data_1YJ6
# 
_entry.id   1YJ6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1YJ6         
RCSB  RCSB031574   
WWPDB D_1000031574 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1GTU 'CRYSTAL STRUCTURE OF LIGAND-FREE HUMAN GLUTATHIONE-S-TRANSFERASE M1A-1A'                         unspecified 
PDB 1XW6 'STRUCTURE OF HUMAN GLUTATHIONE S-TRANSFERASE M1A-1A COMLEXED WITH GLUTATHIONE'                   unspecified 
PDB 1XWK 'STRUCTURE OF HUMAN GLUTATHIONE S-TRANSFERASE M1A-1A COMLEXED WITH GLUTATHIONYL-S-DINITROBENZENE' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YJ6 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patskovsky, Y.V.' 1 
'Patskovska, L.N.' 2 
'Listowsky, I.'    3 
'Almo, S.C.'       4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Human Glutathione S-Transferase M1A-1A Catalyzes Formation of Gsh-Metal Complexes'             'To be Published' ?  ?    
? ?    ?      ?  ?         0353 ? ? ? 
1       'Functions of His-107 in the Catalytic Mechanism of Human Glutathione S-Transferase Hgstm1A-1A' Biochemistry      38 1193 
? 1999 BICHAW US 0006-2960 0033 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Patskovsky, Y.V.' 1 
primary 'Patskovska, L.N.' 2 
primary 'Listowsky, I.'    3 
primary 'Almo, S.C.'       4 
1       'Patskovsky, Y.V.' 5 
1       'Patskovska, L.N.' 6 
1       'Listowsky, I.'    7 
# 
_cell.entry_id           1YJ6 
_cell.length_a           178.640 
_cell.length_b           51.410 
_cell.length_c           93.820 
_cell.angle_alpha        90.00 
_cell.angle_beta         122.47 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1YJ6 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glutathione S-transferase Mu 1' 25746.842 3   2.5.1.18 ? ? ? 
2 non-polymer syn 'ZINC ION'                       65.409    3   ?        ? ? ? 
3 non-polymer syn GLUTATHIONE                      307.323   3   ?        ? ? ? 
4 water       nat water                            18.015    106 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GSTM1-1, GST class-mu 1, GSTM1a-1a, GSTM1b-1b, HB subunit 4, GTH4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI
ARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLV
YDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI
ARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLV
YDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   MET n 
1 4   ILE n 
1 5   LEU n 
1 6   GLY n 
1 7   TYR n 
1 8   TRP n 
1 9   ASP n 
1 10  ILE n 
1 11  ARG n 
1 12  GLY n 
1 13  LEU n 
1 14  ALA n 
1 15  HIS n 
1 16  ALA n 
1 17  ILE n 
1 18  ARG n 
1 19  LEU n 
1 20  LEU n 
1 21  LEU n 
1 22  GLU n 
1 23  TYR n 
1 24  THR n 
1 25  ASP n 
1 26  SER n 
1 27  SER n 
1 28  TYR n 
1 29  GLU n 
1 30  GLU n 
1 31  LYS n 
1 32  LYS n 
1 33  TYR n 
1 34  THR n 
1 35  MET n 
1 36  GLY n 
1 37  ASP n 
1 38  ALA n 
1 39  PRO n 
1 40  ASP n 
1 41  TYR n 
1 42  ASP n 
1 43  ARG n 
1 44  SER n 
1 45  GLN n 
1 46  TRP n 
1 47  LEU n 
1 48  ASN n 
1 49  GLU n 
1 50  LYS n 
1 51  PHE n 
1 52  LYS n 
1 53  LEU n 
1 54  GLY n 
1 55  LEU n 
1 56  ASP n 
1 57  PHE n 
1 58  PRO n 
1 59  ASN n 
1 60  LEU n 
1 61  PRO n 
1 62  TYR n 
1 63  LEU n 
1 64  ILE n 
1 65  ASP n 
1 66  GLY n 
1 67  ALA n 
1 68  HIS n 
1 69  LYS n 
1 70  ILE n 
1 71  THR n 
1 72  GLN n 
1 73  SER n 
1 74  ASN n 
1 75  ALA n 
1 76  ILE n 
1 77  LEU n 
1 78  CYS n 
1 79  TYR n 
1 80  ILE n 
1 81  ALA n 
1 82  ARG n 
1 83  LYS n 
1 84  HIS n 
1 85  ASN n 
1 86  LEU n 
1 87  CYS n 
1 88  GLY n 
1 89  GLU n 
1 90  THR n 
1 91  GLU n 
1 92  GLU n 
1 93  GLU n 
1 94  LYS n 
1 95  ILE n 
1 96  ARG n 
1 97  VAL n 
1 98  ASP n 
1 99  ILE n 
1 100 LEU n 
1 101 GLU n 
1 102 ASN n 
1 103 GLN n 
1 104 THR n 
1 105 MET n 
1 106 ASP n 
1 107 ASN n 
1 108 HIS n 
1 109 MET n 
1 110 GLN n 
1 111 LEU n 
1 112 GLY n 
1 113 MET n 
1 114 ILE n 
1 115 CYS n 
1 116 TYR n 
1 117 ASN n 
1 118 PRO n 
1 119 GLU n 
1 120 PHE n 
1 121 GLU n 
1 122 LYS n 
1 123 LEU n 
1 124 LYS n 
1 125 PRO n 
1 126 LYS n 
1 127 TYR n 
1 128 LEU n 
1 129 GLU n 
1 130 GLU n 
1 131 LEU n 
1 132 PRO n 
1 133 GLU n 
1 134 LYS n 
1 135 LEU n 
1 136 LYS n 
1 137 LEU n 
1 138 TYR n 
1 139 SER n 
1 140 GLU n 
1 141 PHE n 
1 142 LEU n 
1 143 GLY n 
1 144 LYS n 
1 145 ARG n 
1 146 PRO n 
1 147 TRP n 
1 148 PHE n 
1 149 ALA n 
1 150 GLY n 
1 151 ASN n 
1 152 LYS n 
1 153 ILE n 
1 154 THR n 
1 155 PHE n 
1 156 VAL n 
1 157 ASP n 
1 158 PHE n 
1 159 LEU n 
1 160 VAL n 
1 161 TYR n 
1 162 ASP n 
1 163 VAL n 
1 164 LEU n 
1 165 ASP n 
1 166 LEU n 
1 167 HIS n 
1 168 ARG n 
1 169 ILE n 
1 170 PHE n 
1 171 GLU n 
1 172 PRO n 
1 173 LYS n 
1 174 CYS n 
1 175 LEU n 
1 176 ASP n 
1 177 ALA n 
1 178 PHE n 
1 179 PRO n 
1 180 ASN n 
1 181 LEU n 
1 182 LYS n 
1 183 ASP n 
1 184 PHE n 
1 185 ILE n 
1 186 SER n 
1 187 ARG n 
1 188 PHE n 
1 189 GLU n 
1 190 GLY n 
1 191 LEU n 
1 192 GLU n 
1 193 LYS n 
1 194 ILE n 
1 195 SER n 
1 196 ALA n 
1 197 TYR n 
1 198 MET n 
1 199 LYS n 
1 200 SER n 
1 201 SER n 
1 202 ARG n 
1 203 PHE n 
1 204 LEU n 
1 205 PRO n 
1 206 ARG n 
1 207 PRO n 
1 208 VAL n 
1 209 PHE n 
1 210 SER n 
1 211 LYS n 
1 212 MET n 
1 213 ALA n 
1 214 VAL n 
1 215 TRP n 
1 216 GLY n 
1 217 ASN n 
1 218 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'GSTM1, GST1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET3A_HGSTM1A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSTM1_HUMAN 
_struct_ref.pdbx_db_accession          P09488 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIA
RKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVY
DVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1YJ6 A 2 ? 218 ? P09488 1 ? 217 ? 1 217 
2 1 1YJ6 B 2 ? 218 ? P09488 1 ? 217 ? 1 217 
3 1 1YJ6 C 2 ? 218 ? P09488 1 ? 217 ? 1 217 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1YJ6 MET A 1 ? UNP P09488 ? ? 'INITIATING METHIONINE' 0 1 
2 1YJ6 MET B 1 ? UNP P09488 ? ? 'INITIATING METHIONINE' 0 2 
3 1YJ6 MET C 1 ? UNP P09488 ? ? 'INITIATING METHIONINE' 0 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'      75.067  
GSH non-polymer         . GLUTATHIONE     ? 'C10 H17 N3 O6 S' 307.323 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER           ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'            65.409  
