ? ? ? 1_555 A  U   1478 O4    ? ? 0 A   1465 0 U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1535 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  C   1477 N4    ? ? 0 C   1466 0 C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1536 hydrog ? ? A  C   1467 N3    ? ? ? 1_555 A  G   1475 N1    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1537 hydrog ? ? A  C   1467 N4    ? ? ? 1_555 A  G   1475 O6    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1538 hydrog ? ? A  C   1467 O2    ? ? ? 1_555 A  G   1475 N2    ? ? 0 C   1467 0 G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1539 hydrog ? ? A  C   1467 O2    ? ? ? 1_555 A  A   1476 N6    ? ? 0 C   1467 0 A   1476 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1540 hydrog ? ? A  G   1468 N1    ? ? ? 1_555 A  C   1474 N3    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1541 hydrog ? ? A  G   1468 N2    ? ? ? 1_555 A  C   1474 O2    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1542 hydrog ? ? A  G   1468 O6    ? ? ? 1_555 A  C   1474 N4    ? ? 0 G   1468 0 C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1543 hydrog ? ? A  G   1475 N2    ? ? ? 1_555 A  A   1866 N3    ? ? 0 G   1475 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1544 hydrog ? ? A  A   1485 N6    ? ? ? 1_555 A  A   1656 N1    ? ? 0 A   1485 0 A   1656 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1545 hydrog ? ? A  A   1487 N3    ? ? ? 1_555 A  G   1697 N2    ? ? 0 A   1487 0 G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1546 hydrog ? ? A  G   1489 N3    ? ? ? 1_555 A  A   1656 N6    ? ? 0 G   1489 0 A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1547 hydrog ? ? A  G   1489 N2    ? ? ? 1_555 A  A   1657 N1    ? ? 0 G   1489 0 A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1548 hydrog ? ? A  A   1494 N1    ? ? ? 1_555 A  U   1511 N3    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1549 hydrog ? ? A  A   1494 N6    ? ? ? 1_555 A  U   1511 O4    ? ? 0 A   1494 0 U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1550 hydrog ? ? A  C   1495 N3    ? ? ? 1_555 A  G   1510 N1    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1551 hydrog ? ? A  C   1495 N4    ? ? ? 1_555 A  G   1510 O6    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1552 hydrog ? ? A  C   1495 O2    ? ? ? 1_555 A  G   1510 N2    ? ? 0 C   1495 0 G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1553 hydrog ? ? A  A   1496 N1    ? ? ? 1_555 A  U   1509 N3    ? ? 0 A   1496 0 U   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1554 hydrog ? ? A  A   1496 N6    ? ? ? 1_555 A  U   1509 O4    ? ? 0 A   1496 0 U   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1555 hydrog ? ? A  G   1497 N1    ? ? ? 1_555 A  C   1508 N3    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1556 hydrog ? ? A  G   1497 N2    ? ? ? 1_555 A  C   1508 O2    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1557 hydrog ? ? A  G   1497 O6    ? ? ? 1_555 A  C   1508 N4    ? ? 0 G   1497 0 C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1558 hydrog ? ? A  G   1498 N1    ? ? ? 1_555 A  C   1507 N3    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1559 hydrog ? ? A  G   1498 N2    ? ? ? 1_555 A  C   1507 O2    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1560 hydrog ? ? A  G   1498 O6    ? ? ? 1_555 A  C   1507 N4    ? ? 0 G   1498 0 C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1561 hydrog ? ? A  U   1499 N3    ? ? ? 1_555 A  A   1504 N7    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1562 hydrog ? ? A  U   1499 O2    ? ? ? 1_555 A  A   1504 N6    ? ? 0 U   1499 0 A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1563 hydrog ? ? A  C   1514 N3    ? ? ? 1_555 A  G   1672 N1    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1564 hydrog ? ? A  C   1514 N4    ? ? ? 1_555 A  G   1672 O6    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1565 hydrog ? ? A  C   1514 O2    ? ? ? 1_555 A  G   1672 N2    ? ? 0 C   1514 0 G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1566 hydrog ? ? A  A   1515 N1    ? ? ? 1_555 A  U   1671 N3    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1567 hydrog ? ? A  A   1515 N6    ? ? ? 1_555 A  U   1671 O4    ? ? 0 A   1515 0 U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1568 hydrog ? ? A  U   1516 N3    ? ? ? 1_555 A  A   1670 N1    ? ? 0 U   1516 0 A   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1569 hydrog ? ? A  U   1516 O4    ? ? ? 1_555 A  A   1670 N6    ? ? 0 U   1516 0 A   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1570 hydrog ? ? A  C   1517 N3    ? ? ? 1_555 A  G   1669 N1    ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1571 hydrog ? ? A  C   1517 N4    ? ? ? 1_555 A  G   1669 O6    ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1572 hydrog ? ? A  C   1517 O2    ? ? ? 1_555 A  G   1669 N2    ? ? 0 C   1517 0 G   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1573 hydrog ? ? A  A   1518 N1    ? ? ? 1_555 A  U   1668 N3    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1574 hydrog ? ? A  A   1518 N6    ? ? ? 1_555 A  U   1668 O4    ? ? 0 A   1518 0 U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1575 hydrog ? ? A  U   1519 N3    ? ? ? 1_555 A  A   1667 N1    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1576 hydrog ? ? A  U   1519 O4    ? ? ? 1_555 A  A   1667 N6    ? ? 0 U   1519 0 A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1577 hydrog ? ? A  G   1520 N1    ? ? ? 1_555 A  C   1666 N3    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1578 hydrog ? ? A  G   1520 N2    ? ? ? 1_555 A  C   1666 O2    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1579 hydrog ? ? A  G   1520 O6    ? ? ? 1_555 A  C   1666 N4    ? ? 0 G   1520 0 C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1580 hydrog ? ? A  C   1521 N3    ? ? ? 1_555 A  G   1665 N1    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1581 hydrog ? ? A  C   1521 N4    ? ? ? 1_555 A  G   1665 O6    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1582 hydrog ? ? A  C   1521 O2    ? ? ? 1_555 A  G   1665 N2    ? ? 0 C   1521 0 G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1583 hydrog ? ? A  A   1527 N6    ? ? ? 1_555 A  A   1664 N7    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1584 hydrog ? ? A  A   1527 N7    ? ? ? 1_555 A  A   1664 N6    ? ? 0 A   1527 0 A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1585 hydrog ? ? A  A   1528 N6    ? ? ? 1_555 A  G   1663 N3    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1586 hydrog ? ? A  A   1528 N7    ? ? ? 1_555 A  G   1663 N2    ? ? 0 A   1528 0 G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1587 hydrog ? ? A  G   1529 N1    ? ? ? 1_555 A  C   1662 N3    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1588 hydrog ? ? A  G   1529 N2    ? ? ? 1_555 A  C   1662 O2    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1589 hydrog ? ? A  G   1529 O6    ? ? ? 1_555 A  C   1662 N4    ? ? 0 G   1529 0 C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1590 hydrog ? ? A  U   1530 N3    ? ? ? 1_555 A  A   1661 N1    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1591 hydrog ? ? A  U   1530 O4    ? ? ? 1_555 A  A   1661 N6    ? ? 0 U   1530 0 A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1592 hydrog ? ? A  U   1531 N3    ? ? ? 1_555 A  G   1660 O6    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1593 hydrog ? ? A  U   1531 O2    ? ? ? 1_555 A  G   1660 N1    ? ? 0 U   1531 0 G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1594 hydrog ? ? A  G   1532 N2    ? ? ? 1_555 A  A   1659 N7    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1595 hydrog ? ? A  G   1532 N3    ? ? ? 1_555 A  A   1659 N6    ? ? 0 G   1532 0 A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1596 hydrog ? ? A  A   1533 N6    ? ? ? 1_555 A  A   1658 N7    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1597 hydrog ? ? A  A   1533 N7    ? ? ? 1_555 A  A   1658 N6    ? ? 0 A   1533 0 A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1598 hydrog ? ? A  C   1534 N4    ? ? ? 1_555 A  A   1657 N7    ? ? 0 C   1534 0 A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1599 hydrog ? ? A  G   1535 N1    ? ? ? 1_555 A  C   1650 N3    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1600 hydrog ? ? A  G   1535 N2    ? ? ? 1_555 A  C   1650 O2    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1601 hydrog ? ? A  G   1535 O6    ? ? ? 1_555 A  C   1650 N4    ? ? 0 G   1535 0 C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1602 hydrog ? ? A  C   1536 N3    ? ? ? 1_555 A  G   1649 N1    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1603 hydrog ? ? A  C   1536 N4    ? ? ? 1_555 A  G   1649 O6    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1604 hydrog ? ? A  C   1536 O2    ? ? ? 1_555 A  G   1649 N2    ? ? 0 C   1536 0 G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1605 hydrog ? ? A  C   1537 N3    ? ? ? 1_555 A  G   1648 N1    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1606 hydrog ? ? A  C   1537 N4    ? ? ? 1_555 A  G   1648 O6    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1607 hydrog ? ? A  C   1537 O2    ? ? ? 1_555 A  G   1648 N2    ? ? 0 C   1537 0 G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1608 hydrog ? ? A  C   1538 N3    ? ? ? 1_555 A  G   1647 N1    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1609 hydrog ? ? A  C   1538 N4    ? ? ? 1_555 A  G   1647 O6    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1610 hydrog ? ? A  C   1538 O2    ? ? ? 1_555 A  G   1647 N2    ? ? 0 C   1538 0 G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1611 hydrog ? ? A  U   1539 N3    ? ? ? 1_555 A  G   1646 O6    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1612 hydrog ? ? A  U   1539 O2    ? ? ? 1_555 A  G   1646 N1    ? ? 0 U   1539 0 G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1613 hydrog ? ? A  U   1539 N3    ? ? ? 1_555 A  G   1647 O6    ? ? 0 U   1539 0 G   1647 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1614 hydrog ? ? A  U   1539 O2    ? ? ? 1_555 A  G   1647 N1    ? ? 0 U   1539 0 G   1647 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1615 hydrog ? ? A  G   1540 N1    ? ? ? 1_555 A  U   1645 O2    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1616 hydrog ? ? A  G   1540 O6    ? ? ? 1_555 A  U   1645 N3    ? ? 0 G   1540 0 U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1617 hydrog ? ? A  G   1541 N1    ? ? ? 1_555 A  C   1644 N3    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1618 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  C   1644 O2    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1619 hydrog ? ? A  G   1541 O6    ? ? ? 1_555 A  C   1644 N4    ? ? 0 G   1541 0 C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1620 hydrog ? ? A  G   1542 N2    ? ? ? 1_555 A  A   1616 N3    ? ? 0 G   1542 0 A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1621 hydrog ? ? A  G   1542 N1    ? ? ? 1_555 A  C   1643 N3    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1622 hydrog ? ? A  G   1542 N2    ? ? ? 1_555 A  C   1643 O2    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1623 hydrog ? ? A  G   1542 O6    ? ? ? 1_555 A  C   1643 N4    ? ? 0 G   1542 0 C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1624 hydrog ? ? A  G   1543 N2    ? ? ? 1_555 A  A   1642 N7    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1625 hydrog ? ? A  G   1543 N3    ? ? ? 1_555 A  A   1642 N6    ? ? 0 G   1543 0 A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1626 hydrog ? ? A  U   1544 N3    ? ? ? 1_555 A  A   1641 N7    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1627 hydrog ? ? A  U   1544 O2    ? ? ? 1_555 A  A   1641 N6    ? ? 0 U   1544 0 A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1628 hydrog ? ? A  C   1545 N4    ? ? ? 1_555 A  C   1640 O2    ? ? 0 C   1545 0 C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1629 hydrog ? ? A  C   1545 N3    ? ? ? 1_555 A  U   1702 N3    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1630 hydrog ? ? A  C   1545 N4    ? ? ? 1_555 A  U   1702 O4    ? ? 0 C   1545 0 U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1631 hydrog ? ? A  G   1546 N1    ? ? ? 1_555 A  U   1639 O2    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1632 hydrog ? ? A  G   1546 O6    ? ? ? 1_555 A  U   1639 N3    ? ? 0 G   1546 0 U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1633 hydrog ? ? A  A   1547 N1    ? ? ? 1_555 A  U   1638 N3    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1634 hydrog ? ? A  A   1547 N6    ? ? ? 1_555 A  U   1638 O4    ? ? 0 A   1547 0 U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1635 hydrog ? ? A  U   1548 N3    ? ? ? 1_555 A  A   1637 N1    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1636 hydrog ? ? A  U   1548 O4    ? ? ? 1_555 A  A   1637 N6    ? ? 0 U   1548 0 A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1637 hydrog ? ? A  C   1549 N3    ? ? ? 1_555 A  G   1636 N1    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1638 hydrog ? ? A  C   1549 N4    ? ? ? 1_555 A  G   1636 O6    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1639 hydrog ? ? A  C   1549 O2    ? ? ? 1_555 A  G   1636 N2    ? ? 0 C   1549 0 G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1640 hydrog ? ? A  A   1550 N1    ? ? ? 1_555 A  U   1635 N3    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1641 hydrog ? ? A  A   1550 N6    ? ? ? 1_555 A  U   1635 O4    ? ? 0 A   1550 0 U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1642 hydrog ? ? A  C   1551 N3    ? ? ? 1_555 A  G   1634 N1    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1643 hydrog ? ? A  C   1551 N4    ? ? ? 1_555 A  G   1634 O6    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1644 hydrog ? ? A  C   1551 O2    ? ? ? 1_555 A  G   1634 N2    ? ? 0 C   1551 0 G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1645 hydrog ? ? A  G   1552 N1    ? ? ? 1_555 A  U   1569 O2    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1646 hydrog ? ? A  G   1552 O6    ? ? ? 1_555 A  U   1569 N3    ? ? 0 G   1552 0 U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1647 hydrog ? ? A  C   1553 N3    ? ? ? 1_555 A  G   1568 N1    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1648 hydrog ? ? A  C   1553 N4    ? ? ? 1_555 A  G   1568 O6    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1649 hydrog ? ? A  C   1553 O2    ? ? ? 1_555 A  G   1568 N2    ? ? 0 C   1553 0 G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1650 hydrog ? ? A  C   1554 N3    ? ? ? 1_555 A  G   1567 N1    ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1651 hydrog ? ? A  C   1554 N4    ? ? ? 1_555 A  G   1567 O6    ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1652 hydrog ? ? A  C   1554 O2    ? ? ? 1_555 A  G   1567 N2    ? ? 0 C   1554 0 G   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1653 hydrog ? ? A  G   1555 N1    ? ? ? 1_555 A  C   1566 N3    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1654 hydrog ? ? A  G   1555 N2    ? ? ? 1_555 A  C   1566 O2    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1655 hydrog ? ? A  G   1555 O6    ? ? ? 1_555 A  C   1566 N4    ? ? 0 G   1555 0 C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1656 hydrog ? ? A  G   1556 N1    ? ? ? 1_555 A  C   1565 N3    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1657 hydrog ? ? A  G   1556 N2    ? ? ? 1_555 A  C   1565 O2    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1658 hydrog ? ? A  G   1556 O6    ? ? ? 1_555 A  C   1565 N4    ? ? 0 G   1556 0 C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1659 hydrog ? ? A  G   1557 N1    ? ? ? 1_555 A  C   1564 N3    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1660 hydrog ? ? A  G   1557 N2    ? ? ? 1_555 A  C   1564 O2    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1661 hydrog ? ? A  G   1557 O6    ? ? ? 1_555 A  C   1564 N4    ? ? 0 G   1557 0 C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1662 hydrog ? ? A  U   1561 N3    ? ? ? 1_555 A  A   2739 N1    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1663 hydrog ? ? A  U   1561 O4    ? ? ? 1_555 A  A   2739 N6    ? ? 0 U   1561 0 A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1664 hydrog ? ? A  C   1562 N3    ? ? ? 1_555 A  G   2738 N1    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1665 hydrog ? ? A  C   1562 N4    ? ? ? 1_555 A  G   2738 O6    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1666 hydrog ? ? A  C   1562 O2    ? ? ? 1_555 A  G   2738 N2    ? ? 0 C   1562 0 G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1667 hydrog ? ? A  G   1568 N2    ? ? ? 1_555 A  A   1632 N3    ? ? 0 G   1568 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1668 hydrog ? ? A  C   1570 N3    ? ? ? 1_555 A  G   1627 N1    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1669 hydrog ? ? A  C   1570 N4    ? ? ? 1_555 A  G   1627 O6    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1670 hydrog ? ? A  C   1570 O2    ? ? ? 1_555 A  G   1627 N2    ? ? 0 C   1570 0 G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1671 hydrog ? ? A  G   1571 N2    ? ? ? 1_555 A  A   1626 N7    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1672 hydrog ? ? A  G   1571 N3    ? ? ? 1_555 A  A   1626 N6    ? ? 0 G   1571 0 A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1673 hydrog ? ? A  A   1572 N6    ? ? ? 1_555 A  A   1624 N7    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1674 hydrog ? ? A  A   1572 N7    ? ? ? 1_555 A  A   1624 N6    ? ? 0 A   1572 0 A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1675 hydrog ? ? A  A   1573 N6    ? ? ? 1_555 A  C   1623 O2    ? ? 0 A   1573 0 C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1676 hydrog ? ? A  C   1574 N3    ? ? ? 1_555 A  G   1622 N1    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1677 hydrog ? ? A  C   1574 N4    ? ? ? 1_555 A  G   1622 O6    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1678 hydrog ? ? A  C   1574 O2    ? ? ? 1_555 A  G   1622 N2    ? ? 0 C   1574 0 G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1679 hydrog ? ? A  C   1575 N3    ? ? ? 1_555 A  G   1621 N1    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1680 hydrog ? ? A  C   1575 N4    ? ? ? 1_555 A  G   1621 O6    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1681 hydrog ? ? A  C   1575 O2    ? ? ? 1_555 A  G   1621 N2    ? ? 0 C   1575 0 G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1682 hydrog ? ? A  G   1576 N1    ? ? ? 1_555 A  C   1620 N3    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1683 hydrog ? ? A  G   1576 N2    ? ? ? 1_555 A  C   1620 O2    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1684 hydrog ? ? A  G   1576 O6    ? ? ? 1_555 A  C   1620 N4    ? ? 0 G   1576 0 C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1685 hydrog ? ? A  U   1577 N3    ? ? ? 1_555 A  G   1619 O6    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1686 hydrog ? ? A  U   1577 O2    ? ? ? 1_555 A  G   1619 N1    ? ? 0 U   1577 0 G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1687 hydrog ? ? A  C   1578 N3    ? ? ? 1_555 A  G   1618 N1    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1688 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  G   1618 O6    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1689 hydrog ? ? A  C   1578 O2    ? ? ? 1_555 A  G   1618 N2    ? ? 0 C   1578 0 G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1690 hydrog ? ? A  C   1579 N3    ? ? ? 1_555 A  A   1616 N6    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1691 hydrog ? ? A  C   1579 N4    ? ? ? 1_555 A  A   1616 N7    ? ? 0 C   1579 0 A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1692 hydrog ? ? A  C   1579 N4    ? ? ? 1_555 A  G   1618 O6    ? ? 0 C   1579 0 G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1693 hydrog ? ? A  A   1581 N6    ? ? ? 1_555 A  G   1614 N3    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1694 hydrog ? ? A  A   1581 N7    ? ? ? 1_555 A  G   1614 N2    ? ? 0 A   1581 0 G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1695 hydrog ? ? A  C   1582 N4    ? ? ? 1_555 A  C   1613 N3    ? ? 0 C   1582 0 C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1696 hydrog ? ? A  U   1583 N3    ? ? ? 1_555 A  A   1612 N1    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1697 hydrog ? ? A  U   1583 O4    ? ? ? 1_555 A  A   1612 N6    ? ? 0 U   1583 0 A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1698 hydrog ? ? A  C   1584 N3    ? ? ? 1_555 A  G   1611 N1    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1699 hydrog ? ? A  C   1584 N4    ? ? ? 1_555 A  G   1611 O6    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1700 hydrog ? ? A  C   1584 O2    ? ? ? 1_555 A  G   1611 N2    ? ? 0 C   1584 0 G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1701 hydrog ? ? A  C   1585 N3    ? ? ? 1_555 A  G   1610 N1    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1702 hydrog ? ? A  C   1585 N4    ? ? ? 1_555 A  G   1610 O6    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1703 hydrog ? ? A  C   1585 O2    ? ? ? 1_555 A  G   1610 N2    ? ? 0 C   1585 0 G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1704 hydrog ? ? A  G   1586 N1    ? ? ? 1_555 A  C   1609 N3    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1705 hydrog ? ? A  G   1586 N2    ? ? ? 1_555 A  C   1609 O2    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1706 hydrog ? ? A  G   1586 O6    ? ? ? 1_555 A  C   1609 N4    ? ? 0 G   1586 0 C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1707 hydrog ? ? A  U   1587 N3    ? ? ? 1_555 A  G   1608 O6    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1708 hydrog ? ? A  U   1587 O2    ? ? ? 1_555 A  G   1608 N1    ? ? 0 U   1587 0 G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1709 hydrog ? ? A  G   1588 N2    ? ? ? 1_555 A  A   1607 N7    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1710 hydrog ? ? A  G   1588 N3    ? ? ? 1_555 A  A   1607 N6    ? ? 0 G   1588 0 A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1711 hydrog ? ? A  G   1589 N2    ? ? ? 1_555 A  A   1606 N7    ? ? 0 G   1589 0 A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1712 hydrog ? ? A  A   1590 N6    ? ? ? 1_555 A  G   1605 N3    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1713 hydrog ? ? A  A   1590 N7    ? ? ? 1_555 A  G   1605 N2    ? ? 0 A   1590 0 G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1714 hydrog ? ? A  G   1592 N1    ? ? ? 1_555 A  C   1602 N3    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1715 hydrog ? ? A  G   1592 N2    ? ? ? 1_555 A  C   1602 O2    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1716 hydrog ? ? A  G   1592 O6    ? ? ? 1_555 A  C   1602 N4    ? ? 0 G   1592 0 C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1717 hydrog ? ? A  C   1593 N3    ? ? ? 1_555 A  G   1601 N1    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1718 hydrog ? ? A  C   1593 N4    ? ? ? 1_555 A  G   1601 O6    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1719 hydrog ? ? A  C   1593 O2    ? ? ? 1_555 A  G   1601 N2    ? ? 0 C   1593 0 G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1720 hydrog ? ? A  C   1594 N3    ? ? ? 1_555 A  G   1600 N1    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1721 hydrog ? ? A  C   1594 N4    ? ? ? 1_555 A  G   1600 O6    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1722 hydrog ? ? A  C   1594 O2    ? ? ? 1_555 A  G   1600 N2    ? ? 0 C   1594 0 G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1723 hydrog ? ? A  G   1628 N1    ? ? ? 1_555 A  C   1633 O2    ? ? 0 G   1628 0 C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1724 hydrog ? ? A  G   1629 N2    ? ? ? 1_555 A  A   1632 N7    ? ? 0 G   1629 0 A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1725 hydrog ? ? A  G   1629 N1    ? ? ? 1_555 A  C   1633 N3    ? ? 0 G   1629 0 C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1726 hydrog ? ? A  C   1651 N3    ? ? ? 1_555 A  G   1655 N1    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1727 hydrog ? ? A  C   1651 N4    ? ? ? 1_555 A  G   1655 O6    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1728 hydrog ? ? A  C   1651 O2    ? ? ? 1_555 A  G   1655 N2    ? ? 0 C   1651 0 G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1729 hydrog ? ? A  A   1682 N6    ? ? ? 1_555 A  U   1696 O2    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1730 hydrog ? ? A  A   1682 N7    ? ? ? 1_555 A  U   1696 N3    ? ? 0 A   1682 0 U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1731 hydrog ? ? A  A   1684 N6    ? ? ? 1_555 A  U   1722 O4    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1732 hydrog ? ? A  A   1684 N7    ? ? ? 1_555 A  U   1722 N3    ? ? 0 A   1684 0 U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1733 hydrog ? ? A  C   1686 N3    ? ? ? 1_555 A  G   1695 N1    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1734 hydrog ? ? A  C   1686 N4    ? ? ? 1_555 A  G   1695 O6    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1735 hydrog ? ? A  C   1686 O2    ? ? ? 1_555 A  G   1695 N2    ? ? 0 C   1686 0 G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1736 hydrog ? ? A  C   1687 N3    ? ? ? 1_555 A  G   1694 N1    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1737 hydrog ? ? A  C   1687 N4    ? ? ? 1_555 A  G   1694 O6    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1738 hydrog ? ? A  C   1687 O2    ? ? ? 1_555 A  G   1694 N2    ? ? 0 C   1687 0 G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1739 hydrog ? ? A  G   1703 N1    ? ? ? 1_555 A  C   1715 N3    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1740 hydrog ? ? A  G   1703 N2    ? ? ? 1_555 A  C   1715 O2    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1741 hydrog ? ? A  G   1703 O6    ? ? ? 1_555 A  C   1715 N4    ? ? 0 G   1703 0 C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1742 hydrog ? ? A  G   1704 N1    ? ? ? 1_555 A  C   1714 N3    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1743 hydrog ? ? A  G   1704 N2    ? ? ? 1_555 A  C   1714 O2    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1744 hydrog ? ? A  G   1704 O6    ? ? ? 1_555 A  C   1714 N4    ? ? 0 G   1704 0 C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1745 hydrog ? ? A  C   1705 N3    ? ? ? 1_555 A  G   1713 N1    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1746 hydrog ? ? A  C   1705 N4    ? ? ? 1_555 A  G   1713 O6    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1747 hydrog ? ? A  C   1705 O2    ? ? ? 1_555 A  G   1713 N2    ? ? 0 C   1705 0 G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1748 hydrog ? ? A  G   1706 N2    ? ? ? 1_555 A  A   1712 N7    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1749 hydrog ? ? A  G   1706 N3    ? ? ? 1_555 A  A   1712 N6    ? ? 0 G   1706 0 A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1750 hydrog ? ? A  G   1707 N2    ? ? ? 1_555 A  A   1711 N7    ? ? 0 G   1707 0 A   1711 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1751 hydrog ? ? A  C   1725 N3    ? ? ? 1_555 A  G   2050 N1    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1752 hydrog ? ? A  C   1725 N4    ? ? ? 1_555 A  G   2050 O6    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1753 hydrog ? ? A  C   1725 O2    ? ? ? 1_555 A  G   2050 N2    ? ? 0 C   1725 0 G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1754 hydrog ? ? A  G   1726 N1    ? ? ? 1_555 A  C   2049 N3    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1755 hydrog ? ? A  G   1726 N2    ? ? ? 1_555 A  C   2049 O2    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1756 hydrog ? ? A  G   1726 O6    ? ? ? 1_555 A  C   2049 N4    ? ? 0 G   1726 0 C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1757 hydrog ? ? A  G   1727 N1    ? ? ? 1_555 A  C   2048 N3    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1758 hydrog ? ? A  G   1727 N2    ? ? ? 1_555 A  C   2048 O2    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1759 hydrog ? ? A  G   1727 O6    ? ? ? 1_555 A  C   2048 N4    ? ? 0 G   1727 0 C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1760 hydrog ? ? A  G   1728 N1    ? ? ? 1_555 A  C   2047 N3    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1761 hydrog ? ? A  G   1728 N2    ? ? ? 1_555 A  C   2047 O2    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1762 hydrog ? ? A  G   1728 O6    ? ? ? 1_555 A  C   2047 N4    ? ? 0 G   1728 0 C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1763 hydrog ? ? A  A   1733 N6    ? ? ? 1_555 A  G   2046 N3    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1764 hydrog ? ? A  A   1733 N7    ? ? ? 1_555 A  G   2046 N2    ? ? 0 A   1733 0 G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1765 hydrog ? ? A  C   1734 N3    ? ? ? 1_555 A  G   2045 N1    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1766 hydrog ? ? A  C   1734 N4    ? ? ? 1_555 A  G   2045 O6    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1767 hydrog ? ? A  C   1734 O2    ? ? ? 1_555 A  G   2045 N2    ? ? 0 C   1734 0 G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1768 hydrog ? ? A  C   1735 N3    ? ? ? 1_555 A  G   2044 N1    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1769 hydrog ? ? A  C   1735 N4    ? ? ? 1_555 A  G   2044 O6    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1770 hydrog ? ? A  C   1735 O2    ? ? ? 1_555 A  G   2044 N2    ? ? 0 C   1735 0 G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1771 hydrog ? ? A  A   1736 N1    ? ? ? 1_555 A  U   2043 N3    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1772 hydrog ? ? A  A   1736 N6    ? ? ? 1_555 A  U   2043 O4    ? ? 0 A   1736 0 U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1773 hydrog ? ? A  A   1737 N1    ? ? ? 1_555 A  U   2042 N3    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1774 hydrog ? ? A  A   1737 N6    ? ? ? 1_555 A  U   2042 O4    ? ? 0 A   1737 0 U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1775 hydrog ? ? A  C   1738 N3    ? ? ? 1_555 A  G   2041 N1    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1776 hydrog ? ? A  C   1738 N4    ? ? ? 1_555 A  G   2041 O6    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1777 hydrog ? ? A  C   1738 O2    ? ? ? 1_555 A  G   2041 N2    ? ? 0 C   1738 0 G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1778 hydrog ? ? A  G   1739 N1    ? ? ? 1_555 A  C   2040 N3    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1779 hydrog ? ? A  G   1739 N2    ? ? ? 1_555 A  C   2040 O2    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1780 hydrog ? ? A  G   1739 O6    ? ? ? 1_555 A  C   2040 N4    ? ? 0 G   1739 0 C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1781 hydrog ? ? A  U   1740 N3    ? ? ? 1_555 A  A   2039 N1    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1782 hydrog ? ? A  U   1740 O4    ? ? ? 1_555 A  A   2039 N6    ? ? 0 U   1740 0 A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1783 hydrog ? ? A  U   1741 N3    ? ? ? 1_555 A  A   2038 N1    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1784 hydrog ? ? A  U   1741 O4    ? ? ? 1_555 A  A   2038 N6    ? ? 0 U   1741 0 A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1785 hydrog ? ? A  A   1742 N6    ? ? ? 1_555 A  G   2033 O6    ? ? 0 A   1742 0 G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1786 hydrog ? ? A  A   1742 N1    ? ? ? 1_555 A  C   2037 N4    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1787 hydrog ? ? A  A   1742 N6    ? ? ? 1_555 A  C   2037 N3    ? ? 0 A   1742 0 C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1788 hydrog ? ? A  G   1743 N1    ? ? ? 1_555 A  C   2036 N3    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1789 hydrog ? ? A  G   1743 N2    ? ? ? 1_555 A  C   2036 O2    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1790 hydrog ? ? A  G   1743 O6    ? ? ? 1_555 A  C   2036 N4    ? ? 0 G   1743 0 C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1791 hydrog ? ? A  G   1744 N1    ? ? ? 1_555 A  C   2035 N3    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1792 hydrog ? ? A  G   1744 N2    ? ? ? 1_555 A  C   2035 O2    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1793 hydrog ? ? A  G   1744 O6    ? ? ? 1_555 A  C   2035 N4    ? ? 0 G   1744 0 C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1794 hydrog ? ? A  G   1745 N2    ? ? ? 1_555 A  U   2034 O4    ? ? 0 G   1745 0 U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1795 hydrog ? ? A  A   1746 N6    ? ? ? 1_555 A  U   2032 O2    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1796 hydrog ? ? A  A   1746 N7    ? ? ? 1_555 A  U   2032 N3    ? ? 0 A   1746 0 U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1797 hydrog ? ? A  A   1747 N1    ? ? ? 1_555 A  U   2034 N3    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1798 hydrog ? ? A  A   1747 N6    ? ? ? 1_555 A  U   2034 O4    ? ? 0 A   1747 0 U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1799 hydrog ? ? A  G   1752 N1    ? ? ? 1_555 A  C   2031 N3    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1800 hydrog ? ? A  G   1752 N2    ? ? ? 1_555 A  C   2031 O2    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1801 hydrog ? ? A  G   1752 O6    ? ? ? 1_555 A  C   2031 N4    ? ? 0 G   1752 0 C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1802 hydrog ? ? A  G   1760 N1    ? ? ? 1_555 A  U   1784 O2    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1803 hydrog ? ? A  G   1760 O6    ? ? ? 1_555 A  U   1784 N3    ? ? 0 G   1760 0 U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1804 hydrog ? ? A  U   1761 N3    ? ? ? 1_555 A  A   1783 N1    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1805 hydrog ? ? A  U   1761 O4    ? ? ? 1_555 A  A   1783 N6    ? ? 0 U   1761 0 A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1806 hydrog ? ? A  C   1762 N3    ? ? ? 1_555 A  G   1782 N1    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1807 hydrog ? ? A  C   1762 N4    ? ? ? 1_555 A  G   1782 O6    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1808 hydrog ? ? A  C   1762 O2    ? ? ? 1_555 A  G   1782 N2    ? ? 0 C   1762 0 G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1809 hydrog ? ? A  C   1763 N3    ? ? ? 1_555 A  G   1781 N1    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1810 hydrog ? ? A  C   1763 N4    ? ? ? 1_555 A  G   1781 O6    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1811 hydrog ? ? A  C   1763 O2    ? ? ? 1_555 A  G   1781 N2    ? ? 0 C   1763 0 G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1812 hydrog ? ? A  C   1764 N3    ? ? ? 1_555 A  G   1780 N1    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1813 hydrog ? ? A  C   1764 N4    ? ? ? 1_555 A  G   1780 O6    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1814 hydrog ? ? A  C   1764 O2    ? ? ? 1_555 A  G   1780 N2    ? ? 0 C   1764 0 G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1815 hydrog ? ? A  G   1765 N2    ? ? ? 1_555 A  A   1779 N7    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1816 hydrog ? ? A  G   1765 N3    ? ? ? 1_555 A  A   1779 N6    ? ? 0 G   1765 0 A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1817 hydrog ? ? A  A   1767 N6    ? ? ? 1_555 A  A   1776 N7    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1818 hydrog ? ? A  A   1767 N7    ? ? ? 1_555 A  A   1776 N6    ? ? 0 A   1767 0 A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1819 hydrog ? ? A  C   1768 N4    ? ? ? 1_555 A  A   1775 N3    ? ? 0 C   1768 0 A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1820 hydrog ? ? A  C   1769 N3    ? ? ? 1_555 A  G   1774 N1    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1821 hydrog ? ? A  C   1769 N4    ? ? ? 1_555 A  G   1774 O6    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1822 hydrog ? ? A  C   1769 O2    ? ? ? 1_555 A  G   1774 N2    ? ? 0 C   1769 0 G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1823 hydrog ? ? A  U   1770 O2    ? ? ? 1_555 A  G   1773 N1    ? ? 0 U   1770 0 G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1824 hydrog ? ? A  U   1771 N3    ? ? ? 1_555 A  A   1885 N1    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1825 hydrog ? ? A  U   1771 O4    ? ? ? 1_555 A  A   1885 N6    ? ? 0 U   1771 0 A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1826 hydrog ? ? A  G   1785 N1    ? ? ? 1_555 A  U   1807 O2    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1827 hydrog ? ? A  G   1785 O6    ? ? ? 1_555 A  U   1807 N3    ? ? 0 G   1785 0 U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1828 hydrog ? ? A  C   1786 N3    ? ? ? 1_555 A  G   1806 N1    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1829 hydrog ? ? A  C   1786 N4    ? ? ? 1_555 A  G   1806 O6    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1830 hydrog ? ? A  C   1786 O2    ? ? ? 1_555 A  G   1806 N2    ? ? 0 C   1786 0 G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1831 hydrog ? ? A  C   1787 N3    ? ? ? 1_555 A  G   1805 N1    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1832 hydrog ? ? A  C   1787 N4    ? ? ? 1_555 A  G   1805 O6    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1833 hydrog ? ? A  C   1787 O2    ? ? ? 1_555 A  G   1805 N2    ? ? 0 C   1787 0 G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1834 hydrog ? ? A  U   1788 N3    ? ? ? 1_555 A  A   1804 N1    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1835 hydrog ? ? A  U   1788 O4    ? ? ? 1_555 A  A   1804 N6    ? ? 0 U   1788 0 A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1836 hydrog ? ? A  G   1789 N1    ? ? ? 1_555 A  C   1803 N3    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1837 hydrog ? ? A  G   1789 N2    ? ? ? 1_555 A  C   1803 O2    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1838 hydrog ? ? A  G   1789 O6    ? ? ? 1_555 A  C   1803 N4    ? ? 0 G   1789 0 C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1839 hydrog ? ? A  C   1790 N3    ? ? ? 1_555 A  G   1802 N1    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1840 hydrog ? ? A  C   1790 N4    ? ? ? 1_555 A  G   1802 O6    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1841 hydrog ? ? A  C   1790 O2    ? ? ? 1_555 A  G   1802 N2    ? ? 0 C   1790 0 G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1842 hydrog ? ? A  U   1791 N3    ? ? ? 1_555 A  A   1801 N1    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1843 hydrog ? ? A  U   1791 O4    ? ? ? 1_555 A  A   1801 N6    ? ? 0 U   1791 0 A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1844 hydrog ? ? A  C   1792 N3    ? ? ? 1_555 A  G   1800 N1    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1845 hydrog ? ? A  C   1792 N4    ? ? ? 1_555 A  G   1800 O6    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1846 hydrog ? ? A  C   1792 O2    ? ? ? 1_555 A  G   1800 N2    ? ? 0 C   1792 0 G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1847 hydrog ? ? A  C   1793 N3    ? ? ? 1_555 A  G   1799 N1    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1848 hydrog ? ? A  C   1793 N4    ? ? ? 1_555 A  G   1799 O6    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1849 hydrog ? ? A  C   1793 O2    ? ? ? 1_555 A  G   1799 N2    ? ? 0 C   1793 0 G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1850 hydrog ? ? A  G   1794 N2    ? ? ? 1_555 A  A   1797 N7    ? ? 0 G   1794 0 A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1851 hydrog ? ? A  G   1805 N2    ? ? ? 1_555 A  A   2875 N3    ? ? 0 G   1805 0 A   2875 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1852 hydrog ? ? A  G   1806 N2    ? ? ? 1_555 A  A   2883 N3    ? ? 0 G   1806 0 A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1853 hydrog ? ? A  C   1808 N3    ? ? ? 1_555 A  G   1812 N1    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1854 hydrog ? ? A  C   1808 N4    ? ? ? 1_555 A  G   1812 O6    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1855 hydrog ? ? A  C   1808 O2    ? ? ? 1_555 A  G   1812 N2    ? ? 0 C   1808 0 G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1856 hydrog ? ? A  C   1810 N4    ? ? ? 1_555 A  C   2752 O2    ? ? 0 C   1810 0 C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1857 hydrog ? ? A  A   1811 N1    ? ? ? 1_555 A  G   2731 N2    ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1858 hydrog ? ? A  A   1811 N6    ? ? ? 1_555 A  G   2731 N3    ? ? 0 A   1811 0 G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1859 hydrog ? ? A  U   1813 O2    ? ? ? 1_555 A  U   1817 N3    ? ? 0 U   1813 0 U   1817 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1860 hydrog ? ? A  U   1813 N3    ? ? ? 1_555 A  C   1818 O2    ? ? 0 U   1813 0 C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1861 hydrog ? ? A  G   1820 N1    ? ? ? 1_555 A  C   2029 N3    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1862 hydrog ? ? A  G   1820 N2    ? ? ? 1_555 A  C   2029 O2    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1863 hydrog ? ? A  G   1820 O6    ? ? ? 1_555 A  C   2029 N4    ? ? 0 G   1820 0 C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1864 hydrog ? ? A  A   1821 N1    ? ? ? 1_555 A  U   2028 N3    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1865 hydrog ? ? A  A   1821 N6    ? ? ? 1_555 A  U   2028 O4    ? ? 0 A   1821 0 U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1866 hydrog ? ? A  A   1822 N1    ? ? ? 1_555 A  U   2027 N3    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1867 hydrog ? ? A  A   1822 N6    ? ? ? 1_555 A  U   2027 O4    ? ? 0 A   1822 0 U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1868 hydrog ? ? A  G   1823 N1    ? ? ? 1_555 A  C   2026 N3    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1869 hydrog ? ? A  G   1823 N2    ? ? ? 1_555 A  C   2026 O2    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1870 hydrog ? ? A  G   1823 O6    ? ? ? 1_555 A  C   2026 N4    ? ? 0 G   1823 0 C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1871 hydrog ? ? A  C   1824 N3    ? ? ? 1_555 A  G   2025 N1    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1872 hydrog ? ? A  C   1824 N4    ? ? ? 1_555 A  G   2025 O6    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1873 hydrog ? ? A  C   1824 O2    ? ? ? 1_555 A  G   2025 N2    ? ? 0 C   1824 0 G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1874 hydrog ? ? A  U   1825 N3    ? ? ? 1_555 A  A   2024 N1    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1875 hydrog ? ? A  U   1825 O4    ? ? ? 1_555 A  A   2024 N6    ? ? 0 U   1825 0 A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1876 hydrog ? ? A  C   1826 N3    ? ? ? 1_555 A  G   2023 N1    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1877 hydrog ? ? A  C   1826 N4    ? ? ? 1_555 A  G   2023 O6    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1878 hydrog ? ? A  C   1826 O2    ? ? ? 1_555 A  G   2023 N2    ? ? 0 C   1826 0 G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1879 hydrog ? ? A  G   1827 N1    ? ? ? 1_555 A  C   2021 N3    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1880 hydrog ? ? A  G   1827 N2    ? ? ? 1_555 A  C   2021 O2    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1881 hydrog ? ? A  G   1827 O6    ? ? ? 1_555 A  C   2021 N4    ? ? 0 G   1827 0 C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1882 hydrog ? ? A  G   1828 N1    ? ? ? 1_555 A  C   2020 N3    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1883 hydrog ? ? A  G   1828 N2    ? ? ? 1_555 A  C   2020 O2    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1884 hydrog ? ? A  G   1828 O6    ? ? ? 1_555 A  C   2020 N4    ? ? 0 G   1828 0 C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1885 hydrog ? ? A  A   1829 N3    ? ? ? 1_555 A  A   2018 N6    ? ? 0 A   1829 0 A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1886 hydrog ? ? A  C   1830 N4    ? ? ? 1_555 A  U   1846 O2    ? ? 0 C   1830 0 U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog1887 hydrog ? ? A  G   1832 N1    ? ? ? 1_555 A  C   1844 N3    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1888 hydrog ? ? A  G   1832 N2    ? ? ? 1_555 A  C   1844 O2    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1889 hydrog ? ? A  G   1832 O6    ? ? ? 1_555 A  C   1844 N4    ? ? 0 G   1832 0 C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1890 hydrog ? ? A  U   1833 N3    ? ? ? 1_555 A  A   1843 N1    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1891 hydrog ? ? A  U   1833 O4    ? ? ? 1_555 A  A   1843 N6    ? ? 0 U   1833 0 A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1892 hydrog ? ? A  C   1834 O2    ? ? ? 1_555 A  C   1841 N4    ? ? 0 C   1834 0 C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1893 hydrog ? ? A  U   1835 O4    ? ? ? 1_555 A  C   1841 N4    ? ? 0 U   1835 0 C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1894 hydrog ? ? A  U   1838 N3    ? ? ? 1_555 A  PSU 2621 O2    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1895 hydrog ? ? A  U   1838 O4    ? ? ? 1_555 A  PSU 2621 N3    ? ? 0 U   1838 0 PSU 2621 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1896 hydrog ? ? A  A   1839 N3    ? ? ? 1_555 A  G   2642 N2    ? ? 0 A   1839 0 G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1897 hydrog ? ? A  C   1841 O2    ? ? ? 1_555 A  G   2623 N2    ? ? 0 C   1841 0 G   2623 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1898 hydrog ? ? A  A   1847 N6    ? ? ? 1_555 A  G   1884 N3    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1899 hydrog ? ? A  A   1847 N7    ? ? ? 1_555 A  G   1884 N2    ? ? 0 A   1847 0 G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1900 hydrog ? ? A  G   1848 N1    ? ? ? 1_555 A  U   1883 O2    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1901 hydrog ? ? A  G   1848 O6    ? ? ? 1_555 A  U   1883 N3    ? ? 0 G   1848 0 U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1902 hydrog ? ? A  G   1849 N1    ? ? ? 1_555 A  C   1882 N3    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1903 hydrog ? ? A  G   1849 N2    ? ? ? 1_555 A  C   1882 O2    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1904 hydrog ? ? A  G   1849 O6    ? ? ? 1_555 A  C   1882 N4    ? ? 0 G   1849 0 C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1905 hydrog ? ? A  G   1849 N2    ? ? ? 1_555 A  A   1941 N3    ? ? 0 G   1849 0 A   1941 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1906 hydrog ? ? A  U   1850 N3    ? ? ? 1_555 A  A   1881 N1    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1907 hydrog ? ? A  U   1850 O4    ? ? ? 1_555 A  A   1881 N6    ? ? 0 U   1850 0 A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1908 hydrog ? ? A  G   1851 N1    ? ? ? 1_555 A  C   1880 N3    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1909 hydrog ? ? A  G   1851 N2    ? ? ? 1_555 A  C   1880 O2    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1910 hydrog ? ? A  G   1851 O6    ? ? ? 1_555 A  C   1880 N4    ? ? 0 G   1851 0 C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1911 hydrog ? ? A  A   1852 N1    ? ? ? 1_555 A  U   1879 N3    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1912 hydrog ? ? A  A   1852 N6    ? ? ? 1_555 A  U   1879 O4    ? ? 0 A   1852 0 U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1913 hydrog ? ? A  C   1853 N3    ? ? ? 1_555 A  G   1878 N1    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1914 hydrog ? ? A  C   1853 N4    ? ? ? 1_555 A  G   1878 O6    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1915 hydrog ? ? A  C   1853 O2    ? ? ? 1_555 A  G   1878 N2    ? ? 0 C   1853 0 G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1916 hydrog ? ? A  C   1854 N3    ? ? ? 1_555 A  G   1877 N1    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1917 hydrog ? ? A  C   1854 N4    ? ? ? 1_555 A  G   1877 O6    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1918 hydrog ? ? A  C   1854 O2    ? ? ? 1_555 A  G   1877 N2    ? ? 0 C   1854 0 G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1919 hydrog ? ? A  G   1855 N2    ? ? ? 1_555 A  U   1874 O2    ? ? 0 G   1855 0 U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1920 hydrog ? ? A  C   1856 N3    ? ? ? 1_555 A  G   1873 N2    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1921 hydrog ? ? A  C   1856 O2    ? ? ? 1_555 A  G   1873 N1    ? ? 0 C   1856 0 G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1922 hydrog ? ? A  C   1856 N4    ? ? ? 1_555 A  A   1875 N7    ? ? 0 C   1856 0 A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1923 hydrog ? ? A  A   1858 N6    ? ? ? 1_555 A  U   1871 O4    ? ? 0 A   1858 0 U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1924 hydrog ? ? A  A   1859 N6    ? ? ? 1_555 A  C   1870 O2    ? ? 0 A   1859 0 C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1925 hydrog ? ? A  A   1859 N3    ? ? ? 1_555 A  G   1878 N2    ? ? 0 A   1859 0 G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1926 hydrog ? ? A  U   1860 N3    ? ? ? 1_555 A  A   1869 N1    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1927 hydrog ? ? A  U   1860 O4    ? ? ? 1_555 A  A   1869 N6    ? ? 0 U   1860 0 A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1928 hydrog ? ? A  C   1861 N3    ? ? ? 1_555 A  G   1868 N1    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1929 hydrog ? ? A  C   1861 N4    ? ? ? 1_555 A  G   1868 O6    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1930 hydrog ? ? A  C   1861 O2    ? ? ? 1_555 A  G   1868 N2    ? ? 0 C   1861 0 G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1931 hydrog ? ? A  C   1862 N3    ? ? ? 1_555 A  G   1867 N1    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1932 hydrog ? ? A  C   1862 N4    ? ? ? 1_555 A  G   1867 O6    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1933 hydrog ? ? A  C   1862 O2    ? ? ? 1_555 A  G   1867 N2    ? ? 0 C   1862 0 G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1934 hydrog ? ? A  G   1863 N2    ? ? ? 1_555 A  A   1866 N7    ? ? 0 G   1863 0 A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1935 hydrog ? ? A  A   1885 N6    ? ? ? 1_555 A  U   2017 O2    ? ? 0 A   1885 0 U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1936 hydrog ? ? A  A   1886 N6    ? ? ? 1_555 A  U   2016 O2    ? ? 0 A   1886 0 U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1937 hydrog ? ? A  U   1887 N3    ? ? ? 1_555 A  A   2015 N1    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1938 hydrog ? ? A  U   1887 O4    ? ? ? 1_555 A  A   2015 N6    ? ? 0 U   1887 0 A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1939 hydrog ? ? A  C   1888 N3    ? ? ? 1_555 A  G   2014 N1    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1940 hydrog ? ? A  C   1888 N4    ? ? ? 1_555 A  G   2014 O6    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1941 hydrog ? ? A  C   1888 O2    ? ? ? 1_555 A  G   2014 N2    ? ? 0 C   1888 0 G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1942 hydrog ? ? A  C   1889 N3    ? ? ? 1_555 A  G   2013 N1    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1943 hydrog ? ? A  C   1889 N4    ? ? ? 1_555 A  G   2013 O6    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1944 hydrog ? ? A  C   1889 O2    ? ? ? 1_555 A  G   2013 N2    ? ? 0 C   1889 0 G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1945 hydrog ? ? A  U   1890 O4    ? ? ? 1_555 A  A   1941 N6    ? ? 0 U   1890 0 A   1941 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1946 hydrog ? ? A  U   1890 N3    ? ? ? 1_555 A  A   2011 N7    ? ? 0 U   1890 0 A   2011 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1947 hydrog ? ? A  G   1891 N1    ? ? ? 1_555 A  C   1946 N3    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1948 hydrog ? ? A  G   1891 N2    ? ? ? 1_555 A  C   1946 O2    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1949 hydrog ? ? A  G   1891 O6    ? ? ? 1_555 A  C   1946 N4    ? ? 0 G   1891 0 C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1950 hydrog ? ? A  C   1892 N3    ? ? ? 1_555 A  G   1945 N1    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1951 hydrog ? ? A  C   1892 N4    ? ? ? 1_555 A  G   1945 O6    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1952 hydrog ? ? A  C   1892 O2    ? ? ? 1_555 A  G   1945 N2    ? ? 0 C   1892 0 G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1953 hydrog ? ? A  C   1893 N3    ? ? ? 1_555 A  G   1944 N1    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1954 hydrog ? ? A  C   1893 N4    ? ? ? 1_555 A  G   1944 O6    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1955 hydrog ? ? A  C   1893 O2    ? ? ? 1_555 A  G   1944 N2    ? ? 0 C   1893 0 G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1956 hydrog ? ? A  C   1894 N3    ? ? ? 1_555 A  A   1942 N6    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1957 hydrog ? ? A  C   1894 N4    ? ? ? 1_555 A  A   1942 N7    ? ? 0 C   1894 0 A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1958 hydrog ? ? A  G   1896 N1    ? ? ? 1_555 A  C   1943 N3    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1959 hydrog ? ? A  G   1896 N2    ? ? ? 1_555 A  C   1943 O2    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1960 hydrog ? ? A  G   1896 O6    ? ? ? 1_555 A  C   1943 N4    ? ? 0 G   1896 0 C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1961 hydrog ? ? A  U   1897 N3    ? ? ? 1_555 A  A   1942 N1    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1962 hydrog ? ? A  U   1897 O4    ? ? ? 1_555 A  A   1942 N6    ? ? 0 U   1897 0 A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1963 hydrog ? ? A  G   1898 N1    ? ? ? 1_555 A  U   1939 O2    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1964 hydrog ? ? A  G   1898 O6    ? ? ? 1_555 A  U   1939 N3    ? ? 0 G   1898 0 U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1965 hydrog ? ? A  C   1899 N3    ? ? ? 1_555 A  G   1938 N1    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1966 hydrog ? ? A  C   1899 N4    ? ? ? 1_555 A  G   1938 O6    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1967 hydrog ? ? A  C   1899 O2    ? ? ? 1_555 A  G   1938 N2    ? ? 0 C   1899 0 G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1968 hydrog ? ? A  A   1900 N1    ? ? ? 1_555 A  U   1937 N3    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1969 hydrog ? ? A  A   1900 N6    ? ? ? 1_555 A  U   1937 O4    ? ? 0 A   1900 0 U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1970 hydrog ? ? A  G   1901 N1    ? ? ? 1_555 A  C   1936 N3    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1971 hydrog ? ? A  G   1901 N2    ? ? ? 1_555 A  C   1936 O2    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1972 hydrog ? ? A  G   1901 O6    ? ? ? 1_555 A  C   1936 N4    ? ? 0 G   1901 0 C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1973 hydrog ? ? A  G   1902 N1    ? ? ? 1_555 A  C   1935 N3    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1974 hydrog ? ? A  G   1902 N2    ? ? ? 1_555 A  C   1935 O2    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1975 hydrog ? ? A  G   1902 O6    ? ? ? 1_555 A  C   1935 N4    ? ? 0 G   1902 0 C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1976 hydrog ? ? A  U   1903 O2    ? ? ? 1_555 A  A   1934 N6    ? ? 0 U   1903 0 A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1977 hydrog ? ? A  U   1905 N3    ? ? ? 1_555 A  A   1934 N1    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1978 hydrog ? ? A  U   1905 O4    ? ? ? 1_555 A  A   1934 N6    ? ? 0 U   1905 0 A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1979 hydrog ? ? A  C   1906 N3    ? ? ? 1_555 A  G   1933 N1    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1980 hydrog ? ? A  C   1906 N4    ? ? ? 1_555 A  G   1933 O6    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1981 hydrog ? ? A  C   1906 O2    ? ? ? 1_555 A  G   1933 N2    ? ? 0 C   1906 0 G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1982 hydrog ? ? A  U   1907 N3    ? ? ? 1_555 A  G   1932 O6    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1983 hydrog ? ? A  U   1907 O2    ? ? ? 1_555 A  G   1932 N1    ? ? 0 U   1907 0 G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1984 hydrog ? ? A  G   1908 N2    ? ? ? 1_555 A  A   1931 N7    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1985 hydrog ? ? A  G   1908 N3    ? ? ? 1_555 A  A   1931 N6    ? ? 0 G   1908 0 A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1986 hydrog ? ? A  A   1910 N3    ? ? ? 1_555 A  G   2128 N2    ? ? 0 A   1910 0 G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1987 hydrog ? ? A  A   1912 N6    ? ? ? 1_555 A  A   1927 N1    ? ? 0 A   1912 0 A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1988 hydrog ? ? A  C   1913 N3    ? ? ? 1_555 A  G   1926 N1    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1989 hydrog ? ? A  C   1913 N4    ? ? ? 1_555 A  G   1926 O6    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1990 hydrog ? ? A  C   1913 O2    ? ? ? 1_555 A  G   1926 N2    ? ? 0 C   1913 0 G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1991 hydrog ? ? A  C   1914 N3    ? ? ? 1_555 A  G   1925 N1    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1992 hydrog ? ? A  C   1914 N4    ? ? ? 1_555 A  G   1925 O6    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1993 hydrog ? ? A  C   1914 O2    ? ? ? 1_555 A  G   1925 N2    ? ? 0 C   1914 0 G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1994 hydrog ? ? A  U   1915 N3    ? ? ? 1_555 A  A   1924 N1    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1995 hydrog ? ? A  U   1915 O4    ? ? ? 1_555 A  A   1924 N6    ? ? 0 U   1915 0 A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1996 hydrog ? ? A  C   1916 N3    ? ? ? 1_555 A  G   1923 N1    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1997 hydrog ? ? A  C   1916 N4    ? ? ? 1_555 A  G   1923 O6    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1998 hydrog ? ? A  C   1916 O2    ? ? ? 1_555 A  G   1923 N2    ? ? 0 C   1916 0 G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1999 hydrog ? ? A  G   1917 N2    ? ? ? 1_555 A  A   1922 N7    ? ? 0 G   1917 0 A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2000 hydrog ? ? A  A   1921 N1    ? ? ? 1_555 A  G   2449 N2    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2001 hydrog ? ? A  A   1921 N6    ? ? ? 1_555 A  G   2449 N3    ? ? 0 A   1921 0 G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2002 hydrog ? ? A  A   1931 N3    ? ? ? 1_555 A  G   2267 N2    ? ? 0 A   1931 0 G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2003 hydrog ? ? A  C   1940 O2    ? ? ? 1_555 A  C   1943 N4    ? ? 0 C   1940 0 C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2004 hydrog ? ? A  G   1944 N2    ? ? ? 1_555 A  A   1968 N1    ? ? 0 G   1944 0 A   1968 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2005 hydrog ? ? A  G   1945 N2    ? ? ? 1_555 A  A   1969 N3    ? ? 0 G   1945 0 A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2006 hydrog ? ? A  G   1947 N1    ? ? ? 1_555 A  C   1965 N3    ? ? 0 G   1947 0 C   1965 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2007 hydrog ? ? A  G   1948 N1    ? ? ? 1_555 A  U   1964 O2    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2008 hydrog ? ? A  G   1948 O6    ? ? ? 1_555 A  U   1964 N3    ? ? 0 G   1948 0 U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2009 hydrog ? ? A  U   1966 N3    ? ? ? 1_555 A  G   1970 O6    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog2010 hydrog ? ? A  U   1966 O4    ? ? ? 1_555 A  G   1970 N1    ? ? 0 U   1966 0 G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog2011 hydrog ? ? A  U   1967 O2    ? ? ? 1_555 A  A   1969 N6    ? ? 0 U   1967 0 A   1969 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2012 hydrog ? ? A  G   1971 N2    ? ? ? 1_555 A  U   1972 O4    ? ? 0 G   1971 0 U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2013 hydrog ? ? A  U   1972 N3    ? ? ? 1_555 A  A   2010 N7    ? ? 0 U   1972 0 A   2010 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2014 hydrog ? ? A  A   1973 N6    ? ? ? 1_555 A  G   2009 N3    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2015 hydrog ? ? A  A   1973 N7    ? ? ? 1_555 A  G   2009 N2    ? ? 0 A   1973 0 G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2016 hydrog ? ? A  G   1974 N1    ? ? ? 1_555 A  U   2008 O2    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2017 hydrog ? ? A  G   1974 O6    ? ? ? 1_555 A  U   2008 N3    ? ? 0 G   1974 0 U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2018 hydrog ? ? A  C   1975 N3    ? ? ? 1_555 A  G   2005 N1    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2019 hydrog ? ? A  C   1975 N4    ? ? ? 1_555 A  G   2005 O6    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2020 hydrog ? ? A  C   1975 O2    ? ? ? 1_555 A  G   2005 N2    ? ? 0 C   1975 0 G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2021 hydrog ? ? A  U   1977 N3    ? ? ? 1_555 A  U   1984 O4    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2022 hydrog ? ? A  U   1977 O2    ? ? ? 1_555 A  U   1984 N3    ? ? 0 U   1977 0 U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2023 hydrog ? ? A  A   1978 N1    ? ? ? 1_555 A  G   2005 N2    ? ? 0 A   1978 0 G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2024 hydrog ? ? A  G   1979 N2    ? ? ? 1_555 A  U   2640 O2    ? ? 0 G   1979 0 U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2025 hydrog ? ? A  A   1981 N3    ? ? ? 1_555 A  C   1983 N4    ? ? 0 A   1981 0 C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2026 hydrog ? ? A  G   1986 N1    ? ? ? 1_555 A  C   2002 N3    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2027 hydrog ? ? A  G   1986 N2    ? ? ? 1_555 A  C   2002 O2    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2028 hydrog ? ? A  G   1986 O6    ? ? ? 1_555 A  C   2002 N4    ? ? 0 G   1986 0 C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2029 hydrog ? ? A  C   1987 N3    ? ? ? 1_555 A  G   2001 N1    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2030 hydrog ? ? A  C   1987 N4    ? ? ? 1_555 A  G   2001 O6    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2031 hydrog ? ? A  C   1987 O2    ? ? ? 1_555 A  G   2001 N2    ? ? 0 C   1987 0 G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2032 hydrog ? ? A  C   1988 N3    ? ? ? 1_555 A  G   2000 N1    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2033 hydrog ? ? A  C   1988 N4    ? ? ? 1_555 A  G   2000 O6    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2034 hydrog ? ? A  C   1988 O2    ? ? ? 1_555 A  G   2000 N2    ? ? 0 C   1988 0 G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2035 hydrog ? ? A  G   1989 N1    ? ? ? 1_555 A  C   1999 N3    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2036 hydrog ? ? A  G   1989 N2    ? ? ? 1_555 A  C   1999 O2    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2037 hydrog ? ? A  G   1989 O6    ? ? ? 1_555 A  C   1999 N4    ? ? 0 G   1989 0 C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2038 hydrog ? ? A  C   1990 N3    ? ? ? 1_555 A  G   1998 N1    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2039 hydrog ? ? A  C   1990 N4    ? ? ? 1_555 A  G   1998 O6    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2040 hydrog ? ? A  C   1990 O2    ? ? ? 1_555 A  G   1998 N2    ? ? 0 C   1990 0 G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2041 hydrog ? ? A  A   1994 N3    ? ? ? 1_555 A  G   2584 N2    ? ? 0 A   1994 0 G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2042 hydrog ? ? A  U   1996 O4    ? ? ? 1_555 A  C   2591 N4    ? ? 0 U   1996 0 C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2043 hydrog ? ? A  A   2010 N3    ? ? ? 1_555 A  G   2013 N2    ? ? 0 A   2010 0 G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2044 hydrog ? ? A  G   2033 N1    ? ? ? 1_555 A  C   2037 O2    ? ? 0 G   2033 0 C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2045 hydrog ? ? A  G   2041 N2    ? ? ? 1_555 A  U   2726 O4    ? ? 0 G   2041 0 U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2046 hydrog ? ? A  A   2054 N1    ? ? ? 1_555 A  U   2648 N3    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2047 hydrog ? ? A  A   2054 N6    ? ? ? 1_555 A  U   2648 O2    ? ? 0 A   2054 0 U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2048 hydrog ? ? A  A   2060 N1    ? ? ? 1_555 A  U   2076 N3    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2049 hydrog ? ? A  A   2060 N6    ? ? ? 1_555 A  U   2076 O4    ? ? 0 A   2060 0 U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2050 hydrog ? ? A  C   2061 N3    ? ? ? 1_555 A  G   2075 N1    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2051 hydrog ? ? A  C   2061 N4    ? ? ? 1_555 A  G   2075 O6    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2052 hydrog ? ? A  C   2061 O2    ? ? ? 1_555 A  G   2075 N2    ? ? 0 C   2061 0 G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2053 hydrog ? ? A  U   2063 N3    ? ? ? 1_555 A  A   2083 N3    ? ? 0 U   2063 0 A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2054 hydrog ? ? A  U   2064 N3    ? ? ? 1_555 A  A   2081 N1    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2055 hydrog ? ? A  U   2064 O4    ? ? ? 1_555 A  A   2081 N6    ? ? 0 U   2064 0 A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2056 hydrog ? ? A  C   2065 N3    ? ? ? 1_555 A  G   2080 N1    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2057 hydrog ? ? A  C   2065 N4    ? ? ? 1_555 A  G   2080 O6    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2058 hydrog ? ? A  C   2065 O2    ? ? ? 1_555 A  G   2080 N2    ? ? 0 C   2065 0 G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2059 hydrog ? ? A  C   2066 N3    ? ? ? 1_555 A  G   2079 N1    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2060 hydrog ? ? A  C   2066 N4    ? ? ? 1_555 A  G   2079 O6    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2061 hydrog ? ? A  C   2066 O2    ? ? ? 1_555 A  G   2079 N2    ? ? 0 C   2066 0 G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2062 hydrog ? ? A  A   2067 N1    ? ? ? 1_555 A  U   2078 N3    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2063 hydrog ? ? A  A   2067 N6    ? ? ? 1_555 A  U   2078 O4    ? ? 0 A   2067 0 U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2064 hydrog ? ? A  G   2068 N1    ? ? ? 1_555 A  C   2077 N3    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2065 hydrog ? ? A  G   2068 N2    ? ? ? 1_555 A  C   2077 O2    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2066 hydrog ? ? A  G   2068 O6    ? ? ? 1_555 A  C   2077 N4    ? ? 0 G   2068 0 C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2067 hydrog ? ? A  U   2069 N3    ? ? ? 1_555 A  A   2074 N7    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2068 hydrog ? ? A  U   2069 O2    ? ? ? 1_555 A  A   2074 N6    ? ? 0 U   2069 0 A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2069 hydrog ? ? A  G   2072 N2    ? ? ? 1_555 A  A   2490 N3    ? ? 0 G   2072 0 A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2070 hydrog ? ? A  C   2084 N3    ? ? ? 1_555 A  G   2660 N1    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2071 hydrog ? ? A  C   2084 N4    ? ? ? 1_555 A  G   2660 O6    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2072 hydrog ? ? A  C   2084 O2    ? ? ? 1_555 A  G   2660 N2    ? ? 0 C   2084 0 G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2073 hydrog ? ? A  A   2085 N1    ? ? ? 1_555 A  U   2659 N3    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2074 hydrog ? ? A  A   2085 N6    ? ? ? 1_555 A  U   2659 O4    ? ? 0 A   2085 0 U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2075 hydrog ? ? A  C   2086 N3    ? ? ? 1_555 A  G   2658 N1    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2076 hydrog ? ? A  C   2086 N4    ? ? ? 1_555 A  G   2658 O6    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2077 hydrog ? ? A  C   2086 O2    ? ? ? 1_555 A  G   2658 N2    ? ? 0 C   2086 0 G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2078 hydrog ? ? A  C   2087 N3    ? ? ? 1_555 A  G   2657 N1    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2079 hydrog ? ? A  C   2087 N4    ? ? ? 1_555 A  G   2657 O6    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2080 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  G   2657 N2    ? ? 0 C   2087 0 G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2081 hydrog ? ? A  C   2088 N3    ? ? ? 1_555 A  G   2656 N1    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2082 hydrog ? ? A  C   2088 N4    ? ? ? 1_555 A  G   2656 O6    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2083 hydrog ? ? A  C   2088 O2    ? ? ? 1_555 A  G   2656 N2    ? ? 0 C   2088 0 G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2084 hydrog ? ? A  C   2088 O2    ? ? ? 1_555 A  A   2840 N6    ? ? 0 C   2088 0 A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2085 hydrog ? ? A  A   2089 N1    ? ? ? 1_555 A  U   2655 N3    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2086 hydrog ? ? A  A   2089 N6    ? ? ? 1_555 A  U   2655 O4    ? ? 0 A   2089 0 U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2087 hydrog ? ? A  G   2090 N1    ? ? ? 1_555 A  C   2654 N3    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2088 hydrog ? ? A  G   2090 N2    ? ? ? 1_555 A  C   2654 O2    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2089 hydrog ? ? A  G   2090 O6    ? ? ? 1_555 A  C   2654 N4    ? ? 0 G   2090 0 C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2090 hydrog ? ? A  G   2091 N1    ? ? ? 1_555 A  A   2653 N1    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2091 hydrog ? ? A  G   2091 O6    ? ? ? 1_555 A  A   2653 N6    ? ? 0 G   2091 0 A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2092 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  C   2654 O2    ? ? 0 G   2091 0 C   2654 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2093 hydrog ? ? A  G   2092 N2    ? ? ? 1_555 A  G   2093 O6    ? ? 0 G   2092 0 G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2094 hydrog ? ? A  G   2092 N2    ? ? ? 1_555 A  U   2652 O4    ? ? 0 G   2092 0 U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2095 hydrog ? ? A  G   2093 N1    ? ? ? 1_555 A  U   2652 O2    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2096 hydrog ? ? A  G   2093 O6    ? ? ? 1_555 A  U   2652 N3    ? ? 0 G   2093 0 U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2097 hydrog ? ? A  G   2094 N1    ? ? ? 1_555 A  C   2651 N3    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2098 hydrog ? ? A  G   2094 N2    ? ? ? 1_555 A  C   2651 O2    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2099 hydrog ? ? A  G   2094 O6    ? ? ? 1_555 A  C   2651 N4    ? ? 0 G   2094 0 C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2100 hydrog ? ? A  A   2095 N6    ? ? ? 1_555 A  A   2612 N1    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2101 hydrog ? ? A  A   2095 N7    ? ? ? 1_555 A  A   2612 N6    ? ? 0 A   2095 0 A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2102 hydrog ? ? A  A   2095 N1    ? ? ? 1_555 A  U   2650 N3    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2103 hydrog ? ? A  A   2095 N6    ? ? ? 1_555 A  U   2650 O4    ? ? 0 A   2095 0 U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2104 hydrog ? ? A  G   2097 N1    ? ? ? 1_555 A  C   2647 N3    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2105 hydrog ? ? A  G   2097 N2    ? ? ? 1_555 A  C   2647 O2    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2106 hydrog ? ? A  G   2097 O6    ? ? ? 1_555 A  C   2647 N4    ? ? 0 G   2097 0 C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2107 hydrog ? ? A  C   2098 N3    ? ? ? 1_555 A  G   2646 N1    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2108 hydrog ? ? A  C   2098 N4    ? ? ? 1_555 A  G   2646 O6    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2109 hydrog ? ? A  C   2098 O2    ? ? ? 1_555 A  G   2646 N2    ? ? 0 C   2098 0 G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2110 hydrog ? ? A  G   2102 N1    ? ? ? 1_555 A  A   2486 N1    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2111 hydrog ? ? A  G   2102 O6    ? ? ? 1_555 A  A   2486 N6    ? ? 0 G   2102 0 A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2112 hydrog ? ? A  C   2104 N3    ? ? ? 1_555 A  A   2485 N6    ? ? 0 C   2104 0 A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2113 hydrog ? ? A  C   2104 N4    ? ? ? 1_555 A  C   2536 O2    ? ? 0 C   2104 0 C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2114 hydrog ? ? A  C   2105 N3    ? ? ? 1_555 A  G   2481 N1    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2115 hydrog ? ? A  C   2105 N4    ? ? ? 1_555 A  G   2481 O6    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2116 hydrog ? ? A  C   2105 O2    ? ? ? 1_555 A  G   2481 N2    ? ? 0 C   2105 0 G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2117 hydrog ? ? A  C   2106 N3    ? ? ? 1_555 A  G   2480 N1    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2118 hydrog ? ? A  C   2106 N4    ? ? ? 1_555 A  G   2480 O6    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2119 hydrog ? ? A  C   2106 O2    ? ? ? 1_555 A  G   2480 N2    ? ? 0 C   2106 0 G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2120 hydrog ? ? A  U   2107 N3    ? ? ? 1_555 A  A   2479 N1    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2121 hydrog ? ? A  U   2107 O4    ? ? ? 1_555 A  A   2479 N6    ? ? 0 U   2107 0 A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2122 hydrog ? ? A  A   2108 N1    ? ? ? 1_555 A  U   2478 N3    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2123 hydrog ? ? A  A   2108 N6    ? ? ? 1_555 A  U   2478 O4    ? ? 0 A   2108 0 U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2124 hydrog ? ? A  U   2109 N3    ? ? ? 1_555 A  A   2467 N1    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2125 hydrog ? ? A  U   2109 O2    ? ? ? 1_555 A  A   2467 N6    ? ? 0 U   2109 0 A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2126 hydrog ? ? A  G   2110 N1    ? ? ? 1_555 A  C   2477 N3    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2127 hydrog ? ? A  G   2110 N2    ? ? ? 1_555 A  C   2477 O2    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2128 hydrog ? ? A  G   2110 O6    ? ? ? 1_555 A  C   2477 N4    ? ? 0 G   2110 0 C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2129 hydrog ? ? A  G   2111 N1    ? ? ? 1_555 A  C   2476 N3    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2130 hydrog ? ? A  G   2111 N2    ? ? ? 1_555 A  C   2476 O2    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2131 hydrog ? ? A  G   2111 O6    ? ? ? 1_555 A  C   2476 N4    ? ? 0 G   2111 0 C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2132 hydrog ? ? A  A   2112 N1    ? ? ? 1_555 A  U   2473 N3    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2133 hydrog ? ? A  A   2112 N6    ? ? ? 1_555 A  U   2473 O4    ? ? 0 A   2112 0 U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2134 hydrog ? ? A  G   2113 N1    ? ? ? 1_555 A  C   2472 N3    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2135 hydrog ? ? A  G   2113 N2    ? ? ? 1_555 A  C   2472 O2    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2136 hydrog ? ? A  G   2113 O6    ? ? ? 1_555 A  C   2472 N4    ? ? 0 G   2113 0 C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2137 hydrog ? ? A  G   2113 N3    ? ? ? 1_555 A  C   2475 N4    ? ? 0 G   2113 0 C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2138 hydrog ? ? A  C   2114 N3    ? ? ? 1_555 A  G   2471 N1    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2139 hydrog ? ? A  C   2114 N4    ? ? ? 1_555 A  G   2471 O6    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2140 hydrog ? ? A  C   2114 O2    ? ? ? 1_555 A  G   2471 N2    ? ? 0 C   2114 0 G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2141 hydrog ? ? A  U   2115 N3    ? ? ? 1_555 A  A   2470 N1    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2142 hydrog ? ? A  U   2115 O4    ? ? ? 1_555 A  A   2470 N6    ? ? 0 U   2115 0 A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2143 hydrog ? ? A  U   2115 O2    ? ? ? 1_555 A  G   2632 N2    ? ? 0 U   2115 0 G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2144 hydrog ? ? A  U   2116 N3    ? ? ? 1_555 A  A   2118 N7    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2145 hydrog ? ? A  U   2116 O4    ? ? ? 1_555 A  A   2118 N6    ? ? 0 U   2116 0 A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2146 hydrog ? ? A  A   2118 N6    ? ? ? 1_555 A  G   2271 O6    ? ? 0 A   2118 0 G   2271 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2147 hydrog ? ? A  A   2118 N1    ? ? ? 1_555 A  U   2276 N3    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2148 hydrog ? ? A  A   2118 N6    ? ? ? 1_555 A  U   2276 O4    ? ? 0 A   2118 0 U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2149 hydrog ? ? A  C   2119 N4    ? ? ? 1_555 A  G   2271 O6    ? ? 0 C   2119 0 G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2150 hydrog ? ? A  C   2119 N3    ? ? ? 1_555 A  G   2275 N1    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2151 hydrog ? ? A  C   2119 N4    ? ? ? 1_555 A  G   2275 O6    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2152 hydrog ? ? A  C   2119 O2    ? ? ? 1_555 A  G   2275 N2    ? ? 0 C   2119 0 G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2153 hydrog ? ? A  U   2120 N3    ? ? ? 1_555 A  A   2274 N1    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2154 hydrog ? ? A  U   2120 O4    ? ? ? 1_555 A  A   2274 N6    ? ? 0 U   2120 0 A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2155 hydrog ? ? A  G   2121 N1    ? ? ? 1_555 A  C   2273 N3    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2156 hydrog ? ? A  G   2121 N2    ? ? ? 1_555 A  C   2273 O2    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2157 hydrog ? ? A  G   2121 O6    ? ? ? 1_555 A  C   2273 N4    ? ? 0 G   2121 0 C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2158 hydrog ? ? A  C   2122 N3    ? ? ? 1_555 A  G   2272 N1    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2159 hydrog ? ? A  C   2122 N4    ? ? ? 1_555 A  G   2272 O6    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2160 hydrog ? ? A  C   2122 O2    ? ? ? 1_555 A  G   2272 N2    ? ? 0 C   2122 0 G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2161 hydrog ? ? A  A   2123 N6    ? ? ? 1_555 A  G   2270 N3    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2162 hydrog ? ? A  A   2123 N7    ? ? ? 1_555 A  G   2270 N2    ? ? 0 A   2123 0 G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2163 hydrog ? ? A  G   2124 N1    ? ? ? 1_555 A  C   2269 N3    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2164 hydrog ? ? A  G   2124 N2    ? ? ? 1_555 A  C   2269 O2    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2165 hydrog ? ? A  G   2124 O6    ? ? ? 1_555 A  C   2269 N4    ? ? 0 G   2124 0 C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2166 hydrog ? ? A  G   2125 N1    ? ? ? 1_555 A  C   2268 N3    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2167 hydrog ? ? A  G   2125 N2    ? ? ? 1_555 A  C   2268 O2    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2168 hydrog ? ? A  G   2125 O6    ? ? ? 1_555 A  C   2268 N4    ? ? 0 G   2125 0 C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2169 hydrog ? ? A  C   2126 N3    ? ? ? 1_555 A  G   2267 N1    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2170 hydrog ? ? A  C   2126 N4    ? ? ? 1_555 A  G   2267 O6    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2171 hydrog ? ? A  C   2126 O2    ? ? ? 1_555 A  G   2267 N2    ? ? 0 C   2126 0 G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2172 hydrog ? ? A  U   2127 N3    ? ? ? 1_555 A  A   2266 N1    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2173 hydrog ? ? A  U   2127 O4    ? ? ? 1_555 A  A   2266 N6    ? ? 0 U   2127 0 A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2174 hydrog ? ? A  G   2128 N1    ? ? ? 1_555 A  U   2265 O2    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2175 hydrog ? ? A  G   2128 O6    ? ? ? 1_555 A  U   2265 N3    ? ? 0 G   2128 0 U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2176 hydrog ? ? A  U   2129 N3    ? ? ? 1_555 A  A   2264 N1    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2177 hydrog ? ? A  U   2129 O4    ? ? ? 1_555 A  A   2264 N6    ? ? 0 U   2129 0 A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2178 hydrog ? ? A  C   2130 N3    ? ? ? 1_555 A  G   2263 N1    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2179 hydrog ? ? A  C   2130 N4    ? ? ? 1_555 A  G   2263 O6    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2180 hydrog ? ? A  C   2130 O2    ? ? ? 1_555 A  G   2263 N2    ? ? 0 C   2130 0 G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2181 hydrog ? ? A  G   2131 N1    ? ? ? 1_555 A  C   2262 N3    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2182 hydrog ? ? A  G   2131 N2    ? ? ? 1_555 A  C   2262 O2    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2183 hydrog ? ? A  G   2131 O6    ? ? ? 1_555 A  C   2262 N4    ? ? 0 G   2131 0 C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2184 hydrog ? ? A  C   2132 O2    ? ? ? 1_555 A  C   2261 N4    ? ? 0 C   2132 0 C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2185 hydrog ? ? A  U   2133 O4    ? ? ? 1_555 A  A   2260 N6    ? ? 0 U   2133 0 A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2186 hydrog ? ? A  G   2134 N1    ? ? ? 1_555 A  C   2241 N3    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2187 hydrog ? ? A  G   2134 N2    ? ? ? 1_555 A  C   2241 O2    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2188 hydrog ? ? A  G   2134 O6    ? ? ? 1_555 A  C   2241 N4    ? ? 0 G   2134 0 C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2189 hydrog ? ? A  A   2135 N1    ? ? ? 1_555 A  U   2240 N3    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2190 hydrog ? ? A  A   2135 N6    ? ? ? 1_555 A  U   2240 O4    ? ? 0 A   2135 0 U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2191 hydrog ? ? A  G   2136 N1    ? ? ? 1_555 A  C   2239 O2    ? ? 0 G   2136 0 C   2239 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2192 hydrog ? ? A  U   2242 N3    ? ? ? 1_555 A  A   2258 N7    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2193 hydrog ? ? A  U   2242 O2    ? ? ? 1_555 A  A   2258 N6    ? ? 0 U   2242 0 A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2194 hydrog ? ? A  A   2244 N6    ? ? ? 1_555 A  G   2257 N3    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2195 hydrog ? ? A  A   2244 N7    ? ? ? 1_555 A  G   2257 N2    ? ? 0 A   2244 0 G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2196 hydrog ? ? A  C   2245 N3    ? ? ? 1_555 A  G   2256 N1    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2197 hydrog ? ? A  C   2245 N4    ? ? ? 1_555 A  G   2256 O6    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2198 hydrog ? ? A  C   2245 O2    ? ? ? 1_555 A  G   2256 N2    ? ? 0 C   2245 0 G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2199 hydrog ? ? A  U   2246 N3    ? ? ? 1_555 A  A   2255 N1    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2200 hydrog ? ? A  U   2246 O4    ? ? ? 1_555 A  A   2255 N6    ? ? 0 U   2246 0 A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2201 hydrog ? ? A  C   2247 N3    ? ? ? 1_555 A  G   2254 N1    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2202 hydrog ? ? A  C   2247 N4    ? ? ? 1_555 A  G   2254 O6    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2203 hydrog ? ? A  C   2247 O2    ? ? ? 1_555 A  G   2254 N2    ? ? 0 C   2247 0 G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2204 hydrog ? ? A  C   2248 O2    ? ? ? 1_555 A  G   2253 N2    ? ? 0 C   2248 0 G   2253 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2205 hydrog ? ? A  G   2249 N2    ? ? ? 1_555 A  A   2252 N7    ? ? 0 G   2249 0 A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2206 hydrog ? ? A  G   2271 N7    ? ? ? 1_555 A  A   2274 N6    ? ? 0 G   2271 0 A   2274 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2207 hydrog ? ? A  U   2277 N3    ? ? ? 1_555 A  A   2470 N7    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2208 hydrog ? ? A  U   2277 O4    ? ? ? 1_555 A  A   2470 N6    ? ? 0 U   2277 0 A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2209 hydrog ? ? A  U   2278 N3    ? ? ? 1_555 A  G   2471 N7    ? ? 0 U   2278 0 G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2210 hydrog ? ? A  G   2279 N1    ? ? ? 1_555 A  C   2292 N3    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2211 hydrog ? ? A  G   2279 N2    ? ? ? 1_555 A  C   2292 O2    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2212 hydrog ? ? A  G   2279 O6    ? ? ? 1_555 A  C   2292 N4    ? ? 0 G   2279 0 C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2213 hydrog ? ? A  A   2280 N1    ? ? ? 1_555 A  U   2290 N3    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2214 hydrog ? ? A  A   2280 N6    ? ? ? 1_555 A  U   2290 O4    ? ? 0 A   2280 0 U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2215 hydrog ? ? A  C   2281 N3    ? ? ? 1_555 A  G   2289 N1    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2216 hydrog ? ? A  C   2281 N4    ? ? ? 1_555 A  G   2289 O6    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2217 hydrog ? ? A  C   2281 O2    ? ? ? 1_555 A  G   2289 N2    ? ? 0 C   2281 0 G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2218 hydrog ? ? A  G   2288 N1    ? ? ? 1_555 A  C   2309 N3    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2219 hydrog ? ? A  G   2288 N2    ? ? ? 1_555 A  C   2309 O2    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2220 hydrog ? ? A  G   2288 O6    ? ? ? 1_555 A  C   2309 N4    ? ? 0 G   2288 0 C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2221 hydrog ? ? A  G   2289 N2    ? ? ? 1_555 A  A   2291 N1    ? ? 0 G   2289 0 A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2222 hydrog ? ? A  G   2293 N1    ? ? ? 1_555 A  C   2315 N3    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2223 hydrog ? ? A  G   2293 N2    ? ? ? 1_555 A  C   2315 O2    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2224 hydrog ? ? A  G   2293 O6    ? ? ? 1_555 A  C   2315 N4    ? ? 0 G   2293 0 C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2225 hydrog ? ? A  C   2294 N3    ? ? ? 1_555 A  G   2314 N1    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2226 hydrog ? ? A  C   2294 N4    ? ? ? 1_555 A  G   2314 O6    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2227 hydrog ? ? A  C   2294 O2    ? ? ? 1_555 A  G   2314 N2    ? ? 0 C   2294 0 G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2228 hydrog ? ? A  G   2295 N1    ? ? ? 1_555 A  C   2313 N3    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2229 hydrog ? ? A  G   2295 N2    ? ? ? 1_555 A  C   2313 O2    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2230 hydrog ? ? A  G   2295 O6    ? ? ? 1_555 A  C   2313 N4    ? ? 0 G   2295 0 C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2231 hydrog ? ? A  G   2295 N2    ? ? ? 1_555 A  A   2361 N3    ? ? 0 G   2295 0 A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2232 hydrog ? ? A  C   2296 N3    ? ? ? 1_555 A  G   2312 N1    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2233 hydrog ? ? A  C   2296 N4    ? ? ? 1_555 A  G   2312 O6    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2234 hydrog ? ? A  C   2296 O2    ? ? ? 1_555 A  G   2312 N2    ? ? 0 C   2296 0 G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2235 hydrog ? ? A  U   2297 N3    ? ? ? 1_555 A  A   2311 N1    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2236 hydrog ? ? A  U   2297 O4    ? ? ? 1_555 A  A   2311 N6    ? ? 0 U   2297 0 A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2237 hydrog ? ? A  C   2298 N3    ? ? ? 1_555 A  G   2310 N1    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2238 hydrog ? ? A  C   2298 N4    ? ? ? 1_555 A  G   2310 O6    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2239 hydrog ? ? A  C   2298 O2    ? ? ? 1_555 A  G   2310 N2    ? ? 0 C   2298 0 G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2240 hydrog ? ? A  G   2299 N2    ? ? ? 1_555 A  U   2308 O4    ? ? 0 G   2299 0 U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2241 hydrog ? ? A  A   2300 N6    ? ? ? 1_555 A  A   2307 N7    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2242 hydrog ? ? A  A   2300 N7    ? ? ? 1_555 A  A   2307 N6    ? ? 0 A   2300 0 A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2243 hydrog ? ? A  A   2301 N1    ? ? ? 1_555 A  U   2306 N3    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2244 hydrog ? ? A  A   2301 N6    ? ? ? 1_555 A  U   2306 O2    ? ? 0 A   2301 0 U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2245 hydrog ? ? A  G   2314 N2    ? ? ? 1_555 A  A   2425 N3    ? ? 0 G   2314 0 A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2246 hydrog ? ? A  G   2316 N1    ? ? ? 1_555 A  C   2464 N3    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2247 hydrog ? ? A  G   2316 N2    ? ? ? 1_555 A  C   2464 O2    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2248 hydrog ? ? A  G   2316 O6    ? ? ? 1_555 A  C   2464 N4    ? ? 0 G   2316 0 C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2249 hydrog ? ? A  C   2317 N3    ? ? ? 1_555 A  G   2359 N1    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2250 hydrog ? ? A  C   2317 N4    ? ? ? 1_555 A  G   2359 O6    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2251 hydrog ? ? A  C   2317 O2    ? ? ? 1_555 A  G   2359 N2    ? ? 0 C   2317 0 G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2252 hydrog ? ? A  C   2318 N3    ? ? ? 1_555 A  G   2421 N1    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2253 hydrog ? ? A  C   2318 N4    ? ? ? 1_555 A  G   2421 O6    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2254 hydrog ? ? A  C   2318 O2    ? ? ? 1_555 A  G   2421 N2    ? ? 0 C   2318 0 G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2255 hydrog ? ? A  C   2319 N3    ? ? ? 1_555 A  G   2420 N1    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2256 hydrog ? ? A  C   2319 N4    ? ? ? 1_555 A  G   2420 O6    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2257 hydrog ? ? A  C   2319 O2    ? ? ? 1_555 A  G   2420 N2    ? ? 0 C   2319 0 G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2258 hydrog ? ? A  A   2321 N1    ? ? ? 1_555 A  U   2378 N3    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2259 hydrog ? ? A  A   2321 N6    ? ? ? 1_555 A  U   2378 O2    ? ? 0 A   2321 0 U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2260 hydrog ? ? A  A   2321 N6    ? ? ? 1_555 A  A   2380 N7    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2261 hydrog ? ? A  A   2321 N7    ? ? ? 1_555 A  A   2380 N6    ? ? 0 A   2321 0 A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2262 hydrog ? ? A  U   2322 O2    ? ? ? 1_555 A  G   2421 N2    ? ? 0 U   2322 0 G   2421 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2263 hydrog ? ? A  G   2323 N1    ? ? ? 1_555 A  U   2377 O2    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2264 hydrog ? ? A  G   2323 O6    ? ? ? 1_555 A  U   2377 N3    ? ? 0 G   2323 0 U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2265 hydrog ? ? A  G   2324 N1    ? ? ? 1_555 A  C   2376 N3    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2266 hydrog ? ? A  G   2324 N2    ? ? ? 1_555 A  C   2376 O2    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2267 hydrog ? ? A  G   2324 O6    ? ? ? 1_555 A  C   2376 N4    ? ? 0 G   2324 0 C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2268 hydrog ? ? A  U   2325 N3    ? ? ? 1_555 A  A   2375 N1    ? ? 0 U   2325 0 A   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2269 hydrog ? ? A  U   2325 O4    ? ? ? 1_555 A  A   2375 N6    ? ? 0 U   2325 0 A   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2270 hydrog ? ? A  C   2326 N3    ? ? ? 1_555 A  G   2374 N1    ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2271 hydrog ? ? A  C   2326 N4    ? ? ? 1_555 A  G   2374 O6    ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2272 hydrog ? ? A  C   2326 O2    ? ? ? 1_555 A  G   2374 N2    ? ? 0 C   2326 0 G   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2273 hydrog ? ? A  A   2327 N1    ? ? ? 1_555 A  U   2373 N3    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2274 hydrog ? ? A  A   2327 N6    ? ? ? 1_555 A  U   2373 O4    ? ? 0 A   2327 0 U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2275 hydrog ? ? A  U   2328 N3    ? ? ? 1_555 A  A   2372 N1    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2276 hydrog ? ? A  U   2328 O4    ? ? ? 1_555 A  A   2372 N6    ? ? 0 U   2328 0 A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2277 hydrog ? ? A  C   2329 N3    ? ? ? 1_555 A  G   2371 N1    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2278 hydrog ? ? A  C   2329 N4    ? ? ? 1_555 A  G   2371 O6    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2279 hydrog ? ? A  C   2329 O2    ? ? ? 1_555 A  G   2371 N2    ? ? 0 C   2329 0 G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2280 hydrog ? ? A  U   2330 N3    ? ? ? 1_555 A  A   2369 N7    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2281 hydrog ? ? A  U   2330 O2    ? ? ? 1_555 A  A   2369 N6    ? ? 0 U   2330 0 A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2282 hydrog ? ? A  C   2331 N3    ? ? ? 1_555 A  G   2355 N1    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2283 hydrog ? ? A  C   2331 N4    ? ? ? 1_555 A  G   2355 O6    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2284 hydrog ? ? A  C   2331 O2    ? ? ? 1_555 A  G   2355 N2    ? ? 0 C   2331 0 G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2285 hydrog ? ? A  A   2332 N7    ? ? ? 1_555 A  G   2352 N2    ? ? 0 A   2332 0 G   2352 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2286 hydrog ? ? A  G   2333 N1    ? ? ? 1_555 A  C   2351 N3    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2287 hydrog ? ? A  G   2333 N2    ? ? ? 1_555 A  C   2351 O2    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2288 hydrog ? ? A  G   2333 O6    ? ? ? 1_555 A  C   2351 N4    ? ? 0 G   2333 0 C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2289 hydrog ? ? A  C   2334 N3    ? ? ? 1_555 A  G   2350 N1    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2290 hydrog ? ? A  C   2334 N4    ? ? ? 1_555 A  G   2350 O6    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2291 hydrog ? ? A  C   2334 O2    ? ? ? 1_555 A  G   2350 N2    ? ? 0 C   2334 0 G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2292 hydrog ? ? A  C   2335 N3    ? ? ? 1_555 A  G   2349 N1    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2293 hydrog ? ? A  C   2335 N4    ? ? ? 1_555 A  G   2349 O6    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2294 hydrog ? ? A  C   2335 O2    ? ? ? 1_555 A  G   2349 N2    ? ? 0 C   2335 0 G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2295 hydrog ? ? A  G   2336 N1    ? ? ? 1_555 A  C   2348 N3    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2296 hydrog ? ? A  G   2336 N2    ? ? ? 1_555 A  C   2348 O2    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2297 hydrog ? ? A  G   2336 O6    ? ? ? 1_555 A  C   2348 N4    ? ? 0 G   2336 0 C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2298 hydrog ? ? A  G   2337 N1    ? ? ? 1_555 A  C   2347 N3    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2299 hydrog ? ? A  G   2337 N2    ? ? ? 1_555 A  C   2347 O2    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2300 hydrog ? ? A  G   2337 O6    ? ? ? 1_555 A  C   2347 N4    ? ? 0 G   2337 0 C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2301 hydrog ? ? A  G   2338 N1    ? ? ? 1_555 A  C   2346 N3    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2302 hydrog ? ? A  G   2338 N2    ? ? ? 1_555 A  C   2346 O2    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2303 hydrog ? ? A  G   2338 O6    ? ? ? 1_555 A  C   2346 N4    ? ? 0 G   2338 0 C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2304 hydrog ? ? A  A   2356 N1    ? ? ? 1_555 A  A   2369 N6    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2305 hydrog ? ? A  A   2356 N6    ? ? ? 1_555 A  A   2369 N1    ? ? 0 A   2356 0 A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2306 hydrog ? ? A  G   2357 N1    ? ? ? 1_555 A  C   2366 N3    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2307 hydrog ? ? A  G   2357 N2    ? ? ? 1_555 A  C   2366 O2    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2308 hydrog ? ? A  G   2357 O6    ? ? ? 1_555 A  C   2366 N4    ? ? 0 G   2357 0 C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2309 hydrog ? ? A  U   2358 N3    ? ? ? 1_555 A  G   2365 O6    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2310 hydrog ? ? A  U   2358 O2    ? ? ? 1_555 A  G   2365 N1    ? ? 0 U   2358 0 G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2311 hydrog ? ? A  C   2360 O2    ? ? ? 1_555 A  A   2425 N6    ? ? 0 C   2360 0 A   2425 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2312 hydrog ? ? A  C   2360 N3    ? ? ? 1_555 A  G   2426 N1    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2313 hydrog ? ? A  C   2360 N4    ? ? ? 1_555 A  G   2426 O6    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2314 hydrog ? ? A  C   2360 O2    ? ? ? 1_555 A  G   2426 N2    ? ? 0 C   2360 0 G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2315 hydrog ? ? A  A   2362 N1    ? ? ? 1_555 A  U   2424 N3    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2316 hydrog ? ? A  A   2362 N6    ? ? ? 1_555 A  U   2424 O4    ? ? 0 A   2362 0 U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2317 hydrog ? ? A  G   2363 N1    ? ? ? 1_555 A  C   2423 N3    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2318 hydrog ? ? A  G   2363 N2    ? ? ? 1_555 A  C   2423 O2    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2319 hydrog ? ? A  G   2363 O6    ? ? ? 1_555 A  C   2423 N4    ? ? 0 G   2363 0 C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2320 hydrog ? ? A  A   2364 N1    ? ? ? 1_555 A  U   2422 N3    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2321 hydrog ? ? A  A   2364 N6    ? ? ? 1_555 A  U   2422 O4    ? ? 0 A   2364 0 U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2322 hydrog ? ? A  G   2365 N2    ? ? ? 1_555 A  A   2370 N3    ? ? 0 G   2365 0 A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2323 hydrog ? ? A  G   2379 O6    ? ? ? 1_555 A  A   2408 N6    ? ? 0 G   2379 0 A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2324 hydrog ? ? A  C   2381 N3    ? ? ? 1_555 A  G   2407 N1    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2325 hydrog ? ? A  C   2381 N4    ? ? ? 1_555 A  G   2407 O6    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2326 hydrog ? ? A  C   2381 O2    ? ? ? 1_555 A  G   2407 N2    ? ? 0 C   2381 0 G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2327 hydrog ? ? A  A   2382 N1    ? ? ? 1_555 A  U   2406 N3    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2328 hydrog ? ? A  A   2382 N6    ? ? ? 1_555 A  U   2406 O4    ? ? 0 A   2382 0 U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2329 hydrog ? ? A  G   2383 N1    ? ? ? 1_555 A  C   2405 N3    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2330 hydrog ? ? A  G   2383 N2    ? ? ? 1_555 A  C   2405 O2    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2331 hydrog ? ? A  G   2383 O6    ? ? ? 1_555 A  C   2405 N4    ? ? 0 G   2383 0 C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2332 hydrog ? ? A  U   2384 N3    ? ? ? 1_555 A  G   2404 O6    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2333 hydrog ? ? A  U   2384 O2    ? ? ? 1_555 A  G   2404 N1    ? ? 0 U   2384 0 G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2334 hydrog ? ? A  G   2385 N1    ? ? ? 1_555 A  C   2403 N3    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2335 hydrog ? ? A  G   2385 N2    ? ? ? 1_555 A  C   2403 O2    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2336 hydrog ? ? A  G   2385 O6    ? ? ? 1_555 A  C   2403 N4    ? ? 0 G   2385 0 C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2337 hydrog ? ? A  U   2386 N3    ? ? ? 1_555 A  A   2402 N1    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2338 hydrog ? ? A  U   2386 O4    ? ? ? 1_555 A  A   2402 N6    ? ? 0 U   2386 0 A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2339 hydrog ? ? A  U   2387 N3    ? ? ? 1_555 A  A   2401 N1    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2340 hydrog ? ? A  U   2387 O4    ? ? ? 1_555 A  A   2401 N6    ? ? 0 U   2387 0 A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2341 hydrog ? ? A  C   2388 N3    ? ? ? 1_555 A  G   2400 N1    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2342 hydrog ? ? A  C   2388 N4    ? ? ? 1_555 A  G   2400 O6    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2343 hydrog ? ? A  C   2388 O2    ? ? ? 1_555 A  G   2400 N2    ? ? 0 C   2388 0 G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2344 hydrog ? ? A  U   2389 N3    ? ? ? 1_555 A  G   2399 O6    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2345 hydrog ? ? A  U   2389 O2    ? ? ? 1_555 A  G   2399 N1    ? ? 0 U   2389 0 G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2346 hydrog ? ? A  U   2390 O2    ? ? ? 1_555 A  A   2398 N6    ? ? 0 U   2390 0 A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2347 hydrog ? ? A  C   2391 N4    ? ? ? 1_555 A  G   2397 N7    ? ? 0 C   2391 0 G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2348 hydrog ? ? A  C   2409 N3    ? ? ? 1_555 A  G   2418 N1    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2349 hydrog ? ? A  C   2409 N4    ? ? ? 1_555 A  G   2418 O6    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2350 hydrog ? ? A  C   2409 O2    ? ? ? 1_555 A  G   2418 N2    ? ? 0 C   2409 0 G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2351 hydrog ? ? A  G   2410 N1    ? ? ? 1_555 A  C   2417 N3    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2352 hydrog ? ? A  G   2410 N2    ? ? ? 1_555 A  C   2417 O2    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2353 hydrog ? ? A  G   2410 O6    ? ? ? 1_555 A  C   2417 N4    ? ? 0 G   2410 0 C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2354 hydrog ? ? A  C   2411 N3    ? ? ? 1_555 A  G   2416 N1    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2355 hydrog ? ? A  C   2411 N4    ? ? ? 1_555 A  G   2416 O6    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2356 hydrog ? ? A  C   2411 O2    ? ? ? 1_555 A  G   2416 N2    ? ? 0 C   2411 0 G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2357 hydrog ? ? A  G   2412 N2    ? ? ? 1_555 A  A   2415 N7    ? ? 0 G   2412 0 A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2358 hydrog ? ? A  C   2427 N4    ? ? ? 1_555 A  G   2462 O6    ? ? 0 C   2427 0 G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2359 hydrog ? ? A  G   2428 N2    ? ? ? 1_555 A  G   2466 N3    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2360 hydrog ? ? A  G   2428 N3    ? ? ? 1_555 A  G   2466 N2    ? ? 0 G   2428 0 G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2361 hydrog ? ? A  A   2429 N6    ? ? ? 1_555 A  U   2461 O2    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2362 hydrog ? ? A  A   2429 N7    ? ? ? 1_555 A  U   2461 N3    ? ? 0 A   2429 0 U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2363 hydrog ? ? A  A   2430 N6    ? ? ? 1_555 A  A   2460 N1    ? ? 0 A   2430 0 A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2364 hydrog ? ? A  C   2432 N3    ? ? ? 1_555 A  G   2459 N1    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2365 hydrog ? ? A  C   2432 N4    ? ? ? 1_555 A  G   2459 O6    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2366 hydrog ? ? A  C   2432 O2    ? ? ? 1_555 A  G   2459 N2    ? ? 0 C   2432 0 G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2367 hydrog ? ? A  A   2433 N1    ? ? ? 1_555 A  U   2458 N3    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2368 hydrog ? ? A  A   2433 N6    ? ? ? 1_555 A  U   2458 O4    ? ? 0 A   2433 0 U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2369 hydrog ? ? A  A   2434 N1    ? ? ? 1_555 A  U   2457 N3    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2370 hydrog ? ? A  A   2434 N6    ? ? ? 1_555 A  U   2457 O4    ? ? 0 A   2434 0 U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2371 hydrog ? ? A  U   2435 N3    ? ? ? 1_555 A  A   2456 N1    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2372 hydrog ? ? A  U   2435 O4    ? ? ? 1_555 A  A   2456 N6    ? ? 0 U   2435 0 A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2373 hydrog ? ? A  U   2436 N3    ? ? ? 1_555 A  A   2455 N1    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2374 hydrog ? ? A  U   2436 O4    ? ? ? 1_555 A  A   2455 N6    ? ? 0 U   2436 0 A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2375 hydrog ? ? A  G   2438 N1    ? ? ? 1_555 A  C   2454 N3    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2376 hydrog ? ? A  G   2438 N2    ? ? ? 1_555 A  C   2454 O2    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2377 hydrog ? ? A  G   2438 O6    ? ? ? 1_555 A  C   2454 N4    ? ? 0 G   2438 0 C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2378 hydrog ? ? A  C   2439 N3    ? ? ? 1_555 A  G   2453 N1    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2379 hydrog ? ? A  C   2439 N4    ? ? ? 1_555 A  G   2453 O6    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2380 hydrog ? ? A  C   2439 O2    ? ? ? 1_555 A  G   2453 N2    ? ? 0 C   2439 0 G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2381 hydrog ? ? A  C   2440 N3    ? ? ? 1_555 A  G   2452 N1    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2382 hydrog ? ? A  C   2440 N4    ? ? ? 1_555 A  G   2452 O6    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2383 hydrog ? ? A  C   2440 O2    ? ? ? 1_555 A  G   2452 N2    ? ? 0 C   2440 0 G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2384 hydrog ? ? A  U   2441 N3    ? ? ? 1_555 A  G   2451 O6    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2385 hydrog ? ? A  U   2441 O2    ? ? ? 1_555 A  G   2451 N1    ? ? 0 U   2441 0 G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2386 hydrog ? ? A  G   2442 N1    ? ? ? 1_555 A  C   2450 N3    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2387 hydrog ? ? A  G   2442 N2    ? ? ? 1_555 A  C   2450 O2    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2388 hydrog ? ? A  G   2442 O6    ? ? ? 1_555 A  C   2450 N4    ? ? 0 G   2442 0 C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2389 hydrog ? ? A  G   2471 N2    ? ? ? 1_555 A  A   2633 N3    ? ? 0 G   2471 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2390 hydrog ? ? A  U   2473 O2    ? ? ? 1_555 A  C   2475 N4    ? ? 0 U   2473 0 C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2391 hydrog ? ? A  G   2482 O6    ? ? ? 1_555 A  A   2486 N6    ? ? 0 G   2482 0 A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2392 hydrog ? ? A  A   2485 N6    ? ? ? 1_555 A  C   2536 N3    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2393 hydrog ? ? A  A   2485 N7    ? ? ? 1_555 A  C   2536 N4    ? ? 0 A   2485 0 C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2394 hydrog ? ? A  G   2489 N1    ? ? ? 1_555 A  C   2533 N3    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2395 hydrog ? ? A  G   2489 N2    ? ? ? 1_555 A  C   2533 O2    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2396 hydrog ? ? A  G   2489 O6    ? ? ? 1_555 A  C   2533 N4    ? ? 0 G   2489 0 C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2397 hydrog ? ? A  A   2490 N1    ? ? ? 1_555 A  U   2531 N3    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2398 hydrog ? ? A  A   2490 N6    ? ? ? 1_555 A  U   2531 O4    ? ? 0 A   2490 0 U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2399 hydrog ? ? A  G   2491 N1    ? ? ? 1_555 A  C   2530 N3    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2400 hydrog ? ? A  G   2491 N2    ? ? ? 1_555 A  C   2530 O2    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2401 hydrog ? ? A  G   2491 O6    ? ? ? 1_555 A  C   2530 N4    ? ? 0 G   2491 0 C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2402 hydrog ? ? A  U   2492 N3    ? ? ? 1_555 A  G   2529 O6    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2403 hydrog ? ? A  U   2492 O2    ? ? ? 1_555 A  G   2529 N1    ? ? 0 U   2492 0 G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2404 hydrog ? ? A  G   2494 N1    ? ? ? 1_555 A  U   2528 O2    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2405 hydrog ? ? A  G   2494 O6    ? ? ? 1_555 A  U   2528 N3    ? ? 0 G   2494 0 U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2406 hydrog ? ? A  U   2495 O4    ? ? ? 1_555 A  G   2525 N2    ? ? 0 U   2495 0 G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2407 hydrog ? ? A  U   2495 N3    ? ? ? 1_555 A  U   2527 O4    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2408 hydrog ? ? A  U   2495 O2    ? ? ? 1_555 A  U   2527 N3    ? ? 0 U   2495 0 U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2409 hydrog ? ? A  C   2496 N3    ? ? ? 1_555 A  G   2524 N1    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2410 hydrog ? ? A  C   2496 N4    ? ? ? 1_555 A  G   2524 O6    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2411 hydrog ? ? A  C   2496 O2    ? ? ? 1_555 A  G   2524 N2    ? ? 0 C   2496 0 G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2412 hydrog ? ? A  A   2497 N1    ? ? ? 1_555 A  U   2523 N3    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2413 hydrog ? ? A  A   2497 N6    ? ? ? 1_555 A  U   2523 O4    ? ? 0 A   2497 0 U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2414 hydrog ? ? A  C   2498 N3    ? ? ? 1_555 A  G   2522 N1    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2415 hydrog ? ? A  C   2498 N4    ? ? ? 1_555 A  G   2522 O6    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2416 hydrog ? ? A  C   2498 O2    ? ? ? 1_555 A  G   2522 N2    ? ? 0 C   2498 0 G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2417 hydrog ? ? A  U   2499 N3    ? ? ? 1_555 A  A   2521 N1    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2418 hydrog ? ? A  U   2499 O4    ? ? ? 1_555 A  A   2521 N6    ? ? 0 U   2499 0 A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2419 hydrog ? ? A  C   2500 N3    ? ? ? 1_555 A  G   2520 N1    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2420 hydrog ? ? A  C   2500 N4    ? ? ? 1_555 A  G   2520 O6    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2421 hydrog ? ? A  C   2500 O2    ? ? ? 1_555 A  G   2520 N2    ? ? 0 C   2500 0 G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2422 hydrog ? ? A  G   2501 N1    ? ? ? 1_555 A  C   2519 N3    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2423 hydrog ? ? A  G   2501 N2    ? ? ? 1_555 A  C   2519 O2    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2424 hydrog ? ? A  G   2501 O6    ? ? ? 1_555 A  C   2519 N4    ? ? 0 G   2501 0 C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2425 hydrog ? ? A  C   2502 O2    ? ? ? 1_555 A  C   2518 N4    ? ? 0 C   2502 0 C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2426 hydrog ? ? A  A   2503 N3    ? ? ? 1_555 A  A   2517 N6    ? ? 0 A   2503 0 A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2427 hydrog ? ? A  A   2504 N6    ? ? ? 1_555 A  G   2516 N3    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2428 hydrog ? ? A  A   2504 N7    ? ? ? 1_555 A  G   2516 N2    ? ? 0 A   2504 0 G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2429 hydrog ? ? A  G   2505 N1    ? ? ? 1_555 A  C   2515 N3    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2430 hydrog ? ? A  G   2505 N2    ? ? ? 1_555 A  C   2515 O2    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2431 hydrog ? ? A  G   2505 O6    ? ? ? 1_555 A  C   2515 N4    ? ? 0 G   2505 0 C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2432 hydrog ? ? A  A   2506 N1    ? ? ? 1_555 A  U   2514 N3    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2433 hydrog ? ? A  A   2506 N6    ? ? ? 1_555 A  U   2514 O4    ? ? 0 A   2506 0 U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2434 hydrog ? ? A  G   2507 N2    ? ? ? 1_555 A  A   2513 N7    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2435 hydrog ? ? A  G   2507 N3    ? ? ? 1_555 A  A   2513 N6    ? ? 0 G   2507 0 A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2436 hydrog ? ? A  C   2510 N3    ? ? ? 1_555 A  G   2564 N1    ? ? 0 C   2510 0 G   2564 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2437 hydrog ? ? A  G   2524 N3    ? ? ? 1_555 A  C   2526 N4    ? ? 0 G   2524 0 C   2526 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2438 hydrog ? ? A  G   2525 N2    ? ? ? 1_555 A  U   2527 O4    ? ? 0 G   2525 0 U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2439 hydrog ? ? A  A   2532 N3    ? ? ? 1_555 A  C   2533 N4    ? ? 0 A   2532 0 C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2440 hydrog ? ? A  G   2540 N1    ? ? ? 1_555 A  U   2645 O2    ? ? 0 G   2540 0 U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2441 hydrog ? ? A  U   2541 N3    ? ? ? 1_555 A  G   2618 O6    ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2442 hydrog ? ? A  U   2541 O2    ? ? ? 1_555 A  G   2618 N1    ? ? 0 U   2541 0 G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2443 hydrog ? ? A  C   2542 O2    ? ? ? 1_555 A  OMG 2588 N2    ? ? 0 C   2542 0 OMG 2588 1_555 ? ? ? ? ? ? 'C-OMG PAIR' ? ? 