# 
_exptl.entry_id          1YJ6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_percent_sol   47.40 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            280 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_details    'PEG4000, GSH, Zinc chloride, pH 6.00, VAPOR DIFFUSION, temperature 280K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2004-11-20 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1YJ6 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   0.000 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   23285 
_reflns.number_all                   23285 
_reflns.percent_possible_obs         91.4 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              0.049 
_reflns.pdbx_netI_over_sigmaI        7.7000 
_reflns.B_iso_Wilson_estimate        20.1 
_reflns.pdbx_redundancy              11.500 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   61.2 
_reflns_shell.Rmerge_I_obs           0.315 
_reflns_shell.pdbx_Rsym_value        0.39 
_reflns_shell.meanI_over_sigI_obs    1.800 
_reflns_shell.pdbx_redundancy        4.10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1544 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1YJ6 
_refine.ls_number_reflns_obs                     22694 
_refine.ls_number_reflns_all                     23285 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               137983.26 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    89.9 
_refine.ls_R_factor_obs                          0.23 
_refine.ls_R_factor_all                          0.24 
_refine.ls_R_factor_R_work                       0.23 
_refine.ls_R_factor_R_free                       0.264 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.0 
_refine.ls_number_reflns_R_free                  674 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.7 
_refine.aniso_B[1][1]                            -9.04 
_refine.aniso_B[2][2]                            13.28 
_refine.aniso_B[3][3]                            -4.24 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            2.28 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.272049 
_refine.solvent_model_param_bsol                 10 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1GTU 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1YJ6 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.73 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.77 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5412 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             97 
_refine_hist.number_atoms_total               5581 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.4  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.11  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        2.43  2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       3.72  3.5 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        3.94  3.5 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       5.51  4.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             2779 
_refine_ls_shell.R_factor_R_work                  0.401 
_refine_ls_shell.percent_reflns_obs               68.8 
_refine_ls_shell.R_factor_R_free                  0.375 
_refine_ls_shell.R_factor_R_free_error            0.040 
_refine_ls_shell.percent_reflns_R_free            3.1 
_refine_ls_shell.number_reflns_R_free             89 
_refine_ls_shell.number_reflns_obs                2779 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1YJ6 
_struct.title                     
'crystal structure of human glutathione S-transferase M1A-1A complexed with glutathionyl-zinc-trihydroxide' 
_struct.pdbx_descriptor           
'crystal structure of human glutathione S-transferase M1A-1A complexed with glutathionyl-zinc-trihydroxide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YJ6 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'transferase, glutathione, conjugation, detoxification, cytosolic, dimer, active site, zinc, coordination complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The biological assembly is a homodimer. The asymmetric unit contains one full homodimer (chains A,B) and a monomer (chain C)' ? 
2 ?                                                                                                                              ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 13  ? THR A 24  ? LEU A 12  THR A 23  1 ? 12 
HELX_P HELX_P2  2  ARG A 43  ? ASN A 48  ? ARG A 42  ASN A 47  1 ? 6  
HELX_P HELX_P3  3  GLN A 72  ? LYS A 83  ? GLN A 71  LYS A 82  1 ? 12 
HELX_P HELX_P4  4  THR A 90  ? TYR A 116 ? THR A 89  TYR A 115 1 ? 27 
HELX_P HELX_P5  5  GLU A 119 ? GLY A 143 ? GLU A 118 GLY A 142 1 ? 25 
HELX_P HELX_P6  6  PHE A 155 ? GLU A 171 ? PHE A 154 GLU A 170 1 ? 17 
HELX_P HELX_P7  7  PRO A 172 ? ASP A 176 ? PRO A 171 ASP A 175 5 ? 5  
HELX_P HELX_P8  8  PHE A 178 ? GLY A 190 ? PHE A 177 GLY A 189 1 ? 13 
HELX_P HELX_P9  9  LEU A 191 ? SER A 200 ? LEU A 190 SER A 199 1 ? 10 
HELX_P HELX_P10 10 ALA B 14  ? THR B 24  ? ALA B 13  THR B 23  1 ? 11 
HELX_P HELX_P11 11 ARG B 43  ? ASN B 48  ? ARG B 42  ASN B 47  1 ? 6  
HELX_P HELX_P12 12 GLN B 72  ? LYS B 83  ? GLN B 71  LYS B 82  1 ? 12 
HELX_P HELX_P13 13 THR B 90  ? ASN B 117 ? THR B 89  ASN B 116 1 ? 28 
HELX_P HELX_P14 14 GLU B 119 ? GLY B 143 ? GLU B 118 GLY B 142 1 ? 25 
HELX_P HELX_P15 15 PHE B 155 ? GLU B 171 ? PHE B 154 GLU B 170 1 ? 17 
HELX_P HELX_P16 16 PRO B 172 ? ASP B 176 ? PRO B 171 ASP B 175 5 ? 5  
HELX_P HELX_P17 17 PHE B 178 ? GLY B 190 ? PHE B 177 GLY B 189 1 ? 13 
HELX_P HELX_P18 18 LEU B 191 ? SER B 200 ? LEU B 190 SER B 199 1 ? 10 
HELX_P HELX_P19 19 ALA C 14  ? THR C 24  ? ALA C 13  THR C 23  1 ? 11 
HELX_P HELX_P20 20 ARG C 43  ? ASN C 48  ? ARG C 42  ASN C 47  1 ? 6  
HELX_P HELX_P21 21 GLN C 72  ? LYS C 83  ? GLN C 71  LYS C 82  1 ? 12 
HELX_P HELX_P22 22 THR C 90  ? ASN C 117 ? THR C 89  ASN C 116 1 ? 28 
HELX_P HELX_P23 23 GLU C 119 ? GLY C 143 ? GLU C 118 GLY C 142 1 ? 25 
HELX_P HELX_P24 24 THR C 154 ? GLU C 171 ? THR C 153 GLU C 170 1 ? 18 
HELX_P HELX_P25 25 PRO C 172 ? ASP C 176 ? PRO C 171 ASP C 175 5 ? 5  
HELX_P HELX_P26 26 PHE C 178 ? GLY C 190 ? PHE C 177 GLY C 189 1 ? 13 
HELX_P HELX_P27 27 LEU C 191 ? SER C 200 ? LEU C 190 SER C 199 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ZN  . ZN  ? ? ? 1_555 J HOH . O   ? ? A ZN  219 A HOH 257 1_555 ? ? ? ? ? ? ? 1.867 ? 