hydrog2444 hydrog ? ? A  C   2542 N3    ? ? ? 1_555 A  G   2617 N1    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2445 hydrog ? ? A  C   2542 N4    ? ? ? 1_555 A  G   2617 O6    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2446 hydrog ? ? A  C   2542 O2    ? ? ? 1_555 A  G   2617 N2    ? ? 0 C   2542 0 G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2447 hydrog ? ? A  G   2543 N1    ? ? ? 1_555 A  U   2615 O2    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2448 hydrog ? ? A  G   2543 O6    ? ? ? 1_555 A  U   2615 N3    ? ? 0 G   2543 0 U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2449 hydrog ? ? A  G   2544 N1    ? ? ? 1_555 A  C   2614 N3    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2450 hydrog ? ? A  G   2544 N2    ? ? ? 1_555 A  C   2614 O2    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2451 hydrog ? ? A  G   2544 O6    ? ? ? 1_555 A  C   2614 N4    ? ? 0 G   2544 0 C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2452 hydrog ? ? A  U   2545 N3    ? ? ? 1_555 A  G   2613 O6    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2453 hydrog ? ? A  U   2545 O2    ? ? ? 1_555 A  G   2613 N1    ? ? 0 U   2545 0 G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2454 hydrog ? ? A  U   2546 N3    ? ? ? 1_555 A  U   2610 O2    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2455 hydrog ? ? A  U   2546 O4    ? ? ? 1_555 A  U   2610 N3    ? ? 0 U   2546 0 U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2456 hydrog ? ? A  C   2547 N3    ? ? ? 1_555 A  G   2609 N1    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2457 hydrog ? ? A  C   2547 N4    ? ? ? 1_555 A  G   2609 O6    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2458 hydrog ? ? A  C   2547 O2    ? ? ? 1_555 A  G   2609 N2    ? ? 0 C   2547 0 G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2459 hydrog ? ? A  C   2548 N3    ? ? ? 1_555 A  G   2606 N1    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2460 hydrog ? ? A  C   2548 N4    ? ? ? 1_555 A  G   2606 O6    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2461 hydrog ? ? A  C   2548 O2    ? ? ? 1_555 A  G   2606 N2    ? ? 0 C   2548 0 G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2462 hydrog ? ? A  C   2549 N3    ? ? ? 1_555 A  G   2605 N1    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2463 hydrog ? ? A  C   2549 N4    ? ? ? 1_555 A  G   2605 O6    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2464 hydrog ? ? A  C   2549 O2    ? ? ? 1_555 A  G   2605 N2    ? ? 0 C   2549 0 G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2465 hydrog ? ? A  U   2550 N3    ? ? ? 1_555 A  A   2604 N1    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2466 hydrog ? ? A  U   2550 O4    ? ? ? 1_555 A  A   2604 N6    ? ? 0 U   2550 0 A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2467 hydrog ? ? A  C   2551 N3    ? ? ? 1_555 A  G   2603 N1    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2468 hydrog ? ? A  C   2551 N4    ? ? ? 1_555 A  G   2603 O6    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2469 hydrog ? ? A  C   2551 O2    ? ? ? 1_555 A  G   2603 N2    ? ? 0 C   2551 0 G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2470 hydrog ? ? A  C   2552 N3    ? ? ? 1_555 A  G   2602 N1    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2471 hydrog ? ? A  C   2552 N4    ? ? ? 1_555 A  G   2602 O6    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2472 hydrog ? ? A  C   2552 O2    ? ? ? 1_555 A  G   2602 N2    ? ? 0 C   2552 0 G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2473 hydrog ? ? A  U   2554 O2    ? ? ? 1_555 A  C   2556 N4    ? ? 0 U   2554 0 C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2474 hydrog ? ? A  C   2555 N4    ? ? ? 1_555 A  A   2577 N1    ? ? 0 C   2555 0 A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2475 hydrog ? ? A  C   2555 N3    ? ? ? 1_555 A  G   2580 N1    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2476 hydrog ? ? A  C   2555 N4    ? ? ? 1_555 A  G   2580 O6    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2477 hydrog ? ? A  C   2555 O2    ? ? ? 1_555 A  G   2580 N2    ? ? 0 C   2555 0 G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2478 hydrog ? ? A  C   2556 N3    ? ? ? 1_555 A  G   2579 N1    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2479 hydrog ? ? A  C   2556 N4    ? ? ? 1_555 A  G   2579 O6    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2480 hydrog ? ? A  C   2556 O2    ? ? ? 1_555 A  G   2579 N2    ? ? 0 C   2556 0 G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2481 hydrog ? ? A  U   2557 N3    ? ? ? 1_555 A  G   2578 O6    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2482 hydrog ? ? A  U   2557 O2    ? ? ? 1_555 A  G   2578 N1    ? ? 0 U   2557 0 G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2483 hydrog ? ? A  G   2558 N1    ? ? ? 1_555 A  C   2575 N3    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2484 hydrog ? ? A  G   2558 N2    ? ? ? 1_555 A  C   2575 O2    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2485 hydrog ? ? A  G   2558 O6    ? ? ? 1_555 A  C   2575 N4    ? ? 0 G   2558 0 C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2486 hydrog ? ? A  G   2558 N2    ? ? ? 1_555 A  A   2799 N3    ? ? 0 G   2558 0 A   2799 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2487 hydrog ? ? A  C   2559 N3    ? ? ? 1_555 A  G   2574 N1    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2488 hydrog ? ? A  C   2559 N4    ? ? ? 1_555 A  G   2574 O6    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2489 hydrog ? ? A  C   2559 O2    ? ? ? 1_555 A  G   2574 N2    ? ? 0 C   2559 0 G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2490 hydrog ? ? A  C   2560 N3    ? ? ? 1_555 A  G   2573 N1    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2491 hydrog ? ? A  C   2560 N4    ? ? ? 1_555 A  G   2573 O6    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2492 hydrog ? ? A  C   2560 O2    ? ? ? 1_555 A  G   2573 N2    ? ? 0 C   2560 0 G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2493 hydrog ? ? A  C   2561 N3    ? ? ? 1_555 A  G   2572 N1    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2494 hydrog ? ? A  C   2561 N4    ? ? ? 1_555 A  G   2572 O6    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2495 hydrog ? ? A  C   2561 O2    ? ? ? 1_555 A  G   2572 N2    ? ? 0 C   2561 0 G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2496 hydrog ? ? A  G   2562 N1    ? ? ? 1_555 A  C   2571 N3    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2497 hydrog ? ? A  G   2562 N2    ? ? ? 1_555 A  C   2571 O2    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2498 hydrog ? ? A  G   2562 O6    ? ? ? 1_555 A  C   2571 N4    ? ? 0 G   2562 0 C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2499 hydrog ? ? A  U   2563 N3    ? ? ? 1_555 A  G   2570 O6    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2500 hydrog ? ? A  U   2563 O2    ? ? ? 1_555 A  G   2570 N1    ? ? 0 U   2563 0 G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2501 hydrog ? ? A  A   2566 N1    ? ? ? 1_555 A  A   2699 N6    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2502 hydrog ? ? A  A   2566 N6    ? ? ? 1_555 A  A   2699 N1    ? ? 0 A   2566 0 A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2503 hydrog ? ? A  G   2567 N2    ? ? ? 1_555 A  G   2700 N3    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2504 hydrog ? ? A  G   2567 N3    ? ? ? 1_555 A  G   2700 N2    ? ? 0 G   2567 0 G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2505 hydrog ? ? A  G   2574 N2    ? ? ? 1_555 A  A   2776 N3    ? ? 0 G   2574 0 A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2506 hydrog ? ? A  A   2576 N3    ? ? ? 1_555 A  A   2800 N6    ? ? 0 A   2576 0 A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2507 hydrog ? ? A  G   2580 N2    ? ? ? 1_555 A  A   2600 N3    ? ? 0 G   2580 0 A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2508 hydrog ? ? A  U   2581 N3    ? ? ? 1_555 A  G   2602 N7    ? ? 0 U   2581 0 G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2509 hydrog ? ? A  G   2582 N1    ? ? ? 1_555 A  A   2596 N1    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2510 hydrog ? ? A  G   2582 O6    ? ? ? 1_555 A  A   2596 N6    ? ? 0 G   2582 0 A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2511 hydrog ? ? A  A   2583 N1    ? ? ? 1_555 A  U   2595 N3    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2512 hydrog ? ? A  A   2583 N6    ? ? ? 1_555 A  U   2595 O4    ? ? 0 A   2583 0 U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2513 hydrog ? ? A  G   2584 N1    ? ? ? 1_555 A  C   2594 N3    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2514 hydrog ? ? A  G   2584 N2    ? ? ? 1_555 A  C   2594 O2    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2515 hydrog ? ? A  G   2584 O6    ? ? ? 1_555 A  C   2594 N4    ? ? 0 G   2584 0 C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2516 hydrog ? ? A  G   2585 N1    ? ? ? 1_555 A  C   2593 N3    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2517 hydrog ? ? A  G   2585 N2    ? ? ? 1_555 A  C   2593 O2    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2518 hydrog ? ? A  G   2585 O6    ? ? ? 1_555 A  C   2593 N4    ? ? 0 G   2585 0 C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2519 hydrog ? ? A  U   2586 O4    ? ? ? 1_555 A  G   2592 N1    ? ? 0 U   2586 0 G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2520 hydrog ? ? A  OMU 2587 O2    ? ? ? 1_555 A  C   2591 N4    ? ? 0 OMU 2587 0 C   2591 1_555 ? ? ? ? ? ? 'OMU-C MISPAIR' 
?     ? 
hydrog2521 hydrog ? ? A  U   2597 N3    ? ? ? 1_555 A  A   2601 N7    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2522 hydrog ? ? A  U   2597 O2    ? ? ? 1_555 A  A   2601 N6    ? ? 0 U   2597 0 A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2523 hydrog ? ? A  A   2622 N6    ? ? ? 1_555 A  G   2643 N3    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2524 hydrog ? ? A  A   2622 N7    ? ? ? 1_555 A  G   2643 N2    ? ? 0 A   2622 0 G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2525 hydrog ? ? A  G   2623 N1    ? ? ? 1_555 A  C   2641 N3    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2526 hydrog ? ? A  G   2623 N2    ? ? ? 1_555 A  C   2641 O2    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2527 hydrog ? ? A  G   2623 O6    ? ? ? 1_555 A  C   2641 N4    ? ? 0 G   2623 0 C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2528 hydrog ? ? A  A   2624 N1    ? ? ? 1_555 A  U   2640 N3    ? ? 0 A   2624 0 U   2640 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2529 hydrog ? ? A  C   2625 N3    ? ? ? 1_555 A  G   2639 N1    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2530 hydrog ? ? A  C   2625 N4    ? ? ? 1_555 A  G   2639 O6    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2531 hydrog ? ? A  C   2625 O2    ? ? ? 1_555 A  G   2639 N2    ? ? 0 C   2625 0 G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2532 hydrog ? ? A  C   2626 N3    ? ? ? 1_555 A  G   2638 N1    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2533 hydrog ? ? A  C   2626 N4    ? ? ? 1_555 A  G   2638 O6    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2534 hydrog ? ? A  C   2626 O2    ? ? ? 1_555 A  G   2638 N2    ? ? 0 C   2626 0 G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2535 hydrog ? ? A  G   2627 N1    ? ? ? 1_555 A  C   2636 N3    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2536 hydrog ? ? A  G   2627 N2    ? ? ? 1_555 A  C   2636 O2    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2537 hydrog ? ? A  G   2627 O6    ? ? ? 1_555 A  C   2636 N4    ? ? 0 G   2627 0 C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2538 hydrog ? ? A  U   2628 N3    ? ? ? 1_555 A  A   2635 N1    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2539 hydrog ? ? A  U   2628 O4    ? ? ? 1_555 A  A   2635 N6    ? ? 0 U   2628 0 A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2540 hydrog ? ? A  C   2629 N3    ? ? ? 1_555 A  G   2634 N1    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2541 hydrog ? ? A  C   2629 N4    ? ? ? 1_555 A  G   2634 O6    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2542 hydrog ? ? A  C   2629 O2    ? ? ? 1_555 A  G   2634 N2    ? ? 0 C   2629 0 G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2543 hydrog ? ? A  G   2630 N2    ? ? ? 1_555 A  A   2633 N7    ? ? 0 G   2630 0 A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2544 hydrog ? ? A  A   2649 N3    ? ? ? 1_555 A  C   2651 N4    ? ? 0 A   2649 0 C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2545 hydrog ? ? A  G   2657 N2    ? ? ? 1_555 A  A   2841 N1    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2546 hydrog ? ? A  G   2657 N3    ? ? ? 1_555 A  A   2841 N6    ? ? 0 G   2657 0 A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2547 hydrog ? ? A  U   2661 O2    ? ? ? 1_555 A  A   2812 N6    ? ? 0 U   2661 0 A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2548 hydrog ? ? A  G   2662 N2    ? ? ? 1_555 A  A   2816 N3    ? ? 0 G   2662 0 A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2549 hydrog ? ? A  G   2667 N1    ? ? ? 1_555 A  C   2822 N3    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2550 hydrog ? ? A  G   2667 N2    ? ? ? 1_555 A  C   2822 O2    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2551 hydrog ? ? A  G   2667 O6    ? ? ? 1_555 A  C   2822 N4    ? ? 0 G   2667 0 C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2552 hydrog ? ? A  G   2667 N2    ? ? ? 1_555 A  A   2827 N3    ? ? 0 G   2667 0 A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2553 hydrog ? ? A  G   2668 O6    ? ? ? 1_555 A  A   2820 N6    ? ? 0 G   2668 0 A   2820 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2554 hydrog ? ? A  G   2668 N1    ? ? ? 1_555 A  C   2821 N3    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2555 hydrog ? ? A  G   2668 N2    ? ? ? 1_555 A  C   2821 O2    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2556 hydrog ? ? A  G   2668 O6    ? ? ? 1_555 A  C   2821 N4    ? ? 0 G   2668 0 C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2557 hydrog ? ? A  U   2669 N3    ? ? ? 1_555 A  A   2820 N1    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2558 hydrog ? ? A  U   2669 O4    ? ? ? 1_555 A  A   2820 N6    ? ? 0 U   2669 0 A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2559 hydrog ? ? A  G   2670 N1    ? ? ? 1_555 A  C   2819 N3    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2560 hydrog ? ? A  G   2670 N2    ? ? ? 1_555 A  C   2819 O2    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2561 hydrog ? ? A  G   2670 O6    ? ? ? 1_555 A  C   2819 N4    ? ? 0 G   2670 0 C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2562 hydrog ? ? A  U   2671 N3    ? ? ? 1_555 A  A   2818 N1    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2563 hydrog ? ? A  U   2671 O4    ? ? ? 1_555 A  A   2818 N6    ? ? 0 U   2671 0 A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2564 hydrog ? ? A  C   2672 N3    ? ? ? 1_555 A  G   2817 N1    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2565 hydrog ? ? A  C   2672 N4    ? ? ? 1_555 A  G   2817 O6    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2566 hydrog ? ? A  C   2672 O2    ? ? ? 1_555 A  G   2817 N2    ? ? 0 C   2672 0 G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2567 hydrog ? ? A  U   2673 N3    ? ? ? 1_555 A  A   2811 N7    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2568 hydrog ? ? A  U   2673 O2    ? ? ? 1_555 A  A   2811 N6    ? ? 0 U   2673 0 A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2569 hydrog ? ? A  G   2674 N2    ? ? ? 1_555 A  A   2813 N7    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2570 hydrog ? ? A  G   2674 N3    ? ? ? 1_555 A  A   2813 N6    ? ? 0 G   2674 0 A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2571 hydrog ? ? A  A   2675 N6    ? ? ? 1_555 A  G   2810 N3    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2572 hydrog ? ? A  A   2675 N7    ? ? ? 1_555 A  G   2810 N2    ? ? 0 A   2675 0 G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2573 hydrog ? ? A  C   2676 N3    ? ? ? 1_555 A  G   2809 N1    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2574 hydrog ? ? A  C   2676 N4    ? ? ? 1_555 A  G   2809 O6    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2575 hydrog ? ? A  C   2676 O2    ? ? ? 1_555 A  G   2809 N2    ? ? 0 C   2676 0 G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2576 hydrog ? ? A  A   2677 N1    ? ? ? 1_555 A  U   2808 N3    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2577 hydrog ? ? A  A   2677 N6    ? ? ? 1_555 A  U   2808 O4    ? ? 0 A   2677 0 U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2578 hydrog ? ? A  A   2678 N1    ? ? ? 1_555 A  U   2807 N3    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2579 hydrog ? ? A  A   2678 N6    ? ? ? 1_555 A  U   2807 O4    ? ? 0 A   2678 0 U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2580 hydrog ? ? A  G   2679 N1    ? ? ? 1_555 A  C   2806 N3    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2581 hydrog ? ? A  G   2679 N2    ? ? ? 1_555 A  C   2806 O2    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2582 hydrog ? ? A  G   2679 O6    ? ? ? 1_555 A  C   2806 N4    ? ? 0 G   2679 0 C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2583 hydrog ? ? A  A   2680 N1    ? ? ? 1_555 A  G   2712 N2    ? ? 0 A   2680 0 G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2584 hydrog ? ? A  A   2681 N3    ? ? ? 1_555 A  G   2713 N2    ? ? 0 A   2681 0 G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2585 hydrog ? ? A  C   2682 N3    ? ? ? 1_555 A  G   2712 N1    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2586 hydrog ? ? A  C   2682 N4    ? ? ? 1_555 A  G   2712 O6    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2587 hydrog ? ? A  C   2682 O2    ? ? ? 1_555 A  G   2712 N2    ? ? 0 C   2682 0 G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2588 hydrog ? ? A  G   2683 N1    ? ? ? 1_555 A  U   2711 O2    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2589 hydrog ? ? A  G   2683 O6    ? ? ? 1_555 A  U   2711 N3    ? ? 0 G   2683 0 U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2590 hydrog ? ? A  A   2684 N1    ? ? ? 1_555 A  U   2710 N3    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2591 hydrog ? ? A  A   2684 N6    ? ? ? 1_555 A  U   2710 O4    ? ? 0 A   2684 0 U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2592 hydrog ? ? A  C   2685 N3    ? ? ? 1_555 A  G   2709 N1    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2593 hydrog ? ? A  C   2685 N4    ? ? ? 1_555 A  G   2709 O6    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2594 hydrog ? ? A  C   2685 O2    ? ? ? 1_555 A  G   2709 N2    ? ? 0 C   2685 0 G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2595 hydrog ? ? A  C   2686 N3    ? ? ? 1_555 A  G   2708 N1    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2596 hydrog ? ? A  C   2686 N4    ? ? ? 1_555 A  G   2708 O6    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2597 hydrog ? ? A  C   2686 O2    ? ? ? 1_555 A  G   2708 N2    ? ? 0 C   2686 0 G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2598 hydrog ? ? A  G   2687 N1    ? ? ? 1_555 A  C   2707 N3    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2599 hydrog ? ? A  G   2687 N2    ? ? ? 1_555 A  C   2707 O2    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2600 hydrog ? ? A  G   2687 O6    ? ? ? 1_555 A  C   2707 N4    ? ? 0 G   2687 0 C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2601 hydrog ? ? A  U   2688 N3    ? ? ? 1_555 A  A   2706 N1    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2602 hydrog ? ? A  U   2688 O4    ? ? ? 1_555 A  A   2706 N6    ? ? 0 U   2688 0 A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2603 hydrog ? ? A  A   2689 N1    ? ? ? 1_555 A  U   2705 N3    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2604 hydrog ? ? A  A   2689 N6    ? ? ? 1_555 A  U   2705 O4    ? ? 0 A   2689 0 U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2605 hydrog ? ? A  U   2690 O2    ? ? ? 1_555 A  C   2704 N4    ? ? 0 U   2690 0 C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2606 hydrog ? ? A  A   2691 N6    ? ? ? 1_555 A  A   2703 N7    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2607 hydrog ? ? A  A   2691 N7    ? ? ? 1_555 A  A   2703 N6    ? ? 0 A   2691 0 A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2608 hydrog ? ? A  G   2692 N2    ? ? ? 1_555 A  U   2693 O4    ? ? 0 G   2692 0 U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2609 hydrog ? ? A  U   2693 N3    ? ? ? 1_555 A  A   2702 N7    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2610 hydrog ? ? A  U   2693 O2    ? ? ? 1_555 A  A   2702 N6    ? ? 0 U   2693 0 A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2611 hydrog ? ? A  A   2694 N6    ? ? ? 1_555 A  G   2701 N3    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2612 hydrog ? ? A  A   2694 N7    ? ? ? 1_555 A  G   2701 N2    ? ? 0 A   2694 0 G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2613 hydrog ? ? A  C   2695 N3    ? ? ? 1_555 A  G   2700 N1    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2614 hydrog ? ? A  C   2695 N4    ? ? ? 1_555 A  G   2700 O6    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2615 hydrog ? ? A  C   2695 O2    ? ? ? 1_555 A  G   2700 N2    ? ? 0 C   2695 0 G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2616 hydrog ? ? A  G   2696 N2    ? ? ? 1_555 A  A   2699 N7    ? ? 0 G   2696 0 A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2617 hydrog ? ? A  G   2713 N1    ? ? ? 1_555 A  C   2767 N3    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2618 hydrog ? ? A  G   2713 N2    ? ? ? 1_555 A  C   2767 O2    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2619 hydrog ? ? A  G   2713 O6    ? ? ? 1_555 A  C   2767 N4    ? ? 0 G   2713 0 C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2620 hydrog ? ? A  U   2714 N3    ? ? ? 1_555 A  A   2766 N1    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2621 hydrog ? ? A  U   2714 O4    ? ? ? 1_555 A  A   2766 N6    ? ? 0 U   2714 0 A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2622 hydrog ? ? A  G   2715 N1    ? ? ? 1_555 A  C   2765 N3    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2623 hydrog ? ? A  G   2715 N2    ? ? ? 1_555 A  C   2765 O2    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2624 hydrog ? ? A  G   2715 O6    ? ? ? 1_555 A  C   2765 N4    ? ? 0 G   2715 0 C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2625 hydrog ? ? A  G   2716 N1    ? ? ? 1_555 A  C   2764 N3    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2626 hydrog ? ? A  G   2716 N2    ? ? ? 1_555 A  C   2764 O2    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2627 hydrog ? ? A  G   2716 O6    ? ? ? 1_555 A  C   2764 N4    ? ? 0 G   2716 0 C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2628 hydrog ? ? A  C   2717 N3    ? ? ? 1_555 A  G   2763 N1    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2629 hydrog ? ? A  C   2717 N4    ? ? ? 1_555 A  G   2763 O6    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2630 hydrog ? ? A  C   2717 O2    ? ? ? 1_555 A  G   2763 N2    ? ? 0 C   2717 0 G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2631 hydrog ? ? A  C   2718 N3    ? ? ? 1_555 A  A   2761 N6    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2632 hydrog ? ? A  C   2718 N4    ? ? ? 1_555 A  A   2761 N7    ? ? 0 C   2718 0 A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2633 hydrog ? ? A  C   2720 N4    ? ? ? 1_555 A  G   2763 N3    ? ? 0 C   2720 0 G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2634 hydrog ? ? A  U   2721 N3    ? ? ? 1_555 A  A   2761 N1    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2635 hydrog ? ? A  U   2721 O4    ? ? ? 1_555 A  A   2761 N6    ? ? 0 U   2721 0 A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2636 hydrog ? ? A  G   2722 N1    ? ? ? 1_555 A  C   2760 N3    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2637 hydrog ? ? A  G   2722 N2    ? ? ? 1_555 A  C   2760 O2    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2638 hydrog ? ? A  G   2722 O6    ? ? ? 1_555 A  C   2760 N4    ? ? 0 G   2722 0 C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2639 hydrog ? ? A  G   2723 N1    ? ? ? 1_555 A  C   2759 N3    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2640 hydrog ? ? A  G   2723 N2    ? ? ? 1_555 A  C   2759 O2    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2641 hydrog ? ? A  G   2723 O6    ? ? ? 1_555 A  C   2759 N4    ? ? 0 G   2723 0 C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2642 hydrog ? ? A  U   2724 N3    ? ? ? 1_555 A  G   2758 O6    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2643 hydrog ? ? A  U   2724 O2    ? ? ? 1_555 A  G   2758 N1    ? ? 0 U   2724 0 G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2644 hydrog ? ? A  G   2725 N2    ? ? ? 1_555 A  A   2757 N7    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2645 hydrog ? ? A  G   2725 N3    ? ? ? 1_555 A  A   2757 N6    ? ? 0 G   2725 0 A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2646 hydrog ? ? A  A   2727 N7    ? ? ? 1_555 A  G   2755 N2    ? ? 0 A   2727 0 G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2647 hydrog ? ? A  C   2728 N3    ? ? ? 1_555 A  G   2754 N1    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2648 hydrog ? ? A  C   2728 N4    ? ? ? 1_555 A  G   2754 O6    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2649 hydrog ? ? A  C   2728 O2    ? ? ? 1_555 A  G   2754 N2    ? ? 0 C   2728 0 G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2650 hydrog ? ? A  C   2729 N3    ? ? ? 1_555 A  G   2753 N1    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2651 hydrog ? ? A  C   2729 N4    ? ? ? 1_555 A  G   2753 O6    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2652 hydrog ? ? A  C   2729 O2    ? ? ? 1_555 A  G   2753 N2    ? ? 0 C   2729 0 G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2653 hydrog ? ? A  G   2730 N1    ? ? ? 1_555 A  C   2752 N3    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2654 hydrog ? ? A  G   2730 N2    ? ? ? 1_555 A  C   2752 O2    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2655 hydrog ? ? A  G   2730 O6    ? ? ? 1_555 A  C   2752 N4    ? ? 0 G   2730 0 C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2656 hydrog ? ? A  G   2731 N1    ? ? ? 1_555 A  C   2751 N3    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2657 hydrog ? ? A  G   2731 N2    ? ? ? 1_555 A  C   2751 O2    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2658 hydrog ? ? A  G   2731 O6    ? ? ? 1_555 A  C   2751 N4    ? ? 0 G   2731 0 C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2659 hydrog ? ? A  U   2732 N3    ? ? ? 1_555 A  G   2750 O6    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2660 hydrog ? ? A  U   2732 O2    ? ? ? 1_555 A  G   2750 N1    ? ? 0 U   2732 0 G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2661 hydrog ? ? A  U   2733 N3    ? ? ? 1_555 A  A   2746 N1    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2662 hydrog ? ? A  U   2733 O4    ? ? ? 1_555 A  A   2746 N6    ? ? 0 U   2733 0 A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2663 hydrog ? ? A  G   2734 N1    ? ? ? 1_555 A  C   2745 N3    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2664 hydrog ? ? A  G   2734 N2    ? ? ? 1_555 A  C   2745 O2    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2665 hydrog ? ? A  G   2734 O6    ? ? ? 1_555 A  C   2745 N4    ? ? 0 G   2734 0 C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2666 hydrog ? ? A  U   2735 N3    ? ? ? 1_555 A  G   2744 O6    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2667 hydrog ? ? A  U   2735 O2    ? ? ? 1_555 A  G   2744 N1    ? ? 0 U   2735 0 G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2668 hydrog ? ? A  U   2736 N3    ? ? ? 1_555 A  A   2743 N1    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2669 hydrog ? ? A  U   2736 O4    ? ? ? 1_555 A  A   2743 N6    ? ? 0 U   2736 0 A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2670 hydrog ? ? A  C   2737 N3    ? ? ? 1_555 A  G   2742 N1    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2671 hydrog ? ? A  C   2737 N4    ? ? ? 1_555 A  G   2742 O6    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2672 hydrog ? ? A  C   2737 O2    ? ? ? 1_555 A  G   2742 N2    ? ? 0 C   2737 0 G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2673 hydrog ? ? A  U   2756 N3    ? ? ? 1_555 A  A   2896 N1    ? ? 0 U   2756 0 A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2674 hydrog ? ? A  C   2769 N4    ? ? ? 1_555 A  A   2805 N3    ? ? 0 C   2769 0 A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2675 hydrog ? ? A  G   2770 N1    ? ? ? 1_555 A  C   2804 N3    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2676 hydrog ? ? A  G   2770 N2    ? ? ? 1_555 A  C   2804 O2    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2677 hydrog ? ? A  G   2770 O6    ? ? ? 1_555 A  C   2804 N4    ? ? 0 G   2770 0 C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2678 hydrog ? ? A  G   2771 N1    ? ? ? 1_555 A  C   2803 N3    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2679 hydrog ? ? A  G   2771 N2    ? ? ? 1_555 A  C   2803 O2    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2680 hydrog ? ? A  G   2771 O6    ? ? ? 1_555 A  C   2803 N4    ? ? 0 G   2771 0 C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2681 hydrog ? ? A  G   2772 N1    ? ? ? 1_555 A  C   2802 N3    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2682 hydrog ? ? A  G   2772 N2    ? ? ? 1_555 A  C   2802 O2    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2683 hydrog ? ? A  G   2772 O6    ? ? ? 1_555 A  C   2802 N4    ? ? 0 G   2772 0 C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2684 hydrog ? ? A  G   2773 N1    ? ? ? 1_555 A  A   2801 N1    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2685 hydrog ? ? A  G   2773 O6    ? ? ? 1_555 A  A   2801 N6    ? ? 0 G   2773 0 A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2686 hydrog ? ? A  U   2774 N3    ? ? ? 1_555 A  A   2799 N7    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2687 hydrog ? ? A  U   2774 O2    ? ? ? 1_555 A  A   2799 N6    ? ? 0 U   2774 0 A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2688 hydrog ? ? A  A   2776 N6    ? ? ? 1_555 A  G   2798 N3    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2689 hydrog ? ? A  A   2776 N7    ? ? ? 1_555 A  G   2798 N2    ? ? 0 A   2776 0 G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2690 hydrog ? ? A  G   2777 N1    ? ? ? 1_555 A  C   2797 N3    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2691 hydrog ? ? A  G   2777 N2    ? ? ? 1_555 A  C   2797 O2    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2692 hydrog ? ? A  G   2777 O6    ? ? ? 1_555 A  C   2797 N4    ? ? 0 G   2777 0 C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2693 hydrog ? ? A  A   2778 N1    ? ? ? 1_555 A  U   2796 N3    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2694 hydrog ? ? A  A   2778 N6    ? ? ? 1_555 A  U   2796 O4    ? ? 0 A   2778 0 U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2695 hydrog ? ? A  G   2779 N1    ? ? ? 1_555 A  C   2795 N3    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2696 hydrog ? ? A  G   2779 N2    ? ? ? 1_555 A  C   2795 O2    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2697 hydrog ? ? A  G   2779 O6    ? ? ? 1_555 A  C   2795 N4    ? ? 0 G   2779 0 C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2698 hydrog ? ? A  C   2780 N3    ? ? ? 1_555 A  G   2794 N1    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2699 hydrog ? ? A  C   2780 N4    ? ? ? 1_555 A  G   2794 O6    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2700 hydrog ? ? A  C   2780 O2    ? ? ? 1_555 A  G   2794 N2    ? ? 0 C   2780 0 G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2701 hydrog ? ? A  U   2781 N3    ? ? ? 1_555 A  U   2791 O4    ? ? 0 U   2781 0 U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog2702 hydrog ? ? A  U   2781 O2    ? ? ? 1_555 A  A   2793 N6    ? ? 0 U   2781 0 A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2703 hydrog ? ? A  G   2782 N2    ? ? ? 1_555 A  A   2792 N7    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2704 hydrog ? ? A  G   2782 N3    ? ? ? 1_555 A  A   2792 N6    ? ? 0 G   2782 0 A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2705 hydrog ? ? A  A   2783 N6    ? ? ? 1_555 A  U   2789 O2    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2706 hydrog ? ? A  A   2783 N7    ? ? ? 1_555 A  U   2789 N3    ? ? 0 A   2783 0 U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2707 hydrog ? ? A  A   2784 N6    ? ? ? 1_555 A  A   2788 N1    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2708 hydrog ? ? A  A   2784 N7    ? ? ? 1_555 A  A   2788 N6    ? ? 0 A   2784 0 A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2709 hydrog ? ? A  C   2785 O2    ? ? ? 1_555 A  C   2787 N4    ? ? 0 C   2785 0 C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2710 hydrog ? ? A  U   2791 N3    ? ? ? 1_555 A  A   2793 N7    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2711 hydrog ? ? A  U   2791 O4    ? ? ? 1_555 A  A   2793 N6    ? ? 0 U   2791 0 A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2712 hydrog ? ? A  A   2812 N1    ? ? ? 1_555 A  A   2814 N6    ? ? 0 A   2812 0 A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2713 hydrog ? ? A  G   2826 N2    ? ? ? 1_555 A  A   2914 N7    ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2714 hydrog ? ? A  G   2826 N3    ? ? ? 1_555 A  A   2914 N6    ? ? 0 G   2826 0 A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2715 hydrog ? ? A  A   2827 N6    ? ? ? 1_555 A  A   2913 N3    ? ? 0 A   2827 0 A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2716 hydrog ? ? A  G   2828 N1    ? ? ? 1_555 A  C   2912 N3    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2717 hydrog ? ? A  G   2828 N2    ? ? ? 1_555 A  C   2912 O2    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2718 hydrog ? ? A  G   2828 O6    ? ? ? 1_555 A  C   2912 N4    ? ? 0 G   2828 0 C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2719 hydrog ? ? A  G   2829 N1    ? ? ? 1_555 A  C   2911 N3    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2720 hydrog ? ? A  G   2829 N2    ? ? ? 1_555 A  C   2911 O2    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2721 hydrog ? ? A  G   2829 O6    ? ? ? 1_555 A  C   2911 N4    ? ? 0 G   2829 0 C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2722 hydrog ? ? A  U   2830 N3    ? ? ? 1_555 A  A   2910 N1    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2723 hydrog ? ? A  U   2830 O4    ? ? ? 1_555 A  A   2910 N6    ? ? 0 U   2830 0 A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2724 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  G   2909 N2    ? ? 0 C   2831 0 G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2725 hydrog ? ? A  C   2832 N3    ? ? ? 1_555 A  G   2848 N1    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2726 hydrog ? ? A  C   2832 N4    ? ? ? 1_555 A  G   2848 O6    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2727 hydrog ? ? A  C   2832 O2    ? ? ? 1_555 A  G   2848 N2    ? ? 0 C   2832 0 G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2728 hydrog ? ? A  C   2832 O2    ? ? ? 1_555 A  A   2908 N6    ? ? 0 C   2832 0 A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2729 hydrog ? ? A  C   2833 N3    ? ? ? 1_555 A  G   2847 N1    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2730 hydrog ? ? A  C   2833 N4    ? ? ? 1_555 A  G   2847 O6    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2731 hydrog ? ? A  C   2833 O2    ? ? ? 1_555 A  G   2847 N2    ? ? 0 C   2833 0 G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2732 hydrog ? ? A  G   2834 N1    ? ? ? 1_555 A  C   2846 N3    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2733 hydrog ? ? A  G   2834 N2    ? ? ? 1_555 A  C   2846 O2    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2734 hydrog ? ? A  G   2834 O6    ? ? ? 1_555 A  C   2846 N4    ? ? 0 G   2834 0 C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2735 hydrog ? ? A  C   2835 N3    ? ? ? 1_555 A  G   2845 N1    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2736 hydrog ? ? A  C   2835 N4    ? ? ? 1_555 A  G   2845 O6    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2737 hydrog ? ? A  C   2835 O2    ? ? ? 1_555 A  G   2845 N2    ? ? 0 C   2835 0 G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2738 hydrog ? ? A  G   2836 N1    ? ? ? 1_555 A  C   2844 N3    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2739 hydrog ? ? A  G   2836 N2    ? ? ? 1_555 A  C   2844 O2    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2740 hydrog ? ? A  G   2836 O6    ? ? ? 1_555 A  C   2844 N4    ? ? 0 G   2836 0 C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2741 hydrog ? ? A  A   2838 N3    ? ? ? 1_555 A  A   2843 N6    ? ? 0 A   2838 0 A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2742 hydrog ? ? A  G   2847 N2    ? ? ? 1_555 A  A   2906 N3    ? ? 0 G   2847 0 A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2743 hydrog ? ? A  G   2851 N2    ? ? ? 1_555 A  A   2906 N7    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2744 hydrog ? ? A  G   2851 N3    ? ? ? 1_555 A  A   2906 N6    ? ? 0 G   2851 0 A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2745 hydrog ? ? A  A   2852 N1    ? ? ? 1_555 A  C   2903 N4    ? ? 0 A   2852 0 C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2746 hydrog ? ? A  U   2853 O4    ? ? ? 1_555 A  A   2902 N6    ? ? 0 U   2853 0 A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2747 hydrog ? ? A  U   2853 N3    ? ? ? 1_555 A  A   2905 N1    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2748 hydrog ? ? A  U   2853 O4    ? ? ? 1_555 A  A   2905 N6    ? ? 0 U   2853 0 A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2749 hydrog ? ? A  A   2854 N1    ? ? ? 1_555 A  U   2904 N3    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2750 hydrog ? ? A  A   2854 N6    ? ? ? 1_555 A  U   2904 O4    ? ? 0 A   2854 0 U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2751 hydrog ? ? A  G   2855 N1    ? ? ? 1_555 A  C   2903 N3    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2752 hydrog ? ? A  G   2855 N2    ? ? ? 1_555 A  C   2903 O2    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2753 hydrog ? ? A  G   2855 O6    ? ? ? 1_555 A  C   2903 N4    ? ? 0 G   2855 0 C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2754 hydrog ? ? A  A   2856 N6    ? ? ? 1_555 A  C   2901 O2    ? ? 0 A   2856 0 C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2755 hydrog ? ? A  C   2857 N3    ? ? ? 1_555 A  G   2900 N1    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2756 hydrog ? ? A  C   2857 N4    ? ? ? 1_555 A  G   2900 O6    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2757 hydrog ? ? A  C   2857 O2    ? ? ? 1_555 A  G   2900 N2    ? ? 0 C   2857 0 G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2758 hydrog ? ? A  U   2858 N3    ? ? ? 1_555 A  A   2899 N1    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2759 hydrog ? ? A  U   2858 O4    ? ? ? 1_555 A  A   2899 N6    ? ? 0 U   2858 0 A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2760 hydrog ? ? A  C   2859 N3    ? ? ? 1_555 A  G   2898 N1    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2761 hydrog ? ? A  C   2859 N4    ? ? ? 1_555 A  G   2898 O6    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2762 hydrog ? ? A  C   2859 O2    ? ? ? 1_555 A  G   2898 N2    ? ? 0 C   2859 0 G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2763 hydrog ? ? A  G   2860 N1    ? ? ? 1_555 A  C   2897 N3    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2764 hydrog ? ? A  G   2860 N2    ? ? ? 1_555 A  C   2897 O2    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2765 hydrog ? ? A  G   2860 O6    ? ? ? 1_555 A  C   2897 N4    ? ? 0 G   2860 0 C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2766 hydrog ? ? A  G   2861 N1    ? ? ? 1_555 A  C   2895 N3    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2767 hydrog ? ? A  G   2861 N2    ? ? ? 1_555 A  C   2895 O2    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2768 hydrog ? ? A  G   2861 O6    ? ? ? 1_555 A  C   2895 N4    ? ? 0 G   2861 0 C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2769 hydrog ? ? A  G   2862 N1    ? ? ? 1_555 A  C   2894 N3    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2770 hydrog ? ? A  G   2862 N2    ? ? ? 1_555 A  C   2894 O2    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2771 hydrog ? ? A  G   2862 O6    ? ? ? 1_555 A  C   2894 N4    ? ? 0 G   2862 0 C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2772 hydrog ? ? A  G   2863 N1    ? ? ? 1_555 A  C   2893 N3    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2773 hydrog ? ? A  G   2863 N2    ? ? ? 1_555 A  C   2893 O2    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2774 hydrog ? ? A  G   2863 O6    ? ? ? 1_555 A  C   2893 N4    ? ? 0 G   2863 0 C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2775 hydrog ? ? A  U   2864 N3    ? ? ? 1_555 A  G   2892 O6    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2776 hydrog ? ? A  U   2864 O2    ? ? ? 1_555 A  G   2892 N1    ? ? 0 U   2864 0 G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2777 hydrog ? ? A  G   2865 N2    ? ? ? 1_555 A  A   2891 N7    ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2778 hydrog ? ? A  G   2865 N3    ? ? ? 1_555 A  A   2891 N6    ? ? 0 G   2865 0 A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2779 hydrog ? ? A  C   2868 N4    ? ? ? 1_555 A  U   2889 O4    ? ? 0 C   2868 0 U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2780 hydrog ? ? A  G   2869 N1    ? ? ? 1_555 A  U   2888 O2    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2781 hydrog ? ? A  G   2869 O6    ? ? ? 1_555 A  U   2888 N3    ? ? 0 G   2869 0 U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2782 hydrog ? ? A  C   2870 N3    ? ? ? 1_555 A  G   2887 N1    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2783 hydrog ? ? A  C   2870 N4    ? ? ? 1_555 A  G   2887 O6    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2784 hydrog ? ? A  C   2870 O2    ? ? ? 1_555 A  G   2887 N2    ? ? 0 C   2870 0 G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2785 hydrog ? ? A  G   2871 N1    ? ? ? 1_555 A  C   2886 N3    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2786 hydrog ? ? A  G   2871 N2    ? ? ? 1_555 A  C   2886 O2    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2787 hydrog ? ? A  G   2871 O6    ? ? ? 1_555 A  C   2886 N4    ? ? 0 G   2871 0 C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2788 hydrog ? ? A  U   2872 N3    ? ? ? 1_555 A  A   2885 N1    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2789 hydrog ? ? A  U   2872 O4    ? ? ? 1_555 A  A   2885 N6    ? ? 0 U   2872 0 A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2790 hydrog ? ? A  C   2873 O2    ? ? ? 1_555 A  G   2884 N2    ? ? 0 C   2873 0 G   2884 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2791 hydrog ? ? A  G   2874 N2    ? ? ? 1_555 A  A   2883 N7    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2792 hydrog ? ? A  G   2874 N3    ? ? ? 1_555 A  A   2883 N6    ? ? 0 G   2874 0 A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2793 hydrog ? ? A  A   2875 N6    ? ? ? 1_555 A  G   2882 N3    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2794 hydrog ? ? A  A   2875 N7    ? ? ? 1_555 A  G   2882 N2    ? ? 0 A   2875 0 G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2795 hydrog ? ? A  G   2876 N1    ? ? ? 1_555 A  C   2881 N3    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2796 hydrog ? ? A  G   2876 N2    ? ? ? 1_555 A  C   2881 O2    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2797 hydrog ? ? A  G   2876 O6    ? ? ? 1_555 A  C   2881 N4    ? ? 0 G   2876 0 C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2798 hydrog ? ? A  G   2877 N2    ? ? ? 1_555 A  A   2880 N7    ? ? 0 G   2877 0 A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2799 hydrog ? ? A  A   2902 N7    ? ? ? 1_555 A  A   2905 N6    ? ? 0 A   2902 0 A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2800 hydrog ? ? F  A   3    N3    ? ? ? 1_555 F  G   21   N2    ? ? 9 A   3    9 G   21   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2801 hydrog ? ? F  A   3    N6    ? ? ? 1_555 F  G   25   O6    ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2802 hydrog ? ? F  A   3    N7    ? ? ? 1_555 F  G   25   N1    ? ? 9 A   3    9 G   25   1_555 ? ? ? ? ? ? TYPE_9_PAIR ? ? 
hydrog2803 hydrog ? ? F  G   4    N1    ? ? ? 1_555 F  C   119  N3    ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2804 hydrog ? ? F  G   4    N2    ? ? ? 1_555 F  C   119  O2    ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2805 hydrog ? ? F  G   4    O6    ? ? ? 1_555 F  C   119  N4    ? ? 9 G   4    9 C   119  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2806 hydrog ? ? F  G   5    N1    ? ? ? 1_555 F  C   118  N3    ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2807 hydrog ? ? F  G   5    N2    ? ? ? 1_555 F  C   118  O2    ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2808 hydrog ? ? F  G   5    O6    ? ? ? 1_555 F  C   118  N4    ? ? 9 G   5    9 C   118  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2809 hydrog ? ? F  C   6    N3    ? ? ? 1_555 F  G   117  N1    ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2810 hydrog ? ? F  C   6    N4    ? ? ? 1_555 F  G   117  O6    ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2811 hydrog ? ? F  C   6    O2    ? ? ? 1_555 F  G   117  N2    ? ? 9 C   6    9 G   117  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2812 hydrog ? ? F  G   7    N1    ? ? ? 1_555 F  C   116  N3    ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2813 hydrog ? ? F  G   7    N2    ? ? ? 1_555 F  C   116  O2    ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2814 hydrog ? ? F  G   7    O6    ? ? ? 1_555 F  C   116  N4    ? ? 9 G   7    9 C   116  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2815 hydrog ? ? F  G   8    N1    ? ? ? 1_555 F  C   115  N3    ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2816 hydrog ? ? F  G   8    N2    ? ? ? 1_555 F  C   115  O2    ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2817 hydrog ? ? F  G   8    O6    ? ? ? 1_555 F  C   115  N4    ? ? 9 G   8    9 C   115  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2818 hydrog ? ? F  C   9    N3    ? ? ? 1_555 F  G   114  N1    ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2819 hydrog ? ? F  C   9    N4    ? ? ? 1_555 F  G   114  O6    ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2820 hydrog ? ? F  C   9    O2    ? ? ? 1_555 F  G   114  N2    ? ? 9 C   9    9 G   114  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2821 hydrog ? ? F  A   11   N3    ? ? ? 1_555 F  G   68   N2    ? ? 9 A   11   9 G   68   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2822 hydrog ? ? F  G   14   N1    ? ? ? 1_555 F  C   67   N3    ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2823 hydrog ? ? F  G   14   N2    ? ? ? 1_555 F  C   67   O2    ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2824 hydrog ? ? F  G   14   O6    ? ? ? 1_555 F  C   67   N4    ? ? 9 G   14   9 C   67   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2825 hydrog ? ? F  C   15   N3    ? ? ? 1_555 F  G   66   N1    ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2826 hydrog ? ? F  C   15   N4    ? ? ? 1_555 F  G   66   O6    ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2827 hydrog ? ? F  C   15   O2    ? ? ? 1_555 F  G   66   N2    ? ? 9 C   15   9 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2828 hydrog ? ? F  C   15   N4    ? ? ? 1_555 F  C   113  O2    ? ? 9 C   15   9 C   113  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2829 hydrog ? ? F  G   16   N1    ? ? ? 1_555 F  C   64   N3    ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2830 hydrog ? ? F  G   16   N2    ? ? ? 1_555 F  C   64   O2    ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2831 hydrog ? ? F  G   16   O6    ? ? ? 1_555 F  C   64   N4    ? ? 9 G   16   9 C   64   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2832 hydrog ? ? F  G   17   N1    ? ? ? 1_555 F  C   63   N3    ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2833 hydrog ? ? F  G   17   N2    ? ? ? 1_555 F  C   63   O2    ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2834 hydrog ? ? F  G   17   O6    ? ? ? 1_555 F  C   63   N4    ? ? 9 G   17   9 C   63   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2835 hydrog ? ? F  U   18   N3    ? ? ? 1_555 F  A   62   N1    ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2836 hydrog ? ? F  U   18   O4    ? ? ? 1_555 F  A   62   N6    ? ? 9 U   18   9 A   62   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2837 hydrog ? ? F  G   19   N1    ? ? ? 1_555 F  C   61   N3    ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2838 hydrog ? ? F  G   19   N2    ? ? ? 1_555 F  C   61   O2    ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2839 hydrog ? ? F  G   19   O6    ? ? ? 1_555 F  C   61   N4    ? ? 9 G   19   9 C   61   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2840 hydrog ? ? F  G   20   N1    ? ? ? 1_555 F  C   60   N3    ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2841 hydrog ? ? F  G   20   N2    ? ? ? 1_555 F  C   60   O2    ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2842 hydrog ? ? F  G   20   O6    ? ? ? 1_555 F  C   60   N4    ? ? 9 G   20   9 C   60   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2843 hydrog ? ? F  G   21   N1    ? ? ? 1_555 F  C   59   N3    ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2844 hydrog ? ? F  G   21   N2    ? ? ? 1_555 F  C   59   O2    ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2845 hydrog ? ? F  G   21   O6    ? ? ? 1_555 F  C   59   N4    ? ? 9 G   21   9 C   59   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2846 hydrog ? ? F  G   22   N2    ? ? ? 1_555 F  C   26   N3    ? ? 9 G   22   9 C   26   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2847 hydrog ? ? F  G   22   N1    ? ? ? 1_555 F  G   58   O6    ? ? 9 G   22   9 G   58   1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2848 hydrog ? ? F  C   27   O2    ? ? ? 1_555 F  G   58   N1    ? ? 9 C   27   9 G   58   1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2849 hydrog ? ? F  U   28   N3    ? ? ? 1_555 F  A   54   N1    ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2850 hydrog ? ? F  U   28   O4    ? ? ? 1_555 F  A   54   N6    ? ? 9 U   28   9 A   54   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2851 hydrog ? ? F  C   29   N3    ? ? ? 1_555 F  G   53   N1    ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2852 hydrog ? ? F  C   29   N4    ? ? ? 1_555 F  G   53   O6    ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2853 hydrog ? ? F  C   29   O2    ? ? ? 1_555 F  G   53   N2    ? ? 9 C   29   9 G   53   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2854 hydrog ? ? F  C   29   O2    ? ? ? 1_555 F  A   56   N6    ? ? 9 C   29   9 A   56   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2855 hydrog ? ? F  C   30   N3    ? ? ? 1_555 F  G   50   N1    ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2856 hydrog ? ? F  C   30   N4    ? ? ? 1_555 F  G   50   O6    ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2857 hydrog ? ? F  C   30   O2    ? ? ? 1_555 F  G   50   N2    ? ? 9 C   30   9 G   50   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2858 hydrog ? ? F  C   30   O2    ? ? ? 1_555 F  A   52   N6    ? ? 9 C   30   9 A   52   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2859 hydrog ? ? F  C   31   N3    ? ? ? 1_555 F  G   49   N1    ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2860 hydrog ? ? F  C   31   N4    ? ? ? 1_555 F  G   49   O6    ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2861 hydrog ? ? F  C   31   O2    ? ? ? 1_555 F  G   49   N2    ? ? 9 C   31   9 G   49   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2862 hydrog ? ? F  G   32   N1    ? ? ? 1_555 F  C   48   N3    ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2863 hydrog ? ? F  G   32   N2    ? ? ? 1_555 F  C   48   O2    ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2864 hydrog ? ? F  G   32   O6    ? ? ? 1_555 F  C   48   N4    ? ? 9 G   32   9 C   48   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2865 hydrog ? ? F  U   33   O2    ? ? ? 1_555 F  C   35   N4    ? ? 9 U   33   9 C   35   1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2866 hydrog ? ? F  U   33   N3    ? ? ? 1_555 F  A   47   N1    ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2867 hydrog ? ? F  U   33   O4    ? ? ? 1_555 F  A   47   N6    ? ? 9 U   33   9 A   47   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2868 hydrog ? ? F  C   35   N4    ? ? ? 1_555 F  C   48   O2    ? ? 9 C   35   9 C   48   1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2869 hydrog ? ? F  C   36   N4    ? ? ? 1_555 F  A   47   N3    ? ? 9 C   36   9 A   47   1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2870 hydrog ? ? F  C   37   N3    ? ? ? 1_555 F  G   43   N1    ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2871 hydrog ? ? F  C   37   N4    ? ? ? 1_555 F  G   43   O6    ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2872 hydrog ? ? F  C   37   O2    ? ? ? 1_555 F  G   43   N2    ? ? 9 C   37   9 G   43   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2873 hydrog ? ? F  A   38   N3    ? ? ? 1_555 F  A   45   N6    ? ? 9 A   38   9 A   45   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2874 hydrog ? ? F  U   39   O2    ? ? ? 1_555 F  A   44   N6    ? ? 9 U   39   9 A   44   1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2875 hydrog ? ? F  G   43   N2    ? ? ? 1_555 F  C   46   O2    ? ? 9 G   43   9 C   46   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2876 hydrog ? ? F  A   51   N3    ? ? ? 1_555 F  A   52   N6    ? ? 9 A   51   9 A   52   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2877 hydrog ? ? F  A   54   N3    ? ? ? 1_555 F  A   56   N6    ? ? 9 A   54   9 A   56   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2878 hydrog ? ? F  A   65   N3    ? ? ? 1_555 F  C   67   N4    ? ? 9 A   65   9 C   67   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2879 hydrog ? ? F  G   66   O6    ? ? ? 1_555 F  C   113  N4    ? ? 9 G   66   9 C   113  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2880 hydrog ? ? F  U   69   N3    ? ? ? 1_555 F  U   112  O2    ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2881 hydrog ? ? F  U   69   O4    ? ? ? 1_555 F  U   112  N3    ? ? 9 U   69   9 U   112  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2882 hydrog ? ? F  U   70   N3    ? ? ? 1_555 F  U   111  O2    ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2883 hydrog ? ? F  U   70   O4    ? ? ? 1_555 F  U   111  N3    ? ? 9 U   70   9 U   111  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2884 hydrog ? ? F  C   71   N3    ? ? ? 1_555 F  G   110  N1    ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2885 hydrog ? ? F  C   71   N4    ? ? ? 1_555 F  G   110  O6    ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2886 hydrog ? ? F  C   71   O2    ? ? ? 1_555 F  G   110  N2    ? ? 9 C   71   9 G   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2887 hydrog ? ? F  C   72   N3    ? ? ? 1_555 F  G   109  N1    ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2888 hydrog ? ? F  C   72   N4    ? ? ? 1_555 F  G   109  O6    ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2889 hydrog ? ? F  C   72   O2    ? ? ? 1_555 F  G   109  N2    ? ? 9 C   72   9 G   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2890 hydrog ? ? F  A   73   N6    ? ? ? 1_555 F  C   108  N3    ? ? 9 A   73   9 C   108  1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2891 hydrog ? ? F  G   74   N1    ? ? ? 1_555 F  C   107  N3    ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2892 hydrog ? ? F  G   74   N2    ? ? ? 1_555 F  C   107  O2    ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2893 hydrog ? ? F  G   74   O6    ? ? ? 1_555 F  C   107  N4    ? ? 9 G   74   9 C   107  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2894 hydrog ? ? F  G   75   N2    ? ? ? 1_555 F  U   106  O2    ? ? 9 G   75   9 U   106  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2895 hydrog ? ? F  G   76   N2    ? ? ? 1_555 F  A   105  N7    ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2896 hydrog ? ? F  G   76   N3    ? ? ? 1_555 F  A   105  N6    ? ? 9 G   76   9 A   105  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2897 hydrog ? ? F  G   76   N2    ? ? ? 1_555 F  U   106  O4    ? ? 9 G   76   9 U   106  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2898 hydrog ? ? F  A   77   N6    ? ? ? 1_555 F  A   104  N7    ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2899 hydrog ? ? F  A   77   N7    ? ? ? 1_555 F  A   104  N6    ? ? 9 A   77   9 A   104  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2900 hydrog ? ? F  G   78   N2    ? ? ? 1_555 F  U   79   O4    ? ? 9 G   78   9 U   79   1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2901 hydrog ? ? F  U   79   N3    ? ? ? 1_555 F  A   103  N7    ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2902 hydrog ? ? F  U   79   O2    ? ? ? 1_555 F  A   103  N6    ? ? 9 U   79   9 A   103  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2903 hydrog ? ? F  A   80   N6    ? ? ? 1_555 F  G   102  N3    ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2904 hydrog ? ? F  A   80   N7    ? ? ? 1_555 F  G   102  N2    ? ? 9 A   80   9 G   102  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2905 hydrog ? ? F  C   81   N3    ? ? ? 1_555 F  G   101  N1    ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2906 hydrog ? ? F  C   81   N4    ? ? ? 1_555 F  G   101  O6    ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2907 hydrog ? ? F  C   81   O2    ? ? ? 1_555 F  G   101  N2    ? ? 9 C   81   9 G   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2908 hydrog ? ? F  U   82   N3    ? ? ? 1_555 F  G   100  O6    ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2909 hydrog ? ? F  U   82   O2    ? ? ? 1_555 F  G   100  N1    ? ? 9 U   82   9 G   100  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2910 hydrog ? ? F  G   83   N1    ? ? ? 1_555 F  U   99   O2    ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2911 hydrog ? ? F  G   83   O6    ? ? ? 1_555 F  U   99   N3    ? ? 9 G   83   9 U   99   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2912 hydrog ? ? F  G   84   N1    ? ? ? 1_555 F  C   98   N3    ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2913 hydrog ? ? F  G   84   N2    ? ? ? 1_555 F  C   98   O2    ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2914 hydrog ? ? F  G   84   O6    ? ? ? 1_555 F  C   98   N4    ? ? 9 G   84   9 C   98   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2915 hydrog ? ? F  A   85   N1    ? ? ? 1_555 F  U   97   N3    ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2916 hydrog ? ? F  A   85   N6    ? ? ? 1_555 F  U   97   O4    ? ? 9 A   85   9 U   97   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2917 hydrog ? ? F  G   86   N1    ? ? ? 1_555 F  C   96   N3    ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2918 hydrog ? ? F  G   86   N2    ? ? ? 1_555 F  C   96   O2    ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2919 hydrog ? ? F  G   86   O6    ? ? ? 1_555 F  C   96   N4    ? ? 9 G   86   9 C   96   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2920 hydrog ? ? F  G   88   N1    ? ? ? 1_555 F  C   95   N3    ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2921 hydrog ? ? F  G   88   N2    ? ? ? 1_555 F  C   95   O2    ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2922 hydrog ? ? F  G   88   O6    ? ? ? 1_555 F  C   95   N4    ? ? 9 G   88   9 C   95   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2923 hydrog ? ? F  C   89   N3    ? ? ? 1_555 F  G   94   N1    ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2924 hydrog ? ? F  C   89   N4    ? ? ? 1_555 F  G   94   O6    ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2925 hydrog ? ? F  C   89   O2    ? ? ? 1_555 F  G   94   N2    ? ? 9 C   89   9 G   94   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2926 hydrog ? ? F  G   90   N2    ? ? ? 1_555 F  A   93   N7    ? ? 9 G   90   9 A   93   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 MEA 5   E . ? MEA 5   8 MHV 6   E ? MHV 6   8 1 -1.10 
2 TRP 187 G . ? TRP 186 A PRO 188 G ? PRO 187 A 1 -0.50 
3 GLY 15  H . ? GLY 14  B PRO 16  H ? PRO 15  B 1 -0.06 
4 ASN 244 H . ? ASN 243 B PRO 245 H ? PRO 244 B 1 -0.06 
5 VAL 136 I . ? VAL 136 C PRO 137 I ? PRO 137 C 1 0.21  
6 GLN 56  L . ? GLN 55  F PRO 57  L ? PRO 56  F 1 -0.21 
7 ARG 185 S . ? ARG 184 M PRO 186 S ? PRO 185 M 1 0.02  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1A ? 3 ? 
3A ? 2 ? 
3B ? 4 ? 
AA ? 4 ? 
AB ? 6 ? 
AC ? 2 ? 
BA ? 5 ? 
BB ? 5 ? 
BC ? 2 ? 
BD ? 8 ? 
BE ? 2 ? 
CA ? 2 ? 
CB ? 2 ? 
CC ? 4 ? 
CD ? 2 ? 
DA ? 5 ? 
EA ? 3 ? 
EB ? 3 ? 
EC ? 4 ? 
ED ? 3 ? 
FA ? 4 ? 
HA ? 4 ? 
HB ? 3 ? 
JA ? 3 ? 
JB ? 2 ? 
KA ? 5 ? 
KB ? 2 ? 
KC ? 6 ? 
LA ? 3 ? 
LB ? 3 ? 
MA ? 4 ? 
NA ? 4 ? 
OA ? 2 ? 
OB ? 4 ? 
OC ? 4 ? 
OD ? 2 ? 
PA ? 2 ? 
QA ? 5 ? 
RA ? 3 ? 
RB ? 2 ? 
RC ? 2 ? 
SA ? 4 ? 
TA ? 6 ? 
TB ? 2 ? 
WA ? 5 ? 
XA ? 4 ? 
YA ? 2 ? 
YB ? 2 ? 