metalc2  metalc ? ? D ZN  . ZN  ? ? ? 1_555 J HOH . O   ? ? A ZN  219 A HOH 258 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc3  metalc ? ? D ZN  . ZN  ? ? ? 1_555 J HOH . O   ? ? A ZN  219 A HOH 259 1_555 ? ? ? ? ? ? ? 1.862 ? 
metalc4  metalc ? ? F ZN  . ZN  ? ? ? 1_555 K HOH . O   ? ? B ZN  219 B HOH 253 1_555 ? ? ? ? ? ? ? 1.831 ? 
metalc5  metalc ? ? F ZN  . ZN  ? ? ? 1_555 K HOH . O   ? ? B ZN  219 B HOH 251 1_555 ? ? ? ? ? ? ? 1.979 ? 
metalc6  metalc ? ? F ZN  . ZN  ? ? ? 1_555 K HOH . O   ? ? B ZN  219 B HOH 252 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc7  metalc ? ? H ZN  . ZN  ? ? ? 1_555 L HOH . O   ? ? C ZN  219 C HOH 249 1_555 ? ? ? ? ? ? ? 1.872 ? 
metalc8  metalc ? ? H ZN  . ZN  ? ? ? 1_555 L HOH . O   ? ? C ZN  219 C HOH 251 1_555 ? ? ? ? ? ? ? 1.875 ? 
metalc9  metalc ? ? H ZN  . ZN  ? ? ? 1_555 L HOH . O   ? ? C ZN  219 C HOH 250 1_555 ? ? ? ? ? ? ? 1.927 ? 
metalc10 metalc ? ? D ZN  . ZN  ? ? ? 1_555 E GSH . SG2 ? ? A ZN  219 A GSH 218 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc11 metalc ? ? G GSH . SG2 ? ? ? 1_555 F ZN  . ZN  ? ? B GSH 218 B ZN  219 1_555 ? ? ? ? ? ? ? 1.956 ? 
metalc12 metalc ? ? I GSH . SG2 ? ? ? 1_555 H ZN  . ZN  ? ? C GSH 218 C ZN  219 1_555 ? ? ? ? ? ? ? 2.002 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 38  A . ? ALA 37  A PRO 39  A ? PRO 38  A 1 0.29  
2 LEU 60  A . ? LEU 59  A PRO 61  A ? PRO 60  A 1 0.80  
3 ARG 206 A . ? ARG 205 A PRO 207 A ? PRO 206 A 1 -0.32 
4 ALA 38  B . ? ALA 37  B PRO 39  B ? PRO 38  B 1 -0.47 
5 LEU 60  B . ? LEU 59  B PRO 61  B ? PRO 60  B 1 0.13  
6 ARG 206 B . ? ARG 205 B PRO 207 B ? PRO 206 B 1 -0.12 
7 ALA 38  C . ? ALA 37  C PRO 39  C ? PRO 38  C 1 -0.10 
8 LEU 60  C . ? LEU 59  C PRO 61  C ? PRO 60  C 1 -0.46 
9 ARG 206 C . ? ARG 205 C PRO 207 C ? PRO 206 C 1 -0.48 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 28 ? TYR A 33 ? TYR A 27 TYR A 32 
A 2 MET A 3  ? TRP A 8  ? MET A 2  TRP A 7  
A 3 TYR A 62 ? ASP A 65 ? TYR A 61 ASP A 64 
A 4 HIS A 68 ? THR A 71 ? HIS A 67 THR A 70 
B 1 TYR B 28 ? TYR B 33 ? TYR B 27 TYR B 32 
B 2 MET B 3  ? TRP B 8  ? MET B 2  TRP B 7  
B 3 TYR B 62 ? ASP B 65 ? TYR B 61 ASP B 64 
B 4 HIS B 68 ? THR B 71 ? HIS B 67 THR B 70 
C 1 TYR C 28 ? TYR C 33 ? TYR C 27 TYR C 32 
C 2 MET C 3  ? TRP C 8  ? MET C 2  TRP C 7  
C 3 TYR C 62 ? ASP C 65 ? TYR C 61 ASP C 64 
C 4 HIS C 68 ? THR C 71 ? HIS C 67 THR C 70 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 29 ? O GLU A 28 N MET A 3  ? N MET A 2  
A 2 3 N ILE A 4  ? N ILE A 3  O ILE A 64 ? O ILE A 63 
A 3 4 N LEU A 63 ? N LEU A 62 O ILE A 70 ? O ILE A 69 
B 1 2 O GLU B 29 ? O GLU B 28 N MET B 3  ? N MET B 2  
B 2 3 N ILE B 4  ? N ILE B 3  O ILE B 64 ? O ILE B 63 
B 3 4 N LEU B 63 ? N LEU B 62 O ILE B 70 ? O ILE B 69 
C 1 2 O GLU C 29 ? O GLU C 28 N MET C 3  ? N MET C 2  
C 2 3 N ILE C 4  ? N ILE C 3  O ILE C 64 ? O ILE C 63 
C 3 4 N ASP C 65 ? N ASP C 64 O HIS C 68 ? O HIS C 67 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 219'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 219'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 219'  
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE GSH A 218' 
AC5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE GSH B 218' 
AC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE GSH C 218' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  GSH E .   ? GSH A 218 . ? 1_555 ? 
2  AC1 4  HOH J .   ? HOH A 257 . ? 1_555 ? 
3  AC1 4  HOH J .   ? HOH A 258 . ? 1_555 ? 
4  AC1 4  HOH J .   ? HOH A 259 . ? 1_555 ? 
5  AC2 4  GSH G .   ? GSH B 218 . ? 1_555 ? 
6  AC2 4  HOH K .   ? HOH B 251 . ? 1_555 ? 
7  AC2 4  HOH K .   ? HOH B 252 . ? 1_555 ? 
8  AC2 4  HOH K .   ? HOH B 253 . ? 1_555 ? 
9  AC3 4  GSH I .   ? GSH C 218 . ? 1_555 ? 
10 AC3 4  HOH L .   ? HOH C 249 . ? 1_555 ? 
11 AC3 4  HOH L .   ? HOH C 250 . ? 1_555 ? 
12 AC3 4  HOH L .   ? HOH C 251 . ? 1_555 ? 
13 AC4 12 TRP A 8   ? TRP A 7   . ? 1_555 ? 
14 AC4 12 LEU A 13  ? LEU A 12  . ? 1_555 ? 
15 AC4 12 ARG A 43  ? ARG A 42  . ? 1_555 ? 
16 AC4 12 TRP A 46  ? TRP A 45  . ? 1_555 ? 
17 AC4 12 LYS A 50  ? LYS A 49  . ? 1_555 ? 
18 AC4 12 ASN A 59  ? ASN A 58  . ? 1_555 ? 
19 AC4 12 LEU A 60  ? LEU A 59  . ? 1_555 ? 
20 AC4 12 GLN A 72  ? GLN A 71  . ? 1_555 ? 
21 AC4 12 SER A 73  ? SER A 72  . ? 1_555 ? 
22 AC4 12 ZN  D .   ? ZN  A 219 . ? 1_555 ? 
23 AC4 12 HOH J .   ? HOH A 228 . ? 1_555 ? 
24 AC4 12 ASP B 106 ? ASP B 105 . ? 1_555 ? 
25 AC5 15 ASP A 106 ? ASP A 105 . ? 1_555 ? 
26 AC5 15 TRP B 8   ? TRP B 7   . ? 1_555 ? 
27 AC5 15 LEU B 13  ? LEU B 12  . ? 1_555 ? 
28 AC5 15 ARG B 43  ? ARG B 42  . ? 1_555 ? 
29 AC5 15 TRP B 46  ? TRP B 45  . ? 1_555 ? 
30 AC5 15 LYS B 50  ? LYS B 49  . ? 1_555 ? 
31 AC5 15 ASN B 59  ? ASN B 58  . ? 1_555 ? 
32 AC5 15 LEU B 60  ? LEU B 59  . ? 1_555 ? 
33 AC5 15 GLN B 72  ? GLN B 71  . ? 1_555 ? 
34 AC5 15 SER B 73  ? SER B 72  . ? 1_555 ? 
35 AC5 15 MET B 105 ? MET B 104 . ? 1_555 ? 
36 AC5 15 ZN  F .   ? ZN  B 219 . ? 1_555 ? 
37 AC5 15 HOH K .   ? HOH B 232 . ? 1_555 ? 
38 AC5 15 HOH K .   ? HOH B 243 . ? 1_555 ? 
39 AC5 15 HOH K .   ? HOH B 253 . ? 1_555 ? 
40 AC6 12 TYR C 7   ? TYR C 6   . ? 1_555 ? 
41 AC6 12 LEU C 13  ? LEU C 12  . ? 1_555 ? 
42 AC6 12 TRP C 46  ? TRP C 45  . ? 1_555 ? 
43 AC6 12 LYS C 50  ? LYS C 49  . ? 1_555 ? 
44 AC6 12 ASN C 59  ? ASN C 58  . ? 1_555 ? 
45 AC6 12 LEU C 60  ? LEU C 59  . ? 1_555 ? 
46 AC6 12 GLN C 72  ? GLN C 71  . ? 1_555 ? 
47 AC6 12 SER C 73  ? SER C 72  . ? 1_555 ? 
48 AC6 12 MET C 105 ? MET C 104 . ? 1_555 ? 
49 AC6 12 ASP C 106 ? ASP C 105 . ? 2_554 ? 
50 AC6 12 ZN  H .   ? ZN  C 219 . ? 1_555 ? 
51 AC6 12 HOH L .   ? HOH C 250 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1YJ6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1YJ6 
_atom_sites.fract_transf_matrix[1][1]   0.005598 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003562 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019451 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012634 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 2   ? 27.765  20.406  -6.450  1.00 54.04  ? 1   PRO A N   1 
ATOM   2    C  CA  . PRO A 1 2   ? 27.503  18.952  -6.475  1.00 51.93  ? 1   PRO A CA  1 
ATOM   3    C  C   . PRO A 1 2   ? 27.269  18.401  -5.072  1.00 51.28  ? 1   PRO A C   1 
ATOM   4    O  O   . PRO A 1 2   ? 27.364  19.123  -4.075  1.00 49.59  ? 1   PRO A O   1 
ATOM   5    C  CB  . PRO A 1 2   ? 28.740  18.306  -7.066  1.00 49.45  ? 1   PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 2   ? 29.809  19.284  -6.597  1.00 53.74  ? 1   PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 2   ? 29.184  20.633  -6.778  1.00 53.55  ? 1   PRO A CD  1 
ATOM   8    N  N   . MET A 1 3   ? 26.940  17.119  -5.013  1.00 47.94  ? 2   MET A N   1 
ATOM   9    C  CA  . MET A 1 3   ? 26.711  16.446  -3.749  1.00 43.77  ? 2   MET A CA  1 
ATOM   10   C  C   . MET A 1 3   ? 28.010  16.479  -2.967  1.00 42.24  ? 2   MET A C   1 
ATOM   11   O  O   . MET A 1 3   ? 29.089  16.582  -3.551  1.00 42.67  ? 2   MET A O   1 
ATOM   12   C  CB  . MET A 1 3   ? 26.342  14.997  -4.009  1.00 43.30  ? 2   MET A CB  1 
ATOM   13   C  CG  . MET A 1 3   ? 24.934  14.638  -3.659  1.00 43.25  ? 2   MET A CG  1 
ATOM   14   S  SD  . MET A 1 3   ? 24.551  13.026  -4.347  1.00 43.34  ? 2   MET A SD  1 
ATOM   15   C  CE  . MET A 1 3   ? 23.486  13.497  -5.680  1.00 56.93  ? 2   MET A CE  1 
ATOM   16   N  N   . ILE A 1 4   ? 27.910  16.420  -1.647  1.00 37.64  ? 3   ILE A N   1 
ATOM   17   C  CA  . ILE A 1 4   ? 29.099  16.425  -0.808  1.00 33.82  ? 3   ILE A CA  1 
ATOM   18   C  C   . ILE A 1 4   ? 28.927  15.429  0.322   1.00 28.81  ? 3   ILE A C   1 
ATOM   19   O  O   . ILE A 1 4   ? 27.920  15.418  1.023   1.00 23.78  ? 3   ILE A O   1 
ATOM   20   C  CB  . ILE A 1 4   ? 29.479  17.854  -0.314  1.00 34.82  ? 3   ILE A CB  1 
ATOM   21   C  CG1 . ILE A 1 4   ? 30.337  17.776  0.950   1.00 38.41  ? 3   ILE A CG1 1 