ZA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
1A 1 2 ? anti-parallel 
1A 2 3 ? anti-parallel 
3A 1 2 ? parallel      
3B 1 2 ? anti-parallel 
3B 2 3 ? anti-parallel 
3B 3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AC 1 2 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BB 4 5 ? parallel      
BC 1 2 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
BD 5 6 ? anti-parallel 
BE 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CC 1 2 ? parallel      
CC 2 3 ? parallel      
CC 3 4 ? parallel      
CD 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EB 1 2 ? anti-parallel 
EB 2 3 ? anti-parallel 
EC 1 2 ? anti-parallel 
EC 2 3 ? anti-parallel 
EC 3 4 ? anti-parallel 
ED 1 2 ? anti-parallel 
ED 2 3 ? anti-parallel 
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
FA 3 4 ? parallel      
HA 1 2 ? anti-parallel 
HA 2 3 ? anti-parallel 
HA 3 4 ? anti-parallel 
HB 1 2 ? anti-parallel 
HB 2 3 ? anti-parallel 
JA 1 2 ? parallel      
JA 2 3 ? parallel      
JB 1 2 ? anti-parallel 
KA 1 2 ? anti-parallel 
KA 2 3 ? anti-parallel 
KA 3 4 ? parallel      
KA 4 5 ? anti-parallel 
KB 1 2 ? anti-parallel 
KC 1 2 ? anti-parallel 
KC 2 3 ? anti-parallel 
KC 3 4 ? anti-parallel 
KC 4 5 ? anti-parallel 
KC 5 6 ? parallel      
LA 1 2 ? parallel      
LA 2 3 ? parallel      
LB 1 2 ? parallel      
LB 2 3 ? parallel      
MA 1 2 ? anti-parallel 
MA 2 3 ? anti-parallel 
MA 3 4 ? anti-parallel 
NA 1 2 ? anti-parallel 
NA 2 3 ? anti-parallel 
NA 3 4 ? parallel      
OA 1 2 ? parallel      
OB 1 2 ? parallel      
OB 2 3 ? parallel      
OB 3 4 ? anti-parallel 
OC 1 2 ? parallel      
OC 2 3 ? parallel      
OC 3 4 ? parallel      
OD 1 2 ? anti-parallel 
PA 1 2 ? anti-parallel 
QA 1 2 ? anti-parallel 
QA 2 3 ? anti-parallel 
QA 3 4 ? anti-parallel 
QA 4 5 ? anti-parallel 
RA 1 2 ? anti-parallel 
RA 2 3 ? anti-parallel 
RB 1 2 ? anti-parallel 
RC 1 2 ? anti-parallel 
SA 1 2 ? anti-parallel 
SA 2 3 ? anti-parallel 
SA 3 4 ? anti-parallel 
TA 1 2 ? anti-parallel 
TA 2 3 ? parallel      
TA 3 4 ? anti-parallel 
TA 4 5 ? anti-parallel 
TA 5 6 ? anti-parallel 
TB 1 2 ? anti-parallel 
WA 1 2 ? anti-parallel 
WA 2 3 ? anti-parallel 
WA 3 4 ? anti-parallel 
WA 4 5 ? parallel      
XA 1 2 ? anti-parallel 
XA 2 3 ? anti-parallel 
XA 3 4 ? parallel      
YA 1 2 ? anti-parallel 
YB 1 2 ? parallel      
ZA 1 2 ? anti-parallel 
ZA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1A 1 HIS B  17  ? THR B  18  ? HIS 1 16  THR 1 17  
1A 2 TYR B  28  ? HIS B  29  ? TYR 1 27  HIS 1 28  
1A 3 VAL B  34  ? CYS B  35  ? VAL 1 33  CYS 1 34  
3A 1 GLN D  2   ? PRO D  4   ? GLN 3 2   PRO 3 4   
3A 2 GLU D  89  ? GLN D  91  ? GLU 3 89  GLN 3 91  
3B 1 ARG D  6   ? CYS D  11  ? ARG 3 6   CYS 3 11  
3B 2 GLU D  16  ? LYS D  24  ? GLU 3 16  LYS 3 24  
3B 3 LEU D  67  ? CYS D  71  ? LEU 3 67  CYS 3 71  
3B 4 ALA D  77  ? LEU D  79  ? ALA 3 77  LEU 3 79  
AA 1 ARG G  66  ? ILE G  69  ? ARG A 65  ILE A 68  
AA 2 PRO G  55  ? PHE G  61  ? PRO A 54  PHE A 60  
AA 3 ALA G  40  ? HIS G  48  ? ALA A 39  HIS A 47  
AA 4 GLU G  80  ? GLN G  82  ? GLU A 79  GLN A 81  
AB 1 THR G  94  ? PRO G  96  ? THR A 93  PRO A 95  
AB 2 ARG G  154 ? ILE G  157 ? ARG A 153 ILE A 156 
AB 3 PRO G  105 ? CYS G  107 ? PRO A 104 CYS A 106 
AB 4 ALA G  127 ? LEU G  129 ? ALA A 126 LEU A 128 
AB 5 VAL G  139 ? LYS G  140 ? VAL A 138 LYS A 139 
AB 6 MET G  146 ? LYS G  147 ? MET A 145 LYS A 146 
AC 1 SER G  215 ? ILE G  216 ? SER A 214 ILE A 215 
AC 2 ASP G  228 ? ILE G  229 ? ASP A 227 ILE A 228 
BA 1 GLY H  38  ? VAL H  39  ? GLY B 37  VAL B 38  
BA 2 VAL H  162 ? GLY H  168 ? VAL B 161 GLY B 167 
BA 3 LEU H  138 ? HIS H  146 ? LEU B 137 HIS B 145 
BA 4 MET H  80  ? THR H  91  ? MET B 79  THR B 90  
BA 5 GLY H  94  ? TRP H  102 ? GLY B 93  TRP B 101 
BB 1 GLY H  38  ? VAL H  39  ? GLY B 37  VAL B 38  
BB 2 VAL H  162 ? GLY H  168 ? VAL B 161 GLY B 167 
BB 3 LEU H  138 ? HIS H  146 ? LEU B 137 HIS B 145 
BB 4 MET H  80  ? THR H  91  ? MET B 79  THR B 90  
BB 5 GLU H  188 ? HIS H  189 ? GLU B 187 HIS B 188 
BC 1 GLY H  94  ? TRP H  102 ? GLY B 93  TRP B 101 
BC 2 MET H  80  ? THR H  91  ? MET B 79  THR B 90  
BD 1 PHE H  42  ? VAL H  55  ? PHE B 41  VAL B 54  
BD 2 LEU H  309 ? PHE H  312 ? LEU B 308 PHE B 311 
BD 3 TYR H  200 ? VAL H  206 ? TYR B 199 VAL B 205 
BD 4 GLN H  262 ? GLY H  276 ? GLN B 261 GLY B 275 
BD 5 GLY H  293 ? LYS H  299 ? GLY B 292 LYS B 298 
BD 6 GLU H  67  ? GLU H  76  ? GLU B 66  GLU B 75  
BD 7 PHE H  42  ? VAL H  55  ? PHE B 41  VAL B 54  
BE 1 THR H  212 ? GLN H  213 ? THR B 211 GLN B 212 
BE 2 GLY H  256 ? GLN H  257 ? GLY B 255 GLN B 256 
CA 1 GLN I  2   ? TYR I  6   ? GLN C 2   TYR C 6   
CA 2 THR I  12  ? ASP I  17  ? THR C 12  ASP C 17  
CB 1 LYS I  72  ? LEU I  73  ? LYS C 72  LEU C 73  
CB 2 ARG I  76  ? ALA I  77  ? ARG C 76  ALA C 77  
CC 1 VAL I  138 ? VAL I  140 ? VAL C 138 VAL C 140 
CC 2 THR I  233 ? THR I  236 ? THR C 233 THR C 236 
CC 3 LEU I  193 ? THR I  196 ? LEU C 193 THR C 196 
CC 4 ASP I  211 ? THR I  214 ? ASP C 211 THR C 214 
CD 1 LYS I  173 ? ILE I  174 ? LYS C 173 ILE C 174 
CD 2 TYR I  186 ? ARG I  187 ? TYR C 186 ARG C 187 
DA 1 VAL J  51  ? THR J  53  ? VAL D 50  THR D 52  
DA 2 GLY J  71  ? LEU J  76  ? GLY D 70  LEU D 75  
DA 3 ARG J  18  ? GLY J  27  ? ARG D 17  GLY D 26  
DA 4 ASP J  130 ? VAL J  136 ? ASP D 129 VAL D 135 
DA 5 PHE J  105 ? PHE J  107 ? PHE D 104 PHE D 106 
EA 1 ARG K  3   ? GLU K  7   ? ARG E 2   GLU E 6   
EA 2 THR K  47  ? SER K  52  ? THR E 46  SER E 51  
EA 3 ILE K  39  ? ASP K  44  ? ILE E 38  ASP E 43  
EB 1 ASP K  13  ? ASP K  17  ? ASP E 12  ASP E 16  
EB 2 ASP K  20  ? GLY K  25  ? ASP E 19  GLY E 24  
EB 3 GLY K  28  ? ARG K  33  ? GLY E 27  ARG E 32  
EC 1 ASP K  124 ? ASP K  128 ? ASP E 123 ASP E 127 
EC 2 GLU K  131 ? GLY K  136 ? GLU E 130 GLY E 135 
EC 3 TRP K  81  ? PHE K  88  ? TRP E 80  PHE E 87  
EC 4 GLY K  166 ? ARG K  171 ? GLY E 165 ARG E 170 
ED 1 VAL K  96  ? GLU K  99  ? VAL E 95  GLU E 98  
ED 2 GLU K  102 ? ILE K  105 ? GLU E 101 ILE E 104 
ED 3 ARG K  115 ? THR K  118 ? ARG E 114 THR E 117 
FA 1 ALA L  29  ? LYS L  32  ? ALA F 28  LYS F 31  
FA 2 ALA L  96  ? THR L  100 ? ALA F 95  THR F 99  
FA 3 VAL L  49  ? ALA L  52  ? VAL F 48  ALA F 51  
FA 4 PHE L  75  ? VAL L  78  ? PHE F 74  VAL F 77  
HA 1 LYS N  87  ? LEU N  90  ? LYS H 87  LEU H 90  
HA 2 GLU N  134 ? CYS N  141 ? GLU H 134 CYS H 141 
HA 3 VAL N  48  ? VAL N  54  ? VAL H 48  VAL H 54  
HA 4 CYS N  164 ? VAL N  168 ? CYS H 164 VAL H 168 
HB 1 VAL N  58  ? ARG N  61  ? VAL H 58  ARG H 61  
HB 2 LYS N  122 ? VAL N  130 ? LYS H 122 VAL H 130 
HB 3 GLN N  96  ? GLU N  100 ? GLN H 96  GLU H 100 
JA 1 VAL P  10  ? ASP P  13  ? VAL J 10  ASP J 13  
JA 2 VAL P  36  ? VAL P  39  ? VAL J 36  VAL J 39  
JA 3 VAL P  101 ? VAL P  103 ? VAL J 101 VAL J 103 
JB 1 VAL P  45  ? THR P  47  ? VAL J 45  THR J 47  
JB 2 PHE P  129 ? THR P  131 ? PHE J 129 THR J 131 
KA 1 ASP Q  7   ? VAL Q  8   ? ASP K 7   VAL K 8   
KA 2 ILE Q  80  ? ARG Q  81  ? ILE K 80  ARG K 81  
KA 3 ARG Q  87  ? PHE Q  90  ? ARG K 87  PHE K 90  
KA 4 THR AA 19  ? VAL AA 22  ? THR U 19  VAL U 22  
KA 5 THR AA 28  ? PHE AA 31  ? THR U 28  PHE U 31  
KB 1 LEU Q  12  ? GLU Q  13  ? LEU K 12  GLU K 13  
KB 2 LYS Q  46  ? ALA Q  47  ? LYS K 46  ALA K 47  
KC 1 LEU Q  17  ? CYS Q  20  ? LEU K 17  CYS K 20  
KC 2 ALA Q  26  ? VAL Q  34  ? ALA K 26  VAL K 34  
KC 3 LYS Q  52  ? GLY Q  60  ? LYS K 52  GLY K 60  
KC 4 VAL Q  68  ? ARG Q  75  ? VAL K 68  ARG K 75  
KC 5 ALA Q  94  ? VAL Q  98  ? ALA K 94  VAL K 98  
KC 6 LEU Q  17  ? CYS Q  20  ? LEU K 17  CYS K 20  
LA 1 ALA R  62  ? ASP R  66  ? ALA L 61  ASP L 65  
LA 2 TYR R  106 ? LEU R  110 ? TYR L 105 LEU L 109 
LA 3 ASP R  125 ? PHE R  126 ? ASP L 124 PHE L 125 
LB 1 ARG R  91  ? ASP R  93  ? ARG L 90  ASP L 92  
LB 2 THR R  120 ? ALA R  123 ? THR L 119 ALA L 122 
LB 3 SER R  140 ? LEU R  143 ? SER L 139 LEU L 142 
MA 1 VAL S  38  ? ARG S  40  ? VAL M 37  ARG M 39  
MA 2 VAL S  61  ? ARG S  69  ? VAL M 60  ARG M 68  
MA 3 GLN S  127 ? ILE S  135 ? GLN M 126 ILE M 134 
MA 4 ARG S  114 ? ASP S  124 ? ARG M 113 ASP M 123 
NA 1 ASP T  57  ? ALA T  60  ? ASP N 56  ALA N 59  
NA 2 VAL T  44  ? THR T  50  ? VAL N 43  THR N 49  
NA 3 ARG T  34  ? LYS T  39  ? ARG N 33  LYS N 38  
NA 4 VAL T  102 ? ASP T  104 ? VAL N 101 ASP N 103 
OA 1 ALA U  42  ? ASN U  45  ? ALA O 41  ASN O 44  
OA 2 THR U  58  ? LEU U  66  ? THR O 57  LEU O 65  
OB 1 GLU U  95  ? SER U  98  ? GLU O 94  SER O 97  
OB 2 THR U  76  ? PHE U  82  ? THR O 75  PHE O 81  
OB 3 THR U  58  ? LEU U  66  ? THR O 57  LEU O 65  
OB 4 VAL U  112 ? VAL U  114 ? VAL O 111 VAL O 113 
OC 1 GLU U  95  ? SER U  98  ? GLU O 94  SER O 97  
OC 2 THR U  76  ? PHE U  82  ? THR O 75  PHE O 81  
OC 3 THR U  58  ? LEU U  66  ? THR O 57  LEU O 65  
OC 4 ALA U  42  ? ASN U  45  ? ALA O 41  ASN O 44  
OD 1 VAL U  112 ? VAL U  114 ? VAL O 111 VAL O 113 
OD 2 THR U  58  ? LEU U  66  ? THR O 57  LEU O 65  
PA 1 VAL V  22  ? PHE V  24  ? VAL P 21  PHE P 23  
PA 2 ILE V  50  ? ALA V  52  ? ILE P 49  ALA P 51  
QA 1 LYS W  81  ? VAL W  87  ? LYS Q 80  VAL Q 86  
QA 2 ALA W  71  ? ASP W  78  ? ALA Q 70  ASP Q 77  
QA 3 THR W  61  ? GLN W  68  ? THR Q 60  GLN Q 67  
QA 4 LYS W  39  ? LEU W  42  ? LYS Q 38  LEU Q 41  
QA 5 LEU W  92  ? ARG W  94  ? LEU Q 91  ARG Q 93  
RA 1 THR X  14  ? GLN X  23  ? THR R 13  GLN R 22  
RA 2 SER X  139 ? GLU X  149 ? SER R 138 GLU R 148 
RA 3 THR X  111 ? GLN X  123 ? THR R 110 GLN R 122 
RB 1 VAL X  58  ? PRO X  59  ? VAL R 57  PRO R 58  
RB 2 GLY X  79  ? ARG X  80  ? GLY R 78  ARG R 79  
RC 1 ARG X  126 ? PRO X  128 ? ARG R 125 PRO R 127 
RC 2 ALA X  134 ? ALA X  136 ? ALA R 133 ALA R 135 
SA 1 ILE Y  6   ? PRO Y  9   ? ILE S 5   PRO S 8   
SA 2 LYS Y  24  ? VAL Y  29  ? LYS S 23  VAL S 28  
SA 3 LYS Y  63  ? LEU Y  69  ? LYS S 62  LEU S 68  
SA 4 VAL Y  50  ? ASN Y  57  ? VAL S 49  ASN S 56  
TA 1 ASN Z  40  ? ARG Z  42  ? ASN T 39  ARG T 41  
TA 2 ARG Z  25  ? LEU Z  28  ? ARG T 24  LEU T 27  
TA 3 VAL Z  97  ? ASP Z  101 ? VAL T 96  ASP T 100 
TA 4 THR Z  48  ? VAL Z  51  ? THR T 47  VAL T 50  
TA 5 GLU Z  60  ? ASP Z  67  ? GLU T 59  ASP T 66  
TA 6 VAL Z  72  ? VAL Z  75  ? VAL T 71  VAL T 74  
TB 1 THR Z  79  ? GLU Z  81  ? THR T 78  GLU T 80  
TB 2 GLU Z  87  ? PRO Z  89  ? GLU T 86  PRO T 88  
WA 1 THR CA 115 ? ARG CA 117 ? THR W 115 ARG W 117 
WA 2 HIS CA 31  ? VAL CA 35  ? HIS W 31  VAL W 35  
WA 3 HIS CA 2   ? GLN CA 6   ? HIS W 2   GLN W 6   
WA 4 VAL CA 52  ? GLY CA 55  ? VAL W 52  GLY W 55  
WA 5 GLY CA 139 ? LYS CA 140 ? GLY W 139 LYS W 140 
XA 1 ARG DA 9   ? PRO DA 14  ? ARG X 8   PRO X 13  
XA 2 LYS DA 70  ? PHE DA 78  ? LYS X 69  PHE X 77  
XA 3 GLU DA 83  ? GLU DA 87  ? GLU X 82  GLU X 86  
XA 4 VAL DA 49  ? LEU DA 51  ? VAL X 48  LEU X 50  
YA 1 GLU EA 97  ? ALA EA 100 ? GLU Y 96  ALA Y 99  
YA 2 TYR EA 234 ? VAL EA 237 ? TYR Y 233 VAL Y 236 
YB 1 GLU EA 184 ? VAL EA 188 ? GLU Y 183 VAL Y 187 
YB 2 GLU EA 202 ? ILE EA 206 ? GLU Y 201 ILE Y 205 
ZA 1 VAL FA 38  ? GLY FA 42  ? VAL Z 47  GLY Z 51  
ZA 2 ILE FA 45  ? CYS FA 48  ? ILE Z 54  CYS Z 57  
ZA 3 LYS FA 54  ? THR FA 56  ? LYS Z 63  THR Z 65  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
1A 1 2 N THR B  18  ? N THR 1 17  O TYR B  28  ? O TYR 1 27  
1A 2 3 N HIS B  29  ? N HIS 1 28  O VAL B  34  ? O VAL 1 33  
3A 1 2 N MET D  3   ? N MET 3 3   O GLU D  89  ? O GLU 3 89  
3B 1 2 N CYS D  11  ? N CYS 3 11  O GLU D  16  ? O GLU 3 16  
3B 2 3 N GLU D  23  ? N GLU 3 23  O LYS D  68  ? O LYS 3 68  
3B 3 4 N TYR D  69  ? N TYR 3 69  O HIS D  78  ? O HIS 3 78  
AA 1 2 N ILE G  69  ? N ILE A 68  O ALA G  57  ? O ALA A 56  
AA 2 3 N GLU G  60  ? N GLU A 59  O THR G  42  ? O THR A 41  
AA 3 4 N GLY G  41  ? N GLY A 40  O LEU G  81  ? O LEU A 80  
AB 1 2 N LEU G  95  ? N LEU A 94  O ALA G  155 ? O ALA A 154 
AB 2 3 N THR G  156 ? N THR A 155 O CYS G  107 ? O CYS A 106 
AB 3 4 N VAL G  106 ? N VAL A 105 O ALA G  127 ? O ALA A 126 
AB 4 5 N GLN G  128 ? N GLN A 127 O LYS G  140 ? O LYS A 139 
AB 5 6 N VAL G  139 ? N VAL A 138 O LYS G  147 ? O LYS A 146 
AC 1 2 N ILE G  216 ? N ILE A 215 O ASP G  228 ? O ASP A 227 
BA 1 2 N GLY H  38  ? N GLY B 37  O GLY H  168 ? O GLY B 167 
BA 2 3 N VAL H  167 ? N VAL B 166 O LEU H  141 ? O LEU B 140 
BA 3 4 N HIS H  146 ? N HIS B 145 O ARG H  81  ? O ARG B 80  
BA 4 5 N THR H  91  ? N THR B 90  O GLY H  94  ? O GLY B 93  
BB 1 2 N GLY H  38  ? N GLY B 37  O GLY H  168 ? O GLY B 167 
BB 2 3 N VAL H  167 ? N VAL B 166 O LEU H  141 ? O LEU B 140 
BB 3 4 N HIS H  146 ? N HIS B 145 O ARG H  81  ? O ARG B 80  
BB 4 5 N MET H  80  ? N MET B 79  O HIS H  189 ? O HIS B 188 
BC 1 2 N VAL H  101 ? N VAL B 100 O LEU H  85  ? O LEU B 84  
BD 1 2 N GLY H  44  ? N GLY B 43  O VAL H  310 ? O VAL B 309 
BD 2 3 N ARG H  311 ? N ARG B 310 O ALA H  204 ? O ALA B 203 
BD 3 4 N GLY H  205 ? N GLY B 204 O ARG H  263 ? O ARG B 262 
BD 4 5 N GLY H  276 ? N GLY B 275 O GLY H  293 ? O GLY B 292 
BD 5 6 N VAL H  298 ? N VAL B 297 O THR H  73  ? O THR B 72  
BE 1 2 N GLN H  213 ? N GLN B 212 O GLY H  256 ? O GLY B 255 
CA 1 2 O ILE I  5   ? O ILE C 5   N ASP I  13  ? N ASP C 13  
CB 1 2 N LEU I  73  ? N LEU C 73  O ARG I  76  ? O ARG C 76  
CC 1 2 N VAL I  138 ? N VAL C 138 O THR I  233 ? O THR C 233 
CC 2 3 N VAL I  234 ? N VAL C 234 O LEU I  193 ? O LEU C 193 
CC 3 4 N PHE I  194 ? N PHE C 194 O ASP I  211 ? O ASP C 211 
CD 1 2 N LYS I  173 ? N LYS C 173 O ARG I  187 ? O ARG C 187 
DA 1 2 N THR J  53  ? N THR D 52  O GLY J  71  ? O GLY D 70  
DA 2 3 N LEU J  76  ? N LEU D 75  O VAL J  22  ? O VAL D 21  
DA 3 4 N HIS J  25  ? N HIS D 24  O ASP J  130 ? O ASP D 129 
DA 4 5 N VAL J  133 ? N VAL D 132 O PHE J  105 ? O PHE D 104 
EA 1 2 N LEU K  6   ? N LEU E 5   O VAL K  48  ? O VAL E 47  
EA 2 3 N GLU K  51  ? N GLU E 50  O ASP K  40  ? O ASP E 39  
EB 1 2 N ASP K  17  ? N ASP E 16  O ASP K  20  ? O ASP E 19  
EB 2 3 N GLY K  25  ? N GLY E 24  O GLY K  28  ? O GLY E 27  
EC 1 2 N ASP K  128 ? N ASP E 127 O GLU K  131 ? O GLU E 130 
EC 2 3 N GLY K  136 ? N GLY E 135 O TRP K  81  ? O TRP E 80  
EC 3 4 N PHE K  88  ? N PHE E 87  O GLY K  166 ? O GLY E 165 
ED 1 2 N GLU K  99  ? N GLU E 98  O GLU K  102 ? O GLU E 101 
ED 2 3 N ILE K  105 ? N ILE E 104 O ARG K  115 ? O ARG E 114 
FA 1 2 N LYS L  31  ? N LYS F 30  O ALA L  98  ? O ALA F 97  
FA 2 3 N ALA L  97  ? N ALA F 96  O PHE L  50  ? O PHE F 49  
FA 3 4 N VAL L  51  ? N VAL F 50  O ILE L  76  ? O ILE F 75  
HA 1 2 N THR N  89  ? N THR H 89  O THR N  138 ? O THR H 138 
HA 2 3 N CYS N  141 ? N CYS H 141 O VAL N  48  ? O VAL H 48  
HA 3 4 N ILE N  53  ? N ILE H 53  O ARG N  165 ? O ARG H 165 
HB 1 2 N LEU N  60  ? N LEU H 60  O ALA N  128 ? O ALA H 128 
HB 2 3 N ALA N  127 ? N ALA H 127 O GLN N  96  ? O GLN H 96  
JA 1 2 N VAL P  12  ? N VAL J 12  O ALA P  37  ? O ALA J 37  
JA 2 3 N VAL P  38  ? N VAL J 38  O ARG P  102 ? O ARG J 102 
JB 1 2 N ILE P  46  ? N ILE J 46  O VAL P  130 ? O VAL J 130 
KA 1 2 N ASP Q  7   ? N ASP K 7   O ARG Q  81  ? O ARG K 81  
KA 2 3 N ILE Q  80  ? N ILE K 80  O VAL Q  88  ? O VAL K 88  
KA 3 4 N LYS Q  89  ? N LYS K 89  O MET AA 20  ? O MET U 20  
KA 4 5 N PHE AA 21  ? N PHE U 21  O THR AA 29  ? O THR U 29  
KB 1 2 N LEU Q  12  ? N LEU K 12  O ALA Q  47  ? O ALA K 47  
KC 1 2 N CYS Q  20  ? N CYS K 20  O ARG Q  27  ? O ARG K 27  
KC 2 3 N ILE Q  32  ? N ILE K 32  O THR Q  54  ? O THR K 54  
KC 3 4 N VAL Q  55  ? N VAL K 55  O LEU Q  69  ? O LEU K 69  
KC 4 5 N VAL Q  74  ? N VAL K 74  O ALA Q  94  ? O ALA K 94  
KC 5 6 N ALA Q  95  ? N ALA K 95  O THR Q  19  ? O THR K 19  
LA 1 2 N ALA R  63  ? N ALA L 62  O TYR R  106 ? O TYR L 105 
LA 2 3 N VAL R  109 ? N VAL L 108 O ASP R  125 ? O ASP L 124 
LB 1 2 N VAL R  92  ? N VAL L 91  O THR R  120 ? O THR L 119 
LB 2 3 N LEU R  121 ? N LEU L 120 O SER R  140 ? O SER L 139 
MA 1 2 N GLU S  39  ? N GLU M 38  O ARG S  65  ? O ARG M 64  
MA 2 3 N VAL S  68  ? N VAL M 67  O LYS S  128 ? O LYS M 127 
MA 3 4 N ILE S  135 ? N ILE M 134 O ARG S  114 ? O ARG M 113 
NA 1 2 N LEU T  59  ? N LEU N 58  O LEU T  48  ? O LEU N 47  
NA 2 3 N VAL T  49  ? N VAL N 48  O ARG T  34  ? O ARG N 33  
NA 3 4 N LEU T  35  ? N LEU N 34  O VAL T  102 ? O VAL N 101 
OA 1 2 N ALA U  42  ? N ALA O 41  O PRO U  62  ? O PRO O 61  
OB 1 2 N VAL U  97  ? N VAL O 96  O VAL U  77  ? O VAL O 76  
OB 2 3 N ALA U  78  ? N ALA O 77  O VAL U  59  ? O VAL O 58  
OB 3 4 N VAL U  60  ? N VAL O 59  O ARG U  113 ? O ARG O 112 
OC 1 2 N VAL U  97  ? N VAL O 96  O VAL U  77  ? O VAL O 76  
OC 2 3 N ALA U  78  ? N ALA O 77  O VAL U  59  ? O VAL O 58  
OC 3 4 N LYS U  64  ? N LYS O 63  O ALA U  42  ? O ALA O 41  
OD 1 2 N ARG U  113 ? N ARG O 112 O THR U  58  ? O THR O 57  
PA 1 2 N TRP V  23  ? N TRP P 22  O GLN V  51  ? O GLN P 50  
QA 1 2 N VAL W  87  ? N VAL Q 86  O TYR W  72  ? O TYR Q 71  
QA 2 3 N ASP W  75  ? N ASP Q 74  O THR W  63  ? O THR Q 62  
QA 3 4 N GLY W  62  ? N GLY Q 61  O VAL W  40  ? O VAL Q 39  
QA 4 5 N HIS W  41  ? N HIS Q 40  O ARG W  93  ? O ARG Q 92  
RA 1 2 N ARG X  22  ? N ARG R 21  O VAL X  142 ? O VAL R 141 
RA 2 3 N GLU X  149 ? N GLU R 148 O THR X  111 ? O THR R 110 
RB 1 2 N VAL X  58  ? N VAL R 57  O ARG X  80  ? O ARG R 79  
RC 1 2 N LYS X  127 ? N LYS R 126 O SER X  135 ? O SER R 134 
SA 1 2 N LYS Y  7   ? N LYS S 6   O ALA Y  28  ? O ALA S 27  
SA 2 3 N VAL Y  29  ? N VAL S 28  O LYS Y  63  ? O LYS S 62  
SA 3 4 O ARG Y  68  ? O ARG S 67  N GLU Y  51  ? N GLU S 50  
TA 1 2 N VAL Z  41  ? N VAL T 40  O ALA Z  26  ? O ALA T 25  
TA 2 3 N THR Z  27  ? N THR T 26  O VAL Z  97  ? O VAL T 96  
TA 3 4 N THR Z  100 ? N THR T 99  O THR Z  48  ? O THR T 47  
TA 4 5 N VAL Z  49  ? N VAL T 48  O GLY Z  61  ? O GLY T 60  
TA 5 6 N ASP Z  67  ? N ASP T 66  O VAL Z  72  ? O VAL T 71  
TB 1 2 N LEU Z  80  ? N LEU T 79  O VAL Z  88  ? O VAL T 87  
WA 1 2 N LEU CA 116 ? N LEU W 116 O CYS CA 32  ? O CYS W 32  
WA 2 3 N VAL CA 35  ? N VAL W 35  O HIS CA 2   ? O HIS W 2   
WA 3 4 N VAL CA 5   ? N VAL W 5   O ALA CA 53  ? O ALA W 53  
WA 4 5 N PHE CA 54  ? N PHE W 54  O GLY CA 139 ? O GLY W 139 
XA 1 2 N ILE DA 13  ? N ILE X 12  O ILE DA 71  ? O ILE X 70  
XA 2 3 N PHE DA 78  ? N PHE X 77  O GLU DA 83  ? O GLU X 82  
XA 3 4 N VAL DA 86  ? N VAL X 85  O ARG DA 50  ? O ARG X 49  
YA 1 2 N GLN EA 99  ? N GLN Y 98  O VAL EA 235 ? O VAL Y 234 
YB 1 2 N VAL EA 186 ? N VAL Y 185 O ALA EA 203 ? O ALA Y 202 
ZA 1 2 N GLN FA 41  ? N GLN Z 50  O ILE FA 45  ? O ILE Z 54  
ZA 2 3 N TRP FA 46  ? N TRP Z 55  O PHE FA 55  ? O PHE Z 64  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG 08001'            
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08002'            
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08003'            
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08004'            
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08005'            
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08006'            
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08007'            
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08008'            
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08009'            
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08010'            
BC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08011'            
BC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08012'            
BC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08013'            
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08014'            
BC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08015'            
BC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08016'            
BC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08017'            
BC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08018'            
CC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08019'            
CC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08020'            
CC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08021'            
CC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08022'            
CC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08023'            
CC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08024'            
CC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08025'            
CC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08026'            
CC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08027'            
DC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08028'            
DC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08029'            
DC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08030'            
DC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08031'            
DC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08032'            
DC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG 08033'            
DC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08034'            
DC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08035'            
DC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08036'            
EC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08037'            
EC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08038'            
EC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08039'            
EC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08040'            
EC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08041'            
EC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08042'            
EC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08043'            
EC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG 08044'            
EC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08045'            
FC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08046'            
FC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08047'            
FC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08048'            
FC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08049'            
FC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08050'            
FC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08051'            
FC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08052'            
FC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08053'            
FC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08054'            
GC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG 08057'            
GC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08058'            
GC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08059'            
GC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08060'            
GC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08061'            
GC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08062'            
GC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08064'            
GC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08066'            
GC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG 08067'            
HC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08068'            
HC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08070'            
HC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08071'            
HC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08072'            
HC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08074'            
HC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08075'            
HC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08077'            
HC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08079'            
HC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08080'            
IC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08081'            
IC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08082'            
IC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08083'            
IC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08084'            
IC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08085'            
IC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08086'            
IC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08087'            
IC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08088'            
IC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG 08089'            
JC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08090'            
JC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08091'            
JC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08092'            
JC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08093'            
JC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08094'            
JC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08096'            
JC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08097'            
JC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08098'            
JC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08099'            
KC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08100'            
KC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08101'            
KC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08102'            
KC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08103'            
KC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08104'            
KC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08105'            
KC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08106'            
KC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08107'            
KC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08109'            
LC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08110'            
LC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08111'            
LC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08112'            
LC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG 08113'            
LC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08115'            
LC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 08116'            
LC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 08118'            
LC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE K 08402'             
LC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08501'            
MC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08502'            
MC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA 08503'            
MC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08505'            
MC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08506'            
MC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08507'            
MC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08508'            
MC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA 08509'            
MC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08510'            
MC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA 08511'            
NC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA 08513'            
NC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08514'            
NC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08515'            
NC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA 08516'            
NC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08517'            
NC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08518'            
NC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08519'            
NC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08520'            
NC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08521'            
OC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08523'            
OC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08524'            
OC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08525'            
OC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08526'            
OC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08527'            
OC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08528'            
OC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08529'            
OC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08530'            
OC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08531'            
PC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08532'            
PC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08533'            
PC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08534'            
PC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08535'            
PC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA 08536'            
PC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08538'            
PC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08539'            
PC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08540'            
PC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08541'            
QC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08542'            
QC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA 08543'            
QC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08544'            
QC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08549'            
QC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08550'            
QC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08552'            
QC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08553'            
QC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08554'            
QC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08555'            
RC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08556'            
RC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08557'            
RC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08558'            
RC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08559'            
RC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA 08560'            
RC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08561'            
RC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08562'            
RC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08563'            
RC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA 08564'            
SC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08565'            
SC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08566'            
SC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08567'            
SC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08568'            
SC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NA 08569'            
SC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08570'            
SC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08571'            
SC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08572'            
SC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08573'            
TC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08574'            
TC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 08575'            
TC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08576'            
TC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08577'            
TC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08578'            
TC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA 08580'            
TC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA 08581'            
TC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NA 08583'            
TC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA 08584'            
UC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL 08803'            
UC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL 08805'            
UC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL 08811'            
UC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL 08812'            
UC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL 08813'            
UC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL 08814'            
UC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL 08815'            
UC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL 08816'            
UC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL 08817'            
VC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL 08822'            
VC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE VIR 09000'           
VC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CD 18702'            
VC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG 28076'            
VC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG 38078'            
VC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CD 38704'            
VC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL 38804'            
VC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG 98095'            
VC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA 98551'            
WC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA 98582'            
WC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG A8065'            
WC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A8545'            
WC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A8809'            
WC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG B8055'            
WC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG B8056'            
WC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL B8819'            
WC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA C8504'            
WC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NA H8522'            
XC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA J8546'            
XC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL J8801'            
XC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL J8802'            
XC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL J8821'            
XC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG K8069'            
XC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA L8579'            
XC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL L8810'            
XC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA M8547'            
XC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL M8818'            
YC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL N8807'            
YC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CD O8705'            
YC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL O8808'            
YC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA Q8548'            
YC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA R8537'            
YC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA R8585'            
YC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL R8806'            
YC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NA S8512'            
YC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG T8073'            
ZC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CD U8701'            
ZC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG Y8108'            
ZC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL Y8820'            
ZC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CD Z8703'            
ZC5 Software ? ? ? ? 11 'BINDING SITE FOR CHAIN 8 OF VIRGINIAMYCIN S1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  G   A  2482 ? G   0 2482 . ? 1_555 ? 