ATOM   22   C  CG2 . ILE A 1 4   ? 28.250  18.727  -0.151  1.00 35.39  ? 3   ILE A CG2 1 
ATOM   23   C  CD1 . ILE A 1 4   ? 30.779  19.122  1.470   1.00 45.52  ? 3   ILE A CD1 1 
ATOM   24   N  N   . LEU A 1 5   ? 29.893  14.532  0.425   1.00 26.31  ? 4   LEU A N   1 
ATOM   25   C  CA  . LEU A 1 5   ? 29.875  13.478  1.419   1.00 28.95  ? 4   LEU A CA  1 
ATOM   26   C  C   . LEU A 1 5   ? 30.911  13.703  2.514   1.00 27.40  ? 4   LEU A C   1 
ATOM   27   O  O   . LEU A 1 5   ? 32.116  13.554  2.277   1.00 28.09  ? 4   LEU A O   1 
ATOM   28   C  CB  . LEU A 1 5   ? 30.127  12.144  0.713   1.00 27.09  ? 4   LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 5   ? 30.432  10.896  1.537   1.00 26.09  ? 4   LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 5   ? 29.243  10.510  2.390   1.00 27.39  ? 4   LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 5   ? 30.809  9.760   0.612   1.00 32.94  ? 4   LEU A CD2 1 
ATOM   32   N  N   . GLY A 1 6   ? 30.441  14.064  3.703   1.00 27.27  ? 5   GLY A N   1 
ATOM   33   C  CA  . GLY A 1 6   ? 31.343  14.282  4.820   1.00 28.07  ? 5   GLY A CA  1 
ATOM   34   C  C   . GLY A 1 6   ? 31.623  12.993  5.567   1.00 28.80  ? 5   GLY A C   1 
ATOM   35   O  O   . GLY A 1 6   ? 30.718  12.177  5.783   1.00 26.92  ? 5   GLY A O   1 
ATOM   36   N  N   . TYR A 1 7   ? 32.883  12.789  5.939   1.00 25.19  ? 6   TYR A N   1 
ATOM   37   C  CA  . TYR A 1 7   ? 33.282  11.598  6.683   1.00 27.63  ? 6   TYR A CA  1 
ATOM   38   C  C   . TYR A 1 7   ? 34.737  11.681  7.110   1.00 27.28  ? 6   TYR A C   1 
ATOM   39   O  O   . TYR A 1 7   ? 35.449  12.614  6.744   1.00 21.54  ? 6   TYR A O   1 
ATOM   40   C  CB  . TYR A 1 7   ? 33.077  10.332  5.850   1.00 22.41  ? 6   TYR A CB  1 
ATOM   41   C  CG  . TYR A 1 7   ? 33.095  9.075   6.678   1.00 18.59  ? 6   TYR A CG  1 
ATOM   42   C  CD1 . TYR A 1 7   ? 32.204  8.911   7.742   1.00 16.36  ? 6   TYR A CD1 1 
ATOM   43   C  CD2 . TYR A 1 7   ? 33.995  8.043   6.404   1.00 23.68  ? 6   TYR A CD2 1 
ATOM   44   C  CE1 . TYR A 1 7   ? 32.202  7.751   8.520   1.00 18.06  ? 6   TYR A CE1 1 
ATOM   45   C  CE2 . TYR A 1 7   ? 34.006  6.869   7.175   1.00 18.86  ? 6   TYR A CE2 1 
ATOM   46   C  CZ  . TYR A 1 7   ? 33.103  6.733   8.234   1.00 22.43  ? 6   TYR A CZ  1 
ATOM   47   O  OH  . TYR A 1 7   ? 33.096  5.599   9.015   1.00 22.42  ? 6   TYR A OH  1 
ATOM   48   N  N   . TRP A 1 8   ? 35.147  10.735  7.947   1.00 25.04  ? 7   TRP A N   1 
ATOM   49   C  CA  . TRP A 1 8   ? 36.522  10.680  8.407   1.00 24.89  ? 7   TRP A CA  1 
ATOM   50   C  C   . TRP A 1 8   ? 37.367  10.297  7.202   1.00 28.43  ? 7   TRP A C   1 
ATOM   51   O  O   . TRP A 1 8   ? 36.855  9.770   6.216   1.00 32.63  ? 7   TRP A O   1 
ATOM   52   C  CB  . TRP A 1 8   ? 36.684  9.627   9.507   1.00 23.04  ? 7   TRP A CB  1 
ATOM   53   C  CG  . TRP A 1 8   ? 35.960  9.963   10.777  1.00 22.35  ? 7   TRP A CG  1 
ATOM   54   C  CD1 . TRP A 1 8   ? 34.898  9.298   11.308  1.00 20.05  ? 7   TRP A CD1 1 
ATOM   55   C  CD2 . TRP A 1 8   ? 36.244  11.047  11.672  1.00 19.10  ? 7   TRP A CD2 1 
ATOM   56   N  NE1 . TRP A 1 8   ? 34.502  9.900   12.474  1.00 19.04  ? 7   TRP A NE1 1 
ATOM   57   C  CE2 . TRP A 1 8   ? 35.318  10.981  12.726  1.00 18.00  ? 7   TRP A CE2 1 
ATOM   58   C  CE3 . TRP A 1 8   ? 37.202  12.073  11.691  1.00 24.45  ? 7   TRP A CE3 1 
ATOM   59   C  CZ2 . TRP A 1 8   ? 35.303  11.893  13.788  1.00 24.24  ? 7   TRP A CZ2 1 
ATOM   60   C  CZ3 . TRP A 1 8   ? 37.195  12.984  12.746  1.00 21.63  ? 7   TRP A CZ3 1 
ATOM   61   C  CH2 . TRP A 1 8   ? 36.252  12.884  13.781  1.00 24.28  ? 7   TRP A CH2 1 
ATOM   62   N  N   . ASP A 1 9   ? 38.662  10.560  7.290   1.00 31.16  ? 8   ASP A N   1 
ATOM   63   C  CA  . ASP A 1 9   ? 39.582  10.244  6.212   1.00 32.63  ? 8   ASP A CA  1 
ATOM   64   C  C   . ASP A 1 9   ? 39.888  8.754   6.267   1.00 32.10  ? 8   ASP A C   1 
ATOM   65   O  O   . ASP A 1 9   ? 41.052  8.354   6.339   1.00 33.68  ? 8   ASP A O   1 
ATOM   66   C  CB  . ASP A 1 9   ? 40.862  11.060  6.401   1.00 42.39  ? 8   ASP A CB  1 
ATOM   67   C  CG  . ASP A 1 9   ? 41.737  11.095  5.160   1.00 53.80  ? 8   ASP A CG  1 
ATOM   68   O  OD1 . ASP A 1 9   ? 42.720  11.867  5.169   1.00 59.96  ? 8   ASP A OD1 1 
ATOM   69   O  OD2 . ASP A 1 9   ? 41.452  10.367  4.179   1.00 56.64  ? 8   ASP A OD2 1 
ATOM   70   N  N   . ILE A 1 10  ? 38.839  7.937   6.261   1.00 31.74  ? 9   ILE A N   1 