2   AC1 4  A   A  2483 ? A   0 2483 . ? 1_555 ? 
3   AC1 4  C   A  2533 ? C   0 2533 . ? 1_555 ? 
4   AC1 4  C   A  2534 ? C   0 2534 . ? 1_555 ? 
5   AC2 3  G   A  627  ? G   0 627  . ? 1_555 ? 
6   AC2 3  A   A  2483 ? A   0 2483 . ? 1_555 ? 
7   AC2 3  C   A  2534 ? C   0 2534 . ? 1_555 ? 
8   AC3 3  A   A  876  ? A   0 876  . ? 1_555 ? 
9   AC3 3  G   A  877  ? G   0 877  . ? 1_555 ? 
10  AC3 3  A   A  2624 ? A   0 2624 . ? 1_555 ? 
11  AC4 2  G   A  456  ? G   0 456  . ? 1_555 ? 
12  AC4 2  A   A  459  ? A   0 459  . ? 1_555 ? 
13  AC5 3  A   A  1836 ? A   0 1836 . ? 1_555 ? 
14  AC5 3  U   A  1838 ? U   0 1838 . ? 1_555 ? 
15  AC5 3  A   A  1839 ? A   0 1839 . ? 1_555 ? 
16  AC6 3  U   A  821  ? U   0 821  . ? 1_555 ? 
17  AC6 3  C   A  822  ? C   0 822  . ? 1_555 ? 
18  AC6 3  G   A  854  ? G   0 854  . ? 1_555 ? 
19  AC7 3  U   A  832  ? U   0 832  . ? 1_555 ? 
20  AC7 3  A   A  1839 ? A   0 1839 . ? 1_555 ? 
21  AC7 3  A   A  1840 ? A   0 1840 . ? 1_555 ? 
22  AC8 3  U   A  919  ? U   0 919  . ? 1_555 ? 
23  AC8 3  C   A  2464 ? C   0 2464 . ? 1_555 ? 
24  AC8 3  A   A  2465 ? A   0 2465 . ? 1_555 ? 
25  AC9 3  U   A  2610 ? U   0 2610 . ? 1_555 ? 
26  AC9 3  G   A  2611 ? G   0 2611 . ? 1_555 ? 
27  AC9 3  A   A  2612 ? A   0 2612 . ? 1_555 ? 
28  BC1 3  G   A  836  ? G   0 836  . ? 1_555 ? 
29  BC1 3  U   A  2615 ? U   0 2615 . ? 1_555 ? 
30  BC1 3  GLN H  231  ? GLN B 230  . ? 1_555 ? 
31  BC2 2  G   A  824  ? G   0 824  . ? 1_555 ? 
32  BC2 2  G   A  854  ? G   0 854  . ? 1_555 ? 
33  BC3 1  G   A  28   ? G   0 28   . ? 1_555 ? 
34  BC4 2  G   A  877  ? G   0 877  . ? 1_555 ? 
35  BC4 2  G   A  2623 ? G   0 2623 . ? 1_555 ? 
36  BC5 3  A   A  2101 ? A   0 2101 . ? 1_555 ? 
37  BC5 3  G   A  2102 ? G   0 2102 . ? 1_555 ? 
38  BC5 3  G   A  2537 ? G   0 2537 . ? 1_555 ? 
39  BC6 2  A   A  844  ? A   0 844  . ? 1_555 ? 
40  BC6 2  A   A  1689 ? A   0 1689 . ? 1_555 ? 
41  BC7 3  A   A  1504 ? A   0 1504 . ? 1_555 ? 
42  BC7 3  A   A  1678 ? A   0 1678 . ? 1_555 ? 
43  BC7 3  C   A  1679 ? C   0 1679 . ? 1_555 ? 
44  BC8 1  G   A  456  ? G   0 456  . ? 1_555 ? 
45  BC9 2  A   A  1291 ? A   0 1291 . ? 1_555 ? 
46  BC9 2  G   A  1292 ? G   0 1292 . ? 1_555 ? 
47  CC1 1  A   A  2011 ? A   0 2011 . ? 1_555 ? 
48  CC2 2  G   A  1828 ? G   0 1828 . ? 1_555 ? 
49  CC2 2  C   A  1830 ? C   0 1830 . ? 1_555 ? 
50  CC3 1  G   A  2304 ? G   0 2304 . ? 1_555 ? 
51  CC4 2  G   A  2097 ? G   0 2097 . ? 1_555 ? 
52  CC4 2  G   A  2540 ? G   0 2540 . ? 1_555 ? 
53  CC5 3  G   A  2616 ? G   0 2616 . ? 1_555 ? 
54  CC5 3  G   A  2617 ? G   0 2617 . ? 1_555 ? 
55  CC5 3  G   A  2618 ? G   0 2618 . ? 1_555 ? 
56  CC6 1  A   A  1381 ? A   0 1381 . ? 1_555 ? 
57  CC7 2  U   A  1120 ? U   0 1120 . ? 1_555 ? 
58  CC7 2  G   A  1121 ? G   0 1121 . ? 1_555 ? 
59  CC8 3  C   A  2608 ? C   0 2608 . ? 1_555 ? 
60  CC8 3  G   A  2609 ? G   0 2609 . ? 1_555 ? 
61  CC8 3  U   A  2610 ? U   0 2610 . ? 1_555 ? 
62  CC9 2  C   A  240  ? C   0 240  . ? 1_555 ? 
63  CC9 2  G   A  269  ? G   0 269  . ? 1_555 ? 
64  DC1 2  A   A  1448 ? A   0 1448 . ? 1_555 ? 
65  DC1 2  U   A  1677 ? U   0 1677 . ? 1_555 ? 
66  DC2 3  A   A  1502 ? A   0 1502 . ? 1_555 ? 
67  DC2 3  U   A  1503 ? U   0 1503 . ? 1_555 ? 
68  DC2 3  C   A  1679 ? C   0 1679 . ? 1_555 ? 
69  DC3 2  U   A  1748 ? U   0 1748 . ? 1_555 ? 
70  DC3 2  U   A  1749 ? U   0 1749 . ? 1_555 ? 
71  DC4 2  U   A  777  ? U   0 777  . ? 1_555 ? 
72  DC4 2  C   A  778  ? C   0 778  . ? 1_555 ? 
73  DC5 1  U   A  2115 ? U   0 2115 . ? 1_555 ? 
74  DC6 4  A   A  1747 ? A   0 1747 . ? 1_555 ? 
75  DC6 4  U   A  1748 ? U   0 1748 . ? 1_555 ? 
76  DC6 4  U   A  1749 ? U   0 1749 . ? 1_555 ? 
77  DC6 4  G   A  2585 ? G   0 2585 . ? 1_555 ? 
78  DC7 2  A   A  2302 ? A   0 2302 . ? 1_555 ? 
79  DC7 2  A   A  2303 ? A   0 2303 . ? 1_555 ? 
80  DC8 1  G   A  1484 ? G   0 1484 . ? 1_555 ? 
81  DC9 1  G   A  956  ? G   0 956  . ? 1_555 ? 
82  EC1 2  A   A  2553 ? A   0 2553 . ? 1_555 ? 
83  EC1 2  A   A  2576 ? A   0 2576 . ? 1_555 ? 
84  EC2 1  G   A  2271 ? G   0 2271 . ? 1_555 ? 
85  EC3 1  U   A  115  ? U   0 115  . ? 1_555 ? 
86  EC4 1  U   A  392  ? U   0 392  . ? 1_555 ? 
87  EC5 3  G   A  196  ? G   0 196  . ? 1_555 ? 
88  EC5 3  A   A  227  ? A   0 227  . ? 1_555 ? 
89  EC5 3  C   A  228  ? C   0 228  . ? 1_555 ? 
90  EC6 2  U   A  1309 ? U   0 1309 . ? 1_555 ? 
91  EC6 2  U   A  1346 ? U   0 1346 . ? 1_555 ? 
92  EC7 3  G   A  816  ? G   0 816  . ? 1_555 ? 
93  EC7 3  G   A  817  ? G   0 817  . ? 1_555 ? 
94  EC7 3  MG  YD .    ? MG  0 8105 . ? 1_555 ? 
95  EC8 4  C   A  2048 ? C   0 2048 . ? 1_555 ? 
96  EC8 4  C   A  2088 ? C   0 2088 . ? 1_555 ? 
97  EC8 4  A   A  2089 ? A   0 2089 . ? 1_555 ? 
98  EC8 4  GLY X  66   ? GLY R 65   . ? 1_555 ? 
99  EC9 1  G   A  1979 ? G   0 1979 . ? 1_555 ? 
100 FC1 1  G   A  1794 ? G   0 1794 . ? 1_555 ? 
101 FC2 1  A   A  1098 ? A   0 1098 . ? 1_555 ? 
102 FC3 2  A   A  2746 ? A   0 2746 . ? 1_555 ? 
103 FC3 2  G   A  2750 ? G   0 2750 . ? 1_555 ? 
104 FC4 2  G   A  2421 ? G   0 2421 . ? 1_555 ? 
105 FC4 2  C   A  2423 ? C   0 2423 . ? 1_555 ? 
106 FC5 1  C   A  2248 ? C   0 2248 . ? 1_555 ? 
107 FC6 1  G   A  641  ? G   0 641  . ? 1_555 ? 
108 FC7 3  U   A  1125 ? U   0 1125 . ? 1_555 ? 
109 FC7 3  C   A  1129 ? C   0 1129 . ? 1_555 ? 
110 FC7 3  G   F  92   ? G   9 92   . ? 1_555 ? 
111 FC8 1  G   A  471  ? G   0 471  . ? 1_555 ? 
112 FC9 2  C   A  162  ? C   0 162  . ? 1_555 ? 
113 FC9 2  U   A  2276 ? U   0 2276 . ? 1_555 ? 
114 GC1 5  U   A  1883 ? U   0 1883 . ? 1_555 ? 
115 GC1 5  U   A  2012 ? U   0 2012 . ? 1_555 ? 
116 GC1 5  G   A  2013 ? G   0 2013 . ? 1_555 ? 
117 GC1 5  MG  JC .    ? MG  0 8058 . ? 1_555 ? 
118 GC1 5  GLN G  208  ? GLN A 207  . ? 1_555 ? 
119 GC2 3  U   A  1883 ? U   0 1883 . ? 1_555 ? 
120 GC2 3  G   A  2013 ? G   0 2013 . ? 1_555 ? 
121 GC2 3  MG  IC .    ? MG  0 8057 . ? 1_555 ? 
122 GC3 1  G   A  2618 ? G   0 2618 . ? 1_555 ? 
123 GC4 3  G   A  175  ? G   0 175  . ? 1_555 ? 
124 GC4 3  U   A  224  ? U   0 224  . ? 1_555 ? 
125 GC4 3  G   A  393  ? G   0 393  . ? 1_555 ? 
126 GC5 2  A   A  1369 ? A   0 1369 . ? 1_555 ? 
127 GC5 2  U   A  2650 ? U   0 2650 . ? 1_555 ? 
128 GC6 2  G   A  1489 ? G   0 1489 . ? 1_555 ? 
129 GC6 2  G   A  1491 ? G   0 1491 . ? 1_555 ? 
130 GC7 3  U   A  2277 ? U   0 2277 . ? 1_555 ? 
131 GC7 3  U   A  2278 ? U   0 2278 . ? 1_555 ? 
132 GC7 3  G   A  2471 ? G   0 2471 . ? 1_555 ? 
133 GC8 2  G   A  1873 ? G   0 1873 . ? 1_555 ? 
134 GC8 2  ASP G  27   ? ASP A 26   . ? 1_555 ? 
135 GC9 4  A   A  1845 ? A   0 1845 . ? 1_555 ? 
136 GC9 4  U   A  1846 ? U   0 1846 . ? 1_555 ? 
137 GC9 4  G   A  1884 ? G   0 1884 . ? 1_555 ? 
138 GC9 4  ASN G  189  ? ASN A 188  . ? 1_555 ? 
139 HC1 1  A   A  2568 ? A   0 2568 . ? 1_555 ? 
140 HC2 2  A   A  166  ? A   0 166  . ? 1_555 ? 
141 HC2 2  G   A  219  ? G   0 219  . ? 1_555 ? 
142 HC3 2  U   A  1817 ? U   0 1817 . ? 1_555 ? 
143 HC3 2  C   A  1818 ? C   0 1818 . ? 1_555 ? 
144 HC4 1  C   A  2298 ? C   0 2298 . ? 1_555 ? 
145 HC5 2  A   A  1286 ? A   0 1286 . ? 1_555 ? 
146 HC5 2  A   A  1287 ? A   0 1287 . ? 1_555 ? 
147 HC6 2  A   A  907  ? A   0 907  . ? 1_555 ? 
148 HC6 2  A   A  908  ? A   0 908  . ? 1_555 ? 
149 HC7 2  C   A  880  ? C   0 880  . ? 1_555 ? 
150 HC7 2  U   A  883  ? U   0 883  . ? 1_555 ? 
151 HC8 3  A   A  165  ? A   0 165  . ? 1_555 ? 
152 HC8 3  A   A  167  ? A   0 167  . ? 1_555 ? 
153 HC8 3  C   A  168  ? C   0 168  . ? 1_555 ? 
154 HC9 2  A   A  1684 ? A   0 1684 . ? 1_555 ? 
155 HC9 2  U   A  1724 ? U   0 1724 . ? 1_555 ? 
156 IC1 3  C   A  1420 ? C   0 1420 . ? 1_555 ? 
157 IC1 3  C   A  1421 ? C   0 1421 . ? 1_555 ? 
158 IC1 3  G   A  1438 ? G   0 1438 . ? 1_555 ? 
159 IC2 2  C   A  1436 ? C   0 1436 . ? 1_555 ? 
160 IC2 2  A   A  1437 ? A   0 1437 . ? 1_555 ? 
161 IC3 1  A   A  1754 ? A   0 1754 . ? 1_555 ? 
162 IC4 2  A   A  1742 ? A   0 1742 . ? 1_555 ? 
163 IC4 2  G   A  1745 ? G   0 1745 . ? 1_555 ? 
164 IC5 2  G   A  2617 ? G   0 2617 . ? 1_555 ? 
165 IC5 2  G   A  2618 ? G   0 2618 . ? 1_555 ? 
166 IC6 2  A   A  532  ? A   0 532  . ? 1_555 ? 
167 IC6 2  U   A  533  ? U   0 533  . ? 1_555 ? 
168 IC7 2  A   A  682  ? A   0 682  . ? 1_555 ? 
169 IC7 2  G   A  683  ? G   0 683  . ? 1_555 ? 
170 IC8 3  G   A  2540 ? G   0 2540 . ? 1_555 ? 
171 IC8 3  G   A  2611 ? G   0 2611 . ? 1_555 ? 
172 IC8 3  NA  UF .    ? NA  0 8539 . ? 1_555 ? 
173 IC9 4  C   A  515  ? C   0 515  . ? 1_555 ? 
174 IC9 4  A   A  516  ? A   0 516  . ? 1_555 ? 
175 IC9 4  U   A  517  ? U   0 517  . ? 1_555 ? 
176 IC9 4  G   A  518  ? G   0 518  . ? 1_555 ? 
177 JC1 2  A   A  2103 ? A   0 2103 . ? 1_555 ? 
178 JC1 2  U   A  2478 ? U   0 2478 . ? 1_555 ? 
179 JC2 1  G   A  918  ? G   0 918  . ? 1_555 ? 
180 JC3 1  C   A  1844 ? C   0 1844 . ? 1_555 ? 
181 JC4 2  A   A  1070 ? A   0 1070 . ? 1_555 ? 
182 JC4 2  G   A  1071 ? G   0 1071 . ? 1_555 ? 
183 JC5 3  U   A  1096 ? U   0 1096 . ? 1_555 ? 
184 JC5 3  C   A  1257 ? C   0 1257 . ? 1_555 ? 
185 JC5 3  G   A  1258 ? G   0 1258 . ? 1_555 ? 
186 JC6 3  G   A  1848 ? G   0 1848 . ? 1_555 ? 
187 JC6 3  G   A  1849 ? G   0 1849 . ? 1_555 ? 
188 JC6 3  MG  HE .    ? MG  0 8115 . ? 1_555 ? 
189 JC7 2  G   A  863  ? G   0 863  . ? 1_555 ? 
190 JC7 2  U   A  864  ? U   0 864  . ? 1_555 ? 
191 JC8 1  A   A  907  ? A   0 907  . ? 1_555 ? 
192 JC9 1  A   A  2612 ? A   0 2612 . ? 1_555 ? 
193 KC1 1  G   A  2080 ? G   0 2080 . ? 1_555 ? 
194 KC2 3  U   A  2107 ? U   0 2107 . ? 1_555 ? 
195 KC2 3  C   A  2281 ? C   0 2281 . ? 1_555 ? 
196 KC2 3  U   A  2282 ? U   0 2282 . ? 1_555 ? 
197 KC3 2  A   A  2434 ? A   0 2434 . ? 1_555 ? 
198 KC3 2  U   A  2458 ? U   0 2458 . ? 1_555 ? 
199 KC4 3  A   A  2577 ? A   0 2577 . ? 1_555 ? 
200 KC4 3  G   A  2578 ? G   0 2578 . ? 1_555 ? 
201 KC4 3  G   A  2579 ? G   0 2579 . ? 1_555 ? 
202 KC5 2  C   A  2104 ? C   0 2104 . ? 1_555 ? 
203 KC5 2  C   A  2105 ? C   0 2105 . ? 1_555 ? 
204 KC6 2  G   A  817  ? G   0 817  . ? 1_555 ? 
205 KC6 2  MG  WB .    ? MG  0 8043 . ? 1_555 ? 
206 KC7 2  A   A  1106 ? A   0 1106 . ? 1_555 ? 
207 KC7 2  A   A  1107 ? A   0 1107 . ? 1_555 ? 
208 KC8 1  G   A  2000 ? G   0 2000 . ? 1_555 ? 
209 KC9 2  U   A  903  ? U   0 903  . ? 1_555 ? 
210 KC9 2  A   A  1357 ? A   0 1357 . ? 1_555 ? 
211 LC1 2  G   A  2609 ? G   0 2609 . ? 1_555 ? 
212 LC1 2  U   A  2610 ? U   0 2610 . ? 1_555 ? 
213 LC2 1  A   A  187  ? A   0 187  . ? 1_555 ? 
214 LC3 1  A   A  2112 ? A   0 2112 . ? 1_555 ? 
215 LC4 2  A   A  2430 ? A   0 2430 . ? 1_555 ? 
216 LC4 2  C   A  2431 ? C   0 2431 . ? 1_555 ? 
217 LC5 3  G   A  1849 ? G   0 1849 . ? 1_555 ? 
218 LC5 3  U   A  1850 ? U   0 1850 . ? 1_555 ? 
219 LC5 3  MG  PD .    ? MG  0 8096 . ? 1_555 ? 
220 LC6 3  A   A  1840 ? A   0 1840 . ? 1_555 ? 
221 LC6 3  C   A  1841 ? C   0 1841 . ? 1_555 ? 
222 LC6 3  A   A  2022 ? A   0 2022 . ? 1_555 ? 
223 LC7 1  MHW E  1    ? MHW 8 1    . ? 1_555 ? 
224 LC8 4  C   A  162  ? C   0 162  . ? 1_555 ? 
225 LC8 4  U   A  163  ? U   0 163  . ? 1_555 ? 
226 LC8 4  U   A  172  ? U   0 172  . ? 1_555 ? 
227 LC8 4  ARG S  83   ? ARG M 82   . ? 1_555 ? 
228 LC9 3  C   A  1069 ? C   0 1069 . ? 1_555 ? 
229 LC9 3  G   A  1072 ? G   0 1072 . ? 1_555 ? 
230 LC9 3  G   A  1087 ? G   0 1087 . ? 1_555 ? 
231 MC1 4  G   A  1119 ? G   0 1119 . ? 1_555 ? 
232 MC1 4  U   A  1120 ? U   0 1120 . ? 1_555 ? 
233 MC1 4  G   A  1121 ? G   0 1121 . ? 1_555 ? 
234 MC1 4  U   A  1122 ? U   0 1122 . ? 1_555 ? 
235 MC2 6  A   A  643  ? A   0 643  . ? 1_555 ? 
236 MC2 6  G   A  644  ? G   0 644  . ? 1_555 ? 
237 MC2 6  U   A  904  ? U   0 904  . ? 1_555 ? 
238 MC2 6  C   A  1353 ? C   0 1353 . ? 1_555 ? 
239 MC2 6  G   A  1354 ? G   0 1354 . ? 1_555 ? 
240 MC2 6  ARG R  9    ? ARG L 8    . ? 1_555 ? 
241 MC3 4  A   A  630  ? A   0 630  . ? 1_555 ? 
242 MC3 4  A   A  631  ? A   0 631  . ? 1_555 ? 
243 MC3 4  G   A  2070 ? G   0 2070 . ? 1_555 ? 
244 MC3 4  A   A  2074 ? A   0 2074 . ? 1_555 ? 
245 MC4 4  G   A  2092 ? G   0 2092 . ? 1_555 ? 
246 MC4 4  G   A  2093 ? G   0 2093 . ? 1_555 ? 
247 MC4 4  G   A  2094 ? G   0 2094 . ? 1_555 ? 
248 MC4 4  A   A  2649 ? A   0 2649 . ? 1_555 ? 
249 MC5 4  C   A  40   ? C   0 40   . ? 1_555 ? 
250 MC5 4  G   A  41   ? G   0 41   . ? 1_555 ? 
251 MC5 4  A   A  442  ? A   0 442  . ? 1_555 ? 
252 MC5 4  C   A  443  ? C   0 443  . ? 1_555 ? 
253 MC6 4  C   A  1394 ? C   0 1394 . ? 1_555 ? 
254 MC6 4  U   A  1432 ? U   0 1432 . ? 1_555 ? 
255 MC6 4  G   A  1433 ? G   0 1433 . ? 1_555 ? 
256 MC6 4  U   A  1724 ? U   0 1724 . ? 1_555 ? 
257 MC7 6  A   A  1133 ? A   0 1133 . ? 1_555 ? 
258 MC7 6  G   A  1134 ? G   0 1134 . ? 1_555 ? 
259 MC7 6  TYR N  157  ? TYR H 157  . ? 1_555 ? 
260 MC7 6  ILE N  160  ? ILE H 160  . ? 1_555 ? 
261 MC7 6  THR N  161  ? THR H 161  . ? 1_555 ? 
262 MC7 6  PRO N  162  ? PRO H 162  . ? 1_555 ? 
263 MC8 3  A   A  2577 ? A   0 2577 . ? 1_555 ? 
264 MC8 3  G   A  2578 ? G   0 2578 . ? 1_555 ? 
265 MC8 3  G   A  2579 ? G   0 2579 . ? 1_555 ? 
266 MC9 2  G   A  2524 ? G   0 2524 . ? 1_555 ? 
267 MC9 2  G   A  2525 ? G   0 2525 . ? 1_555 ? 
268 NC1 2  A   A  2398 ? A   0 2398 . ? 1_555 ? 
269 NC1 2  G   A  2399 ? G   0 2399 . ? 1_555 ? 
270 NC2 4  U   A  2541 ? U   0 2541 . ? 1_555 ? 
271 NC2 4  U   A  2607 ? U   0 2607 . ? 1_555 ? 
272 NC2 4  C   A  2608 ? C   0 2608 . ? 1_555 ? 
273 NC2 4  TRP H  243  ? TRP B 242  . ? 1_555 ? 
274 NC3 3  A   A  165  ? A   0 165  . ? 1_555 ? 
275 NC3 3  A   A  166  ? A   0 166  . ? 1_555 ? 
276 NC3 3  A   A  167  ? A   0 167  . ? 1_555 ? 
277 NC4 2  C   A  896  ? C   0 896  . ? 1_555 ? 
278 NC4 2  A   A  897  ? A   0 897  . ? 1_555 ? 
279 NC5 4  G   A  1416 ? G   0 1416 . ? 1_555 ? 
280 NC5 4  G   A  1417 ? G   0 1417 . ? 1_555 ? 
281 NC5 4  TRP C  43   ? TRP 2 42   . ? 1_555 ? 
282 NC5 4  ASN C  46   ? ASN 2 45   . ? 1_555 ? 
283 NC6 3  G   A  2543 ? G   0 2543 . ? 1_555 ? 
284 NC6 3  G   A  2544 ? G   0 2544 . ? 1_555 ? 
285 NC6 3  NA  DF .    ? NA  0 8520 . ? 1_555 ? 
286 NC7 3  A   A  2465 ? A   0 2465 . ? 1_555 ? 
287 NC7 3  G   A  2466 ? G   0 2466 . ? 1_555 ? 
288 NC7 3  ASP R  37   ? ASP L 36   . ? 1_555 ? 
289 NC8 4  G   A  2543 ? G   0 2543 . ? 1_555 ? 
290 NC8 4  G   A  2544 ? G   0 2544 . ? 1_555 ? 
291 NC8 4  U   A  2615 ? U   0 2615 . ? 1_555 ? 
292 NC8 4  NA  BF .    ? NA  0 8518 . ? 1_555 ? 
293 NC9 5  G   A  836  ? G   0 836  . ? 1_555 ? 
294 NC9 5  U   A  837  ? U   0 837  . ? 1_555 ? 
295 NC9 5  A   A  1736 ? A   0 1736 . ? 1_555 ? 
296 NC9 5  A   A  1737 ? A   0 1737 . ? 1_555 ? 
297 NC9 5  ARG H  230  ? ARG B 229  . ? 1_555 ? 
298 OC1 5  G   A  885  ? G   0 885  . ? 1_555 ? 
299 OC1 5  A   A  2112 ? A   0 2112 . ? 1_555 ? 
300 OC1 5  G   A  2113 ? G   0 2113 . ? 1_555 ? 
301 OC1 5  C   A  2475 ? C   0 2475 . ? 1_555 ? 
302 OC1 5  C   A  2476 ? C   0 2476 . ? 1_555 ? 
303 OC2 4  A   A  45   ? A   0 45   . ? 1_555 ? 
304 OC2 4  C   A  130  ? C   0 130  . ? 1_555 ? 
305 OC2 4  U   A  146  ? U   0 146  . ? 1_555 ? 
306 OC2 4  G   A  147  ? G   0 147  . ? 1_555 ? 
307 OC3 3  A   A  776  ? A   0 776  . ? 1_555 ? 
308 OC3 3  U   A  777  ? U   0 777  . ? 1_555 ? 
309 OC3 3  U   A  779  ? U   0 779  . ? 1_555 ? 
310 OC4 4  G   A  1971 ? G   0 1971 . ? 1_555 ? 
311 OC4 4  G   A  2009 ? G   0 2009 . ? 1_555 ? 
312 OC4 4  A   A  2010 ? A   0 2010 . ? 1_555 ? 
313 OC4 4  U   A  2012 ? U   0 2012 . ? 1_555 ? 
314 OC5 4  U   A  821  ? U   0 821  . ? 1_555 ? 
315 OC5 4  C   A  853  ? C   0 853  . ? 1_555 ? 
316 OC5 4  G   A  854  ? G   0 854  . ? 1_555 ? 
317 OC5 4  U   A  1831 ? U   0 1831 . ? 1_555 ? 
318 OC6 5  G   A  56   ? G   0 56   . ? 1_555 ? 
319 OC6 5  A   A  59   ? A   0 59   . ? 1_555 ? 
320 OC6 5  A   A  60   ? A   0 60   . ? 1_555 ? 
321 OC6 5  G   A  61   ? G   0 61   . ? 1_555 ? 
322 OC6 5  C   A  62   ? C   0 62   . ? 1_555 ? 
323 OC7 3  G   A  66   ? G   0 66   . ? 1_555 ? 
324 OC7 3  U   A  107  ? U   0 107  . ? 1_555 ? 
325 OC7 3  U   A  108  ? U   0 108  . ? 1_555 ? 
326 OC8 3  G   A  140  ? G   0 140  . ? 1_555 ? 
327 OC8 3  C   A  141  ? C   0 141  . ? 1_555 ? 
328 OC8 3  G   A  142  ? G   0 142  . ? 1_555 ? 
329 OC9 4  U   A  170  ? U   0 170  . ? 1_555 ? 
330 OC9 4  C   A  171  ? C   0 171  . ? 1_555 ? 
331 OC9 4  C   A  218  ? C   0 218  . ? 1_555 ? 
332 OC9 4  G   A  221  ? G   0 221  . ? 1_555 ? 
333 PC1 5  G   A  386  ? G   0 386  . ? 1_555 ? 
334 PC1 5  G   A  387  ? G   0 387  . ? 1_555 ? 
335 PC1 5  G   A  388  ? G   0 388  . ? 1_555 ? 
336 PC1 5  C   A  401  ? C   0 401  . ? 1_555 ? 
337 PC1 5  U   A  402  ? U   0 402  . ? 1_555 ? 
338 PC2 4  C   A  1894 ? C   0 1894 . ? 1_555 ? 
339 PC2 4  U   A  1897 ? U   0 1897 . ? 1_555 ? 
340 PC2 4  G   A  1898 ? G   0 1898 . ? 1_555 ? 
341 PC2 4  U   A  1939 ? U   0 1939 . ? 1_555 ? 
342 PC3 4  C   A  1894 ? C   0 1894 . ? 1_555 ? 
343 PC3 4  A   A  1895 ? A   0 1895 . ? 1_555 ? 
344 PC3 4  G   A  1896 ? G   0 1896 . ? 1_555 ? 
345 PC3 4  U   A  1897 ? U   0 1897 . ? 1_555 ? 
346 PC4 5  C   A  621  ? C   0 621  . ? 1_555 ? 
347 PC4 5  G   A  622  ? G   0 622  . ? 1_555 ? 
348 PC4 5  U   A  623  ? U   0 623  . ? 1_555 ? 
349 PC4 5  1MA A  628  ? 1MA 0 628  . ? 1_555 ? 
350 PC4 5  A   A  630  ? A   0 630  . ? 1_555 ? 
351 PC5 2  G   A  1706 ? G   0 1706 . ? 1_555 ? 
352 PC5 2  G   A  1707 ? G   0 1707 . ? 1_555 ? 
353 PC6 4  U   A  2659 ? U   0 2659 . ? 1_555 ? 
354 PC6 4  G   A  2660 ? G   0 2660 . ? 1_555 ? 
355 PC6 4  VAL X  73   ? VAL R 72   . ? 1_555 ? 
356 PC6 4  TRP X  76   ? TRP R 75   . ? 1_555 ? 
357 PC7 5  G   A  2540 ? G   0 2540 . ? 1_555 ? 
358 PC7 5  G   A  2611 ? G   0 2611 . ? 1_555 ? 
359 PC7 5  G   A  2616 ? G   0 2616 . ? 1_555 ? 
360 PC7 5  U   A  2645 ? U   0 2645 . ? 1_555 ? 
361 PC7 5  MG  ID .    ? MG  0 8088 . ? 1_555 ? 
362 PC8 3  U   A  1740 ? U   0 1740 . ? 1_555 ? 
363 PC8 3  U   A  1741 ? U   0 1741 . ? 1_555 ? 
364 PC8 3  G   A  2033 ? G   0 2033 . ? 1_555 ? 
365 PC9 3  G   A  681  ? G   0 681  . ? 1_555 ? 
366 PC9 3  A   A  682  ? A   0 682  . ? 1_555 ? 
367 PC9 3  G   A  683  ? G   0 683  . ? 1_555 ? 
368 QC1 3  G   A  891  ? G   0 891  . ? 1_555 ? 
369 QC1 3  G   A  892  ? G   0 892  . ? 1_555 ? 
370 QC1 3  C   A  893  ? C   0 893  . ? 1_555 ? 
371 QC2 6  U   A  308  ? U   0 308  . ? 1_555 ? 
372 QC2 6  U   A  335  ? U   0 335  . ? 1_555 ? 
373 QC2 6  A   A  339  ? A   0 339  . ? 1_555 ? 
374 QC2 6  C   A  342  ? C   0 342  . ? 1_555 ? 
375 QC2 6  SER Z  95   ? SER T 94   . ? 1_555 ? 
376 QC2 6  ASN Z  96   ? ASN T 95   . ? 1_555 ? 
377 QC3 5  U   A  2663 ? U   0 2663 . ? 1_555 ? 
378 QC3 5  A   A  2811 ? A   0 2811 . ? 1_555 ? 
379 QC3 5  A   A  2812 ? A   0 2812 . ? 1_555 ? 
380 QC3 5  A   A  2816 ? A   0 2816 . ? 1_555 ? 
381 QC3 5  G   A  2817 ? G   0 2817 . ? 1_555 ? 
382 QC4 5  A   A  914  ? A   0 914  . ? 1_555 ? 
383 QC4 5  C   A  915  ? C   0 915  . ? 1_555 ? 
384 QC4 5  C   A  1043 ? C   0 1043 . ? 1_555 ? 
385 QC4 5  C   A  1044 ? C   0 1044 . ? 1_555 ? 
386 QC4 5  G   A  1045 ? G   0 1045 . ? 1_555 ? 
387 QC5 3  U   A  623  ? U   0 623  . ? 1_555 ? 
388 QC5 3  U   A  624  ? U   0 624  . ? 1_555 ? 
389 QC5 3  G   A  901  ? G   0 901  . ? 1_555 ? 
390 QC6 3  A   A  955  ? A   0 955  . ? 1_555 ? 
391 QC6 3  C   F  81   ? C   9 81   . ? 1_555 ? 
392 QC6 3  U   F  82   ? U   9 82   . ? 1_555 ? 
393 QC7 4  A   A  1040 ? A   0 1040 . ? 1_555 ? 
394 QC7 4  G   A  1295 ? G   0 1295 . ? 1_555 ? 
395 QC7 4  A   A  1296 ? A   0 1296 . ? 1_555 ? 
396 QC7 4  GLY R  15   ? GLY L 14   . ? 1_555 ? 
397 QC8 4  U   A  768  ? U   0 768  . ? 1_555 ? 
398 QC8 4  C   A  769  ? C   0 769  . ? 1_555 ? 
399 QC8 4  G   A  2111 ? G   0 2111 . ? 1_555 ? 
400 QC8 4  A   A  2112 ? A   0 2112 . ? 1_555 ? 
401 QC9 3  G   A  1119 ? G   0 1119 . ? 1_555 ? 
402 QC9 3  C   A  1243 ? C   0 1243 . ? 1_555 ? 
403 QC9 3  THR P  47   ? THR J 47   . ? 1_555 ? 
404 RC1 4  C   A  920  ? C   0 920  . ? 1_555 ? 
405 RC1 4  U   A  2278 ? U   0 2278 . ? 1_555 ? 
406 RC1 4  G   A  2279 ? G   0 2279 . ? 1_555 ? 
407 RC1 4  A   A  2463 ? A   0 2463 . ? 1_555 ? 
408 RC2 4  G   A  941  ? G   0 941  . ? 1_555 ? 
409 RC2 4  U   A  942  ? U   0 942  . ? 1_555 ? 
410 RC2 4  C   A  1023 ? C   0 1023 . ? 1_555 ? 
411 RC2 4  G   A  1024 ? G   0 1024 . ? 1_555 ? 
412 RC3 5  G   A  898  ? G   0 898  . ? 1_555 ? 
413 RC3 5  A   A  922  ? A   0 922  . ? 1_555 ? 
414 RC3 5  A   A  923  ? A   0 923  . ? 1_555 ? 
415 RC3 5  G   A  924  ? G   0 924  . ? 1_555 ? 
416 RC3 5  U   A  2109 ? U   0 2109 . ? 1_555 ? 
417 RC4 4  A   A  453  ? A   0 453  . ? 1_555 ? 
418 RC4 4  U   A  454  ? U   0 454  . ? 1_555 ? 
419 RC4 4  C   A  478  ? C   0 478  . ? 1_555 ? 
420 RC4 4  G   A  479  ? G   0 479  . ? 1_555 ? 
421 RC5 2  U   A  837  ? U   0 837  . ? 1_555 ? 
422 RC5 2  GLN H  231  ? GLN B 230  . ? 1_555 ? 
423 RC6 5  A   A  167  ? A   0 167  . ? 1_555 ? 
424 RC6 5  C   A  168  ? C   0 168  . ? 1_555 ? 
425 RC6 5  G   A  2110 ? G   0 2110 . ? 1_555 ? 
426 RC6 5  G   A  2111 ? G   0 2111 . ? 1_555 ? 
427 RC6 5  U   A  2277 ? U   0 2277 . ? 1_555 ? 
428 RC7 3  U   A  1359 ? U   0 1359 . ? 1_555 ? 
429 RC7 3  C   A  1360 ? C   0 1360 . ? 1_555 ? 
430 RC7 3  GLY I  66   ? GLY C 66   . ? 1_555 ? 
431 RC8 3  G   A  636  ? G   0 636  . ? 1_555 ? 
432 RC8 3  U   A  2057 ? U   0 2057 . ? 1_555 ? 
433 RC8 3  G   A  2058 ? G   0 2058 . ? 1_555 ? 
434 RC9 6  U   A  391  ? U   0 391  . ? 1_555 ? 
435 RC9 6  U   A  392  ? U   0 392  . ? 1_555 ? 
436 RC9 6  U   A  398  ? U   0 398  . ? 1_555 ? 
437 RC9 6  C   A  399  ? C   0 399  . ? 1_555 ? 
438 RC9 6  LYS S  194  ? LYS M 193  . ? 1_555 ? 
439 RC9 6  GLY S  195  ? GLY M 194  . ? 1_555 ? 
440 SC1 4  G   A  544  ? G   0 544  . ? 1_555 ? 
441 SC1 4  G   A  545  ? G   0 545  . ? 1_555 ? 
442 SC1 4  G   A  610  ? G   0 610  . ? 1_555 ? 
443 SC1 4  U   A  611  ? U   0 611  . ? 1_555 ? 
444 SC2 3  G   A  464  ? G   0 464  . ? 1_555 ? 
445 SC2 3  G   A  475  ? G   0 475  . ? 1_555 ? 
446 SC2 3  ARG I  55   ? ARG C 55   . ? 1_555 ? 
447 SC3 4  G   A  798  ? G   0 798  . ? 1_555 ? 
448 SC3 4  C   A  799  ? C   0 799  . ? 1_555 ? 
449 SC3 4  G   A  814  ? G   0 814  . ? 1_555 ? 
450 SC3 4  U   A  815  ? U   0 815  . ? 1_555 ? 
451 SC4 5  U   A  391  ? U   0 391  . ? 1_555 ? 
452 SC4 5  U   A  392  ? U   0 392  . ? 1_555 ? 
453 SC4 5  A   A  395  ? A   0 395  . ? 1_555 ? 
454 SC4 5  U   A  398  ? U   0 398  . ? 1_555 ? 
455 SC4 5  ARG D  42   ? ARG 3 42   . ? 1_555 ? 
456 SC5 1  G   A  1832 ? G   0 1832 . ? 1_555 ? 
457 SC6 3  G   A  2491 ? G   0 2491 . ? 1_555 ? 
458 SC6 3  U   A  2492 ? U   0 2492 . ? 1_555 ? 
459 SC6 3  G   A  2529 ? G   0 2529 . ? 1_555 ? 
460 SC7 3  U   A  919  ? U   0 919  . ? 1_555 ? 
461 SC7 3  G   A  921  ? G   0 921  . ? 1_555 ? 
462 SC7 3  G   A  924  ? G   0 924  . ? 1_555 ? 
463 SC8 5  G   A  1576 ? G   0 1576 . ? 1_555 ? 
464 SC8 5  U   A  1577 ? U   0 1577 . ? 1_555 ? 
465 SC8 5  G   A  1618 ? G   0 1618 . ? 1_555 ? 
466 SC8 5  G   A  1619 ? G   0 1619 . ? 1_555 ? 
467 SC8 5  C   A  1620 ? C   0 1620 . ? 1_555 ? 
468 SC9 4  C   A  195  ? C   0 195  . ? 1_555 ? 
469 SC9 4  G   A  196  ? G   0 196  . ? 1_555 ? 
470 SC9 4  A   A  415  ? A   0 415  . ? 1_555 ? 
471 SC9 4  G   A  416  ? G   0 416  . ? 1_555 ? 
472 TC1 4  G   A  868  ? G   0 868  . ? 1_555 ? 
473 TC1 4  G   A  869  ? G   0 869  . ? 1_555 ? 
474 TC1 4  A   A  886  ? A   0 886  . ? 1_555 ? 
475 TC1 4  G   A  887  ? G   0 887  . ? 1_555 ? 
476 TC2 5  A   A  632  ? A   0 632  . ? 1_555 ? 
477 TC2 5  C   A  633  ? C   0 633  . ? 1_555 ? 
478 TC2 5  C   A  2536 ? C   0 2536 . ? 1_555 ? 
479 TC2 5  A   A  2538 ? A   0 2538 . ? 1_555 ? 
480 TC2 5  U   A  2539 ? U   0 2539 . ? 1_555 ? 
481 TC3 3  G   A  911  ? G   0 911  . ? 1_555 ? 
482 TC3 3  U   A  1293 ? U   0 1293 . ? 1_555 ? 
483 TC3 3  G   A  1295 ? G   0 1295 . ? 1_555 ? 
484 TC4 4  C   A  762  ? C   0 762  . ? 1_555 ? 
485 TC4 4  G   A  902  ? G   0 902  . ? 1_555 ? 
486 TC4 4  U   A  903  ? U   0 903  . ? 1_555 ? 
487 TC4 4  HIS R  19   ? HIS L 18   . ? 1_555 ? 
488 TC5 4  U   A  831  ? U   0 831  . ? 1_555 ? 
489 TC5 4  U   A  832  ? U   0 832  . ? 1_555 ? 
490 TC5 4  G   A  833  ? G   0 833  . ? 1_555 ? 
491 TC5 4  C   A  849  ? C   0 849  . ? 1_555 ? 
492 TC6 4  G   A  2585 ? G   0 2585 . ? 1_555 ? 
493 TC6 4  U   A  2586 ? U   0 2586 . ? 1_555 ? 
494 TC6 4  OMU A  2587 ? OMU 0 2587 . ? 1_555 ? 
495 TC6 4  G   A  2592 ? G   0 2592 . ? 1_555 ? 
496 TC7 2  G   A  2772 ? G   0 2772 . ? 1_555 ? 
497 TC7 2  G   A  2773 ? G   0 2773 . ? 1_555 ? 
498 TC8 1  C   A  197  ? C   0 197  . ? 1_555 ? 
499 TC9 3  G   A  1077 ? G   0 1077 . ? 1_555 ? 
500 TC9 3  A   A  1079 ? A   0 1079 . ? 1_555 ? 
501 TC9 3  C   A  1080 ? C   0 1080 . ? 1_555 ? 
502 UC1 2  G   A  1452 ? G   0 1452 . ? 1_555 ? 
503 UC1 2  G   A  1676 ? G   0 1676 . ? 1_555 ? 
504 UC2 2  C   A  197  ? C   0 197  . ? 1_555 ? 
505 UC2 2  G   A  201  ? G   0 201  . ? 1_555 ? 
506 UC3 3  C   A  2388 ? C   0 2388 . ? 1_555 ? 
507 UC3 3  HIS W  54   ? HIS Q 53   . ? 1_555 ? 
508 UC3 3  PHE W  57   ? PHE Q 56   . ? 1_555 ? 
509 UC4 5  G   A  2582 ? G   0 2582 . ? 1_555 ? 
510 UC4 5  A   A  2596 ? A   0 2596 . ? 1_555 ? 
511 UC4 5  LYS Q  14   ? LYS K 14   . ? 1_555 ? 
512 UC4 5  ILE Q  32   ? ILE K 32   . ? 1_555 ? 
513 UC4 5  SER Q  33   ? SER K 33   . ? 1_555 ? 
514 UC5 3  G   A  1300 ? G   0 1300 . ? 1_555 ? 
515 UC5 3  A   A  1328 ? A   0 1328 . ? 1_555 ? 
516 UC5 3  G   A  1329 ? G   0 1329 . ? 1_555 ? 
517 UC6 2  G   A  644  ? G   0 644  . ? 1_555 ? 
518 UC6 2  HIS R  14   ? HIS L 13   . ? 1_555 ? 
519 UC7 3  A   A  1597 ? A   0 1597 . ? 1_555 ? 
520 UC7 3  A   A  1598 ? A   0 1598 . ? 1_555 ? 
521 UC7 3  G   A  1646 ? G   0 1646 . ? 1_555 ? 
522 UC8 3  G   A  1119 ? G   0 1119 . ? 1_555 ? 
523 UC8 3  C   A  1243 ? C   0 1243 . ? 1_555 ? 
524 UC8 3  LYS P  56   ? LYS J 56   . ? 1_555 ? 
525 UC9 3  C   A  594  ? C   0 594  . ? 1_555 ? 
526 UC9 3  U   A  595  ? U   0 595  . ? 1_555 ? 
527 UC9 3  ARG EA 116  ? ARG Y 115  . ? 1_555 ? 
528 VC1 2  G   A  1072 ? G   0 1072 . ? 1_555 ? 
529 VC1 2  G   A  1087 ? G   0 1087 . ? 1_555 ? 
530 VC2 9  G   A  2102 ? G   0 2102 . ? 1_555 ? 
531 VC2 9  A   A  2103 ? A   0 2103 . ? 1_555 ? 
532 VC2 9  C   A  2104 ? C   0 2104 . ? 1_555 ? 
533 VC2 9  A   A  2486 ? A   0 2486 . ? 1_555 ? 
534 VC2 9  C   A  2487 ? C   0 2487 . ? 1_555 ? 
535 VC2 9  A   A  2538 ? A   0 2538 . ? 1_555 ? 
536 VC2 9  G   A  2540 ? G   0 2540 . ? 1_555 ? 
537 VC2 9  U   A  2620 ? U   0 2620 . ? 1_555 ? 
538 VC2 9  DBB E  3    ? DBB 8 3    . ? 1_555 ? 
539 VC3 4  CYS B  20   ? CYS 1 19   . ? 1_555 ? 
540 VC3 4  CYS B  23   ? CYS 1 22   . ? 1_555 ? 
541 VC3 4  CYS B  35   ? CYS 1 34   . ? 1_555 ? 
542 VC3 4  CYS B  38   ? CYS 1 37   . ? 1_555 ? 
543 VC4 1  ASP C  16   ? ASP 2 15   . ? 1_555 ? 
544 VC5 3  GLY D  45   ? GLY 3 45   . ? 1_555 ? 
545 VC5 3  GLY D  47   ? GLY 3 47   . ? 1_555 ? 
546 VC5 3  ASP D  49   ? ASP 3 49   . ? 1_555 ? 
547 VC6 4  CYS D  11   ? CYS 3 11   . ? 1_555 ? 
548 VC6 4  CYS D  14   ? CYS 3 14   . ? 1_555 ? 
549 VC6 4  CYS D  71   ? CYS 3 71   . ? 1_555 ? 
550 VC6 4  CYS D  74   ? CYS 3 74   . ? 1_555 ? 
551 VC7 1  ASP D  66   ? ASP 3 66   . ? 1_555 ? 
552 VC8 4  G   F  21   ? G   9 21   . ? 1_555 ? 
553 VC8 4  U   F  55   ? U   9 55   . ? 1_555 ? 
554 VC8 4  A   F  56   ? A   9 56   . ? 1_555 ? 
555 VC8 4  A   F  57   ? A   9 57   . ? 1_555 ? 
556 VC9 2  C   F  40   ? C   9 40   . ? 1_555 ? 
557 VC9 2  LYS J  54   ? LYS D 53   . ? 1_555 ? 
558 WC1 5  G   F  21   ? G   9 21   . ? 1_555 ? 
559 WC1 5  G   F  22   ? G   9 22   . ? 1_555 ? 
560 WC1 5  U   F  55   ? U   9 55   . ? 1_555 ? 
561 WC1 5  A   F  57   ? A   9 57   . ? 1_555 ? 
562 WC1 5  G   F  58   ? G   9 58   . ? 1_555 ? 
563 WC2 1  THR G  16   ? THR A 15   . ? 1_555 ? 
564 WC3 5  A   A  2633 ? A   0 2633 . ? 1_555 ? 
565 WC3 5  PHE G  202  ? PHE A 201  . ? 1_555 ? 
566 WC3 5  GLY G  203  ? GLY A 202  . ? 1_555 ? 
567 WC3 5  GLY G  204  ? GLY A 203  . ? 1_555 ? 
568 WC3 5  HIS G  209  ? HIS A 208  . ? 1_555 ? 
569 WC4 2  LYS G  176  ? LYS A 175  . ? 1_555 ? 
570 WC4 2  LYS G  179  ? LYS A 178  . ? 1_555 ? 
571 WC5 1  GLY H  338  ? GLY B 337  . ? 1_555 ? 
572 WC6 2  A   A  2757 ? A   0 2757 . ? 1_555 ? 
573 WC6 2  ASN H  336  ? ASN B 335  . ? 1_555 ? 
574 WC7 3  ARG H  224  ? ARG B 223  . ? 1_555 ? 
575 WC7 3  LYS H  225  ? LYS B 224  . ? 1_555 ? 
576 WC7 3  HIS H  228  ? HIS B 227  . ? 1_555 ? 
577 WC8 3  ASP I  45   ? ASP C 45   . ? 1_555 ? 
578 WC8 3  THR I  94   ? THR C 94   . ? 1_555 ? 
579 WC8 3  LYS I  96   ? LYS C 96   . ? 1_555 ? 
580 WC9 1  ARG N  117  ? ARG H 117  . ? 1_555 ? 
581 XC1 4  ARG P  60   ? ARG J 60   . ? 1_555 ? 
582 XC1 4  VAL P  61   ? VAL J 61   . ? 1_555 ? 
583 XC1 4  ILE P  63   ? ILE J 63   . ? 1_555 ? 
584 XC1 4  TYR P  69   ? TYR J 69   . ? 1_555 ? 
585 XC2 2  ILE P  127  ? ILE J 127  . ? 1_555 ? 
586 XC2 2  LYS P  128  ? LYS J 128  . ? 1_555 ? 
587 XC3 2  PRO P  88   ? PRO J 88   . ? 1_555 ? 
588 XC3 2  LYS P  90   ? LYS J 90   . ? 1_555 ? 
589 XC4 4  GLY P  64   ? GLY J 64   . ? 1_555 ? 
590 XC4 4  ASN P  65   ? ASN J 65   . ? 1_555 ? 
591 XC4 4  GLY P  68   ? GLY J 68   . ? 1_555 ? 
592 XC4 4  TYR P  69   ? TYR J 69   . ? 1_555 ? 
593 XC5 1  ASN Q  42   ? ASN K 42   . ? 1_555 ? 
594 XC6 6  ARG R  28   ? ARG L 27   . ? 1_555 ? 
595 XC6 6  GLY R  29   ? GLY L 28   . ? 1_555 ? 
596 XC6 6  GLY R  30   ? GLY L 29   . ? 1_555 ? 
597 XC6 6  GLY R  32   ? GLY L 31   . ? 1_555 ? 
598 XC6 6  ALA R  34   ? ALA L 33   . ? 1_555 ? 
599 XC6 6  GLU R  40   ? GLU L 39   . ? 1_555 ? 
600 XC7 1  ARG R  54   ? ARG L 53   . ? 1_555 ? 
601 XC8 4  SER S  107  ? SER M 106  . ? 1_555 ? 
602 XC8 4  PHE S  110  ? PHE M 109  . ? 1_555 ? 
603 XC8 4  PRO S  111  ? PRO M 110  . ? 1_555 ? 
604 XC8 4  LEU S  113  ? LEU M 112  . ? 1_555 ? 
605 XC9 4  SER S  107  ? SER M 106  . ? 1_555 ? 
606 XC9 4  VAL S  115  ? VAL M 114  . ? 1_555 ? 
607 XC9 4  ARG S  159  ? ARG M 158  . ? 1_555 ? 
608 XC9 4  VAL S  160  ? VAL M 159  . ? 1_555 ? 
609 YC1 3  ARG T  38   ? ARG N 37   . ? 1_555 ? 
610 YC1 3  LYS T  39   ? LYS N 38   . ? 1_555 ? 
611 YC1 3  ASN T  108  ? ASN N 107  . ? 1_555 ? 
612 YC2 1  HIS U  41   ? HIS O 40   . ? 1_555 ? 
613 YC3 1  ASN U  45   ? ASN O 44   . ? 1_555 ? 
614 YC4 4  ASP W  21   ? ASP Q 20   . ? 1_555 ? 
615 YC4 4  GLY W  23   ? GLY Q 22   . ? 1_555 ? 
616 YC4 4  SER W  25   ? SER Q 24   . ? 1_555 ? 
617 YC4 4  SER W  47   ? SER Q 46   . ? 1_555 ? 
618 YC5 4  SER X  71   ? SER R 70   . ? 1_555 ? 
619 YC5 4  LYS X  72   ? LYS R 71   . ? 1_555 ? 
620 YC5 4  VAL X  73   ? VAL R 72   . ? 1_555 ? 
621 YC5 4  ASP X  74   ? ASP R 73   . ? 1_555 ? 
622 YC6 3  U   A  12   ? U   0 12   . ? 1_555 ? 
623 YC6 3  LYS X  61   ? LYS R 60   . ? 1_555 ? 
624 YC6 3  ASN X  64   ? ASN R 63   . ? 1_555 ? 
625 YC7 1  LYS X  119  ? LYS R 118  . ? 1_555 ? 
626 YC8 2  HIS Y  8    ? HIS S 7    . ? 1_555 ? 
627 YC8 2  GLU Y  62   ? GLU S 61   . ? 1_555 ? 
628 YC9 6  GLN Z  38   ? GLN T 37   . ? 1_555 ? 
629 YC9 6  ARG Z  112  ? ARG T 111  . ? 1_555 ? 
630 YC9 6  LEU Z  113  ? LEU T 112  . ? 1_555 ? 
631 YC9 6  GLU Z  114  ? GLU T 113  . ? 1_555 ? 
632 YC9 6  SER Z  115  ? SER T 114  . ? 1_555 ? 
633 YC9 6  ASP Z  118  ? ASP T 117  . ? 1_555 ? 
634 ZC1 4  CYS AA 6    ? CYS U 6    . ? 1_555 ? 
635 ZC1 4  CYS AA 9    ? CYS U 9    . ? 1_555 ? 
636 ZC1 4  CYS AA 32   ? CYS U 32   . ? 1_555 ? 
637 ZC1 4  CYS AA 36   ? CYS U 36   . ? 1_555 ? 
638 ZC2 4  HIS EA 134  ? HIS Y 133  . ? 1_555 ? 
639 ZC2 4  LYS EA 137  ? LYS Y 136  . ? 1_555 ? 
640 ZC2 4  LYS EA 138  ? LYS Y 137  . ? 1_555 ? 
641 ZC2 4  VAL EA 140  ? VAL Y 139  . ? 1_555 ? 
642 ZC3 2  G   A  1269 ? G   0 1269 . ? 1_555 ? 
643 ZC3 2  ARG EA 170  ? ARG Y 169  . ? 1_555 ? 
644 ZC4 4  CYS FA 30   ? CYS Z 39   . ? 1_555 ? 
645 ZC4 4  CYS FA 33   ? CYS Z 42   . ? 1_555 ? 
646 ZC4 4  CYS FA 48   ? CYS Z 57   . ? 1_555 ? 
647 ZC4 4  CYS FA 51   ? CYS Z 60   . ? 1_555 ? 
648 ZC5 11 U   A  1838 ? U   0 1838 . ? 1_555 ? 
649 ZC5 11 G   A  2099 ? G   0 2099 . ? 1_555 ? 
650 ZC5 11 A   A  2103 ? A   0 2103 . ? 1_555 ? 
651 ZC5 11 G   A  2540 ? G   0 2540 . ? 1_555 ? 
652 ZC5 11 U   A  2620 ? U   0 2620 . ? 1_555 ? 
653 ZC5 11 PSU A  2621 ? PSU 0 2621 . ? 1_555 ? 
654 ZC5 11 C   A  2644 ? C   0 2644 . ? 1_555 ? 
655 ZC5 11 U   A  2645 ? U   0 2645 . ? 1_555 ? 
656 ZC5 11 G   A  2646 ? G   0 2646 . ? 1_555 ? 
657 ZC5 11 MG  KE .    ? MG  0 8118 . ? 1_555 ? 
658 ZC5 11 VIR RH .    ? VIR 0 9000 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1YIT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1YIT 
_atom_sites.fract_transf_matrix[1][1]   0.004704 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003336 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001743 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  10   ? 16.508  147.850 103.819 1.00 92.43  ? 10   U   0 "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  10   ? 16.905  149.225 103.778 1.00 92.37  ? 10   U   0 "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  10   ? 18.364  149.483 104.109 1.00 91.76  ? 10   U   0 "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  10   ? 18.641  149.129 105.493 1.00 93.31  ? 10   U   0 "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  10   ? 19.412  148.701 103.328 1.00 89.44  ? 10   U   0 "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  10   ? 19.600  149.230 102.013 1.00 83.65  ? 10   U   0 "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  10   ? 20.635  148.835 104.231 1.00 90.55  ? 10   U   0 "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  10   ? 21.247  150.105 104.145 1.00 91.87  ? 10   U   0 "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  10   ? 19.996  148.712 105.616 1.00 92.47  ? 10   U   0 "C1'" 1 
ATOM   10    N  N1    . U   A  1  10   ? 20.032  147.359 106.204 1.00 94.01  ? 10   U   0 N1    1 
ATOM   11    C  C2    . U   A  1  10   ? 19.869  147.249 107.586 1.00 95.20  ? 10   U   0 C2    1 
ATOM   12    O  O2    . U   A  1  10   ? 19.683  148.210 108.321 1.00 97.52  ? 10   U   0 O2    1 
ATOM   13    N  N3    . U   A  1  10   ? 19.932  145.970 108.076 1.00 94.31  ? 10   U   0 N3    1 
ATOM   14    C  C4    . U   A  1  10   ? 20.133  144.814 107.357 1.00 94.11  ? 10   U   0 C4    1 
ATOM   15    O  O4    . U   A  1  10   ? 20.254  143.753 107.961 1.00 94.43  ? 10   U   0 O4    1 
ATOM   16    C  C5    . U   A  1  10   ? 20.278  145.000 105.944 1.00 93.13  ? 10   U   0 C5    1 
ATOM   17    C  C6    . U   A  1  10   ? 20.226  146.230 105.429 1.00 93.03  ? 10   U   0 C6    1 
ATOM   18    P  P     . A   A  1  11   ? 20.819  148.709 101.099 1.00 76.84  ? 11   A   0 P     1 
ATOM   19    O  OP1   . A   A  1  11   ? 20.450  148.958 99.682  1.00 77.93  ? 11   A   0 OP1   1 
ATOM   20    O  OP2   . A   A  1  11   ? 21.201  147.341 101.524 1.00 75.39  ? 11   A   0 OP2   1 
ATOM   21    O  "O5'" . A   A  1  11   ? 21.981  149.724 101.484 1.00 72.99  ? 11   A   0 "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  11   ? 23.333  149.493 101.087 1.00 65.96  ? 11   A   0 "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  11   ? 24.270  150.271 101.975 1.00 61.02  ? 11   A   0 "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  11   ? 23.980  149.997 103.369 1.00 60.11  ? 11   A   0 "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  11   ? 25.730  149.919 101.784 1.00 58.40  ? 11   A   0 "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  11   ? 26.281  150.712 100.749 1.00 53.95  ? 11   A   0 "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  11   ? 26.318  150.170 103.165 1.00 58.60  ? 11   A   0 "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  11   ? 26.543  151.537 103.433 1.00 59.17  ? 11   A   0 "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  11   ? 25.174  149.683 104.055 1.00 58.16  ? 11   A   0 "C1'" 1 
ATOM   30    N  N9    . A   A  1  11   ? 25.168  148.241 104.319 1.00 57.63  ? 11   A   0 N9    1 
ATOM   31    C  C8    . A   A  1  11   ? 24.087  147.386 104.291 1.00 57.65  ? 11   A   0 C8    1 
ATOM   32    N  N7    . A   A  1  11   ? 24.382  146.148 104.605 1.00 56.36  ? 11   A   0 N7    1 
ATOM   33    C  C5    . A   A  1  11   ? 25.748  146.185 104.848 1.00 56.71  ? 11   A   0 C5    1 
ATOM   34    C  C6    . A   A  1  11   ? 26.665  145.198 105.234 1.00 55.03  ? 11   A   0 C6    1 
ATOM   35    N  N6    . A   A  1  11   ? 26.338  143.928 105.452 1.00 56.20  ? 11   A   0 N6    1 
ATOM   36    N  N1    . A   A  1  11   ? 27.950  145.565 105.394 1.00 55.76  ? 11   A   0 N1    1 
ATOM   37    C  C2    . A   A  1  11   ? 28.285  146.840 105.180 1.00 57.35  ? 11   A   0 C2    1 
ATOM   38    N  N3    . A   A  1  11   ? 27.518  147.863 104.818 1.00 57.78  ? 11   A   0 N3    1 
ATOM   39    C  C4    . A   A  1  11   ? 26.245  147.465 104.668 1.00 57.33  ? 11   A   0 C4    1 
ATOM   40    P  P     . U   A  1  12   ? 26.424  150.097 99.276  1.00 52.37  ? 12   U   0 P     1 
ATOM   41    O  OP1   . U   A  1  12   ? 26.791  151.213 98.374  1.00 54.50  ? 12   U   0 OP1   1 
ATOM   42    O  OP2   . U   A  1  12   ? 25.220  149.294 98.983  1.00 53.85  ? 12   U   0 OP2   1 
ATOM   43    O  "O5'" . U   A  1  12   ? 27.662  149.096 99.391  1.00 53.68  ? 12   U   0 "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  12   ? 28.988  149.588 99.682  1.00 51.58  ? 12   U   0 "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  12   ? 29.852  148.493 100.269 1.00 49.32  ? 12   U   0 "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  12   ? 29.310  148.065 101.547 1.00 48.70  ? 12   U   0 "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  12   ? 29.936  147.201 99.479  1.00 49.29  ? 12   U   0 "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  12   ? 30.825  147.268 98.378  1.00 48.39  ? 12   U   0 "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  12   ? 30.414  146.223 100.540 1.00 50.15  ? 12   U   0 "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  12   ? 31.799  146.324 100.821 1.00 52.28  ? 12   U   0 "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  12   ? 29.594  146.684 101.746 1.00 49.27  ? 12   U   0 "C1'" 1 
ATOM   52    N  N1    . U   A  1  12   ? 28.329  145.934 101.827 1.00 48.93  ? 12   U   0 N1    1 
ATOM   53    C  C2    . U   A  1  12   ? 28.387  144.619 102.276 1.00 50.23  ? 12   U   0 C2    1 
ATOM   54    O  O2    . U   A  1  12   ? 29.422  144.081 102.642 1.00 52.24  ? 12   U   0 O2    1 
ATOM   55    N  N3    . U   A  1  12   ? 27.190  143.953 102.276 1.00 49.48  ? 12   U   0 N3    1 
ATOM   56    C  C4    . U   A  1  12   ? 25.968  144.444 101.887 1.00 49.69  ? 12   U   0 C4    1 
ATOM   57    O  O4    . U   A  1  12   ? 25.003  143.680 101.837 1.00 49.98  ? 12   U   0 O4    1 
ATOM   58    C  C5    . U   A  1  12   ? 25.981  145.812 101.465 1.00 49.52  ? 12   U   0 C5    1 
ATOM   59    C  C6    . U   A  1  12   ? 27.131  146.493 101.452 1.00 48.47  ? 12   U   0 C6    1 
ATOM   60    P  P     . G   A  1  13   ? 30.323  146.794 96.928  1.00 48.89  ? 13   G   0 P     1 
ATOM   61    O  OP1   . G   A  1  13   ? 31.541  146.542 96.117  1.00 50.25  ? 13   G   0 OP1   1 
ATOM   62    O  OP2   . G   A  1  13   ? 29.317  147.784 96.464  1.00 51.39  ? 13   G   0 OP2   1 
ATOM   63    O  "O5'" . G   A  1  13   ? 29.595  145.396 97.176  1.00 45.80  ? 13   G   0 "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  13   ? 30.332  144.308 97.735  1.00 45.27  ? 13   G   0 "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  13   ? 29.433  143.143 98.096  1.00 43.88  ? 13   G   0 "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  13   ? 28.303  143.571 98.890  1.00 42.28  ? 13   G   0 "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  13   ? 28.718  142.372 97.003  1.00 41.42  ? 13   G   0 "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  13   ? 29.594  141.529 96.266  1.00 41.04  ? 13   G   0 "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  13   ? 27.777  141.514 97.843  1.00 41.41  ? 13   G   0 "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  13   ? 28.436  140.417 98.439  1.00 38.20  ? 13   G   0 "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  13   ? 27.387  142.492 98.955  1.00 41.66  ? 13   G   0 "C1'" 1 
ATOM   72    N  N9    . G   A  1  13   ? 26.025  142.990 98.805  1.00 40.76  ? 13   G   0 N9    1 
ATOM   73    C  C8    . G   A  1  13   ? 25.619  144.265 98.499  1.00 42.33  ? 13   G   0 C8    1 
ATOM   74    N  N7    . G   A  1  13   ? 24.319  144.384 98.432  1.00 44.23  ? 13   G   0 N7    1 
ATOM   75    C  C5    . G   A  1  13   ? 23.842  143.108 98.711  1.00 42.77  ? 13   G   0 C5    1 
ATOM   76    C  C6    . G   A  1  13   ? 22.513  142.615 98.782  1.00 41.46  ? 13   G   0 C6    1 
ATOM   77    O  O6    . G   A  1  13   ? 21.454  143.222 98.603  1.00 41.89  ? 13   G   0 O6    1 
ATOM   78    N  N1    . G   A  1  13   ? 22.488  141.263 99.095  1.00 39.69  ? 13   G   0 N1    1 
ATOM   79    C  C2    . G   A  1  13   ? 23.593  140.483 99.301  1.00 39.55  ? 13   G   0 C2    1 
ATOM   80    N  N2    . G   A  1  13   ? 23.359  139.199 99.569  1.00 39.46  ? 13   G   0 N2    1 
ATOM   81    N  N3    . G   A  1  13   ? 24.833  140.926 99.243  1.00 39.73  ? 13   G   0 N3    1 
ATOM   82    C  C4    . G   A  1  13   ? 24.883  142.239 98.944  1.00 41.15  ? 13   G   0 C4    1 
ATOM   83    P  P     . C   A  1  14   ? 29.081  140.850 94.906  1.00 39.91  ? 14   C   0 P     1 
ATOM   84    O  OP1   . C   A  1  14   ? 30.244  140.263 94.195  1.00 37.58  ? 14   C   0 OP1   1 
ATOM   85    O  OP2   . C   A  1  14   ? 28.215  141.837 94.208  1.00 40.95  ? 14   C   0 OP2   1 
ATOM   86    O  "O5'" . C   A  1  14   ? 28.164  139.658 95.415  1.00 39.46  ? 14   C   0 "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  14   ? 28.746  138.475 95.980  1.00 39.62  ? 14   C   0 "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  14   ? 27.720  137.379 96.045  1.00 39.82  ? 14   C   0 "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  14   ? 26.668  137.769 96.964  1.00 40.35  ? 14   C   0 "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  14   ? 26.997  137.102 94.740  1.00 40.69  ? 14   C   0 "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  14   ? 27.755  136.231 93.912  1.00 44.09  ? 14   C   0 "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  14   ? 25.704  136.471 95.228  1.00 41.00  ? 14   C   0 "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  14   ? 25.887  135.128 95.613  1.00 42.10  ? 14   C   0 "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  14   ? 25.420  137.302 96.482  1.00 40.46  ? 14   C   0 "C1'" 1 
ATOM   95    N  N1    . C   A  1  14   ? 24.544  138.466 96.243  1.00 38.51  ? 14   C   0 N1    1 
ATOM   96    C  C2    . C   A  1  14   ? 23.153  138.296 96.299  1.00 38.63  ? 14   C   0 C2    1 
ATOM   97    O  O2    . C   A  1  14   ? 22.688  137.165 96.522  1.00 38.90  ? 14   C   0 O2    1 
ATOM   98    N  N3    . C   A  1  14   ? 22.351  139.368 96.105  1.00 38.46  ? 14   C   0 N3    1 
ATOM   99    C  C4    . C   A  1  14   ? 22.885  140.567 95.862  1.00 36.59  ? 14   C   0 C4    1 
ATOM   100   N  N4    . C   A  1  14   ? 22.061  141.598 95.699  1.00 34.96  ? 14   C   0 N4    1 
ATOM   101   C  C5    . C   A  1  14   ? 24.289  140.761 95.782  1.00 37.87  ? 14   C   0 C5    1 
ATOM   102   C  C6    . C   A  1  14   ? 25.074  139.697 95.977  1.00 37.92  ? 14   C   0 C6    1 
ATOM   103   P  P     . C   A  1  15   ? 27.561  136.266 92.313  1.00 47.91  ? 15   C   0 P     1 
ATOM   104   O  OP1   . C   A  1  15   ? 28.574  135.332 91.750  1.00 46.63  ? 15   C   0 OP1   1 
ATOM   105   O  OP2   . C   A  1  15   ? 27.515  137.675 91.842  1.00 45.10  ? 15   C   0 OP2   1 
ATOM   106   O  "O5'" . C   A  1  15   ? 26.117  135.636 92.088  1.00 48.04  ? 15   C   0 "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  15   ? 25.854  134.266 92.414  1.00 49.37  ? 15   C   0 "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  15   ? 24.401  133.950 92.179  1.00 51.81  ? 15   C   0 "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  15   ? 23.588  134.686 93.128  1.00 53.26  ? 15   C   0 "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  15   ? 23.831  134.382 90.838  1.00 53.33  ? 15   C   0 "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  15   ? 24.164  133.503 89.774  1.00 54.92  ? 15   C   0 "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  15   ? 22.340  134.394 91.128  1.00 53.87  ? 15   C   0 "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  15   ? 21.786  133.096 91.173  1.00 55.48  ? 15   C   0 "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  15   ? 22.328  134.981 92.537  1.00 53.61  ? 15   C   0 "C1'" 1 
ATOM   115   N  N1    . C   A  1  15   ? 22.113  136.440 92.536  1.00 53.41  ? 15   C   0 N1    1 
ATOM   116   C  C2    . C   A  1  15   ? 20.798  136.916 92.513  1.00 53.38  ? 15   C   0 C2    1 
ATOM   117   O  O2    . C   A  1  15   ? 19.868  136.100 92.469  1.00 55.01  ? 15   C   0 O2    1 
ATOM   118   N  N3    . C   A  1  15   ? 20.573  138.247 92.536  1.00 52.11  ? 15   C   0 N3    1 
ATOM   119   C  C4    . C   A  1  15   ? 21.597  139.093 92.578  1.00 52.41  ? 15   C   0 C4    1 
ATOM   120   N  N4    . C   A  1  15   ? 21.323  140.394 92.620  1.00 53.35  ? 15   C   0 N4    1 
ATOM   121   C  C5    . C   A  1  15   ? 22.949  138.641 92.584  1.00 53.31  ? 15   C   0 C5    1 
ATOM   122   C  C6    . C   A  1  15   ? 23.160  137.318 92.561  1.00 52.83  ? 15   C   0 C6    1 
ATOM   123   P  P     . A   A  1  16   ? 24.309  134.089 88.283  1.00 56.26  ? 16   A   0 P     1 
ATOM   124   O  OP1   . A   A  1  16   ? 24.871  132.988 87.461  1.00 54.99  ? 16   A   0 OP1   1 
ATOM   125   O  OP2   . A   A  1  16   ? 25.024  135.393 88.346  1.00 56.03  ? 16   A   0 OP2   1 
ATOM   126   O  "O5'" . A   A  1  16   ? 22.804  134.383 87.831  1.00 55.28  ? 16   A   0 "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  16   ? 21.921  133.306 87.453  1.00 54.41  ? 16   A   0 "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  16   ? 20.514  133.815 87.248  1.00 53.79  ? 16   A   0 "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  16   ? 20.065  134.468 88.464  1.00 51.87  ? 16   A   0 "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  16   ? 20.308  134.877 86.177  1.00 55.01  ? 16   A   0 "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  16   ? 20.222  134.342 84.857  1.00 57.44  ? 16   A   0 "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  16   ? 18.992  135.501 86.616  1.00 53.43  ? 16   A   0 "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  16   ? 17.872  134.719 86.267  1.00 55.54  ? 16   A   0 "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  16   ? 19.166  135.517 88.135  1.00 51.53  ? 16   A   0 "C1'" 1 
ATOM   135   N  N9    . A   A  1  16   ? 19.751  136.787 88.560  1.00 50.16  ? 16   A   0 N9    1 
ATOM   136   C  C8    . A   A  1  16   ? 21.076  137.105 88.762  1.00 49.20  ? 16   A   0 C8    1 
ATOM   137   N  N7    . A   A  1  16   ? 21.274  138.360 89.089  1.00 47.94  ? 16   A   0 N7    1 
ATOM   138   C  C5    . A   A  1  16   ? 19.995  138.903 89.117  1.00 46.43  ? 16   A   0 C5    1 
ATOM   139   C  C6    . A   A  1  16   ? 19.521  140.197 89.397  1.00 44.39  ? 16   A   0 C6    1 
ATOM   140   N  N6    . A   A  1  16   ? 20.307  141.230 89.693  1.00 43.49  ? 16   A   0 N6    1 
ATOM   141   N  N1    . A   A  1  16   ? 18.190  140.397 89.353  1.00 43.30  ? 16   A   0 N1    1 
ATOM   142   C  C2    . A   A  1  16   ? 17.397  139.367 89.033  1.00 44.81  ? 16   A   0 C2    1 
ATOM   143   N  N3    . A   A  1  16   ? 17.720  138.112 88.740  1.00 44.28  ? 16   A   0 N3    1 
ATOM   144   C  C4    . A   A  1  16   ? 19.049  137.943 88.804  1.00 47.67  ? 16   A   0 C4    1 
ATOM   145   P  P     . G   A  1  17   ? 20.578  135.274 83.587  1.00 60.61  ? 17   G   0 P     1 
ATOM   146   O  OP1   . G   A  1  17   ? 20.454  134.394 82.391  1.00 60.64  ? 17   G   0 OP1   1 
ATOM   147   O  OP2   . G   A  1  17   ? 21.865  135.969 83.849  1.00 60.69  ? 17   G   0 OP2   1 
ATOM   148   O  "O5'" . G   A  1  17   ? 19.430  136.390 83.550  1.00 56.71  ? 17   G   0 "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  17   ? 18.073  136.046 83.206  1.00 53.65  ? 17   G   0 "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  17   ? 17.136  137.213 83.452  1.00 52.24  ? 17   G   0 "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  17   ? 17.369  137.758 84.776  1.00 53.19  ? 17   G   0 "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  17   ? 17.276  138.442 82.570  1.00 51.76  ? 17   G   0 "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  17   ? 16.639  138.246 81.310  1.00 50.86  ? 17   G   0 "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  17   ? 16.530  139.493 83.387  1.00 52.32  ? 17   G   0 "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  17   ? 15.126  139.405 83.253  1.00 52.68  ? 17   G   0 "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  17   ? 16.908  139.100 84.818  1.00 51.23  ? 17   G   0 "C1'" 1 
ATOM   157   N  N9    . G   A  1  17   ? 17.948  139.952 85.395  1.00 49.73  ? 17   G   0 N9    1 
ATOM   158   C  C8    . G   A  1  17   ? 19.260  139.625 85.648  1.00 49.51  ? 17   G   0 C8    1 
ATOM   159   N  N7    . G   A  1  17   ? 19.948  140.618 86.144  1.00 49.16  ? 17   G   0 N7    1 
ATOM   160   C  C5    . G   A  1  17   ? 19.036  141.662 86.227  1.00 48.36  ? 17   G   0 C5    1 
ATOM   161   C  C6    . G   A  1  17   ? 19.202  142.997 86.683  1.00 48.68  ? 17   G   0 C6    1 
ATOM   162   O  O6    . G   A  1  17   ? 20.223  143.550 87.108  1.00 50.58  ? 17   G   0 O6    1 
ATOM   163   N  N1    . G   A  1  17   ? 18.016  143.713 86.604  1.00 47.87  ? 17   G   0 N1    1 
ATOM   164   C  C2    . G   A  1  17   ? 16.824  143.220 86.146  1.00 48.02  ? 17   G   0 C2    1 
ATOM   165   N  N2    . G   A  1  17   ? 15.791  144.076 86.153  1.00 46.78  ? 17   G   0 N2    1 
ATOM   166   N  N3    . G   A  1  17   ? 16.655  141.982 85.714  1.00 49.19  ? 17   G   0 N3    1 
ATOM   167   C  C4    . G   A  1  17   ? 17.796  141.264 85.780  1.00 48.72  ? 17   G   0 C4    1 
ATOM   168   P  P     . C   A  1  18   ? 17.025  139.179 80.060  1.00 48.68  ? 18   C   0 P     1 
ATOM   169   O  OP1   . C   A  1  18   ? 16.277  138.672 78.880  1.00 51.02  ? 18   C   0 OP1   1 
ATOM   170   O  OP2   . C   A  1  18   ? 18.497  139.292 79.995  1.00 49.23  ? 18   C   0 OP2   1 
ATOM   171   O  "O5'" . C   A  1  18   ? 16.452  140.608 80.454  1.00 45.86  ? 18   C   0 "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  18   ? 15.044  140.875 80.447  1.00 42.20  ? 18   C   0 "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  18   ? 14.792  142.316 80.827  1.00 42.14  ? 18   C   0 "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  18   ? 15.224  142.527 82.197  1.00 40.98  ? 18   C   0 "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  18   ? 15.572  143.350 80.026  1.00 41.69  ? 18   C   0 "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  18   ? 14.937  143.664 78.791  1.00 41.20  ? 18   C   0 "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  18   ? 15.616  144.534 80.979  1.00 41.80  ? 18   C   0 "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  18   ? 14.414  145.276 80.989  1.00 44.37  ? 18   C   0 "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  18   ? 15.779  143.824 82.326  1.00 40.76  ? 18   C   0 "C1'" 1 
ATOM   180   N  N1    . C   A  1  18   ? 17.185  143.695 82.748  1.00 39.30  ? 18   C   0 N1    1 
ATOM   181   C  C2    . C   A  1  18   ? 17.795  144.780 83.380  1.00 40.57  ? 18   C   0 C2    1 
ATOM   182   O  O2    . C   A  1  18   ? 17.136  145.816 83.562  1.00 41.23  ? 18   C   0 O2    1 
ATOM   183   N  N3    . C   A  1  18   ? 19.088  144.676 83.776  1.00 40.34  ? 18   C   0 N3    1 
ATOM   184   C  C4    . C   A  1  18   ? 19.761  143.545 83.560  1.00 38.54  ? 18   C   0 C4    1 
ATOM   185   N  N4    . C   A  1  18   ? 21.022  143.485 83.969  1.00 36.63  ? 18   C   0 N4    1 
ATOM   186   C  C5    . C   A  1  18   ? 19.164  142.425 82.917  1.00 38.64  ? 18   C   0 C5    1 
ATOM   187   C  C6    . C   A  1  18   ? 17.887  142.541 82.532  1.00 38.79  ? 18   C   0 C6    1 
ATOM   188   P  P     . U   A  1  19   ? 15.828  144.050 77.510  1.00 41.25  ? 19   U   0 P     1 
ATOM   189   O  OP1   . U   A  1  19   ? 14.944  144.098 76.330  1.00 42.39  ? 19   U   0 OP1   1 
ATOM   190   O  OP2   . U   A  1  19   ? 17.028  143.173 77.482  1.00 42.34  ? 19   U   0 OP2   1 
ATOM   191   O  "O5'" . U   A  1  19   ? 16.290  145.539 77.822  1.00 41.00  ? 19   U   0 "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  19   ? 15.351  146.624 77.793  1.00 38.06  ? 19   U   0 "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  19   ? 16.033  147.914 78.177  1.00 37.52  ? 19   U   0 "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  19   ? 16.434  147.863 79.570  1.00 37.69  ? 19   U   0 "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  19   ? 17.331  148.218 77.452  1.00 37.47  ? 19   U   0 "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  19   ? 17.130  148.757 76.162  1.00 38.09  ? 19   U   0 "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  19   ? 17.980  149.216 78.392  1.00 39.08  ? 19   U   0 "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  19   ? 17.397  150.503 78.311  1.00 39.80  ? 19   U   0 "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  19   ? 17.647  148.584 79.742  1.00 40.32  ? 19   U   0 "C1'" 1 
ATOM   200   N  N1    . U   A  1  19   ? 18.701  147.642 80.155  1.00 43.55  ? 19   U   0 N1    1 
ATOM   201   C  C2    . U   A  1  19   ? 19.831  148.159 80.779  1.00 44.60  ? 19   U   0 C2    1 
ATOM   202   O  O2    . U   A  1  19   ? 19.981  149.349 81.020  1.00 44.29  ? 19   U   0 O2    1 
ATOM   203   N  N3    . U   A  1  19   ? 20.781  147.227 81.112  1.00 45.28  ? 19   U   0 N3    1 
ATOM   204   C  C4    . U   A  1  19   ? 20.725  145.869 80.900  1.00 44.68  ? 19   U   0 C4    1 
ATOM   205   O  O4    . U   A  1  19   ? 21.671  145.166 81.247  1.00 44.05  ? 19   U   0 O4    1 
ATOM   206   C  C5    . U   A  1  19   ? 19.530  145.413 80.265  1.00 44.77  ? 19   U   0 C5    1 
ATOM   207   C  C6    . U   A  1  19   ? 18.584  146.289 79.924  1.00 43.62  ? 19   U   0 C6    1 
ATOM   208   P  P     . G   A  1  20   ? 18.188  148.439 75.003  1.00 37.72  ? 20   G   0 P     1 
ATOM   209   O  OP1   . G   A  1  20   ? 17.663  149.054 73.767  1.00 36.46  ? 20   G   0 OP1   1 
ATOM   210   O  OP2   . G   A  1  20   ? 18.473  146.986 75.028  1.00 39.49  ? 20   G   0 OP2   1 
ATOM   211   O  "O5'" . G   A  1  20   ? 19.505  149.213 75.459  1.00 37.03  ? 20   G   0 "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  20   ? 19.544  150.648 75.470  1.00 37.78  ? 20   G   0 "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  20   ? 20.809  151.145 76.133  1.00 38.83  ? 20   G   0 "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  20   ? 20.863  150.668 77.502  1.00 39.67  ? 20   G   0 "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  20   ? 22.127  150.677 75.548  1.00 38.83  ? 20   G   0 "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  20   ? 22.510  151.423 74.410  1.00 39.68  ? 20   G   0 "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  20   ? 23.080  150.920 76.706  1.00 40.04  ? 20   G   0 "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  20   ? 23.479  152.270 76.840  1.00 39.11  ? 20   G   0 "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  20   ? 22.212  150.501 77.893  1.00 39.72  ? 20   G   0 "C1'" 1 
ATOM   220   N  N9    . G   A  1  20   ? 22.446  149.099 78.236  1.00 42.07  ? 20   G   0 N9    1 
ATOM   221   C  C8    . G   A  1  20   ? 21.678  147.999 77.924  1.00 42.96  ? 20   G   0 C8    1 
ATOM   222   N  N7    . G   A  1  20   ? 22.210  146.873 78.323  1.00 43.09  ? 20   G   0 N7    1 
ATOM   223   C  C5    . G   A  1  20   ? 23.390  147.255 78.949  1.00 44.42  ? 20   G   0 C5    1 
ATOM   224   C  C6    . G   A  1  20   ? 24.400  146.478 79.574  1.00 44.87  ? 20   G   0 C6    1 
ATOM   225   O  O6    . G   A  1  20   ? 24.469  145.248 79.683  1.00 46.56  ? 20   G   0 O6    1 
ATOM   226   N  N1    . G   A  1  20   ? 25.414  147.281 80.094  1.00 43.88  ? 20   G   0 N1    1 
ATOM   227   C  C2    . G   A  1  20   ? 25.463  148.653 80.005  1.00 42.47  ? 20   G   0 C2    1 
ATOM   228   N  N2    . G   A  1  20   ? 26.516  149.255 80.554  1.00 42.87  ? 20   G   0 N2    1 
ATOM   229   N  N3    . G   A  1  20   ? 24.544  149.382 79.416  1.00 42.47  ? 20   G   0 N3    1 
ATOM   230   C  C4    . G   A  1  20   ? 23.540  148.627 78.917  1.00 43.74  ? 20   G   0 C4    1 
ATOM   231   P  P     . G   A  1  21   ? 23.370  150.718 73.258  1.00 42.76  ? 21   G   0 P     1 
ATOM   232   O  OP1   . G   A  1  21   ? 23.629  151.767 72.246  1.00 43.05  ? 21   G   0 OP1   1 
ATOM   233   O  OP2   . G   A  1  21   ? 22.704  149.465 72.855  1.00 43.56  ? 21   G   0 OP2   1 
ATOM   234   O  "O5'" . G   A  1  21   ? 24.756  150.345 73.957  1.00 43.91  ? 21   G   0 "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  21   ? 25.745  151.363 74.161  1.00 41.79  ? 21   G   0 "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  21   ? 26.778  150.959 75.196  1.00 41.28  ? 21   G   0 "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  21   ? 26.248  150.057 76.202  1.00 39.78  ? 21   G   0 "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  21   ? 27.998  150.185 74.738  1.00 39.16  ? 21   G   0 "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  21   ? 28.901  151.032 74.027  1.00 39.08  ? 21   G   0 "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  21   ? 28.601  149.800 76.089  1.00 38.93  ? 21   G   0 "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  21   ? 29.270  150.886 76.702  1.00 36.35  ? 21   G   0 "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  21   ? 27.344  149.507 76.918  1.00 39.13  ? 21   G   0 "C1'" 1 
ATOM   243   N  N9    . G   A  1  21   ? 27.126  148.081 77.144  1.00 39.40  ? 21   G   0 N9    1 
ATOM   244   C  C8    . G   A  1  21   ? 26.061  147.316 76.732  1.00 40.58  ? 21   G   0 C8    1 
ATOM   245   N  N7    . G   A  1  21   ? 26.171  146.059 77.070  1.00 40.09  ? 21   G   0 N7    1 
ATOM   246   C  C5    . G   A  1  21   ? 27.376  145.990 77.753  1.00 39.48  ? 21   G   0 C5    1 
ATOM   247   C  C6    . G   A  1  21   ? 28.032  144.885 78.353  1.00 40.08  ? 21   G   0 C6    1 
ATOM   248   O  O6    . G   A  1  21   ? 27.664  143.708 78.413  1.00 41.07  ? 21   G   0 O6    1 
ATOM   249   N  N1    . G   A  1  21   ? 29.237  145.259 78.928  1.00 39.72  ? 21   G   0 N1    1 
ATOM   250   C  C2    . G   A  1  21   ? 29.747  146.526 78.931  1.00 38.49  ? 21   G   0 C2    1 
ATOM   251   N  N2    . G   A  1  21   ? 30.930  146.669 79.527  1.00 40.10  ? 21   G   0 N2    1 
ATOM   252   N  N3    . G   A  1  21   ? 29.147  147.569 78.386  1.00 37.26  ? 21   G   0 N3    1 
ATOM   253   C  C4    . G   A  1  21   ? 27.975  147.230 77.815  1.00 38.80  ? 21   G   0 C4    1 
ATOM   254   P  P     . U   A  1  22   ? 29.796  150.430 72.839  1.00 37.12  ? 22   U   0 P     1 
ATOM   255   O  OP1   . U   A  1  22   ? 30.542  151.543 72.206  1.00 37.82  ? 22   U   0 OP1   1 
ATOM   256   O  OP2   . U   A  1  22   ? 28.935  149.558 72.011  1.00 39.81  ? 22   U   0 OP2   1 
ATOM   257   O  "O5'" . U   A  1  22   ? 30.843  149.500 73.583  1.00 38.10  ? 22   U   0 "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  22   ? 31.831  150.061 74.456  1.00 38.52  ? 22   U   0 "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  22   ? 32.564  148.963 75.177  1.00 37.59  ? 22   U   0 "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  22   ? 31.626  148.245 76.012  1.00 37.94  ? 22   U   0 "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  22   ? 33.186  147.887 74.299  1.00 36.25  ? 22   U   0 "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  22   ? 34.471  148.288 73.847  1.00 35.76  ? 22   U   0 "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  22   ? 33.292  146.719 75.266  1.00 37.82  ? 22   U   0 "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  22   ? 34.380  146.883 76.157  1.00 38.18  ? 22   U   0 "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  22   ? 31.999  146.880 76.070  1.00 39.18  ? 22   U   0 "C1'" 1 
ATOM   266   N  N1    . U   A  1  22   ? 30.851  146.055 75.653  1.00 39.60  ? 22   U   0 N1    1 
ATOM   267   C  C2    . U   A  1  22   ? 30.799  144.750 76.106  1.00 39.55  ? 22   U   0 C2    1 
ATOM   268   O  O2    . U   A  1  22   ? 31.697  144.233 76.737  1.00 39.39  ? 22   U   0 O2    1 
ATOM   269   N  N3    . U   A  1  22   ? 29.654  144.069 75.783  1.00 40.48  ? 22   U   0 N3    1 
ATOM   270   C  C4    . U   A  1  22   ? 28.586  144.538 75.058  1.00 39.74  ? 22   U   0 C4    1 
ATOM   271   O  O4    . U   A  1  22   ? 27.558  143.868 75.008  1.00 40.98  ? 22   U   0 O4    1 
ATOM   272   C  C5    . U   A  1  22   ? 28.738  145.871 74.570  1.00 39.17  ? 22   U   0 C5    1 
ATOM   273   C  C6    . U   A  1  22   ? 29.837  146.567 74.873  1.00 39.34  ? 22   U   0 C6    1 
ATOM   274   P  P     . G   A  1  23   ? 34.966  147.882 72.377  1.00 36.73  ? 23   G   0 P     1 
ATOM   275   O  OP1   . G   A  1  23   ? 36.363  148.348 72.237  1.00 37.67  ? 23   G   0 OP1   1 
ATOM   276   O  OP2   . G   A  1  23   ? 33.943  148.336 71.410  1.00 39.88  ? 23   G   0 OP2   1 
ATOM   277   O  "O5'" . G   A  1  23   ? 34.967  146.290 72.379  1.00 38.51  ? 23   G   0 "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  23   ? 35.882  145.536 73.199  1.00 36.51  ? 23   G   0 "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  23   ? 35.547  144.070 73.116  1.00 35.49  ? 23   G   0 "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  23   ? 34.249  143.843 73.723  1.00 38.98  ? 23   G   0 "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  23   ? 35.398  143.548 71.699  1.00 34.65  ? 23   G   0 "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  23   ? 36.659  143.183 71.165  1.00 31.89  ? 23   G   0 "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  23   ? 34.460  142.364 71.879  1.00 36.33  ? 23   G   0 "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  23   ? 35.137  141.234 72.383  1.00 35.58  ? 23   G   0 "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  23   ? 33.517  142.895 72.961  1.00 37.46  ? 23   G   0 "C1'" 1 
ATOM   286   N  N9    . G   A  1  23   ? 32.319  143.565 72.460  1.00 38.24  ? 23   G   0 N9    1 
ATOM   287   C  C8    . G   A  1  23   ? 32.235  144.840 71.960  1.00 37.21  ? 23   G   0 C8    1 
ATOM   288   N  N7    . G   A  1  23   ? 31.021  145.185 71.636  1.00 37.59  ? 23   G   0 N7    1 
ATOM   289   C  C5    . G   A  1  23   ? 30.258  144.065 71.927  1.00 37.73  ? 23   G   0 C5    1 
ATOM   290   C  C6    . G   A  1  23   ? 28.875  143.843 71.784  1.00 37.01  ? 23   G   0 C6    1 
ATOM   291   O  O6    . G   A  1  23   ? 28.017  144.617 71.361  1.00 40.71  ? 23   G   0 O6    1 
ATOM   292   N  N1    . G   A  1  23   ? 28.514  142.568 72.190  1.00 36.13  ? 23   G   0 N1    1 
ATOM   293   C  C2    . G   A  1  23   ? 29.374  141.625 72.673  1.00 37.85  ? 23   G   0 C2    1 
ATOM   294   N  N2    . G   A  1  23   ? 28.836  140.451 73.010  1.00 37.68  ? 23   G   0 N2    1 
ATOM   295   N  N3    . G   A  1  23   ? 30.673  141.817 72.815  1.00 40.53  ? 23   G   0 N3    1 
ATOM   296   C  C4    . G   A  1  23   ? 31.044  143.053 72.425  1.00 39.15  ? 23   G   0 C4    1 
ATOM   297   P  P     . G   A  1  24   ? 36.962  143.416 69.605  1.00 29.95  ? 24   G   0 P     1 
ATOM   298   O  OP1   . G   A  1  24   ? 38.426  143.338 69.412  1.00 29.80  ? 24   G   0 OP1   1 
ATOM   299   O  OP2   . G   A  1  24   ? 36.230  144.636 69.180  1.00 31.61  ? 24   G   0 OP2   1 
ATOM   300   O  "O5'" . G   A  1  24   ? 36.296  142.165 68.887  1.00 27.24  ? 24   G   0 "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  24   ? 36.418  140.845 69.438  1.00 27.79  ? 24   G   0 "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  24   ? 35.302  139.977 68.924  1.00 28.11  ? 24   G   0 "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  24   ? 34.046  140.633 69.250  1.00 30.07  ? 24   G   0 "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  24   ? 35.287  139.785 67.412  1.00 27.51  ? 24   G   0 "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  24   ? 34.686  138.536 67.124  1.00 27.58  ? 24   G   0 "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  24   ? 34.388  140.921 66.955  1.00 28.29  ? 24   G   0 "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  24   ? 33.792  140.712 65.702  1.00 29.56  ? 24   G   0 "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  24   ? 33.341  140.921 68.061  1.00 31.10  ? 24   G   0 "C1'" 1 
ATOM   309   N  N9    . G   A  1  24   ? 32.636  142.191 68.207  1.00 31.97  ? 24   G   0 N9    1 
ATOM   310   C  C8    . G   A  1  24   ? 33.147  143.450 68.011  1.00 32.78  ? 24   G   0 C8    1 
ATOM   311   N  N7    . G   A  1  24   ? 32.247  144.389 68.121  1.00 34.93  ? 24   G   0 N7    1 
ATOM   312   C  C5    . G   A  1  24   ? 31.075  143.711 68.425  1.00 32.24  ? 24   G   0 C5    1 
ATOM   313   C  C6    . G   A  1  24   ? 29.767  144.199 68.625  1.00 31.98  ? 24   G   0 C6    1 
ATOM   314   O  O6    . G   A  1  24   ? 29.361  145.361 68.552  1.00 34.05  ? 24   G   0 O6    1 
ATOM   315   N  N1    . G   A  1  24   ? 28.881  143.175 68.928  1.00 30.72  ? 24   G   0 N1    1 
ATOM   316   C  C2    . G   A  1  24   ? 29.212  141.850 69.019  1.00 31.53  ? 24   G   0 C2    1 
ATOM   317   N  N2    . G   A  1  24   ? 28.213  141.017 69.340  1.00 31.85  ? 24   G   0 N2    1 
ATOM   318   N  N3    . G   A  1  24   ? 30.429  141.378 68.812  1.00 30.38  ? 24   G   0 N3    1 
ATOM   319   C  C4    . G   A  1  24   ? 31.304  142.358 68.519  1.00 31.22  ? 24   G   0 C4    1 
ATOM   320   P  P     . A   A  1  25   ? 35.033  137.770 65.755  1.00 30.38  ? 25   A   0 P     1 
ATOM   321   O  OP1   . A   A  1  25   ? 36.490  137.528 65.670  1.00 31.02  ? 25   A   0 OP1   1 
ATOM   322   O  OP2   . A   A  1  25   ? 34.351  138.471 64.651  1.00 33.01  ? 25   A   0 OP2   1 
ATOM   323   O  "O5'" . A   A  1  25   ? 34.330  136.355 65.946  1.00 29.82  ? 25   A   0 "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  25   ? 34.804  135.424 66.935  1.00 27.91  ? 25   A   0 "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  25   ? 33.639  134.755 67.621  1.00 29.81  ? 25   A   0 "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  25   ? 32.891  135.730 68.394  1.00 31.51  ? 25   A   0 "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  25   ? 32.599  134.144 66.701  1.00 29.94  ? 25   A   0 "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  25   ? 33.001  132.863 66.245  1.00 29.96  ? 25   A   0 "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  25   ? 31.382  134.071 67.609  1.00 32.58  ? 25   A   0 "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  25   ? 31.440  132.993 68.519  1.00 34.32  ? 25   A   0 "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  25   ? 31.514  135.381 68.390  1.00 34.63  ? 25   A   0 "C1'" 1 
ATOM   332   N  N9    . A   A  1  25   ? 30.745  136.476 67.787  1.00 38.59  ? 25   A   0 N9    1 
ATOM   333   C  C8    . A   A  1  25   ? 31.214  137.616 67.171  1.00 39.14  ? 25   A   0 C8    1 
ATOM   334   N  N7    . A   A  1  25   ? 30.265  138.400 66.722  1.00 39.63  ? 25   A   0 N7    1 
ATOM   335   C  C5    . A   A  1  25   ? 29.091  137.738 67.064  1.00 38.98  ? 25   A   0 C5    1 
ATOM   336   C  C6    . A   A  1  25   ? 27.734  138.048 66.859  1.00 39.08  ? 25   A   0 C6    1 
ATOM   337   N  N6    . A   A  1  25   ? 27.307  139.157 66.249  1.00 38.40  ? 25   A   0 N6    1 
ATOM   338   N  N1    . A   A  1  25   ? 26.816  137.167 67.311  1.00 39.02  ? 25   A   0 N1    1 
ATOM   339   C  C2    . A   A  1  25   ? 27.239  136.063 67.932  1.00 37.86  ? 25   A   0 C2    1 
ATOM   340   N  N3    . A   A  1  25   ? 28.480  135.666 68.191  1.00 37.93  ? 25   A   0 N3    1 
ATOM   341   C  C4    . A   A  1  25   ? 29.371  136.555 67.723  1.00 38.15  ? 25   A   0 C4    1 
ATOM   342   P  P     . U   A  1  26   ? 32.576  132.370 64.777  1.00 30.97  ? 26   U   0 P     1 
ATOM   343   O  OP1   . U   A  1  26   ? 33.015  130.950 64.634  1.00 27.67  ? 26   U   0 OP1   1 
ATOM   344   O  OP2   . U   A  1  26   ? 33.030  133.390 63.787  1.00 26.69  ? 26   U   0 OP2   1 
ATOM   345   O  "O5'" . U   A  1  26   ? 30.987  132.393 64.825  1.00 29.27  ? 26   U   0 "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  26   ? 30.264  131.508 65.686  1.00 27.64  ? 26   U   0 "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  26   ? 28.801  131.846 65.654  1.00 29.25  ? 26   U   0 "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  26   ? 28.609  133.191 66.151  1.00 31.96  ? 26   U   0 "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  26   ? 28.189  131.880 64.270  1.00 30.22  ? 26   U   0 "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  26   ? 27.818  130.590 63.863  1.00 31.23  ? 26   U   0 "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  26   ? 26.986  132.779 64.466  1.00 31.52  ? 26   U   0 "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  26   ? 25.925  132.106 65.110  1.00 32.94  ? 26   U   0 "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  26   ? 27.561  133.819 65.425  1.00 32.88  ? 26   U   0 "C1'" 1 
ATOM   354   N  N1    . U   A  1  26   ? 28.093  135.028 64.771  1.00 33.35  ? 26   U   0 N1    1 
ATOM   355   C  C2    . U   A  1  26   ? 27.185  135.947 64.297  1.00 33.29  ? 26   U   0 C2    1 
ATOM   356   O  O2    . U   A  1  26   ? 25.988  135.754 64.297  1.00 33.82  ? 26   U   0 O2    1 
ATOM   357   N  N3    . U   A  1  26   ? 27.733  137.101 63.804  1.00 34.70  ? 26   U   0 N3    1 
ATOM   358   C  C4    . U   A  1  26   ? 29.067  137.413 63.712  1.00 33.69  ? 26   U   0 C4    1 
ATOM   359   O  O4    . U   A  1  26   ? 29.396  138.548 63.365  1.00 32.50  ? 26   U   0 O4    1 
ATOM   360   C  C5    . U   A  1  26   ? 29.948  136.384 64.163  1.00 33.24  ? 26   U   0 C5    1 
ATOM   361   C  C6    . U   A  1  26   ? 29.446  135.257 64.664  1.00 32.15  ? 26   U   0 C6    1 
ATOM   362   P  P     . U   A  1  27   ? 28.179  130.102 62.389  1.00 34.79  ? 27   U   0 P     1 
ATOM   363   O  OP1   . U   A  1  27   ? 28.135  128.621 62.427  1.00 33.29  ? 27   U   0 OP1   1 
ATOM   364   O  OP2   . U   A  1  27   ? 29.426  130.788 61.963  1.00 35.19  ? 27   U   0 OP2   1 
ATOM   365   O  "O5'" . U   A  1  27   ? 26.983  130.674 61.504  1.00 35.26  ? 27   U   0 "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  27   ? 25.613  130.323 61.788  1.00 32.35  ? 27   U   0 "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  27   ? 24.666  131.292 61.122  1.00 30.29  ? 27   U   0 "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  27   ? 24.715  132.583 61.780  1.00 30.10  ? 27   U   0 "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  27   ? 24.965  131.618 59.674  1.00 31.86  ? 27   U   0 "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  27   ? 24.532  130.593 58.794  1.00 34.84  ? 27   U   0 "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  27   ? 24.217  132.929 59.494  1.00 31.95  ? 27   U   0 "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  27   ? 22.823  132.741 59.401  1.00 33.20  ? 27   U   0 "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  27   ? 24.503  133.615 60.828  1.00 31.63  ? 27   U   0 "C1'" 1 
ATOM   374   N  N1    . U   A  1  27   ? 25.691  134.489 60.789  1.00 33.19  ? 27   U   0 N1    1 
ATOM   375   C  C2    . U   A  1  27   ? 25.511  135.833 60.454  1.00 34.80  ? 27   U   0 C2    1 
ATOM   376   O  O2    . U   A  1  27   ? 24.424  136.321 60.199  1.00 37.95  ? 27   U   0 O2    1 
ATOM   377   N  N3    . U   A  1  27   ? 26.659  136.584 60.429  1.00 32.41  ? 27   U   0 N3    1 
ATOM   378   C  C4    . U   A  1  27   ? 27.934  136.151 60.698  1.00 31.19  ? 27   U   0 C4    1 
ATOM   379   O  O4    . U   A  1  27   ? 28.867  136.941 60.613  1.00 28.82  ? 27   U   0 O4    1 
ATOM   380   C  C5    . U   A  1  27   ? 28.038  134.766 61.039  1.00 32.49  ? 27   U   0 C5    1 
ATOM   381   C  C6    . U   A  1  27   ? 26.945  134.002 61.071  1.00 32.00  ? 27   U   0 C6    1 
ATOM   382   P  P     . G   A  1  28   ? 25.368  130.300 57.456  1.00 38.90  ? 28   G   0 P     1 
ATOM   383   O  OP1   . G   A  1  28   ? 24.838  129.075 56.809  1.00 36.40  ? 28   G   0 OP1   1 
ATOM   384   O  OP2   . G   A  1  28   ? 26.808  130.376 57.795  1.00 40.85  ? 28   G   0 OP2   1 
ATOM   385   O  "O5'" . G   A  1  28   ? 25.021  131.554 56.543  1.00 39.89  ? 28   G   0 "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  28   ? 23.655  131.870 56.226  1.00 39.94  ? 28   G   0 "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  28   ? 23.550  133.268 55.662  1.00 40.02  ? 28   G   0 "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  28   ? 23.828  134.251 56.692  1.00 41.20  ? 28   G   0 "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  28   ? 24.531  133.633 54.566  1.00 39.04  ? 28   G   0 "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  28   ? 24.157  133.102 53.314  1.00 38.05  ? 28   G   0 "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  28   ? 24.462  135.148 54.594  1.00 39.60  ? 28   G   0 "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  28   ? 23.280  135.643 54.013  1.00 43.45  ? 28   G   0 "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  28   ? 24.398  135.405 56.098  1.00 41.03  ? 28   G   0 "C1'" 1 
ATOM   394   N  N9    . G   A  1  28   ? 25.738  135.597 56.637  1.00 42.16  ? 28   G   0 N9    1 
ATOM   395   C  C8    . G   A  1  28   ? 26.535  134.664 57.257  1.00 42.71  ? 28   G   0 C8    1 
ATOM   396   N  N7    . G   A  1  28   ? 27.709  135.130 57.581  1.00 43.56  ? 28   G   0 N7    1 
ATOM   397   C  C5    . G   A  1  28   ? 27.682  136.455 57.162  1.00 43.44  ? 28   G   0 C5    1 
ATOM   398   C  C6    . G   A  1  28   ? 28.673  137.469 57.242  1.00 41.95  ? 28   G   0 C6    1 
ATOM   399   O  O6    . G   A  1  28   ? 29.806  137.398 57.715  1.00 40.60  ? 28   G   0 O6    1 
ATOM   400   N  N1    . G   A  1  28   ? 28.226  138.666 56.697  1.00 42.46  ? 28   G   0 N1    1 
ATOM   401   C  C2    . G   A  1  28   ? 26.984  138.872 56.149  1.00 41.96  ? 28   G   0 C2    1 
ATOM   402   N  N2    . G   A  1  28   ? 26.739  140.104 55.690  1.00 40.70  ? 28   G   0 N2    1 
ATOM   403   N  N3    . G   A  1  28   ? 26.051  137.938 56.065  1.00 42.42  ? 28   G   0 N3    1 
ATOM   404   C  C4    . G   A  1  28   ? 26.467  136.761 56.588  1.00 43.32  ? 28   G   0 C4    1 
ATOM   405   P  P     . C   A  1  29   ? 25.291  132.578 52.315  1.00 37.55  ? 29   C   0 P     1 
ATOM   406   O  OP1   . C   A  1  29   ? 24.621  131.943 51.159  1.00 40.13  ? 29   C   0 OP1   1 
ATOM   407   O  OP2   . C   A  1  29   ? 26.287  131.816 53.095  1.00 38.40  ? 29   C   0 OP2   1 
ATOM   408   O  "O5'" . C   A  1  29   ? 25.979  133.912 51.809  1.00 36.61  ? 29   C   0 "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  29   ? 25.204  134.945 51.218  1.00 33.52  ? 29   C   0 "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  29   ? 26.056  136.159 50.988  1.00 34.41  ? 29   C   0 "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  29   ? 26.459  136.726 52.260  1.00 33.19  ? 29   C   0 "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  29   ? 27.369  135.923 50.260  1.00 34.28  ? 29   C   0 "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  29   ? 27.195  135.836 48.852  1.00 35.48  ? 29   C   0 "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  29   ? 28.160  137.161 50.647  1.00 35.29  ? 29   C   0 "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  29   ? 27.792  138.283 49.872  1.00 32.33  ? 29   C   0 "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  29   ? 27.725  137.351 52.106  1.00 35.42  ? 29   C   0 "C1'" 1 
ATOM   417   N  N1    . C   A  1  29   ? 28.685  136.755 53.056  1.00 38.15  ? 29   C   0 N1    1 
ATOM   418   C  C2    . C   A  1  29   ? 29.810  137.496 53.412  1.00 39.49  ? 29   C   0 C2    1 
ATOM   419   O  O2    . C   A  1  29   ? 29.935  138.643 52.967  1.00 43.02  ? 29   C   0 O2    1 
ATOM   420   N  N3    . C   A  1  29   ? 30.731  136.953 54.236  1.00 38.31  ? 29   C   0 N3    1 
ATOM   421   C  C4    . C   A  1  29   ? 30.554  135.727 54.713  1.00 38.58  ? 29   C   0 C4    1 
ATOM   422   N  N4    . C   A  1  29   ? 31.501  135.229 55.504  1.00 40.30  ? 29   C   0 N4    1 
ATOM   423   C  C5    . C   A  1  29   ? 29.400  134.954 54.397  1.00 39.21  ? 29   C   0 C5    1 
ATOM   424   C  C6    . C   A  1  29   ? 28.499  135.501 53.571  1.00 39.43  ? 29   C   0 C6    1 
ATOM   425   P  P     . U   A  1  30   ? 28.147  134.872 47.989  1.00 39.56  ? 30   U   0 P     1 