ATOM   71   C  CA  . ILE A 1 10  ? 38.985  6.481   6.333   1.00 34.19  ? 9   ILE A CA  1 
ATOM   72   C  C   . ILE A 1 10  ? 37.865  5.774   5.575   1.00 35.00  ? 9   ILE A C   1 
ATOM   73   O  O   . ILE A 1 10  ? 36.923  6.413   5.099   1.00 37.33  ? 9   ILE A O   1 
ATOM   74   C  CB  . ILE A 1 10  ? 38.910  5.958   7.798   1.00 32.17  ? 9   ILE A CB  1 
ATOM   75   C  CG1 . ILE A 1 10  ? 37.534  6.266   8.401   1.00 28.30  ? 9   ILE A CG1 1 
ATOM   76   C  CG2 . ILE A 1 10  ? 40.024  6.551   8.651   1.00 24.91  ? 9   ILE A CG2 1 
ATOM   77   C  CD1 . ILE A 1 10  ? 37.247  5.509   9.684   1.00 25.53  ? 9   ILE A CD1 1 
ATOM   78   N  N   . ARG A 1 11  ? 37.966  4.450   5.511   1.00 33.24  ? 10  ARG A N   1 
ATOM   79   C  CA  . ARG A 1 11  ? 36.971  3.618   4.849   1.00 32.18  ? 10  ARG A CA  1 
ATOM   80   C  C   . ARG A 1 11  ? 35.684  3.652   5.678   1.00 31.56  ? 10  ARG A C   1 
ATOM   81   O  O   . ARG A 1 11  ? 34.721  4.335   5.325   1.00 35.86  ? 10  ARG A O   1 
ATOM   82   C  CB  . ARG A 1 11  ? 37.503  2.188   4.731   1.00 30.43  ? 10  ARG A CB  1 
ATOM   83   C  CG  . ARG A 1 11  ? 36.543  1.200   4.104   1.00 29.49  ? 10  ARG A CG  1 
ATOM   84   C  CD  . ARG A 1 11  ? 37.198  -0.152  4.024   1.00 27.70  ? 10  ARG A CD  1 
ATOM   85   N  NE  . ARG A 1 11  ? 36.310  -1.207  3.548   1.00 26.28  ? 10  ARG A NE  1 
ATOM   86   C  CZ  . ARG A 1 11  ? 36.695  -2.189  2.734   1.00 24.41  ? 10  ARG A CZ  1 
ATOM   87   N  NH1 . ARG A 1 11  ? 37.952  -2.234  2.294   1.00 22.10  ? 10  ARG A NH1 1 
ATOM   88   N  NH2 . ARG A 1 11  ? 35.851  -3.166  2.417   1.00 22.41  ? 10  ARG A NH2 1 
ATOM   89   N  N   . GLY A 1 12  ? 35.681  2.914   6.784   1.00 29.02  ? 11  GLY A N   1 
ATOM   90   C  CA  . GLY A 1 12  ? 34.529  2.887   7.662   1.00 26.24  ? 11  GLY A CA  1 
ATOM   91   C  C   . GLY A 1 12  ? 33.189  2.601   7.013   1.00 30.68  ? 11  GLY A C   1 
ATOM   92   O  O   . GLY A 1 12  ? 33.051  1.652   6.231   1.00 32.78  ? 11  GLY A O   1 
ATOM   93   N  N   . LEU A 1 13  ? 32.205  3.433   7.343   1.00 31.22  ? 12  LEU A N   1 
ATOM   94   C  CA  . LEU A 1 13  ? 30.841  3.309   6.841   1.00 30.10  ? 12  LEU A CA  1 
ATOM   95   C  C   . LEU A 1 13  ? 30.591  4.008   5.518   1.00 32.84  ? 12  LEU A C   1 
ATOM   96   O  O   . LEU A 1 13  ? 29.564  3.783   4.871   1.00 35.45  ? 12  LEU A O   1 
ATOM   97   C  CB  . LEU A 1 13  ? 29.853  3.847   7.884   1.00 28.61  ? 12  LEU A CB  1 
ATOM   98   C  CG  . LEU A 1 13  ? 29.770  3.068   9.201   1.00 27.57  ? 12  LEU A CG  1 
ATOM   99   C  CD1 . LEU A 1 13  ? 28.878  3.781   10.189  1.00 16.09  ? 12  LEU A CD1 1 
ATOM   100  C  CD2 . LEU A 1 13  ? 29.262  1.675   8.922   1.00 29.86  ? 12  LEU A CD2 1 
ATOM   101  N  N   . ALA A 1 14  ? 31.496  4.898   5.143   1.00 33.27  ? 13  ALA A N   1 
ATOM   102  C  CA  . ALA A 1 14  ? 31.366  5.639   3.897   1.00 31.13  ? 13  ALA A CA  1 
ATOM   103  C  C   . ALA A 1 14  ? 31.726  4.802   2.682   1.00 26.50  ? 13  ALA A C   1 
ATOM   104  O  O   . ALA A 1 14  ? 31.427  5.190   1.561   1.00 25.15  ? 13  ALA A O   1 
ATOM   105  C  CB  . ALA A 1 14  ? 32.242  6.868   3.933   1.00 26.59  ? 13  ALA A CB  1 
ATOM   106  N  N   . HIS A 1 15  ? 32.310  3.634   2.916   1.00 25.58  ? 14  HIS A N   1 
ATOM   107  C  CA  . HIS A 1 15  ? 32.733  2.782   1.818   1.00 25.81  ? 14  HIS A CA  1 
ATOM   108  C  C   . HIS A 1 15  ? 31.601  2.477   0.851   1.00 25.84  ? 14  HIS A C   1 
ATOM   109  O  O   . HIS A 1 15  ? 31.633  2.914   -0.306  1.00 20.45  ? 14  HIS A O   1 
ATOM   110  C  CB  . HIS A 1 15  ? 33.348  1.474   2.335   1.00 23.79  ? 14  HIS A CB  1 
ATOM   111  C  CG  . HIS A 1 15  ? 34.320  0.851   1.373   1.00 23.19  ? 14  HIS A CG  1 
ATOM   112  N  ND1 . HIS A 1 15  ? 35.358  1.556   0.820   1.00 27.37  ? 14  HIS A ND1 1 
ATOM   113  C  CD2 . HIS A 1 15  ? 34.394  -0.397  0.857   1.00 18.26  ? 14  HIS A CD2 1 
ATOM   114  C  CE1 . HIS A 1 15  ? 36.035  0.781   0.001   1.00 23.41  ? 14  HIS A CE1 1 
ATOM   115  N  NE2 . HIS A 1 15  ? 35.472  -0.414  -0.004  1.00 21.41  ? 14  HIS A NE2 1 
ATOM   116  N  N   . ALA A 1 16  ? 30.606  1.725   1.310   1.00 23.50  ? 15  ALA A N   1 
ATOM   117  C  CA  . ALA A 1 16  ? 29.482  1.364   0.447   1.00 29.76  ? 15  ALA A CA  1 
ATOM   118  C  C   . ALA A 1 16  ? 28.861  2.573   -0.237  1.00 29.81  ? 15  ALA A C   1 
ATOM   119  O  O   . ALA A 1 16  ? 28.423  2.479   -1.375  1.00 33.96  ? 15  ALA A O   1 
ATOM   120  C  CB  . ALA A 1 16  ? 28.436  0.608   1.227   1.00 26.98  ? 15  ALA A CB  1 