ATOM   426   O  OP1   . U   A  1  30   ? 27.589  134.775 46.615  1.00 38.07  ? 30   U   0 OP1   1 
ATOM   427   O  OP2   . U   A  1  30   ? 28.381  133.638 48.775  1.00 39.20  ? 30   U   0 OP2   1 
ATOM   428   O  "O5'" . U   A  1  30   ? 29.534  135.655 47.899  1.00 39.47  ? 30   U   0 "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  30   ? 29.579  137.033 47.511  1.00 36.67  ? 30   U   0 "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  30   ? 31.005  137.533 47.511  1.00 37.21  ? 30   U   0 "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  30   ? 31.542  137.459 48.859  1.00 37.28  ? 30   U   0 "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  30   ? 32.003  136.806 46.615  1.00 36.20  ? 30   U   0 "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  30   ? 32.936  137.739 46.090  1.00 37.69  ? 30   U   0 "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  30   ? 32.751  135.918 47.597  1.00 35.99  ? 30   U   0 "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  30   ? 34.064  135.628 47.155  1.00 36.26  ? 30   U   0 "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  30   ? 32.791  136.813 48.832  1.00 36.17  ? 30   U   0 "C1'" 1 
ATOM   437   N  N1    . U   A  1  30   ? 32.983  136.116 50.114  1.00 38.19  ? 30   U   0 N1    1 
ATOM   438   C  C2    . U   A  1  30   ? 33.867  136.668 51.028  1.00 37.75  ? 30   U   0 C2    1 
ATOM   439   O  O2    . U   A  1  30   ? 34.465  137.715 50.832  1.00 37.32  ? 30   U   0 O2    1 
ATOM   440   N  N3    . U   A  1  30   ? 34.025  135.945 52.183  1.00 37.07  ? 30   U   0 N3    1 
ATOM   441   C  C4    . U   A  1  30   ? 33.410  134.758 52.514  1.00 36.05  ? 30   U   0 C4    1 
ATOM   442   O  O4    . U   A  1  30   ? 33.745  134.167 53.538  1.00 35.18  ? 30   U   0 O4    1 
ATOM   443   C  C5    . U   A  1  30   ? 32.500  134.273 51.538  1.00 37.19  ? 30   U   0 C5    1 
ATOM   444   C  C6    . U   A  1  30   ? 32.320  134.948 50.402  1.00 38.29  ? 30   U   0 C6    1 
ATOM   445   P  P     . C   A  1  31   ? 32.662  138.428 44.670  1.00 39.47  ? 31   C   0 P     1 
ATOM   446   O  OP1   . C   A  1  31   ? 32.169  139.803 44.951  1.00 40.84  ? 31   C   0 OP1   1 
ATOM   447   O  OP2   . C   A  1  31   ? 31.855  137.522 43.821  1.00 41.04  ? 31   C   0 OP2   1 
ATOM   448   O  "O5'" . C   A  1  31   ? 34.090  138.520 43.977  1.00 41.00  ? 31   C   0 "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  31   ? 35.295  138.262 44.706  1.00 44.04  ? 31   C   0 "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  31   ? 36.403  139.129 44.170  1.00 46.98  ? 31   C   0 "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  31   ? 35.992  140.519 44.231  1.00 51.83  ? 31   C   0 "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  31   ? 37.720  139.059 44.922  1.00 46.68  ? 31   C   0 "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  31   ? 38.741  139.389 43.998  1.00 40.08  ? 31   C   0 "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  31   ? 37.568  140.181 45.940  1.00 50.71  ? 31   C   0 "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  31   ? 38.800  140.669 46.424  1.00 51.54  ? 31   C   0 "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  31   ? 36.860  141.235 45.093  1.00 55.08  ? 31   C   0 "C1'" 1 
ATOM   457   N  N1    . C   A  1  31   ? 36.060  142.222 45.846  1.00 61.62  ? 31   C   0 N1    1 
ATOM   458   C  C2    . C   A  1  31   ? 36.564  143.531 46.008  1.00 64.16  ? 31   C   0 C2    1 
ATOM   459   O  O2    . C   A  1  31   ? 37.688  143.815 45.551  1.00 64.87  ? 31   C   0 O2    1 
ATOM   460   N  N3    . C   A  1  31   ? 35.811  144.449 46.659  1.00 66.05  ? 31   C   0 N3    1 
ATOM   461   C  C4    . C   A  1  31   ? 34.613  144.109 47.144  1.00 66.90  ? 31   C   0 C4    1 
ATOM   462   N  N4    . C   A  1  31   ? 33.901  145.054 47.764  1.00 68.97  ? 31   C   0 N4    1 
ATOM   463   C  C5    . C   A  1  31   ? 34.089  142.786 47.013  1.00 65.93  ? 31   C   0 C5    1 
ATOM   464   C  C6    . C   A  1  31   ? 34.838  141.884 46.367  1.00 63.62  ? 31   C   0 C6    1 
ATOM   465   P  P     . G   A  1  32   ? 39.703  138.245 43.443  1.00 36.80  ? 32   G   0 P     1 
ATOM   466   O  OP1   . G   A  1  32   ? 40.660  138.875 42.508  1.00 39.09  ? 32   G   0 OP1   1 
ATOM   467   O  OP2   . G   A  1  32   ? 38.875  137.102 42.997  1.00 37.92  ? 32   G   0 OP2   1 
ATOM   468   O  "O5'" . G   A  1  32   ? 40.509  137.771 44.718  1.00 36.97  ? 32   G   0 "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  32   ? 41.288  138.688 45.487  1.00 33.91  ? 32   G   0 "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  32   ? 41.846  137.974 46.681  1.00 33.93  ? 32   G   0 "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  32   ? 40.736  137.542 47.509  1.00 37.37  ? 32   G   0 "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  32   ? 42.596  136.690 46.358  1.00 32.44  ? 32   G   0 "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  32   ? 43.947  136.958 46.008  1.00 29.85  ? 32   G   0 "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  32   ? 42.456  135.914 47.657  1.00 34.82  ? 32   G   0 "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  32   ? 43.331  136.415 48.645  1.00 35.32  ? 32   G   0 "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  32   ? 41.017  136.263 48.056  1.00 37.94  ? 32   G   0 "C1'" 1 
ATOM   477   N  N9    . G   A  1  32   ? 40.017  135.314 47.562  1.00 40.63  ? 32   G   0 N9    1 
ATOM   478   C  C8    . G   A  1  32   ? 39.235  135.426 46.435  1.00 40.40  ? 32   G   0 C8    1 
ATOM   479   N  N7    . G   A  1  32   ? 38.460  134.394 46.243  1.00 42.62  ? 32   G   0 N7    1 
ATOM   480   C  C5    . G   A  1  32   ? 38.740  133.551 47.311  1.00 45.06  ? 32   G   0 C5    1 
ATOM   481   C  C6    . G   A  1  32   ? 38.212  132.269 47.648  1.00 46.06  ? 32   G   0 C6    1 
ATOM   482   O  O6    . G   A  1  32   ? 37.368  131.592 47.046  1.00 45.33  ? 32   G   0 O6    1 
ATOM   483   N  N1    . G   A  1  32   ? 38.774  131.782 48.823  1.00 47.03  ? 32   G   0 N1    1 
ATOM   484   C  C2    . G   A  1  32   ? 39.716  132.429 49.579  1.00 45.54  ? 32   G   0 C2    1 
ATOM   485   N  N2    . G   A  1  32   ? 40.131  131.798 50.677  1.00 46.92  ? 32   G   0 N2    1 
ATOM   486   N  N3    . G   A  1  32   ? 40.215  133.611 49.279  1.00 46.87  ? 32   G   0 N3    1 
ATOM   487   C  C4    . G   A  1  32   ? 39.690  134.111 48.139  1.00 44.56  ? 32   G   0 C4    1 
ATOM   488   P  P     . G   A  1  33   ? 44.877  135.779 45.444  1.00 32.36  ? 33   G   0 P     1 
ATOM   489   O  OP1   . G   A  1  33   ? 46.230  136.317 45.194  1.00 28.97  ? 33   G   0 OP1   1 
ATOM   490   O  OP2   . G   A  1  33   ? 44.153  135.071 44.351  1.00 30.52  ? 33   G   0 OP2   1 
ATOM   491   O  "O5'" . G   A  1  33   ? 45.007  134.809 46.697  1.00 33.80  ? 33   G   0 "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  33   ? 45.350  133.429 46.535  1.00 32.60  ? 33   G   0 "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  33   ? 44.934  132.657 47.753  1.00 33.09  ? 33   G   0 "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  33   ? 43.511  132.819 47.991  1.00 34.27  ? 33   G   0 "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  33   ? 45.136  131.162 47.650  1.00 32.63  ? 33   G   0 "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  33   ? 46.476  130.851 47.992  1.00 32.64  ? 33   G   0 "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  33   ? 44.152  130.646 48.687  1.00 34.20  ? 33   G   0 "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  33   ? 44.647  130.835 49.996  1.00 34.65  ? 33   G   0 "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  33   ? 42.972  131.603 48.488  1.00 35.90  ? 33   G   0 "C1'" 1 
ATOM   500   N  N9    . G   A  1  33   ? 41.973  131.113 47.537  1.00 37.92  ? 33   G   0 N9    1 
ATOM   501   C  C8    . G   A  1  33   ? 41.569  131.724 46.372  1.00 39.42  ? 33   G   0 C8    1 
ATOM   502   N  N7    . G   A  1  33   ? 40.688  131.031 45.707  1.00 39.01  ? 33   G   0 N7    1 
ATOM   503   C  C5    . G   A  1  33   ? 40.491  129.895 46.478  1.00 39.57  ? 33   G   0 C5    1 
ATOM   504   C  C6    . G   A  1  33   ? 39.663  128.767 46.256  1.00 40.14  ? 33   G   0 C6    1 
ATOM   505   O  O6    . G   A  1  33   ? 38.920  128.529 45.296  1.00 42.95  ? 33   G   0 O6    1 
ATOM   506   N  N1    . G   A  1  33   ? 39.760  127.853 47.293  1.00 40.36  ? 33   G   0 N1    1 
ATOM   507   C  C2    . G   A  1  33   ? 40.549  127.996 48.399  1.00 38.57  ? 33   G   0 C2    1 
ATOM   508   N  N2    . G   A  1  33   ? 40.480  127.007 49.292  1.00 36.17  ? 33   G   0 N2    1 
ATOM   509   N  N3    . G   A  1  33   ? 41.339  129.032 48.614  1.00 38.79  ? 33   G   0 N3    1 
ATOM   510   C  C4    . G   A  1  33   ? 41.263  129.937 47.620  1.00 38.55  ? 33   G   0 C4    1 
ATOM   511   P  P     . C   A  1  34   ? 47.369  129.969 46.999  1.00 32.93  ? 34   C   0 P     1 
ATOM   512   O  OP1   . C   A  1  34   ? 48.755  129.996 47.509  1.00 35.76  ? 34   C   0 OP1   1 
ATOM   513   O  OP2   . C   A  1  34   ? 47.095  130.408 45.620  1.00 34.74  ? 34   C   0 OP2   1 
ATOM   514   O  "O5'" . C   A  1  34   ? 46.809  128.492 47.185  1.00 33.55  ? 34   C   0 "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  34   ? 46.788  127.871 48.484  1.00 31.87  ? 34   C   0 "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  34   ? 45.888  126.662 48.472  1.00 31.02  ? 34   C   0 "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  34   ? 44.494  127.057 48.405  1.00 32.08  ? 34   C   0 "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  34   ? 46.062  125.739 47.286  1.00 30.23  ? 34   C   0 "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  34   ? 47.175  124.890 47.474  1.00 30.32  ? 34   C   0 "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  34   ? 44.742  124.991 47.291  1.00 32.65  ? 34   C   0 "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  34   ? 44.664  124.051 48.342  1.00 33.98  ? 34   C   0 "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  34   ? 43.773  126.120 47.624  1.00 33.47  ? 34   C   0 "C1'" 1 
ATOM   523   N  N1    . C   A  1  34   ? 43.263  126.807 46.423  1.00 37.96  ? 34   C   0 N1    1 
ATOM   524   C  C2    . C   A  1  34   ? 42.248  126.196 45.659  1.00 39.91  ? 34   C   0 C2    1 
ATOM   525   O  O2    . C   A  1  34   ? 41.848  125.061 45.974  1.00 41.68  ? 34   C   0 O2    1 
ATOM   526   N  N3    . C   A  1  34   ? 41.743  126.853 44.590  1.00 40.14  ? 34   C   0 N3    1 
ATOM   527   C  C4    . C   A  1  34   ? 42.220  128.056 44.259  1.00 40.65  ? 34   C   0 C4    1 
ATOM   528   N  N4    . C   A  1  34   ? 41.682  128.677 43.210  1.00 39.72  ? 34   C   0 N4    1 
ATOM   529   C  C5    . C   A  1  34   ? 43.268  128.681 44.993  1.00 41.36  ? 34   C   0 C5    1 
ATOM   530   C  C6    . C   A  1  34   ? 43.755  128.028 46.056  1.00 39.36  ? 34   C   0 C6    1 
ATOM   531   P  P     . U   A  1  35   ? 48.029  124.411 46.209  1.00 28.45  ? 35   U   0 P     1 
ATOM   532   O  OP1   . U   A  1  35   ? 49.196  123.666 46.727  1.00 29.32  ? 35   U   0 OP1   1 
ATOM   533   O  OP2   . U   A  1  35   ? 48.246  125.580 45.339  1.00 32.44  ? 35   U   0 OP2   1 
ATOM   534   O  "O5'" . U   A  1  35   ? 47.053  123.408 45.449  1.00 31.02  ? 35   U   0 "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  35   ? 46.636  122.170 46.063  1.00 31.60  ? 35   U   0 "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  35   ? 45.570  121.488 45.230  1.00 30.71  ? 35   U   0 "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  35   ? 44.345  122.268 45.239  1.00 32.20  ? 35   U   0 "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  35   ? 45.872  121.314 43.753  1.00 30.60  ? 35   U   0 "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  35   ? 46.718  120.204 43.516  1.00 29.81  ? 35   U   0 "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  35   ? 44.480  121.105 43.179  1.00 32.62  ? 35   U   0 "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  35   ? 43.983  119.805 43.430  1.00 33.77  ? 35   U   0 "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  35   ? 43.673  122.108 44.001  1.00 33.50  ? 35   U   0 "C1'" 1 
ATOM   543   N  N1    . U   A  1  35   ? 43.597  123.416 43.337  1.00 36.41  ? 35   U   0 N1    1 
ATOM   544   C  C2    . U   A  1  35   ? 42.615  123.599 42.376  1.00 37.34  ? 35   U   0 C2    1 
ATOM   545   O  O2    . U   A  1  35   ? 41.818  122.734 42.064  1.00 35.45  ? 35   U   0 O2    1 
ATOM   546   N  N3    . U   A  1  35   ? 42.606  124.840 41.789  1.00 39.07  ? 35   U   0 N3    1 
ATOM   547   C  C4    . U   A  1  35   ? 43.457  125.894 42.054  1.00 37.77  ? 35   U   0 C4    1 
ATOM   548   O  O4    . U   A  1  35   ? 43.320  126.950 41.437  1.00 37.60  ? 35   U   0 O4    1 
ATOM   549   C  C5    . U   A  1  35   ? 44.441  125.629 43.056  1.00 37.47  ? 35   U   0 C5    1 
ATOM   550   C  C6    . U   A  1  35   ? 44.477  124.433 43.649  1.00 37.57  ? 35   U   0 C6    1 
ATOM   551   P  P     . C   A  1  36   ? 47.411  120.023 42.080  1.00 29.86  ? 36   C   0 P     1 
ATOM   552   O  OP1   . C   A  1  36   ? 48.336  118.870 42.170  1.00 29.97  ? 36   C   0 OP1   1 
ATOM   553   O  OP2   . C   A  1  36   ? 47.913  121.335 41.620  1.00 29.76  ? 36   C   0 OP2   1 
ATOM   554   O  "O5'" . C   A  1  36   ? 46.213  119.638 41.112  1.00 30.87  ? 36   C   0 "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  36   ? 45.515  118.401 41.246  1.00 27.48  ? 36   C   0 "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  36   ? 44.376  118.359 40.265  1.00 30.71  ? 36   C   0 "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  36   ? 43.477  119.464 40.537  1.00 29.85  ? 36   C   0 "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  36   ? 44.738  118.576 38.805  1.00 31.55  ? 36   C   0 "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  36   ? 45.242  117.417 38.172  1.00 34.17  ? 36   C   0 "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  36   ? 43.402  118.991 38.223  1.00 31.75  ? 36   C   0 "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  36   ? 42.506  117.905 38.136  1.00 32.25  ? 36   C   0 "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  36   ? 42.896  119.911 39.321  1.00 31.90  ? 36   C   0 "C1'" 1 
ATOM   563   N  N1    . C   A  1  36   ? 43.298  121.303 39.080  1.00 34.91  ? 36   C   0 N1    1 
ATOM   564   C  C2    . C   A  1  36   ? 42.451  122.114 38.327  1.00 36.74  ? 36   C   0 C2    1 
ATOM   565   O  O2    . C   A  1  36   ? 41.431  121.616 37.831  1.00 37.68  ? 36   C   0 O2    1 
ATOM   566   N  N3    . C   A  1  36   ? 42.765  123.418 38.153  1.00 37.75  ? 36   C   0 N3    1 
ATOM   567   C  C4    . C   A  1  36   ? 43.881  123.913 38.687  1.00 36.58  ? 36   C   0 C4    1 
ATOM   568   N  N4    . C   A  1  36   ? 44.122  125.213 38.524  1.00 36.55  ? 36   C   0 N4    1 
ATOM   569   C  C5    . C   A  1  36   ? 44.791  123.098 39.421  1.00 36.79  ? 36   C   0 C5    1 
ATOM   570   C  C6    . C   A  1  36   ? 44.463  121.809 39.592  1.00 36.51  ? 36   C   0 C6    1 
ATOM   571   P  P     . A   A  1  37   ? 46.194  117.576 36.890  1.00 38.08  ? 37   A   0 P     1 
ATOM   572   O  OP1   . A   A  1  37   ? 46.604  116.212 36.487  1.00 38.32  ? 37   A   0 OP1   1 
ATOM   573   O  OP2   . A   A  1  37   ? 47.229  118.597 37.184  1.00 38.15  ? 37   A   0 OP2   1 
ATOM   574   O  "O5'" . A   A  1  37   ? 45.236  118.178 35.770  1.00 39.79  ? 37   A   0 "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  37   ? 44.155  117.402 35.234  1.00 40.41  ? 37   A   0 "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  37   ? 43.426  118.189 34.177  1.00 42.77  ? 37   A   0 "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  37   ? 42.840  119.373 34.775  1.00 43.81  ? 37   A   0 "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  37   ? 44.276  118.742 33.046  1.00 43.66  ? 37   A   0 "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  37   ? 44.538  117.761 32.048  1.00 44.81  ? 37   A   0 "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  37   ? 43.399  119.866 32.523  1.00 43.49  ? 37   A   0 "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  37   ? 42.339  119.373 31.734  1.00 43.80  ? 37   A   0 "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  37   ? 42.820  120.422 33.825  1.00 43.88  ? 37   A   0 "C1'" 1 
ATOM   583   N  N9    . A   A  1  37   ? 43.579  121.549 34.365  1.00 45.25  ? 37   A   0 N9    1 
ATOM   584   C  C8    . A   A  1  37   ? 44.502  121.544 35.379  1.00 45.89  ? 37   A   0 C8    1 
ATOM   585   N  N7    . A   A  1  37   ? 45.000  122.727 35.645  1.00 46.69  ? 37   A   0 N7    1 
ATOM   586   C  C5    . A   A  1  37   ? 44.365  123.567 34.742  1.00 46.00  ? 37   A   0 C5    1 
ATOM   587   C  C6    . A   A  1  37   ? 44.450  124.954 34.514  1.00 46.71  ? 37   A   0 C6    1 
ATOM   588   N  N6    . A   A  1  37   ? 45.250  125.770 35.202  1.00 46.29  ? 37   A   0 N6    1 
ATOM   589   N  N1    . A   A  1  37   ? 43.675  125.481 33.540  1.00 46.86  ? 37   A   0 N1    1 
ATOM   590   C  C2    . A   A  1  37   ? 42.881  124.662 32.844  1.00 46.64  ? 37   A   0 C2    1 
ATOM   591   N  N3    . A   A  1  37   ? 42.716  123.346 32.961  1.00 46.84  ? 37   A   0 N3    1 
ATOM   592   C  C4    . A   A  1  37   ? 43.493  122.855 33.943  1.00 46.21  ? 37   A   0 C4    1 
ATOM   593   P  P     . G   A  1  38   ? 45.845  117.898 31.129  1.00 44.86  ? 38   G   0 P     1 
ATOM   594   O  OP1   . G   A  1  38   ? 46.082  116.610 30.440  1.00 45.30  ? 38   G   0 OP1   1 
ATOM   595   O  OP2   . G   A  1  38   ? 46.915  118.473 31.975  1.00 47.91  ? 38   G   0 OP2   1 
ATOM   596   O  "O5'" . G   A  1  38   ? 45.424  118.978 30.037  1.00 45.71  ? 38   G   0 "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  38   ? 44.442  118.656 29.041  1.00 45.39  ? 38   G   0 "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  38   ? 43.968  119.902 28.328  1.00 45.39  ? 38   G   0 "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  38   ? 43.401  120.833 29.285  1.00 46.31  ? 38   G   0 "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  38   ? 45.018  120.734 27.622  1.00 45.34  ? 38   G   0 "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  38   ? 45.369  120.194 26.369  1.00 46.26  ? 38   G   0 "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  38   ? 44.295  122.060 27.475  1.00 45.86  ? 38   G   0 "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  38   ? 43.295  122.014 26.474  1.00 44.01  ? 38   G   0 "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  38   ? 43.628  122.163 28.844  1.00 45.98  ? 38   G   0 "C1'" 1 
ATOM   605   N  N9    . G   A  1  38   ? 44.504  122.828 29.805  1.00 46.82  ? 38   G   0 N9    1 
ATOM   606   C  C8    . G   A  1  38   ? 45.229  122.254 30.823  1.00 47.22  ? 38   G   0 C8    1 
ATOM   607   N  N7    . G   A  1  38   ? 45.932  123.120 31.502  1.00 47.40  ? 38   G   0 N7    1 
ATOM   608   C  C5    . G   A  1  38   ? 45.655  124.336 30.897  1.00 45.93  ? 38   G   0 C5    1 
ATOM   609   C  C6    . G   A  1  38   ? 46.125  125.636 31.197  1.00 46.33  ? 38   G   0 C6    1 
ATOM   610   O  O6    . G   A  1  38   ? 46.911  125.985 32.089  1.00 43.95  ? 38   G   0 O6    1 
ATOM   611   N  N1    . G   A  1  38   ? 45.583  126.584 30.333  1.00 46.87  ? 38   G   0 N1    1 
ATOM   612   C  C2    . G   A  1  38   ? 44.698  126.309 29.310  1.00 48.38  ? 38   G   0 C2    1 
ATOM   613   N  N2    . G   A  1  38   ? 44.267  127.350 28.583  1.00 49.16  ? 38   G   0 N2    1 
ATOM   614   N  N3    . G   A  1  38   ? 44.261  125.100 29.022  1.00 47.16  ? 38   G   0 N3    1 
ATOM   615   C  C4    . G   A  1  38   ? 44.773  124.170 29.850  1.00 46.28  ? 38   G   0 C4    1 
ATOM   616   P  P     . G   A  1  39   ? 46.852  120.410 25.808  1.00 47.35  ? 39   G   0 P     1 
ATOM   617   O  OP1   . G   A  1  39   ? 46.917  119.674 24.522  1.00 49.31  ? 39   G   0 OP1   1 
ATOM   618   O  OP2   . G   A  1  39   ? 47.827  120.093 26.879  1.00 47.37  ? 39   G   0 OP2   1 
ATOM   619   O  "O5'" . G   A  1  39   ? 46.920  121.970 25.508  1.00 46.16  ? 39   G   0 "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  39   ? 46.152  122.538 24.444  1.00 47.22  ? 39   G   0 "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  39   ? 46.303  124.033 24.436  1.00 48.29  ? 39   G   0 "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  39   ? 45.948  124.537 25.750  1.00 49.13  ? 39   G   0 "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  39   ? 47.706  124.576 24.210  1.00 48.39  ? 39   G   0 "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  39   ? 48.038  124.633 22.828  1.00 47.91  ? 39   G   0 "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  39   ? 47.593  125.970 24.808  1.00 49.15  ? 39   G   0 "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  39   ? 46.935  126.874 23.939  1.00 47.70  ? 39   G   0 "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  39   ? 46.713  125.697 26.032  1.00 49.22  ? 39   G   0 "C1'" 1 
ATOM   628   N  N9    . G   A  1  39   ? 47.488  125.461 27.246  1.00 48.90  ? 39   G   0 N9    1 
ATOM   629   C  C8    . G   A  1  39   ? 47.702  124.265 27.885  1.00 49.85  ? 39   G   0 C8    1 
ATOM   630   N  N7    . G   A  1  39   ? 48.456  124.379 28.945  1.00 51.42  ? 39   G   0 N7    1 
ATOM   631   C  C5    . G   A  1  39   ? 48.754  125.733 29.010  1.00 51.64  ? 39   G   0 C5    1 
ATOM   632   C  C6    . G   A  1  39   ? 49.538  126.466 29.948  1.00 52.08  ? 39   G   0 C6    1 
ATOM   633   O  O6    . G   A  1  39   ? 50.157  126.050 30.934  1.00 51.70  ? 39   G   0 O6    1 
ATOM   634   N  N1    . G   A  1  39   ? 49.564  127.821 29.638  1.00 52.24  ? 39   G   0 N1    1 
ATOM   635   C  C2    . G   A  1  39   ? 48.932  128.399 28.566  1.00 51.64  ? 39   G   0 C2    1 
ATOM   636   N  N2    . G   A  1  39   ? 49.079  129.725 28.434  1.00 51.61  ? 39   G   0 N2    1 
ATOM   637   N  N3    . G   A  1  39   ? 48.208  127.730 27.688  1.00 50.95  ? 39   G   0 N3    1 
ATOM   638   C  C4    . G   A  1  39   ? 48.159  126.413 27.970  1.00 50.29  ? 39   G   0 C4    1 
ATOM   639   P  P     . C   A  1  40   ? 49.563  124.421 22.357  1.00 48.63  ? 40   C   0 P     1 
ATOM   640   O  OP1   . C   A  1  40   ? 49.533  124.477 20.881  1.00 50.02  ? 40   C   0 OP1   1 
ATOM   641   O  OP2   . C   A  1  40   ? 50.132  123.226 23.029  1.00 47.53  ? 40   C   0 OP2   1 
ATOM   642   O  "O5'" . C   A  1  40   ? 50.342  125.705 22.896  1.00 49.15  ? 40   C   0 "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  40   ? 49.980  127.042 22.478  1.00 48.94  ? 40   C   0 "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  40   ? 50.618  128.069 23.393  1.00 48.18  ? 40   C   0 "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  40   ? 50.165  127.839 24.755  1.00 49.13  ? 40   C   0 "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  40   ? 52.135  128.017 23.478  1.00 48.09  ? 40   C   0 "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  40   ? 52.745  128.778 22.437  1.00 46.81  ? 40   C   0 "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  40   ? 52.413  128.603 24.857  1.00 48.39  ? 40   C   0 "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  40   ? 52.376  130.015 24.870  1.00 48.18  ? 40   C   0 "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  40   ? 51.236  128.048 25.665  1.00 48.96  ? 40   C   0 "C1'" 1 
ATOM   651   N  N1    . C   A  1  40   ? 51.524  126.765 26.343  1.00 49.31  ? 40   C   0 N1    1 
ATOM   652   C  C2    . C   A  1  40   ? 52.104  126.772 27.626  1.00 48.77  ? 40   C   0 C2    1 
ATOM   653   O  O2    . C   A  1  40   ? 52.375  127.856 28.166  1.00 48.03  ? 40   C   0 O2    1 
ATOM   654   N  N3    . C   A  1  40   ? 52.354  125.594 28.241  1.00 49.75  ? 40   C   0 N3    1 
ATOM   655   C  C4    . C   A  1  40   ? 52.058  124.443 27.628  1.00 50.94  ? 40   C   0 C4    1 
ATOM   656   N  N4    . C   A  1  40   ? 52.324  123.303 28.267  1.00 51.08  ? 40   C   0 N4    1 
ATOM   657   C  C5    . C   A  1  40   ? 51.476  124.408 26.331  1.00 50.75  ? 40   C   0 C5    1 
ATOM   658   C  C6    . C   A  1  40   ? 51.229  125.577 25.731  1.00 49.83  ? 40   C   0 C6    1 
ATOM   659   P  P     . G   A  1  41   ? 54.290  128.530 22.063  1.00 46.15  ? 41   G   0 P     1 
ATOM   660   O  OP1   . G   A  1  41   ? 54.666  129.560 21.065  1.00 46.61  ? 41   G   0 OP1   1 
ATOM   661   O  OP2   . G   A  1  41   ? 54.484  127.094 21.742  1.00 45.98  ? 41   G   0 OP2   1 
ATOM   662   O  "O5'" . G   A  1  41   ? 55.076  128.841 23.412  1.00 45.58  ? 41   G   0 "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  41   ? 55.379  130.190 23.804  1.00 43.35  ? 41   G   0 "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  41   ? 56.365  130.184 24.944  1.00 44.40  ? 41   G   0 "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  41   ? 55.739  129.599 26.114  1.00 45.56  ? 41   G   0 "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  41   ? 57.622  129.355 24.718  1.00 43.51  ? 41   G   0 "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  41   ? 58.614  130.135 24.063  1.00 43.19  ? 41   G   0 "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  41   ? 58.043  129.022 26.142  1.00 44.04  ? 41   G   0 "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  41   ? 58.687  130.115 26.765  1.00 44.92  ? 41   G   0 "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  41   ? 56.684  128.814 26.818  1.00 45.13  ? 41   G   0 "C1'" 1 
ATOM   671   N  N9    . G   A  1  41   ? 56.212  127.434 26.802  1.00 47.10  ? 41   G   0 N9    1 
ATOM   672   C  C8    . G   A  1  41   ? 55.614  126.776 25.753  1.00 47.73  ? 41   G   0 C8    1 
ATOM   673   N  N7    . G   A  1  41   ? 55.278  125.550 26.042  1.00 48.78  ? 41   G   0 N7    1 
ATOM   674   C  C5    . G   A  1  41   ? 55.683  125.385 27.359  1.00 48.01  ? 41   G   0 C5    1 
ATOM   675   C  C6    . G   A  1  41   ? 55.582  124.261 28.216  1.00 48.25  ? 41   G   0 C6    1 
ATOM   676   O  O6    . G   A  1  41   ? 55.093  123.150 27.978  1.00 47.43  ? 41   G   0 O6    1 
ATOM   677   N  N1    . G   A  1  41   ? 56.122  124.526 29.469  1.00 48.01  ? 41   G   0 N1    1 
ATOM   678   C  C2    . G   A  1  41   ? 56.681  125.717 29.851  1.00 47.17  ? 41   G   0 C2    1 
ATOM   679   N  N2    . G   A  1  41   ? 57.144  125.775 31.099  1.00 47.99  ? 41   G   0 N2    1 
ATOM   680   N  N3    . G   A  1  41   ? 56.778  126.772 29.066  1.00 47.49  ? 41   G   0 N3    1 
ATOM   681   C  C4    . G   A  1  41   ? 56.264  126.537 27.841  1.00 47.91  ? 41   G   0 C4    1 
ATOM   682   P  P     . C   A  1  42   ? 59.362  129.578 22.755  1.00 43.35  ? 42   C   0 P     1 
ATOM   683   O  OP1   . C   A  1  42   ? 59.303  130.713 21.799  1.00 44.55  ? 42   C   0 OP1   1 
ATOM   684   O  OP2   . C   A  1  42   ? 58.838  128.247 22.346  1.00 43.15  ? 42   C   0 OP2   1 
ATOM   685   O  "O5'" . C   A  1  42   ? 60.878  129.404 23.220  1.00 41.33  ? 42   C   0 "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  42   ? 61.795  130.521 23.186  1.00 39.80  ? 42   C   0 "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  42   ? 61.557  131.432 24.369  1.00 38.93  ? 42   C   0 "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  42   ? 61.827  130.713 25.600  1.00 38.34  ? 42   C   0 "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  42   ? 62.446  132.660 24.468  1.00 39.96  ? 42   C   0 "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  42   ? 61.957  133.720 23.645  1.00 44.90  ? 42   C   0 "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  42   ? 62.328  133.001 25.944  1.00 37.59  ? 42   C   0 "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  42   ? 61.093  133.623 26.216  1.00 36.24  ? 42   C   0 "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  42   ? 62.335  131.606 26.573  1.00 36.58  ? 42   C   0 "C1'" 1 
ATOM   694   N  N1    . C   A  1  42   ? 63.684  131.154 26.964  1.00 35.81  ? 42   C   0 N1    1 
ATOM   695   C  C2    . C   A  1  42   ? 64.256  131.671 28.136  1.00 36.49  ? 42   C   0 C2    1 
ATOM   696   O  O2    . C   A  1  42   ? 63.588  132.449 28.842  1.00 35.68  ? 42   C   0 O2    1 
ATOM   697   N  N3    . C   A  1  42   ? 65.521  131.309 28.470  1.00 35.79  ? 42   C   0 N3    1 
ATOM   698   C  C4    . C   A  1  42   ? 66.200  130.462 27.693  1.00 36.43  ? 42   C   0 C4    1 
ATOM   699   N  N4    . C   A  1  42   ? 67.446  130.155 28.044  1.00 38.34  ? 42   C   0 N4    1 
ATOM   700   C  C5    . C   A  1  42   ? 65.631  129.897 26.517  1.00 35.89  ? 42   C   0 C5    1 
ATOM   701   C  C6    . C   A  1  42   ? 64.383  130.265 26.193  1.00 35.87  ? 42   C   0 C6    1 
ATOM   702   P  P     . U   A  1  43   ? 62.981  134.808 23.038  1.00 45.27  ? 43   U   0 P     1 
ATOM   703   O  OP1   . U   A  1  43   ? 62.192  135.682 22.135  1.00 43.95  ? 43   U   0 OP1   1 
ATOM   704   O  OP2   . U   A  1  43   ? 64.179  134.101 22.517  1.00 45.16  ? 43   U   0 OP2   1 
ATOM   705   O  "O5'" . U   A  1  43   ? 63.402  135.675 24.301  1.00 43.85  ? 43   U   0 "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  43   ? 62.447  136.543 24.922  1.00 43.85  ? 43   U   0 "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  43   ? 63.091  137.315 26.045  1.00 44.11  ? 43   U   0 "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  43   ? 63.483  136.412 27.115  1.00 45.78  ? 43   U   0 "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  43   ? 64.386  138.021 25.707  1.00 42.75  ? 43   U   0 "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  43   ? 64.176  139.225 24.998  1.00 41.91  ? 43   U   0 "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  43   ? 64.971  138.254 27.090  1.00 43.69  ? 43   U   0 "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  43   ? 64.317  139.309 27.772  1.00 43.43  ? 43   U   0 "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  43   ? 64.636  136.925 27.768  1.00 42.34  ? 43   U   0 "C1'" 1 
ATOM   714   N  N1    . U   A  1  43   ? 65.720  135.937 27.649  1.00 39.75  ? 43   U   0 N1    1 
ATOM   715   C  C2    . U   A  1  43   ? 66.763  136.013 28.558  1.00 39.16  ? 43   U   0 C2    1 
ATOM   716   O  O2    . U   A  1  43   ? 66.829  136.871 29.419  1.00 41.13  ? 43   U   0 O2    1 
ATOM   717   N  N3    . U   A  1  43   ? 67.730  135.051 28.416  1.00 35.74  ? 43   U   0 N3    1 
ATOM   718   C  C4    . U   A  1  43   ? 67.769  134.054 27.476  1.00 36.41  ? 43   U   0 C4    1 
ATOM   719   O  O4    . U   A  1  43   ? 68.725  133.284 27.452  1.00 37.12  ? 43   U   0 O4    1 
ATOM   720   C  C5    . U   A  1  43   ? 66.668  134.049 26.565  1.00 38.14  ? 43   U   0 C5    1 
ATOM   721   C  C6    . U   A  1  43   ? 65.705  134.968 26.679  1.00 37.98  ? 43   U   0 C6    1 
ATOM   722   P  P     . G   A  1  44   ? 65.306  139.745 23.984  1.00 42.18  ? 44   G   0 P     1 
ATOM   723   O  OP1   . G   A  1  44   ? 64.802  141.051 23.465  1.00 40.09  ? 44   G   0 OP1   1 
ATOM   724   O  OP2   . G   A  1  44   ? 65.650  138.656 23.035  1.00 40.11  ? 44   G   0 OP2   1 
ATOM   725   O  "O5'" . G   A  1  44   ? 66.580  139.982 24.919  1.00 40.72  ? 44   G   0 "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  44   ? 66.616  141.074 25.861  1.00 39.23  ? 44   G   0 "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  44   ? 67.990  141.206 26.472  1.00 38.05  ? 44   G   0 "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  44   ? 68.226  140.125 27.407  1.00 39.95  ? 44   G   0 "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  44   ? 69.174  141.120 25.528  1.00 38.08  ? 44   G   0 "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  44   ? 69.401  142.334 24.824  1.00 38.87  ? 44   G   0 "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  44   ? 70.307  140.796 26.491  1.00 38.45  ? 44   G   0 "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  44   ? 70.739  141.920 27.223  1.00 38.04  ? 44   G   0 "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  44   ? 69.616  139.823 27.446  1.00 38.64  ? 44   G   0 "C1'" 1 
ATOM   734   N  N9    . G   A  1  44   ? 69.803  138.435 27.034  1.00 36.14  ? 44   G   0 N9    1 
ATOM   735   C  C8    . G   A  1  44   ? 68.916  137.662 26.328  1.00 36.68  ? 44   G   0 C8    1 
ATOM   736   N  N7    . G   A  1  44   ? 69.376  136.473 26.058  1.00 36.69  ? 44   G   0 N7    1 
ATOM   737   C  C5    . G   A  1  44   ? 70.640  136.456 26.625  1.00 34.38  ? 44   G   0 C5    1 
ATOM   738   C  C6    . G   A  1  44   ? 71.622  135.440 26.631  1.00 34.59  ? 44   G   0 C6    1 
ATOM   739   O  O6    . G   A  1  44   ? 71.575  134.319 26.104  1.00 36.98  ? 44   G   0 O6    1 
ATOM   740   N  N1    . G   A  1  44   ? 72.759  135.831 27.326  1.00 33.85  ? 44   G   0 N1    1 
ATOM   741   C  C2    . G   A  1  44   ? 72.932  137.046 27.928  1.00 33.67  ? 44   G   0 C2    1 
ATOM   742   N  N2    . G   A  1  44   ? 74.101  137.219 28.551  1.00 33.86  ? 44   G   0 N2    1 
ATOM   743   N  N3    . G   A  1  44   ? 72.026  138.014 27.918  1.00 33.23  ? 44   G   0 N3    1 
ATOM   744   C  C4    . G   A  1  44   ? 70.913  137.652 27.250  1.00 34.21  ? 44   G   0 C4    1 
ATOM   745   P  P     . A   A  1  45   ? 70.091  142.299 23.366  1.00 39.12  ? 45   A   0 P     1 
ATOM   746   O  OP1   . A   A  1  45   ? 69.045  142.666 22.376  1.00 38.50  ? 45   A   0 OP1   1 
ATOM   747   O  OP2   . A   A  1  45   ? 70.855  141.040 23.183  1.00 38.86  ? 45   A   0 OP2   1 
ATOM   748   O  "O5'" . A   A  1  45   ? 71.178  143.458 23.442  1.00 39.18  ? 45   A   0 "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  45   ? 72.140  143.492 24.507  1.00 37.92  ? 45   A   0 "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  45   ? 73.245  144.464 24.179  1.00 39.07  ? 45   A   0 "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  45   ? 74.136  144.587 25.319  1.00 39.45  ? 45   A   0 "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  45   ? 74.130  144.064 23.009  1.00 39.01  ? 45   A   0 "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  45   ? 74.632  145.253 22.419  1.00 43.82  ? 45   A   0 "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  45   ? 75.258  143.306 23.696  1.00 37.39  ? 45   A   0 "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  45   ? 76.456  143.268 22.949  1.00 33.53  ? 45   A   0 "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  45   ? 75.429  144.132 24.968  1.00 38.42  ? 45   A   0 "C1'" 1 
ATOM   757   N  N9    . A   A  1  45   ? 75.972  143.405 26.114  1.00 39.31  ? 45   A   0 N9    1 
ATOM   758   C  C8    . A   A  1  45   ? 77.025  143.794 26.890  1.00 39.80  ? 45   A   0 C8    1 
ATOM   759   N  N7    . A   A  1  45   ? 77.270  142.990 27.889  1.00 42.58  ? 45   A   0 N7    1 
ATOM   760   C  C5    . A   A  1  45   ? 76.317  141.993 27.759  1.00 42.35  ? 45   A   0 C5    1 
ATOM   761   C  C6    . A   A  1  45   ? 76.035  140.850 28.523  1.00 42.23  ? 45   A   0 C6    1 
ATOM   762   N  N6    . A   A  1  45   ? 76.706  140.519 29.629  1.00 41.59  ? 45   A   0 N6    1 
ATOM   763   N  N1    . A   A  1  45   ? 75.025  140.053 28.114  1.00 41.27  ? 45   A   0 N1    1 
ATOM   764   C  C2    . A   A  1  45   ? 74.346  140.396 27.018  1.00 40.25  ? 45   A   0 C2    1 
ATOM   765   N  N3    . A   A  1  45   ? 74.506  141.448 26.227  1.00 41.82  ? 45   A   0 N3    1 
ATOM   766   C  C4    . A   A  1  45   ? 75.522  142.222 26.658  1.00 41.61  ? 45   A   0 C4    1 
ATOM   767   P  P     . U   A  1  46   ? 74.478  145.491 20.843  1.00 45.49  ? 46   U   0 P     1 
ATOM   768   O  OP1   . U   A  1  46   ? 74.605  144.173 20.171  1.00 44.01  ? 46   U   0 OP1   1 
ATOM   769   O  OP2   . U   A  1  46   ? 75.414  146.586 20.501  1.00 43.41  ? 46   U   0 OP2   1 
ATOM   770   O  "O5'" . U   A  1  46   ? 72.983  146.008 20.677  1.00 44.88  ? 46   U   0 "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  46   ? 72.623  147.323 21.105  1.00 47.93  ? 46   U   0 "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  46   ? 71.130  147.517 21.029  1.00 51.25  ? 46   U   0 "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  46   ? 70.688  147.427 19.646  1.00 55.21  ? 46   U   0 "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  46   ? 70.258  146.543 21.814  1.00 52.35  ? 46   U   0 "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  46   ? 69.171  147.261 22.350  1.00 48.58  ? 46   U   0 "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  46   ? 69.733  145.600 20.740  1.00 55.49  ? 46   U   0 "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  46   ? 68.475  145.037 21.064  1.00 56.52  ? 46   U   0 "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  46   ? 69.581  146.555 19.563  1.00 56.75  ? 46   U   0 "C1'" 1 
ATOM   779   N  N1    . U   A  1  46   ? 69.595  145.889 18.255  1.00 59.41  ? 46   U   0 N1    1 
ATOM   780   C  C2    . U   A  1  46   ? 68.432  145.925 17.512  1.00 61.14  ? 46   U   0 C2    1 
ATOM   781   O  O2    . U   A  1  46   ? 67.413  146.486 17.893  1.00 60.82  ? 46   U   0 O2    1 
ATOM   782   N  N3    . U   A  1  46   ? 68.499  145.278 16.305  1.00 63.90  ? 46   U   0 N3    1 
ATOM   783   C  C4    . U   A  1  46   ? 69.588  144.613 15.777  1.00 65.18  ? 46   U   0 C4    1 
ATOM   784   O  O4    . U   A  1  46   ? 69.491  144.068 14.672  1.00 67.66  ? 46   U   0 O4    1 
ATOM   785   C  C5    . U   A  1  46   ? 70.755  144.626 16.608  1.00 64.12  ? 46   U   0 C5    1 
ATOM   786   C  C6    . U   A  1  46   ? 70.719  145.248 17.787  1.00 61.02  ? 46   U   0 C6    1 
ATOM   787   P  P     . G   A  1  47   ? 69.344  147.991 23.754  1.00 48.17  ? 47   G   0 P     1 
ATOM   788   O  OP1   . G   A  1  47   ? 67.993  148.209 24.325  1.00 48.37  ? 47   G   0 OP1   1 
ATOM   789   O  OP2   . G   A  1  47   ? 70.258  149.143 23.549  1.00 48.27  ? 47   G   0 OP2   1 
ATOM   790   O  "O5'" . G   A  1  47   ? 70.150  146.935 24.632  1.00 47.48  ? 47   G   0 "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  47   ? 69.488  145.870 25.311  1.00 43.39  ? 47   G   0 "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  47   ? 69.904  145.858 26.757  1.00 43.67  ? 47   G   0 "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  47   ? 71.350  145.702 26.814  1.00 44.51  ? 47   G   0 "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  47   ? 69.582  147.121 27.545  1.00 42.89  ? 47   G   0 "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  47   ? 69.210  146.803 28.874  1.00 44.59  ? 47   G   0 "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  47   ? 70.895  147.893 27.535  1.00 42.47  ? 47   G   0 "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  47   ? 71.061  148.695 28.685  1.00 42.06  ? 47   G   0 "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  47   ? 71.931  146.774 27.526  1.00 42.93  ? 47   G   0 "C1'" 1 
ATOM   799   N  N9    . G   A  1  47   ? 73.142  147.176 26.816  1.00 44.48  ? 47   G   0 N9    1 
ATOM   800   C  C8    . G   A  1  47   ? 73.204  147.784 25.585  1.00 45.85  ? 47   G   0 C8    1 
ATOM   801   N  N7    . G   A  1  47   ? 74.422  148.050 25.204  1.00 45.93  ? 47   G   0 N7    1 
ATOM   802   C  C5    . G   A  1  47   ? 75.216  147.588 26.240  1.00 43.89  ? 47   G   0 C5    1 
ATOM   803   C  C6    . G   A  1  47   ? 76.618  147.606 26.387  1.00 44.77  ? 47   G   0 C6    1 
ATOM   804   O  O6    . G   A  1  47   ? 77.466  148.066 25.614  1.00 44.83  ? 47   G   0 O6    1 
ATOM   805   N  N1    . G   A  1  47   ? 77.012  147.018 27.583  1.00 46.16  ? 47   G   0 N1    1 
ATOM   806   C  C2    . G   A  1  47   ? 76.160  146.493 28.523  1.00 45.31  ? 47   G   0 C2    1 
ATOM   807   N  N2    . G   A  1  47   ? 76.730  145.975 29.620  1.00 45.59  ? 47   G   0 N2    1 
ATOM   808   N  N3    . G   A  1  47   ? 74.846  146.478 28.397  1.00 44.00  ? 47   G   0 N3    1 
ATOM   809   C  C4    . G   A  1  47   ? 74.445  147.036 27.241  1.00 43.76  ? 47   G   0 C4    1 
ATOM   810   P  P     . A   A  1  48   ? 67.764  147.244 29.412  1.00 44.62  ? 48   A   0 P     1 
ATOM   811   O  OP1   . A   A  1  48   ? 67.094  147.996 28.326  1.00 46.11  ? 48   A   0 OP1   1 
ATOM   812   O  OP2   . A   A  1  48   ? 67.925  147.881 30.740  1.00 43.32  ? 48   A   0 OP2   1 
ATOM   813   O  "O5'" . A   A  1  48   ? 67.002  145.855 29.585  1.00 43.22  ? 48   A   0 "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  48   ? 66.507  145.129 28.443  1.00 41.77  ? 48   A   0 "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  48   ? 66.292  143.676 28.799  1.00 41.88  ? 48   A   0 "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  48   ? 67.572  143.011 28.914  1.00 43.70  ? 48   A   0 "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  48   ? 65.599  143.441 30.130  1.00 41.68  ? 48   A   0 "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  48   ? 64.191  143.463 29.973  1.00 39.32  ? 48   A   0 "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  48   ? 66.105  142.066 30.538  1.00 43.65  ? 48   A   0 "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  48   ? 65.402  141.019 29.908  1.00 45.89  ? 48   A   0 "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  48   ? 67.534  142.094 29.992  1.00 44.46  ? 48   A   0 "C1'" 1 
ATOM   822   N  N9    . A   A  1  48   ? 68.561  142.491 30.952  1.00 44.98  ? 48   A   0 N9    1 
ATOM   823   C  C8    . A   A  1  48   ? 69.175  143.712 31.065  1.00 44.15  ? 48   A   0 C8    1 
ATOM   824   N  N7    . A   A  1  48   ? 70.126  143.742 31.960  1.00 45.79  ? 48   A   0 N7    1 
ATOM   825   C  C5    . A   A  1  48   ? 70.129  142.458 32.488  1.00 45.30  ? 48   A   0 C5    1 
ATOM   826   C  C6    . A   A  1  48   ? 70.928  141.836 33.463  1.00 45.39  ? 48   A   0 C6    1 
ATOM   827   N  N6    . A   A  1  48   ? 71.944  142.439 34.090  1.00 44.42  ? 48   A   0 N6    1 
ATOM   828   N  N1    . A   A  1  48   ? 70.655  140.551 33.768  1.00 44.39  ? 48   A   0 N1    1 
ATOM   829   C  C2    . A   A  1  48   ? 69.663  139.939 33.126  1.00 45.19  ? 48   A   0 C2    1 
ATOM   830   N  N3    . A   A  1  48   ? 68.857  140.407 32.182  1.00 47.30  ? 48   A   0 N3    1 
ATOM   831   C  C4    . A   A  1  48   ? 69.148  141.688 31.901  1.00 45.89  ? 48   A   0 C4    1 
ATOM   832   P  P     . A   A  1  49   ? 63.284  144.224 31.050  1.00 40.63  ? 49   A   0 P     1 
ATOM   833   O  OP1   . A   A  1  49   ? 61.887  144.235 30.545  1.00 40.62  ? 49   A   0 OP1   1 
ATOM   834   O  OP2   . A   A  1  49   ? 63.954  145.505 31.382  1.00 42.06  ? 49   A   0 OP2   1 
ATOM   835   O  "O5'" . A   A  1  49   ? 63.350  143.287 32.334  1.00 40.27  ? 49   A   0 "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  49   ? 62.783  141.974 32.314  1.00 38.58  ? 49   A   0 "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  49   ? 63.332  141.153 33.448  1.00 38.29  ? 49   A   0 "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  49   ? 64.754  140.954 33.259  1.00 40.39  ? 49   A   0 "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  49   ? 63.246  141.781 34.827  1.00 37.56  ? 49   A   0 "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  49   ? 61.971  141.633 35.409  1.00 35.80  ? 49   A   0 "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  49   ? 64.290  140.992 35.592  1.00 39.71  ? 49   A   0 "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  49   ? 63.818  139.725 35.996  1.00 39.70  ? 49   A   0 "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  49   ? 65.386  140.853 34.531  1.00 43.29  ? 49   A   0 "C1'" 1 
ATOM   844   N  N9    . A   A  1  49   ? 66.344  141.948 34.675  1.00 46.28  ? 49   A   0 N9    1 
ATOM   845   C  C8    . A   A  1  49   ? 66.326  143.187 34.084  1.00 46.95  ? 49   A   0 C8    1 
ATOM   846   N  N7    . A   A  1  49   ? 67.278  143.984 34.501  1.00 47.84  ? 49   A   0 N7    1 
ATOM   847   C  C5    . A   A  1  49   ? 67.985  143.213 35.412  1.00 46.88  ? 49   A   0 C5    1 
ATOM   848   C  C6    . A   A  1  49   ? 69.104  143.487 36.219  1.00 46.66  ? 49   A   0 C6    1 
ATOM   849   N  N6    . A   A  1  49   ? 69.728  144.665 36.252  1.00 44.79  ? 49   A   0 N6    1 
ATOM   850   N  N1    . A   A  1  49   ? 69.561  142.495 37.011  1.00 48.32  ? 49   A   0 N1    1 
ATOM   851   C  C2    . A   A  1  49   ? 68.925  141.314 36.995  1.00 48.63  ? 49   A   0 C2    1 
ATOM   852   N  N3    . A   A  1  49   ? 67.862  140.940 36.289  1.00 48.31  ? 49   A   0 N3    1 
ATOM   853   C  C4    . A   A  1  49   ? 67.435  141.948 35.509  1.00 47.37  ? 49   A   0 C4    1 
ATOM   854   P  P     . G   A  1  50   ? 61.289  142.879 36.142  1.00 36.11  ? 50   G   0 P     1 
ATOM   855   O  OP1   . G   A  1  50   ? 59.997  142.409 36.685  1.00 37.30  ? 50   G   0 OP1   1 
ATOM   856   O  OP2   . G   A  1  50   ? 61.324  144.047 35.233  1.00 38.90  ? 50   G   0 OP2   1 
ATOM   857   O  "O5'" . G   A  1  50   ? 62.267  143.213 37.346  1.00 36.91  ? 50   G   0 "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  50   ? 62.536  142.251 38.362  1.00 37.56  ? 50   G   0 "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  50   ? 63.675  142.721 39.230  1.00 37.89  ? 50   G   0 "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  50   ? 64.897  142.793 38.449  1.00 39.04  ? 50   G   0 "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  50   ? 63.542  144.120 39.794  1.00 36.82  ? 50   G   0 "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  50   ? 62.697  144.167 40.925  1.00 38.62  ? 50   G   0 "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  50   ? 64.980  144.429 40.146  1.00 37.45  ? 50   G   0 "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  50   ? 65.376  143.724 41.304  1.00 35.59  ? 50   G   0 "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  50   ? 65.696  143.864 38.917  1.00 38.71  ? 50   G   0 "C1'" 1 
ATOM   866   N  N9    . G   A  1  50   ? 65.777  144.867 37.856  1.00 41.02  ? 50   G   0 N9    1 
ATOM   867   C  C8    . G   A  1  50   ? 64.985  144.962 36.738  1.00 41.20  ? 50   G   0 C8    1 
ATOM   868   N  N7    . G   A  1  50   ? 65.260  146.004 36.003  1.00 42.43  ? 50   G   0 N7    1 
ATOM   869   C  C5    . G   A  1  50   ? 66.307  146.627 36.668  1.00 42.87  ? 50   G   0 C5    1 
ATOM   870   C  C6    . G   A  1  50   ? 67.023  147.816 36.357  1.00 43.70  ? 50   G   0 C6    1 
ATOM   871   O  O6    . G   A  1  50   ? 66.868  148.588 35.402  1.00 44.14  ? 50   G   0 O6    1 
ATOM   872   N  N1    . G   A  1  50   ? 68.005  148.077 37.303  1.00 44.58  ? 50   G   0 N1    1 
ATOM   873   C  C2    . G   A  1  50   ? 68.267  147.306 38.404  1.00 43.68  ? 50   G   0 C2    1 
ATOM   874   N  N2    . G   A  1  50   ? 69.260  147.721 39.195  1.00 45.05  ? 50   G   0 N2    1 
ATOM   875   N  N3    . G   A  1  50   ? 67.607  146.209 38.707  1.00 43.09  ? 50   G   0 N3    1 
ATOM   876   C  C4    . G   A  1  50   ? 66.648  145.929 37.804  1.00 42.07  ? 50   G   0 C4    1 
ATOM   877   P  P     . G   A  1  51   ? 61.942  145.532 41.291  1.00 39.80  ? 51   G   0 P     1 
ATOM   878   O  OP1   . G   A  1  51   ? 61.098  145.251 42.485  1.00 39.20  ? 51   G   0 OP1   1 
ATOM   879   O  OP2   . G   A  1  51   ? 61.310  146.067 40.057  1.00 38.76  ? 51   G   0 OP2   1 
ATOM   880   O  "O5'" . G   A  1  51   ? 63.125  146.520 41.707  1.00 38.35  ? 51   G   0 "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  51   ? 63.889  146.298 42.907  1.00 36.39  ? 51   G   0 "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  51   ? 65.049  147.261 42.987  1.00 35.39  ? 51   G   0 "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  51   ? 65.845  147.137 41.779  1.00 37.50  ? 51   G   0 "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  51   ? 64.735  148.746 43.035  1.00 34.73  ? 51   G   0 "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  51   ? 64.367  149.190 44.330  1.00 34.00  ? 51   G   0 "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  51   ? 66.061  149.342 42.598  1.00 35.59  ? 51   G   0 "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  51   ? 67.033  149.284 43.614  1.00 37.01  ? 51   G   0 "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  51   ? 66.455  148.379 41.480  1.00 37.34  ? 51   G   0 "C1'" 1 
ATOM   889   N  N9    . G   A  1  51   ? 65.944  148.859 40.201  1.00 39.91  ? 51   G   0 N9    1 
ATOM   890   C  C8    . G   A  1  51   ? 64.934  148.326 39.436  1.00 40.21  ? 51   G   0 C8    1 
ATOM   891   N  N7    . G   A  1  51   ? 64.677  149.031 38.368  1.00 40.07  ? 51   G   0 N7    1 
ATOM   892   C  C5    . G   A  1  51   ? 65.578  150.083 38.428  1.00 40.90  ? 51   G   0 C5    1 
ATOM   893   C  C6    . G   A  1  51   ? 65.768  151.180 37.560  1.00 42.06  ? 51   G   0 C6    1 
ATOM   894   O  O6    . G   A  1  51   ? 65.156  151.456 36.523  1.00 43.69  ? 51   G   0 O6    1 
ATOM   895   N  N1    . G   A  1  51   ? 66.787  152.012 38.006  1.00 41.69  ? 51   G   0 N1    1 
ATOM   896   C  C2    . G   A  1  51   ? 67.523  151.816 39.144  1.00 40.18  ? 51   G   0 C2    1 
ATOM   897   N  N2    . G   A  1  51   ? 68.452  152.728 39.418  1.00 40.79  ? 51   G   0 N2    1 
ATOM   898   N  N3    . G   A  1  51   ? 67.357  150.802 39.957  1.00 40.65  ? 51   G   0 N3    1 
ATOM   899   C  C4    . G   A  1  51   ? 66.375  149.981 39.545  1.00 40.45  ? 51   G   0 C4    1 
ATOM   900   P  P     . A   A  1  52   ? 63.611  150.604 44.508  1.00 36.86  ? 52   A   0 P     1 
ATOM   901   O  OP1   . A   A  1  52   ? 63.352  150.770 45.963  1.00 37.44  ? 52   A   0 OP1   1 
ATOM   902   O  OP2   . A   A  1  52   ? 62.481  150.729 43.545  1.00 35.86  ? 52   A   0 OP2   1 
ATOM   903   O  "O5'" . A   A  1  52   ? 64.704  151.676 44.083  1.00 36.24  ? 52   A   0 "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  52   ? 65.901  151.850 44.849  1.00 36.34  ? 52   A   0 "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  52   ? 66.652  153.047 44.344  1.00 37.07  ? 52   A   0 "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  52   ? 67.064  152.807 42.975  1.00 37.37  ? 52   A   0 "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  52   ? 65.829  154.319 44.271  1.00 37.25  ? 52   A   0 "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  52   ? 65.803  154.980 45.527  1.00 38.08  ? 52   A   0 "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  52   ? 66.577  155.111 43.214  1.00 38.20  ? 52   A   0 "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  52   ? 67.754  155.688 43.740  1.00 37.22  ? 52   A   0 "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  52   ? 66.948  154.002 42.227  1.00 38.26  ? 52   A   0 "C1'" 1 
ATOM   912   N  N9    . A   A  1  52   ? 65.934  153.777 41.196  1.00 40.14  ? 52   A   0 N9    1 
ATOM   913   C  C8    . A   A  1  52   ? 64.981  152.790 41.174  1.00 40.99  ? 52   A   0 C8    1 
ATOM   914   N  N7    . A   A  1  52   ? 64.225  152.810 40.108  1.00 40.35  ? 52   A   0 N7    1 
ATOM   915   C  C5    . A   A  1  52   ? 64.704  153.885 39.381  1.00 39.87  ? 52   A   0 C5    1 
ATOM   916   C  C6    . A   A  1  52   ? 64.329  154.422 38.150  1.00 40.72  ? 52   A   0 C6    1 
ATOM   917   N  N6    . A   A  1  52   ? 63.346  153.924 37.399  1.00 41.93  ? 52   A   0 N6    1 
ATOM   918   N  N1    . A   A  1  52   ? 65.004  155.499 37.705  1.00 40.30  ? 52   A   0 N1    1 
ATOM   919   C  C2    . A   A  1  52   ? 65.989  155.992 38.459  1.00 40.00  ? 52   A   0 C2    1 
ATOM   920   N  N3    . A   A  1  52   ? 66.439  155.573 39.632  1.00 39.92  ? 52   A   0 N3    1 
ATOM   921   C  C4    . A   A  1  52   ? 65.748  154.500 40.043  1.00 40.49  ? 52   A   0 C4    1 
ATOM   922   P  P     . C   A  1  53   ? 64.597  155.975 45.879  1.00 37.67  ? 53   C   0 P     1 
ATOM   923   O  OP1   . C   A  1  53   ? 64.964  156.647 47.155  1.00 33.83  ? 53   C   0 OP1   1 
ATOM   924   O  OP2   . C   A  1  53   ? 63.321  155.227 45.785  1.00 38.82  ? 53   C   0 OP2   1 
ATOM   925   O  "O5'" . C   A  1  53   ? 64.635  157.048 44.701  1.00 37.31  ? 53   C   0 "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  53   ? 65.677  158.026 44.647  1.00 37.21  ? 53   C   0 "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  53   ? 65.541  158.888 43.420  1.00 38.77  ? 53   C   0 "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  53   ? 65.727  158.089 42.219  1.00 40.52  ? 53   C   0 "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  53   ? 64.210  159.575 43.179  1.00 39.59  ? 53   C   0 "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  53   ? 64.018  160.723 44.004  1.00 40.70  ? 53   C   0 "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  53   ? 64.341  159.934 41.706  1.00 39.96  ? 53   C   0 "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  53   ? 65.230  161.013 41.509  1.00 41.64  ? 53   C   0 "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  53   ? 64.991  158.666 41.150  1.00 40.23  ? 53   C   0 "C1'" 1 
ATOM   934   N  N1    . C   A  1  53   ? 63.963  157.708 40.691  1.00 41.32  ? 53   C   0 N1    1 
ATOM   935   C  C2    . C   A  1  53   ? 63.459  157.827 39.381  1.00 41.26  ? 53   C   0 C2    1 
ATOM   936   O  O2    . C   A  1  53   ? 63.933  158.693 38.622  1.00 41.46  ? 53   C   0 O2    1 
ATOM   937   N  N3    . C   A  1  53   ? 62.469  156.997 38.980  1.00 40.49  ? 53   C   0 N3    1 
ATOM   938   C  C4    . C   A  1  53   ? 61.983  156.079 39.818  1.00 40.27  ? 53   C   0 C4    1 
ATOM   939   N  N4    . C   A  1  53   ? 60.982  155.312 39.391  1.00 38.85  ? 53   C   0 N4    1 
ATOM   940   C  C5    . C   A  1  53   ? 62.497  155.913 41.136  1.00 40.60  ? 53   C   0 C5    1 
ATOM   941   C  C6    . C   A  1  53   ? 63.478  156.738 41.527  1.00 41.21  ? 53   C   0 C6    1 
ATOM   942   P  P     . G   A  1  54   ? 62.638  161.555 43.913  1.00 41.89  ? 54   G   0 P     1 
ATOM   943   O  OP1   . G   A  1  54   ? 62.726  162.664 44.889  1.00 41.81  ? 54   G   0 OP1   1 
ATOM   944   O  OP2   . G   A  1  54   ? 61.474  160.633 43.963  1.00 41.55  ? 54   G   0 OP2   1 
ATOM   945   O  "O5'" . G   A  1  54   ? 62.707  162.189 42.458  1.00 39.65  ? 54   G   0 "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  54   ? 61.532  162.640 41.786  1.00 39.10  ? 54   G   0 "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  54   ? 61.811  162.775 40.313  1.00 40.21  ? 54   G   0 "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  54   ? 62.350  161.537 39.784  1.00 40.96  ? 54   G   0 "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  54   ? 60.601  163.108 39.464  1.00 41.71  ? 54   G   0 "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  54   ? 60.473  164.512 39.332  1.00 41.96  ? 54   G   0 "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  54   ? 60.903  162.410 38.146  1.00 42.96  ? 54   G   0 "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  54   ? 61.795  163.145 37.336  1.00 45.23  ? 54   G   0 "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  54   ? 61.612  161.149 38.643  1.00 42.61  ? 54   G   0 "C1'" 1 
ATOM   954   N  N9    . G   A  1  54   ? 60.718  160.067 39.048  1.00 43.38  ? 54   G   0 N9    1 
ATOM   955   C  C8    . G   A  1  54   ? 60.620  159.522 40.304  1.00 42.87  ? 54   G   0 C8    1 
ATOM   956   N  N7    . G   A  1  54   ? 59.783  158.528 40.366  1.00 44.77  ? 54   G   0 N7    1 
ATOM   957   C  C5    . G   A  1  54   ? 59.290  158.412 39.075  1.00 44.03  ? 54   G   0 C5    1 
ATOM   958   C  C6    . G   A  1  54   ? 58.368  157.493 38.531  1.00 43.89  ? 54   G   0 C6    1 
ATOM   959   O  O6    . G   A  1  54   ? 57.804  156.550 39.087  1.00 44.64  ? 54   G   0 O6    1 
ATOM   960   N  N1    . G   A  1  54   ? 58.134  157.741 37.188  1.00 44.26  ? 54   G   0 N1    1 
ATOM   961   C  C2    . G   A  1  54   ? 58.723  158.732 36.457  1.00 42.94  ? 54   G   0 C2    1 
ATOM   962   N  N2    . G   A  1  54   ? 58.353  158.804 35.179  1.00 43.42  ? 54   G   0 N2    1 
ATOM   963   N  N3    . G   A  1  54   ? 59.605  159.584 36.943  1.00 42.82  ? 54   G   0 N3    1 
ATOM   964   C  C4    . G   A  1  54   ? 59.839  159.369 38.253  1.00 43.49  ? 54   G   0 C4    1 
ATOM   965   P  P     . U   A  1  55   ? 59.065  165.204 39.619  1.00 43.91  ? 55   U   0 P     1 
ATOM   966   O  OP1   . U   A  1  55   ? 59.214  166.666 39.451  1.00 44.38  ? 55   U   0 OP1   1 
ATOM   967   O  OP2   . U   A  1  55   ? 58.532  164.660 40.892  1.00 44.78  ? 55   U   0 OP2   1 
ATOM   968   O  "O5'" . U   A  1  55   ? 58.146  164.660 38.448  1.00 44.85  ? 55   U   0 "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  55   ? 58.482  164.874 37.078  1.00 46.77  ? 55   U   0 "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  55   ? 57.516  164.116 36.216  1.00 50.00  ? 55   U   0 "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  55   ? 57.771  162.697 36.356  1.00 51.75  ? 55   U   0 "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  55   ? 56.064  164.291 36.637  1.00 49.42  ? 55   U   0 "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  55   ? 55.508  165.455 36.040  1.00 48.91  ? 55   U   0 "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  55   ? 55.414  163.015 36.130  1.00 51.31  ? 55   U   0 "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  55   ? 55.114  163.087 34.755  1.00 52.89  ? 55   U   0 "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  55   ? 56.538  161.992 36.343  1.00 53.59  ? 55   U   0 "C1'" 1 
ATOM   977   N  N1    . U   A  1  55   ? 56.425  161.192 37.577  1.00 54.19  ? 55   U   0 N1    1 
ATOM   978   C  C2    . U   A  1  55   ? 55.639  160.056 37.531  1.00 53.82  ? 55   U   0 C2    1 
ATOM   979   O  O2    . U   A  1  55   ? 55.059  159.692 36.525  1.00 53.46  ? 55   U   0 O2    1 
ATOM   980   N  N3    . U   A  1  55   ? 55.559  159.358 38.708  1.00 54.99  ? 55   U   0 N3    1 
ATOM   981   C  C4    . U   A  1  55   ? 56.173  159.663 39.900  1.00 54.44  ? 55   U   0 C4    1 
ATOM   982   O  O4    . U   A  1  55   ? 55.992  158.935 40.876  1.00 54.20  ? 55   U   0 O4    1 
ATOM   983   C  C5    . U   A  1  55   ? 56.977  160.842 39.869  1.00 54.85  ? 55   U   0 C5    1 
ATOM   984   C  C6    . U   A  1  55   ? 57.073  161.550 38.739  1.00 54.71  ? 55   U   0 C6    1 
ATOM   985   P  P     . G   A  1  56   ? 54.516  166.392 36.884  1.00 50.06  ? 56   G   0 P     1 
ATOM   986   O  OP1   . G   A  1  56   ? 54.184  167.570 36.045  1.00 50.06  ? 56   G   0 OP1   1 
ATOM   987   O  OP2   . G   A  1  56   ? 55.089  166.597 38.233  1.00 50.20  ? 56   G   0 OP2   1 
ATOM   988   O  "O5'" . G   A  1  56   ? 53.192  165.522 37.006  1.00 50.55  ? 56   G   0 "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  56   ? 52.491  165.118 35.829  1.00 49.74  ? 56   G   0 "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  56   ? 51.008  165.211 36.049  1.00 50.26  ? 56   G   0 "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  56   ? 50.584  164.113 36.896  1.00 52.20  ? 56   G   0 "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  56   ? 50.492  166.484 36.708  1.00 50.28  ? 56   G   0 "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  56   ? 49.227  166.793 36.137  1.00 52.60  ? 56   G   0 "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  56   ? 50.307  166.050 38.160  1.00 49.11  ? 56   G   0 "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  56   ? 49.318  166.791 38.836  1.00 47.14  ? 56   G   0 "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  56   ? 49.826  164.615 37.973  1.00 51.43  ? 56   G   0 "C1'" 1 
ATOM   997   N  N9    . G   A  1  56   ? 49.975  163.702 39.105  1.00 54.04  ? 56   G   0 N9    1 
ATOM   998   C  C8    . G   A  1  56   ? 50.684  163.901 40.270  1.00 54.42  ? 56   G   0 C8    1 
ATOM   999   N  N7    . G   A  1  56   ? 50.614  162.889 41.092  1.00 53.77  ? 56   G   0 N7    1 
ATOM   1000  C  C5    . G   A  1  56   ? 49.815  161.963 40.432  1.00 54.26  ? 56   G   0 C5    1 
ATOM   1001  C  C6    . G   A  1  56   ? 49.387  160.673 40.827  1.00 53.59  ? 56   G   0 C6    1 
ATOM   1002  O  O6    . G   A  1  56   ? 49.638  160.066 41.871  1.00 54.02  ? 56   G   0 O6    1 
ATOM   1003  N  N1    . G   A  1  56   ? 48.586  160.080 39.856  1.00 54.66  ? 56   G   0 N1    1 
ATOM   1004  C  C2    . G   A  1  56   ? 48.245  160.649 38.656  1.00 54.30  ? 56   G   0 C2    1 
ATOM   1005  N  N2    . G   A  1  56   ? 47.472  159.911 37.851  1.00 53.24  ? 56   G   0 N2    1 
ATOM   1006  N  N3    . G   A  1  56   ? 48.636  161.850 38.274  1.00 54.41  ? 56   G   0 N3    1 
ATOM   1007  C  C4    . G   A  1  56   ? 49.413  162.448 39.205  1.00 54.31  ? 56   G   0 C4    1 
ATOM   1008  P  P     . C   A  1  57   ? 48.998  168.215 35.426  1.00 52.45  ? 57   C   0 P     1 
ATOM   1009  O  OP1   . C   A  1  57   ? 47.709  168.165 34.687  1.00 52.89  ? 57   C   0 OP1   1 
ATOM   1010  O  OP2   . C   A  1  57   ? 50.247  168.551 34.703  1.00 51.89  ? 57   C   0 OP2   1 
ATOM   1011  O  "O5'" . C   A  1  57   ? 48.822  169.229 36.638  1.00 51.76  ? 57   C   0 "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  57   ? 49.204  170.605 36.506  1.00 51.62  ? 57   C   0 "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  57   ? 48.545  171.431 37.577  1.00 51.10  ? 57   C   0 "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  57   ? 47.117  171.499 37.342  1.00 50.03  ? 57   C   0 "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  57   ? 48.657  170.870 38.981  1.00 51.71  ? 57   C   0 "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  57   ? 49.921  171.186 39.538  1.00 54.00  ? 57   C   0 "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  57   ? 47.500  171.557 39.693  1.00 50.80  ? 57   C   0 "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  57   ? 47.793  172.894 40.052  1.00 50.25  ? 57   C   0 "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  57   ? 46.442  171.576 38.586  1.00 49.30  ? 57   C   0 "C1'" 1 
ATOM   1020  N  N1    . C   A  1  57   ? 45.438  170.498 38.656  1.00 47.84  ? 57   C   0 N1    1 
ATOM   1021  C  C2    . C   A  1  57   ? 44.410  170.606 39.598  1.00 47.50  ? 57   C   0 C2    1 
ATOM   1022  O  O2    . C   A  1  57   ? 44.418  171.561 40.381  1.00 48.67  ? 57   C   0 O2    1 
ATOM   1023  N  N3    . C   A  1  57   ? 43.441  169.666 39.638  1.00 46.98  ? 57   C   0 N3    1 
ATOM   1024  C  C4    . C   A  1  57   ? 43.479  168.636 38.792  1.00 48.20  ? 57   C   0 C4    1 
ATOM   1025  N  N4    . C   A  1  57   ? 42.488  167.741 38.856  1.00 47.93  ? 57   C   0 N4    1 
ATOM   1026  C  C5    . C   A  1  57   ? 44.534  168.479 37.841  1.00 47.82  ? 57   C   0 C5    1 
ATOM   1027  C  C6    . C   A  1  57   ? 45.486  169.424 37.810  1.00 47.47  ? 57   C   0 C6    1 
ATOM   1028  P  P     . C   A  1  58   ? 50.622  170.161 40.552  1.00 55.71  ? 58   C   0 P     1 
ATOM   1029  O  OP1   . C   A  1  58   ? 51.915  170.783 40.925  1.00 55.25  ? 58   C   0 OP1   1 
ATOM   1030  O  OP2   . C   A  1  58   ? 50.605  168.791 39.985  1.00 55.79  ? 58   C   0 OP2   1 
ATOM   1031  O  "O5'" . C   A  1  58   ? 49.660  170.177 41.814  1.00 54.49  ? 58   C   0 "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  58   ? 49.498  171.369 42.575  1.00 56.05  ? 58   C   0 "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  58   ? 48.378  171.202 43.553  1.00 57.95  ? 58   C   0 "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  58   ? 47.129  171.050 42.843  1.00 58.83  ? 58   C   0 "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  58   ? 48.436  169.931 44.369  1.00 59.81  ? 58   C   0 "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  58   ? 49.384  170.032 45.410  1.00 62.37  ? 58   C   0 "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  58   ? 47.009  169.828 44.879  1.00 60.28  ? 58   C   0 "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  58   ? 46.748  170.680 45.976  1.00 61.77  ? 58   C   0 "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  58   ? 46.229  170.315 43.655  1.00 59.61  ? 58   C   0 "C1'" 1 
ATOM   1040  N  N1    . C   A  1  58   ? 45.670  169.200 42.878  1.00 58.73  ? 58   C   0 N1    1 
ATOM   1041  C  C2    . C   A  1  58   ? 44.409  168.734 43.226  1.00 58.50  ? 58   C   0 C2    1 
ATOM   1042  O  O2    . C   A  1  58   ? 43.804  169.295 44.147  1.00 57.18  ? 58   C   0 O2    1 
ATOM   1043  N  N3    . C   A  1  58   ? 43.877  167.688 42.556  1.00 59.85  ? 58   C   0 N3    1 
ATOM   1044  C  C4    . C   A  1  58   ? 44.561  167.115 41.565  1.00 60.47  ? 58   C   0 C4    1 
ATOM   1045  N  N4    . C   A  1  58   ? 43.998  166.078 40.938  1.00 61.23  ? 58   C   0 N4    1 
ATOM   1046  C  C5    . C   A  1  58   ? 45.853  167.579 41.175  1.00 59.84  ? 58   C   0 C5    1 
ATOM   1047  C  C6    . C   A  1  58   ? 46.364  168.618 41.852  1.00 59.76  ? 58   C   0 C6    1 
ATOM   1048  P  P     . A   A  1  59   ? 50.735  169.173 45.325  1.00 64.88  ? 59   A   0 P     1 
ATOM   1049  O  OP1   . A   A  1  59   ? 51.437  169.365 46.631  1.00 64.85  ? 59   A   0 OP1   1 
ATOM   1050  O  OP2   . A   A  1  59   ? 51.434  169.505 44.051  1.00 64.23  ? 59   A   0 OP2   1 
ATOM   1051  O  "O5'" . A   A  1  59   ? 50.223  167.668 45.210  1.00 63.10  ? 59   A   0 "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  59   ? 49.616  167.014 46.334  1.00 58.85  ? 59   A   0 "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  59   ? 49.844  165.524 46.262  1.00 57.07  ? 59   A   0 "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  59   ? 48.798  164.901 45.471  1.00 56.28  ? 59   A   0 "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  59   ? 51.177  165.057 45.676  1.00 55.13  ? 59   A   0 "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  59   ? 51.704  163.987 46.457  1.00 54.46  ? 59   A   0 "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  59   ? 50.770  164.546 44.294  1.00 54.77  ? 59   A   0 "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  59   ? 51.618  163.523 43.823  1.00 54.98  ? 59   A   0 "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  59   ? 49.379  163.986 44.576  1.00 54.60  ? 59   A   0 "C1'" 1 
ATOM   1060  N  N9    . A   A  1  59   ? 48.495  163.857 43.419  1.00 55.45  ? 59   A   0 N9    1 
ATOM   1061  C  C8    . A   A  1  59   ? 48.359  164.705 42.351  1.00 56.00  ? 59   A   0 C8    1 
ATOM   1062  N  N7    . A   A  1  59   ? 47.485  164.301 41.462  1.00 57.22  ? 59   A   0 N7    1 
ATOM   1063  C  C5    . A   A  1  59   ? 47.007  163.106 41.981  1.00 57.63  ? 59   A   0 C5    1 
ATOM   1064  C  C6    . A   A  1  59   ? 46.060  162.174 41.507  1.00 58.38  ? 59   A   0 C6    1 
ATOM   1065  N  N6    . A   A  1  59   ? 45.411  162.296 40.344  1.00 57.48  ? 59   A   0 N6    1 
ATOM   1066  N  N1    . A   A  1  59   ? 45.806  161.092 42.276  1.00 57.97  ? 59   A   0 N1    1 
ATOM   1067  C  C2    . A   A  1  59   ? 46.470  160.957 43.428  1.00 56.52  ? 59   A   0 C2    1 
ATOM   1068  N  N3    . A   A  1  59   ? 47.388  161.752 43.972  1.00 57.17  ? 59   A   0 N3    1 
ATOM   1069  C  C4    . A   A  1  59   ? 47.615  162.824 43.191  1.00 57.15  ? 59   A   0 C4    1 
ATOM   1070  P  P     . A   A  1  60   ? 53.164  164.127 47.125  1.00 51.89  ? 60   A   0 P     1 
ATOM   1071  O  OP1   . A   A  1  60   ? 53.114  165.227 48.118  1.00 51.02  ? 60   A   0 OP1   1 
ATOM   1072  O  OP2   . A   A  1  60   ? 54.175  164.155 46.041  1.00 52.66  ? 60   A   0 OP2   1 
ATOM   1073  O  "O5'" . A   A  1  60   ? 53.348  162.757 47.899  1.00 50.07  ? 60   A   0 "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  60   ? 54.063  162.686 49.134  1.00 47.57  ? 60   A   0 "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  60   ? 53.460  161.609 49.999  1.00 46.93  ? 60   A   0 "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  60   ? 52.135  162.020 50.433  1.00 45.63  ? 60   A   0 "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  60   ? 53.223  160.290 49.284  1.00 44.73  ? 60   A   0 "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  60   ? 54.387  159.494 49.242  1.00 43.58  ? 60   A   0 "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  60   ? 52.121  159.665 50.116  1.00 45.49  ? 60   A   0 "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  60   ? 52.623  159.089 51.302  1.00 47.07  ? 60   A   0 "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  60   ? 51.266  160.896 50.437  1.00 46.28  ? 60   A   0 "C1'" 1 
ATOM   1082  N  N9    . A   A  1  60   ? 50.246  161.120 49.415  1.00 47.01  ? 60   A   0 N9    1 
ATOM   1083  C  C8    . A   A  1  60   ? 50.183  162.146 48.503  1.00 47.37  ? 60   A   0 C8    1 
ATOM   1084  N  N7    . A   A  1  60   ? 49.179  162.050 47.669  1.00 47.84  ? 60   A   0 N7    1 
ATOM   1085  C  C5    . A   A  1  60   ? 48.528  160.889 48.062  1.00 48.55  ? 60   A   0 C5    1 
ATOM   1086  C  C6    . A   A  1  60   ? 47.398  160.225 47.561  1.00 48.63  ? 60   A   0 C6    1 
ATOM   1087  N  N6    . A   A  1  60   ? 46.694  160.654 46.517  1.00 47.74  ? 60   A   0 N6    1 
ATOM   1088  N  N1    . A   A  1  60   ? 47.013  159.085 48.178  1.00 50.44  ? 60   A   0 N1    1 
ATOM   1089  C  C2    . A   A  1  60   ? 47.723  158.654 49.230  1.00 49.80  ? 60   A   0 C2    1 
ATOM   1090  N  N3    . A   A  1  60   ? 48.804  159.191 49.793  1.00 49.51  ? 60   A   0 N3    1 
ATOM   1091  C  C4    . A   A  1  60   ? 49.163  160.317 49.151  1.00 48.41  ? 60   A   0 C4    1 
ATOM   1092  P  P     . G   A  1  61   ? 54.609  158.484 48.021  1.00 47.15  ? 61   G   0 P     1 
ATOM   1093  O  OP1   . G   A  1  61   ? 55.953  157.879 48.190  1.00 47.26  ? 61   G   0 OP1   1 
ATOM   1094  O  OP2   . G   A  1  61   ? 54.282  159.186 46.755  1.00 46.53  ? 61   G   0 OP2   1 
ATOM   1095  O  "O5'" . G   A  1  61   ? 53.519  157.356 48.282  1.00 47.78  ? 61   G   0 "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  61   ? 53.573  156.548 49.473  1.00 47.20  ? 61   G   0 "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  61   ? 52.485  155.496 49.456  1.00 46.26  ? 61   G   0 "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  61   ? 51.188  156.140 49.529  1.00 46.37  ? 61   G   0 "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  61   ? 52.405  154.626 48.214  1.00 45.64  ? 61   G   0 "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  61   ? 53.354  153.561 48.253  1.00 44.48  ? 61   G   0 "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  61   ? 50.961  154.145 48.259  1.00 46.49  ? 61   G   0 "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  61   ? 50.760  153.083 49.167  1.00 47.69  ? 61   G   0 "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  61   ? 50.243  155.392 48.784  1.00 47.40  ? 61   G   0 "C1'" 1 
ATOM   1104  N  N9    . G   A  1  61   ? 49.722  156.245 47.721  1.00 48.40  ? 61   G   0 N9    1 
ATOM   1105  C  C8    . G   A  1  61   ? 50.153  157.502 47.373  1.00 48.12  ? 61   G   0 C8    1 
ATOM   1106  N  N7    . G   A  1  61   ? 49.509  158.002 46.356  1.00 48.72  ? 61   G   0 N7    1 
ATOM   1107  C  C5    . G   A  1  61   ? 48.596  157.018 46.013  1.00 48.70  ? 61   G   0 C5    1 
ATOM   1108  C  C6    . G   A  1  61   ? 47.644  156.977 44.972  1.00 47.82  ? 61   G   0 C6    1 
ATOM   1109  O  O6    . G   A  1  61   ? 47.410  157.827 44.111  1.00 47.04  ? 61   G   0 O6    1 
ATOM   1110  N  N1    . G   A  1  61   ? 46.928  155.787 44.983  1.00 48.06  ? 61   G   0 N1    1 
ATOM   1111  C  C2    . G   A  1  61   ? 47.112  154.764 45.876  1.00 48.60  ? 61   G   0 C2    1 
ATOM   1112  N  N2    . G   A  1  61   ? 46.327  153.693 45.722  1.00 49.48  ? 61   G   0 N2    1 
ATOM   1113  N  N3    . G   A  1  61   ? 48.002  154.786 46.847  1.00 48.90  ? 61   G   0 N3    1 
ATOM   1114  C  C4    . G   A  1  61   ? 48.706  155.933 46.855  1.00 48.80  ? 61   G   0 C4    1 
ATOM   1115  P  P     . C   A  1  62   ? 54.069  153.078 46.893  1.00 44.98  ? 62   C   0 P     1 
ATOM   1116  O  OP1   . C   A  1  62   ? 55.070  152.046 47.233  1.00 44.02  ? 62   C   0 OP1   1 
ATOM   1117  O  OP2   . C   A  1  62   ? 54.489  154.269 46.113  1.00 45.01  ? 62   C   0 OP2   1 
ATOM   1118  O  "O5'" . C   A  1  62   ? 52.898  152.361 46.093  1.00 46.33  ? 62   C   0 "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  62   ? 52.208  151.233 46.653  1.00 46.72  ? 62   C   0 "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  62   ? 51.012  150.889 45.806  1.00 48.37  ? 62   C   0 "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  62   ? 50.041  151.963 45.883  1.00 50.97  ? 62   C   0 "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  62   ? 51.273  150.759 44.318  1.00 48.38  ? 62   C   0 "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  62   ? 51.791  149.492 43.975  1.00 49.06  ? 62   C   0 "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  62   ? 49.886  150.957 43.742  1.00 51.16  ? 62   C   0 "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  62   ? 49.085  149.806 43.888  1.00 51.12  ? 62   C   0 "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  62   ? 49.351  152.066 44.648  1.00 52.25  ? 62   C   0 "C1'" 1 
ATOM   1127  N  N1    . C   A  1  62   ? 49.594  153.404 44.081  1.00 55.11  ? 62   C   0 N1    1 
ATOM   1128  C  C2    . C   A  1  62   ? 48.669  153.923 43.167  1.00 55.82  ? 62   C   0 C2    1 
ATOM   1129  O  O2    . C   A  1  62   ? 47.676  153.240 42.865  1.00 55.93  ? 62   C   0 O2    1 
ATOM   1130  N  N3    . C   A  1  62   ? 48.882  155.153 42.637  1.00 56.17  ? 62   C   0 N3    1 
ATOM   1131  C  C4    . C   A  1  62   ? 49.964  155.851 42.986  1.00 56.44  ? 62   C   0 C4    1 
ATOM   1132  N  N4    . C   A  1  62   ? 50.132  157.056 42.445  1.00 57.08  ? 62   C   0 N4    1 
ATOM   1133  C  C5    . C   A  1  62   ? 50.923  155.344 43.908  1.00 57.98  ? 62   C   0 C5    1 
ATOM   1134  C  C6    . C   A  1  62   ? 50.701  154.129 44.428  1.00 56.57  ? 62   C   0 C6    1 
ATOM   1135  P  P     . U   A  1  63   ? 52.769  149.353 42.712  1.00 50.68  ? 63   U   0 P     1 
ATOM   1136  O  OP1   . U   A  1  63   ? 53.155  147.923 42.608  1.00 50.03  ? 63   U   0 OP1   1 
ATOM   1137  O  OP2   . U   A  1  63   ? 53.831  150.391 42.820  1.00 49.73  ? 63   U   0 OP2   1 
ATOM   1138  O  "O5'" . U   A  1  63   ? 51.826  149.707 41.477  1.00 50.01  ? 63   U   0 "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  63   ? 50.763  148.819 41.081  1.00 47.35  ? 63   U   0 "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  63   ? 49.974  149.416 39.941  1.00 46.93  ? 63   U   0 "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  63   ? 49.319  150.628 40.399  1.00 47.10  ? 63   U   0 "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  63   ? 50.774  149.872 38.732  1.00 46.73  ? 63   U   0 "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  63   ? 51.121  148.816 37.851  1.00 46.88  ? 63   U   0 "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  63   ? 49.828  150.870 38.096  1.00 47.65  ? 63   U   0 "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  63   ? 48.775  150.224 37.419  1.00 49.26  ? 63   U   0 "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  63   ? 49.270  151.570 39.338  1.00 49.31  ? 63   U   0 "C1'" 1 
ATOM   1147  N  N1    . U   A  1  63   ? 50.066  152.750 39.720  1.00 51.38  ? 63   U   0 N1    1 
ATOM   1148  C  C2    . U   A  1  63   ? 49.675  153.984 39.221  1.00 50.68  ? 63   U   0 C2    1 
ATOM   1149  O  O2    . U   A  1  63   ? 48.704  154.128 38.500  1.00 51.86  ? 63   U   0 O2    1 
ATOM   1150  N  N3    . U   A  1  63   ? 50.468  155.041 39.597  1.00 49.85  ? 63   U   0 N3    1 
ATOM   1151  C  C4    . U   A  1  63   ? 51.587  154.996 40.400  1.00 49.86  ? 63   U   0 C4    1 
ATOM   1152  O  O4    . U   A  1  63   ? 52.200  156.035 40.641  1.00 49.67  ? 63   U   0 O4    1 
ATOM   1153  C  C5    . U   A  1  63   ? 51.925  153.693 40.882  1.00 50.54  ? 63   U   0 C5    1 
ATOM   1154  C  C6    . U   A  1  63   ? 51.175  152.642 40.539  1.00 50.80  ? 63   U   0 C6    1 
ATOM   1155  P  P     . G   A  1  64   ? 52.524  148.875 37.061  1.00 48.78  ? 64   G   0 P     1 
ATOM   1156  O  OP1   . G   A  1  64   ? 52.750  147.582 36.369  1.00 46.99  ? 64   G   0 OP1   1 
ATOM   1157  O  OP2   . G   A  1  64   ? 53.556  149.387 38.000  1.00 47.99  ? 64   G   0 OP2   1 
ATOM   1158  O  "O5'" . G   A  1  64   ? 52.267  149.979 35.943  1.00 49.45  ? 64   G   0 "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  64   ? 51.113  149.902 35.091  1.00 48.68  ? 64   G   0 "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  64   ? 50.880  151.220 34.395  1.00 50.20  ? 64   G   0 "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  64   ? 50.541  152.256 35.355  1.00 51.96  ? 64   G   0 "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  64   ? 52.073  151.793 33.661  1.00 49.35  ? 64   G   0 "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  64   ? 52.248  151.168 32.406  1.00 48.18  ? 64   G   0 "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  64   ? 51.691  153.260 33.537  1.00 50.58  ? 64   G   0 "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  64   ? 50.737  153.488 32.520  1.00 49.91  ? 64   G   0 "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  64   ? 51.034  153.507 34.895  1.00 52.09  ? 64   G   0 "C1'" 1 
ATOM   1167  N  N9    . G   A  1  64   ? 51.967  154.031 35.889  1.00 54.21  ? 64   G   0 N9    1 
ATOM   1168  C  C8    . G   A  1  64   ? 52.511  153.351 36.951  1.00 55.48  ? 64   G   0 C8    1 
ATOM   1169  N  N7    . G   A  1  64   ? 53.307  154.086 37.677  1.00 56.49  ? 64   G   0 N7    1 
ATOM   1170  C  C5    . G   A  1  64   ? 53.291  155.326 37.057  1.00 56.31  ? 64   G   0 C5    1 
ATOM   1171  C  C6    . G   A  1  64   ? 53.967  156.522 37.391  1.00 57.16  ? 64   G   0 C6    1 
ATOM   1172  O  O6    . G   A  1  64   ? 54.741  156.730 38.332  1.00 57.74  ? 64   G   0 O6    1 
ATOM   1173  N  N1    . G   A  1  64   ? 53.672  157.543 36.494  1.00 56.27  ? 64   G   0 N1    1 
ATOM   1174  C  C2    . G   A  1  64   ? 52.840  157.427 35.414  1.00 54.60  ? 64   G   0 C2    1 
ATOM   1175  N  N2    . G   A  1  64   ? 52.694  158.523 34.672  1.00 52.73  ? 64   G   0 N2    1 
ATOM   1176  N  N3    . G   A  1  64   ? 52.202  156.316 35.089  1.00 55.44  ? 64   G   0 N3    1 
ATOM   1177  C  C4    . G   A  1  64   ? 52.472  155.311 35.950  1.00 55.22  ? 64   G   0 C4    1 
ATOM   1178  P  P     . C   A  1  65   ? 53.727  150.838 31.894  1.00 47.76  ? 65   C   0 P     1 
ATOM   1179  O  OP1   . C   A  1  65   ? 53.590  150.018 30.668  1.00 49.41  ? 65   C   0 OP1   1 
ATOM   1180  O  OP2   . C   A  1  65   ? 54.506  150.316 33.039  1.00 47.77  ? 65   C   0 OP2   1 
ATOM   1181  O  "O5'" . C   A  1  65   ? 54.318  152.261 31.489  1.00 49.34  ? 65   C   0 "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  65   ? 53.654  153.089 30.508  1.00 49.38  ? 65   C   0 "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  65   ? 54.067  154.535 30.667  1.00 49.17  ? 65   C   0 "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  65   ? 53.694  155.004 31.990  1.00 50.14  ? 65   C   0 "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  65   ? 55.559  154.809 30.589  1.00 48.97  ? 65   C   0 "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  65   ? 56.003  154.920 29.251  1.00 47.84  ? 65   C   0 "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  65   ? 55.687  156.129 31.331  1.00 49.94  ? 65   C   0 "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  65   ? 55.331  157.240 30.535  1.00 49.44  ? 65   C   0 "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  65   ? 54.658  155.942 32.449  1.00 51.02  ? 65   C   0 "C1'" 1 
ATOM   1190  N  N1    . C   A  1  65   ? 55.258  155.447 33.703  1.00 51.57  ? 65   C   0 N1    1 
ATOM   1191  C  C2    . C   A  1  65   ? 55.920  156.359 34.537  1.00 52.41  ? 65   C   0 C2    1 
ATOM   1192  O  O2    . C   A  1  65   ? 55.978  157.552 34.200  1.00 53.41  ? 65   C   0 O2    1 
ATOM   1193  N  N3    . C   A  1  65   ? 56.480  155.920 35.684  1.00 51.10  ? 65   C   0 N3    1 
ATOM   1194  C  C4    . C   A  1  65   ? 56.404  154.634 36.012  1.00 50.44  ? 65   C   0 C4    1 
ATOM   1195  N  N4    . C   A  1  65   ? 56.973  154.251 37.149  1.00 51.19  ? 65   C   0 N4    1 
ATOM   1196  C  C5    . C   A  1  65   ? 55.739  153.684 35.186  1.00 51.85  ? 65   C   0 C5    1 
ATOM   1197  C  C6    . C   A  1  65   ? 55.184  154.128 34.053  1.00 51.62  ? 65   C   0 C6    1 
ATOM   1198  P  P     . G   A  1  66   ? 57.554  154.701 28.910  1.00 49.87  ? 66   G   0 P     1 
ATOM   1199  O  OP1   . G   A  1  66   ? 57.680  154.679 27.429  1.00 50.15  ? 66   G   0 OP1   1 
ATOM   1200  O  OP2   . G   A  1  66   ? 58.021  153.538 29.702  1.00 48.79  ? 66   G   0 OP2   1 
ATOM   1201  O  "O5'" . G   A  1  66   ? 58.286  156.000 29.478  1.00 47.52  ? 66   G   0 "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  66   ? 57.920  157.321 29.029  1.00 45.56  ? 66   G   0 "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  66   ? 58.854  158.359 29.616  1.00 43.98  ? 66   G   0 "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  66   ? 58.852  158.245 31.064  1.00 44.42  ? 66   G   0 "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  66   ? 60.315  158.273 29.201  1.00 43.66  ? 66   G   0 "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  66   ? 60.862  159.587 29.273  1.00 45.30  ? 66   G   0 "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  66   ? 60.922  157.430 30.317  1.00 42.87  ? 66   G   0 "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  66   ? 62.311  157.643 30.471  1.00 40.80  ? 66   G   0 "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  66   ? 60.159  157.960 31.529  1.00 42.19  ? 66   G   0 "C1'" 1 
ATOM   1210  N  N9    . G   A  1  66   ? 60.042  157.034 32.652  1.00 41.62  ? 66   G   0 N9    1 
ATOM   1211  C  C8    . G   A  1  66   ? 59.234  155.926 32.723  1.00 41.82  ? 66   G   0 C8    1 
ATOM   1212  N  N7    . G   A  1  66   ? 59.290  155.322 33.878  1.00 42.24  ? 66   G   0 N7    1 
ATOM   1213  C  C5    . G   A  1  66   ? 60.201  156.067 34.613  1.00 41.30  ? 66   G   0 C5    1 
ATOM   1214  C  C6    . G   A  1  66   ? 60.656  155.904 35.948  1.00 40.40  ? 66   G   0 C6    1 
ATOM   1215  O  O6    . G   A  1  66   ? 60.332  155.044 36.775  1.00 38.13  ? 66   G   0 O6    1 
ATOM   1216  N  N1    . G   A  1  66   ? 61.578  156.882 36.293  1.00 40.00  ? 66   G   0 N1    1 
ATOM   1217  C  C2    . G   A  1  66   ? 62.009  157.886 35.469  1.00 39.93  ? 66   G   0 C2    1 
ATOM   1218  N  N2    . G   A  1  66   ? 62.914  158.718 35.985  1.00 40.58  ? 66   G   0 N2    1 
ATOM   1219  N  N3    . G   A  1  66   ? 61.589  158.058 34.230  1.00 41.64  ? 66   G   0 N3    1 
ATOM   1220  C  C4    . G   A  1  66   ? 60.689  157.118 33.868  1.00 41.91  ? 66   G   0 C4    1 
ATOM   1221  P  P     . A   A  1  67   ? 60.775  160.573 28.007  1.00 45.01  ? 67   A   0 P     1 
ATOM   1222  O  OP1   . A   A  1  67   ? 59.875  159.977 26.984  1.00 45.84  ? 67   A   0 OP1   1 
ATOM   1223  O  OP2   . A   A  1  67   ? 62.157  160.945 27.642  1.00 42.55  ? 67   A   0 OP2   1 
ATOM   1224  O  "O5'" . A   A  1  67   ? 60.042  161.864 28.578  1.00 44.53  ? 67   A   0 "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  67   ? 60.439  162.440 29.829  1.00 46.34  ? 67   A   0 "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  67   ? 60.912  163.858 29.621  1.00 48.05  ? 67   A   0 "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  67   ? 61.388  164.385 30.890  1.00 48.71  ? 67   A   0 "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  67   ? 62.084  163.997 28.656  1.00 48.55  ? 67   A   0 "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  67   ? 62.042  165.295 28.056  1.00 47.51  ? 67   A   0 "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  67   ? 63.280  163.888 29.594  1.00 49.26  ? 67   A   0 "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  67   ? 64.468  164.435 29.061  1.00 51.34  ? 67   A   0 "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  67   ? 62.769  164.680 30.797  1.00 49.80  ? 67   A   0 "C1'" 1 
ATOM   1233  N  N9    . A   A  1  67   ? 63.393  164.341 32.077  1.00 51.81  ? 67   A   0 N9    1 
ATOM   1234  C  C8    . A   A  1  67   ? 64.039  165.193 32.937  1.00 52.81  ? 67   A   0 C8    1 
ATOM   1235  N  N7    . A   A  1  67   ? 64.486  164.613 34.022  1.00 53.53  ? 67   A   0 N7    1 
ATOM   1236  C  C5    . A   A  1  67   ? 64.114  163.286 33.864  1.00 53.59  ? 67   A   0 C5    1 
ATOM   1237  C  C6    . A   A  1  67   ? 64.300  162.156 34.667  1.00 54.13  ? 67   A   0 C6    1 
ATOM   1238  N  N6    . A   A  1  67   ? 64.934  162.179 35.840  1.00 54.44  ? 67   A   0 N6    1 
ATOM   1239  N  N1    . A   A  1  67   ? 63.808  160.983 34.219  1.00 55.38  ? 67   A   0 N1    1 
ATOM   1240  C  C2    . A   A  1  67   ? 63.177  160.959 33.040  1.00 53.70  ? 67   A   0 C2    1 
ATOM   1241  N  N3    . A   A  1  67   ? 62.941  161.951 32.196  1.00 53.00  ? 67   A   0 N3    1 
ATOM   1242  C  C4    . A   A  1  67   ? 63.441  163.104 32.671  1.00 52.94  ? 67   A   0 C4    1 
ATOM   1243  P  P     . U   A  1  68   ? 62.003  165.443 26.459  1.00 45.56  ? 68   U   0 P     1 
ATOM   1244  O  OP1   . U   A  1  68   ? 62.953  164.464 25.863  1.00 44.59  ? 68   U   0 OP1   1 
ATOM   1245  O  OP2   . U   A  1  68   ? 62.164  166.884 26.169  1.00 45.21  ? 68   U   0 OP2   1 
ATOM   1246  O  "O5'" . U   A  1  68   ? 60.507  165.046 26.085  1.00 43.99  ? 68   U   0 "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  68   ? 59.432  165.970 26.321  1.00 43.42  ? 68   U   0 "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  68   ? 58.103  165.328 26.007  1.00 44.01  ? 68   U   0 "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  68   ? 58.137  164.811 24.649  1.00 44.54  ? 68   U   0 "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  68   ? 57.687  164.148 26.881  1.00 43.79  ? 68   U   0 "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  68   ? 56.256  164.130 26.909  1.00 44.79  ? 68   U   0 "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  68   ? 58.176  162.965 26.057  1.00 43.81  ? 68   U   0 "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  68   ? 57.553  161.738 26.373  1.00 43.50  ? 68   U   0 "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  68   ? 57.792  163.446 24.662  1.00 43.88  ? 68   U   0 "C1'" 1 
ATOM   1255  N  N1    . U   A  1  68   ? 58.430  162.779 23.520  1.00 44.67  ? 68   U   0 N1    1 
ATOM   1256  C  C2    . U   A  1  68   ? 57.656  161.897 22.778  1.00 44.99  ? 68   U   0 C2    1 
ATOM   1257  O  O2    . U   A  1  68   ? 56.492  161.632 23.049  1.00 43.72  ? 68   U   0 O2    1 
ATOM   1258  N  N3    . U   A  1  68   ? 58.298  161.325 21.710  1.00 45.44  ? 68   U   0 N3    1 
ATOM   1259  C  C4    . U   A  1  68   ? 59.605  161.522 21.325  1.00 45.91  ? 68   U   0 C4    1 
ATOM   1260  O  O4    . U   A  1  68   ? 60.049  160.900 20.363  1.00 46.69  ? 68   U   0 O4    1 
ATOM   1261  C  C5    . U   A  1  68   ? 60.340  162.435 22.146  1.00 46.41  ? 68   U   0 C5    1 
ATOM   1262  C  C6    . U   A  1  68   ? 59.742  163.019 23.189  1.00 45.58  ? 68   U   0 C6    1 
ATOM   1263  P  P     . A   A  1  69   ? 55.463  164.469 28.265  1.00 46.17  ? 69   A   0 P     1 
ATOM   1264  O  OP1   . A   A  1  69   ? 54.155  165.043 27.884  1.00 48.85  ? 69   A   0 OP1   1 
ATOM   1265  O  OP2   . A   A  1  69   ? 56.354  165.234 29.178  1.00 45.24  ? 69   A   0 OP2   1 
ATOM   1266  O  "O5'" . A   A  1  69   ? 55.155  163.035 28.886  1.00 45.62  ? 69   A   0 "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  69   ? 56.225  162.153 29.189  1.00 44.63  ? 69   A   0 "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  69   ? 55.783  161.041 30.108  1.00 43.98  ? 69   A   0 "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  69   ? 57.030  160.460 30.574  1.00 44.65  ? 69   A   0 "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  69   ? 55.011  161.426 31.377  1.00 43.38  ? 69   A   0 "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  69   ? 53.610  161.128 31.264  1.00 43.65  ? 69   A   0 "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  69   ? 55.673  160.563 32.439  1.00 44.82  ? 69   A   0 "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  69   ? 55.216  159.230 32.377  1.00 43.93  ? 69   A   0 "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  69   ? 57.122  160.595 31.971  1.00 46.27  ? 69   A   0 "C1'" 1 
ATOM   1275  N  N9    . A   A  1  69   ? 57.832  161.847 32.269  1.00 48.00  ? 69   A   0 N9    1 
ATOM   1276  C  C8    . A   A  1  69   ? 57.620  163.098 31.739  1.00 47.45  ? 69   A   0 C8    1 
ATOM   1277  N  N7    . A   A  1  69   ? 58.423  164.016 32.213  1.00 49.34  ? 69   A   0 N7    1 
ATOM   1278  C  C5    . A   A  1  69   ? 59.217  163.330 33.122  1.00 49.25  ? 69   A   0 C5    1 
ATOM   1279  C  C6    . A   A  1  69   ? 60.267  163.739 33.961  1.00 48.38  ? 69   A   0 C6    1 
ATOM   1280  N  N6    . A   A  1  69   ? 60.710  164.992 34.039  1.00 48.48  ? 69   A   0 N6    1 
ATOM   1281  N  N1    . A   A  1  69   ? 60.853  162.804 34.732  1.00 49.07  ? 69   A   0 N1    1 
ATOM   1282  C  C2    . A   A  1  69   ? 60.407  161.551 34.667  1.00 48.97  ? 69   A   0 C2    1 
ATOM   1283  N  N3    . A   A  1  69   ? 59.430  161.043 33.927  1.00 49.49  ? 69   A   0 N3    1 
ATOM   1284  C  C4    . A   A  1  69   ? 58.867  161.994 33.165  1.00 49.01  ? 69   A   0 C4    1 
ATOM   1285  P  P     . A   A  1  70   ? 52.613  161.370 32.520  1.00 42.88  ? 70   A   0 P     1 
ATOM   1286  O  OP1   . A   A  1  70   ? 51.896  162.654 32.347  1.00 44.37  ? 70   A   0 OP1   1 
ATOM   1287  O  OP2   . A   A  1  70   ? 53.357  161.128 33.768  1.00 44.97  ? 70   A   0 OP2   1 
ATOM   1288  O  "O5'" . A   A  1  70   ? 51.548  160.193 32.387  1.00 44.18  ? 70   A   0 "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  70   ? 50.147  160.428 32.606  1.00 46.51  ? 70   A   0 "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  70   ? 49.377  159.125 32.539  1.00 49.47  ? 70   A   0 "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  70   ? 49.863  158.220 33.564  1.00 49.58  ? 70   A   0 "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  70   ? 47.880  159.261 32.787  1.00 51.69  ? 70   A   0 "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  70   ? 47.185  158.229 32.108  1.00 54.83  ? 70   A   0 "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  70   ? 47.770  159.027 34.286  1.00 51.89  ? 70   A   0 "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  70   ? 46.487  158.561 34.648  1.00 53.56  ? 70   A   0 "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  70   ? 48.833  157.950 34.496  1.00 51.68  ? 70   A   0 "C1'" 1 
ATOM   1297  N  N9    . A   A  1  70   ? 49.436  157.952 35.828  1.00 52.71  ? 70   A   0 N9    1 
ATOM   1298  C  C8    . A   A  1  70   ? 49.456  156.925 36.733  1.00 53.99  ? 70   A   0 C8    1 
ATOM   1299  N  N7    . A   A  1  70   ? 50.143  157.189 37.816  1.00 55.21  ? 70   A   0 N7    1 
ATOM   1300  C  C5    . A   A  1  70   ? 50.595  158.486 37.618  1.00 54.67  ? 70   A   0 C5    1 
ATOM   1301  C  C6    . A   A  1  70   ? 51.398  159.338 38.393  1.00 54.31  ? 70   A   0 C6    1 
ATOM   1302  N  N6    . A   A  1  70   ? 51.933  158.990 39.566  1.00 53.53  ? 70   A   0 N6    1 
ATOM   1303  N  N1    . A   A  1  70   ? 51.645  160.574 37.913  1.00 53.93  ? 70   A   0 N1    1 
ATOM   1304  C  C2    . A   A  1  70   ? 51.128  160.914 36.730  1.00 53.38  ? 70   A   0 C2    1 
ATOM   1305  N  N3    . A   A  1  70   ? 50.374  160.200 35.904  1.00 53.24  ? 70   A   0 N3    1 
ATOM   1306  C  C4    . A   A  1  70   ? 50.143  158.979 36.410  1.00 53.46  ? 70   A   0 C4    1 
ATOM   1307  P  P     . G   A  1  71   ? 46.713  158.450 30.591  1.00 57.62  ? 71   G   0 P     1 
ATOM   1308  O  OP1   . G   A  1  71   ? 46.127  159.817 30.464  1.00 56.01  ? 71   G   0 OP1   1 
ATOM   1309  O  OP2   . G   A  1  71   ? 45.907  157.258 30.195  1.00 57.38  ? 71   G   0 OP2   1 
ATOM   1310  O  "O5'" . G   A  1  71   ? 48.083  158.420 29.788  1.00 54.97  ? 71   G   0 "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  71   ? 48.176  158.952 28.468  1.00 53.06  ? 71   G   0 "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  71   ? 49.322  159.919 28.398  1.00 52.16  ? 71   G   0 "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  71   ? 50.431  159.404 29.178  1.00 49.38  ? 71   G   0 "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  71   ? 49.873  160.168 27.004  1.00 52.60  ? 71   G   0 "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  71   ? 49.136  161.196 26.326  1.00 53.34  ? 71   G   0 "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  71   ? 51.326  160.517 27.303  1.00 51.00  ? 71   G   0 "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  71   ? 51.458  161.831 27.809  1.00 52.59  ? 71   G   0 "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  71   ? 51.631  159.549 28.450  1.00 48.19  ? 71   G   0 "C1'" 1 
ATOM   1319  N  N9    . G   A  1  71   ? 52.061  158.212 28.049  1.00 45.44  ? 71   G   0 N9    1 
ATOM   1320  C  C8    . G   A  1  71   ? 51.374  157.037 28.245  1.00 44.92  ? 71   G   0 C8    1 
ATOM   1321  N  N7    . G   A  1  71   ? 52.011  155.989 27.802  1.00 44.09  ? 71   G   0 N7    1 
ATOM   1322  C  C5    . G   A  1  71   ? 53.190  156.499 27.279  1.00 44.25  ? 71   G   0 C5    1 
ATOM   1323  C  C6    . G   A  1  71   ? 54.284  155.838 26.667  1.00 44.64  ? 71   G   0 C6    1 
ATOM   1324  O  O6    . G   A  1  71   ? 54.440  154.628 26.463  1.00 45.98  ? 71   G   0 O6    1 
ATOM   1325  N  N1    . G   A  1  71   ? 55.269  156.734 26.280  1.00 44.97  ? 71   G   0 N1    1 
ATOM   1326  C  C2    . G   A  1  71   ? 55.215  158.090 26.459  1.00 46.19  ? 71   G   0 C2    1 
ATOM   1327  N  N2    . G   A  1  71   ? 56.263  158.785 26.000  1.00 47.62  ? 71   G   0 N2    1 
ATOM   1328  N  N3    . G   A  1  71   ? 54.207  158.721 27.040  1.00 45.97  ? 71   G   0 N3    1 
ATOM   1329  C  C4    . G   A  1  71   ? 53.235  157.870 27.420  1.00 44.71  ? 71   G   0 C4    1 
ATOM   1330  P  P     . C   A  1  72   ? 48.581  160.939 24.829  1.00 54.60  ? 72   C   0 P     1 
ATOM   1331  O  OP1   . C   A  1  72   ? 47.672  162.061 24.498  1.00 53.69  ? 72   C   0 OP1   1 
ATOM   1332  O  OP2   . C   A  1  72   ? 48.092  159.545 24.700  1.00 53.95  ? 72   C   0 OP2   1 
ATOM   1333  O  "O5'" . C   A  1  72   ? 49.877  161.065 23.915  1.00 53.75  ? 72   C   0 "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  72   ? 50.445  162.347 23.611  1.00 52.25  ? 72   C   0 "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  72   ? 51.438  162.213 22.486  1.00 52.72  ? 72   C   0 "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  72   ? 52.589  161.446 22.926  1.00 53.09  ? 72   C   0 "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  72   ? 50.932  161.446 21.282  1.00 52.18  ? 72   C   0 "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  72   ? 50.131  162.260 20.444  1.00 52.35  ? 72   C   0 "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  72   ? 52.226  160.992 20.630  1.00 51.88  ? 72   C   0 "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  72   ? 52.856  162.050 19.937  1.00 52.35  ? 72   C   0 "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  72   ? 53.057  160.630 21.861  1.00 52.02  ? 72   C   0 "C1'" 1 
ATOM   1342  N  N1    . C   A  1  72   ? 52.920  159.215 22.271  1.00 53.13  ? 72   C   0 N1    1 
ATOM   1343  C  C2    . C   A  1  72   ? 53.611  158.221 21.554  1.00 51.61  ? 72   C   0 C2    1 
ATOM   1344  O  O2    . C   A  1  72   ? 54.324  158.550 20.597  1.00 51.13  ? 72   C   0 O2    1 
ATOM   1345  N  N3    . C   A  1  72   ? 53.483  156.930 21.931  1.00 51.32  ? 72   C   0 N3    1 
ATOM   1346  C  C4    . C   A  1  72   ? 52.714  156.609 22.975  1.00 52.30  ? 72   C   0 C4    1 
ATOM   1347  N  N4    . C   A  1  72   ? 52.628  155.326 23.315  1.00 52.44  ? 72   C   0 N4    1 
ATOM   1348  C  C5    . C   A  1  72   ? 52.002  157.593 23.720  1.00 52.42  ? 72   C   0 C5    1 
ATOM   1349  C  C6    . C   A  1  72   ? 52.131  158.870 23.339  1.00 53.49  ? 72   C   0 C6    1 
ATOM   1350  P  P     . U   A  1  73   ? 48.970  161.586 19.569  1.00 52.19  ? 73   U   0 P     1 
ATOM   1351  O  OP1   . U   A  1  73   ? 48.198  162.682 18.937  1.00 50.83  ? 73   U   0 OP1   1 
ATOM   1352  O  OP2   . U   A  1  73   ? 48.274  160.597 20.427  1.00 51.10  ? 73   U   0 OP2   1 
ATOM   1353  O  "O5'" . U   A  1  73   ? 49.773  160.787 18.449  1.00 50.94  ? 73   U   0 "O5'" 1 
ATOM   1354  C  "C5'" . U   A  1  73   ? 50.642  161.481 17.541  1.00 51.14  ? 73   U   0 "C5'" 1 
ATOM   1355  C  "C4'" . U   A  1  73   ? 51.174  160.534 16.498  1.00 52.87  ? 73   U   0 "C4'" 1 
ATOM   1356  O  "O4'" . U   A  1  73   ? 52.110  159.610 17.102  1.00 54.05  ? 73   U   0 "O4'" 1 
ATOM   1357  C  "C3'" . U   A  1  73   ? 50.149  159.635 15.833  1.00 53.52  ? 73   U   0 "C3'" 1 
ATOM   1358  O  "O3'" . U   A  1  73   ? 49.462  160.303 14.793  1.00 53.50  ? 73   U   0 "O3'" 1 
ATOM   1359  C  "C2'" . U   A  1  73   ? 51.013  158.503 15.308  1.00 53.82  ? 73   U   0 "C2'" 1 
ATOM   1360  O  "O2'" . U   A  1  73   ? 51.688  158.868 14.124  1.00 52.38  ? 73   U   0 "O2'" 1 
ATOM   1361  C  "C1'" . U   A  1  73   ? 52.019  158.354 16.451  1.00 55.02  ? 73   U   0 "C1'" 1 
ATOM   1362  N  N1    . U   A  1  73   ? 51.633  157.344 17.449  1.00 56.70  ? 73   U   0 N1    1 
ATOM   1363  C  C2    . U   A  1  73   ? 51.806  156.011 17.117  1.00 58.49  ? 73   U   0 C2    1 
ATOM   1364  O  O2    . U   A  1  73   ? 52.223  155.642 16.026  1.00 59.46  ? 73   U   0 O2    1 
ATOM   1365  N  N3    . U   A  1  73   ? 51.465  155.122 18.108  1.00 59.75  ? 73   U   0 N3    1 
ATOM   1366  C  C4    . U   A  1  73   ? 50.969  155.420 19.359  1.00 58.77  ? 73   U   0 C4    1 
ATOM   1367  O  O4    . U   A  1  73   ? 50.723  154.505 20.144  1.00 59.30  ? 73   U   0 O4    1 
ATOM   1368  C  C5    . U   A  1  73   ? 50.799  156.815 19.618  1.00 58.33  ? 73   U   0 C5    1 
ATOM   1369  C  C6    . U   A  1  73   ? 51.128  157.707 18.680  1.00 57.55  ? 73   U   0 C6    1 
ATOM   1370  P  P     . G   A  1  74   ? 48.046  159.748 14.296  1.00 53.31  ? 74   G   0 P     1 
ATOM   1371  O  OP1   . G   A  1  74   ? 47.572  160.712 13.274  1.00 55.30  ? 74   G   0 OP1   1 
ATOM   1372  O  OP2   . G   A  1  74   ? 47.189  159.447 15.462  1.00 53.35  ? 74   G   0 OP2   1 
ATOM   1373  O  "O5'" . G   A  1  74   ? 48.417  158.372 13.591  1.00 53.41  ? 74   G   0 "O5'" 1 
ATOM   1374  C  "C5'" . G   A  1  74   ? 49.178  158.349 12.369  1.00 53.77  ? 74   G   0 "C5'" 1 
ATOM   1375  C  "C4'" . G   A  1  74   ? 49.280  156.936 11.848  1.00 54.42  ? 74   G   0 "C4'" 1 
ATOM   1376  O  "O4'" . G   A  1  74   ? 50.066  156.138 12.771  1.00 55.66  ? 74   G   0 "O4'" 1 
ATOM   1377  C  "C3'" . G   A  1  74   ? 47.958  156.196 11.744  1.00 53.74  ? 74   G   0 "C3'" 1 
ATOM   1378  O  "O3'" . G   A  1  74   ? 47.280  156.501 10.537  1.00 54.16  ? 74   G   0 "O3'" 1 
ATOM   1379  C  "C2'" . G   A  1  74   ? 48.393  154.743 11.825  1.00 53.28  ? 74   G   0 "C2'" 1 
ATOM   1380  O  "O2'" . G   A  1  74   ? 48.903  154.279 10.594  1.00 50.04  ? 74   G   0 "O2'" 1 
ATOM   1381  C  "C1'" . G   A  1  74   ? 49.520  154.831 12.860  1.00 54.95  ? 74   G   0 "C1'" 1 
ATOM   1382  N  N9    . G   A  1  74   ? 49.072  154.625 14.236  1.00 55.76  ? 74   G   0 N9    1 
ATOM   1383  C  C8    . G   A  1  74   ? 48.732  155.596 15.149  1.00 56.28  ? 74   G   0 C8    1 
ATOM   1384  N  N7    . G   A  1  74   ? 48.363  155.111 16.302  1.00 57.18  ? 74   G   0 N7    1 
ATOM   1385  C  C5    . G   A  1  74   ? 48.465  153.736 16.144  1.00 57.76  ? 74   G   0 C5    1 
ATOM   1386  C  C6    . G   A  1  74   ? 48.189  152.682 17.057  1.00 58.65  ? 74   G   0 C6    1 
ATOM   1387  O  O6    . G   A  1  74   ? 47.788  152.756 18.227  1.00 59.53  ? 74   G   0 O6    1 
ATOM   1388  N  N1    . G   A  1  74   ? 48.425  151.439 16.483  1.00 59.15  ? 74   G   0 N1    1 
ATOM   1389  C  C2    . G   A  1  74   ? 48.870  151.232 15.201  1.00 59.50  ? 74   G   0 C2    1 
ATOM   1390  N  N2    . G   A  1  74   ? 49.045  149.958 14.837  1.00 60.16  ? 74   G   0 N2    1 
ATOM   1391  N  N3    . G   A  1  74   ? 49.128  152.203 14.341  1.00 58.69  ? 74   G   0 N3    1 
ATOM   1392  C  C4    . G   A  1  74   ? 48.905  153.421 14.875  1.00 57.08  ? 74   G   0 C4    1 
ATOM   1393  P  P     . U   A  1  75   ? 45.689  156.311 10.450  1.00 55.19  ? 75   U   0 P     1 
ATOM   1394  O  OP1   . U   A  1  75   ? 45.275  156.838 9.123   1.00 55.96  ? 75   U   0 OP1   1 
ATOM   1395  O  OP2   . U   A  1  75   ? 45.063  156.850 11.681  1.00 52.54  ? 75   U   0 OP2   1 
ATOM   1396  O  "O5'" . U   A  1  75   ? 45.498  154.730 10.452  1.00 55.40  ? 75   U   0 "O5'" 1 
ATOM   1397  C  "C5'" . U   A  1  75   ? 45.989  153.923 9.367   1.00 55.63  ? 75   U   0 "C5'" 1 
ATOM   1398  C  "C4'" . U   A  1  75   ? 45.762  152.458 9.657   1.00 58.03  ? 75   U   0 "C4'" 1 
ATOM   1399  O  "O4'" . U   A  1  75   ? 46.624  152.020 10.742  1.00 59.54  ? 75   U   0 "O4'" 1 
ATOM   1400  C  "C3'" . U   A  1  75   ? 44.370  152.103 10.143  1.00 58.46  ? 75   U   0 "C3'" 1 
ATOM   1401  O  "O3'" . U   A  1  75   ? 43.432  151.995 9.099   1.00 59.76  ? 75   U   0 "O3'" 1 
ATOM   1402  C  "C2'" . U   A  1  75   ? 44.606  150.777 10.837  1.00 59.28  ? 75   U   0 "C2'" 1 
ATOM   1403  O  "O2'" . U   A  1  75   ? 44.752  149.715 9.919   1.00 58.48  ? 75   U   0 "O2'" 1 
ATOM   1404  C  "C1'" . U   A  1  75   ? 45.938  151.057 11.537  1.00 59.93  ? 75   U   0 "C1'" 1 
ATOM   1405  N  N1    . U   A  1  75   ? 45.725  151.613 12.887  1.00 60.35  ? 75   U   0 N1    1 
ATOM   1406  C  C2    . U   A  1  75   ? 45.557  150.718 13.942  1.00 61.02  ? 75   U   0 C2    1 
ATOM   1407  O  O2    . U   A  1  75   ? 45.603  149.501 13.802  1.00 62.28  ? 75   U   0 O2    1 
ATOM   1408  N  N3    . U   A  1  75   ? 45.330  151.302 15.166  1.00 59.26  ? 75   U   0 N3    1 
ATOM   1409  C  C4    . U   A  1  75   ? 45.255  152.649 15.444  1.00 58.32  ? 75   U   0 C4    1 
ATOM   1410  O  O4    . U   A  1  75   ? 44.998  153.017 16.591  1.00 57.07  ? 75   U   0 O4    1 
ATOM   1411  C  C5    . U   A  1  75   ? 45.453  153.503 14.315  1.00 58.84  ? 75   U   0 C5    1 
ATOM   1412  C  C6    . U   A  1  75   ? 45.676  152.973 13.108  1.00 58.97  ? 75   U   0 C6    1 
ATOM   1413  P  P     . G   A  1  76   ? 41.889  152.308 9.396   1.00 63.45  ? 76   G   0 P     1 
ATOM   1414  O  OP1   . G   A  1  76   ? 41.197  152.251 8.078   1.00 64.75  ? 76   G   0 OP1   1 
ATOM   1415  O  OP2   . G   A  1  76   ? 41.795  153.544 10.223  1.00 61.27  ? 76   G   0 OP2   1 
ATOM   1416  O  "O5'" . G   A  1  76   ? 41.408  151.070 10.279  1.00 62.62  ? 76   G   0 "O5'" 1 
ATOM   1417  C  "C5'" . G   A  1  76   ? 41.297  149.758 9.701   1.00 64.08  ? 76   G   0 "C5'" 1 
ATOM   1418  C  "C4'" . G   A  1  76   ? 40.988  148.727 10.763  1.00 65.48  ? 76   G   0 "C4'" 1 
ATOM   1419  O  "O4'" . G   A  1  76   ? 42.091  148.658 11.705  1.00 64.74  ? 76   G   0 "O4'" 1 
ATOM   1420  C  "C3'" . G   A  1  76   ? 39.782  148.982 11.655  1.00 66.12  ? 76   G   0 "C3'" 1 
ATOM   1421  O  "O3'" . G   A  1  76   ? 38.537  148.645 11.065  1.00 69.09  ? 76   G   0 "O3'" 1 
ATOM   1422  C  "C2'" . G   A  1  76   ? 40.088  148.087 12.841  1.00 64.91  ? 76   G   0 "C2'" 1 
ATOM   1423  O  "O2'" . G   A  1  76   ? 39.829  146.729 12.566  1.00 64.34  ? 76   G   0 "O2'" 1 
ATOM   1424  C  "C1'" . G   A  1  76   ? 41.592  148.316 12.991  1.00 64.42  ? 76   G   0 "C1'" 1 
ATOM   1425  N  N9    . G   A  1  76   ? 41.831  149.429 13.909  1.00 62.75  ? 76   G   0 N9    1 
ATOM   1426  C  C8    . G   A  1  76   ? 42.181  150.724 13.606  1.00 60.97  ? 76   G   0 C8    1 
ATOM   1427  N  N7    . G   A  1  76   ? 42.253  151.493 14.658  1.00 60.48  ? 76   G   0 N7    1 
ATOM   1428  C  C5    . G   A  1  76   ? 41.944  150.652 15.720  1.00 59.40  ? 76   G   0 C5    1 
ATOM   1429  C  C6    . G   A  1  76   ? 41.847  150.917 17.109  1.00 57.36  ? 76   G   0 C6    1 
ATOM   1430  O  O6    . G   A  1  76   ? 42.007  151.986 17.703  1.00 55.29  ? 76   G   0 O6    1 
ATOM   1431  N  N1    . G   A  1  76   ? 41.517  149.771 17.823  1.00 57.61  ? 76   G   0 N1    1 
ATOM   1432  C  C2    . G   A  1  76   ? 41.302  148.532 17.273  1.00 58.55  ? 76   G   0 C2    1 
ATOM   1433  N  N2    . G   A  1  76   ? 41.004  147.542 18.117  1.00 58.67  ? 76   G   0 N2    1 
ATOM   1434  N  N3    . G   A  1  76   ? 41.377  148.277 15.986  1.00 59.41  ? 76   G   0 N3    1 
ATOM   1435  C  C4    . G   A  1  76   ? 41.699  149.373 15.274  1.00 60.82  ? 76   G   0 C4    1 
ATOM   1436  P  P     . G   A  1  77   ? 37.219  149.477 11.472  1.00 71.91  ? 77   G   0 P     1 
ATOM   1437  O  OP1   . G   A  1  77   ? 36.161  149.153 10.483  1.00 72.36  ? 77   G   0 OP1   1 
ATOM   1438  O  OP2   . G   A  1  77   ? 37.604  150.896 11.702  1.00 71.19  ? 77   G   0 OP2   1 
ATOM   1439  O  "O5'" . G   A  1  77   ? 36.784  148.879 12.882  1.00 69.42  ? 77   G   0 "O5'" 1 
ATOM   1440  C  "C5'" . G   A  1  77   ? 36.666  147.466 13.081  1.00 65.40  ? 77   G   0 "C5'" 1 
ATOM   1441  C  "C4'" . G   A  1  77   ? 36.684  147.152 14.554  1.00 63.22  ? 77   G   0 "C4'" 1 
ATOM   1442  O  "O4'" . G   A  1  77   ? 37.922  147.648 15.129  1.00 63.41  ? 77   G   0 "O4'" 1 
ATOM   1443  C  "C3'" . G   A  1  77   ? 35.626  147.829 15.408  1.00 61.89  ? 77   G   0 "C3'" 1 
ATOM   1444  O  "O3'" . G   A  1  77   ? 34.366  147.179 15.347  1.00 60.33  ? 77   G   0 "O3'" 1 
ATOM   1445  C  "C2'" . G   A  1  77   ? 36.233  147.710 16.796  1.00 62.47  ? 77   G   0 "C2'" 1 
ATOM   1446  O  "O2'" . G   A  1  77   ? 36.087  146.407 17.327  1.00 63.33  ? 77   G   0 "O2'" 1 
ATOM   1447  C  "C1'" . G   A  1  77   ? 37.710  147.972 16.497  1.00 62.65  ? 77   G   0 "C1'" 1 
ATOM   1448  N  N9    . G   A  1  77   ? 38.101  149.361 16.734  1.00 61.96  ? 77   G   0 N9    1 
ATOM   1449  C  C8    . G   A  1  77   ? 38.424  150.316 15.799  1.00 61.17  ? 77   G   0 C8    1 
ATOM   1450  N  N7    . G   A  1  77   ? 38.727  151.470 16.329  1.00 60.44  ? 77   G   0 N7    1 
ATOM   1451  C  C5    . G   A  1  77   ? 38.599  151.267 17.697  1.00 61.01  ? 77   G   0 C5    1 
ATOM   1452  C  C6    . G   A  1  77   ? 38.797  152.161 18.788  1.00 60.79  ? 77   G   0 C6    1 
ATOM   1453  O  O6    . G   A  1  77   ? 39.138  153.349 18.764  1.00 60.95  ? 77   G   0 O6    1 
ATOM   1454  N  N1    . G   A  1  77   ? 38.555  151.540 20.006  1.00 60.18  ? 77   G   0 N1    1 
ATOM   1455  C  C2    . G   A  1  77   ? 38.174  150.234 20.164  1.00 59.95  ? 77   G   0 C2    1 
ATOM   1456  N  N2    . G   A  1  77   ? 37.990  149.825 21.425  1.00 59.00  ? 77   G   0 N2    1 
ATOM   1457  N  N3    . G   A  1  77   ? 37.988  149.391 19.162  1.00 60.34  ? 77   G   0 N3    1 
ATOM   1458  C  C4    . G   A  1  77   ? 38.216  149.971 17.964  1.00 61.31  ? 77   G   0 C4    1 
ATOM   1459  P  P     . G   A  1  78   ? 33.037  147.988 15.754  1.00 61.92  ? 78   G   0 P     1 
ATOM   1460  O  OP1   . G   A  1  78   ? 31.978  146.990 16.039  1.00 63.30  ? 78   G   0 OP1   1 
ATOM   1461  O  OP2   . G   A  1  78   ? 32.786  149.050 14.747  1.00 62.63  ? 78   G   0 OP2   1 
ATOM   1462  O  "O5'" . G   A  1  78   ? 33.424  148.719 17.115  1.00 60.96  ? 78   G   0 "O5'" 1 
ATOM   1463  C  "C5'" . G   A  1  78   ? 33.406  148.024 18.375  1.00 56.62  ? 78   G   0 "C5'" 1 
ATOM   1464  C  "C4'" . G   A  1  78   ? 33.479  149.019 19.501  1.00 54.87  ? 78   G   0 "C4'" 1 
ATOM   1465  O  "O4'" . G   A  1  78   ? 34.749  149.713 19.445  1.00 55.47  ? 78   G   0 "O4'" 1 
ATOM   1466  C  "C3'" . G   A  1  78   ? 32.438  150.119 19.421  1.00 53.75  ? 78   G   0 "C3'" 1 
ATOM   1467  O  "O3'" . G   A  1  78   ? 31.227  149.679 20.014  1.00 53.76  ? 78   G   0 "O3'" 1 
ATOM   1468  C  "C2'" . G   A  1  78   ? 33.097  151.258 20.187  1.00 54.70  ? 78   G   0 "C2'" 1 
ATOM   1469  O  "O2'" . G   A  1  78   ? 32.969  151.118 21.585  1.00 54.28  ? 78   G   0 "O2'" 1 
ATOM   1470  C  "C1'" . G   A  1  78   ? 34.567  151.075 19.796  1.00 56.02  ? 78   G   0 "C1'" 1 
ATOM   1471  N  N9    . G   A  1  78   ? 35.014  151.894 18.670  1.00 58.20  ? 78   G   0 N9    1 
ATOM   1472  C  C8    . G   A  1  78   ? 34.986  151.550 17.339  1.00 58.59  ? 78   G   0 C8    1 
ATOM   1473  N  N7    . G   A  1  78   ? 35.471  152.476 16.559  1.00 59.07  ? 78   G   0 N7    1 
ATOM   1474  C  C5    . G   A  1  78   ? 35.838  153.498 17.422  1.00 59.09  ? 78   G   0 C5    1 
ATOM   1475  C  C6    . G   A  1  78   ? 36.418  154.762 17.151  1.00 59.49  ? 78   G   0 C6    1 
ATOM   1476  O  O6    . G   A  1  78   ? 36.730  155.247 16.060  1.00 60.96  ? 78   G   0 O6    1 
ATOM   1477  N  N1    . G   A  1  78   ? 36.627  155.490 18.315  1.00 59.28  ? 78   G   0 N1    1 
ATOM   1478  C  C2    . G   A  1  78   ? 36.318  155.062 19.579  1.00 59.01  ? 78   G   0 C2    1 
ATOM   1479  N  N2    . G   A  1  78   ? 36.595  155.916 20.570  1.00 59.19  ? 78   G   0 N2    1 
ATOM   1480  N  N3    . G   A  1  78   ? 35.777  153.884 19.850  1.00 59.80  ? 78   G   0 N3    1 
ATOM   1481  C  C4    . G   A  1  78   ? 35.563  153.158 18.730  1.00 59.06  ? 78   G   0 C4    1 
ATOM   1482  P  P     . G   A  1  79   ? 29.819  150.192 19.437  1.00 55.15  ? 79   G   0 P     1 
ATOM   1483  O  OP1   . G   A  1  79   ? 28.738  149.377 20.057  1.00 54.76  ? 79   G   0 OP1   1 
ATOM   1484  O  OP2   . G   A  1  79   ? 29.939  150.249 17.952  1.00 56.50  ? 79   G   0 OP2   1 
ATOM   1485  O  "O5'" . G   A  1  79   ? 29.682  151.659 20.033  1.00 49.15  ? 79   G   0 "O5'" 1 
ATOM   1486  C  "C5'" . G   A  1  79   ? 29.683  151.863 21.449  1.00 45.66  ? 79   G   0 "C5'" 1 
ATOM   1487  C  "C4'" . G   A  1  79   ? 29.996  153.298 21.767  1.00 45.48  ? 79   G   0 "C4'" 1 
ATOM   1488  O  "O4'" . G   A  1  79   ? 31.321  153.631 21.286  1.00 44.45  ? 79   G   0 "O4'" 1 
ATOM   1489  C  "C3'" . G   A  1  79   ? 29.073  154.311 21.117  1.00 44.89  ? 79   G   0 "C3'" 1 
ATOM   1490  O  "O3'" . G   A  1  79   ? 27.892  154.430 21.918  1.00 45.63  ? 79   G   0 "O3'" 1 
ATOM   1491  C  "C2'" . G   A  1  79   ? 29.948  155.557 21.067  1.00 44.06  ? 79   G   0 "C2'" 1 
ATOM   1492  O  "O2'" . G   A  1  79   ? 30.012  156.224 22.311  1.00 44.80  ? 79   G   0 "O2'" 1 
ATOM   1493  C  "C1'" . G   A  1  79   ? 31.325  154.951 20.779  1.00 44.64  ? 79   G   0 "C1'" 1 
ATOM   1494  N  N9    . G   A  1  79   ? 31.694  154.878 19.369  1.00 46.15  ? 79   G   0 N9    1 
ATOM   1495  C  C8    . G   A  1  79   ? 31.234  153.971 18.445  1.00 47.74  ? 79   G   0 C8    1 
ATOM   1496  N  N7    . G   A  1  79   ? 31.780  154.114 17.268  1.00 49.19  ? 79   G   0 N7    1 
ATOM   1497  C  C5    . G   A  1  79   ? 32.646  155.190 17.417  1.00 48.66  ? 79   G   0 C5    1 
ATOM   1498  C  C6    . G   A  1  79   ? 33.520  155.804 16.480  1.00 48.78  ? 79   G   0 C6    1 
ATOM   1499  O  O6    . G   A  1  79   ? 33.714  155.504 15.297  1.00 48.67  ? 79   G   0 O6    1 
ATOM   1500  N  N1    . G   A  1  79   ? 34.217  156.866 17.049  1.00 49.92  ? 79   G   0 N1    1 
ATOM   1501  C  C2    . G   A  1  79   ? 34.094  157.284 18.353  1.00 50.17  ? 79   G   0 C2    1 
ATOM   1502  N  N2    . G   A  1  79   ? 34.861  158.328 18.718  1.00 49.00  ? 79   G   0 N2    1 
ATOM   1503  N  N3    . G   A  1  79   ? 33.282  156.720 19.235  1.00 49.68  ? 79   G   0 N3    1 
ATOM   1504  C  C4    . G   A  1  79   ? 32.595  155.683 18.704  1.00 47.96  ? 79   G   0 C4    1 
ATOM   1505  P  P     . A   A  1  80   ? 26.819  155.588 21.622  1.00 46.98  ? 80   A   0 P     1 
ATOM   1506  O  OP1   . A   A  1  80   ? 25.494  155.173 22.148  1.00 44.93  ? 80   A   0 OP1   1 
ATOM   1507  O  OP2   . A   A  1  80   ? 26.954  155.946 20.187  1.00 49.13  ? 80   A   0 OP2   1 
ATOM   1508  O  "O5'" . A   A  1  80   ? 27.327  156.809 22.513  1.00 46.42  ? 80   A   0 "O5'" 1 
ATOM   1509  C  "C5'" . A   A  1  80   ? 27.542  156.645 23.923  1.00 46.33  ? 80   A   0 "C5'" 1 
ATOM   1510  C  "C4'" . A   A  1  80   ? 28.036  157.932 24.543  1.00 47.71  ? 80   A   0 "C4'" 1 
ATOM   1511  O  "O4'" . A   A  1  80   ? 29.292  158.328 23.927  1.00 48.53  ? 80   A   0 "O4'" 1 
ATOM   1512  C  "C3'" . A   A  1  80   ? 27.118  159.144 24.434  1.00 47.06  ? 80   A   0 "C3'" 1 
ATOM   1513  O  "O3'" . A   A  1  80   ? 27.330  159.965 25.573  1.00 46.96  ? 80   A   0 "O3'" 1 
ATOM   1514  C  "C2'" . A   A  1  80   ? 27.692  159.879 23.230  1.00 48.01  ? 80   A   0 "C2'" 1 
ATOM   1515  O  "O2'" . A   A  1  80   ? 27.412  161.262 23.245  1.00 50.01  ? 80   A   0 "O2'" 1 
ATOM   1516  C  "C1'" . A   A  1  80   ? 29.182  159.653 23.450  1.00 48.90  ? 80   A   0 "C1'" 1 
ATOM   1517  N  N9    . A   A  1  80   ? 30.020  159.791 22.263  1.00 50.58  ? 80   A   0 N9    1 
ATOM   1518  C  C8    . A   A  1  80   ? 29.838  159.247 21.017  1.00 51.58  ? 80   A   0 C8    1 
ATOM   1519  N  N7    . A   A  1  80   ? 30.797  159.532 20.173  1.00 51.87  ? 80   A   0 N7    1 
ATOM   1520  C  C5    . A   A  1  80   ? 31.665  160.327 20.907  1.00 51.77  ? 80   A   0 C5    1 
ATOM   1521  C  C6    . A   A  1  80   ? 32.879  160.952 20.582  1.00 51.34  ? 80   A   0 C6    1 
ATOM   1522  N  N6    . A   A  1  80   ? 33.450  160.881 19.377  1.00 52.06  ? 80   A   0 N6    1 
ATOM   1523  N  N1    . A   A  1  80   ? 33.494  161.667 21.546  1.00 51.99  ? 80   A   0 N1    1 
ATOM   1524  C  C2    . A   A  1  80   ? 32.917  161.752 22.749  1.00 52.39  ? 80   A   0 C2    1 
ATOM   1525  N  N3    . A   A  1  80   ? 31.777  161.216 23.174  1.00 53.48  ? 80   A   0 N3    1 
ATOM   1526  C  C4    . A   A  1  80   ? 31.194  160.503 22.194  1.00 52.29  ? 80   A   0 C4    1 
ATOM   1527  P  P     . G   A  1  81   ? 26.399  159.804 26.864  1.00 48.33  ? 81   G   0 P     1 
ATOM   1528  O  OP1   . G   A  1  81   ? 25.163  159.066 26.480  1.00 47.15  ? 81   G   0 OP1   1 
ATOM   1529  O  OP2   . G   A  1  81   ? 26.300  161.139 27.500  1.00 47.25  ? 81   G   0 OP2   1 
ATOM   1530  O  "O5'" . G   A  1  81   ? 27.240  158.860 27.832  1.00 50.06  ? 81   G   0 "O5'" 1 
ATOM   1531  C  "C5'" . G   A  1  81   ? 28.377  159.358 28.572  1.00 48.38  ? 81   G   0 "C5'" 1 
ATOM   1532  C  "C4'" . G   A  1  81   ? 29.662  158.966 27.876  1.00 47.12  ? 81   G   0 "C4'" 1 
ATOM   1533  O  "O4'" . G   A  1  81   ? 29.786  159.710 26.629  1.00 46.40  ? 81   G   0 "O4'" 1 
ATOM   1534  C  "C3'" . G   A  1  81   ? 30.948  159.265 28.630  1.00 45.77  ? 81   G   0 "C3'" 1 
ATOM   1535  O  "O3'" . G   A  1  81   ? 31.263  158.227 29.550  1.00 45.55  ? 81   G   0 "O3'" 1 
ATOM   1536  C  "C2'" . G   A  1  81   ? 31.946  159.400 27.490  1.00 45.64  ? 81   G   0 "C2'" 1 
ATOM   1537  O  "O2'" . G   A  1  81   ? 32.278  158.157 26.902  1.00 46.03  ? 81   G   0 "O2'" 1 
ATOM   1538  C  "C1'" . G   A  1  81   ? 31.110  160.205 26.494  1.00 45.07  ? 81   G   0 "C1'" 1 
ATOM   1539  N  N9    . G   A  1  81   ? 31.111  161.626 26.848  1.00 42.79  ? 81   G   0 N9    1 
ATOM   1540  C  C8    . G   A  1  81   ? 30.050  162.382 27.290  1.00 41.05  ? 81   G   0 C8    1 
ATOM   1541  N  N7    . G   A  1  81   ? 30.386  163.607 27.597  1.00 39.38  ? 81   G   0 N7    1 
ATOM   1542  C  C5    . G   A  1  81   ? 31.744  163.669 27.328  1.00 40.90  ? 81   G   0 C5    1 
ATOM   1543  C  C6    . G   A  1  81   ? 32.666  164.740 27.483  1.00 42.17  ? 81   G   0 C6    1 
ATOM   1544  O  O6    . G   A  1  81   ? 32.458  165.884 27.916  1.00 44.94  ? 81   G   0 O6    1 
ATOM   1545  N  N1    . G   A  1  81   ? 33.948  164.373 27.080  1.00 40.91  ? 81   G   0 N1    1 
ATOM   1546  C  C2    . G   A  1  81   ? 34.301  163.136 26.594  1.00 41.57  ? 81   G   0 C2    1 
ATOM   1547  N  N2    . G   A  1  81   ? 35.586  162.976 26.248  1.00 41.18  ? 81   G   0 N2    1 
ATOM   1548  N  N3    . G   A  1  81   ? 33.454  162.129 26.455  1.00 42.06  ? 81   G   0 N3    1 
ATOM   1549  C  C4    . G   A  1  81   ? 32.203  162.463 26.840  1.00 42.33  ? 81   G   0 C4    1 
ATOM   1550  P  P     . C   A  1  82   ? 31.746  158.599 31.038  1.00 44.98  ? 82   C   0 P     1 
ATOM   1551  O  OP1   . C   A  1  82   ? 31.586  157.382 31.872  1.00 44.53  ? 82   C   0 OP1   1 
ATOM   1552  O  OP2   . C   A  1  82   ? 31.088  159.866 31.451  1.00 42.19  ? 82   C   0 OP2   1 
ATOM   1553  O  "O5'" . C   A  1  82   ? 33.305  158.867 30.872  1.00 44.76  ? 82   C   0 "O5'" 1 
ATOM   1554  C  "C5'" . C   A  1  82   ? 34.130  157.969 30.109  1.00 44.97  ? 82   C   0 "C5'" 1 
ATOM   1555  C  "C4'" . C   A  1  82   ? 35.371  158.689 29.640  1.00 46.81  ? 82   C   0 "C4'" 1 
ATOM   1556  O  "O4'" . C   A  1  82   ? 34.970  159.854 28.871  1.00 46.59  ? 82   C   0 "O4'" 1 
ATOM   1557  C  "C3'" . C   A  1  82   ? 36.237  159.270 30.747  1.00 46.74  ? 82   C   0 "C3'" 1 
ATOM   1558  O  "O3'" . C   A  1  82   ? 37.120  158.300 31.298  1.00 47.54  ? 82   C   0 "O3'" 1 
ATOM   1559  C  "C2'" . C   A  1  82   ? 36.973  160.398 30.038  1.00 44.10  ? 82   C   0 "C2'" 1 
ATOM   1560  O  "O2'" . C   A  1  82   ? 38.062  159.941 29.263  1.00 41.73  ? 82   C   0 "O2'" 1 
ATOM   1561  C  "C1'" . C   A  1  82   ? 35.873  160.925 29.114  1.00 43.38  ? 82   C   0 "C1'" 1 
ATOM   1562  N  N1    . C   A  1  82   ? 35.115  162.066 29.663  1.00 39.98  ? 82   C   0 N1    1 
ATOM   1563  C  C2    . C   A  1  82   ? 35.758  163.309 29.796  1.00 38.82  ? 82   C   0 C2    1 
ATOM   1564  O  O2    . C   A  1  82   ? 36.948  163.412 29.459  1.00 36.95  ? 82   C   0 O2    1 
ATOM   1565  N  N3    . C   A  1  82   ? 35.065  164.362 30.288  1.00 38.28  ? 82   C   0 N3    1 
ATOM   1566  C  C4    . C   A  1  82   ? 33.787  164.214 30.645  1.00 38.32  ? 82   C   0 C4    1 
ATOM   1567  N  N4    . C   A  1  82   ? 33.146  165.279 31.135  1.00 37.18  ? 82   C   0 N4    1 
ATOM   1568  C  C5    . C   A  1  82   ? 33.108  162.965 30.520  1.00 39.44  ? 82   C   0 C5    1 
ATOM   1569  C  C6    . C   A  1  82   ? 33.804  161.927 30.032  1.00 39.16  ? 82   C   0 C6    1 
ATOM   1570  P  P     . C   A  1  83   ? 37.580  158.430 32.829  1.00 48.23  ? 83   C   0 P     1 
ATOM   1571  O  OP1   . C   A  1  83   ? 38.319  157.180 33.130  1.00 47.43  ? 83   C   0 OP1   1 
ATOM   1572  O  OP2   . C   A  1  83   ? 36.413  158.822 33.666  1.00 46.68  ? 83   C   0 OP2   1 
ATOM   1573  O  "O5'" . C   A  1  83   ? 38.604  159.648 32.818  1.00 47.53  ? 83   C   0 "O5'" 1 
ATOM   1574  C  "C5'" . C   A  1  83   ? 39.886  159.521 32.174  1.00 47.42  ? 83   C   0 "C5'" 1 
ATOM   1575  C  "C4'" . C   A  1  83   ? 40.702  160.770 32.384  1.00 45.73  ? 83   C   0 "C4'" 1 
ATOM   1576  O  "O4'" . C   A  1  83   ? 40.075  161.883 31.702  1.00 45.63  ? 83   C   0 "O4'" 1 
ATOM   1577  C  "C3'" . C   A  1  83   ? 40.816  161.236 33.823  1.00 45.87  ? 83   C   0 "C3'" 1 
ATOM   1578  O  "O3'" . C   A  1  83   ? 41.834  160.513 34.504  1.00 47.70  ? 83   C   0 "O3'" 1 
ATOM   1579  C  "C2'" . C   A  1  83   ? 41.154  162.710 33.653  1.00 45.15  ? 83   C   0 "C2'" 1 
ATOM   1580  O  "O2'" . C   A  1  83   ? 42.507  162.923 33.317  1.00 45.55  ? 83   C   0 "O2'" 1 
ATOM   1581  C  "C1'" . C   A  1  83   ? 40.297  163.075 32.439  1.00 44.72  ? 83   C   0 "C1'" 1 
ATOM   1582  N  N1    . C   A  1  83   ? 38.997  163.674 32.793  1.00 42.64  ? 83   C   0 N1    1 
ATOM   1583  C  C2    . C   A  1  83   ? 38.939  165.049 33.027  1.00 41.67  ? 83   C   0 C2    1 
ATOM   1584  O  O2    . C   A  1  83   ? 39.976  165.716 32.929  1.00 41.73  ? 83   C   0 O2    1 
ATOM   1585  N  N3    . C   A  1  83   ? 37.758  165.617 33.356  1.00 41.83  ? 83   C   0 N3    1 
ATOM   1586  C  C4    . C   A  1  83   ? 36.660  164.865 33.454  1.00 42.36  ? 83   C   0 C4    1 
ATOM   1587  N  N4    . C   A  1  83   ? 35.513  165.469 33.784  1.00 41.97  ? 83   C   0 N4    1 
ATOM   1588  C  C5    . C   A  1  83   ? 36.687  163.459 33.219  1.00 42.58  ? 83   C   0 C5    1 
ATOM   1589  C  C6    . C   A  1  83   ? 37.866  162.910 32.894  1.00 42.83  ? 83   C   0 C6    1 
ATOM   1590  P  P     . G   A  1  84   ? 41.630  160.087 36.043  1.00 48.03  ? 84   G   0 P     1 
ATOM   1591  O  OP1   . G   A  1  84   ? 40.198  160.216 36.425  1.00 46.49  ? 84   G   0 OP1   1 
ATOM   1592  O  OP2   . G   A  1  84   ? 42.661  160.824 36.815  1.00 48.78  ? 84   G   0 OP2   1 
ATOM   1593  O  "O5'" . G   A  1  84   ? 42.008  158.540 36.056  1.00 47.37  ? 84   G   0 "O5'" 1 
ATOM   1594  C  "C5'" . G   A  1  84   ? 41.345  157.602 35.185  1.00 47.59  ? 84   G   0 "C5'" 1 
ATOM   1595  C  "C4'" . G   A  1  84   ? 41.669  156.185 35.596  1.00 47.86  ? 84   G   0 "C4'" 1 
ATOM   1596  O  "O4'" . G   A  1  84   ? 43.097  155.952 35.468  1.00 48.68  ? 84   G   0 "O4'" 1 
ATOM   1597  C  "C3'" . G   A  1  84   ? 41.368  155.856 37.044  1.00 48.48  ? 84   G   0 "C3'" 1 
ATOM   1598  O  "O3'" . G   A  1  84   ? 40.008  155.506 37.212  1.00 50.20  ? 84   G   0 "O3'" 1 
ATOM   1599  C  "C2'" . G   A  1  84   ? 42.301  154.690 37.306  1.00 49.17  ? 84   G   0 "C2'" 1 
ATOM   1600  O  "O2'" . G   A  1  84   ? 41.805  153.505 36.729  1.00 52.20  ? 84   G   0 "O2'" 1 
ATOM   1601  C  "C1'" . G   A  1  84   ? 43.546  155.128 36.532  1.00 49.77  ? 84   G   0 "C1'" 1 
ATOM   1602  N  N9    . G   A  1  84   ? 44.495  155.896 37.341  1.00 50.39  ? 84   G   0 N9    1 
ATOM   1603  C  C8    . G   A  1  84   ? 44.832  157.221 37.188  1.00 50.74  ? 84   G   0 C8    1 
ATOM   1604  N  N7    . G   A  1  84   ? 45.692  157.639 38.076  1.00 50.14  ? 84   G   0 N7    1 
ATOM   1605  C  C5    . G   A  1  84   ? 45.946  156.525 38.860  1.00 50.79  ? 84   G   0 C5    1 
ATOM   1606  C  C6    . G   A  1  84   ? 46.790  156.371 39.984  1.00 50.86  ? 84   G   0 C6    1 
ATOM   1607  O  O6    . G   A  1  84   ? 47.519  157.210 40.522  1.00 51.60  ? 84   G   0 O6    1 
ATOM   1608  N  N1    . G   A  1  84   ? 46.737  155.079 40.487  1.00 49.92  ? 84   G   0 N1    1 
ATOM   1609  C  C2    . G   A  1  84   ? 45.981  154.062 39.972  1.00 48.22  ? 84   G   0 C2    1 
ATOM   1610  N  N2    . G   A  1  84   ? 46.070  152.890 40.604  1.00 48.62  ? 84   G   0 N2    1 
ATOM   1611  N  N3    . G   A  1  84   ? 45.196  154.186 38.919  1.00 49.76  ? 84   G   0 N3    1 
ATOM   1612  C  C4    . G   A  1  84   ? 45.222  155.438 38.418  1.00 50.31  ? 84   G   0 C4    1 
ATOM   1613  P  P     . C   A  1  85   ? 39.273  155.828 38.602  1.00 53.92  ? 85   C   0 P     1 
ATOM   1614  O  OP1   . C   A  1  85   ? 37.861  155.391 38.465  1.00 54.81  ? 85   C   0 OP1   1 
ATOM   1615  O  OP2   . C   A  1  85   ? 39.567  157.224 39.010  1.00 52.64  ? 85   C   0 OP2   1 
ATOM   1616  O  "O5'" . C   A  1  85   ? 39.987  154.849 39.628  1.00 55.25  ? 85   C   0 "O5'" 1 
ATOM   1617  C  "C5'" . C   A  1  85   ? 39.947  153.431 39.424  1.00 57.45  ? 85   C   0 "C5'" 1 
ATOM   1618  C  "C4'" . C   A  1  85   ? 40.622  152.726 40.567  1.00 59.81  ? 85   C   0 "C4'" 1 
ATOM   1619  O  "O4'" . C   A  1  85   ? 42.055  152.939 40.504  1.00 59.69  ? 85   C   0 "O4'" 1 
ATOM   1620  C  "C3'" . C   A  1  85   ? 40.226  153.216 41.947  1.00 60.87  ? 85   C   0 "C3'" 1 
ATOM   1621  O  "O3'" . C   A  1  85   ? 39.000  152.625 42.364  1.00 64.00  ? 85   C   0 "O3'" 1 
ATOM   1622  C  "C2'" . C   A  1  85   ? 41.415  152.782 42.791  1.00 60.34  ? 85   C   0 "C2'" 1 
ATOM   1623  O  "O2'" . C   A  1  85   ? 41.359  151.412 43.123  1.00 59.63  ? 85   C   0 "O2'" 1 
ATOM   1624  C  "C1'" . C   A  1  85   ? 42.576  153.021 41.819  1.00 60.49  ? 85   C   0 "C1'" 1 
ATOM   1625  N  N1    . C   A  1  85   ? 43.230  154.333 41.982  1.00 61.81  ? 85   C   0 N1    1 
ATOM   1626  C  C2    . C   A  1  85   ? 44.218  154.475 42.963  1.00 61.66  ? 85   C   0 C2    1 
ATOM   1627  O  O2    . C   A  1  85   ? 44.509  153.499 43.668  1.00 62.70  ? 85   C   0 O2    1 
ATOM   1628  N  N3    . C   A  1  85   ? 44.827  155.673 43.120  1.00 61.85  ? 85   C   0 N3    1 
ATOM   1629  C  C4    . C   A  1  85   ? 44.483  156.704 42.346  1.00 61.83  ? 85   C   0 C4    1 
ATOM   1630  N  N4    . C   A  1  85   ? 45.105  157.865 42.542  1.00 61.38  ? 85   C   0 N4    1 
ATOM   1631  C  C5    . C   A  1  85   ? 43.482  156.589 41.339  1.00 62.11  ? 85   C   0 C5    1 
ATOM   1632  C  C6    . C   A  1  85   ? 42.886  155.399 41.193  1.00 62.56  ? 85   C   0 C6    1 
ATOM   1633  P  P     . A   A  1  86   ? 38.095  153.357 43.472  1.00 66.70  ? 86   A   0 P     1 
ATOM   1634  O  OP1   . A   A  1  86   ? 38.795  153.228 44.778  1.00 66.41  ? 86   A   0 OP1   1 
ATOM   1635  O  OP2   . A   A  1  86   ? 36.703  152.856 43.332  1.00 67.03  ? 86   A   0 OP2   1 
ATOM   1636  O  "O5'" . A   A  1  86   ? 38.116  154.894 43.052  1.00 67.13  ? 86   A   0 "O5'" 1 
ATOM   1637  C  "C5'" . A   A  1  86   ? 37.183  155.831 43.625  1.00 67.81  ? 86   A   0 "C5'" 1 
ATOM   1638  C  "C4'" . A   A  1  86   ? 37.718  157.238 43.513  1.00 69.19  ? 86   A   0 "C4'" 1 
ATOM   1639  O  "O4'" . A   A  1  86   ? 38.786  157.442 44.478  1.00 68.59  ? 86   A   0 "O4'" 1 
ATOM   1640  C  "C3'" . A   A  1  86   ? 38.302  157.610 42.154  1.00 70.69  ? 86   A   0 "C3'" 1 
ATOM   1641  O  "O3'" . A   A  1  86   ? 38.099  159.000 41.932  1.00 75.42  ? 86   A   0 "O3'" 1 
ATOM   1642  C  "C2'" . A   A  1  86   ? 39.791  157.363 42.367  1.00 69.55  ? 86   A   0 "C2'" 1 
ATOM   1643  O  "O2'" . A   A  1  86   ? 40.595  158.112 41.482  1.00 69.64  ? 86   A   0 "O2'" 1 
ATOM   1644  C  "C1'" . A   A  1  86   ? 39.954  157.862 43.801  1.00 68.29  ? 86   A   0 "C1'" 1 
ATOM   1645  N  N9    . A   A  1  86   ? 41.119  157.366 44.533  1.00 66.88  ? 86   A   0 N9    1 
ATOM   1646  C  C8    . A   A  1  86   ? 41.351  156.104 45.018  1.00 66.50  ? 86   A   0 C8    1 
ATOM   1647  N  N7    . A   A  1  86   ? 42.474  155.993 45.685  1.00 66.30  ? 86   A   0 N7    1 
ATOM   1648  C  C5    . A   A  1  86   ? 43.024  157.265 45.627  1.00 66.60  ? 86   A   0 C5    1 
ATOM   1649  C  C6    . A   A  1  86   ? 44.206  157.812 46.157  1.00 66.54  ? 86   A   0 C6    1 
ATOM   1650  N  N6    . A   A  1  86   ? 45.081  157.123 46.897  1.00 66.03  ? 86   A   0 N6    1 
ATOM   1651  N  N1    . A   A  1  86   ? 44.461  159.111 45.905  1.00 66.91  ? 86   A   0 N1    1 
ATOM   1652  C  C2    . A   A  1  86   ? 43.581  159.808 45.178  1.00 67.17  ? 86   A   0 C2    1 
ATOM   1653  N  N3    . A   A  1  86   ? 42.433  159.412 44.639  1.00 66.72  ? 86   A   0 N3    1 
ATOM   1654  C  C4    . A   A  1  86   ? 42.209  158.115 44.904  1.00 66.75  ? 86   A   0 C4    1 
ATOM   1655  P  P     . C   A  1  87   ? 36.945  159.494 40.931  1.00 79.09  ? 87   C   0 P     1 
ATOM   1656  O  OP1   . C   A  1  87   ? 36.471  158.349 40.102  1.00 78.10  ? 87   C   0 OP1   1 
ATOM   1657  O  OP2   . C   A  1  87   ? 37.449  160.726 40.264  1.00 76.83  ? 87   C   0 OP2   1 
ATOM   1658  O  "O5'" . C   A  1  87   ? 35.756  159.919 41.900  1.00 79.69  ? 87   C   0 "O5'" 1 
ATOM   1659  C  "C5'" . C   A  1  87   ? 34.581  160.524 41.356  1.00 83.36  ? 87   C   0 "C5'" 1 
ATOM   1660  C  "C4'" . C   A  1  87   ? 33.515  160.684 42.411  1.00 85.10  ? 87   C   0 "C4'" 1 
ATOM   1661  O  "O4'" . C   A  1  87   ? 33.135  159.378 42.925  1.00 87.04  ? 87   C   0 "O4'" 1 
ATOM   1662  C  "C3'" . C   A  1  87   ? 33.857  161.533 43.636  1.00 84.52  ? 87   C   0 "C3'" 1 
ATOM   1663  O  "O3'" . C   A  1  87   ? 32.727  162.352 43.906  1.00 81.82  ? 87   C   0 "O3'" 1 
ATOM   1664  C  "C2'" . C   A  1  87   ? 33.992  160.490 44.746  1.00 86.18  ? 87   C   0 "C2'" 1 
ATOM   1665  O  "O2'" . C   A  1  87   ? 33.671  160.993 46.027  1.00 85.74  ? 87   C   0 "O2'" 1 
ATOM   1666  C  "C1'" . C   A  1  87   ? 32.934  159.485 44.312  1.00 88.14  ? 87   C   0 "C1'" 1 
ATOM   1667  N  N1    . C   A  1  87   ? 33.001  158.144 44.918  1.00 91.53  ? 87   C   0 N1    1 
ATOM   1668  C  C2    . C   A  1  87   ? 31.928  157.719 45.722  1.00 93.02  ? 87   C   0 C2    1 
ATOM   1669  O  O2    . C   A  1  87   ? 30.967  158.488 45.908  1.00 93.28  ? 87   C   0 O2    1 
ATOM   1670  N  N3    . C   A  1  87   ? 31.965  156.487 46.277  1.00 94.37  ? 87   C   0 N3    1 
ATOM   1671  C  C4    . C   A  1  87   ? 33.013  155.689 46.061  1.00 94.48  ? 87   C   0 C4    1 
ATOM   1672  N  N4    . C   A  1  87   ? 33.001  154.481 46.631  1.00 95.26  ? 87   C   0 N4    1 
ATOM   1673  C  C5    . C   A  1  87   ? 34.119  156.096 45.253  1.00 93.89  ? 87   C   0 C5    1 
ATOM   1674  C  C6    . C   A  1  87   ? 34.072  157.319 44.707  1.00 92.41  ? 87   C   0 C6    1 
ATOM   1675  P  P     . G   A  1  88   ? 32.643  163.823 43.268  1.00 79.11  ? 88   G   0 P     1 
ATOM   1676  O  OP1   . G   A  1  88   ? 31.208  164.111 43.018  1.00 80.30  ? 88   G   0 OP1   1 
ATOM   1677  O  OP2   . G   A  1  88   ? 33.619  163.903 42.147  1.00 78.31  ? 88   G   0 OP2   1 
ATOM   1678  O  "O5'" . G   A  1  88   ? 33.146  164.773 44.440  1.00 76.99  ? 88   G   0 "O5'" 1 
ATOM   1679  C  "C5'" . G   A  1  88   ? 34.428  164.560 45.033  1.00 72.53  ? 88   G   0 "C5'" 1 
ATOM   1680  C  "C4'" . G   A  1  88   ? 34.835  165.747 45.862  1.00 69.66  ? 88   G   0 "C4'" 1 
ATOM   1681  O  "O4'" . G   A  1  88   ? 36.179  165.503 46.344  1.00 68.36  ? 88   G   0 "O4'" 1 
ATOM   1682  C  "C3'" . G   A  1  88   ? 34.890  167.080 45.124  1.00 69.26  ? 88   G   0 "C3'" 1 
ATOM   1683  O  "O3'" . G   A  1  88   ? 33.677  167.805 45.322  1.00 71.13  ? 88   G   0 "O3'" 1 
ATOM   1684  C  "C2'" . G   A  1  88   ? 36.088  167.773 45.759  1.00 67.04  ? 88   G   0 "C2'" 1 
ATOM   1685  O  "O2'" . G   A  1  88   ? 35.779  168.349 47.013  1.00 66.59  ? 88   G   0 "O2'" 1 
ATOM   1686  C  "C1'" . G   A  1  88   ? 37.015  166.584 45.995  1.00 65.40  ? 88   G   0 "C1'" 1 
ATOM   1687  N  N9    . G   A  1  88   ? 37.825  166.179 44.850  1.00 60.97  ? 88   G   0 N9    1 
ATOM   1688  C  C8    . G   A  1  88   ? 37.576  165.158 43.966  1.00 59.84  ? 88   G   0 C8    1 
ATOM   1689  N  N7    . G   A  1  88   ? 38.520  165.007 43.078  1.00 58.67  ? 88   G   0 N7    1 
ATOM   1690  C  C5    . G   A  1  88   ? 39.440  165.994 43.389  1.00 57.90  ? 88   G   0 C5    1 
ATOM   1691  C  C6    . G   A  1  88   ? 40.680  166.318 42.786  1.00 57.24  ? 88   G   0 C6    1 
ATOM   1692  O  O6    . G   A  1  88   ? 41.242  165.768 41.831  1.00 55.51  ? 88   G   0 O6    1 
ATOM   1693  N  N1    . G   A  1  88   ? 41.281  167.404 43.413  1.00 57.53  ? 88   G   0 N1    1 
ATOM   1694  C  C2    . G   A  1  88   ? 40.759  168.088 44.486  1.00 58.18  ? 88   G   0 C2    1 
ATOM   1695  N  N2    . G   A  1  88   ? 41.470  169.125 44.946  1.00 58.21  ? 88   G   0 N2    1 
ATOM   1696  N  N3    . G   A  1  88   ? 39.616  167.782 45.065  1.00 58.96  ? 88   G   0 N3    1 
ATOM   1697  C  C4    . G   A  1  88   ? 39.014  166.735 44.470  1.00 59.15  ? 88   G   0 C4    1 
ATOM   1698  P  P     . G   A  1  89   ? 33.165  168.848 44.206  1.00 73.15  ? 89   G   0 P     1 
ATOM   1699  O  OP1   . G   A  1  89   ? 31.898  169.409 44.747  1.00 71.75  ? 89   G   0 OP1   1 
ATOM   1700  O  OP2   . G   A  1  89   ? 33.173  168.182 42.868  1.00 72.00  ? 89   G   0 OP2   1 
ATOM   1701  O  "O5'" . G   A  1  89   ? 34.257  170.007 44.191  1.00 69.79  ? 89   G   0 "O5'" 1 
ATOM   1702  C  "C5'" . G   A  1  89   ? 34.271  171.021 45.209  1.00 67.48  ? 89   G   0 "C5'" 1 
ATOM   1703  C  "C4'" . G   A  1  89   ? 35.477  171.911 45.039  1.00 66.56  ? 89   G   0 "C4'" 1 
ATOM   1704  O  "O4'" . G   A  1  89   ? 36.684  171.108 45.153  1.00 64.91  ? 89   G   0 "O4'" 1 
ATOM   1705  C  "C3'" . G   A  1  89   ? 35.623  172.567 43.676  1.00 66.83  ? 89   G   0 "C3'" 1 
ATOM   1706  O  "O3'" . G   A  1  89   ? 34.811  173.720 43.515  1.00 68.59  ? 89   G   0 "O3'" 1 
ATOM   1707  C  "C2'" . G   A  1  89   ? 37.112  172.878 43.632  1.00 65.20  ? 89   G   0 "C2'" 1 
ATOM   1708  O  "O2'" . G   A  1  89   ? 37.487  174.005 44.401  1.00 64.48  ? 89   G   0 "O2'" 1 
ATOM   1709  C  "C1'" . G   A  1  89   ? 37.680  171.615 44.274  1.00 62.49  ? 89   G   0 "C1'" 1 
ATOM   1710  N  N9    . G   A  1  89   ? 37.991  170.597 43.273  1.00 58.21  ? 89   G   0 N9    1 
ATOM   1711  C  C8    . G   A  1  89   ? 37.204  169.547 42.857  1.00 56.21  ? 89   G   0 C8    1 
ATOM   1712  N  N7    . G   A  1  89   ? 37.788  168.796 41.961  1.00 54.87  ? 89   G   0 N7    1 
ATOM   1713  C  C5    . G   A  1  89   ? 39.029  169.390 41.774  1.00 54.39  ? 89   G   0 C5    1 
ATOM   1714  C  C6    . G   A  1  89   ? 40.118  169.018 40.937  1.00 53.79  ? 89   G   0 C6    1 
ATOM   1715  O  O6    . G   A  1  89   ? 40.214  168.044 40.176  1.00 52.52  ? 89   G   0 O6    1 
ATOM   1716  N  N1    . G   A  1  89   ? 41.176  169.910 41.055  1.00 53.97  ? 89   G   0 N1    1 
ATOM   1717  C  C2    . G   A  1  89   ? 41.193  171.011 41.876  1.00 55.15  ? 89   G   0 C2    1 
ATOM   1718  N  N2    . G   A  1  89   ? 42.297  171.758 41.852  1.00 56.34  ? 89   G   0 N2    1 
ATOM   1719  N  N3    . G   A  1  89   ? 40.200  171.356 42.664  1.00 55.21  ? 89   G   0 N3    1 
ATOM   1720  C  C4    . G   A  1  89   ? 39.159  170.509 42.565  1.00 55.50  ? 89   G   0 C4    1 
ATOM   1721  P  P     . A   A  1  90   ? 34.202  174.060 42.067  1.00 69.14  ? 90   A   0 P     1 
ATOM   1722  O  OP1   . A   A  1  90   ? 33.349  175.267 42.243  1.00 68.93  ? 90   A   0 OP1   1 
ATOM   1723  O  OP2   . A   A  1  90   ? 33.611  172.813 41.516  1.00 68.16  ? 90   A   0 OP2   1 
ATOM   1724  O  "O5'" . A   A  1  90   ? 35.473  174.445 41.181  1.00 68.01  ? 90   A   0 "O5'" 1 
ATOM   1725  C  "C5'" . A   A  1  90   ? 36.198  175.665 41.428  1.00 67.27  ? 90   A   0 "C5'" 1 
ATOM   1726  C  "C4'" . A   A  1  90   ? 37.461  175.728 40.592  1.00 67.07  ? 90   A   0 "C4'" 1 
ATOM   1727  O  "O4'" . A   A  1  90   ? 38.340  174.619 40.931  1.00 66.18  ? 90   A   0 "O4'" 1 
ATOM   1728  C  "C3'" . A   A  1  90   ? 37.330  175.601 39.083  1.00 67.28  ? 90   A   0 "C3'" 1 
ATOM   1729  O  "O3'" . A   A  1  90   ? 36.890  176.793 38.446  1.00 68.79  ? 90   A   0 "O3'" 1 
ATOM   1730  C  "C2'" . A   A  1  90   ? 38.760  175.266 38.689  1.00 65.86  ? 90   A   0 "C2'" 1 
ATOM   1731  O  "O2'" . A   A  1  90   ? 39.609  176.396 38.714  1.00 66.95  ? 90   A   0 "O2'" 1 
ATOM   1732  C  "C1'" . A   A  1  90   ? 39.150  174.296 39.806  1.00 64.18  ? 90   A   0 "C1'" 1 
ATOM   1733  N  N9    . A   A  1  90   ? 38.860  172.925 39.383  1.00 61.82  ? 90   A   0 N9    1 
ATOM   1734  C  C8    . A   A  1  90   ? 37.698  172.204 39.539  1.00 60.41  ? 90   A   0 C8    1 
ATOM   1735  N  N7    . A   A  1  90   ? 37.719  171.033 38.949  1.00 58.42  ? 90   A   0 N7    1 
ATOM   1736  C  C5    . A   A  1  90   ? 38.986  170.969 38.385  1.00 57.90  ? 90   A   0 C5    1 
ATOM   1737  C  C6    . A   A  1  90   ? 39.620  169.993 37.603  1.00 56.73  ? 90   A   0 C6    1 
ATOM   1738  N  N6    . A   A  1  90   ? 39.031  168.858 37.222  1.00 57.00  ? 90   A   0 N6    1 
ATOM   1739  N  N1    . A   A  1  90   ? 40.891  170.229 37.211  1.00 55.93  ? 90   A   0 N1    1 
ATOM   1740  C  C2    . A   A  1  90   ? 41.471  171.379 37.576  1.00 56.65  ? 90   A   0 C2    1 
ATOM   1741  N  N3    . A   A  1  90   ? 40.974  172.381 38.295  1.00 57.11  ? 90   A   0 N3    1 
ATOM   1742  C  C4    . A   A  1  90   ? 39.711  172.112 38.671  1.00 59.10  ? 90   A   0 C4    1 
ATOM   1743  P  P     . G   A  1  91   ? 36.060  176.695 37.068  1.00 70.62  ? 91   G   0 P     1 
ATOM   1744  O  OP1   . G   A  1  91   ? 35.854  178.094 36.596  1.00 70.30  ? 91   G   0 OP1   1 
ATOM   1745  O  OP2   . G   A  1  91   ? 34.879  175.810 37.297  1.00 69.03  ? 91   G   0 OP2   1 
ATOM   1746  O  "O5'" . G   A  1  91   ? 37.050  175.963 36.050  1.00 66.05  ? 91   G   0 "O5'" 1 
ATOM   1747  C  "C5'" . G   A  1  91   ? 38.263  176.603 35.624  1.00 60.75  ? 91   G   0 "C5'" 1 
ATOM   1748  C  "C4'" . G   A  1  91   ? 39.210  175.606 34.996  1.00 58.65  ? 91   G   0 "C4'" 1 
ATOM   1749  O  "O4'" . G   A  1  91   ? 39.276  174.419 35.833  1.00 57.25  ? 91   G   0 "O4'" 1 
ATOM   1750  C  "C3'" . G   A  1  91   ? 38.848  175.018 33.643  1.00 58.51  ? 91   G   0 "C3'" 1 
ATOM   1751  O  "O3'" . G   A  1  91   ? 39.109  175.888 32.549  1.00 60.36  ? 91   G   0 "O3'" 1 
ATOM   1752  C  "C2'" . G   A  1  91   ? 39.762  173.803 33.603  1.00 56.50  ? 91   G   0 "C2'" 1 
ATOM   1753  O  "O2'" . G   A  1  91   ? 41.114  174.148 33.374  1.00 55.79  ? 91   G   0 "O2'" 1 
ATOM   1754  C  "C1'" . G   A  1  91   ? 39.611  173.291 35.032  1.00 55.00  ? 91   G   0 "C1'" 1 
ATOM   1755  N  N9    . G   A  1  91   ? 38.531  172.309 35.098  1.00 52.89  ? 91   G   0 N9    1 
ATOM   1756  C  C8    . G   A  1  91   ? 37.256  172.477 35.589  1.00 51.54  ? 91   G   0 C8    1 
ATOM   1757  N  N7    . G   A  1  91   ? 36.512  171.411 35.457  1.00 50.25  ? 91   G   0 N7    1 
ATOM   1758  C  C5    . G   A  1  91   ? 37.348  170.482 34.849  1.00 50.28  ? 91   G   0 C5    1 
ATOM   1759  C  C6    . G   A  1  91   ? 37.099  169.141 34.439  1.00 50.59  ? 91   G   0 C6    1 
ATOM   1760  O  O6    . G   A  1  91   ? 36.048  168.485 34.524  1.00 50.51  ? 91   G   0 O6    1 
ATOM   1761  N  N1    . G   A  1  91   ? 38.231  168.565 33.871  1.00 48.68  ? 91   G   0 N1    1 
ATOM   1762  C  C2    . G   A  1  91   ? 39.439  169.192 33.711  1.00 47.94  ? 91   G   0 C2    1 
ATOM   1763  N  N2    . G   A  1  91   ? 40.406  168.472 33.139  1.00 48.02  ? 91   G   0 N2    1 
ATOM   1764  N  N3    . G   A  1  91   ? 39.682  170.434 34.080  1.00 49.08  ? 91   G   0 N3    1 
ATOM   1765  C  C4    . G   A  1  91   ? 38.600  171.016 34.636  1.00 50.50  ? 91   G   0 C4    1 
ATOM   1766  P  P     . G   A  1  92   ? 38.345  175.655 31.146  1.00 59.97  ? 92   G   0 P     1 
ATOM   1767  O  OP1   . G   A  1  92   ? 38.790  176.752 30.246  1.00 59.30  ? 92   G   0 OP1   1 
ATOM   1768  O  OP2   . G   A  1  92   ? 36.893  175.463 31.422  1.00 58.18  ? 92   G   0 OP2   1 
ATOM   1769  O  "O5'" . G   A  1  92   ? 38.937  174.284 30.582  1.00 57.48  ? 92   G   0 "O5'" 1 
ATOM   1770  C  "C5'" . G   A  1  92   ? 40.339  174.165 30.293  1.00 54.44  ? 92   G   0 "C5'" 1 
ATOM   1771  C  "C4'" . G   A  1  92   ? 40.701  172.739 29.957  1.00 52.87  ? 92   G   0 "C4'" 1 
ATOM   1772  O  "O4'" . G   A  1  92   ? 40.261  171.852 31.022  1.00 51.72  ? 92   G   0 "O4'" 1 
ATOM   1773  C  "C3'" . G   A  1  92   ? 40.063  172.120 28.729  1.00 52.75  ? 92   G   0 "C3'" 1 
ATOM   1774  O  "O3'" . G   A  1  92   ? 40.665  172.563 27.517  1.00 53.63  ? 92   G   0 "O3'" 1 
ATOM   1775  C  "C2'" . G   A  1  92   ? 40.300  170.636 28.993  1.00 51.23  ? 92   G   0 "C2'" 1 
ATOM   1776  O  "O2'" . G   A  1  92   ? 41.646  170.241 28.805  1.00 51.23  ? 92   G   0 "O2'" 1 
ATOM   1777  C  "C1'" . G   A  1  92   ? 40.003  170.558 30.486  1.00 49.01  ? 92   G   0 "C1'" 1 
ATOM   1778  N  N9    . G   A  1  92   ? 38.613  170.199 30.757  1.00 45.47  ? 92   G   0 N9    1 
ATOM   1779  C  C8    . G   A  1  92   ? 37.616  171.028 31.209  1.00 44.98  ? 92   G   0 C8    1 
ATOM   1780  N  N7    . G   A  1  92   ? 36.476  170.416 31.370  1.00 43.89  ? 92   G   0 N7    1 
ATOM   1781  C  C5    . G   A  1  92   ? 36.732  169.104 31.002  1.00 41.17  ? 92   G   0 C5    1 
ATOM   1782  C  C6    . G   A  1  92   ? 35.875  167.979 30.976  1.00 41.09  ? 92   G   0 C6    1 
ATOM   1783  O  O6    . G   A  1  92   ? 34.684  167.909 31.295  1.00 42.91  ? 92   G   0 O6    1 
ATOM   1784  N  N1    . G   A  1  92   ? 36.535  166.844 30.530  1.00 40.03  ? 92   G   0 N1    1 
ATOM   1785  C  C2    . G   A  1  92   ? 37.851  166.792 30.164  1.00 40.72  ? 92   G   0 C2    1 
ATOM   1786  N  N2    . G   A  1  92   ? 38.299  165.593 29.766  1.00 38.87  ? 92   G   0 N2    1 
ATOM   1787  N  N3    . G   A  1  92   ? 38.667  167.837 30.188  1.00 41.57  ? 92   G   0 N3    1 
ATOM   1788  C  C4    . G   A  1  92   ? 38.043  168.952 30.615  1.00 41.92  ? 92   G   0 C4    1 
ATOM   1789  P  P     . C   A  1  93   ? 39.881  172.369 26.122  1.00 54.63  ? 93   C   0 P     1 
ATOM   1790  O  OP1   . C   A  1  93   ? 40.715  173.003 25.059  1.00 54.84  ? 93   C   0 OP1   1 
ATOM   1791  O  OP2   . C   A  1  93   ? 38.459  172.781 26.290  1.00 51.47  ? 93   C   0 OP2   1 
ATOM   1792  O  "O5'" . C   A  1  93   ? 39.905  170.795 25.887  1.00 52.12  ? 93   C   0 "O5'" 1 
ATOM   1793  C  "C5'" . C   A  1  93   ? 41.149  170.099 25.713  1.00 51.16  ? 93   C   0 "C5'" 1 
ATOM   1794  C  "C4'" . C   A  1  93   ? 40.899  168.621 25.540  1.00 51.05  ? 93   C   0 "C4'" 1 
ATOM   1795  O  "O4'" . C   A  1  93   ? 40.313  168.067 26.752  1.00 49.41  ? 93   C   0 "O4'" 1 
ATOM   1796  C  "C3'" . C   A  1  93   ? 39.890  168.247 24.469  1.00 51.14  ? 93   C   0 "C3'" 1 
ATOM   1797  O  "O3'" . C   A  1  93   ? 40.417  168.324 23.149  1.00 52.85  ? 93   C   0 "O3'" 1 
ATOM   1798  C  "C2'" . C   A  1  93   ? 39.504  166.837 24.895  1.00 49.19  ? 93   C   0 "C2'" 1 
ATOM   1799  O  "O2'" . C   A  1  93   ? 40.502  165.871 24.602  1.00 46.55  ? 93   C   0 "O2'" 1 
ATOM   1800  C  "C1'" . C   A  1  93   ? 39.414  167.018 26.410  1.00 47.18  ? 93   C   0 "C1'" 1 
ATOM   1801  N  N1    . C   A  1  93   ? 38.052  167.385 26.855  1.00 44.45  ? 93   C   0 N1    1 
ATOM   1802  C  C2    . C   A  1  93   ? 37.064  166.386 26.911  1.00 43.71  ? 93   C   0 C2    1 
ATOM   1803  O  O2    . C   A  1  93   ? 37.349  165.238 26.549  1.00 42.48  ? 93   C   0 O2    1 
ATOM   1804  N  N3    . C   A  1  93   ? 35.823  166.701 27.352  1.00 43.90  ? 93   C   0 N3    1 
ATOM   1805  C  C4    . C   A  1  93   ? 35.541  167.955 27.711  1.00 44.04  ? 93   C   0 C4    1 
ATOM   1806  N  N4    . C   A  1  93   ? 34.302  168.219 28.146  1.00 42.29  ? 93   C   0 N4    1 
ATOM   1807  C  C5    . C   A  1  93   ? 36.516  168.995 27.643  1.00 44.17  ? 93   C   0 C5    1 
ATOM   1808  C  C6    . C   A  1  93   ? 37.747  168.669 27.215  1.00 43.72  ? 93   C   0 C6    1 
ATOM   1809  P  P     . G   A  1  94   ? 39.419  168.592 21.917  1.00 52.88  ? 94   G   0 P     1 
ATOM   1810  O  OP1   . G   A  1  94   ? 40.209  168.487 20.663  1.00 52.53  ? 94   G   0 OP1   1 
ATOM   1811  O  OP2   . G   A  1  94   ? 38.621  169.816 22.191  1.00 53.21  ? 94   G   0 OP2   1 
ATOM   1812  O  "O5'" . G   A  1  94   ? 38.422  167.357 21.965  1.00 53.45  ? 94   G   0 "O5'" 1 
ATOM   1813  C  "C5'" . G   A  1  94   ? 38.882  166.035 21.655  1.00 52.45  ? 94   G   0 "C5'" 1 
ATOM   1814  C  "C4'" . G   A  1  94   ? 37.720  165.084 21.627  1.00 51.57  ? 94   G   0 "C4'" 1 
ATOM   1815  O  "O4'" . G   A  1  94   ? 37.146  164.988 22.955  1.00 50.71  ? 94   G   0 "O4'" 1 
ATOM   1816  C  "C3'" . G   A  1  94   ? 36.539  165.535 20.790  1.00 52.88  ? 94   G   0 "C3'" 1 
ATOM   1817  O  "O3'" . G   A  1  94   ? 36.758  165.338 19.399  1.00 58.13  ? 94   G   0 "O3'" 1 
ATOM   1818  C  "C2'" . G   A  1  94   ? 35.424  164.673 21.360  1.00 49.58  ? 94   G   0 "C2'" 1 
ATOM   1819  O  "O2'" . G   A  1  94   ? 35.516  163.329 20.936  1.00 48.50  ? 94   G   0 "O2'" 1 
ATOM   1820  C  "C1'" . G   A  1  94   ? 35.757  164.728 22.849  1.00 47.81  ? 94   G   0 "C1'" 1 
ATOM   1821  N  N9    . G   A  1  94   ? 35.026  165.778 23.548  1.00 45.38  ? 94   G   0 N9    1 
ATOM   1822  C  C8    . G   A  1  94   ? 35.487  167.005 23.961  1.00 44.10  ? 94   G   0 C8    1 
ATOM   1823  N  N7    . G   A  1  94   ? 34.569  167.721 24.554  1.00 43.75  ? 94   G   0 N7    1 
ATOM   1824  C  C5    . G   A  1  94   ? 33.438  166.916 24.530  1.00 44.12  ? 94   G   0 C5    1 
ATOM   1825  C  C6    . G   A  1  94   ? 32.119  167.154 25.014  1.00 45.44  ? 94   G   0 C6    1 
ATOM   1826  O  O6    . G   A  1  94   ? 31.667  168.166 25.569  1.00 46.91  ? 94   G   0 O6    1 
ATOM   1827  N  N1    . G   A  1  94   ? 31.288  166.059 24.791  1.00 45.46  ? 94   G   0 N1    1 
ATOM   1828  C  C2    . G   A  1  94   ? 31.671  164.889 24.172  1.00 45.73  ? 94   G   0 C2    1 
ATOM   1829  N  N2    . G   A  1  94   ? 30.734  163.929 24.058  1.00 45.28  ? 94   G   0 N2    1 
ATOM   1830  N  N3    . G   A  1  94   ? 32.885  164.669 23.703  1.00 44.77  ? 94   G   0 N3    1 
ATOM   1831  C  C4    . G   A  1  94   ? 33.709  165.714 23.917  1.00 44.42  ? 94   G   0 C4    1 
ATOM   1832  P  P     . A   A  1  95   ? 36.503  166.553 18.375  1.00 59.57  ? 95   A   0 P     1 
ATOM   1833  O  OP1   . A   A  1  95   ? 37.835  167.039 17.929  1.00 57.81  ? 95   A   0 OP1   1 
ATOM   1834  O  OP2   . A   A  1  95   ? 35.539  167.506 18.996  1.00 58.64  ? 95   A   0 OP2   1 
ATOM   1835  O  "O5'" . A   A  1  95   ? 35.766  165.861 17.143  1.00 61.54  ? 95   A   0 "O5'" 1 
ATOM   1836  C  "C5'" . A   A  1  95   ? 34.593  165.040 17.342  1.00 64.24  ? 95   A   0 "C5'" 1 
ATOM   1837  C  "C4'" . A   A  1  95   ? 33.714  165.092 16.116  1.00 66.47  ? 95   A   0 "C4'" 1 
ATOM   1838  O  "O4'" . A   A  1  95   ? 32.639  164.118 16.227  1.00 66.85  ? 95   A   0 "O4'" 1 
ATOM   1839  C  "C3'" . A   A  1  95   ? 33.043  166.438 15.869  1.00 68.84  ? 95   A   0 "C3'" 1 
ATOM   1840  O  "O3'" . A   A  1  95   ? 32.919  166.663 14.470  1.00 71.11  ? 95   A   0 "O3'" 1 
ATOM   1841  C  "C2'" . A   A  1  95   ? 31.659  166.233 16.470  1.00 68.96  ? 95   A   0 "C2'" 1 
ATOM   1842  O  "O2'" . A   A  1  95   ? 30.698  167.111 15.913  1.00 69.34  ? 95   A   0 "O2'" 1 
ATOM   1843  C  "C1'" . A   A  1  95   ? 31.394  164.774 16.097  1.00 68.44  ? 95   A   0 "C1'" 1 
ATOM   1844  N  N9    . A   A  1  95   ? 30.415  164.094 16.948  1.00 69.26  ? 95   A   0 N9    1 
ATOM   1845  C  C8    . A   A  1  95   ? 29.229  163.525 16.551  1.00 69.22  ? 95   A   0 C8    1 
ATOM   1846  N  N7    . A   A  1  95   ? 28.535  163.006 17.533  1.00 69.61  ? 95   A   0 N7    1 
ATOM   1847  C  C5    . A   A  1  95   ? 29.317  163.244 18.656  1.00 70.56  ? 95   A   0 C5    1 
ATOM   1848  C  C6    . A   A  1  95   ? 29.131  162.950 20.020  1.00 70.79  ? 95   A   0 C6    1 
ATOM   1849  N  N6    . A   A  1  95   ? 28.055  162.324 20.504  1.00 71.09  ? 95   A   0 N6    1 
ATOM   1850  N  N1    . A   A  1  95   ? 30.100  163.330 20.882  1.00 70.65  ? 95   A   0 N1    1 
ATOM   1851  C  C2    . A   A  1  95   ? 31.178  163.959 20.397  1.00 69.99  ? 95   A   0 C2    1 
ATOM   1852  N  N3    . A   A  1  95   ? 31.466  164.292 19.141  1.00 70.08  ? 95   A   0 N3    1 
ATOM   1853  C  C4    . A   A  1  95   ? 30.483  163.905 18.309  1.00 70.10  ? 95   A   0 C4    1 
ATOM   1854  P  P     . A   A  1  96   ? 33.673  167.909 13.794  1.00 71.57  ? 96   A   0 P     1 
ATOM   1855  O  OP1   . A   A  1  96   ? 33.631  169.075 14.726  1.00 71.06  ? 96   A   0 OP1   1 
ATOM   1856  O  OP2   . A   A  1  96   ? 33.081  168.032 12.436  1.00 72.95  ? 96   A   0 OP2   1 
ATOM   1857  O  "O5'" . A   A  1  96   ? 35.184  167.417 13.644  1.00 67.78  ? 96   A   0 "O5'" 1 
ATOM   1858  C  "C5'" . A   A  1  96   ? 35.549  166.498 12.601  1.00 65.37  ? 96   A   0 "C5'" 1 
ATOM   1859  C  "C4'" . A   A  1  96   ? 37.019  166.168 12.674  1.00 65.15  ? 96   A   0 "C4'" 1 
ATOM   1860  O  "O4'" . A   A  1  96   ? 37.789  167.396 12.532  1.00 64.94  ? 96   A   0 "O4'" 1 
ATOM   1861  C  "C3'" . A   A  1  96   ? 37.504  165.516 13.970  1.00 65.09  ? 96   A   0 "C3'" 1 
ATOM   1862  O  "O3'" . A   A  1  96   ? 38.547  164.591 13.673  1.00 64.80  ? 96   A   0 "O3'" 1 
ATOM   1863  C  "C2'" . A   A  1  96   ? 38.113  166.694 14.722  1.00 65.93  ? 96   A   0 "C2'" 1 
ATOM   1864  O  "O2'" . A   A  1  96   ? 39.108  166.319 15.653  1.00 65.91  ? 96   A   0 "O2'" 1 
ATOM   1865  C  "C1'" . A   A  1  96   ? 38.742  167.458 13.566  1.00 65.93  ? 96   A   0 "C1'" 1 
ATOM   1866  N  N9    . A   A  1  96   ? 39.092  168.852 13.834  1.00 66.73  ? 96   A   0 N9    1 
ATOM   1867  C  C8    . A   A  1  96   ? 38.382  169.827 14.497  1.00 66.76  ? 96   A   0 C8    1 
ATOM   1868  N  N7    . A   A  1  96   ? 39.020  170.971 14.593  1.00 67.35  ? 96   A   0 N7    1 
ATOM   1869  C  C5    . A   A  1  96   ? 40.227  170.738 13.939  1.00 68.05  ? 96   A   0 C5    1 
ATOM   1870  C  C6    . A   A  1  96   ? 41.358  171.556 13.693  1.00 68.39  ? 96   A   0 C6    1 
ATOM   1871  N  N6    . A   A  1  96   ? 41.468  172.822 14.108  1.00 67.84  ? 96   A   0 N6    1 
ATOM   1872  N  N1    . A   A  1  96   ? 42.388  171.012 13.001  1.00 68.25  ? 96   A   0 N1    1 
ATOM   1873  C  C2    . A   A  1  96   ? 42.289  169.736 12.598  1.00 67.48  ? 96   A   0 C2    1 
ATOM   1874  N  N3    . A   A  1  96   ? 41.291  168.870 12.775  1.00 67.05  ? 96   A   0 N3    1 
ATOM   1875  C  C4    . A   A  1  96   ? 40.279  169.440 13.459  1.00 67.46  ? 96   A   0 C4    1 
ATOM   1876  P  P     . G   A  1  97   ? 38.269  163.014 13.774  1.00 64.65  ? 97   G   0 P     1 
ATOM   1877  O  OP1   . G   A  1  97   ? 39.524  162.318 14.164  1.00 63.08  ? 97   G   0 OP1   1 
ATOM   1878  O  OP2   . G   A  1  97   ? 37.571  162.614 12.529  1.00 65.00  ? 97   G   0 OP2   1 
ATOM   1879  O  "O5'" . G   A  1  97   ? 37.215  162.890 14.962  1.00 65.49  ? 97   G   0 "O5'" 1 
ATOM   1880  C  "C5'" . G   A  1  97   ? 37.610  163.059 16.338  1.00 63.80  ? 97   G   0 "C5'" 1 
ATOM   1881  C  "C4'" . G   A  1  97   ? 37.039  161.939 17.173  1.00 61.95  ? 97   G   0 "C4'" 1 
ATOM   1882  O  "O4'" . G   A  1  97   ? 35.588  161.996 17.105  1.00 62.25  ? 97   G   0 "O4'" 1 
ATOM   1883  C  "C3'" . G   A  1  97   ? 37.422  160.543 16.702  1.00 60.86  ? 97   G   0 "C3'" 1 
ATOM   1884  O  "O3'" . G   A  1  97   ? 37.460  159.672 17.819  1.00 60.09  ? 97   G   0 "O3'" 1 
ATOM   1885  C  "C2'" . G   A  1  97   ? 36.270  160.180 15.774  1.00 60.99  ? 97   G   0 "C2'" 1 
ATOM   1886  O  "O2'" . G   A  1  97   ? 36.099  158.787 15.608  1.00 59.66  ? 97   G   0 "O2'" 1 
ATOM   1887  C  "C1'" . G   A  1  97   ? 35.085  160.820 16.499  1.00 62.45  ? 97   G   0 "C1'" 1 
ATOM   1888  N  N9    . G   A  1  97   ? 33.995  161.207 15.606  1.00 63.82  ? 97   G   0 N9    1 
ATOM   1889  C  C8    . G   A  1  97   ? 34.104  161.932 14.443  1.00 64.33  ? 97   G   0 C8    1 
ATOM   1890  N  N7    . G   A  1  97   ? 32.963  162.109 13.839  1.00 64.91  ? 97   G   0 N7    1 
ATOM   1891  C  C5    . G   A  1  97   ? 32.039  161.468 14.651  1.00 65.02  ? 97   G   0 C5    1 
ATOM   1892  C  C6    . G   A  1  97   ? 30.637  161.318 14.502  1.00 65.60  ? 97   G   0 C6    1 
ATOM   1893  O  O6    . G   A  1  97   ? 29.910  161.729 13.588  1.00 66.49  ? 97   G   0 O6    1 
ATOM   1894  N  N1    . G   A  1  97   ? 30.086  160.603 15.556  1.00 65.37  ? 97   G   0 N1    1 
ATOM   1895  C  C2    . G   A  1  97   ? 30.789  160.093 16.614  1.00 65.31  ? 97   G   0 C2    1 
ATOM   1896  N  N2    . G   A  1  97   ? 30.068  159.430 17.523  1.00 66.56  ? 97   G   0 N2    1 
ATOM   1897  N  N3    . G   A  1  97   ? 32.098  160.220 16.767  1.00 64.66  ? 97   G   0 N3    1 
ATOM   1898  C  C4    . G   A  1  97   ? 32.656  160.914 15.753  1.00 64.39  ? 97   G   0 C4    1 
ATOM   1899  P  P     . A   A  1  98   ? 38.800  158.857 18.147  1.00 60.01  ? 98   A   0 P     1 
ATOM   1900  O  OP1   . A   A  1  98   ? 39.866  159.265 17.190  1.00 60.68  ? 98   A   0 OP1   1 
ATOM   1901  O  OP2   . A   A  1  98   ? 38.439  157.429 18.263  1.00 59.98  ? 98   A   0 OP2   1 
ATOM   1902  O  "O5'" . A   A  1  98   ? 39.195  159.386 19.593  1.00 58.87  ? 98   A   0 "O5'" 1 
ATOM   1903  C  "C5'" . A   A  1  98   ? 39.947  160.599 19.760  1.00 56.63  ? 98   A   0 "C5'" 1 
ATOM   1904  C  "C4'" . A   A  1  98   ? 39.764  161.131 21.157  1.00 55.61  ? 98   A   0 "C4'" 1 
ATOM   1905  O  "O4'" . A   A  1  98   ? 38.405  161.619 21.311  1.00 55.98  ? 98   A   0 "O4'" 1 
ATOM   1906  C  "C3'" . A   A  1  98   ? 39.914  160.100 22.263  1.00 55.16  ? 98   A   0 "C3'" 1 
ATOM   1907  O  "O3'" . A   A  1  98   ? 41.269  159.848 22.614  1.00 52.97  ? 98   A   0 "O3'" 1 
ATOM   1908  C  "C2'" . A   A  1  98   ? 39.120  160.735 23.390  1.00 55.62  ? 98   A   0 "C2'" 1 
ATOM   1909  O  "O2'" . A   A  1  98   ? 39.842  161.774 24.010  1.00 56.58  ? 98   A   0 "O2'" 1 
ATOM   1910  C  "C1'" . A   A  1  98   ? 37.939  161.327 22.620  1.00 56.39  ? 98   A   0 "C1'" 1 
ATOM   1911  N  N9    . A   A  1  98   ? 36.827  160.381 22.507  1.00 57.52  ? 98   A   0 N9    1 
ATOM   1912  C  C8    . A   A  1  98   ? 36.416  159.696 21.390  1.00 58.12  ? 98   A   0 C8    1 
ATOM   1913  N  N7    . A   A  1  98   ? 35.400  158.898 21.603  1.00 58.59  ? 98   A   0 N7    1 
ATOM   1914  C  C5    . A   A  1  98   ? 35.117  159.069 22.951  1.00 59.13  ? 98   A   0 C5    1 
ATOM   1915  C  C6    . A   A  1  98   ? 34.151  158.494 23.795  1.00 60.19  ? 98   A   0 C6    1 
ATOM   1916  N  N6    . A   A  1  98   ? 33.257  157.587 23.389  1.00 60.52  ? 98   A   0 N6    1 
ATOM   1917  N  N1    . A   A  1  98   ? 34.138  158.883 25.091  1.00 60.69  ? 98   A   0 N1    1 
ATOM   1918  C  C2    . A   A  1  98   ? 35.040  159.783 25.500  1.00 59.83  ? 98   A   0 C2    1 
ATOM   1919  N  N3    . A   A  1  98   ? 35.999  160.392 24.804  1.00 60.39  ? 98   A   0 N3    1 
ATOM   1920  C  C4    . A   A  1  98   ? 35.984  159.986 23.519  1.00 59.20  ? 98   A   0 C4    1 
ATOM   1921  P  P     . A   A  1  99   ? 41.718  158.353 23.001  1.00 53.46  ? 99   A   0 P     1 
ATOM   1922  O  OP1   . A   A  1  99   ? 43.125  158.387 23.474  1.00 53.73  ? 99   A   0 OP1   1 
ATOM   1923  O  OP2   . A   A  1  99   ? 41.358  157.464 21.873  1.00 54.21  ? 99   A   0 OP2   1 
ATOM   1924  O  "O5'" . A   A  1  99   ? 40.777  157.987 24.239  1.00 53.89  ? 99   A   0 "O5'" 1 
ATOM   1925  C  "C5'" . A   A  1  99   ? 40.818  158.769 25.452  1.00 52.95  ? 99   A   0 "C5'" 1 
ATOM   1926  C  "C4'" . A   A  1  99   ? 39.738  158.329 26.419  1.00 52.38  ? 99   A   0 "C4'" 1 
ATOM   1927  O  "O4'" . A   A  1  99   ? 38.444  158.399 25.769  1.00 53.41  ? 99   A   0 "O4'" 1 
ATOM   1928  C  "C3'" . A   A  1  99   ? 39.790  156.900 26.936  1.00 52.35  ? 99   A   0 "C3'" 1 
ATOM   1929  O  "O3'" . A   A  1  99   ? 40.726  156.758 27.995  1.00 51.23  ? 99   A   0 "O3'" 1 