ATOM   121  N  N   . ILE A 1 17  ? 28.824  3.702   0.460   1.00 28.39  ? 16  ILE A N   1 
ATOM   122  C  CA  . ILE A 1 17  ? 28.267  4.925   -0.103  1.00 29.75  ? 16  ILE A CA  1 
ATOM   123  C  C   . ILE A 1 17  ? 29.101  5.361   -1.307  1.00 28.43  ? 16  ILE A C   1 
ATOM   124  O  O   . ILE A 1 17  ? 28.569  5.660   -2.378  1.00 27.98  ? 16  ILE A O   1 
ATOM   125  C  CB  . ILE A 1 17  ? 28.260  6.071   0.939   1.00 29.65  ? 16  ILE A CB  1 
ATOM   126  C  CG1 . ILE A 1 17  ? 27.394  5.682   2.138   1.00 26.15  ? 16  ILE A CG1 1 
ATOM   127  C  CG2 . ILE A 1 17  ? 27.773  7.379   0.302   1.00 34.32  ? 16  ILE A CG2 1 
ATOM   128  C  CD1 . ILE A 1 17  ? 27.328  6.725   3.226   1.00 27.48  ? 16  ILE A CD1 1 
ATOM   129  N  N   . ARG A 1 18  ? 30.402  5.481   -1.084  1.00 26.00  ? 17  ARG A N   1 
ATOM   130  C  CA  . ARG A 1 18  ? 31.327  5.872   -2.128  1.00 27.72  ? 17  ARG A CA  1 
ATOM   131  C  C   . ARG A 1 18  ? 31.144  4.962   -3.326  1.00 32.64  ? 17  ARG A C   1 
ATOM   132  O  O   . ARG A 1 18  ? 30.972  5.430   -4.449  1.00 37.30  ? 17  ARG A O   1 
ATOM   133  C  CB  . ARG A 1 18  ? 32.750  5.770   -1.605  1.00 25.85  ? 17  ARG A CB  1 
ATOM   134  C  CG  . ARG A 1 18  ? 33.061  6.818   -0.566  1.00 27.41  ? 17  ARG A CG  1 
ATOM   135  C  CD  . ARG A 1 18  ? 34.442  6.650   0.025   1.00 25.13  ? 17  ARG A CD  1 
ATOM   136  N  NE  . ARG A 1 18  ? 34.697  7.689   1.013   1.00 31.86  ? 17  ARG A NE  1 
ATOM   137  C  CZ  . ARG A 1 18  ? 35.350  7.479   2.149   1.00 32.48  ? 17  ARG A CZ  1 
ATOM   138  N  NH1 . ARG A 1 18  ? 35.817  6.260   2.422   1.00 21.61  ? 17  ARG A NH1 1 
ATOM   139  N  NH2 . ARG A 1 18  ? 35.498  8.477   3.026   1.00 34.19  ? 17  ARG A NH2 1 
ATOM   140  N  N   . LEU A 1 19  ? 31.188  3.658   -3.077  1.00 34.58  ? 18  LEU A N   1 
ATOM   141  C  CA  . LEU A 1 19  ? 31.001  2.667   -4.125  1.00 34.07  ? 18  LEU A CA  1 
ATOM   142  C  C   . LEU A 1 19  ? 29.695  2.933   -4.857  1.00 30.93  ? 18  LEU A C   1 
ATOM   143  O  O   . LEU A 1 19  ? 29.632  2.840   -6.085  1.00 32.85  ? 18  LEU A O   1 
ATOM   144  C  CB  . LEU A 1 19  ? 30.943  1.264   -3.523  1.00 34.36  ? 18  LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 19  ? 32.207  0.773   -2.825  1.00 37.29  ? 18  LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 19  ? 32.006  -0.628  -2.261  1.00 36.36  ? 18  LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 19  ? 33.361  0.786   -3.819  1.00 35.51  ? 18  LEU A CD2 1 
ATOM   148  N  N   . LEU A 1 20  ? 28.648  3.219   -4.093  1.00 24.78  ? 19  LEU A N   1 
ATOM   149  C  CA  . LEU A 1 20  ? 27.347  3.486   -4.676  1.00 29.00  ? 19  LEU A CA  1 
ATOM   150  C  C   . LEU A 1 20  ? 27.358  4.743   -5.520  1.00 28.63  ? 19  LEU A C   1 
ATOM   151  O  O   . LEU A 1 20  ? 26.827  4.746   -6.624  1.00 30.06  ? 19  LEU A O   1 
ATOM   152  C  CB  . LEU A 1 20  ? 26.272  3.606   -3.596  1.00 29.70  ? 19  LEU A CB  1 
ATOM   153  C  CG  . LEU A 1 20  ? 24.865  3.803   -4.164  1.00 29.70  ? 19  LEU A CG  1 
ATOM   154  C  CD1 . LEU A 1 20  ? 24.518  2.612   -5.050  1.00 29.49  ? 19  LEU A CD1 1 
ATOM   155  C  CD2 . LEU A 1 20  ? 23.854  3.945   -3.034  1.00 19.28  ? 19  LEU A CD2 1 
ATOM   156  N  N   . LEU A 1 21  ? 27.914  5.816   -4.968  1.00 27.25  ? 20  LEU A N   1 
ATOM   157  C  CA  . LEU A 1 21  ? 27.994  7.087   -5.662  1.00 26.36  ? 20  LEU A CA  1 
ATOM   158  C  C   . LEU A 1 21  ? 28.699  6.939   -7.005  1.00 29.15  ? 20  LEU A C   1 
ATOM   159  O  O   . LEU A 1 21  ? 28.337  7.590   -7.988  1.00 32.83  ? 20  LEU A O   1 
ATOM   160  C  CB  . LEU A 1 21  ? 28.744  8.095   -4.801  1.00 25.43  ? 20  LEU A CB  1 
ATOM   161  C  CG  . LEU A 1 21  ? 27.938  8.831   -3.742  1.00 28.38  ? 20  LEU A CG  1 
ATOM   162  C  CD1 . LEU A 1 21  ? 28.851  9.667   -2.875  1.00 27.25  ? 20  LEU A CD1 1 
ATOM   163  C  CD2 . LEU A 1 21  ? 26.891  9.712   -4.417  1.00 19.99  ? 20  LEU A CD2 1 
ATOM   164  N  N   . GLU A 1 22  ? 29.742  6.118   -7.025  1.00 26.33  ? 21  GLU A N   1 
ATOM   165  C  CA  . GLU A 1 22  ? 30.508  5.887   -8.239  1.00 29.27  ? 21  GLU A CA  1 
ATOM   166  C  C   . GLU A 1 22  ? 29.729  5.078   -9.267  1.00 29.62  ? 21  GLU A C   1 
ATOM   167  O  O   . GLU A 1 22  ? 29.763  5.386   -10.460 1.00 29.02  ? 21  GLU A O   1 
ATOM   168  C  CB  . GLU A 1 22  ? 31.834  5.200   -7.906  1.00 31.32  ? 21  GLU A CB  1 
ATOM   169  C  CG  . GLU A 1 22  ? 32.847  6.133   -7.244  1.00 38.79  ? 21  GLU A CG  1 