ATOM   1930  C  "C2'" . A   A  1  99   ? 38.361  156.695 27.425  1.00 53.29  ? 99   A   0 "C2'" 1 
ATOM   1931  O  "O2'" . A   A  1  99   ? 38.108  157.302 28.677  1.00 52.30  ? 99   A   0 "O2'" 1 
ATOM   1932  C  "C1'" . A   A  1  99   ? 37.568  157.440 26.347  1.00 54.23  ? 99   A   0 "C1'" 1 
ATOM   1933  N  N9    . A   A  1  99   ? 37.077  156.552 25.292  1.00 54.38  ? 99   A   0 N9    1 
ATOM   1934  C  C8    . A   A  1  99   ? 37.632  156.299 24.064  1.00 54.40  ? 99   A   0 C8    1 
ATOM   1935  N  N7    . A   A  1  99   ? 36.966  155.422 23.354  1.00 55.06  ? 99   A   0 N7    1 
ATOM   1936  C  C5    . A   A  1  99   ? 35.894  155.080 24.166  1.00 54.69  ? 99   A   0 C5    1 
ATOM   1937  C  C6    . A   A  1  99   ? 34.820  154.186 23.993  1.00 54.80  ? 99   A   0 C6    1 
ATOM   1938  N  N6    . A   A  1  99   ? 34.638  153.441 22.900  1.00 54.82  ? 99   A   0 N6    1 
ATOM   1939  N  N1    . A   A  1  99   ? 33.925  154.080 24.996  1.00 54.22  ? 99   A   0 N1    1 
ATOM   1940  C  C2    . A   A  1  99   ? 34.104  154.824 26.091  1.00 54.77  ? 99   A   0 C2    1 
ATOM   1941  N  N3    . A   A  1  99   ? 35.071  155.694 26.372  1.00 54.63  ? 99   A   0 N3    1 
ATOM   1942  C  C4    . A   A  1  99   ? 35.945  155.775 25.357  1.00 54.23  ? 99   A   0 C4    1 
ATOM   1943  P  P     . C   A  1  100  ? 41.907  155.677 27.872  1.00 49.85  ? 100  C   0 P     1 
ATOM   1944  O  OP1   . C   A  1  100  ? 42.606  155.645 29.182  1.00 50.33  ? 100  C   0 OP1   1 
ATOM   1945  O  OP2   . C   A  1  100  ? 42.679  155.934 26.636  1.00 49.31  ? 100  C   0 OP2   1 
ATOM   1946  O  "O5'" . C   A  1  100  ? 41.139  154.306 27.659  1.00 51.13  ? 100  C   0 "O5'" 1 
ATOM   1947  C  "C5'" . C   A  1  100  ? 40.148  153.859 28.592  1.00 51.72  ? 100  C   0 "C5'" 1 
ATOM   1948  C  "C4'" . C   A  1  100  ? 39.333  152.760 27.970  1.00 52.19  ? 100  C   0 "C4'" 1 
ATOM   1949  O  "O4'" . C   A  1  100  ? 38.474  153.316 26.937  1.00 54.09  ? 100  C   0 "O4'" 1 
ATOM   1950  C  "C3'" . C   A  1  100  ? 40.142  151.707 27.233  1.00 50.80  ? 100  C   0 "C3'" 1 
ATOM   1951  O  "O3'" . C   A  1  100  ? 40.726  150.763 28.115  1.00 49.10  ? 100  C   0 "O3'" 1 
ATOM   1952  C  "C2'" . C   A  1  100  ? 39.098  151.118 26.295  1.00 53.16  ? 100  C   0 "C2'" 1 
ATOM   1953  O  "O2'" . C   A  1  100  ? 38.185  150.263 26.960  1.00 52.02  ? 100  C   0 "O2'" 1 
ATOM   1954  C  "C1'" . C   A  1  100  ? 38.351  152.383 25.868  1.00 54.33  ? 100  C   0 "C1'" 1 
ATOM   1955  N  N1    . C   A  1  100  ? 38.889  152.999 24.633  1.00 55.65  ? 100  C   0 N1    1 
ATOM   1956  C  C2    . C   A  1  100  ? 38.369  152.600 23.387  1.00 55.51  ? 100  C   0 C2    1 
ATOM   1957  O  O2    . C   A  1  100  ? 37.488  151.736 23.348  1.00 56.29  ? 100  C   0 O2    1 
ATOM   1958  N  N3    . C   A  1  100  ? 38.847  153.170 22.258  1.00 55.93  ? 100  C   0 N3    1 
ATOM   1959  C  C4    . C   A  1  100  ? 39.807  154.094 22.332  1.00 56.35  ? 100  C   0 C4    1 
ATOM   1960  N  N4    . C   A  1  100  ? 40.248  154.625 21.194  1.00 56.64  ? 100  C   0 N4    1 
ATOM   1961  C  C5    . C   A  1  100  ? 40.358  154.513 23.578  1.00 56.17  ? 100  C   0 C5    1 
ATOM   1962  C  C6    . C   A  1  100  ? 39.875  153.946 24.692  1.00 56.08  ? 100  C   0 C6    1 
ATOM   1963  P  P     . C   A  1  101  ? 42.142  150.096 27.743  1.00 48.25  ? 101  C   0 P     1 
ATOM   1964  O  OP1   . C   A  1  101  ? 42.566  149.280 28.905  1.00 49.01  ? 101  C   0 OP1   1 
ATOM   1965  O  OP2   . C   A  1  101  ? 43.058  151.136 27.217  1.00 49.49  ? 101  C   0 OP2   1 
ATOM   1966  O  "O5'" . C   A  1  101  ? 41.783  149.098 26.561  1.00 47.58  ? 101  C   0 "O5'" 1 
ATOM   1967  C  "C5'" . C   A  1  101  ? 41.024  147.910 26.820  1.00 48.51  ? 101  C   0 "C5'" 1 
ATOM   1968  C  "C4'" . C   A  1  101  ? 40.849  147.112 25.555  1.00 50.71  ? 101  C   0 "C4'" 1 
ATOM   1969  O  "O4'" . C   A  1  101  ? 40.024  147.853 24.624  1.00 50.94  ? 101  C   0 "O4'" 1 
ATOM   1970  C  "C3'" . C   A  1  101  ? 42.115  146.813 24.772  1.00 50.88  ? 101  C   0 "C3'" 1 
ATOM   1971  O  "O3'" . C   A  1  101  ? 42.795  145.685 25.294  1.00 52.24  ? 101  C   0 "O3'" 1 
ATOM   1972  C  "C2'" . C   A  1  101  ? 41.566  146.540 23.384  1.00 51.09  ? 101  C   0 "C2'" 1 
ATOM   1973  O  "O2'" . C   A  1  101  ? 41.011  145.247 23.294  1.00 51.56  ? 101  C   0 "O2'" 1 
ATOM   1974  C  "C1'" . C   A  1  101  ? 40.449  147.583 23.300  1.00 51.23  ? 101  C   0 "C1'" 1 
ATOM   1975  N  N1    . C   A  1  101  ? 40.878  148.848 22.673  1.00 51.71  ? 101  C   0 N1    1 
ATOM   1976  C  C2    . C   A  1  101  ? 41.145  148.854 21.301  1.00 51.97  ? 101  C   0 C2    1 
ATOM   1977  O  O2    . C   A  1  101  ? 41.022  147.796 20.666  1.00 51.85  ? 101  C   0 O2    1 
ATOM   1978  N  N3    . C   A  1  101  ? 41.530  150.008 20.704  1.00 52.58  ? 101  C   0 N3    1 
ATOM   1979  C  C4    . C   A  1  101  ? 41.652  151.124 21.427  1.00 52.75  ? 101  C   0 C4    1 
ATOM   1980  N  N4    . C   A  1  101  ? 42.029  152.240 20.797  1.00 50.72  ? 101  C   0 N4    1 
ATOM   1981  C  C5    . C   A  1  101  ? 41.392  151.145 22.831  1.00 52.87  ? 101  C   0 C5    1 
ATOM   1982  C  C6    . C   A  1  101  ? 41.012  149.997 23.406  1.00 52.20  ? 101  C   0 C6    1 
ATOM   1983  P  P     . A   A  1  102  ? 44.302  145.389 24.840  1.00 53.03  ? 102  A   0 P     1 
ATOM   1984  O  OP1   . A   A  1  102  ? 44.732  144.162 25.552  1.00 54.38  ? 102  A   0 OP1   1 
ATOM   1985  O  OP2   . A   A  1  102  ? 45.103  146.634 24.972  1.00 52.71  ? 102  A   0 OP2   1 
ATOM   1986  O  "O5'" . A   A  1  102  ? 44.162  145.043 23.296  1.00 54.20  ? 102  A   0 "O5'" 1 
ATOM   1987  C  "C5'" . A   A  1  102  ? 43.727  143.746 22.863  1.00 55.55  ? 102  A   0 "C5'" 1 
ATOM   1988  C  "C4'" . A   A  1  102  ? 44.006  143.583 21.393  1.00 56.63  ? 102  A   0 "C4'" 1 
ATOM   1989  O  "O4'" . A   A  1  102  ? 43.215  144.546 20.653  1.00 58.51  ? 102  A   0 "O4'" 1 
ATOM   1990  C  "C3'" . A   A  1  102  ? 45.432  143.900 20.993  1.00 55.82  ? 102  A   0 "C3'" 1 
ATOM   1991  O  "O3'" . A   A  1  102  ? 46.288  142.797 21.201  1.00 56.52  ? 102  A   0 "O3'" 1 
ATOM   1992  C  "C2'" . A   A  1  102  ? 45.282  144.277 19.530  1.00 56.71  ? 102  A   0 "C2'" 1 
ATOM   1993  O  "O2'" . A   A  1  102  ? 45.109  143.148 18.703  1.00 56.77  ? 102  A   0 "O2'" 1 
ATOM   1994  C  "C1'" . A   A  1  102  ? 43.972  145.059 19.570  1.00 57.91  ? 102  A   0 "C1'" 1 
ATOM   1995  N  N9    . A   A  1  102  ? 44.153  146.493 19.791  1.00 58.93  ? 102  A   0 N9    1 
ATOM   1996  C  C8    . A   A  1  102  ? 44.094  147.174 20.984  1.00 59.01  ? 102  A   0 C8    1 
ATOM   1997  N  N7    . A   A  1  102  ? 44.272  148.466 20.865  1.00 59.52  ? 102  A   0 N7    1 
ATOM   1998  C  C5    . A   A  1  102  ? 44.469  148.650 19.504  1.00 59.51  ? 102  A   0 C5    1 
ATOM   1999  C  C6    . A   A  1  102  ? 44.708  149.796 18.733  1.00 59.34  ? 102  A   0 C6    1 
ATOM   2000  N  N6    . A   A  1  102  ? 44.788  151.027 19.243  1.00 59.11  ? 102  A   0 N6    1 
ATOM   2001  N  N1    . A   A  1  102  ? 44.864  149.634 17.402  1.00 59.71  ? 102  A   0 N1    1 
ATOM   2002  C  C2    . A   A  1  102  ? 44.779  148.401 16.892  1.00 58.75  ? 102  A   0 C2    1 
ATOM   2003  N  N3    . A   A  1  102  ? 44.555  147.249 17.511  1.00 58.47  ? 102  A   0 N3    1 
ATOM   2004  C  C4    . A   A  1  102  ? 44.406  147.443 18.831  1.00 59.42  ? 102  A   0 C4    1 
ATOM   2005  P  P     . C   A  1  103  ? 47.822  143.056 21.579  1.00 58.88  ? 103  C   0 P     1 
ATOM   2006  O  OP1   . C   A  1  103  ? 48.400  141.789 22.078  1.00 60.14  ? 103  C   0 OP1   1 
ATOM   2007  O  OP2   . C   A  1  103  ? 47.871  144.277 22.433  1.00 58.36  ? 103  C   0 OP2   1 
ATOM   2008  O  "O5'" . C   A  1  103  ? 48.505  143.362 20.174  1.00 59.16  ? 103  C   0 "O5'" 1 
ATOM   2009  C  "C5'" . C   A  1  103  ? 48.463  142.390 19.116  1.00 60.31  ? 103  C   0 "C5'" 1 
ATOM   2010  C  "C4'" . C   A  1  103  ? 48.761  143.041 17.785  1.00 61.41  ? 103  C   0 "C4'" 1 
ATOM   2011  O  "O4'" . C   A  1  103  ? 47.758  144.051 17.501  1.00 61.29  ? 103  C   0 "O4'" 1 
ATOM   2012  C  "C3'" . C   A  1  103  ? 50.071  143.801 17.690  1.00 62.10  ? 103  C   0 "C3'" 1 
ATOM   2013  O  "O3'" . C   A  1  103  ? 51.177  142.949 17.445  1.00 62.72  ? 103  C   0 "O3'" 1 
ATOM   2014  C  "C2'" . C   A  1  103  ? 49.814  144.737 16.521  1.00 62.83  ? 103  C   0 "C2'" 1 
ATOM   2015  O  "O2'" . C   A  1  103  ? 49.952  144.092 15.272  1.00 64.13  ? 103  C   0 "O2'" 1 
ATOM   2016  C  "C1'" . C   A  1  103  ? 48.349  145.108 16.757  1.00 63.12  ? 103  C   0 "C1'" 1 
ATOM   2017  N  N1    . C   A  1  103  ? 48.189  146.374 17.503  1.00 64.16  ? 103  C   0 N1    1 
ATOM   2018  C  C2    . C   A  1  103  ? 48.080  147.575 16.779  1.00 63.47  ? 103  C   0 C2    1 
ATOM   2019  O  O2    . C   A  1  103  ? 48.106  147.538 15.539  1.00 63.63  ? 103  C   0 O2    1 
ATOM   2020  N  N3    . C   A  1  103  ? 47.949  148.739 17.451  1.00 63.11  ? 103  C   0 N3    1 
ATOM   2021  C  C4    . C   A  1  103  ? 47.926  148.741 18.786  1.00 63.88  ? 103  C   0 C4    1 
ATOM   2022  N  N4    . C   A  1  103  ? 47.812  149.916 19.405  1.00 64.48  ? 103  C   0 N4    1 
ATOM   2023  C  C5    . C   A  1  103  ? 48.025  147.539 19.545  1.00 63.78  ? 103  C   0 C5    1 
ATOM   2024  C  C6    . C   A  1  103  ? 48.154  146.390 18.871  1.00 64.00  ? 103  C   0 C6    1 
ATOM   2025  P  P     . A   A  1  104  ? 52.624  143.355 18.011  1.00 66.09  ? 104  A   0 P     1 
ATOM   2026  O  OP1   . A   A  1  104  ? 53.564  142.248 17.681  1.00 65.63  ? 104  A   0 OP1   1 
ATOM   2027  O  OP2   . A   A  1  104  ? 52.449  143.774 19.433  1.00 64.26  ? 104  A   0 OP2   1 
ATOM   2028  O  "O5'" . A   A  1  104  ? 53.037  144.631 17.141  1.00 65.41  ? 104  A   0 "O5'" 1 
ATOM   2029  C  "C5'" . A   A  1  104  ? 53.375  144.493 15.746  1.00 63.82  ? 104  A   0 "C5'" 1 
ATOM   2030  C  "C4'" . A   A  1  104  ? 53.494  145.847 15.078  1.00 63.19  ? 104  A   0 "C4'" 1 
ATOM   2031  O  "O4'" . A   A  1  104  ? 52.241  146.574 15.194  1.00 62.62  ? 104  A   0 "O4'" 1 
ATOM   2032  C  "C3'" . A   A  1  104  ? 54.510  146.828 15.636  1.00 63.88  ? 104  A   0 "C3'" 1 
ATOM   2033  O  "O3'" . A   A  1  104  ? 55.842  146.540 15.220  1.00 63.59  ? 104  A   0 "O3'" 1 
ATOM   2034  C  "C2'" . A   A  1  104  ? 54.013  148.146 15.054  1.00 63.24  ? 104  A   0 "C2'" 1 
ATOM   2035  O  "O2'" . A   A  1  104  ? 54.344  148.303 13.687  1.00 63.61  ? 104  A   0 "O2'" 1 
ATOM   2036  C  "C1'" . A   A  1  104  ? 52.499  147.974 15.180  1.00 61.77  ? 104  A   0 "C1'" 1 
ATOM   2037  N  N9    . A   A  1  104  ? 51.980  148.566 16.414  1.00 60.62  ? 104  A   0 N9    1 
ATOM   2038  C  C8    . A   A  1  104  ? 51.566  147.918 17.550  1.00 60.46  ? 104  A   0 C8    1 
ATOM   2039  N  N7    . A   A  1  104  ? 51.179  148.723 18.508  1.00 60.16  ? 104  A   0 N7    1 
ATOM   2040  C  C5    . A   A  1  104  ? 51.345  149.989 17.967  1.00 59.42  ? 104  A   0 C5    1 
ATOM   2041  C  C6    . A   A  1  104  ? 51.121  151.276 18.490  1.00 58.81  ? 104  A   0 C6    1 
ATOM   2042  N  N6    . A   A  1  104  ? 50.674  151.503 19.728  1.00 58.51  ? 104  A   0 N6    1 
ATOM   2043  N  N1    . A   A  1  104  ? 51.380  152.332 17.690  1.00 58.30  ? 104  A   0 N1    1 
ATOM   2044  C  C2    . A   A  1  104  ? 51.839  152.101 16.455  1.00 59.71  ? 104  A   0 C2    1 
ATOM   2045  N  N3    . A   A  1  104  ? 52.098  150.939 15.853  1.00 60.34  ? 104  A   0 N3    1 
ATOM   2046  C  C4    . A   A  1  104  ? 51.826  149.909 16.674  1.00 60.07  ? 104  A   0 C4    1 
ATOM   2047  P  P     . G   A  1  105  ? 57.075  146.928 16.183  1.00 63.94  ? 105  G   0 P     1 
ATOM   2048  O  OP1   . G   A  1  105  ? 58.299  146.415 15.511  1.00 64.45  ? 105  G   0 OP1   1 
ATOM   2049  O  OP2   . G   A  1  105  ? 56.765  146.504 17.575  1.00 62.72  ? 105  G   0 OP2   1 
ATOM   2050  O  "O5'" . G   A  1  105  ? 57.123  148.520 16.167  1.00 59.01  ? 105  G   0 "O5'" 1 
ATOM   2051  C  "C5'" . G   A  1  105  ? 57.575  149.212 15.007  1.00 55.34  ? 105  G   0 "C5'" 1 
ATOM   2052  C  "C4'" . G   A  1  105  ? 57.289  150.689 15.115  1.00 53.43  ? 105  G   0 "C4'" 1 
ATOM   2053  O  "O4'" . G   A  1  105  ? 55.924  150.894 15.562  1.00 53.38  ? 105  G   0 "O4'" 1 
ATOM   2054  C  "C3'" . G   A  1  105  ? 58.047  151.499 16.146  1.00 52.13  ? 105  G   0 "C3'" 1 
ATOM   2055  O  "O3'" . G   A  1  105  ? 59.390  151.757 15.753  1.00 51.62  ? 105  G   0 "O3'" 1 
ATOM   2056  C  "C2'" . G   A  1  105  ? 57.219  152.781 16.152  1.00 52.29  ? 105  G   0 "C2'" 1 
ATOM   2057  O  "O2'" . G   A  1  105  ? 57.447  153.603 15.024  1.00 52.14  ? 105  G   0 "O2'" 1 
ATOM   2058  C  "C1'" . G   A  1  105  ? 55.799  152.222 16.048  1.00 51.78  ? 105  G   0 "C1'" 1 
ATOM   2059  N  N9    . G   A  1  105  ? 55.150  152.202 17.353  1.00 50.96  ? 105  G   0 N9    1 
ATOM   2060  C  C8    . G   A  1  105  ? 54.753  151.109 18.085  1.00 50.47  ? 105  G   0 C8    1 
ATOM   2061  N  N7    . G   A  1  105  ? 54.240  151.428 19.243  1.00 51.46  ? 105  G   0 N7    1 
ATOM   2062  C  C5    . G   A  1  105  ? 54.292  152.816 19.271  1.00 50.86  ? 105  G   0 C5    1 
ATOM   2063  C  C6    . G   A  1  105  ? 53.894  153.735 20.277  1.00 49.50  ? 105  G   0 C6    1 
ATOM   2064  O  O6    . G   A  1  105  ? 53.402  153.502 21.378  1.00 48.66  ? 105  G   0 O6    1 
ATOM   2065  N  N1    . G   A  1  105  ? 54.134  155.048 19.895  1.00 50.10  ? 105  G   0 N1    1 
ATOM   2066  C  C2    . G   A  1  105  ? 54.696  155.435 18.707  1.00 49.77  ? 105  G   0 C2    1 
ATOM   2067  N  N2    . G   A  1  105  ? 54.876  156.751 18.537  1.00 48.85  ? 105  G   0 N2    1 
ATOM   2068  N  N3    . G   A  1  105  ? 55.066  154.592 17.759  1.00 50.59  ? 105  G   0 N3    1 
ATOM   2069  C  C4    . G   A  1  105  ? 54.840  153.308 18.108  1.00 50.91  ? 105  G   0 C4    1 
ATOM   2070  P  P     . A   A  1  106  ? 60.457  152.272 16.846  1.00 52.74  ? 106  A   0 P     1 
ATOM   2071  O  OP1   . A   A  1  106  ? 61.709  152.583 16.109  1.00 52.26  ? 106  A   0 OP1   1 
ATOM   2072  O  OP2   . A   A  1  106  ? 60.495  151.305 17.977  1.00 52.34  ? 106  A   0 OP2   1 
ATOM   2073  O  "O5'" . A   A  1  106  ? 59.844  153.646 17.375  1.00 47.96  ? 106  A   0 "O5'" 1 
ATOM   2074  C  "C5'" . A   A  1  106  ? 59.812  154.794 16.522  1.00 46.94  ? 106  A   0 "C5'" 1 
ATOM   2075  C  "C4'" . A   A  1  106  ? 59.545  156.047 17.317  1.00 47.85  ? 106  A   0 "C4'" 1 
ATOM   2076  O  "O4'" . A   A  1  106  ? 58.177  156.068 17.793  1.00 49.10  ? 106  A   0 "O4'" 1 
ATOM   2077  C  "C3'" . A   A  1  106  ? 60.372  156.246 18.571  1.00 47.25  ? 106  A   0 "C3'" 1 
ATOM   2078  O  "O3'" . A   A  1  106  ? 61.665  156.738 18.269  1.00 48.54  ? 106  A   0 "O3'" 1 
ATOM   2079  C  "C2'" . A   A  1  106  ? 59.534  157.259 19.334  1.00 46.36  ? 106  A   0 "C2'" 1 
ATOM   2080  O  "O2'" . A   A  1  106  ? 59.671  158.561 18.814  1.00 45.18  ? 106  A   0 "O2'" 1 
ATOM   2081  C  "C1'" . A   A  1  106  ? 58.122  156.757 19.034  1.00 47.93  ? 106  A   0 "C1'" 1 
ATOM   2082  N  N9    . A   A  1  106  ? 57.653  155.822 20.053  1.00 48.67  ? 106  A   0 N9    1 
ATOM   2083  C  C8    . A   A  1  106  ? 57.630  154.451 19.995  1.00 48.65  ? 106  A   0 C8    1 
ATOM   2084  N  N7    . A   A  1  106  ? 57.157  153.887 21.076  1.00 49.90  ? 106  A   0 N7    1 
ATOM   2085  C  C5    . A   A  1  106  ? 56.848  154.958 21.903  1.00 49.51  ? 106  A   0 C5    1 
ATOM   2086  C  C6    . A   A  1  106  ? 56.311  155.028 23.199  1.00 49.36  ? 106  A   0 C6    1 
ATOM   2087  N  N6    . A   A  1  106  ? 55.968  153.957 23.917  1.00 49.32  ? 106  A   0 N6    1 
ATOM   2088  N  N1    . A   A  1  106  ? 56.132  156.252 23.738  1.00 49.46  ? 106  A   0 N1    1 
ATOM   2089  C  C2    . A   A  1  106  ? 56.470  157.324 23.015  1.00 49.49  ? 106  A   0 C2    1 
ATOM   2090  N  N3    . A   A  1  106  ? 56.980  157.386 21.789  1.00 49.51  ? 106  A   0 N3    1 
ATOM   2091  C  C4    . A   A  1  106  ? 57.148  156.154 21.283  1.00 48.70  ? 106  A   0 C4    1 
ATOM   2092  P  P     . U   A  1  107  ? 62.908  156.301 19.181  1.00 49.93  ? 107  U   0 P     1 
ATOM   2093  O  OP1   . U   A  1  107  ? 64.124  156.877 18.562  1.00 51.66  ? 107  U   0 OP1   1 
ATOM   2094  O  OP2   . U   A  1  107  ? 62.829  154.836 19.397  1.00 51.31  ? 107  U   0 OP2   1 
ATOM   2095  O  "O5'" . U   A  1  107  ? 62.630  157.036 20.570  1.00 48.59  ? 107  U   0 "O5'" 1 
ATOM   2096  C  "C5'" . U   A  1  107  ? 62.372  158.451 20.609  1.00 45.25  ? 107  U   0 "C5'" 1 
ATOM   2097  C  "C4'" . U   A  1  107  ? 61.753  158.856 21.934  1.00 44.87  ? 107  U   0 "C4'" 1 
ATOM   2098  O  "O4'" . U   A  1  107  ? 60.412  158.316 22.076  1.00 44.36  ? 107  U   0 "O4'" 1 
ATOM   2099  C  "C3'" . U   A  1  107  ? 62.449  158.414 23.211  1.00 43.16  ? 107  U   0 "C3'" 1 
ATOM   2100  O  "O3'" . U   A  1  107  ? 63.568  159.224 23.510  1.00 43.67  ? 107  U   0 "O3'" 1 
ATOM   2101  C  "C2'" . U   A  1  107  ? 61.346  158.625 24.237  1.00 43.88  ? 107  U   0 "C2'" 1 
ATOM   2102  O  "O2'" . U   A  1  107  ? 61.176  159.991 24.575  1.00 42.28  ? 107  U   0 "O2'" 1 
ATOM   2103  C  "C1'" . U   A  1  107  ? 60.122  158.132 23.458  1.00 43.93  ? 107  U   0 "C1'" 1 
ATOM   2104  N  N1    . U   A  1  107  ? 59.863  156.703 23.700  1.00 43.12  ? 107  U   0 N1    1 
ATOM   2105  C  C2    . U   A  1  107  ? 59.088  156.353 24.801  1.00 43.73  ? 107  U   0 C2    1 
ATOM   2106  O  O2    . U   A  1  107  ? 58.590  157.167 25.563  1.00 43.11  ? 107  U   0 O2    1 
ATOM   2107  N  N3    . U   A  1  107  ? 58.917  155.007 24.977  1.00 44.24  ? 107  U   0 N3    1 
ATOM   2108  C  C4    . U   A  1  107  ? 59.418  154.000 24.191  1.00 45.10  ? 107  U   0 C4    1 
ATOM   2109  O  O4    . U   A  1  107  ? 59.173  152.830 24.480  1.00 47.91  ? 107  U   0 O4    1 
ATOM   2110  C  C5    . U   A  1  107  ? 60.194  154.441 23.076  1.00 45.01  ? 107  U   0 C5    1 
ATOM   2111  C  C6    . U   A  1  107  ? 60.383  155.741 22.874  1.00 43.16  ? 107  U   0 C6    1 
ATOM   2112  P  P     . U   A  1  108  ? 64.945  158.542 23.959  1.00 45.48  ? 108  U   0 P     1 
ATOM   2113  O  OP1   . U   A  1  108  ? 65.866  159.654 24.300  1.00 44.83  ? 108  U   0 OP1   1 
ATOM   2114  O  OP2   . U   A  1  108  ? 65.354  157.535 22.945  1.00 42.85  ? 108  U   0 OP2   1 
ATOM   2115  O  "O5'" . U   A  1  108  ? 64.558  157.766 25.293  1.00 47.63  ? 108  U   0 "O5'" 1 
ATOM   2116  C  "C5'" . U   A  1  108  ? 63.841  158.420 26.358  1.00 48.36  ? 108  U   0 "C5'" 1 
ATOM   2117  C  "C4'" . U   A  1  108  ? 63.331  157.394 27.340  1.00 48.37  ? 108  U   0 "C4'" 1 
ATOM   2118  O  "O4'" . U   A  1  108  ? 62.277  156.609 26.727  1.00 49.72  ? 108  U   0 "O4'" 1 
ATOM   2119  C  "C3'" . U   A  1  108  ? 64.356  156.359 27.765  1.00 48.70  ? 108  U   0 "C3'" 1 
ATOM   2120  O  "O3'" . U   A  1  108  ? 65.193  156.849 28.796  1.00 48.06  ? 108  U   0 "O3'" 1 
ATOM   2121  C  "C2'" . U   A  1  108  ? 63.481  155.203 28.222  1.00 49.90  ? 108  U   0 "C2'" 1 
ATOM   2122  O  "O2'" . U   A  1  108  ? 62.956  155.406 29.515  1.00 49.78  ? 108  U   0 "O2'" 1 
ATOM   2123  C  "C1'" . U   A  1  108  ? 62.346  155.271 27.198  1.00 50.42  ? 108  U   0 "C1'" 1 
ATOM   2124  N  N1    . U   A  1  108  ? 62.546  154.372 26.049  1.00 51.39  ? 108  U   0 N1    1 
ATOM   2125  C  C2    . U   A  1  108  ? 62.041  153.095 26.148  1.00 52.17  ? 108  U   0 C2    1 
ATOM   2126  O  O2    . U   A  1  108  ? 61.462  152.688 27.139  1.00 53.82  ? 108  U   0 O2    1 
ATOM   2127  N  N3    . U   A  1  108  ? 62.241  152.305 25.043  1.00 53.20  ? 108  U   0 N3    1 
ATOM   2128  C  C4    . U   A  1  108  ? 62.885  152.655 23.873  1.00 53.16  ? 108  U   0 C4    1 
ATOM   2129  O  O4    . U   A  1  108  ? 62.925  151.850 22.937  1.00 53.57  ? 108  U   0 O4    1 
ATOM   2130  C  C5    . U   A  1  108  ? 63.394  153.988 23.853  1.00 51.93  ? 108  U   0 C5    1 
ATOM   2131  C  C6    . U   A  1  108  ? 63.210  154.781 24.912  1.00 52.35  ? 108  U   0 C6    1 
ATOM   2132  P  P     . U   A  1  109  ? 66.657  156.228 28.992  1.00 45.80  ? 109  U   0 P     1 
ATOM   2133  O  OP1   . U   A  1  109  ? 67.395  156.334 27.710  1.00 45.18  ? 109  U   0 OP1   1 
ATOM   2134  O  OP2   . U   A  1  109  ? 66.492  154.907 29.630  1.00 45.13  ? 109  U   0 OP2   1 
ATOM   2135  O  "O5'" . U   A  1  109  ? 67.323  157.212 30.044  1.00 44.28  ? 109  U   0 "O5'" 1 
ATOM   2136  C  "C5'" . U   A  1  109  ? 67.540  158.600 29.733  1.00 42.16  ? 109  U   0 "C5'" 1 
ATOM   2137  C  "C4'" . U   A  1  109  ? 67.726  159.381 31.007  1.00 41.21  ? 109  U   0 "C4'" 1 
ATOM   2138  O  "O4'" . U   A  1  109  ? 66.450  159.512 31.673  1.00 41.79  ? 109  U   0 "O4'" 1 
ATOM   2139  C  "C3'" . U   A  1  109  ? 68.636  158.704 32.018  1.00 40.13  ? 109  U   0 "C3'" 1 
ATOM   2140  O  "O3'" . U   A  1  109  ? 69.994  159.039 31.776  1.00 37.75  ? 109  U   0 "O3'" 1 
ATOM   2141  C  "C2'" . U   A  1  109  ? 68.118  159.241 33.340  1.00 41.60  ? 109  U   0 "C2'" 1 
ATOM   2142  O  "O2'" . U   A  1  109  ? 68.593  160.542 33.607  1.00 44.14  ? 109  U   0 "O2'" 1 
ATOM   2143  C  "C1'" . U   A  1  109  ? 66.613  159.314 33.065  1.00 42.33  ? 109  U   0 "C1'" 1 
ATOM   2144  N  N1    . U   A  1  109  ? 65.828  158.126 33.447  1.00 43.54  ? 109  U   0 N1    1 
ATOM   2145  C  C2    . U   A  1  109  ? 65.883  157.687 34.760  1.00 43.76  ? 109  U   0 C2    1 
ATOM   2146  O  O2    . U   A  1  109  ? 66.601  158.201 35.603  1.00 44.08  ? 109  U   0 O2    1 
ATOM   2147  N  N3    . U   A  1  109  ? 65.069  156.615 35.046  1.00 43.32  ? 109  U   0 N3    1 
ATOM   2148  C  C4    . U   A  1  109  ? 64.236  155.945 34.173  1.00 42.29  ? 109  U   0 C4    1 
ATOM   2149  O  O4    . U   A  1  109  ? 63.496  155.061 34.599  1.00 39.82  ? 109  U   0 O4    1 
ATOM   2150  C  C5    . U   A  1  109  ? 64.262  156.433 32.835  1.00 43.02  ? 109  U   0 C5    1 
ATOM   2151  C  C6    . U   A  1  109  ? 65.034  157.477 32.523  1.00 43.53  ? 109  U   0 C6    1 
ATOM   2152  P  P     . C   A  1  110  ? 71.091  157.879 31.647  1.00 37.97  ? 110  C   0 P     1 
ATOM   2153  O  OP1   . C   A  1  110  ? 72.361  158.463 31.156  1.00 37.48  ? 110  C   0 OP1   1 
ATOM   2154  O  OP2   . C   A  1  110  ? 70.486  156.734 30.925  1.00 37.24  ? 110  C   0 OP2   1 
ATOM   2155  O  "O5'" . C   A  1  110  ? 71.350  157.475 33.157  1.00 38.16  ? 110  C   0 "O5'" 1 
ATOM   2156  C  "C5'" . C   A  1  110  ? 71.991  158.392 34.043  1.00 34.69  ? 110  C   0 "C5'" 1 
ATOM   2157  C  "C4'" . C   A  1  110  ? 71.978  157.847 35.439  1.00 34.90  ? 110  C   0 "C4'" 1 
ATOM   2158  O  "O4'" . C   A  1  110  ? 70.620  157.804 35.932  1.00 37.26  ? 110  C   0 "O4'" 1 
ATOM   2159  C  "C3'" . C   A  1  110  ? 72.479  156.426 35.577  1.00 33.83  ? 110  C   0 "C3'" 1 
ATOM   2160  O  "O3'" . C   A  1  110  ? 73.887  156.436 35.671  1.00 32.34  ? 110  C   0 "O3'" 1 
ATOM   2161  C  "C2'" . C   A  1  110  ? 71.820  155.993 36.876  1.00 37.44  ? 110  C   0 "C2'" 1 
ATOM   2162  O  "O2'" . C   A  1  110  ? 72.460  156.555 38.003  1.00 38.65  ? 110  C   0 "O2'" 1 
ATOM   2163  C  "C1'" . C   A  1  110  ? 70.449  156.656 36.743  1.00 38.20  ? 110  C   0 "C1'" 1 
ATOM   2164  N  N1    . C   A  1  110  ? 69.421  155.791 36.130  1.00 39.48  ? 110  C   0 N1    1 
ATOM   2165  C  C2    . C   A  1  110  ? 68.702  154.924 36.956  1.00 40.53  ? 110  C   0 C2    1 
ATOM   2166  O  O2    . C   A  1  110  ? 68.961  154.901 38.168  1.00 41.25  ? 110  C   0 O2    1 
ATOM   2167  N  N3    . C   A  1  110  ? 67.742  154.137 36.415  1.00 40.55  ? 110  C   0 N3    1 
ATOM   2168  C  C4    . C   A  1  110  ? 67.488  154.198 35.108  1.00 38.98  ? 110  C   0 C4    1 
ATOM   2169  N  N4    . C   A  1  110  ? 66.525  153.419 34.627  1.00 36.24  ? 110  C   0 N4    1 
ATOM   2170  C  C5    . C   A  1  110  ? 68.210  155.067 34.240  1.00 39.11  ? 110  C   0 C5    1 
ATOM   2171  C  C6    . C   A  1  110  ? 69.161  155.835 34.786  1.00 39.10  ? 110  C   0 C6    1 
ATOM   2172  P  P     . C   A  1  111  ? 74.719  155.115 35.343  1.00 33.49  ? 111  C   0 P     1 
ATOM   2173  O  OP1   . C   A  1  111  ? 76.155  155.479 35.474  1.00 32.42  ? 111  C   0 OP1   1 
ATOM   2174  O  OP2   . C   A  1  111  ? 74.222  154.533 34.071  1.00 33.80  ? 111  C   0 OP2   1 
ATOM   2175  O  "O5'" . C   A  1  111  ? 74.335  154.111 36.514  1.00 33.49  ? 111  C   0 "O5'" 1 
ATOM   2176  C  "C5'" . C   A  1  111  ? 74.894  154.239 37.827  1.00 30.69  ? 111  C   0 "C5'" 1 
ATOM   2177  C  "C4'" . C   A  1  111  ? 74.310  153.184 38.730  1.00 31.05  ? 111  C   0 "C4'" 1 
ATOM   2178  O  "O4'" . C   A  1  111  ? 72.867  153.332 38.743  1.00 32.67  ? 111  C   0 "O4'" 1 
ATOM   2179  C  "C3'" . C   A  1  111  ? 74.528  151.742 38.295  1.00 29.79  ? 111  C   0 "C3'" 1 
ATOM   2180  O  "O3'" . C   A  1  111  ? 75.790  151.257 38.742  1.00 29.00  ? 111  C   0 "O3'" 1 
ATOM   2181  C  "C2'" . C   A  1  111  ? 73.377  151.020 38.982  1.00 31.34  ? 111  C   0 "C2'" 1 
ATOM   2182  O  "O2'" . C   A  1  111  ? 73.615  150.751 40.341  1.00 30.53  ? 111  C   0 "O2'" 1 
ATOM   2183  C  "C1'" . C   A  1  111  ? 72.260  152.061 38.891  1.00 33.89  ? 111  C   0 "C1'" 1 
ATOM   2184  N  N1    . C   A  1  111  ? 71.355  151.817 37.755  1.00 36.93  ? 111  C   0 N1    1 
ATOM   2185  C  C2    . C   A  1  111  ? 70.398  150.798 37.871  1.00 37.19  ? 111  C   0 C2    1 
ATOM   2186  O  O2    . C   A  1  111  ? 70.318  150.168 38.937  1.00 34.24  ? 111  C   0 O2    1 
ATOM   2187  N  N3    . C   A  1  111  ? 69.583  150.533 36.821  1.00 38.56  ? 111  C   0 N3    1 
ATOM   2188  C  C4    . C   A  1  111  ? 69.690  151.246 35.695  1.00 38.51  ? 111  C   0 C4    1 
ATOM   2189  N  N4    . C   A  1  111  ? 68.877  150.941 34.685  1.00 39.11  ? 111  C   0 N4    1 
ATOM   2190  C  C5    . C   A  1  111  ? 70.639  152.300 35.557  1.00 38.88  ? 111  C   0 C5    1 
ATOM   2191  C  C6    . C   A  1  111  ? 71.444  152.550 36.602  1.00 38.02  ? 111  C   0 C6    1 
ATOM   2192  P  P     . G   A  1  112  ? 76.476  149.999 38.015  1.00 29.05  ? 112  G   0 P     1 
ATOM   2193  O  OP1   . G   A  1  112  ? 77.500  149.456 38.927  1.00 27.69  ? 112  G   0 OP1   1 
ATOM   2194  O  OP2   . G   A  1  112  ? 76.860  150.397 36.649  1.00 29.02  ? 112  G   0 OP2   1 
ATOM   2195  O  "O5'" . G   A  1  112  ? 75.308  148.923 37.921  1.00 34.61  ? 112  G   0 "O5'" 1 
ATOM   2196  C  "C5'" . G   A  1  112  ? 74.853  148.212 39.096  1.00 35.43  ? 112  G   0 "C5'" 1 
ATOM   2197  C  "C4'" . G   A  1  112  ? 73.709  147.293 38.740  1.00 36.26  ? 112  G   0 "C4'" 1 
ATOM   2198  O  "O4'" . G   A  1  112  ? 72.611  148.068 38.190  1.00 37.63  ? 112  G   0 "O4'" 1 
ATOM   2199  C  "C3'" . G   A  1  112  ? 74.020  146.260 37.671  1.00 34.20  ? 112  G   0 "C3'" 1 
ATOM   2200  O  "O3'" . G   A  1  112  ? 74.594  145.123 38.277  1.00 31.95  ? 112  G   0 "O3'" 1 
ATOM   2201  C  "C2'" . G   A  1  112  ? 72.641  145.942 37.115  1.00 37.54  ? 112  G   0 "C2'" 1 
ATOM   2202  O  "O2'" . G   A  1  112  ? 71.916  145.044 37.932  1.00 36.82  ? 112  G   0 "O2'" 1 
ATOM   2203  C  "C1'" . G   A  1  112  ? 71.966  147.316 37.176  1.00 41.12  ? 112  G   0 "C1'" 1 
ATOM   2204  N  N9    . G   A  1  112  ? 72.028  148.074 35.927  1.00 45.87  ? 112  G   0 N9    1 
ATOM   2205  C  C8    . G   A  1  112  ? 72.982  148.994 35.559  1.00 46.84  ? 112  G   0 C8    1 
ATOM   2206  N  N7    . G   A  1  112  ? 72.744  149.541 34.399  1.00 47.71  ? 112  G   0 N7    1 
ATOM   2207  C  C5    . G   A  1  112  ? 71.568  148.943 33.969  1.00 47.09  ? 112  G   0 C5    1 
ATOM   2208  C  C6    . G   A  1  112  ? 70.817  149.144 32.786  1.00 48.11  ? 112  G   0 C6    1 
ATOM   2209  O  O6    . G   A  1  112  ? 71.042  149.923 31.852  1.00 49.04  ? 112  G   0 O6    1 
ATOM   2210  N  N1    . G   A  1  112  ? 69.698  148.320 32.747  1.00 48.61  ? 112  G   0 N1    1 
ATOM   2211  C  C2    . G   A  1  112  ? 69.346  147.417 33.718  1.00 46.73  ? 112  G   0 C2    1 
ATOM   2212  N  N2    . G   A  1  112  ? 68.246  146.698 33.483  1.00 45.42  ? 112  G   0 N2    1 
ATOM   2213  N  N3    . G   A  1  112  ? 70.029  147.231 34.832  1.00 46.37  ? 112  G   0 N3    1 
ATOM   2214  C  C4    . G   A  1  112  ? 71.121  148.022 34.892  1.00 46.51  ? 112  G   0 C4    1 
ATOM   2215  P  P     . A   A  1  113  ? 75.983  144.544 37.742  1.00 34.42  ? 113  A   0 P     1 
ATOM   2216  O  OP1   . A   A  1  113  ? 76.504  143.635 38.790  1.00 32.04  ? 113  A   0 OP1   1 
ATOM   2217  O  OP2   . A   A  1  113  ? 76.818  145.671 37.277  1.00 33.94  ? 113  A   0 OP2   1 
ATOM   2218  O  "O5'" . A   A  1  113  ? 75.575  143.662 36.481  1.00 35.45  ? 113  A   0 "O5'" 1 
ATOM   2219  C  "C5'" . A   A  1  113  ? 75.210  142.283 36.651  1.00 35.71  ? 113  A   0 "C5'" 1 
ATOM   2220  C  "C4'" . A   A  1  113  ? 75.730  141.443 35.509  1.00 34.92  ? 113  A   0 "C4'" 1 
ATOM   2221  O  "O4'" . A   A  1  113  ? 74.867  141.557 34.350  1.00 35.80  ? 113  A   0 "O4'" 1 
ATOM   2222  C  "C3'" . A   A  1  113  ? 77.075  141.829 34.933  1.00 34.06  ? 113  A   0 "C3'" 1 
ATOM   2223  O  "O3'" . A   A  1  113  ? 78.157  141.444 35.766  1.00 32.60  ? 113  A   0 "O3'" 1 
ATOM   2224  C  "C2'" . A   A  1  113  ? 77.077  141.068 33.609  1.00 34.82  ? 113  A   0 "C2'" 1 
ATOM   2225  O  "O2'" . A   A  1  113  ? 77.487  139.728 33.783  1.00 31.25  ? 113  A   0 "O2'" 1 
ATOM   2226  C  "C1'" . A   A  1  113  ? 75.592  141.127 33.209  1.00 36.56  ? 113  A   0 "C1'" 1 
ATOM   2227  N  N9    . A   A  1  113  ? 75.247  141.997 32.079  1.00 39.88  ? 113  A   0 N9    1 
ATOM   2228  C  C8    . A   A  1  113  ? 75.895  143.122 31.629  1.00 40.26  ? 113  A   0 C8    1 
ATOM   2229  N  N7    . A   A  1  113  ? 75.327  143.677 30.584  1.00 40.32  ? 113  A   0 N7    1 
ATOM   2230  C  C5    . A   A  1  113  ? 74.232  142.865 30.327  1.00 40.78  ? 113  A   0 C5    1 
ATOM   2231  C  C6    . A   A  1  113  ? 73.228  142.908 29.339  1.00 40.99  ? 113  A   0 C6    1 
ATOM   2232  N  N6    . A   A  1  113  ? 73.155  143.842 28.388  1.00 40.78  ? 113  A   0 N6    1 
ATOM   2233  N  N1    . A   A  1  113  ? 72.286  141.944 29.360  1.00 40.38  ? 113  A   0 N1    1 
ATOM   2234  C  C2    . A   A  1  113  ? 72.353  141.008 30.303  1.00 40.63  ? 113  A   0 C2    1 
ATOM   2235  N  N3    . A   A  1  113  ? 73.243  140.856 31.281  1.00 42.47  ? 113  A   0 N3    1 
ATOM   2236  C  C4    . A   A  1  113  ? 74.169  141.828 31.238  1.00 41.27  ? 113  A   0 C4    1 
ATOM   2237  P  P     . A   A  1  114  ? 79.645  141.941 35.410  1.00 36.00  ? 114  A   0 P     1 
ATOM   2238  O  OP1   . A   A  1  114  ? 80.267  140.988 34.444  1.00 33.09  ? 114  A   0 OP1   1 
ATOM   2239  O  OP2   . A   A  1  114  ? 80.343  142.245 36.683  1.00 35.45  ? 114  A   0 OP2   1 
ATOM   2240  O  "O5'" . A   A  1  114  ? 79.405  143.311 34.639  1.00 34.30  ? 114  A   0 "O5'" 1 
ATOM   2241  C  "C5'" . A   A  1  114  ? 79.063  144.519 35.335  1.00 32.91  ? 114  A   0 "C5'" 1 
ATOM   2242  C  "C4'" . A   A  1  114  ? 79.022  145.663 34.356  1.00 33.04  ? 114  A   0 "C4'" 1 
ATOM   2243  O  "O4'" . A   A  1  114  ? 77.891  145.481 33.460  1.00 33.02  ? 114  A   0 "O4'" 1 
ATOM   2244  C  "C3'" . A   A  1  114  ? 78.878  147.061 34.949  1.00 34.01  ? 114  A   0 "C3'" 1 
ATOM   2245  O  "O3'" . A   A  1  114  ? 79.557  147.999 34.112  1.00 35.82  ? 114  A   0 "O3'" 1 
ATOM   2246  C  "C2'" . A   A  1  114  ? 77.384  147.313 34.802  1.00 35.13  ? 114  A   0 "C2'" 1 
ATOM   2247  O  "O2'" . A   A  1  114  ? 77.035  148.680 34.758  1.00 36.18  ? 114  A   0 "O2'" 1 
ATOM   2248  C  "C1'" . A   A  1  114  ? 77.121  146.659 33.452  1.00 34.89  ? 114  A   0 "C1'" 1 
ATOM   2249  N  N9    . A   A  1  114  ? 75.721  146.332 33.190  1.00 35.15  ? 114  A   0 N9    1 
ATOM   2250  C  C8    . A   A  1  114  ? 74.902  145.438 33.820  1.00 36.06  ? 114  A   0 C8    1 
ATOM   2251  N  N7    . A   A  1  114  ? 73.674  145.431 33.358  1.00 38.98  ? 114  A   0 N7    1 
ATOM   2252  C  C5    . A   A  1  114  ? 73.692  146.378 32.346  1.00 37.69  ? 114  A   0 C5    1 
ATOM   2253  C  C6    . A   A  1  114  ? 72.695  146.856 31.464  1.00 38.22  ? 114  A   0 C6    1 
ATOM   2254  N  N6    . A   A  1  114  ? 71.433  146.422 31.449  1.00 37.72  ? 114  A   0 N6    1 
ATOM   2255  N  N1    . A   A  1  114  ? 73.049  147.811 30.582  1.00 39.98  ? 114  A   0 N1    1 
ATOM   2256  C  C2    . A   A  1  114  ? 74.316  148.246 30.583  1.00 39.99  ? 114  A   0 C2    1 
ATOM   2257  N  N3    . A   A  1  114  ? 75.337  147.873 31.349  1.00 37.97  ? 114  A   0 N3    1 
ATOM   2258  C  C4    . A   A  1  114  ? 74.951  146.930 32.223  1.00 37.03  ? 114  A   0 C4    1 
ATOM   2259  P  P     . U   A  1  115  ? 81.166  148.064 34.095  1.00 37.21  ? 115  U   0 P     1 
ATOM   2260  O  OP1   . U   A  1  115  ? 81.758  146.770 34.528  1.00 36.92  ? 115  U   0 OP1   1 
ATOM   2261  O  OP2   . U   A  1  115  ? 81.568  149.315 34.777  1.00 37.33  ? 115  U   0 OP2   1 
ATOM   2262  O  "O5'" . U   A  1  115  ? 81.473  148.231 32.544  1.00 40.11  ? 115  U   0 "O5'" 1 
ATOM   2263  C  "C5'" . U   A  1  115  ? 82.818  148.347 32.042  1.00 43.00  ? 115  U   0 "C5'" 1 
ATOM   2264  C  "C4'" . U   A  1  115  ? 82.821  148.169 30.540  1.00 44.33  ? 115  U   0 "C4'" 1 
ATOM   2265  O  "O4'" . U   A  1  115  ? 82.661  146.761 30.214  1.00 43.77  ? 115  U   0 "O4'" 1 
ATOM   2266  C  "C3'" . U   A  1  115  ? 81.692  148.898 29.819  1.00 46.19  ? 115  U   0 "C3'" 1 
ATOM   2267  O  "O3'" . U   A  1  115  ? 82.106  149.307 28.522  1.00 49.17  ? 115  U   0 "O3'" 1 
ATOM   2268  C  "C2'" . U   A  1  115  ? 80.631  147.814 29.699  1.00 45.20  ? 115  U   0 "C2'" 1 
ATOM   2269  O  "O2'" . U   A  1  115  ? 79.718  148.046 28.646  1.00 46.11  ? 115  U   0 "O2'" 1 
ATOM   2270  C  "C1'" . U   A  1  115  ? 81.492  146.579 29.440  1.00 44.51  ? 115  U   0 "C1'" 1 
ATOM   2271  N  N1    . U   A  1  115  ? 80.841  145.328 29.864  1.00 45.69  ? 115  U   0 N1    1 
ATOM   2272  C  C2    . U   A  1  115  ? 79.857  144.796 29.041  1.00 45.73  ? 115  U   0 C2    1 
ATOM   2273  O  O2    . U   A  1  115  ? 79.544  145.287 27.965  1.00 46.90  ? 115  U   0 O2    1 
ATOM   2274  N  N3    . U   A  1  115  ? 79.252  143.664 29.524  1.00 45.62  ? 115  U   0 N3    1 
ATOM   2275  C  C4    . U   A  1  115  ? 79.523  143.012 30.708  1.00 46.49  ? 115  U   0 C4    1 
ATOM   2276  O  O4    . U   A  1  115  ? 78.827  142.050 31.042  1.00 44.74  ? 115  U   0 O4    1 
ATOM   2277  C  C5    . U   A  1  115  ? 80.573  143.599 31.485  1.00 46.88  ? 115  U   0 C5    1 
ATOM   2278  C  C6    . U   A  1  115  ? 81.180  144.708 31.050  1.00 45.87  ? 115  U   0 C6    1 
ATOM   2279  P  P     . G   A  1  116  ? 82.271  150.872 28.193  1.00 48.80  ? 116  G   0 P     1 
ATOM   2280  O  OP1   . G   A  1  116  ? 81.254  151.667 28.944  1.00 47.28  ? 116  G   0 OP1   1 
ATOM   2281  O  OP2   . G   A  1  116  ? 82.330  150.966 26.713  1.00 49.21  ? 116  G   0 OP2   1 
ATOM   2282  O  "O5'" . G   A  1  116  ? 83.710  151.214 28.776  1.00 44.50  ? 116  G   0 "O5'" 1 
ATOM   2283  C  "C5'" . G   A  1  116  ? 84.890  150.621 28.213  1.00 41.39  ? 116  G   0 "C5'" 1 
ATOM   2284  C  "C4'" . G   A  1  116  ? 86.096  151.415 28.626  1.00 39.39  ? 116  G   0 "C4'" 1 
ATOM   2285  O  "O4'" . G   A  1  116  ? 85.892  152.789 28.223  1.00 38.59  ? 116  G   0 "O4'" 1 
ATOM   2286  C  "C3'" . G   A  1  116  ? 86.309  151.478 30.123  1.00 38.09  ? 116  G   0 "C3'" 1 
ATOM   2287  O  "O3'" . G   A  1  116  ? 87.095  150.371 30.526  1.00 41.64  ? 116  G   0 "O3'" 1 
ATOM   2288  C  "C2'" . G   A  1  116  ? 87.014  152.813 30.303  1.00 36.55  ? 116  G   0 "C2'" 1 
ATOM   2289  O  "O2'" . G   A  1  116  ? 88.371  152.754 29.923  1.00 33.54  ? 116  G   0 "O2'" 1 
ATOM   2290  C  "C1'" . G   A  1  116  ? 86.295  153.662 29.260  1.00 35.95  ? 116  G   0 "C1'" 1 
ATOM   2291  N  N9    . G   A  1  116  ? 85.107  154.379 29.711  1.00 33.75  ? 116  G   0 N9    1 
ATOM   2292  C  C8    . G   A  1  116  ? 83.806  154.106 29.357  1.00 34.16  ? 116  G   0 C8    1 
ATOM   2293  N  N7    . G   A  1  116  ? 82.951  154.960 29.844  1.00 34.27  ? 116  G   0 N7    1 
ATOM   2294  C  C5    . G   A  1  116  ? 83.729  155.836 30.583  1.00 31.97  ? 116  G   0 C5    1 
ATOM   2295  C  C6    . G   A  1  116  ? 83.354  156.964 31.327  1.00 32.11  ? 116  G   0 C6    1 
ATOM   2296  O  O6    . G   A  1  116  ? 82.221  157.428 31.497  1.00 34.79  ? 116  G   0 O6    1 
ATOM   2297  N  N1    . G   A  1  116  ? 84.454  157.574 31.915  1.00 31.39  ? 116  G   0 N1    1 
ATOM   2298  C  C2    . G   A  1  116  ? 85.747  157.139 31.803  1.00 31.89  ? 116  G   0 C2    1 
ATOM   2299  N  N2    . G   A  1  116  ? 86.662  157.859 32.451  1.00 33.41  ? 116  G   0 N2    1 
ATOM   2300  N  N3    . G   A  1  116  ? 86.113  156.077 31.109  1.00 30.42  ? 116  G   0 N3    1 
ATOM   2301  C  C4    . G   A  1  116  ? 85.060  155.480 30.526  1.00 31.61  ? 116  G   0 C4    1 
ATOM   2302  P  P     . A   A  1  117  ? 86.999  149.833 32.032  1.00 43.75  ? 117  A   0 P     1 
ATOM   2303  O  OP1   . A   A  1  117  ? 88.016  148.761 32.149  1.00 41.92  ? 117  A   0 OP1   1 
ATOM   2304  O  OP2   . A   A  1  117  ? 85.575  149.534 32.323  1.00 45.73  ? 117  A   0 OP2   1 
ATOM   2305  O  "O5'" . A   A  1  117  ? 87.424  151.079 32.934  1.00 42.74  ? 117  A   0 "O5'" 1 
ATOM   2306  C  "C5'" . A   A  1  117  ? 88.807  151.452 33.101  1.00 40.67  ? 117  A   0 "C5'" 1 
ATOM   2307  C  "C4'" . A   A  1  117  ? 88.922  152.605 34.073  1.00 39.62  ? 117  A   0 "C4'" 1 
ATOM   2308  O  "O4'" . A   A  1  117  ? 88.266  153.776 33.526  1.00 39.67  ? 117  A   0 "O4'" 1 
ATOM   2309  C  "C3'" . A   A  1  117  ? 88.202  152.406 35.387  1.00 41.15  ? 117  A   0 "C3'" 1 
ATOM   2310  O  "O3'" . A   A  1  117  ? 88.924  151.595 36.289  1.00 43.03  ? 117  A   0 "O3'" 1 
ATOM   2311  C  "C2'" . A   A  1  117  ? 88.018  153.830 35.878  1.00 39.22  ? 117  A   0 "C2'" 1 
ATOM   2312  O  "O2'" . A   A  1  117  ? 89.201  154.367 36.430  1.00 40.36  ? 117  A   0 "O2'" 1 
ATOM   2313  C  "C1'" . A   A  1  117  ? 87.681  154.538 34.571  1.00 37.12  ? 117  A   0 "C1'" 1 
ATOM   2314  N  N9    . A   A  1  117  ? 86.242  154.606 34.330  1.00 36.41  ? 117  A   0 N9    1 
ATOM   2315  C  C8    . A   A  1  117  ? 85.471  153.742 33.591  1.00 38.56  ? 117  A   0 C8    1 
ATOM   2316  N  N7    . A   A  1  117  ? 84.200  154.066 33.554  1.00 37.35  ? 117  A   0 N7    1 
ATOM   2317  C  C5    . A   A  1  117  ? 84.131  155.221 34.315  1.00 35.75  ? 117  A   0 C5    1 
ATOM   2318  C  C6    . A   A  1  117  ? 83.062  156.062 34.652  1.00 35.80  ? 117  A   0 C6    1 
ATOM   2319  N  N6    . A   A  1  117  ? 81.809  155.873 34.233  1.00 37.20  ? 117  A   0 N6    1 
ATOM   2320  N  N1    . A   A  1  117  ? 83.325  157.122 35.440  1.00 35.82  ? 117  A   0 N1    1 
ATOM   2321  C  C2    . A   A  1  117  ? 84.584  157.322 35.844  1.00 38.54  ? 117  A   0 C2    1 
ATOM   2322  N  N3    . A   A  1  117  ? 85.680  156.611 35.578  1.00 37.82  ? 117  A   0 N3    1 
ATOM   2323  C  C4    . A   A  1  117  ? 85.381  155.561 34.803  1.00 35.90  ? 117  A   0 C4    1 
ATOM   2324  P  P     . G   A  1  118  ? 88.117  150.604 37.250  1.00 45.28  ? 118  G   0 P     1 
ATOM   2325  O  OP1   . G   A  1  118  ? 89.124  149.711 37.893  1.00 43.46  ? 118  G   0 OP1   1 
ATOM   2326  O  OP2   . G   A  1  118  ? 86.997  150.018 36.457  1.00 43.79  ? 118  G   0 OP2   1 
ATOM   2327  O  "O5'" . G   A  1  118  ? 87.504  151.567 38.361  1.00 40.35  ? 118  G   0 "O5'" 1 
ATOM   2328  C  "C5'" . G   A  1  118  ? 88.351  152.101 39.380  1.00 38.83  ? 118  G   0 "C5'" 1 
ATOM   2329  C  "C4'" . G   A  1  118  ? 87.726  153.309 40.021  1.00 38.79  ? 118  G   0 "C4'" 1 
ATOM   2330  O  "O4'" . G   A  1  118  ? 87.225  154.204 38.991  1.00 37.51  ? 118  G   0 "O4'" 1 
ATOM   2331  C  "C3'" . G   A  1  118  ? 86.495  153.095 40.874  1.00 38.11  ? 118  G   0 "C3'" 1 
ATOM   2332  O  "O3'" . G   A  1  118  ? 86.786  152.580 42.158  1.00 39.27  ? 118  G   0 "O3'" 1 
ATOM   2333  C  "C2'" . G   A  1  118  ? 85.963  154.512 40.967  1.00 36.28  ? 118  G   0 "C2'" 1 
ATOM   2334  O  "O2'" . G   A  1  118  ? 86.756  155.290 41.838  1.00 36.82  ? 118  G   0 "O2'" 1 
ATOM   2335  C  "C1'" . G   A  1  118  ? 86.167  154.986 39.528  1.00 34.52  ? 118  G   0 "C1'" 1 
ATOM   2336  N  N9    . G   A  1  118  ? 84.962  154.775 38.729  1.00 30.65  ? 118  G   0 N9    1 
ATOM   2337  C  C8    . G   A  1  118  ? 84.766  153.877 37.709  1.00 29.35  ? 118  G   0 C8    1 
ATOM   2338  N  N7    . G   A  1  118  ? 83.560  153.927 37.209  1.00 28.07  ? 118  G   0 N7    1 
ATOM   2339  C  C5    . G   A  1  118  ? 82.928  154.920 37.940  1.00 27.02  ? 118  G   0 C5    1 
ATOM   2340  C  C6    . G   A  1  118  ? 81.603  155.422 37.862  1.00 27.59  ? 118  G   0 C6    1 
ATOM   2341  O  O6    . G   A  1  118  ? 80.693  155.087 37.096  1.00 28.22  ? 118  G   0 O6    1 
ATOM   2342  N  N1    . G   A  1  118  ? 81.380  156.416 38.802  1.00 27.40  ? 118  G   0 N1    1 
ATOM   2343  C  C2    . G   A  1  118  ? 82.310  156.876 39.699  1.00 29.30  ? 118  G   0 C2    1 
ATOM   2344  N  N2    . G   A  1  118  ? 81.909  157.852 40.531  1.00 29.47  ? 118  G   0 N2    1 
ATOM   2345  N  N3    . G   A  1  118  ? 83.543  156.419 39.778  1.00 28.64  ? 118  G   0 N3    1 
ATOM   2346  C  C4    . G   A  1  118  ? 83.780  155.452 38.878  1.00 27.94  ? 118  G   0 C4    1 
ATOM   2347  P  P     . A   A  1  119  ? 85.723  151.607 42.870  1.00 41.59  ? 119  A   0 P     1 
ATOM   2348  O  OP1   . A   A  1  119  ? 86.375  151.110 44.110  1.00 41.76  ? 119  A   0 OP1   1 
ATOM   2349  O  OP2   . A   A  1  119  ? 85.217  150.639 41.860  1.00 40.75  ? 119  A   0 OP2   1 
ATOM   2350  O  "O5'" . A   A  1  119  ? 84.499  152.547 43.252  1.00 36.66  ? 119  A   0 "O5'" 1 
ATOM   2351  C  "C5'" . A   A  1  119  ? 84.632  153.522 44.280  1.00 34.20  ? 119  A   0 "C5'" 1 
ATOM   2352  C  "C4'" . A   A  1  119  ? 83.386  154.357 44.370  1.00 33.08  ? 119  A   0 "C4'" 1 
ATOM   2353  O  "O4'" . A   A  1  119  ? 83.078  154.887 43.061  1.00 33.27  ? 119  A   0 "O4'" 1 
ATOM   2354  C  "C3'" . A   A  1  119  ? 82.109  153.651 44.784  1.00 32.35  ? 119  A   0 "C3'" 1 
ATOM   2355  O  "O3'" . A   A  1  119  ? 82.068  153.556 46.198  1.00 34.18  ? 119  A   0 "O3'" 1 
ATOM   2356  C  "C2'" . A   A  1  119  ? 81.044  154.603 44.260  1.00 33.06  ? 119  A   0 "C2'" 1 
ATOM   2357  O  "O2'" . A   A  1  119  ? 80.860  155.724 45.101  1.00 29.82  ? 119  A   0 "O2'" 1 
ATOM   2358  C  "C1'" . A   A  1  119  ? 81.680  155.067 42.946  1.00 33.17  ? 119  A   0 "C1'" 1 
ATOM   2359  N  N9    . A   A  1  119  ? 81.223  154.329 41.772  1.00 32.83  ? 119  A   0 N9    1 
ATOM   2360  C  C8    . A   A  1  119  ? 81.924  153.450 40.983  1.00 31.94  ? 119  A   0 C8    1 
ATOM   2361  N  N7    . A   A  1  119  ? 81.227  152.968 39.986  1.00 32.93  ? 119  A   0 N7    1 
ATOM   2362  C  C5    . A   A  1  119  ? 79.982  153.568 40.130  1.00 33.46  ? 119  A   0 C5    1 
ATOM   2363  C  C6    . A   A  1  119  ? 78.793  153.473 39.390  1.00 34.85  ? 119  A   0 C6    1 
ATOM   2364  N  N6    . A   A  1  119  ? 78.662  152.740 38.281  1.00 35.27  ? 119  A   0 N6    1 
ATOM   2365  N  N1    . A   A  1  119  ? 77.726  154.178 39.828  1.00 35.91  ? 119  A   0 N1    1 
ATOM   2366  C  C2    . A   A  1  119  ? 77.862  154.939 40.917  1.00 33.78  ? 119  A   0 C2    1 
ATOM   2367  N  N3    . A   A  1  119  ? 78.931  155.129 41.678  1.00 33.65  ? 119  A   0 N3    1 
ATOM   2368  C  C4    . A   A  1  119  ? 79.967  154.402 41.229  1.00 32.61  ? 119  A   0 C4    1 
ATOM   2369  P  P     . A   A  1  120  ? 81.023  152.569 46.911  1.00 34.36  ? 120  A   0 P     1 
ATOM   2370  O  OP1   . A   A  1  120  ? 81.389  152.523 48.348  1.00 32.42  ? 120  A   0 OP1   1 
ATOM   2371  O  OP2   . A   A  1  120  ? 80.969  151.314 46.121  1.00 33.47  ? 120  A   0 OP2   1 
ATOM   2372  O  "O5'" . A   A  1  120  ? 79.635  153.340 46.803  1.00 33.26  ? 120  A   0 "O5'" 1 
ATOM   2373  C  "C5'" . A   A  1  120  ? 78.648  152.944 45.860  1.00 32.33  ? 120  A   0 "C5'" 1 
ATOM   2374  C  "C4'" . A   A  1  120  ? 77.293  152.898 46.522  1.00 33.26  ? 120  A   0 "C4'" 1 
ATOM   2375  O  "O4'" . A   A  1  120  ? 77.433  152.234 47.804  1.00 32.72  ? 120  A   0 "O4'" 1 
ATOM   2376  C  "C3'" . A   A  1  120  ? 76.617  154.210 46.893  1.00 31.92  ? 120  A   0 "C3'" 1 
ATOM   2377  O  "O3'" . A   A  1  120  ? 75.972  154.800 45.766  1.00 34.50  ? 120  A   0 "O3'" 1 
ATOM   2378  C  "C2'" . A   A  1  120  ? 75.602  153.719 47.913  1.00 31.15  ? 120  A   0 "C2'" 1 
ATOM   2379  O  "O2'" . A   A  1  120  ? 74.548  152.989 47.319  1.00 30.91  ? 120  A   0 "O2'" 1 
ATOM   2380  C  "C1'" . A   A  1  120  ? 76.441  152.712 48.695  1.00 31.25  ? 120  A   0 "C1'" 1 
ATOM   2381  N  N9    . A   A  1  120  ? 77.101  153.296 49.863  1.00 31.13  ? 120  A   0 N9    1 
ATOM   2382  C  C8    . A   A  1  120  ? 78.361  153.047 50.354  1.00 29.87  ? 120  A   0 C8    1 
ATOM   2383  N  N7    . A   A  1  120  ? 78.647  153.728 51.436  1.00 29.72  ? 120  A   0 N7    1 
ATOM   2384  C  C5    . A   A  1  120  ? 77.502  154.478 51.671  1.00 29.09  ? 120  A   0 C5    1 
ATOM   2385  C  C6    . A   A  1  120  ? 77.159  155.393 52.680  1.00 29.11  ? 120  A   0 C6    1 
ATOM   2386  N  N6    . A   A  1  120  ? 77.957  155.712 53.692  1.00 30.47  ? 120  A   0 N6    1 
ATOM   2387  N  N1    . A   A  1  120  ? 75.944  155.967 52.620  1.00 29.28  ? 120  A   0 N1    1 
ATOM   2388  C  C2    . A   A  1  120  ? 75.125  155.623 51.624  1.00 31.36  ? 120  A   0 C2    1 
ATOM   2389  N  N3    . A   A  1  120  ? 75.323  154.767 50.629  1.00 30.22  ? 120  A   0 N3    1 
ATOM   2390  C  C4    . A   A  1  120  ? 76.547  154.225 50.710  1.00 29.25  ? 120  A   0 C4    1 
ATOM   2391  P  P     . U   A  1  121  ? 75.525  156.344 45.809  1.00 35.51  ? 121  U   0 P     1 
ATOM   2392  O  OP1   . U   A  1  121  ? 76.744  157.150 45.527  1.00 38.15  ? 121  U   0 OP1   1 
ATOM   2393  O  OP2   . U   A  1  121  ? 74.767  156.585 47.059  1.00 31.89  ? 121  U   0 OP2   1 
ATOM   2394  O  "O5'" . U   A  1  121  ? 74.544  156.491 44.560  1.00 35.19  ? 121  U   0 "O5'" 1 
ATOM   2395  C  "C5'" . U   A  1  121  ? 75.064  156.517 43.207  1.00 38.57  ? 121  U   0 "C5'" 1 
ATOM   2396  C  "C4'" . U   A  1  121  ? 73.977  156.180 42.207  1.00 39.42  ? 121  U   0 "C4'" 1 
ATOM   2397  O  "O4'" . U   A  1  121  ? 73.576  154.806 42.385  1.00 41.28  ? 121  U   0 "O4'" 1 
ATOM   2398  C  "C3'" . U   A  1  121  ? 72.691  156.988 42.317  1.00 40.92  ? 121  U   0 "C3'" 1 
ATOM   2399  O  "O3'" . U   A  1  121  ? 72.815  158.184 41.542  1.00 40.75  ? 121  U   0 "O3'" 1 
ATOM   2400  C  "C2'" . U   A  1  121  ? 71.635  156.051 41.729  1.00 41.39  ? 121  U   0 "C2'" 1 
ATOM   2401  O  "O2'" . U   A  1  121  ? 71.476  156.150 40.330  1.00 43.20  ? 121  U   0 "O2'" 1 
ATOM   2402  C  "C1'" . U   A  1  121  ? 72.206  154.670 42.065  1.00 42.23  ? 121  U   0 "C1'" 1 
ATOM   2403  N  N1    . U   A  1  121  ? 71.528  153.938 43.144  1.00 43.15  ? 121  U   0 N1    1 
ATOM   2404  C  C2    . U   A  1  121  ? 70.500  153.080 42.785  1.00 43.24  ? 121  U   0 C2    1 
ATOM   2405  O  O2    . U   A  1  121  ? 70.142  152.907 41.629  1.00 44.92  ? 121  U   0 O2    1 
ATOM   2406  N  N3    . U   A  1  121  ? 69.903  152.430 43.829  1.00 41.40  ? 121  U   0 N3    1 
ATOM   2407  C  C4    . U   A  1  121  ? 70.212  152.543 45.158  1.00 41.13  ? 121  U   0 C4    1 
ATOM   2408  O  O4    . U   A  1  121  ? 69.561  151.904 45.978  1.00 40.98  ? 121  U   0 O4    1 
ATOM   2409  C  C5    . U   A  1  121  ? 71.286  153.442 45.452  1.00 42.20  ? 121  U   0 C5    1 
ATOM   2410  C  C6    . U   A  1  121  ? 71.892  154.093 44.460  1.00 41.83  ? 121  U   0 C6    1 
ATOM   2411  P  P     . C   A  1  122  ? 71.915  159.470 41.878  1.00 41.81  ? 122  C   0 P     1 
ATOM   2412  O  OP1   . C   A  1  122  ? 70.973  159.160 42.985  1.00 44.42  ? 122  C   0 OP1   1 
ATOM   2413  O  OP2   . C   A  1  122  ? 71.380  159.976 40.598  1.00 40.95  ? 122  C   0 OP2   1 
ATOM   2414  O  "O5'" . C   A  1  122  ? 72.986  160.513 42.417  1.00 41.92  ? 122  C   0 "O5'" 1 
ATOM   2415  C  "C5'" . C   A  1  122  ? 73.908  161.156 41.513  1.00 41.68  ? 122  C   0 "C5'" 1 
ATOM   2416  C  "C4'" . C   A  1  122  ? 75.320  160.998 42.011  1.00 40.40  ? 122  C   0 "C4'" 1 
ATOM   2417  O  "O4'" . C   A  1  122  ? 75.689  159.597 41.952  1.00 39.54  ? 122  C   0 "O4'" 1 
ATOM   2418  C  "C3'" . C   A  1  122  ? 76.397  161.651 41.166  1.00 41.31  ? 122  C   0 "C3'" 1 
ATOM   2419  O  "O3'" . C   A  1  122  ? 76.525  163.039 41.404  1.00 44.50  ? 122  C   0 "O3'" 1 
ATOM   2420  C  "C2'" . C   A  1  122  ? 77.637  160.910 41.620  1.00 39.32  ? 122  C   0 "C2'" 1 
ATOM   2421  O  "O2'" . C   A  1  122  ? 78.080  161.364 42.881  1.00 40.38  ? 122  C   0 "O2'" 1 
ATOM   2422  C  "C1'" . C   A  1  122  ? 77.091  159.490 41.743  1.00 37.50  ? 122  C   0 "C1'" 1 
ATOM   2423  N  N1    . C   A  1  122  ? 77.353  158.675 40.540  1.00 34.48  ? 122  C   0 N1    1 
ATOM   2424  C  C2    . C   A  1  122  ? 78.638  158.144 40.368  1.00 33.22  ? 122  C   0 C2    1 
ATOM   2425  O  O2    . C   A  1  122  ? 79.503  158.397 41.211  1.00 35.79  ? 122  C   0 O2    1 
ATOM   2426  N  N3    . C   A  1  122  ? 78.903  157.376 39.292  1.00 29.94  ? 122  C   0 N3    1 
ATOM   2427  C  C4    . C   A  1  122  ? 77.947  157.131 38.401  1.00 29.79  ? 122  C   0 C4    1 
ATOM   2428  N  N4    . C   A  1  122  ? 78.254  156.354 37.368  1.00 29.18  ? 122  C   0 N4    1 
ATOM   2429  C  C5    . C   A  1  122  ? 76.631  157.668 38.535  1.00 30.64  ? 122  C   0 C5    1 
ATOM   2430  C  C6    . C   A  1  122  ? 76.380  158.429 39.611  1.00 32.21  ? 122  C   0 C6    1 
ATOM   2431  P  P     . U   A  1  123  ? 76.891  164.008 40.181  1.00 47.52  ? 123  U   0 P     1 
ATOM   2432  O  OP1   . U   A  1  123  ? 76.868  165.383 40.746  1.00 46.24  ? 123  U   0 OP1   1 
ATOM   2433  O  OP2   . U   A  1  123  ? 75.994  163.667 39.039  1.00 46.80  ? 123  U   0 OP2   1 
ATOM   2434  O  "O5'" . U   A  1  123  ? 78.381  163.589 39.774  1.00 44.06  ? 123  U   0 "O5'" 1 
ATOM   2435  C  "C5'" . U   A  1  123  ? 79.481  163.908 40.634  1.00 44.89  ? 123  U   0 "C5'" 1 
ATOM   2436  C  "C4'" . U   A  1  123  ? 80.729  163.125 40.269  1.00 44.92  ? 123  U   0 "C4'" 1 
ATOM   2437  O  "O4'" . U   A  1  123  ? 80.393  161.752 39.968  1.00 43.79  ? 123  U   0 "O4'" 1 
ATOM   2438  C  "C3'" . U   A  1  123  ? 81.520  163.487 39.022  1.00 45.83  ? 123  U   0 "C3'" 1 
ATOM   2439  O  "O3'" . U   A  1  123  ? 82.294  164.670 39.185  1.00 50.93  ? 123  U   0 "O3'" 1 
ATOM   2440  C  "C2'" . U   A  1  123  ? 82.451  162.283 38.922  1.00 43.69  ? 123  U   0 "C2'" 1 
ATOM   2441  O  "O2'" . U   A  1  123  ? 83.526  162.328 39.844  1.00 40.49  ? 123  U   0 "O2'" 1 
ATOM   2442  C  "C1'" . U   A  1  123  ? 81.515  161.148 39.340  1.00 42.26  ? 123  U   0 "C1'" 1 
ATOM   2443  N  N1    . U   A  1  123  ? 81.069  160.342 38.196  1.00 38.89  ? 123  U   0 N1    1 
ATOM   2444  C  C2    . U   A  1  123  ? 82.014  159.518 37.601  1.00 37.07  ? 123  U   0 C2    1 
ATOM   2445  O  O2    . U   A  1  123  ? 83.175  159.446 37.984  1.00 33.18  ? 123  U   0 O2    1 
ATOM   2446  N  N3    . U   A  1  123  ? 81.551  158.781 36.546  1.00 36.65  ? 123  U   0 N3    1 
ATOM   2447  C  C4    . U   A  1  123  ? 80.273  158.775 36.035  1.00 38.98  ? 123  U   0 C4    1 
ATOM   2448  O  O4    . U   A  1  123  ? 79.995  157.982 35.134  1.00 42.06  ? 123  U   0 O4    1 
ATOM   2449  C  C5    . U   A  1  123  ? 79.355  159.660 36.693  1.00 37.31  ? 123  U   0 C5    1 
ATOM   2450  C  C6    . U   A  1  123  ? 79.773  160.392 37.724  1.00 37.67  ? 123  U   0 C6    1 
ATOM   2451  P  P     . C   A  1  124  ? 82.831  165.460 37.888  1.00 52.68  ? 124  C   0 P     1 
ATOM   2452  O  OP1   . C   A  1  124  ? 83.410  166.730 38.398  1.00 54.31  ? 124  C   0 OP1   1 
ATOM   2453  O  OP2   . C   A  1  124  ? 81.757  165.497 36.852  1.00 49.02  ? 124  C   0 OP2   1 
ATOM   2454  O  "O5'" . C   A  1  124  ? 84.040  164.568 37.363  1.00 51.45  ? 124  C   0 "O5'" 1 
ATOM   2455  C  "C5'" . C   A  1  124  ? 85.247  164.441 38.138  1.00 52.96  ? 124  C   0 "C5'" 1 
ATOM   2456  C  "C4'" . C   A  1  124  ? 86.232  163.541 37.428  1.00 55.66  ? 124  C   0 "C4'" 1 
ATOM   2457  O  "O4'" . C   A  1  124  ? 85.684  162.198 37.317  1.00 54.45  ? 124  C   0 "O4'" 1 
ATOM   2458  C  "C3'" . C   A  1  124  ? 86.550  163.919 35.990  1.00 57.39  ? 124  C   0 "C3'" 1 
ATOM   2459  O  "O3'" . C   A  1  124  ? 87.524  164.946 35.915  1.00 62.54  ? 124  C   0 "O3'" 1 
ATOM   2460  C  "C2'" . C   A  1  124  ? 87.058  162.604 35.423  1.00 55.84  ? 124  C   0 "C2'" 1 
ATOM   2461  O  "O2'" . C   A  1  124  ? 88.376  162.321 35.851  1.00 57.60  ? 124  C   0 "O2'" 1 
ATOM   2462  C  "C1'" . C   A  1  124  ? 86.104  161.614 36.092  1.00 52.96  ? 124  C   0 "C1'" 1 
ATOM   2463  N  N1    . C   A  1  124  ? 84.911  161.295 35.276  1.00 48.69  ? 124  C   0 N1    1 
ATOM   2464  C  C2    . C   A  1  124  ? 84.992  160.240 34.351  1.00 46.65  ? 124  C   0 C2    1 
ATOM   2465  O  O2    . C   A  1  124  ? 86.072  159.641 34.212  1.00 45.53  ? 124  C   0 O2    1 
ATOM   2466  N  N3    . C   A  1  124  ? 83.892  159.902 33.634  1.00 43.99  ? 124  C   0 N3    1 
ATOM   2467  C  C4    . C   A  1  124  ? 82.749  160.571 33.807  1.00 42.70  ? 124  C   0 C4    1 
ATOM   2468  N  N4    . C   A  1  124  ? 81.685  160.173 33.113  1.00 39.70  ? 124  C   0 N4    1 
ATOM   2469  C  C5    . C   A  1  124  ? 82.647  161.670 34.712  1.00 43.54  ? 124  C   0 C5    1 
ATOM   2470  C  C6    . C   A  1  124  ? 83.742  161.995 35.419  1.00 46.55  ? 124  C   0 C6    1 
ATOM   2471  P  P     . U   A  1  125  ? 87.504  165.971 34.679  1.00 66.24  ? 125  U   0 P     1 
ATOM   2472  O  OP1   . U   A  1  125  ? 88.513  167.002 35.031  1.00 65.24  ? 125  U   0 OP1   1 
ATOM   2473  O  OP2   . U   A  1  125  ? 86.110  166.385 34.362  1.00 65.48  ? 125  U   0 OP2   1 
ATOM   2474  O  "O5'" . U   A  1  125  ? 88.018  165.091 33.454  1.00 66.66  ? 125  U   0 "O5'" 1 
ATOM   2475  C  "C5'" . U   A  1  125  ? 89.403  164.730 33.336  1.00 67.50  ? 125  U   0 "C5'" 1 
ATOM   2476  C  "C4'" . U   A  1  125  ? 89.644  163.977 32.051  1.00 68.87  ? 125  U   0 "C4'" 1 
ATOM   2477  O  "O4'" . U   A  1  125  ? 89.052  162.653 32.133  1.00 68.98  ? 125  U   0 "O4'" 1 
ATOM   2478  C  "C3'" . U   A  1  125  ? 89.022  164.550 30.784  1.00 69.52  ? 125  U   0 "C3'" 1 
ATOM   2479  O  "O3'" . U   A  1  125  ? 89.751  165.661 30.259  1.00 69.03  ? 125  U   0 "O3'" 1 
ATOM   2480  C  "C2'" . U   A  1  125  ? 89.076  163.343 29.852  1.00 69.73  ? 125  U   0 "C2'" 1 
ATOM   2481  O  "O2'" . U   A  1  125  ? 90.366  163.127 29.312  1.00 71.85  ? 125  U   0 "O2'" 1 
ATOM   2482  C  "C1'" . U   A  1  125  ? 88.759  162.197 30.820  1.00 68.07  ? 125  U   0 "C1'" 1 
ATOM   2483  N  N1    . U   A  1  125  ? 87.363  161.730 30.754  1.00 64.42  ? 125  U   0 N1    1 
ATOM   2484  C  C2    . U   A  1  125  ? 87.123  160.528 30.101  1.00 62.98  ? 125  U   0 C2    1 
ATOM   2485  O  O2    . U   A  1  125  ? 88.014  159.840 29.622  1.00 62.41  ? 125  U   0 O2    1 
ATOM   2486  N  N3    . U   A  1  125  ? 85.802  160.160 30.026  1.00 60.52  ? 125  U   0 N3    1 
ATOM   2487  C  C4    . U   A  1  125  ? 84.718  160.849 30.527  1.00 59.70  ? 125  U   0 C4    1 
ATOM   2488  O  O4    . U   A  1  125  ? 83.579  160.439 30.286  1.00 56.69  ? 125  U   0 O4    1 
ATOM   2489  C  C5    . U   A  1  125  ? 85.048  162.065 31.211  1.00 59.83  ? 125  U   0 C5    1 
ATOM   2490  C  C6    . U   A  1  125  ? 86.325  162.455 31.299  1.00 61.68  ? 125  U   0 C6    1 
ATOM   2491  O  "O5'" . A   A  1  128  ? 85.961  160.917 21.018  1.00 92.10  ? 128  A   0 "O5'" 1 
ATOM   2492  C  "C5'" . A   A  1  128  ? 87.140  160.128 20.749  1.00 89.90  ? 128  A   0 "C5'" 1 
ATOM   2493  C  "C4'" . A   A  1  128  ? 87.253  158.976 21.733  1.00 88.40  ? 128  A   0 "C4'" 1 
ATOM   2494  O  "O4'" . A   A  1  128  ? 87.393  159.490 23.090  1.00 87.23  ? 128  A   0 "O4'" 1 
ATOM   2495  C  "C3'" . A   A  1  128  ? 86.062  158.035 21.842  1.00 87.41  ? 128  A   0 "C3'" 1 
ATOM   2496  O  "O3'" . A   A  1  128  ? 85.975  157.081 20.788  1.00 87.21  ? 128  A   0 "O3'" 1 
ATOM   2497  C  "C2'" . A   A  1  128  ? 86.305  157.399 23.203  1.00 86.09  ? 128  A   0 "C2'" 1 
ATOM   2498  O  "O2'" . A   A  1  128  ? 87.366  156.464 23.196  1.00 87.34  ? 128  A   0 "O2'" 1 
ATOM   2499  C  "C1'" . A   A  1  128  ? 86.740  158.620 24.005  1.00 84.19  ? 128  A   0 "C1'" 1 
ATOM   2500  N  N9    . A   A  1  128  ? 85.591  159.330 24.571  1.00 80.88  ? 128  A   0 N9    1 
ATOM   2501  C  C8    . A   A  1  128  ? 84.264  159.224 24.211  1.00 80.02  ? 128  A   0 C8    1 
ATOM   2502  N  N7    . A   A  1  128  ? 83.464  159.993 24.906  1.00 79.32  ? 128  A   0 N7    1 
ATOM   2503  C  C5    . A   A  1  128  ? 84.316  160.651 25.781  1.00 78.72  ? 128  A   0 C5    1 
ATOM   2504  C  C6    . A   A  1  128  ? 84.083  161.605 26.780  1.00 78.17  ? 128  A   0 C6    1 
ATOM   2505  N  N6    . A   A  1  128  ? 82.871  162.083 27.077  1.00 77.83  ? 128  A   0 N6    1 
ATOM   2506  N  N1    . A   A  1  128  ? 85.150  162.061 27.473  1.00 78.25  ? 128  A   0 N1    1 
ATOM   2507  C  C2    . A   A  1  128  ? 86.365  161.582 27.170  1.00 77.68  ? 128  A   0 C2    1 
ATOM   2508  N  N3    . A   A  1  128  ? 86.711  160.684 26.254  1.00 77.27  ? 128  A   0 N3    1 
ATOM   2509  C  C4    . A   A  1  128  ? 85.628  160.253 25.586  1.00 79.11  ? 128  A   0 C4    1 
ATOM   2510  P  P     . A   A  1  129  ? 84.721  156.070 20.738  1.00 85.90  ? 129  A   0 P     1 
ATOM   2511  O  OP1   . A   A  1  129  ? 84.736  155.346 19.435  1.00 84.05  ? 129  A   0 OP1   1 
ATOM   2512  O  OP2   . A   A  1  129  ? 83.491  156.802 21.163  1.00 85.56  ? 129  A   0 OP2   1 
ATOM   2513  O  "O5'" . A   A  1  129  ? 85.065  155.040 21.899  1.00 81.65  ? 129  A   0 "O5'" 1 
ATOM   2514  C  "C5'" . A   A  1  129  ? 86.273  154.253 21.853  1.00 73.28  ? 129  A   0 "C5'" 1 
ATOM   2515  C  "C4'" . A   A  1  129  ? 86.289  153.269 22.995  1.00 66.98  ? 129  A   0 "C4'" 1 
ATOM   2516  O  "O4'" . A   A  1  129  ? 86.674  153.933 24.233  1.00 62.82  ? 129  A   0 "O4'" 1 
ATOM   2517  C  "C3'" . A   A  1  129  ? 84.934  152.657 23.315  1.00 64.17  ? 129  A   0 "C3'" 1 
ATOM   2518  O  "O3'" . A   A  1  129  ? 84.413  151.745 22.329  1.00 62.51  ? 129  A   0 "O3'" 1 
ATOM   2519  C  "C2'" . A   A  1  129  ? 85.093  152.235 24.769  1.00 60.88  ? 129  A   0 "C2'" 1 
ATOM   2520  O  "O2'" . A   A  1  129  ? 85.783  151.026 24.984  1.00 58.55  ? 129  A   0 "O2'" 1 
ATOM   2521  C  "C1'" . A   A  1  129  ? 85.914  153.408 25.315  1.00 59.21  ? 129  A   0 "C1'" 1 
ATOM   2522  N  N9    . A   A  1  129  ? 85.078  154.484 25.857  1.00 55.62  ? 129  A   0 N9    1 
ATOM   2523  C  C8    . A   A  1  129  ? 83.719  154.651 25.706  1.00 54.72  ? 129  A   0 C8    1 
ATOM   2524  N  N7    . A   A  1  129  ? 83.236  155.686 26.346  1.00 53.21  ? 129  A   0 N7    1 
ATOM   2525  C  C5    . A   A  1  129  ? 84.348  156.252 26.948  1.00 51.76  ? 129  A   0 C5    1 
ATOM   2526  C  C6    . A   A  1  129  ? 84.495  157.370 27.778  1.00 50.08  ? 129  A   0 C6    1 
ATOM   2527  N  N6    . A   A  1  129  ? 83.482  158.146 28.157  1.00 47.90  ? 129  A   0 N6    1 
ATOM   2528  N  N1    . A   A  1  129  ? 85.736  157.665 28.219  1.00 51.19  ? 129  A   0 N1    1 
ATOM   2529  C  C2    . A   A  1  129  ? 86.756  156.876 27.842  1.00 53.06  ? 129  A   0 C2    1 
ATOM   2530  N  N3    . A   A  1  129  ? 86.743  155.793 27.066  1.00 52.97  ? 129  A   0 N3    1 
ATOM   2531  C  C4    . A   A  1  129  ? 85.493  155.529 26.648  1.00 53.53  ? 129  A   0 C4    1 
ATOM   2532  P  P     . C   A  1  130  ? 85.237  150.434 21.887  1.00 63.81  ? 130  C   0 P     1 
ATOM   2533  O  OP1   . C   A  1  130  ? 86.511  150.321 22.652  1.00 64.65  ? 130  C   0 OP1   1 
ATOM   2534  O  OP2   . C   A  1  130  ? 85.284  150.447 20.406  1.00 63.39  ? 130  C   0 OP2   1 
ATOM   2535  O  "O5'" . C   A  1  130  ? 84.273  149.229 22.290  1.00 63.84  ? 130  C   0 "O5'" 1 
ATOM   2536  C  "C5'" . C   A  1  130  ? 83.461  149.274 23.485  1.00 59.41  ? 130  C   0 "C5'" 1 
ATOM   2537  C  "C4'" . C   A  1  130  ? 83.155  147.873 23.956  1.00 55.89  ? 130  C   0 "C4'" 1 
ATOM   2538  O  "O4'" . C   A  1  130  ? 82.277  147.199 23.015  1.00 56.31  ? 130  C   0 "O4'" 1 
ATOM   2539  C  "C3'" . C   A  1  130  ? 84.365  146.964 24.032  1.00 53.56  ? 130  C   0 "C3'" 1 
ATOM   2540  O  "O3'" . C   A  1  130  ? 85.088  147.196 25.226  1.00 50.60  ? 130  C   0 "O3'" 1 
ATOM   2541  C  "C2'" . C   A  1  130  ? 83.731  145.580 23.973  1.00 54.32  ? 130  C   0 "C2'" 1 
ATOM   2542  O  "O2'" . C   A  1  130  ? 83.149  145.165 25.189  1.00 54.50  ? 130  C   0 "O2'" 1 
ATOM   2543  C  "C1'" . C   A  1  130  ? 82.598  145.814 22.977  1.00 56.64  ? 130  C   0 "C1'" 1 
ATOM   2544  N  N1    . C   A  1  130  ? 82.956  145.425 21.598  1.00 59.07  ? 130  C   0 N1    1 
ATOM   2545  C  C2    . C   A  1  130  ? 82.994  144.056 21.275  1.00 60.71  ? 130  C   0 C2    1 
ATOM   2546  O  O2    . C   A  1  130  ? 82.720  143.218 22.156  1.00 60.29  ? 130  C   0 O2    1 
ATOM   2547  N  N3    . C   A  1  130  ? 83.327  143.683 20.012  1.00 61.79  ? 130  C   0 N3    1 
ATOM   2548  C  C4    . C   A  1  130  ? 83.608  144.611 19.092  1.00 60.15  ? 130  C   0 C4    1 
ATOM   2549  N  N4    . C   A  1  130  ? 83.924  144.196 17.860  1.00 58.68  ? 130  C   0 N4    1 
ATOM   2550  C  C5    . C   A  1  130  ? 83.575  146.004 19.394  1.00 59.99  ? 130  C   0 C5    1 
ATOM   2551  C  C6    . C   A  1  130  ? 83.249  146.363 20.646  1.00 58.94  ? 130  C   0 C6    1 
ATOM   2552  P  P     . A   A  1  131  ? 86.670  147.429 25.162  1.00 48.30  ? 131  A   0 P     1 
ATOM   2553  O  OP1   . A   A  1  131  ? 86.875  148.862 24.888  1.00 48.57  ? 131  A   0 OP1   1 
ATOM   2554  O  OP2   . A   A  1  131  ? 87.274  146.425 24.262  1.00 49.16  ? 131  A   0 OP2   1 
ATOM   2555  O  "O5'" . A   A  1  131  ? 87.160  147.094 26.637  1.00 46.03  ? 131  A   0 "O5'" 1 
ATOM   2556  C  "C5'" . A   A  1  131  ? 87.530  148.129 27.569  1.00 43.79  ? 131  A   0 "C5'" 1 
ATOM   2557  C  "C4'" . A   A  1  131  ? 87.529  147.568 28.966  1.00 42.51  ? 131  A   0 "C4'" 1 
ATOM   2558  O  "O4'" . A   A  1  131  ? 86.166  147.425 29.425  1.00 42.61  ? 131  A   0 "O4'" 1 
ATOM   2559  C  "C3'" . A   A  1  131  ? 88.119  146.170 29.026  1.00 41.60  ? 131  A   0 "C3'" 1 
ATOM   2560  O  "O3'" . A   A  1  131  ? 89.517  146.225 29.209  1.00 43.06  ? 131  A   0 "O3'" 1 
ATOM   2561  C  "C2'" . A   A  1  131  ? 87.391  145.536 30.197  1.00 41.05  ? 131  A   0 "C2'" 1 
ATOM   2562  O  "O2'" . A   A  1  131  ? 87.939  145.918 31.439  1.00 41.47  ? 131  A   0 "O2'" 1 
ATOM   2563  C  "C1'" . A   A  1  131  ? 86.005  146.167 30.057  1.00 41.79  ? 131  A   0 "C1'" 1 
ATOM   2564  N  N9    . A   A  1  131  ? 85.032  145.393 29.283  1.00 40.67  ? 131  A   0 N9    1 
ATOM   2565  C  C8    . A   A  1  131  ? 84.454  145.740 28.086  1.00 39.84  ? 131  A   0 C8    1 
ATOM   2566  N  N7    . A   A  1  131  ? 83.543  144.896 27.674  1.00 39.99  ? 131  A   0 N7    1 
ATOM   2567  C  C5    . A   A  1  131  ? 83.533  143.913 28.652  1.00 41.18  ? 131  A   0 C5    1 
ATOM   2568  C  C6    . A   A  1  131  ? 82.768  142.748 28.807  1.00 40.26  ? 131  A   0 C6    1 
ATOM   2569  N  N6    . A   A  1  131  ? 81.822  142.371 27.950  1.00 39.29  ? 131  A   0 N6    1 
ATOM   2570  N  N1    . A   A  1  131  ? 83.008  141.978 29.889  1.00 40.09  ? 131  A   0 N1    1 
ATOM   2571  C  C2    . A   A  1  131  ? 83.957  142.365 30.751  1.00 40.38  ? 131  A   0 C2    1 
ATOM   2572  N  N3    . A   A  1  131  ? 84.737  143.442 30.720  1.00 40.34  ? 131  A   0 N3    1 
ATOM   2573  C  C4    . A   A  1  131  ? 84.468  144.189 29.634  1.00 41.55  ? 131  A   0 C4    1 
ATOM   2574  P  P     . A   A  1  132  ? 90.438  145.105 28.548  1.00 44.07  ? 132  A   0 P     1 
ATOM   2575  O  OP1   . A   A  1  132  ? 91.826  145.245 29.058  1.00 45.61  ? 132  A   0 OP1   1 
ATOM   2576  O  OP2   . A   A  1  132  ? 90.175  145.128 27.088  1.00 44.60  ? 132  A   0 OP2   1 
ATOM   2577  O  "O5'" . A   A  1  132  ? 89.852  143.759 29.144  1.00 46.00  ? 132  A   0 "O5'" 1 
ATOM   2578  C  "C5'" . A   A  1  132  ? 90.163  143.333 30.477  1.00 43.02  ? 132  A   0 "C5'" 1 
ATOM   2579  C  "C4'" . A   A  1  132  ? 89.498  142.015 30.737  1.00 42.47  ? 132  A   0 "C4'" 1 
ATOM   2580  O  "O4'" . A   A  1  132  ? 88.062  142.203 30.641  1.00 42.76  ? 132  A   0 "O4'" 1 
ATOM   2581  C  "C3'" . A   A  1  132  ? 89.786  140.971 29.675  1.00 42.73  ? 132  A   0 "C3'" 1 
ATOM   2582  O  "O3'" . A   A  1  132  ? 91.024  140.319 29.882  1.00 43.77  ? 132  A   0 "O3'" 1 
ATOM   2583  C  "C2'" . A   A  1  132  ? 88.587  140.050 29.793  1.00 43.33  ? 132  A   0 "C2'" 1 
ATOM   2584  O  "O2'" . A   A  1  132  ? 88.684  139.174 30.896  1.00 45.86  ? 132  A   0 "O2'" 1 
ATOM   2585  C  "C1'" . A   A  1  132  ? 87.471  141.065 30.041  1.00 43.37  ? 132  A   0 "C1'" 1 
ATOM   2586  N  N9    . A   A  1  132  ? 86.805  141.489 28.812  1.00 43.71  ? 132  A   0 N9    1 
ATOM   2587  C  C8    . A   A  1  132  ? 87.056  142.595 28.042  1.00 44.32  ? 132  A   0 C8    1 
ATOM   2588  N  N7    . A   A  1  132  ? 86.271  142.702 27.000  1.00 43.07  ? 132  A   0 N7    1 
ATOM   2589  C  C5    . A   A  1  132  ? 85.449  141.592 27.090  1.00 43.95  ? 132  A   0 C5    1 
ATOM   2590  C  C6    . A   A  1  132  ? 84.400  141.131 26.289  1.00 45.58  ? 132  A   0 C6    1 
ATOM   2591  N  N6    . A   A  1  132  ? 83.965  141.766 25.199  1.00 46.78  ? 132  A   0 N6    1 
ATOM   2592  N  N1    . A   A  1  132  ? 83.798  139.978 26.649  1.00 46.27  ? 132  A   0 N1    1 
ATOM   2593  C  C2    . A   A  1  132  ? 84.227  139.348 27.745  1.00 44.29  ? 132  A   0 C2    1 
ATOM   2594  N  N3    . A   A  1  132  ? 85.195  139.687 28.584  1.00 43.26  ? 132  A   0 N3    1 
ATOM   2595  C  C4    . A   A  1  132  ? 85.773  140.832 28.196  1.00 43.66  ? 132  A   0 C4    1 
ATOM   2596  P  P     . U   A  1  133  ? 91.889  139.853 28.613  1.00 45.08  ? 133  U   0 P     1 
ATOM   2597  O  OP1   . U   A  1  133  ? 93.249  139.515 29.105  1.00 44.64  ? 133  U   0 OP1   1 
ATOM   2598  O  OP2   . U   A  1  133  ? 91.720  140.843 27.508  1.00 45.05  ? 133  U   0 OP2   1 
ATOM   2599  O  "O5'" . U   A  1  133  ? 91.180  138.516 28.143  1.00 44.04  ? 133  U   0 "O5'" 1 
ATOM   2600  C  "C5'" . U   A  1  133  ? 91.000  137.427 29.052  1.00 43.66  ? 133  U   0 "C5'" 1 
ATOM   2601  C  "C4'" . U   A  1  133  ? 90.110  136.396 28.430  1.00 42.62  ? 133  U   0 "C4'" 1 
ATOM   2602  O  "O4'" . U   A  1  133  ? 88.748  136.885 28.360  1.00 42.74  ? 133  U   0 "O4'" 1 
ATOM   2603  C  "C3'" . U   A  1  133  ? 90.451  136.082 26.989  1.00 43.26  ? 133  U   0 "C3'" 1 
ATOM   2604  O  "O3'" . U   A  1  133  ? 91.563  135.199 26.910  1.00 44.28  ? 133  U   0 "O3'" 1 
ATOM   2605  C  "C2'" . U   A  1  133  ? 89.146  135.490 26.480  1.00 42.98  ? 133  U   0 "C2'" 1 
ATOM   2606  O  "O2'" . U   A  1  133  ? 88.966  134.152 26.899  1.00 42.12  ? 133  U   0 "O2'" 1 
ATOM   2607  C  "C1'" . U   A  1  133  ? 88.125  136.383 27.188  1.00 42.89  ? 133  U   0 "C1'" 1 
ATOM   2608  N  N1    . U   A  1  133  ? 87.669  137.519 26.371  1.00 43.24  ? 133  U   0 N1    1 
ATOM   2609  C  C2    . U   A  1  133  ? 86.589  137.312 25.533  1.00 43.14  ? 133  U   0 C2    1 
ATOM   2610  O  O2    . U   A  1  133  ? 86.009  136.246 25.452  1.00 43.53  ? 133  U   0 O2    1 
ATOM   2611  N  N3    . U   A  1  133  ? 86.212  138.402 24.790  1.00 42.91  ? 133  U   0 N3    1 
ATOM   2612  C  C4    . U   A  1  133  ? 86.788  139.650 24.792  1.00 41.66  ? 133  U   0 C4    1 
ATOM   2613  O  O4    . U   A  1  133  ? 86.343  140.522 24.044  1.00 39.09  ? 133  U   0 O4    1 
ATOM   2614  C  C5    . U   A  1  133  ? 87.895  139.792 25.688  1.00 42.90  ? 133  U   0 C5    1 
ATOM   2615  C  C6    . U   A  1  133  ? 88.289  138.749 26.428  1.00 42.88  ? 133  U   0 C6    1 
ATOM   2616  P  P     . U   A  1  134  ? 92.330  135.021 25.516  1.00 43.82  ? 134  U   0 P     1 
ATOM   2617  O  OP1   . U   A  1  134  ? 93.549  134.205 25.771  1.00 45.03  ? 134  U   0 OP1   1 
ATOM   2618  O  OP2   . U   A  1  134  ? 92.451  136.345 24.844  1.00 40.01  ? 134  U   0 OP2   1 
ATOM   2619  O  "O5'" . U   A  1  134  ? 91.314  134.127 24.692  1.00 42.59  ? 134  U   0 "O5'" 1 
ATOM   2620  C  "C5'" . U   A  1  134  ? 91.144  134.330 23.309  1.00 38.42  ? 134  U   0 "C5'" 1 
ATOM   2621  C  "C4'" . U   A  1  134  ? 89.837  133.761 22.858  1.00 35.94  ? 134  U   0 "C4'" 1 
ATOM   2622  O  "O4'" . U   A  1  134  ? 88.730  134.540 23.372  1.00 36.15  ? 134  U   0 "O4'" 1 
ATOM   2623  C  "C3'" . U   A  1  134  ? 89.697  133.900 21.369  1.00 37.09  ? 134  U   0 "C3'" 1 
ATOM   2624  O  "O3'" . U   A  1  134  ? 90.440  132.881 20.755  1.00 36.75  ? 134  U   0 "O3'" 1 
ATOM   2625  C  "C2'" . U   A  1  134  ? 88.194  133.854 21.170  1.00 36.39  ? 134  U   0 "C2'" 1 
ATOM   2626  O  "O2'" . U   A  1  134  ? 87.658  132.552 21.280  1.00 35.60  ? 134  U   0 "O2'" 1 
ATOM   2627  C  "C1'" . U   A  1  134  ? 87.740  134.697 22.361  1.00 36.53  ? 134  U   0 "C1'" 1 
ATOM   2628  N  N1    . U   A  1  134  ? 87.638  136.130 22.035  1.00 38.02  ? 134  U   0 N1    1 
ATOM   2629  C  C2    . U   A  1  134  ? 86.670  136.532 21.119  1.00 38.48  ? 134  U   0 C2    1 
ATOM   2630  O  O2    . U   A  1  134  ? 85.911  135.760 20.561  1.00 38.84  ? 134  U   0 O2    1 
ATOM   2631  N  N3    . U   A  1  134  ? 86.627  137.879 20.880  1.00 38.20  ? 134  U   0 N3    1 
ATOM   2632  C  C4    . U   A  1  134  ? 87.431  138.846 21.435  1.00 39.19  ? 134  U   0 C4    1 
ATOM   2633  O  O4    . U   A  1  134  ? 87.284  140.021 21.094  1.00 41.42  ? 134  U   0 O4    1 
ATOM   2634  C  C5    . U   A  1  134  ? 88.405  138.356 22.360  1.00 38.11  ? 134  U   0 C5    1 
ATOM   2635  C  C6    . U   A  1  134  ? 88.474  137.052 22.622  1.00 37.01  ? 134  U   0 C6    1 
ATOM   2636  P  P     . G   A  1  135  ? 91.357  133.239 19.505  1.00 35.95  ? 135  G   0 P     1 
ATOM   2637  O  OP1   . G   A  1  135  ? 92.440  132.219 19.458  1.00 34.30  ? 135  G   0 OP1   1 
ATOM   2638  O  OP2   . G   A  1  135  ? 91.705  134.678 19.588  1.00 36.06  ? 135  G   0 OP2   1 
ATOM   2639  O  "O5'" . G   A  1  135  ? 90.359  133.023 18.287  1.00 35.58  ? 135  G   0 "O5'" 1 
ATOM   2640  C  "C5'" . G   A  1  135  ? 89.625  131.792 18.168  1.00 36.18  ? 135  G   0 "C5'" 1 
ATOM   2641  C  "C4'" . G   A  1  135  ? 88.473  131.963 17.225  1.00 37.69  ? 135  G   0 "C4'" 1 
ATOM   2642  O  "O4'" . G   A  1  135  ? 87.499  132.878 17.791  1.00 39.21  ? 135  G   0 "O4'" 1 
ATOM   2643  C  "C3'" . G   A  1  135  ? 88.838  132.625 15.918  1.00 40.76  ? 135  G   0 "C3'" 1 
ATOM   2644  O  "O3'" . G   A  1  135  ? 89.479  131.747 15.020  1.00 41.17  ? 135  G   0 "O3'" 1 
ATOM   2645  C  "C2'" . G   A  1  135  ? 87.489  133.119 15.437  1.00 41.24  ? 135  G   0 "C2'" 1 
ATOM   2646  O  "O2'" . G   A  1  135  ? 86.708  132.057 14.938  1.00 42.72  ? 135  G   0 "O2'" 1 
ATOM   2647  C  "C1'" . G   A  1  135  ? 86.897  133.635 16.750  1.00 40.40  ? 135  G   0 "C1'" 1 
ATOM   2648  N  N9    . G   A  1  135  ? 87.201  135.050 16.965  1.00 42.04  ? 135  G   0 N9    1 
ATOM   2649  C  C8    . G   A  1  135  ? 88.158  135.586 17.799  1.00 43.21  ? 135  G   0 C8    1 
ATOM   2650  N  N7    . G   A  1  135  ? 88.185  136.894 17.774  1.00 42.83  ? 135  G   0 N7    1 
ATOM   2651  C  C5    . G   A  1  135  ? 87.189  137.243 16.870  1.00 41.19  ? 135  G   0 C5    1 
ATOM   2652  C  C6    . G   A  1  135  ? 86.749  138.520 16.427  1.00 40.85  ? 135  G   0 C6    1 
ATOM   2653  O  O6    . G   A  1  135  ? 87.151  139.639 16.763  1.00 40.88  ? 135  G   0 O6    1 
ATOM   2654  N  N1    . G   A  1  135  ? 85.727  138.410 15.496  1.00 41.08  ? 135  G   0 N1    1 
ATOM   2655  C  C2    . G   A  1  135  ? 85.188  137.233 15.048  1.00 41.72  ? 135  G   0 C2    1 
ATOM   2656  N  N2    . G   A  1  135  ? 84.209  137.337 14.142  1.00 42.81  ? 135  G   0 N2    1 
ATOM   2657  N  N3    . G   A  1  135  ? 85.579  136.040 15.455  1.00 42.40  ? 135  G   0 N3    1 
ATOM   2658  C  C4    . G   A  1  135  ? 86.576  136.117 16.360  1.00 41.84  ? 135  G   0 C4    1 
ATOM   2659  P  P     . C   A  1  136  ? 90.686  132.301 14.123  1.00 41.06  ? 136  C   0 P     1 
ATOM   2660  O  OP1   . C   A  1  136  ? 91.294  131.128 13.455  1.00 40.30  ? 136  C   0 OP1   1 
ATOM   2661  O  OP2   . C   A  1  136  ? 91.532  133.193 14.947  1.00 37.90  ? 136  C   0 OP2   1 
ATOM   2662  O  "O5'" . C   A  1  136  ? 89.947  133.199 13.039  1.00 40.02  ? 136  C   0 "O5'" 1 
ATOM   2663  C  "C5'" . C   A  1  136  ? 88.984  132.618 12.154  1.00 41.39  ? 136  C   0 "C5'" 1 
ATOM   2664  C  "C4'" . C   A  1  136  ? 88.273  133.694 11.378  1.00 43.84  ? 136  C   0 "C4'" 1 
ATOM   2665  O  "O4'" . C   A  1  136  ? 87.549  134.551 12.293  1.00 44.06  ? 136  C   0 "O4'" 1 
ATOM   2666  C  "C3'" . C   A  1  136  ? 89.143  134.671 10.609  1.00 45.07  ? 136  C   0 "C3'" 1 
ATOM   2667  O  "O3'" . C   A  1  136  ? 89.569  134.137 9.373   1.00 49.34  ? 136  C   0 "O3'" 1 
ATOM   2668  C  "C2'" . C   A  1  136  ? 88.180  135.822 10.399  1.00 43.45  ? 136  C   0 "C2'" 1 
ATOM   2669  O  "O2'" . C   A  1  136  ? 87.226  135.518 9.408   1.00 44.40  ? 136  C   0 "O2'" 1 
ATOM   2670  C  "C1'" . C   A  1  136  ? 87.479  135.860 11.753  1.00 42.77  ? 136  C   0 "C1'" 1 
ATOM   2671  N  N1    . C   A  1  136  ? 88.133  136.796 12.681  1.00 42.28  ? 136  C   0 N1    1 
ATOM   2672  C  C2    . C   A  1  136  ? 87.745  138.142 12.654  1.00 42.22  ? 136  C   0 C2    1 
ATOM   2673  O  O2    . C   A  1  136  ? 86.853  138.498 11.860  1.00 41.90  ? 136  C   0 O2    1 
ATOM   2674  N  N3    . C   A  1  136  ? 88.346  139.019 13.490  1.00 41.21  ? 136  C   0 N3    1 
ATOM   2675  C  C4    . C   A  1  136  ? 89.292  138.599 14.330  1.00 40.53  ? 136  C   0 C4    1 
ATOM   2676  N  N4    . C   A  1  136  ? 89.856  139.505 15.128  1.00 40.04  ? 136  C   0 N4    1 
ATOM   2677  C  C5    . C   A  1  136  ? 89.702  137.234 14.387  1.00 40.75  ? 136  C   0 C5    1 
ATOM   2678  C  C6    . C   A  1  136  ? 89.104  136.375 13.552  1.00 41.66  ? 136  C   0 C6    1 
ATOM   2679  P  P     . U   A  1  137  ? 91.051  134.447 8.836   1.00 53.42  ? 137  U   0 P     1 
ATOM   2680  O  OP1   . U   A  1  137  ? 91.056  133.831 7.491   1.00 53.07  ? 137  U   0 OP1   1 
ATOM   2681  O  OP2   . U   A  1  137  ? 92.075  134.034 9.835   1.00 48.34  ? 137  U   0 OP2   1 
ATOM   2682  O  "O5'" . U   A  1  137  ? 91.112  136.039 8.703   1.00 55.73  ? 137  U   0 "O5'" 1 
ATOM   2683  C  "C5'" . U   A  1  137  ? 90.267  136.759 7.768   1.00 59.83  ? 137  U   0 "C5'" 1 
ATOM   2684  C  "C4'" . U   A  1  137  ? 90.159  138.223 8.170   1.00 62.97  ? 137  U   0 "C4'" 1 
ATOM   2685  O  "O4'" . U   A  1  137  ? 89.796  138.276 9.576   1.00 63.74  ? 137  U   0 "O4'" 1 
ATOM   2686  C  "C3'" . U   A  1  137  ? 91.416  139.089 8.066   1.00 64.45  ? 137  U   0 "C3'" 1 
ATOM   2687  O  "O3'" . U   A  1  137  ? 91.570  139.640 6.746   1.00 69.97  ? 137  U   0 "O3'" 1 
ATOM   2688  C  "C2'" . U   A  1  137  ? 91.144  140.171 9.109   1.00 62.23  ? 137  U   0 "C2'" 1 
ATOM   2689  O  "O2'" . U   A  1  137  ? 90.223  141.146 8.665   1.00 59.05  ? 137  U   0 "O2'" 1 
ATOM   2690  C  "C1'" . U   A  1  137  ? 90.455  139.361 10.208  1.00 60.69  ? 137  U   0 "C1'" 1 
ATOM   2691  N  N1    . U   A  1  137  ? 91.349  138.819 11.248  1.00 57.41  ? 137  U   0 N1    1 
ATOM   2692  C  C2    . U   A  1  137  ? 91.673  139.636 12.312  1.00 55.57  ? 137  U   0 C2    1 
ATOM   2693  O  O2    . U   A  1  137  ? 91.280  140.778 12.408  1.00 56.66  ? 137  U   0 O2    1 
ATOM   2694  N  N3    . U   A  1  137  ? 92.477  139.064 13.265  1.00 54.72  ? 137  U   0 N3    1 
ATOM   2695  C  C4    . U   A  1  137  ? 92.986  137.784 13.261  1.00 55.23  ? 137  U   0 C4    1 
ATOM   2696  O  O4    . U   A  1  137  ? 93.700  137.409 14.196  1.00 53.13  ? 137  U   0 O4    1 
ATOM   2697  C  C5    . U   A  1  137  ? 92.620  137.004 12.119  1.00 56.52  ? 137  U   0 C5    1 
ATOM   2698  C  C6    . U   A  1  137  ? 91.837  137.534 11.176  1.00 56.23  ? 137  U   0 C6    1 
ATOM   2699  P  P     . U   A  1  138  ? 93.032  140.072 6.196   1.00 73.56  ? 138  U   0 P     1 
ATOM   2700  O  OP1   . U   A  1  138  ? 92.963  139.916 4.726   1.00 73.14  ? 138  U   0 OP1   1 
ATOM   2701  O  OP2   . U   A  1  138  ? 94.078  139.335 6.954   1.00 72.91  ? 138  U   0 OP2   1 
ATOM   2702  O  "O5'" . U   A  1  138  ? 93.148  141.637 6.529   1.00 77.25  ? 138  U   0 "O5'" 1 
ATOM   2703  C  "C5'" . U   A  1  138  ? 93.911  142.541 5.674   1.00 82.33  ? 138  U   0 "C5'" 1 
ATOM   2704  C  "C4'" . U   A  1  138  ? 93.249  143.913 5.589   1.00 86.78  ? 138  U   0 "C4'" 1 
ATOM   2705  O  "O4'" . U   A  1  138  ? 91.839  143.742 5.307   1.00 90.27  ? 138  U   0 "O4'" 1 
ATOM   2706  C  "C3'" . U   A  1  138  ? 93.229  144.769 6.852   1.00 88.45  ? 138  U   0 "C3'" 1 
ATOM   2707  O  "O3'" . U   A  1  138  ? 94.409  145.567 6.946   1.00 86.81  ? 138  U   0 "O3'" 1 
ATOM   2708  C  "C2'" . U   A  1  138  ? 92.068  145.737 6.599   1.00 91.40  ? 138  U   0 "C2'" 1 
ATOM   2709  O  "O2'" . U   A  1  138  ? 92.443  146.938 5.953   1.00 92.83  ? 138  U   0 "O2'" 1 
ATOM   2710  C  "C1'" . U   A  1  138  ? 91.161  144.932 5.660   1.00 94.01  ? 138  U   0 "C1'" 1 
ATOM   2711  N  N1    . U   A  1  138  ? 89.821  144.605 6.174   1.00 98.57  ? 138  U   0 N1    1 
ATOM   2712  C  C2    . U   A  1  138  ? 88.766  144.583 5.263   1.00 100.61 ? 138  U   0 C2    1 
ATOM   2713  O  O2    . U   A  1  138  ? 88.909  144.809 4.063   1.00 99.47  ? 138  U   0 O2    1 
ATOM   2714  N  N3    . U   A  1  138  ? 87.537  144.284 5.812   1.00 102.54 ? 138  U   0 N3    1 
ATOM   2715  C  C4    . U   A  1  138  ? 87.257  144.006 7.145   1.00 102.61 ? 138  U   0 C4    1 
ATOM   2716  O  O4    . U   A  1  138  ? 86.098  143.743 7.486   1.00 102.70 ? 138  U   0 O4    1 
ATOM   2717  C  C5    . U   A  1  138  ? 88.395  144.045 8.012   1.00 101.99 ? 138  U   0 C5    1 
ATOM   2718  C  C6    . U   A  1  138  ? 89.604  144.334 7.513   1.00 100.51 ? 138  U   0 C6    1 
ATOM   2719  P  P     . C   A  1  139  ? 95.661  145.072 7.816   1.00 87.11  ? 139  C   0 P     1 
ATOM   2720  O  OP1   . C   A  1  139  ? 96.424  146.289 8.196   1.00 86.41  ? 139  C   0 OP1   1 
ATOM   2721  O  OP2   . C   A  1  139  ? 96.339  143.991 7.056   1.00 86.59  ? 139  C   0 OP2   1 
ATOM   2722  O  "O5'" . C   A  1  139  ? 95.016  144.452 9.136   1.00 87.11  ? 139  C   0 "O5'" 1 
ATOM   2723  C  "C5'" . C   A  1  139  ? 94.408  145.292 10.136  1.00 84.16  ? 139  C   0 "C5'" 1 
ATOM   2724  C  "C4'" . C   A  1  139  ? 94.851  144.860 11.515  1.00 83.02  ? 139  C   0 "C4'" 1 
ATOM   2725  O  "O4'" . C   A  1  139  ? 94.415  143.491 11.742  1.00 83.57  ? 139  C   0 "O4'" 1 
ATOM   2726  C  "C3'" . C   A  1  139  ? 96.358  144.871 11.766  1.00 82.25  ? 139  C   0 "C3'" 1 
ATOM   2727  O  "O3'" . C   A  1  139  ? 96.635  145.207 13.124  1.00 79.03  ? 139  C   0 "O3'" 1 
ATOM   2728  C  "C2'" . C   A  1  139  ? 96.750  143.422 11.511  1.00 83.30  ? 139  C   0 "C2'" 1 
ATOM   2729  O  "O2'" . C   A  1  139  ? 97.927  143.033 12.192  1.00 84.96  ? 139  C   0 "O2'" 1 
ATOM   2730  C  "C1'" . C   A  1  139  ? 95.531  142.681 12.055  1.00 84.09  ? 139  C   0 "C1'" 1 
ATOM   2731  N  N1    . C   A  1  139  ? 95.345  141.361 11.429  1.00 85.08  ? 139  C   0 N1    1 
ATOM   2732  C  C2    . C   A  1  139  ? 95.791  140.214 12.110  1.00 85.38  ? 139  C   0 C2    1 
ATOM   2733  O  O2    . C   A  1  139  ? 96.313  140.338 13.232  1.00 84.76  ? 139  C   0 O2    1 
ATOM   2734  N  N3    . C   A  1  139  ? 95.639  139.002 11.525  1.00 86.37  ? 139  C   0 N3    1 
ATOM   2735  C  C4    . C   A  1  139  ? 95.066  138.908 10.320  1.00 86.99  ? 139  C   0 C4    1 
ATOM   2736  N  N4    . C   A  1  139  ? 94.933  137.691 9.779   1.00 87.17  ? 139  C   0 N4    1 
ATOM   2737  C  C5    . C   A  1  139  ? 94.601  140.056 9.614   1.00 86.19  ? 139  C   0 C5    1 
ATOM   2738  C  C6    . C   A  1  139  ? 94.757  141.248 10.198  1.00 85.33  ? 139  C   0 C6    1 
ATOM   2739  P  P     . G   A  1  140  ? 96.891  146.742 13.522  1.00 76.11  ? 140  G   0 P     1 
ATOM   2740  O  OP1   . G   A  1  140  ? 97.856  147.309 12.542  1.00 75.99  ? 140  G   0 OP1   1 
ATOM   2741  O  OP2   . G   A  1  140  ? 97.201  146.801 14.973  1.00 76.31  ? 140  G   0 OP2   1 
ATOM   2742  O  "O5'" . G   A  1  140  ? 95.467  147.409 13.264  1.00 71.86  ? 140  G   0 "O5'" 1 
ATOM   2743  C  "C5'" . G   A  1  140  ? 95.289  148.826 13.334  1.00 66.33  ? 140  G   0 "C5'" 1 
ATOM   2744  C  "C4'" . G   A  1  140  ? 93.828  149.156 13.524  1.00 63.78  ? 140  G   0 "C4'" 1 
ATOM   2745  O  "O4'" . G   A  1  140  ? 93.073  148.839 12.332  1.00 64.12  ? 140  G   0 "O4'" 1 
ATOM   2746  C  "C3'" . G   A  1  140  ? 93.110  148.344 14.580  1.00 60.98  ? 140  G   0 "C3'" 1 
ATOM   2747  O  "O3'" . G   A  1  140  ? 93.448  148.850 15.862  1.00 59.15  ? 140  G   0 "O3'" 1 
ATOM   2748  C  "C2'" . G   A  1  140  ? 91.639  148.561 14.215  1.00 61.63  ? 140  G   0 "C2'" 1 
ATOM   2749  O  "O2'" . G   A  1  140  ? 91.106  149.759 14.746  1.00 59.56  ? 140  G   0 "O2'" 1 
ATOM   2750  C  "C1'" . G   A  1  140  ? 91.710  148.672 12.685  1.00 62.14  ? 140  G   0 "C1'" 1 
ATOM   2751  N  N9    . G   A  1  140  ? 91.173  147.559 11.906  1.00 61.92  ? 140  G   0 N9    1 
ATOM   2752  C  C8    . G   A  1  140  ? 90.438  147.656 10.752  1.00 61.44  ? 140  G   0 C8    1 
ATOM   2753  N  N7    . G   A  1  140  ? 90.133  146.498 10.240  1.00 61.85  ? 140  G   0 N7    1 
ATOM   2754  C  C5    . G   A  1  140  ? 90.691  145.578 11.115  1.00 62.52  ? 140  G   0 C5    1 
ATOM   2755  C  C6    . G   A  1  140  ? 90.692  144.162 11.080  1.00 63.70  ? 140  G   0 C6    1 
ATOM   2756  O  O6    . G   A  1  140  ? 90.193  143.407 10.234  1.00 65.00  ? 140  G   0 O6    1 
ATOM   2757  N  N1    . G   A  1  140  ? 91.359  143.625 12.172  1.00 63.75  ? 140  G   0 N1    1 
ATOM   2758  C  C2    . G   A  1  140  ? 91.950  144.349 13.169  1.00 63.80  ? 140  G   0 C2    1 
ATOM   2759  N  N2    . G   A  1  140  ? 92.535  143.640 14.147  1.00 64.64  ? 140  G   0 N2    1 
ATOM   2760  N  N3    . G   A  1  140  ? 91.966  145.670 13.209  1.00 64.29  ? 140  G   0 N3    1 
ATOM   2761  C  C4    . G   A  1  140  ? 91.323  146.215 12.157  1.00 62.32  ? 140  G   0 C4    1 
ATOM   2762  P  P     . C   A  1  141  ? 92.858  148.153 17.176  1.00 57.92  ? 141  C   0 P     1 
ATOM   2763  O  OP1   . C   A  1  141  ? 93.617  148.664 18.349  1.00 55.51  ? 141  C   0 OP1   1 
ATOM   2764  O  OP2   . C   A  1  141  ? 92.799  146.685 16.917  1.00 57.64  ? 141  C   0 OP2   1 
ATOM   2765  O  "O5'" . C   A  1  141  ? 91.371  148.716 17.250  1.00 55.90  ? 141  C   0 "O5'" 1 
ATOM   2766  C  "C5'" . C   A  1  141  ? 90.393  148.056 18.046  1.00 54.49  ? 141  C   0 "C5'" 1 
ATOM   2767  C  "C4'" . C   A  1  141  ? 89.222  147.654 17.197  1.00 54.17  ? 141  C   0 "C4'" 1 
ATOM   2768  O  "O4'" . C   A  1  141  ? 88.722  146.383 17.669  1.00 55.73  ? 141  C   0 "O4'" 1 
ATOM   2769  C  "C3'" . C   A  1  141  ? 88.033  148.603 17.185  1.00 53.95  ? 141  C   0 "C3'" 1 
ATOM   2770  O  "O3'" . C   A  1  141  ? 87.358  148.432 15.942  1.00 54.21  ? 141  C   0 "O3'" 1 
ATOM   2771  C  "C2'" . C   A  1  141  ? 87.167  148.024 18.301  1.00 54.63  ? 141  C   0 "C2'" 1 
ATOM   2772  O  "O2'" . C   A  1  141  ? 85.800  148.345 18.159  1.00 54.16  ? 141  C   0 "O2'" 1 
ATOM   2773  C  "C1'" . C   A  1  141  ? 87.382  146.525 18.083  1.00 56.10  ? 141  C   0 "C1'" 1 
ATOM   2774  N  N1    . C   A  1  141  ? 87.171  145.609 19.221  1.00 57.57  ? 141  C   0 N1    1 
ATOM   2775  C  C2    . C   A  1  141  ? 87.282  144.231 18.982  1.00 58.76  ? 141  C   0 C2    1 
ATOM   2776  O  O2    . C   A  1  141  ? 87.524  143.834 17.825  1.00 59.50  ? 141  C   0 O2    1 
ATOM   2777  N  N3    . C   A  1  141  ? 87.122  143.367 20.009  1.00 58.40  ? 141  C   0 N3    1 
ATOM   2778  C  C4    . C   A  1  141  ? 86.853  143.824 21.229  1.00 56.84  ? 141  C   0 C4    1 
ATOM   2779  N  N4    . C   A  1  141  ? 86.709  142.930 22.207  1.00 57.17  ? 141  C   0 N4    1 
ATOM   2780  C  C5    . C   A  1  141  ? 86.722  145.218 21.500  1.00 57.17  ? 141  C   0 C5    1 
ATOM   2781  C  C6    . C   A  1  141  ? 86.888  146.067 20.478  1.00 56.92  ? 141  C   0 C6    1 
ATOM   2782  P  P     . G   A  1  142  ? 87.158  149.676 14.945  1.00 54.18  ? 142  G   0 P     1 
ATOM   2783  O  OP1   . G   A  1  142  ? 88.419  149.842 14.160  1.00 52.08  ? 142  G   0 OP1   1 
ATOM   2784  O  OP2   . G   A  1  142  ? 86.602  150.818 15.717  1.00 52.27  ? 142  G   0 OP2   1 
ATOM   2785  O  "O5'" . G   A  1  142  ? 86.039  149.155 13.944  1.00 51.15  ? 142  G   0 "O5'" 1 
ATOM   2786  C  "C5'" . G   A  1  142  ? 85.933  149.675 12.616  1.00 49.83  ? 142  G   0 "C5'" 1 
ATOM   2787  C  "C4'" . G   A  1  142  ? 85.782  148.546 11.625  1.00 48.70  ? 142  G   0 "C4'" 1 
ATOM   2788  O  "O4'" . G   A  1  142  ? 87.033  147.832 11.471  1.00 50.06  ? 142  G   0 "O4'" 1 
ATOM   2789  C  "C3'" . G   A  1  142  ? 84.802  147.466 12.025  1.00 48.25  ? 142  G   0 "C3'" 1 
ATOM   2790  O  "O3'" . G   A  1  142  ? 83.474  147.845 11.742  1.00 48.02  ? 142  G   0 "O3'" 1 
ATOM   2791  C  "C2'" . G   A  1  142  ? 85.251  146.287 11.181  1.00 49.02  ? 142  G   0 "C2'" 1 
ATOM   2792  O  "O2'" . G   A  1  142  ? 84.793  146.390 9.852   1.00 49.08  ? 142  G   0 "O2'" 1 
ATOM   2793  C  "C1'" . G   A  1  142  ? 86.768  146.464 11.211  1.00 49.36  ? 142  G   0 "C1'" 1 
ATOM   2794  N  N9    . G   A  1  142  ? 87.444  145.657 12.223  1.00 51.21  ? 142  G   0 N9    1 
ATOM   2795  C  C8    . G   A  1  142  ? 88.193  146.103 13.290  1.00 51.35  ? 142  G   0 C8    1 
ATOM   2796  N  N7    . G   A  1  142  ? 88.735  145.133 13.975  1.00 52.01  ? 142  G   0 N7    1 
ATOM   2797  C  C5    . G   A  1  142  ? 88.304  143.976 13.334  1.00 52.09  ? 142  G   0 C5    1 
ATOM   2798  C  C6    . G   A  1  142  ? 88.581  142.608 13.610  1.00 51.33  ? 142  G   0 C6    1 
ATOM   2799  O  O6    . G   A  1  142  ? 89.302  142.127 14.493  1.00 50.55  ? 142  G   0 O6    1 
ATOM   2800  N  N1    . G   A  1  142  ? 87.925  141.766 12.718  1.00 50.69  ? 142  G   0 N1    1 
ATOM   2801  C  C2    . G   A  1  142  ? 87.117  142.178 11.691  1.00 51.16  ? 142  G   0 C2    1 
ATOM   2802  N  N2    . G   A  1  142  ? 86.566  141.211 10.946  1.00 52.21  ? 142  G   0 N2    1 
ATOM   2803  N  N3    . G   A  1  142  ? 86.863  143.444 11.413  1.00 51.94  ? 142  G   0 N3    1 
ATOM   2804  C  C4    . G   A  1  142  ? 87.486  144.283 12.268  1.00 51.86  ? 142  G   0 C4    1 
ATOM   2805  P  P     . C   A  1  143  ? 82.286  147.195 12.588  1.00 47.94  ? 143  C   0 P     1 
ATOM   2806  O  OP1   . C   A  1  143  ? 81.005  147.772 12.119  1.00 47.65  ? 143  C   0 OP1   1 
ATOM   2807  O  OP2   . C   A  1  143  ? 82.658  147.285 14.031  1.00 46.36  ? 143  C   0 OP2   1 
ATOM   2808  O  "O5'" . C   A  1  143  ? 82.315  145.676 12.127  1.00 46.86  ? 143  C   0 "O5'" 1 
ATOM   2809  C  "C5'" . C   A  1  143  ? 81.870  145.311 10.820  1.00 44.77  ? 143  C   0 "C5'" 1 
ATOM   2810  C  "C4'" . C   A  1  143  ? 81.727  143.819 10.726  1.00 45.77  ? 143  C   0 "C4'" 1 
ATOM   2811  O  "O4'" . C   A  1  143  ? 83.033  143.201 10.841  1.00 45.82  ? 143  C   0 "O4'" 1 
ATOM   2812  C  "C3'" . C   A  1  143  ? 80.914  143.186 11.839  1.00 45.75  ? 143  C   0 "C3'" 1 
ATOM   2813  O  "O3'" . C   A  1  143  ? 79.517  143.263 11.582  1.00 45.77  ? 143  C   0 "O3'" 1 
ATOM   2814  C  "C2'" . C   A  1  143  ? 81.428  141.757 11.834  1.00 45.87  ? 143  C   0 "C2'" 1 
ATOM   2815  O  "O2'" . C   A  1  143  ? 80.847  141.006 10.792  1.00 45.68  ? 143  C   0 "O2'" 1 
ATOM   2816  C  "C1'" . C   A  1  143  ? 82.916  141.978 11.546  1.00 45.68  ? 143  C   0 "C1'" 1 
ATOM   2817  N  N1    . C   A  1  143  ? 83.752  142.054 12.759  1.00 45.38  ? 143  C   0 N1    1 
ATOM   2818  C  C2    . C   A  1  143  ? 84.281  140.873 13.282  1.00 44.04  ? 143  C   0 C2    1 
ATOM   2819  O  O2    . C   A  1  143  ? 84.027  139.806 12.717  1.00 42.98  ? 143  C   0 O2    1 
ATOM   2820  N  N3    . C   A  1  143  ? 85.055  140.923 14.391  1.00 44.47  ? 143  C   0 N3    1 
ATOM   2821  C  C4    . C   A  1  143  ? 85.306  142.095 14.977  1.00 44.81  ? 143  C   0 C4    1 
ATOM   2822  N  N4    . C   A  1  143  ? 86.069  142.093 16.072  1.00 43.67  ? 143  C   0 N4    1 
ATOM   2823  C  C5    . C   A  1  143  ? 84.781  143.320 14.466  1.00 46.03  ? 143  C   0 C5    1 
ATOM   2824  C  C6    . C   A  1  143  ? 84.014  143.254 13.366  1.00 46.33  ? 143  C   0 C6    1 
ATOM   2825  P  P     . A   A  1  144  ? 78.481  143.033 12.786  1.00 47.81  ? 144  A   0 P     1 
ATOM   2826  O  OP1   . A   A  1  144  ? 77.098  143.056 12.231  1.00 46.72  ? 144  A   0 OP1   1 
ATOM   2827  O  OP2   . A   A  1  144  ? 78.840  143.954 13.906  1.00 45.90  ? 144  A   0 OP2   1 
ATOM   2828  O  "O5'" . A   A  1  144  ? 78.804  141.537 13.223  1.00 47.92  ? 144  A   0 "O5'" 1 
ATOM   2829  C  "C5'" . A   A  1  144  ? 78.600  141.092 14.572  1.00 45.40  ? 144  A   0 "C5'" 1 
ATOM   2830  C  "C4'" . A   A  1  144  ? 79.091  139.675 14.727  1.00 43.64  ? 144  A   0 "C4'" 1 
ATOM   2831  O  "O4'" . A   A  1  144  ? 80.514  139.619 14.445  1.00 42.30  ? 144  A   0 "O4'" 1 
ATOM   2832  C  "C3'" . A   A  1  144  ? 78.965  139.115 16.129  1.00 43.16  ? 144  A   0 "C3'" 1 
ATOM   2833  O  "O3'" . A   A  1  144  ? 77.661  138.611 16.357  1.00 42.15  ? 144  A   0 "O3'" 1 
ATOM   2834  C  "C2'" . A   A  1  144  ? 80.034  138.037 16.143  1.00 41.89  ? 144  A   0 "C2'" 1 
ATOM   2835  O  "O2'" . A   A  1  144  ? 79.608  136.872 15.468  1.00 41.23  ? 144  A   0 "O2'" 1 
ATOM   2836  C  "C1'" . A   A  1  144  ? 81.145  138.726 15.348  1.00 41.15  ? 144  A   0 "C1'" 1 
ATOM   2837  N  N9    . A   A  1  144  ? 82.037  139.523 16.187  1.00 40.94  ? 144  A   0 N9    1 
ATOM   2838  C  C8    . A   A  1  144  ? 82.135  140.892 16.225  1.00 40.60  ? 144  A   0 C8    1 
ATOM   2839  N  N7    . A   A  1  144  ? 83.038  141.334 17.060  1.00 40.61  ? 144  A   0 N7    1 
ATOM   2840  C  C5    . A   A  1  144  ? 83.571  140.181 17.615  1.00 40.52  ? 144  A   0 C5    1 
ATOM   2841  C  C6    . A   A  1  144  ? 84.583  139.972 18.562  1.00 40.96  ? 144  A   0 C6    1 
ATOM   2842  N  N6    . A   A  1  144  ? 85.279  140.958 19.132  1.00 39.10  ? 144  A   0 N6    1 
ATOM   2843  N  N1    . A   A  1  144  ? 84.868  138.696 18.903  1.00 41.86  ? 144  A   0 N1    1 
ATOM   2844  C  C2    . A   A  1  144  ? 84.179  137.708 18.320  1.00 40.60  ? 144  A   0 C2    1 
ATOM   2845  N  N3    . A   A  1  144  ? 83.213  137.779 17.411  1.00 40.32  ? 144  A   0 N3    1 
ATOM   2846  C  C4    . A   A  1  144  ? 82.955  139.058 17.095  1.00 40.34  ? 144  A   0 C4    1 
ATOM   2847  P  P     . A   A  1  145  ? 76.974  138.818 17.790  1.00 43.75  ? 145  A   0 P     1 
ATOM   2848  O  OP1   . A   A  1  145  ? 75.546  138.493 17.605  1.00 42.79  ? 145  A   0 OP1   1 
ATOM   2849  O  OP2   . A   A  1  145  ? 77.361  140.145 18.359  1.00 43.12  ? 145  A   0 OP2   1 
ATOM   2850  O  "O5'" . A   A  1  145  ? 77.636  137.682 18.684  1.00 41.41  ? 145  A   0 "O5'" 1 
ATOM   2851  C  "C5'" . A   A  1  145  ? 77.577  136.314 18.272  1.00 38.09  ? 145  A   0 "C5'" 1 
ATOM   2852  C  "C4'" . A   A  1  145  ? 78.527  135.477 19.085  1.00 36.51  ? 145  A   0 "C4'" 1 
ATOM   2853  O  "O4'" . A   A  1  145  ? 79.896  135.890 18.838  1.00 36.60  ? 145  A   0 "O4'" 1 
ATOM   2854  C  "C3'" . A   A  1  145  ? 78.383  135.568 20.593  1.00 35.26  ? 145  A   0 "C3'" 1 
ATOM   2855  O  "O3'" . A   A  1  145  ? 77.312  134.758 21.052  1.00 33.70  ? 145  A   0 "O3'" 1 
ATOM   2856  C  "C2'" . A   A  1  145  ? 79.736  135.047 21.055  1.00 37.10  ? 145  A   0 "C2'" 1 
ATOM   2857  O  "O2'" . A   A  1  145  ? 79.823  133.637 20.945  1.00 38.70  ? 145  A   0 "O2'" 1 
ATOM   2858  C  "C1'" . A   A  1  145  ? 80.668  135.678 20.012  1.00 37.74  ? 145  A   0 "C1'" 1 
ATOM   2859  N  N9    . A   A  1  145  ? 81.255  136.957 20.434  1.00 36.93  ? 145  A   0 N9    1 
ATOM   2860  C  C8    . A   A  1  145  ? 80.882  138.233 20.081  1.00 37.36  ? 145  A   0 C8    1 
ATOM   2861  N  N7    . A   A  1  145  ? 81.618  139.172 20.629  1.00 36.43  ? 145  A   0 N7    1 
ATOM   2862  C  C5    . A   A  1  145  ? 82.537  138.469 21.394  1.00 37.16  ? 145  A   0 C5    1 
ATOM   2863  C  C6    . A   A  1  145  ? 83.604  138.885 22.213  1.00 37.66  ? 145  A   0 C6    1 
ATOM   2864  N  N6    . A   A  1  145  ? 83.945  140.161 22.394  1.00 37.99  ? 145  A   0 N6    1 
ATOM   2865  N  N1    . A   A  1  145  ? 84.323  137.930 22.840  1.00 36.34  ? 145  A   0 N1    1 
ATOM   2866  C  C2    . A   A  1  145  ? 83.995  136.649 22.642  1.00 35.60  ? 145  A   0 C2    1 
ATOM   2867  N  N3    . A   A  1  145  ? 83.027  136.132 21.889  1.00 35.86  ? 145  A   0 N3    1 
ATOM   2868  C  C4    . A   A  1  145  ? 82.324  137.105 21.287  1.00 36.33  ? 145  A   0 C4    1 
ATOM   2869  P  P     . U   A  1  146  ? 76.331  135.297 22.207  1.00 34.53  ? 146  U   0 P     1 
ATOM   2870  O  OP1   . U   A  1  146  ? 75.100  134.470 22.158  1.00 33.42  ? 146  U   0 OP1   1 
ATOM   2871  O  OP2   . U   A  1  146  ? 76.218  136.774 22.123  1.00 34.37  ? 146  U   0 OP2   1 
ATOM   2872  O  "O5'" . U   A  1  146  ? 77.110  134.941 23.546  1.00 33.82  ? 146  U   0 "O5'" 1 
ATOM   2873  C  "C5'" . U   A  1  146  ? 77.619  133.620 23.773  1.00 34.64  ? 146  U   0 "C5'" 1 
ATOM   2874  C  "C4'" . U   A  1  146  ? 78.653  133.651 24.864  1.00 37.39  ? 146  U   0 "C4'" 1 
ATOM   2875  O  "O4'" . U   A  1  146  ? 79.802  134.407 24.412  1.00 39.72  ? 146  U   0 "O4'" 1 
ATOM   2876  C  "C3'" . U   A  1  146  ? 78.210  134.347 26.142  1.00 37.97  ? 146  U   0 "C3'" 1 
ATOM   2877  O  "O3'" . U   A  1  146  ? 77.491  133.430 26.962  1.00 34.89  ? 146  U   0 "O3'" 1 
ATOM   2878  C  "C2'" . U   A  1  146  ? 79.535  134.793 26.759  1.00 39.38  ? 146  U   0 "C2'" 1 
ATOM   2879  O  "O2'" . U   A  1  146  ? 80.172  133.758 27.480  1.00 38.99  ? 146  U   0 "O2'" 1 
ATOM   2880  C  "C1'" . U   A  1  146  ? 80.368  135.111 25.508  1.00 40.72  ? 146  U   0 "C1'" 1 
ATOM   2881  N  N1    . U   A  1  146  ? 80.524  136.531 25.134  1.00 41.63  ? 146  U   0 N1    1 
ATOM   2882  C  C2    . U   A  1  146  ? 81.496  137.274 25.791  1.00 40.64  ? 146  U   0 C2    1 
ATOM   2883  O  O2    . U   A  1  146  ? 82.210  136.814 26.660  1.00 40.86  ? 146  U   0 O2    1 
ATOM   2884  N  N3    . U   A  1  146  ? 81.603  138.579 25.384  1.00 39.80  ? 146  U   0 N3    1 
ATOM   2885  C  C4    . U   A  1  146  ? 80.865  139.209 24.407  1.00 39.79  ? 146  U   0 C4    1 
ATOM   2886  O  O4    . U   A  1  146  ? 81.092  140.392 24.149  1.00 38.54  ? 146  U   0 O4    1 
ATOM   2887  C  C5    . U   A  1  146  ? 79.881  138.385 23.775  1.00 40.27  ? 146  U   0 C5    1 
ATOM   2888  C  C6    . U   A  1  146  ? 79.743  137.110 24.151  1.00 41.55  ? 146  U   0 C6    1 
ATOM   2889  P  P     . G   A  1  147  ? 76.112  133.876 27.664  1.00 38.10  ? 147  G   0 P     1 
ATOM   2890  O  OP1   . G   A  1  147  ? 75.394  132.631 28.053  1.00 41.03  ? 147  G   0 OP1   1 
ATOM   2891  O  OP2   . G   A  1  147  ? 75.395  134.895 26.864  1.00 36.96  ? 147  G   0 OP2   1 
ATOM   2892  O  "O5'" . G   A  1  147  ? 76.615  134.591 28.990  1.00 38.52  ? 147  G   0 "O5'" 1 
ATOM   2893  C  "C5'" . G   A  1  147  ? 77.684  134.020 29.753  1.00 37.36  ? 147  G   0 "C5'" 1 
ATOM   2894  C  "C4'" . G   A  1  147  ? 78.267  135.045 30.684  1.00 36.91  ? 147  G   0 "C4'" 1 
ATOM   2895  O  "O4'" . G   A  1  147  ? 79.019  136.028 29.921  1.00 37.91  ? 147  G   0 "O4'" 1 
ATOM   2896  C  "C3'" . G   A  1  147  ? 77.252  135.829 31.511  1.00 36.66  ? 147  G   0 "C3'" 1 
ATOM   2897  O  "O3'" . G   A  1  147  ? 77.800  136.062 32.796  1.00 35.87  ? 147  G   0 "O3'" 1 
ATOM   2898  C  "C2'" . G   A  1  147  ? 77.165  137.151 30.761  1.00 36.99  ? 147  G   0 "C2'" 1 
ATOM   2899  O  "O2'" . G   A  1  147  ? 76.761  138.215 31.596  1.00 36.41  ? 147  G   0 "O2'" 1 
ATOM   2900  C  "C1'" . G   A  1  147  ? 78.613  137.317 30.316  1.00 38.01  ? 147  G   0 "C1'" 1 
ATOM   2901  N  N9    . G   A  1  147  ? 78.860  138.258 29.227  1.00 41.45  ? 147  G   0 N9    1 
ATOM   2902  C  C8    . G   A  1  147  ? 79.815  139.246 29.223  1.00 42.24  ? 147  G   0 C8    1 
ATOM   2903  N  N7    . G   A  1  147  ? 79.786  139.983 28.149  1.00 43.58  ? 147  G   0 N7    1 
ATOM   2904  C  C5    . G   A  1  147  ? 78.756  139.449 27.390  1.00 43.26  ? 147  G   0 C5    1 
ATOM   2905  C  C6    . G   A  1  147  ? 78.239  139.856 26.138  1.00 43.13  ? 147  G   0 C6    1 
ATOM   2906  O  O6    . G   A  1  147  ? 78.580  140.811 25.439  1.00 44.51  ? 147  G   0 O6    1 
ATOM   2907  N  N1    . G   A  1  147  ? 77.205  139.032 25.722  1.00 44.02  ? 147  G   0 N1    1 
ATOM   2908  C  C2    . G   A  1  147  ? 76.715  137.966 26.427  1.00 43.42  ? 147  G   0 C2    1 
ATOM   2909  N  N2    . G   A  1  147  ? 75.713  137.298 25.850  1.00 44.03  ? 147  G   0 N2    1 
ATOM   2910  N  N3    . G   A  1  147  ? 77.172  137.586 27.608  1.00 43.22  ? 147  G   0 N3    1 
ATOM   2911  C  C4    . G   A  1  147  ? 78.187  138.367 28.028  1.00 42.72  ? 147  G   0 C4    1 
ATOM   2912  P  P     . A   A  1  148  ? 77.297  135.191 34.037  1.00 34.55  ? 148  A   0 P     1 
ATOM   2913  O  OP1   . A   A  1  148  ? 78.244  135.423 35.153  1.00 33.92  ? 148  A   0 OP1   1 
ATOM   2914  O  OP2   . A   A  1  148  ? 77.059  133.808 33.559  1.00 34.56  ? 148  A   0 OP2   1 
ATOM   2915  O  "O5'" . A   A  1  148  ? 75.902  135.848 34.411  1.00 31.93  ? 148  A   0 "O5'" 1 
ATOM   2916  C  "C5'" . A   A  1  148  ? 75.848  136.999 35.250  1.00 31.88  ? 148  A   0 "C5'" 1 
ATOM   2917  C  "C4'" . A   A  1  148  ? 74.551  137.729 35.041  1.00 33.55  ? 148  A   0 "C4'" 1 
ATOM   2918  O  "O4'" . A   A  1  148  ? 74.413  138.076 33.633  1.00 36.01  ? 148  A   0 "O4'" 1 
ATOM   2919  C  "C3'" . A   A  1  148  ? 73.288  136.940 35.303  1.00 33.36  ? 148  A   0 "C3'" 1 
ATOM   2920  O  "O3'" . A   A  1  148  ? 72.982  136.824 36.675  1.00 33.98  ? 148  A   0 "O3'" 1 
ATOM   2921  C  "C2'" . A   A  1  148  ? 72.265  137.774 34.554  1.00 34.06  ? 148  A   0 "C2'" 1 
ATOM   2922  O  "O2'" . A   A  1  148  ? 71.976  138.973 35.242  1.00 32.62  ? 148  A   0 "O2'" 1 
ATOM   2923  C  "C1'" . A   A  1  148  ? 73.037  138.074 33.270  1.00 32.92  ? 148  A   0 "C1'" 1 
ATOM   2924  N  N9    . A   A  1  148  ? 72.821  137.000 32.301  1.00 30.90  ? 148  A   0 N9    1 
ATOM   2925  C  C8    . A   A  1  148  ? 73.649  135.946 32.020  1.00 30.02  ? 148  A   0 C8    1 
ATOM   2926  N  N7    . A   A  1  148  ? 73.144  135.093 31.166  1.00 30.38  ? 148  A   0 N7    1 
ATOM   2927  C  C5    . A   A  1  148  ? 71.907  135.627 30.852  1.00 28.40  ? 148  A   0 C5    1 
ATOM   2928  C  C6    . A   A  1  148  ? 70.871  135.176 30.025  1.00 30.13  ? 148  A   0 C6    1 
ATOM   2929  N  N6    . A   A  1  148  ? 70.903  134.017 29.364  1.00 31.67  ? 148  A   0 N6    1 
ATOM   2930  N  N1    . A   A  1  148  ? 69.775  135.953 29.913  1.00 30.94  ? 148  A   0 N1    1 
ATOM   2931  C  C2    . A   A  1  148  ? 69.726  137.092 30.613  1.00 30.96  ? 148  A   0 C2    1 
ATOM   2932  N  N3    . A   A  1  148  ? 70.625  137.609 31.444  1.00 30.09  ? 148  A   0 N3    1 
ATOM   2933  C  C4    . A   A  1  148  ? 71.706  136.817 31.520  1.00 29.60  ? 148  A   0 C4    1 
ATOM   2934  P  P     . G   A  1  149  ? 72.028  135.633 37.165  1.00 32.47  ? 149  G   0 P     1 
ATOM   2935  O  OP1   . G   A  1  149  ? 71.912  135.756 38.637  1.00 35.04  ? 149  G   0 OP1   1 
ATOM   2936  O  OP2   . G   A  1  149  ? 72.500  134.360 36.574  1.00 32.61  ? 149  G   0 OP2   1 
ATOM   2937  O  "O5'" . G   A  1  149  ? 70.626  135.991 36.513  1.00 30.84  ? 149  G   0 "O5'" 1 
ATOM   2938  C  "C5'" . G   A  1  149  ? 69.961  137.210 36.848  1.00 31.39  ? 149  G   0 "C5'" 1 
ATOM   2939  C  "C4'" . G   A  1  149  ? 68.639  137.288 36.136  1.00 34.06  ? 149  G   0 "C4'" 1 
ATOM   2940  O  "O4'" . G   A  1  149  ? 68.861  137.178 34.708  1.00 36.11  ? 149  G   0 "O4'" 1 
ATOM   2941  C  "C3'" . G   A  1  149  ? 67.655  136.167 36.411  1.00 34.22  ? 149  G   0 "C3'" 1 
ATOM   2942  O  "O3'" . G   A  1  149  ? 66.962  136.383 37.622  1.00 36.74  ? 149  G   0 "O3'" 1 
ATOM   2943  C  "C2'" . G   A  1  149  ? 66.723  136.276 35.214  1.00 34.47  ? 149  G   0 "C2'" 1 
ATOM   2944  O  "O2'" . G   A  1  149  ? 65.816  137.353 35.353  1.00 31.48  ? 149  G   0 "O2'" 1 
ATOM   2945  C  "C1'" . G   A  1  149  ? 67.719  136.595 34.096  1.00 35.27  ? 149  G   0 "C1'" 1 
ATOM   2946  N  N9    . G   A  1  149  ? 68.144  135.419 33.345  1.00 34.85  ? 149  G   0 N9    1 
ATOM   2947  C  C8    . G   A  1  149  ? 69.354  134.770 33.423  1.00 35.08  ? 149  G   0 C8    1 
ATOM   2948  N  N7    . G   A  1  149  ? 69.439  133.746 32.619  1.00 35.71  ? 149  G   0 N7    1 
ATOM   2949  C  C5    . G   A  1  149  ? 68.210  133.716 31.971  1.00 36.39  ? 149  G   0 C5    1 
ATOM   2950  C  C6    . G   A  1  149  ? 67.706  132.819 30.984  1.00 37.23  ? 149  G   0 C6    1 
ATOM   2951  O  O6    . G   A  1  149  ? 68.263  131.829 30.478  1.00 38.45  ? 149  G   0 O6    1 
ATOM   2952  N  N1    . G   A  1  149  ? 66.414  133.161 30.597  1.00 35.41  ? 149  G   0 N1    1 
ATOM   2953  C  C2    . G   A  1  149  ? 65.692  134.216 31.099  1.00 34.80  ? 149  G   0 C2    1 
ATOM   2954  N  N2    . G   A  1  149  ? 64.468  134.388 30.584  1.00 33.16  ? 149  G   0 N2    1 
ATOM   2955  N  N3    . G   A  1  149  ? 66.140  135.045 32.030  1.00 34.48  ? 149  G   0 N3    1 
ATOM   2956  C  C4    . G   A  1  149  ? 67.399  134.742 32.412  1.00 35.47  ? 149  G   0 C4    1 
ATOM   2957  P  P     . G   A  1  150  ? 66.417  135.129 38.456  1.00 39.51  ? 150  G   0 P     1 
ATOM   2958  O  OP1   . G   A  1  150  ? 65.772  135.680 39.678  1.00 37.11  ? 150  G   0 OP1   1 
ATOM   2959  O  OP2   . G   A  1  150  ? 67.511  134.123 38.582  1.00 38.77  ? 150  G   0 OP2   1 
ATOM   2960  O  "O5'" . G   A  1  150  ? 65.293  134.502 37.520  1.00 39.35  ? 150  G   0 "O5'" 1 
ATOM   2961  C  "C5'" . G   A  1  150  ? 64.061  135.200 37.263  1.00 38.07  ? 150  G   0 "C5'" 1 
ATOM   2962  C  "C4'" . G   A  1  150  ? 63.224  134.422 36.277  1.00 37.93  ? 150  G   0 "C4'" 1 
ATOM   2963  O  "O4'" . G   A  1  150  ? 63.953  134.298 35.035  1.00 38.25  ? 150  G   0 "O4'" 1 
ATOM   2964  C  "C3'" . G   A  1  150  ? 62.920  132.990 36.668  1.00 39.96  ? 150  G   0 "C3'" 1 
ATOM   2965  O  "O3'" . G   A  1  150  ? 61.772  132.941 37.500  1.00 44.67  ? 150  G   0 "O3'" 1 
ATOM   2966  C  "C2'" . G   A  1  150  ? 62.644  132.348 35.317  1.00 39.90  ? 150  G   0 "C2'" 1 
ATOM   2967  O  "O2'" . G   A  1  150  ? 61.364  132.679 34.814  1.00 40.19  ? 150  G   0 "O2'" 1 
ATOM   2968  C  "C1'" . G   A  1  150  ? 63.685  133.042 34.445  1.00 38.28  ? 150  G   0 "C1'" 1 
ATOM   2969  N  N9    . G   A  1  150  ? 64.943  132.313 34.334  1.00 37.38  ? 150  G   0 N9    1 
ATOM   2970  C  C8    . G   A  1  150  ? 66.063  132.473 35.111  1.00 37.29  ? 150  G   0 C8    1 
ATOM   2971  N  N7    . G   A  1  150  ? 67.045  131.690 34.761  1.00 37.59  ? 150  G   0 N7    1 
ATOM   2972  C  C5    . G   A  1  150  ? 66.541  130.964 33.693  1.00 37.10  ? 150  G   0 C5    1 
ATOM   2973  C  C6    . G   A  1  150  ? 67.147  129.964 32.904  1.00 38.55  ? 150  G   0 C6    1 
ATOM   2974  O  O6    . G   A  1  150  ? 68.292  129.506 32.990  1.00 42.29  ? 150  G   0 O6    1 
ATOM   2975  N  N1    . G   A  1  150  ? 66.282  129.488 31.926  1.00 38.27  ? 150  G   0 N1    1 
ATOM   2976  C  C2    . G   A  1  150  ? 65.000  129.922 31.732  1.00 37.28  ? 150  G   0 C2    1 
ATOM   2977  N  N2    . G   A  1  150  ? 64.326  129.340 30.731  1.00 36.31  ? 150  G   0 N2    1 
ATOM   2978  N  N3    . G   A  1  150  ? 64.420  130.858 32.462  1.00 37.31  ? 150  G   0 N3    1 
ATOM   2979  C  C4    . G   A  1  150  ? 65.245  131.332 33.419  1.00 37.02  ? 150  G   0 C4    1 
ATOM   2980  P  P     . A   A  1  151  ? 61.927  132.676 39.077  1.00 48.27  ? 151  A   0 P     1 
ATOM   2981  O  OP1   . A   A  1  151  ? 61.256  133.844 39.710  1.00 45.97  ? 151  A   0 OP1   1 
ATOM   2982  O  OP2   . A   A  1  151  ? 63.334  132.343 39.442  1.00 46.40  ? 151  A   0 OP2   1 
ATOM   2983  O  "O5'" . A   A  1  151  ? 61.055  131.366 39.320  1.00 49.42  ? 151  A   0 "O5'" 1 
ATOM   2984  C  "C5'" . A   A  1  151  ? 60.189  131.236 40.465  1.00 49.32  ? 151  A   0 "C5'" 1 
ATOM   2985  C  "C4'" . A   A  1  151  ? 59.239  130.088 40.254  1.00 47.99  ? 151  A   0 "C4'" 1 
ATOM   2986  O  "O4'" . A   A  1  151  ? 58.408  130.372 39.102  1.00 47.84  ? 151  A   0 "O4'" 1 
ATOM   2987  C  "C3'" . A   A  1  151  ? 59.933  128.783 39.918  1.00 47.91  ? 151  A   0 "C3'" 1 
ATOM   2988  O  "O3'" . A   A  1  151  ? 60.312  128.118 41.120  1.00 46.68  ? 151  A   0 "O3'" 1 
ATOM   2989  C  "C2'" . A   A  1  151  ? 58.877  128.040 39.102  1.00 48.07  ? 151  A   0 "C2'" 1 
ATOM   2990  O  "O2'" . A   A  1  151  ? 57.879  127.424 39.888  1.00 50.26  ? 151  A   0 "O2'" 1 
ATOM   2991  C  "C1'" . A   A  1  151  ? 58.222  129.192 38.340  1.00 47.91  ? 151  A   0 "C1'" 1 
ATOM   2992  N  N9    . A   A  1  151  ? 58.735  129.435 36.991  1.00 47.35  ? 151  A   0 N9    1 
ATOM   2993  C  C8    . A   A  1  151  ? 59.534  130.473 36.580  1.00 47.16  ? 151  A   0 C8    1 
ATOM   2994  N  N7    . A   A  1  151  ? 59.781  130.473 35.295  1.00 47.11  ? 151  A   0 N7    1 
ATOM   2995  C  C5    . A   A  1  151  ? 59.110  129.355 34.827  1.00 46.31  ? 151  A   0 C5    1 
ATOM   2996  C  C6    . A   A  1  151  ? 58.965  128.817 33.544  1.00 45.93  ? 151  A   0 C6    1 
ATOM   2997  N  N6    . A   A  1  151  ? 59.487  129.372 32.448  1.00 44.05  ? 151  A   0 N6    1 
ATOM   2998  N  N1    . A   A  1  151  ? 58.247  127.681 33.419  1.00 45.77  ? 151  A   0 N1    1 
ATOM   2999  C  C2    . A   A  1  151  ? 57.702  127.145 34.516  1.00 45.48  ? 151  A   0 C2    1 
ATOM   3000  N  N3    . A   A  1  151  ? 57.751  127.569 35.772  1.00 46.22  ? 151  A   0 N3    1 
ATOM   3001  C  C4    . A   A  1  151  ? 58.479  128.693 35.863  1.00 46.43  ? 151  A   0 C4    1 
ATOM   3002  P  P     . A   A  1  152  ? 61.860  127.800 41.408  1.00 46.98  ? 152  A   0 P     1 
ATOM   3003  O  OP1   . A   A  1  152  ? 62.008  127.773 42.884  1.00 48.53  ? 152  A   0 OP1   1 
ATOM   3004  O  OP2   . A   A  1  152  ? 62.707  128.712 40.596  1.00 48.48  ? 152  A   0 OP2   1 
ATOM   3005  O  "O5'" . A   A  1  152  ? 62.064  126.307 40.892  1.00 43.84  ? 152  A   0 "O5'" 1 
ATOM   3006  C  "C5'" . A   A  1  152  ? 61.353  125.236 41.518  1.00 41.45  ? 152  A   0 "C5'" 1 
ATOM   3007  C  "C4'" . A   A  1  152  ? 60.588  124.442 40.491  1.00 41.23  ? 152  A   0 "C4'" 1 
ATOM   3008  O  "O4'" . A   A  1  152  ? 59.975  125.349 39.541  1.00 40.20  ? 152  A   0 "O4'" 1 
ATOM   3009  C  "C3'" . A   A  1  152  ? 61.401  123.495 39.627  1.00 40.51  ? 152  A   0 "C3'" 1 
ATOM   3010  O  "O3'" . A   A  1  152  ? 61.591  122.262 40.309  1.00 40.82  ? 152  A   0 "O3'" 1 
ATOM   3011  C  "C2'" . A   A  1  152  ? 60.501  123.326 38.413  1.00 40.13  ? 152  A   0 "C2'" 1 
ATOM   3012  O  "O2'" . A   A  1  152  ? 59.430  122.442 38.687  1.00 39.50  ? 152  A   0 "O2'" 1 
ATOM   3013  C  "C1'" . A   A  1  152  ? 59.940  124.742 38.261  1.00 40.30  ? 152  A   0 "C1'" 1 
ATOM   3014  N  N9    . A   A  1  152  ? 60.677  125.595 37.327  1.00 40.27  ? 152  A   0 N9    1 
ATOM   3015  C  C8    . A   A  1  152  ? 61.558  126.609 37.613  1.00 38.76  ? 152  A   0 C8    1 
ATOM   3016  N  N7    . A   A  1  152  ? 62.022  127.221 36.552  1.00 37.77  ? 152  A   0 N7    1 
ATOM   3017  C  C5    . A   A  1  152  ? 61.417  126.558 35.494  1.00 38.76  ? 152  A   0 C5    1 
ATOM   3018  C  C6    . A   A  1  152  ? 61.488  126.731 34.103  1.00 38.04  ? 152  A   0 C6    1 
ATOM   3019  N  N6    . A   A  1  152  ? 62.232  127.665 33.508  1.00 39.15  ? 152  A   0 N6    1 
ATOM   3020  N  N1    . A   A  1  152  ? 60.758  125.905 33.331  1.00 35.81  ? 152  A   0 N1    1 
ATOM   3021  C  C2    . A   A  1  152  ? 60.014  124.975 33.919  1.00 37.24  ? 152  A   0 C2    1 
ATOM   3022  N  N3    . A   A  1  152  ? 59.862  124.709 35.209  1.00 39.14  ? 152  A   0 N3    1 
ATOM   3023  C  C4    . A   A  1  152  ? 60.597  125.548 35.955  1.00 39.88  ? 152  A   0 C4    1 
ATOM   3024  P  P     . C   A  1  153  ? 62.798  121.297 39.892  1.00 42.35  ? 153  C   0 P     1 
ATOM   3025  O  OP1   . C   A  1  153  ? 62.735  120.121 40.790  1.00 41.67  ? 153  C   0 OP1   1 
ATOM   3026  O  OP2   . C   A  1  153  ? 64.037  122.110 39.829  1.00 41.85  ? 153  C   0 OP2   1 
ATOM   3027  O  "O5'" . C   A  1  153  ? 62.418  120.818 38.421  1.00 40.98  ? 153  C   0 "O5'" 1 
ATOM   3028  C  "C5'" . C   A  1  153  ? 61.202  120.086 38.178  1.00 38.58  ? 153  C   0 "C5'" 1 
ATOM   3029  C  "C4'" . C   A  1  153  ? 60.965  119.935 36.696  1.00 37.17  ? 153  C   0 "C4'" 1 
ATOM   3030  O  "O4'" . C   A  1  153  ? 60.710  121.233 36.104  1.00 37.72  ? 153  C   0 "O4'" 1 
ATOM   3031  C  "C3'" . C   A  1  153  ? 62.139  119.390 35.904  1.00 37.08  ? 153  C   0 "C3'" 1 
ATOM   3032  O  "O3'" . C   A  1  153  ? 62.194  117.977 35.958  1.00 35.97  ? 153  C   0 "O3'" 1 
ATOM   3033  C  "C2'" . C   A  1  153  ? 61.843  119.891 34.501  1.00 37.32  ? 153  C   0 "C2'" 1 
ATOM   3034  O  "O2'" . C   A  1  153  ? 60.857  119.111 33.866  1.00 39.65  ? 153  C   0 "O2'" 1 
ATOM   3035  C  "C1'" . C   A  1  153  ? 61.264  121.274 34.797  1.00 38.04  ? 153  C   0 "C1'" 1 
ATOM   3036  N  N1    . C   A  1  153  ? 62.262  122.361 34.735  1.00 38.56  ? 153  C   0 N1    1 
ATOM   3037  C  C2    . C   A  1  153  ? 62.516  122.973 33.505  1.00 37.63  ? 153  C   0 C2    1 
ATOM   3038  O  O2    . C   A  1  153  ? 61.932  122.562 32.495  1.00 37.56  ? 153  C   0 O2    1 
ATOM   3039  N  N3    . C   A  1  153  ? 63.392  123.996 33.446  1.00 37.64  ? 153  C   0 N3    1 
ATOM   3040  C  C4    . C   A  1  153  ? 64.012  124.407 34.548  1.00 36.84  ? 153  C   0 C4    1 
ATOM   3041  N  N4    . C   A  1  153  ? 64.849  125.436 34.441  1.00 37.94  ? 153  C   0 N4    1 
ATOM   3042  C  C5    . C   A  1  153  ? 63.796  123.788 35.808  1.00 37.19  ? 153  C   0 C5    1 
ATOM   3043  C  C6    . C   A  1  153  ? 62.923  122.779 35.857  1.00 38.56  ? 153  C   0 C6    1 
ATOM   3044  P  P     . C   A  1  154  ? 63.597  117.252 36.230  1.00 39.10  ? 154  C   0 P     1 
ATOM   3045  O  OP1   . C   A  1  154  ? 63.349  115.790 36.288  1.00 39.86  ? 154  C   0 OP1   1 
ATOM   3046  O  OP2   . C   A  1  154  ? 64.252  117.931 37.378  1.00 39.69  ? 154  C   0 OP2   1 
ATOM   3047  O  "O5'" . C   A  1  154  ? 64.454  117.565 34.925  1.00 36.87  ? 154  C   0 "O5'" 1 
ATOM   3048  C  "C5'" . C   A  1  154  ? 63.968  117.237 33.610  1.00 31.52  ? 154  C   0 "C5'" 1 
ATOM   3049  C  "C4'" . C   A  1  154  ? 65.009  117.596 32.582  1.00 30.97  ? 154  C   0 "C4'" 1 
ATOM   3050  O  "O4'" . C   A  1  154  ? 65.131  119.037 32.474  1.00 29.81  ? 154  C   0 "O4'" 1 
ATOM   3051  C  "C3'" . C   A  1  154  ? 66.404  117.126 32.943  1.00 29.67  ? 154  C   0 "C3'" 1 
ATOM   3052  O  "O3'" . C   A  1  154  ? 66.601  115.789 32.545  1.00 26.71  ? 154  C   0 "O3'" 1 
ATOM   3053  C  "C2'" . C   A  1  154  ? 67.296  118.089 32.182  1.00 30.41  ? 154  C   0 "C2'" 1 
ATOM   3054  O  "O2'" . C   A  1  154  ? 67.449  117.723 30.836  1.00 35.21  ? 154  C   0 "O2'" 1 
ATOM   3055  C  "C1'" . C   A  1  154  ? 66.489  119.385 32.269  1.00 30.94  ? 154  C   0 "C1'" 1 
ATOM   3056  N  N1    . C   A  1  154  ? 66.922  120.278 33.360  1.00 32.56  ? 154  C   0 N1    1 
ATOM   3057  C  C2    . C   A  1  154  ? 68.144  120.959 33.236  1.00 33.17  ? 154  C   0 C2    1 
ATOM   3058  O  O2    . C   A  1  154  ? 68.823  120.795 32.214  1.00 33.10  ? 154  C   0 O2    1 
ATOM   3059  N  N3    . C   A  1  154  ? 68.548  121.778 34.229  1.00 34.63  ? 154  C   0 N3    1 
ATOM   3060  C  C4    . C   A  1  154  ? 67.781  121.944 35.310  1.00 35.37  ? 154  C   0 C4    1 
ATOM   3061  N  N4    . C   A  1  154  ? 68.206  122.779 36.258  1.00 32.96  ? 154  C   0 N4    1 
ATOM   3062  C  C5    . C   A  1  154  ? 66.539  121.265 35.464  1.00 36.00  ? 154  C   0 C5    1 
ATOM   3063  C  C6    . C   A  1  154  ? 66.152  120.449 34.477  1.00 33.76  ? 154  C   0 C6    1 
ATOM   3064  P  P     . C   A  1  155  ? 67.631  114.878 33.347  1.00 29.44  ? 155  C   0 P     1 
ATOM   3065  O  OP1   . C   A  1  155  ? 67.475  113.481 32.887  1.00 28.30  ? 155  C   0 OP1   1 
ATOM   3066  O  OP2   . C   A  1  155  ? 67.518  115.198 34.793  1.00 31.31  ? 155  C   0 OP2   1 
ATOM   3067  O  "O5'" . C   A  1  155  ? 69.043  115.397 32.852  1.00 31.78  ? 155  C   0 "O5'" 1 
ATOM   3068  C  "C5'" . C   A  1  155  ? 69.424  115.258 31.489  1.00 30.28  ? 155  C   0 "C5'" 1 
ATOM   3069  C  "C4'" . C   A  1  155  ? 70.731  115.953 31.250  1.00 29.58  ? 155  C   0 "C4'" 1 
ATOM   3070  O  "O4'" . C   A  1  155  ? 70.565  117.385 31.407  1.00 29.18  ? 155  C   0 "O4'" 1 
ATOM   3071  C  "C3'" . C   A  1  155  ? 71.862  115.625 32.206  1.00 27.06  ? 155  C   0 "C3'" 1 
ATOM   3072  O  "O3'" . C   A  1  155  ? 72.478  114.388 31.876  1.00 27.14  ? 155  C   0 "O3'" 1 
ATOM   3073  C  "C2'" . C   A  1  155  ? 72.795  116.797 31.953  1.00 28.55  ? 155  C   0 "C2'" 1 
ATOM   3074  O  "O2'" . C   A  1  155  ? 73.459  116.641 30.712  1.00 28.15  ? 155  C   0 "O2'" 1 
ATOM   3075  C  "C1'" . C   A  1  155  ? 71.796  117.952 31.822  1.00 29.46  ? 155  C   0 "C1'" 1 
ATOM   3076  N  N1    . C   A  1  155  ? 71.582  118.708 33.075  1.00 32.72  ? 155  C   0 N1    1 
ATOM   3077  C  C2    . C   A  1  155  ? 72.565  119.624 33.489  1.00 34.05  ? 155  C   0 C2    1 
ATOM   3078  O  O2    . C   A  1  155  ? 73.578  119.771 32.797  1.00 36.06  ? 155  C   0 O2    1 
ATOM   3079  N  N3    . C   A  1  155  ? 72.382  120.322 34.634  1.00 33.72  ? 155  C   0 N3    1 
ATOM   3080  C  C4    . C   A  1  155  ? 71.274  120.139 35.354  1.00 33.95  ? 155  C   0 C4    1 
ATOM   3081  N  N4    . C   A  1  155  ? 71.129  120.857 36.470  1.00 34.54  ? 155  C   0 N4    1 
ATOM   3082  C  C5    . C   A  1  155  ? 70.263  119.216 34.961  1.00 33.18  ? 155  C   0 C5    1 
ATOM   3083  C  C6    . C   A  1  155  ? 70.454  118.529 33.827  1.00 32.89  ? 155  C   0 C6    1 
ATOM   3084  P  P     . C   A  1  156  ? 73.384  113.632 32.963  1.00 28.62  ? 156  C   0 P     1 
ATOM   3085  O  OP1   . C   A  1  156  ? 73.886  112.375 32.383  1.00 26.43  ? 156  C   0 OP1   1 
ATOM   3086  O  OP2   . C   A  1  156  ? 72.627  113.601 34.235  1.00 33.14  ? 156  C   0 OP2   1 
ATOM   3087  O  "O5'" . C   A  1  156  ? 74.635  114.586 33.183  1.00 30.74  ? 156  C   0 "O5'" 1 
ATOM   3088  C  "C5'" . C   A  1  156  ? 75.572  114.823 32.126  1.00 31.20  ? 156  C   0 "C5'" 1 
ATOM   3089  C  "C4'" . C   A  1  156  ? 76.675  115.736 32.598  1.00 31.80  ? 156  C   0 "C4'" 1 
ATOM   3090  O  "O4'" . C   A  1  156  ? 76.152  117.064 32.861  1.00 32.48  ? 156  C   0 "O4'" 1 
ATOM   3091  C  "C3'" . C   A  1  156  ? 77.344  115.367 33.907  1.00 31.66  ? 156  C   0 "C3'" 1 
ATOM   3092  O  "O3'" . C   A  1  156  ? 78.281  114.314 33.751  1.00 33.12  ? 156  C   0 "O3'" 1 
ATOM   3093  C  "C2'" . C   A  1  156  ? 78.010  116.682 34.285  1.00 31.73  ? 156  C   0 "C2'" 1 
ATOM   3094  O  "O2'" . C   A  1  156  ? 79.161  116.944 33.507  1.00 30.18  ? 156  C   0 "O2'" 1 
ATOM   3095  C  "C1'" . C   A  1  156  ? 76.925  117.676 33.882  1.00 33.41  ? 156  C   0 "C1'" 1 
ATOM   3096  N  N1    . C   A  1  156  ? 76.045  118.049 35.003  1.00 36.05  ? 156  C   0 N1    1 
ATOM   3097  C  C2    . C   A  1  156  ? 76.507  118.993 35.924  1.00 37.26  ? 156  C   0 C2    1 
ATOM   3098  O  O2    . C   A  1  156  ? 77.643  119.465 35.779  1.00 38.07  ? 156  C   0 O2    1 
ATOM   3099  N  N3    . C   A  1  156  ? 75.705  119.372 36.944  1.00 38.39  ? 156  C   0 N3    1 
ATOM   3100  C  C4    . C   A  1  156  ? 74.483  118.850 37.063  1.00 38.65  ? 156  C   0 C4    1 
ATOM   3101  N  N4    . C   A  1  156  ? 73.720  119.277 38.072  1.00 38.78  ? 156  C   0 N4    1 
ATOM   3102  C  C5    . C   A  1  156  ? 73.989  117.873 36.149  1.00 37.95  ? 156  C   0 C5    1 
ATOM   3103  C  C6    . C   A  1  156  ? 74.797  117.502 35.145  1.00 37.52  ? 156  C   0 C6    1 
ATOM   3104  P  P     . G   A  1  157  ? 78.821  113.535 35.045  1.00 34.65  ? 157  G   0 P     1 
ATOM   3105  O  OP1   . G   A  1  157  ? 79.624  112.385 34.552  1.00 35.79  ? 157  G   0 OP1   1 
ATOM   3106  O  OP2   . G   A  1  157  ? 77.684  113.300 35.973  1.00 36.59  ? 157  G   0 OP2   1 
ATOM   3107  O  "O5'" . G   A  1  157  ? 79.806  114.566 35.747  1.00 33.99  ? 157  G   0 "O5'" 1 
ATOM   3108  C  "C5'" . G   A  1  157  ? 80.094  114.476 37.151  1.00 32.87  ? 157  G   0 "C5'" 1 
ATOM   3109  C  "C4'" . G   A  1  157  ? 80.705  115.768 37.627  1.00 33.27  ? 157  G   0 "C4'" 1 
ATOM   3110  O  "O4'" . G   A  1  157  ? 79.787  116.851 37.348  1.00 33.83  ? 157  G   0 "O4'" 1 
ATOM   3111  C  "C3'" . G   A  1  157  ? 80.941  115.877 39.118  1.00 33.33  ? 157  G   0 "C3'" 1 
ATOM   3112  O  "O3'" . G   A  1  157  ? 82.145  115.259 39.510  1.00 33.27  ? 157  G   0 "O3'" 1 
ATOM   3113  C  "C2'" . G   A  1  157  ? 80.968  117.378 39.324  1.00 33.68  ? 157  G   0 "C2'" 1 
ATOM   3114  O  "O2'" . G   A  1  157  ? 82.174  117.961 38.869  1.00 34.45  ? 157  G   0 "O2'" 1 
ATOM   3115  C  "C1'" . G   A  1  157  ? 79.834  117.805 38.397  1.00 33.36  ? 157  G   0 "C1'" 1 
ATOM   3116  N  N9    . G   A  1  157  ? 78.531  117.809 39.059  1.00 32.80  ? 157  G   0 N9    1 
ATOM   3117  C  C8    . G   A  1  157  ? 77.411  117.112 38.676  1.00 33.04  ? 157  G   0 C8    1 
ATOM   3118  N  N7    . G   A  1  157  ? 76.390  117.313 39.461  1.00 33.88  ? 157  G   0 N7    1 
ATOM   3119  C  C5    . G   A  1  157  ? 76.864  118.195 40.423  1.00 33.00  ? 157  G   0 C5    1 
ATOM   3120  C  C6    . G   A  1  157  ? 76.211  118.773 41.539  1.00 31.76  ? 157  G   0 C6    1 
ATOM   3121  O  O6    . G   A  1  157  ? 75.048  118.619 41.912  1.00 32.28  ? 157  G   0 O6    1 
ATOM   3122  N  N1    . G   A  1  157  ? 77.059  119.609 42.251  1.00 30.71  ? 157  G   0 N1    1 
ATOM   3123  C  C2    . G   A  1  157  ? 78.365  119.858 41.934  1.00 31.48  ? 157  G   0 C2    1 
ATOM   3124  N  N2    . G   A  1  157  ? 79.018  120.690 42.750  1.00 31.60  ? 157  G   0 N2    1 
ATOM   3125  N  N3    . G   A  1  157  ? 78.987  119.330 40.897  1.00 32.36  ? 157  G   0 N3    1 
ATOM   3126  C  C4    . G   A  1  157  ? 78.182  118.513 40.189  1.00 32.69  ? 157  G   0 C4    1 
ATOM   3127  P  P     . A   A  1  158  ? 82.165  114.396 40.849  1.00 34.15  ? 158  A   0 P     1 
ATOM   3128  O  OP1   . A   A  1  158  ? 83.523  113.812 40.993  1.00 33.15  ? 158  A   0 OP1   1 
ATOM   3129  O  OP2   . A   A  1  158  ? 80.977  113.504 40.808  1.00 33.10  ? 158  A   0 OP2   1 
ATOM   3130  O  "O5'" . A   A  1  158  ? 81.910  115.471 41.996  1.00 32.55  ? 158  A   0 "O5'" 1 
ATOM   3131  C  "C5'" . A   A  1  158  ? 82.948  116.362 42.419  1.00 31.41  ? 158  A   0 "C5'" 1 
ATOM   3132  C  "C4'" . A   A  1  158  ? 82.517  117.119 43.653  1.00 31.36  ? 158  A   0 "C4'" 1 
ATOM   3133  O  "O4'" . A   A  1  158  ? 81.374  117.963 43.355  1.00 29.24  ? 158  A   0 "O4'" 1 
ATOM   3134  C  "C3'" . A   A  1  158  ? 82.026  116.282 44.818  1.00 32.16  ? 158  A   0 "C3'" 1 
ATOM   3135  O  "O3'" . A   A  1  158  ? 83.092  115.722 45.566  1.00 34.62  ? 158  A   0 "O3'" 1 
ATOM   3136  C  "C2'" . A   A  1  158  ? 81.257  117.314 45.627  1.00 31.46  ? 158  A   0 "C2'" 1 
ATOM   3137  O  "O2'" . A   A  1  158  ? 82.116  118.170 46.351  1.00 32.16  ? 158  A   0 "O2'" 1 
ATOM   3138  C  "C1'" . A   A  1  158  ? 80.574  118.107 44.516  1.00 29.73  ? 158  A   0 "C1'" 1 
ATOM   3139  N  N9    . A   A  1  158  ? 79.234  117.595 44.233  1.00 30.59  ? 158  A   0 N9    1 
ATOM   3140  C  C8    . A   A  1  158  ? 78.816  116.798 43.195  1.00 30.60  ? 158  A   0 C8    1 
ATOM   3141  N  N7    . A   A  1  158  ? 77.535  116.516 43.228  1.00 30.28  ? 158  A   0 N7    1 
ATOM   3142  C  C5    . A   A  1  158  ? 77.080  117.169 44.366  1.00 31.48  ? 158  A   0 C5    1 
ATOM   3143  C  C6    . A   A  1  158  ? 75.803  117.280 44.951  1.00 31.73  ? 158  A   0 C6    1 
ATOM   3144  N  N6    . A   A  1  158  ? 74.706  116.709 44.455  1.00 31.57  ? 158  A   0 N6    1 
ATOM   3145  N  N1    . A   A  1  158  ? 75.691  118.013 46.077  1.00 32.35  ? 158  A   0 N1    1 
ATOM   3146  C  C2    . A   A  1  158  ? 76.788  118.593 46.575  1.00 32.63  ? 158  A   0 C2    1 
ATOM   3147  N  N3    . A   A  1  158  ? 78.037  118.568 46.117  1.00 31.87  ? 158  A   0 N3    1 
ATOM   3148  C  C4    . A   A  1  158  ? 78.116  117.833 44.995  1.00 31.00  ? 158  A   0 C4    1 
ATOM   3149  P  P     . G   A  1  159  ? 82.881  114.320 46.313  1.00 35.24  ? 159  G   0 P     1 
ATOM   3150  O  OP1   . G   A  1  159  ? 84.061  114.089 47.193  1.00 34.60  ? 159  G   0 OP1   1 
ATOM   3151  O  OP2   . G   A  1  159  ? 82.506  113.307 45.298  1.00 37.08  ? 159  G   0 OP2   1 
ATOM   3152  O  "O5'" . G   A  1  159  ? 81.598  114.560 47.215  1.00 34.58  ? 159  G   0 "O5'" 1 
ATOM   3153  C  "C5'" . G   A  1  159  ? 81.638  115.469 48.314  1.00 32.41  ? 159  G   0 "C5'" 1 
ATOM   3154  C  "C4'" . G   A  1  159  ? 80.267  115.607 48.916  1.00 31.18  ? 159  G   0 "C4'" 1 
ATOM   3155  O  "O4'" . G   A  1  159  ? 79.350  116.116 47.913  1.00 31.22  ? 159  G   0 "O4'" 1 
ATOM   3156  C  "C3'" . G   A  1  159  ? 79.595  114.323 49.358  1.00 29.57  ? 159  G   0 "C3'" 1 
ATOM   3157  O  "O3'" . G   A  1  159  ? 80.077  113.843 50.596  1.00 29.35  ? 159  G   0 "O3'" 1 
ATOM   3158  C  "C2'" . G   A  1  159  ? 78.138  114.748 49.417  1.00 29.67  ? 159  G   0 "C2'" 1 
ATOM   3159  O  "O2'" . G   A  1  159  ? 77.817  115.517 50.555  1.00 29.11  ? 159  G   0 "O2'" 1 
ATOM   3160  C  "C1'" . G   A  1  159  ? 78.044  115.616 48.165  1.00 30.95  ? 159  G   0 "C1'" 1 
ATOM   3161  N  N9    . G   A  1  159  ? 77.615  114.818 47.019  1.00 32.73  ? 159  G   0 N9    1 
ATOM   3162  C  C8    . G   A  1  159  ? 78.408  114.192 46.084  1.00 30.61  ? 159  G   0 C8    1 
ATOM   3163  N  N7    . G   A  1  159  ? 77.721  113.533 45.193  1.00 30.71  ? 159  G   0 N7    1 
ATOM   3164  C  C5    . G   A  1  159  ? 76.396  113.738 45.556  1.00 30.75  ? 159  G   0 C5    1 
ATOM   3165  C  C6    . G   A  1  159  ? 75.194  113.271 44.960  1.00 30.82  ? 159  G   0 C6    1 
ATOM   3166  O  O6    . G   A  1  159  ? 75.057  112.568 43.957  1.00 29.36  ? 159  G   0 O6    1 
ATOM   3167  N  N1    . G   A  1  159  ? 74.073  113.711 45.657  1.00 31.58  ? 159  G   0 N1    1 
ATOM   3168  C  C2    . G   A  1  159  ? 74.102  114.505 46.782  1.00 31.87  ? 159  G   0 C2    1 
ATOM   3169  N  N2    . G   A  1  159  ? 72.912  114.838 47.315  1.00 30.07  ? 159  G   0 N2    1 
ATOM   3170  N  N3    . G   A  1  159  ? 75.214  114.945 47.342  1.00 30.54  ? 159  G   0 N3    1 
ATOM   3171  C  C4    . G   A  1  159  ? 76.314  114.528 46.681  1.00 30.97  ? 159  G   0 C4    1 
ATOM   3172  P  P     . A   A  1  160  ? 79.495  112.473 51.186  1.00 31.44  ? 160  A   0 P     1 
ATOM   3173  O  OP1   . A   A  1  160  ? 80.391  112.034 52.291  1.00 30.15  ? 160  A   0 OP1   1 
ATOM   3174  O  OP2   . A   A  1  160  ? 79.238  111.555 50.046  1.00 30.47  ? 160  A   0 OP2   1 
ATOM   3175  O  "O5'" . A   A  1  160  ? 78.084  112.920 51.771  1.00 28.17  ? 160  A   0 "O5'" 1 
ATOM   3176  C  "C5'" . A   A  1  160  ? 77.677  112.554 53.090  1.00 24.93  ? 160  A   0 "C5'" 1 
ATOM   3177  C  "C4'" . A   A  1  160  ? 77.608  113.775 53.962  1.00 23.58  ? 160  A   0 "C4'" 1 
ATOM   3178  O  "O4'" . A   A  1  160  ? 76.761  114.772 53.352  1.00 24.37  ? 160  A   0 "O4'" 1 
ATOM   3179  C  "C3'" . A   A  1  160  ? 76.977  113.531 55.310  1.00 24.02  ? 160  A   0 "C3'" 1 
ATOM   3180  O  "O3'" . A   A  1  160  ? 77.923  112.980 56.206  1.00 26.61  ? 160  A   0 "O3'" 1 
ATOM   3181  C  "C2'" . A   A  1  160  ? 76.495  114.915 55.706  1.00 23.53  ? 160  A   0 "C2'" 1 
ATOM   3182  O  "O2'" . A   A  1  160  ? 77.513  115.740 56.229  1.00 22.08  ? 160  A   0 "O2'" 1 
ATOM   3183  C  "C1'" . A   A  1  160  ? 76.037  115.464 54.357  1.00 24.58  ? 160  A   0 "C1'" 1 
ATOM   3184  N  N9    . A   A  1  160  ? 74.607  115.300 54.094  1.00 25.37  ? 160  A   0 N9    1 
ATOM   3185  C  C8    . A   A  1  160  ? 74.020  114.464 53.178  1.00 27.25  ? 160  A   0 C8    1 
ATOM   3186  N  N7    . A   A  1  160  ? 72.715  114.551 53.142  1.00 27.53  ? 160  A   0 N7    1 
ATOM   3187  C  C5    . A   A  1  160  ? 72.420  115.504 54.102  1.00 26.30  ? 160  A   0 C5    1 
ATOM   3188  C  C6    . A   A  1  160  ? 71.203  116.055 54.536  1.00 27.53  ? 160  A   0 C6    1 
ATOM   3189  N  N6    . A   A  1  160  ? 70.013  115.709 54.033  1.00 25.32  ? 160  A   0 N6    1 
ATOM   3190  N  N1    . A   A  1  160  ? 71.252  116.990 55.513  1.00 28.51  ? 160  A   0 N1    1 
ATOM   3191  C  C2    . A   A  1  160  ? 72.452  117.338 56.002  1.00 27.12  ? 160  A   0 C2    1 
ATOM   3192  N  N3    . A   A  1  160  ? 73.662  116.890 55.671  1.00 24.19  ? 160  A   0 N3    1 
ATOM   3193  C  C4    . A   A  1  160  ? 73.575  115.966 54.704  1.00 24.48  ? 160  A   0 C4    1 
ATOM   3194  P  P     . A   A  1  161  ? 77.591  111.597 56.944  1.00 28.77  ? 161  A   0 P     1 
ATOM   3195  O  OP1   . A   A  1  161  ? 78.861  111.125 57.566  1.00 27.07  ? 161  A   0 OP1   1 
ATOM   3196  O  OP2   . A   A  1  161  ? 76.887  110.723 55.971  1.00 27.75  ? 161  A   0 OP2   1 
ATOM   3197  O  "O5'" . A   A  1  161  ? 76.542  112.025 58.071  1.00 25.87  ? 161  A   0 "O5'" 1 
ATOM   3198  C  "C5'" . A   A  1  161  ? 76.934  112.891 59.148  1.00 23.82  ? 161  A   0 "C5'" 1 
ATOM   3199  C  "C4'" . A   A  1  161  ? 75.734  113.606 59.717  1.00 24.63  ? 161  A   0 "C4'" 1 
ATOM   3200  O  "O4'" . A   A  1  161  ? 75.094  114.368 58.669  1.00 26.21  ? 161  A   0 "O4'" 1 
ATOM   3201  C  "C3'" . A   A  1  161  ? 74.606  112.752 60.270  1.00 25.50  ? 161  A   0 "C3'" 1 
ATOM   3202  O  "O3'" . A   A  1  161  ? 74.885  112.300 61.589  1.00 26.49  ? 161  A   0 "O3'" 1 
ATOM   3203  C  "C2'" . A   A  1  161  ? 73.435  113.722 60.235  1.00 24.71  ? 161  A   0 "C2'" 1 
ATOM   3204  O  "O2'" . A   A  1  161  ? 73.487  114.672 61.274  1.00 21.45  ? 161  A   0 "O2'" 1 
ATOM   3205  C  "C1'" . A   A  1  161  ? 73.695  114.440 58.912  1.00 25.76  ? 161  A   0 "C1'" 1 
ATOM   3206  N  N9    . A   A  1  161  ? 72.993  113.809 57.792  1.00 26.26  ? 161  A   0 N9    1 
ATOM   3207  C  C8    . A   A  1  161  ? 73.476  112.905 56.877  1.00 26.24  ? 161  A   0 C8    1 
ATOM   3208  N  N7    . A   A  1  161  ? 72.580  112.504 56.010  1.00 25.50  ? 161  A   0 N7    1 
ATOM   3209  C  C5    . A   A  1  161  ? 71.432  113.192 56.373  1.00 23.77  ? 161  A   0 C5    1 
ATOM   3210  C  C6    . A   A  1  161  ? 70.128  113.195 55.854  1.00 23.09  ? 161  A   0 C6    1 
ATOM   3211  N  N6    . A   A  1  161  ? 69.734  112.460 54.816  1.00 23.11  ? 161  A   0 N6    1 
ATOM   3212  N  N1    . A   A  1  161  ? 69.223  113.987 56.451  1.00 23.94  ? 161  A   0 N1    1 
ATOM   3213  C  C2    . A   A  1  161  ? 69.607  114.723 57.501  1.00 25.83  ? 161  A   0 C2    1 
ATOM   3214  N  N3    . A   A  1  161  ? 70.796  114.803 58.082  1.00 24.74  ? 161  A   0 N3    1 
ATOM   3215  C  C4    . A   A  1  161  ? 71.675  114.004 57.463  1.00 24.47  ? 161  A   0 C4    1 
ATOM   3216  P  P     . C   A  1  162  ? 74.181  110.968 62.137  1.00 26.01  ? 162  C   0 P     1 
ATOM   3217  O  OP1   . C   A  1  162  ? 74.924  110.581 63.355  1.00 23.55  ? 162  C   0 OP1   1 
ATOM   3218  O  OP2   . C   A  1  162  ? 74.039  110.000 61.021  1.00 22.82  ? 162  C   0 OP2   1 
ATOM   3219  O  "O5'" . C   A  1  162  ? 72.737  111.473 62.575  1.00 25.27  ? 162  C   0 "O5'" 1 
ATOM   3220  C  "C5'" . C   A  1  162  ? 72.607  112.389 63.667  1.00 25.60  ? 162  C   0 "C5'" 1 
ATOM   3221  C  "C4'" . C   A  1  162  ? 71.291  113.124 63.608  1.00 24.57  ? 162  C   0 "C4'" 1 
ATOM   3222  O  "O4'" . C   A  1  162  ? 71.087  113.671 62.282  1.00 24.50  ? 162  C   0 "O4'" 1 
ATOM   3223  C  "C3'" . C   A  1  162  ? 70.037  112.307 63.813  1.00 26.05  ? 162  C   0 "C3'" 1 
ATOM   3224  O  "O3'" . C   A  1  162  ? 69.831  111.982 65.176  1.00 27.12  ? 162  C   0 "O3'" 1 
ATOM   3225  C  "C2'" . C   A  1  162  ? 68.979  113.256 63.274  1.00 26.32  ? 162  C   0 "C2'" 1 
ATOM   3226  O  "O2'" . C   A  1  162  ? 68.693  114.326 64.148  1.00 30.72  ? 162  C   0 "O2'" 1 
ATOM   3227  C  "C1'" . C   A  1  162  ? 69.694  113.812 62.043  1.00 25.82  ? 162  C   0 "C1'" 1 
ATOM   3228  N  N1    . C   A  1  162  ? 69.326  113.047 60.839  1.00 25.68  ? 162  C   0 N1    1 
ATOM   3229  C  C2    . C   A  1  162  ? 68.083  113.298 60.241  1.00 25.54  ? 162  C   0 C2    1 
ATOM   3230  O  O2    . C   A  1  162  ? 67.361  114.197 60.701  1.00 25.01  ? 162  C   0 O2    1 
ATOM   3231  N  N3    . C   A  1  162  ? 67.702  112.559 59.177  1.00 26.07  ? 162  C   0 N3    1 
ATOM   3232  C  C4    . C   A  1  162  ? 68.509  111.612 58.699  1.00 26.15  ? 162  C   0 C4    1 
ATOM   3233  N  N4    . C   A  1  162  ? 68.079  110.897 57.660  1.00 28.14  ? 162  C   0 N4    1 
ATOM   3234  C  C5    . C   A  1  162  ? 69.789  111.355 59.267  1.00 26.63  ? 162  C   0 C5    1 
ATOM   3235  C  C6    . C   A  1  162  ? 70.157  112.091 60.324  1.00 26.66  ? 162  C   0 C6    1 
ATOM   3236  P  P     . U   A  1  163  ? 69.796  110.440 65.619  1.00 27.30  ? 163  U   0 P     1 
ATOM   3237  O  OP1   . U   A  1  163  ? 69.314  110.416 67.016  1.00 26.59  ? 163  U   0 OP1   1 
ATOM   3238  O  OP2   . U   A  1  163  ? 71.096  109.830 65.275  1.00 27.53  ? 163  U   0 OP2   1 
ATOM   3239  O  "O5'" . U   A  1  163  ? 68.699  109.781 64.676  1.00 29.39  ? 163  U   0 "O5'" 1 
ATOM   3240  C  "C5'" . U   A  1  163  ? 67.385  110.371 64.546  1.00 30.84  ? 163  U   0 "C5'" 1 
ATOM   3241  C  "C4'" . U   A  1  163  ? 66.653  109.773 63.368  1.00 28.68  ? 163  U   0 "C4'" 1 
ATOM   3242  O  "O4'" . U   A  1  163  ? 67.371  110.058 62.140  1.00 29.50  ? 163  U   0 "O4'" 1 
ATOM   3243  C  "C3'" . U   A  1  163  ? 66.574  108.263 63.377  1.00 29.39  ? 163  U   0 "C3'" 1 
ATOM   3244  O  "O3'" . U   A  1  163  ? 65.574  107.798 64.254  1.00 26.50  ? 163  U   0 "O3'" 1 
ATOM   3245  C  "C2'" . U   A  1  163  ? 66.330  107.936 61.909  1.00 29.73  ? 163  U   0 "C2'" 1 
ATOM   3246  O  "O2'" . U   A  1  163  ? 64.998  108.113 61.469  1.00 32.86  ? 163  U   0 "O2'" 1 
ATOM   3247  C  "C1'" . U   A  1  163  ? 67.220  108.976 61.233  1.00 28.86  ? 163  U   0 "C1'" 1 
ATOM   3248  N  N1    . U   A  1  163  ? 68.547  108.440 60.904  1.00 28.59  ? 163  U   0 N1    1 
ATOM   3249  C  C2    . U   A  1  163  ? 68.638  107.595 59.811  1.00 28.91  ? 163  U   0 C2    1 
ATOM   3250  O  O2    . U   A  1  163  ? 67.675  107.286 59.128  1.00 28.83  ? 163  U   0 O2    1 
ATOM   3251  N  N3    . U   A  1  163  ? 69.895  107.116 59.552  1.00 28.69  ? 163  U   0 N3    1 
ATOM   3252  C  C4    . U   A  1  163  ? 71.042  107.377 60.262  1.00 29.99  ? 163  U   0 C4    1 
ATOM   3253  O  O4    . U   A  1  163  ? 72.090  106.818 59.937  1.00 31.75  ? 163  U   0 O4    1 
ATOM   3254  C  C5    . U   A  1  163  ? 70.869  108.262 61.375  1.00 29.74  ? 163  U   0 C5    1 
ATOM   3255  C  C6    . U   A  1  163  ? 69.659  108.753 61.648  1.00 28.02  ? 163  U   0 C6    1 
ATOM   3256  P  P     . G   A  1  164  ? 65.813  106.437 65.051  1.00 28.30  ? 164  G   0 P     1 
ATOM   3257  O  OP1   . G   A  1  164  ? 64.672  106.331 65.979  1.00 27.95  ? 164  G   0 OP1   1 
ATOM   3258  O  OP2   . G   A  1  164  ? 67.201  106.384 65.577  1.00 27.83  ? 164  G   0 OP2   1 
ATOM   3259  O  "O5'" . G   A  1  164  ? 65.722  105.323 63.922  1.00 28.66  ? 164  G   0 "O5'" 1 
ATOM   3260  C  "C5'" . G   A  1  164  ? 64.564  105.214 63.078  1.00 29.17  ? 164  G   0 "C5'" 1 
ATOM   3261  C  "C4'" . G   A  1  164  ? 64.759  104.114 62.066  1.00 28.88  ? 164  G   0 "C4'" 1 
ATOM   3262  O  "O4'" . G   A  1  164  ? 65.666  104.539 61.015  1.00 30.45  ? 164  G   0 "O4'" 1 
ATOM   3263  C  "C3'" . G   A  1  164  ? 65.428  102.860 62.588  1.00 28.83  ? 164  G   0 "C3'" 1 
ATOM   3264  O  "O3'" . G   A  1  164  ? 64.563  102.066 63.366  1.00 31.39  ? 164  G   0 "O3'" 1 
ATOM   3265  C  "C2'" . G   A  1  164  ? 65.874  102.203 61.296  1.00 28.77  ? 164  G   0 "C2'" 1 
ATOM   3266  O  "O2'" . G   A  1  164  ? 64.788  101.694 60.561  1.00 29.78  ? 164  G   0 "O2'" 1 
ATOM   3267  C  "C1'" . G   A  1  164  ? 66.405  103.415 60.540  1.00 28.53  ? 164  G   0 "C1'" 1 
ATOM   3268  N  N9    . G   A  1  164  ? 67.830  103.635 60.796  1.00 26.74  ? 164  G   0 N9    1 
ATOM   3269  C  C8    . G   A  1  164  ? 68.403  104.641 61.536  1.00 26.04  ? 164  G   0 C8    1 
ATOM   3270  N  N7    . G   A  1  164  ? 69.704  104.584 61.558  1.00 24.93  ? 164  G   0 N7    1 
ATOM   3271  C  C5    . G   A  1  164  ? 70.011  103.476 60.785  1.00 26.04  ? 164  G   0 C5    1 
ATOM   3272  C  C6    . G   A  1  164  ? 71.270  102.928 60.421  1.00 27.46  ? 164  G   0 C6    1 
ATOM   3273  O  O6    . G   A  1  164  ? 72.400  103.338 60.709  1.00 27.53  ? 164  G   0 O6    1 
ATOM   3274  N  N1    . G   A  1  164  ? 71.123  101.791 59.631  1.00 26.40  ? 164  G   0 N1    1 
ATOM   3275  C  C2    . G   A  1  164  ? 69.921  101.259 59.234  1.00 27.37  ? 164  G   0 C2    1 
ATOM   3276  N  N2    . G   A  1  164  ? 69.978  100.164 58.462  1.00 29.17  ? 164  G   0 N2    1 
ATOM   3277  N  N3    . G   A  1  164  ? 68.744  101.767 59.562  1.00 26.49  ? 164  G   0 N3    1 
ATOM   3278  C  C4    . G   A  1  164  ? 68.863  102.867 60.326  1.00 25.33  ? 164  G   0 C4    1 
ATOM   3279  P  P     . A   A  1  165  ? 65.103  101.449 64.741  1.00 31.31  ? 165  A   0 P     1 
ATOM   3280  O  OP1   . A   A  1  165  ? 63.961  100.803 65.425  1.00 30.78  ? 165  A   0 OP1   1 
ATOM   3281  O  OP2   . A   A  1  165  ? 65.853  102.517 65.430  1.00 33.62  ? 165  A   0 OP2   1 
ATOM   3282  O  "O5'" . A   A  1  165  ? 66.124  100.324 64.269  1.00 28.07  ? 165  A   0 "O5'" 1 
ATOM   3283  C  "C5'" . A   A  1  165  ? 65.673  99.250  63.436  1.00 26.81  ? 165  A   0 "C5'" 1 
ATOM   3284  C  "C4'" . A   A  1  165  ? 66.840  98.444  62.926  1.00 26.31  ? 165  A   0 "C4'" 1 
ATOM   3285  O  "O4'" . A   A  1  165  ? 67.693  99.287  62.120  1.00 26.05  ? 165  A   0 "O4'" 1 
ATOM   3286  C  "C3'" . A   A  1  165  ? 67.765  97.831  63.963  1.00 25.90  ? 165  A   0 "C3'" 1 
ATOM   3287  O  "O3'" . A   A  1  165  ? 67.201  96.608  64.443  1.00 26.53  ? 165  A   0 "O3'" 1 
ATOM   3288  C  "C2'" . A   A  1  165  ? 69.044  97.631  63.156  1.00 26.50  ? 165  A   0 "C2'" 1 
ATOM   3289  O  "O2'" . A   A  1  165  ? 68.993  96.494  62.315  1.00 27.70  ? 165  A   0 "O2'" 1 
ATOM   3290  C  "C1'" . A   A  1  165  ? 69.040  98.880  62.271  1.00 26.51  ? 165  A   0 "C1'" 1 
ATOM   3291  N  N9    . A   A  1  165  ? 69.796  100.002 62.825  1.00 26.50  ? 165  A   0 N9    1 
ATOM   3292  C  C8    . A   A  1  165  ? 69.342  100.996 63.659  1.00 27.63  ? 165  A   0 C8    1 
ATOM   3293  N  N7    . A   A  1  165  ? 70.264  101.859 64.002  1.00 27.41  ? 165  A   0 N7    1 
ATOM   3294  C  C5    . A   A  1  165  ? 71.402  101.408 63.348  1.00 25.81  ? 165  A   0 C5    1 
ATOM   3295  C  C6    . A   A  1  165  ? 72.717  101.882 63.313  1.00 23.61  ? 165  A   0 C6    1 
ATOM   3296  N  N6    . A   A  1  165  ? 73.125  102.961 63.974  1.00 27.25  ? 165  A   0 N6    1 
ATOM   3297  N  N1    . A   A  1  165  ? 73.612  101.203 62.570  1.00 21.30  ? 165  A   0 N1    1 
ATOM   3298  C  C2    . A   A  1  165  ? 73.204  100.124 61.910  1.00 22.01  ? 165  A   0 C2    1 
ATOM   3299  N  N3    . A   A  1  165  ? 71.994  99.575  61.859  1.00 25.37  ? 165  A   0 N3    1 
ATOM   3300  C  C4    . A   A  1  165  ? 71.127  100.271 62.613  1.00 26.10  ? 165  A   0 C4    1 
ATOM   3301  P  P     . A   A  1  166  ? 67.980  95.721  65.541  1.00 28.67  ? 166  A   0 P     1 
ATOM   3302  O  OP1   . A   A  1  166  ? 69.417  95.638  65.181  1.00 27.08  ? 166  A   0 OP1   1 
ATOM   3303  O  OP2   . A   A  1  166  ? 67.199  94.469  65.686  1.00 29.03  ? 166  A   0 OP2   1 
ATOM   3304  O  "O5'" . A   A  1  166  ? 67.856  96.556  66.892  1.00 25.14  ? 166  A   0 "O5'" 1 
ATOM   3305  C  "C5'" . A   A  1  166  ? 66.579  96.824  67.494  1.00 23.49  ? 166  A   0 "C5'" 1 
ATOM   3306  C  "C4'" . A   A  1  166  ? 66.306  98.304  67.455  1.00 24.94  ? 166  A   0 "C4'" 1 
ATOM   3307  O  "O4'" . A   A  1  166  ? 64.935  98.537  67.872  1.00 24.18  ? 166  A   0 "O4'" 1 
ATOM   3308  C  "C3'" . A   A  1  166  ? 67.189  99.196  68.336  1.00 25.74  ? 166  A   0 "C3'" 1 
ATOM   3309  O  "O3'" . A   A  1  166  ? 67.630  100.362 67.629  1.00 26.10  ? 166  A   0 "O3'" 1 
ATOM   3310  C  "C2'" . A   A  1  166  ? 66.243  99.597  69.466  1.00 24.68  ? 166  A   0 "C2'" 1 
ATOM   3311  O  "O2'" . A   A  1  166  ? 66.529  100.865 70.018  1.00 22.16  ? 166  A   0 "O2'" 1 
ATOM   3312  C  "C1'" . A   A  1  166  ? 64.898  99.633  68.748  1.00 24.47  ? 166  A   0 "C1'" 1 
ATOM   3313  N  N9    . A   A  1  166  ? 63.760  99.474  69.651  1.00 24.60  ? 166  A   0 N9    1 
ATOM   3314  C  C8    . A   A  1  166  ? 62.665  100.292 69.746  1.00 24.68  ? 166  A   0 C8    1 
ATOM   3315  N  N7    . A   A  1  166  ? 61.819  99.938  70.681  1.00 26.81  ? 166  A   0 N7    1 
ATOM   3316  C  C5    . A   A  1  166  ? 62.388  98.799  71.232  1.00 25.89  ? 166  A   0 C5    1 
ATOM   3317  C  C6    . A   A  1  166  ? 61.980  97.946  72.275  1.00 26.21  ? 166  A   0 C6    1 
ATOM   3318  N  N6    . A   A  1  166  ? 60.857  98.117  72.978  1.00 25.43  ? 166  A   0 N6    1 
ATOM   3319  N  N1    . A   A  1  166  ? 62.778  96.901  72.576  1.00 25.33  ? 166  A   0 N1    1 
ATOM   3320  C  C2    . A   A  1  166  ? 63.906  96.733  71.875  1.00 26.09  ? 166  A   0 C2    1 
ATOM   3321  N  N3    . A   A  1  166  ? 64.395  97.462  70.876  1.00 25.50  ? 166  A   0 N3    1 
ATOM   3322  C  C4    . A   A  1  166  ? 63.579  98.494  70.600  1.00 25.13  ? 166  A   0 C4    1 
ATOM   3323  P  P     . A   A  1  167  ? 69.200  100.552 67.298  1.00 26.91  ? 167  A   0 P     1 
ATOM   3324  O  OP1   . A   A  1  167  ? 69.355  101.897 66.700  1.00 25.96  ? 167  A   0 OP1   1 
ATOM   3325  O  OP2   . A   A  1  167  ? 69.700  99.370  66.562  1.00 26.01  ? 167  A   0 OP2   1 
ATOM   3326  O  "O5'" . A   A  1  167  ? 69.922  100.531 68.717  1.00 24.96  ? 167  A   0 "O5'" 1 
ATOM   3327  C  "C5'" . A   A  1  167  ? 69.861  101.654 69.608  1.00 23.35  ? 167  A   0 "C5'" 1 
ATOM   3328  C  "C4'" . A   A  1  167  ? 71.198  101.853 70.278  1.00 27.00  ? 167  A   0 "C4'" 1 
ATOM   3329  O  "O4'" . A   A  1  167  ? 71.614  100.602 70.894  1.00 29.93  ? 167  A   0 "O4'" 1 
ATOM   3330  C  "C3'" . A   A  1  167  ? 72.367  102.190 69.367  1.00 27.42  ? 167  A   0 "C3'" 1 
ATOM   3331  O  "O3'" . A   A  1  167  ? 72.401  103.571 69.037  1.00 27.62  ? 167  A   0 "O3'" 1 
ATOM   3332  C  "C2'" . A   A  1  167  ? 73.546  101.779 70.234  1.00 28.22  ? 167  A   0 "C2'" 1 
ATOM   3333  O  "O2'" . A   A  1  167  ? 73.752  102.681 71.302  1.00 29.83  ? 167  A   0 "O2'" 1 
ATOM   3334  C  "C1'" . A   A  1  167  ? 73.025  100.468 70.817  1.00 28.01  ? 167  A   0 "C1'" 1 
ATOM   3335  N  N9    . A   A  1  167  ? 73.327  99.342  69.936  1.00 29.46  ? 167  A   0 N9    1 
ATOM   3336  C  C8    . A   A  1  167  ? 72.460  98.629  69.138  1.00 29.49  ? 167  A   0 C8    1 
ATOM   3337  N  N7    . A   A  1  167  ? 73.042  97.694  68.427  1.00 29.92  ? 167  A   0 N7    1 
ATOM   3338  C  C5    . A   A  1  167  ? 74.382  97.790  68.782  1.00 30.81  ? 167  A   0 C5    1 
ATOM   3339  C  C6    . A   A  1  167  ? 75.523  97.085  68.368  1.00 29.97  ? 167  A   0 C6    1 
ATOM   3340  N  N6    . A   A  1  167  ? 75.498  96.102  67.466  1.00 29.56  ? 167  A   0 N6    1 
ATOM   3341  N  N1    . A   A  1  167  ? 76.711  97.432  68.917  1.00 31.22  ? 167  A   0 N1    1 
ATOM   3342  C  C2    . A   A  1  167  ? 76.739  98.422  69.817  1.00 29.99  ? 167  A   0 C2    1 
ATOM   3343  N  N3    . A   A  1  167  ? 75.738  99.161  70.285  1.00 31.39  ? 167  A   0 N3    1 
ATOM   3344  C  C4    . A   A  1  167  ? 74.570  98.793  69.720  1.00 31.38  ? 167  A   0 C4    1 
ATOM   3345  P  P     . C   A  1  168  ? 72.557  104.019 67.501  1.00 27.16  ? 168  C   0 P     1 
ATOM   3346  O  OP1   . C   A  1  168  ? 72.593  105.504 67.500  1.00 26.47  ? 168  C   0 OP1   1 
ATOM   3347  O  OP2   . C   A  1  168  ? 71.553  103.309 66.674  1.00 25.16  ? 168  C   0 OP2   1 
ATOM   3348  O  "O5'" . C   A  1  168  ? 73.981  103.462 67.074  1.00 23.79  ? 168  C   0 "O5'" 1 
ATOM   3349  C  "C5'" . C   A  1  168  ? 75.174  103.874 67.742  1.00 22.77  ? 168  C   0 "C5'" 1 
ATOM   3350  C  "C4'" . C   A  1  168  ? 76.317  103.032 67.269  1.00 23.05  ? 168  C   0 "C4'" 1 
ATOM   3351  O  "O4'" . C   A  1  168  ? 76.047  101.659 67.633  1.00 24.50  ? 168  C   0 "O4'" 1 
ATOM   3352  C  "C3'" . C   A  1  168  ? 76.464  103.006 65.759  1.00 24.51  ? 168  C   0 "C3'" 1 
ATOM   3353  O  "O3'" . C   A  1  168  ? 77.262  104.088 65.309  1.00 26.07  ? 168  C   0 "O3'" 1 
ATOM   3354  C  "C2'" . C   A  1  168  ? 77.108  101.656 65.509  1.00 24.88  ? 168  C   0 "C2'" 1 
ATOM   3355  O  "O2'" . C   A  1  168  ? 78.496  101.688 65.764  1.00 24.96  ? 168  C   0 "O2'" 1 
ATOM   3356  C  "C1'" . C   A  1  168  ? 76.401  100.799 66.562  1.00 25.72  ? 168  C   0 "C1'" 1 
ATOM   3357  N  N1    . C   A  1  168  ? 75.170  100.118 66.094  1.00 26.55  ? 168  C   0 N1    1 
ATOM   3358  C  C2    . C   A  1  168  ? 75.285  98.967  65.301  1.00 26.43  ? 168  C   0 C2    1 
ATOM   3359  O  O2    . C   A  1  168  ? 76.410  98.591  64.946  1.00 26.05  ? 168  C   0 O2    1 
ATOM   3360  N  N3    . C   A  1  168  ? 74.163  98.299  64.936  1.00 25.72  ? 168  C   0 N3    1 
ATOM   3361  C  C4    . C   A  1  168  ? 72.965  98.748  65.318  1.00 25.46  ? 168  C   0 C4    1 
ATOM   3362  N  N4    . C   A  1  168  ? 71.892  98.042  64.964  1.00 24.24  ? 168  C   0 N4    1 
ATOM   3363  C  C5    . C   A  1  168  ? 72.816  99.938  66.088  1.00 25.66  ? 168  C   0 C5    1 
ATOM   3364  C  C6    . C   A  1  168  ? 73.930  100.585 66.449  1.00 26.47  ? 168  C   0 C6    1 
ATOM   3365  P  P     . A   A  1  169  ? 77.230  104.521 63.766  1.00 26.41  ? 169  A   0 P     1 
ATOM   3366  O  OP1   . A   A  1  169  ? 77.675  105.922 63.743  1.00 28.28  ? 169  A   0 OP1   1 
ATOM   3367  O  OP2   . A   A  1  169  ? 75.932  104.167 63.160  1.00 27.43  ? 169  A   0 OP2   1 
ATOM   3368  O  "O5'" . A   A  1  169  ? 78.329  103.585 63.101  1.00 26.18  ? 169  A   0 "O5'" 1 
ATOM   3369  C  "C5'" . A   A  1  169  ? 79.673  104.043 62.923  1.00 26.19  ? 169  A   0 "C5'" 1 
ATOM   3370  C  "C4'" . A   A  1  169  ? 80.502  102.994 62.223  1.00 28.42  ? 169  A   0 "C4'" 1 
ATOM   3371  O  "O4'" . A   A  1  169  ? 80.993  102.038 63.194  1.00 27.25  ? 169  A   0 "O4'" 1 
ATOM   3372  C  "C3'" . A   A  1  169  ? 79.821  102.185 61.117  1.00 27.87  ? 169  A   0 "C3'" 1 
ATOM   3373  O  "O3'" . A   A  1  169  ? 80.629  102.154 59.954  1.00 27.40  ? 169  A   0 "O3'" 1 
ATOM   3374  C  "C2'" . A   A  1  169  ? 79.723  100.783 61.718  1.00 28.94  ? 169  A   0 "C2'" 1 
ATOM   3375  O  "O2'" . A   A  1  169  ? 79.821  99.774  60.729  1.00 29.58  ? 169  A   0 "O2'" 1 
ATOM   3376  C  "C1'" . A   A  1  169  ? 80.941  100.750 62.637  1.00 27.46  ? 169  A   0 "C1'" 1 
ATOM   3377  N  N9    . A   A  1  169  ? 80.874  99.793  63.741  1.00 29.51  ? 169  A   0 N9    1 
ATOM   3378  C  C8    . A   A  1  169  ? 79.852  98.955  64.100  1.00 31.32  ? 169  A   0 C8    1 
ATOM   3379  N  N7    . A   A  1  169  ? 80.120  98.211  65.145  1.00 32.56  ? 169  A   0 N7    1 
ATOM   3380  C  C5    . A   A  1  169  ? 81.405  98.584  65.498  1.00 31.78  ? 169  A   0 C5    1 
ATOM   3381  C  C6    . A   A  1  169  ? 82.263  98.157  66.518  1.00 32.63  ? 169  A   0 C6    1 
ATOM   3382  N  N6    . A   A  1  169  ? 81.954  97.210  67.397  1.00 33.20  ? 169  A   0 N6    1 
ATOM   3383  N  N1    . A   A  1  169  ? 83.475  98.739  66.603  1.00 35.10  ? 169  A   0 N1    1 
ATOM   3384  C  C2    . A   A  1  169  ? 83.800  99.674  65.707  1.00 33.31  ? 169  A   0 C2    1 
ATOM   3385  N  N3    . A   A  1  169  ? 83.086  100.151 64.696  1.00 33.49  ? 169  A   0 N3    1 
ATOM   3386  C  C4    . A   A  1  169  ? 81.881  99.559  64.647  1.00 32.05  ? 169  A   0 C4    1 
ATOM   3387  P  P     . U   A  1  170  ? 80.122  102.900 58.627  1.00 28.36  ? 170  U   0 P     1 
ATOM   3388  O  OP1   . U   A  1  170  ? 81.246  103.736 58.152  1.00 28.18  ? 170  U   0 OP1   1 
ATOM   3389  O  OP2   . U   A  1  170  ? 78.822  103.533 58.932  1.00 27.11  ? 170  U   0 OP2   1 
ATOM   3390  O  "O5'" . U   A  1  170  ? 79.867  101.728 57.577  1.00 29.44  ? 170  U   0 "O5'" 1 
ATOM   3391  C  "C5'" . U   A  1  170  ? 80.961  101.043 56.937  1.00 30.02  ? 170  U   0 "C5'" 1 
ATOM   3392  C  "C4'" . U   A  1  170  ? 80.484  99.754  56.307  1.00 32.30  ? 170  U   0 "C4'" 1 
ATOM   3393  O  "O4'" . U   A  1  170  ? 80.120  98.794  57.336  1.00 34.82  ? 170  U   0 "O4'" 1 
ATOM   3394  C  "C3'" . U   A  1  170  ? 79.233  99.833  55.446  1.00 32.13  ? 170  U   0 "C3'" 1 
ATOM   3395  O  "O3'" . U   A  1  170  ? 79.485  100.335 54.143  1.00 31.21  ? 170  U   0 "O3'" 1 
ATOM   3396  C  "C2'" . U   A  1  170  ? 78.779  98.379  55.410  1.00 33.18  ? 170  U   0 "C2'" 1 
ATOM   3397  O  "O2'" . U   A  1  170  ? 79.484  97.561  54.505  1.00 34.42  ? 170  U   0 "O2'" 1 
ATOM   3398  C  "C1'" . U   A  1  170  ? 79.113  97.922  56.830  1.00 35.61  ? 170  U   0 "C1'" 1 
ATOM   3399  N  N1    . U   A  1  170  ? 77.920  97.977  57.689  1.00 36.31  ? 170  U   0 N1    1 
ATOM   3400  C  C2    . U   A  1  170  ? 76.949  97.016  57.473  1.00 35.99  ? 170  U   0 C2    1 
ATOM   3401  O  O2    . U   A  1  170  ? 77.072  96.121  56.660  1.00 36.08  ? 170  U   0 O2    1 
ATOM   3402  N  N3    . U   A  1  170  ? 75.832  97.138  58.251  1.00 36.50  ? 170  U   0 N3    1 
ATOM   3403  C  C4    . U   A  1  170  ? 75.599  98.080  59.217  1.00 35.58  ? 170  U   0 C4    1 
ATOM   3404  O  O4    . U   A  1  170  ? 74.567  98.018  59.871  1.00 37.30  ? 170  U   0 O4    1 
ATOM   3405  C  C5    . U   A  1  170  ? 76.654  99.025  59.402  1.00 36.04  ? 170  U   0 C5    1 
ATOM   3406  C  C6    . U   A  1  170  ? 77.752  98.944  58.650  1.00 36.01  ? 170  U   0 C6    1 
ATOM   3407  P  P     . C   A  1  171  ? 78.421  101.323 53.455  1.00 31.65  ? 171  C   0 P     1 
ATOM   3408  O  OP1   . C   A  1  171  ? 78.707  101.378 52.001  1.00 31.84  ? 171  C   0 OP1   1 
ATOM   3409  O  OP2   . C   A  1  171  ? 78.397  102.568 54.247  1.00 33.27  ? 171  C   0 OP2   1 
ATOM   3410  O  "O5'" . C   A  1  171  ? 77.011  100.620 53.660  1.00 30.53  ? 171  C   0 "O5'" 1 
ATOM   3411  C  "C5'" . C   A  1  171  ? 76.690  99.391  53.008  1.00 30.00  ? 171  C   0 "C5'" 1 
ATOM   3412  C  "C4'" . C   A  1  171  ? 75.391  98.853  53.546  1.00 30.51  ? 171  C   0 "C4'" 1 
ATOM   3413  O  "O4'" . C   A  1  171  ? 75.539  98.546  54.957  1.00 31.50  ? 171  C   0 "O4'" 1 
ATOM   3414  C  "C3'" . C   A  1  171  ? 74.228  99.825  53.513  1.00 30.45  ? 171  C   0 "C3'" 1 
ATOM   3415  O  "O3'" . C   A  1  171  ? 73.636  99.860  52.233  1.00 31.53  ? 171  C   0 "O3'" 1 
ATOM   3416  C  "C2'" . C   A  1  171  ? 73.306  99.239  54.564  1.00 31.01  ? 171  C   0 "C2'" 1 
ATOM   3417  O  "O2'" . C   A  1  171  ? 72.650  98.084  54.093  1.00 33.93  ? 171  C   0 "O2'" 1 
ATOM   3418  C  "C1'" . C   A  1  171  ? 74.316  98.807  55.629  1.00 32.76  ? 171  C   0 "C1'" 1 
ATOM   3419  N  N1    . C   A  1  171  ? 74.534  99.863  56.637  1.00 33.72  ? 171  C   0 N1    1 
ATOM   3420  C  C2    . C   A  1  171  ? 73.536  100.089 57.590  1.00 34.78  ? 171  C   0 C2    1 
ATOM   3421  O  O2    . C   A  1  171  ? 72.540  99.360  57.597  1.00 36.16  ? 171  C   0 O2    1 
ATOM   3422  N  N3    . C   A  1  171  ? 73.685  101.093 58.482  1.00 35.53  ? 171  C   0 N3    1 
ATOM   3423  C  C4    . C   A  1  171  ? 74.784  101.848 58.457  1.00 34.61  ? 171  C   0 C4    1 
ATOM   3424  N  N4    . C   A  1  171  ? 74.873  102.841 59.341  1.00 33.39  ? 171  C   0 N4    1 
ATOM   3425  C  C5    . C   A  1  171  ? 75.835  101.621 57.518  1.00 33.18  ? 171  C   0 C5    1 
ATOM   3426  C  C6    . C   A  1  171  ? 75.670  100.628 56.635  1.00 33.58  ? 171  C   0 C6    1 
ATOM   3427  P  P     . U   A  1  172  ? 73.059  101.240 51.664  1.00 34.03  ? 172  U   0 P     1 
ATOM   3428  O  OP1   . U   A  1  172  ? 72.356  100.934 50.389  1.00 35.00  ? 172  U   0 OP1   1 
ATOM   3429  O  OP2   . U   A  1  172  ? 74.142  102.252 51.677  1.00 35.08  ? 172  U   0 OP2   1 
ATOM   3430  O  "O5'" . U   A  1  172  ? 71.973  101.659 52.742  1.00 31.89  ? 172  U   0 "O5'" 1 
ATOM   3431  C  "C5'" . U   A  1  172  ? 70.816  100.851 52.954  1.00 30.73  ? 172  U   0 "C5'" 1 
ATOM   3432  C  "C4'" . U   A  1  172  ? 69.927  101.489 53.978  1.00 28.36  ? 172  U   0 "C4'" 1 
ATOM   3433  O  "O4'" . U   A  1  172  ? 70.615  101.543 55.246  1.00 29.60  ? 172  U   0 "O4'" 1 
ATOM   3434  C  "C3'" . U   A  1  172  ? 69.567  102.932 53.697  1.00 27.22  ? 172  U   0 "C3'" 1 
ATOM   3435  O  "O3'" . U   A  1  172  ? 68.486  102.984 52.789  1.00 28.97  ? 172  U   0 "O3'" 1 
ATOM   3436  C  "C2'" . U   A  1  172  ? 69.190  103.434 55.080  1.00 27.21  ? 172  U   0 "C2'" 1 
ATOM   3437  O  "O2'" . U   A  1  172  ? 67.923  102.983 55.485  1.00 27.43  ? 172  U   0 "O2'" 1 
ATOM   3438  C  "C1'" . U   A  1  172  ? 70.215  102.707 55.946  1.00 28.83  ? 172  U   0 "C1'" 1 
ATOM   3439  N  N1    . U   A  1  172  ? 71.407  103.502 56.274  1.00 29.36  ? 172  U   0 N1    1 
ATOM   3440  C  C2    . U   A  1  172  ? 71.279  104.473 57.250  1.00 30.15  ? 172  U   0 C2    1 
ATOM   3441  O  O2    . U   A  1  172  ? 70.228  104.724 57.802  1.00 29.92  ? 172  U   0 O2    1 
ATOM   3442  N  N3    . U   A  1  172  ? 72.428  105.147 57.549  1.00 31.59  ? 172  U   0 N3    1 
ATOM   3443  C  C4    . U   A  1  172  ? 73.661  104.970 56.977  1.00 31.37  ? 172  U   0 C4    1 
ATOM   3444  O  O4    . U   A  1  172  ? 74.606  105.640 57.377  1.00 32.83  ? 172  U   0 O4    1 
ATOM   3445  C  C5    . U   A  1  172  ? 73.711  103.970 55.959  1.00 31.17  ? 172  U   0 C5    1 
ATOM   3446  C  C6    . U   A  1  172  ? 72.611  103.286 55.651  1.00 29.19  ? 172  U   0 C6    1 
ATOM   3447  P  P     . C   A  1  173  ? 68.427  104.137 51.682  1.00 28.50  ? 173  C   0 P     1 
ATOM   3448  O  OP1   . C   A  1  173  ? 67.245  103.859 50.822  1.00 27.62  ? 173  C   0 OP1   1 
ATOM   3449  O  OP2   . C   A  1  173  ? 69.770  104.229 51.068  1.00 26.46  ? 173  C   0 OP2   1 
ATOM   3450  O  "O5'" . C   A  1  173  ? 68.115  105.445 52.530  1.00 27.07  ? 173  C   0 "O5'" 1 
ATOM   3451  C  "C5'" . C   A  1  173  ? 66.904  105.541 53.294  1.00 26.16  ? 173  C   0 "C5'" 1 
ATOM   3452  C  "C4'" . C   A  1  173  ? 66.944  106.745 54.208  1.00 29.13  ? 173  C   0 "C4'" 1 
ATOM   3453  O  "O4'" . C   A  1  173  ? 67.945  106.563 55.240  1.00 31.60  ? 173  C   0 "O4'" 1 
ATOM   3454  C  "C3'" . C   A  1  173  ? 67.317  108.071 53.569  1.00 28.89  ? 173  C   0 "C3'" 1 
ATOM   3455  O  "O3'" . C   A  1  173  ? 66.194  108.652 52.953  1.00 27.35  ? 173  C   0 "O3'" 1 
ATOM   3456  C  "C2'" . C   A  1  173  ? 67.771  108.889 54.768  1.00 29.84  ? 173  C   0 "C2'" 1 
ATOM   3457  O  "O2'" . C   A  1  173  ? 66.675  109.390 55.504  1.00 29.43  ? 173  C   0 "O2'" 1 
ATOM   3458  C  "C1'" . C   A  1  173  ? 68.491  107.823 55.595  1.00 29.25  ? 173  C   0 "C1'" 1 
ATOM   3459  N  N1    . C   A  1  173  ? 69.943  107.767 55.380  1.00 28.24  ? 173  C   0 N1    1 
ATOM   3460  C  C2    . C   A  1  173  ? 70.780  108.419 56.292  1.00 30.58  ? 173  C   0 C2    1 
ATOM   3461  O  O2    . C   A  1  173  ? 70.266  109.073 57.218  1.00 29.42  ? 173  C   0 O2    1 
ATOM   3462  N  N3    . C   A  1  173  ? 72.128  108.321 56.141  1.00 29.76  ? 173  C   0 N3    1 
ATOM   3463  C  C4    . C   A  1  173  ? 72.634  107.614 55.126  1.00 29.76  ? 173  C   0 C4    1 
ATOM   3464  N  N4    . C   A  1  173  ? 73.957  107.507 55.036  1.00 29.74  ? 173  C   0 N4    1 
ATOM   3465  C  C5    . C   A  1  173  ? 71.800  106.974 54.162  1.00 29.05  ? 173  C   0 C5    1 
ATOM   3466  C  C6    . C   A  1  173  ? 70.474  107.076 54.326  1.00 27.65  ? 173  C   0 C6    1 
ATOM   3467  P  P     . A   A  1  174  ? 66.383  109.564 51.658  1.00 28.90  ? 174  A   0 P     1 
ATOM   3468  O  OP1   . A   A  1  174  ? 67.366  110.615 51.966  1.00 31.72  ? 174  A   0 OP1   1 
ATOM   3469  O  OP2   . A   A  1  174  ? 65.020  109.936 51.192  1.00 27.66  ? 174  A   0 OP2   1 
ATOM   3470  O  "O5'" . A   A  1  174  ? 67.052  108.608 50.583  1.00 28.39  ? 174  A   0 "O5'" 1 
ATOM   3471  C  "C5'" . A   A  1  174  ? 67.218  109.051 49.229  1.00 27.21  ? 174  A   0 "C5'" 1 
ATOM   3472  C  "C4'" . A   A  1  174  ? 68.625  108.788 48.771  1.00 29.29  ? 174  A   0 "C4'" 1 
ATOM   3473  O  "O4'" . A   A  1  174  ? 69.544  109.653 49.504  1.00 29.61  ? 174  A   0 "O4'" 1 
ATOM   3474  C  "C3'" . A   A  1  174  ? 69.115  107.361 49.010  1.00 29.10  ? 174  A   0 "C3'" 1 
ATOM   3475  O  "O3'" . A   A  1  174  ? 70.070  107.047 48.006  1.00 31.42  ? 174  A   0 "O3'" 1 
ATOM   3476  C  "C2'" . A   A  1  174  ? 69.889  107.520 50.310  1.00 28.27  ? 174  A   0 "C2'" 1 
ATOM   3477  O  "O2'" . A   A  1  174  ? 70.830  106.492 50.507  1.00 28.49  ? 174  A   0 "O2'" 1 
ATOM   3478  C  "C1'"