ATOM   170  C  CD  . GLU A 1 22  ? 33.467  7.139   -8.210  1.00 41.76  ? 21  GLU A CD  1 
ATOM   171  O  OE1 . GLU A 1 22  ? 33.554  6.838   -9.419  1.00 49.06  ? 21  GLU A OE1 1 
ATOM   172  O  OE2 . GLU A 1 22  ? 33.890  8.222   -7.755  1.00 40.68  ? 21  GLU A OE2 1 
ATOM   173  N  N   . TYR A 1 23  ? 29.079  4.012   -8.810  1.00 30.42  ? 22  TYR A N   1 
ATOM   174  C  CA  . TYR A 1 23  ? 28.286  3.155   -9.684  1.00 32.06  ? 22  TYR A CA  1 
ATOM   175  C  C   . TYR A 1 23  ? 27.134  3.928   -10.319 1.00 33.22  ? 22  TYR A C   1 
ATOM   176  O  O   . TYR A 1 23  ? 26.741  3.649   -11.459 1.00 32.85  ? 22  TYR A O   1 
ATOM   177  C  CB  . TYR A 1 23  ? 27.732  1.975   -8.901  1.00 29.09  ? 22  TYR A CB  1 
ATOM   178  C  CG  . TYR A 1 23  ? 26.822  1.086   -9.714  1.00 35.53  ? 22  TYR A CG  1 
ATOM   179  C  CD1 . TYR A 1 23  ? 27.341  0.084   -10.528 1.00 37.39  ? 22  TYR A CD1 1 
ATOM   180  C  CD2 . TYR A 1 23  ? 25.441  1.247   -9.672  1.00 33.42  ? 22  TYR A CD2 1 
ATOM   181  C  CE1 . TYR A 1 23  ? 26.506  -0.739  -11.279 1.00 38.03  ? 22  TYR A CE1 1 
ATOM   182  C  CE2 . TYR A 1 23  ? 24.599  0.433   -10.419 1.00 37.22  ? 22  TYR A CE2 1 
ATOM   183  C  CZ  . TYR A 1 23  ? 25.136  -0.558  -11.221 1.00 38.13  ? 22  TYR A CZ  1 
ATOM   184  O  OH  . TYR A 1 23  ? 24.296  -1.356  -11.967 1.00 34.55  ? 22  TYR A OH  1 
ATOM   185  N  N   . THR A 1 24  ? 26.563  4.850   -9.550  1.00 29.76  ? 23  THR A N   1 
ATOM   186  C  CA  . THR A 1 24  ? 25.460  5.675   -10.021 1.00 27.81  ? 23  THR A CA  1 
ATOM   187  C  C   . THR A 1 24  ? 25.946  6.872   -10.822 1.00 32.63  ? 23  THR A C   1 
ATOM   188  O  O   . THR A 1 24  ? 25.147  7.669   -11.323 1.00 33.83  ? 23  THR A O   1 
ATOM   189  C  CB  . THR A 1 24  ? 24.587  6.166   -8.865  1.00 26.81  ? 23  THR A CB  1 
ATOM   190  O  OG1 . THR A 1 24  ? 25.372  6.929   -7.935  1.00 23.82  ? 23  THR A OG1 1 
ATOM   191  C  CG2 . THR A 1 24  ? 23.933  4.980   -8.179  1.00 24.31  ? 23  THR A CG2 1 
ATOM   192  N  N   . ASP A 1 25  ? 27.260  6.957   -10.983 1.00 33.79  ? 24  ASP A N   1 
ATOM   193  C  CA  . ASP A 1 25  ? 27.887  8.036   -11.735 1.00 39.89  ? 24  ASP A CA  1 
ATOM   194  C  C   . ASP A 1 25  ? 27.432  9.397   -11.192 1.00 38.04  ? 24  ASP A C   1 
ATOM   195  O  O   . ASP A 1 25  ? 27.334  10.389  -11.926 1.00 38.79  ? 24  ASP A O   1 
ATOM   196  C  CB  . ASP A 1 25  ? 27.573  7.878   -13.237 1.00 48.26  ? 24  ASP A CB  1 
ATOM   197  C  CG  . ASP A 1 25  ? 28.794  8.215   -14.101 1.00 57.23  ? 24  ASP A CG  1 
ATOM   198  O  OD1 . ASP A 1 25  ? 29.769  8.835   -13.612 1.00 62.50  ? 24  ASP A OD1 1 
ATOM   199  O  OD2 . ASP A 1 25  ? 28.781  7.816   -15.285 1.00 62.13  ? 24  ASP A OD2 1 
ATOM   200  N  N   . SER A 1 26  ? 27.207  9.446   -9.885  1.00 37.93  ? 25  SER A N   1 
ATOM   201  C  CA  . SER A 1 26  ? 26.777  10.671  -9.234  1.00 37.48  ? 25  SER A CA  1 
ATOM   202  C  C   . SER A 1 26  ? 27.889  11.715  -9.211  1.00 37.78  ? 25  SER A C   1 
ATOM   203  O  O   . SER A 1 26  ? 29.078  11.387  -9.276  1.00 37.34  ? 25  SER A O   1 
ATOM   204  C  CB  . SER A 1 26  ? 26.299  10.374  -7.807  1.00 33.75  ? 25  SER A CB  1 
ATOM   205  O  OG  . SER A 1 26  ? 25.055  9.695   -7.809  1.00 39.62  ? 25  SER A OG  1 
ATOM   206  N  N   . SER A 1 27  ? 27.496  12.980  -9.186  1.00 38.15  ? 26  SER A N   1 
ATOM   207  C  CA  . SER A 1 27  ? 28.453  14.068  -9.127  1.00 40.16  ? 26  SER A CA  1 
ATOM   208  C  C   . SER A 1 27  ? 28.618  14.395  -7.641  1.00 39.29  ? 26  SER A C   1 
ATOM   209  O  O   . SER A 1 27  ? 27.635  14.721  -6.964  1.00 36.95  ? 26  SER A O   1 
ATOM   210  C  CB  . SER A 1 27  ? 27.905  15.273  -9.887  1.00 38.27  ? 26  SER A CB  1 
ATOM   211  O  OG  . SER A 1 27  ? 28.777  16.385  -9.798  1.00 42.65  ? 26  SER A OG  1 
ATOM   212  N  N   . TYR A 1 28  ? 29.841  14.298  -7.120  1.00 39.10  ? 27  TYR A N   1 
ATOM   213  C  CA  . TYR A 1 28  ? 30.056  14.574  -5.703  1.00 41.79  ? 27  TYR A CA  1 
ATOM   214  C  C   . TYR A 1 28  ? 31.472  14.946  -5.284  1.00 43.56  ? 27  TYR A C   1 
ATOM   215  O  O   . TYR A 1 28  ? 32.452  14.601  -5.944  1.00 41.39  ? 27  TYR A O   1 
ATOM   216  C  CB  . TYR A 1 28  ? 29.626  13.364  -4.878  1.00 41.06  ? 27  TYR A CB  1 
ATOM   217  C  CG  . TYR A 1 28  ? 30.615  12.223  -4.945  1.00 38.75  ? 27  TYR A CG  1 
ATOM   218  C  CD1 . TYR A 1 28  ? 30.566  11.288  -5.976  1.00 39.67  ? 27  TYR A CD1 1 
ATOM   219  C  CD2 . TYR A 1 28  ? 31.610  12.083  -3.980  1.00 37.51  ? 27  TYR A CD2 1 
ATOM   220  C  CE1 . TYR A 1 28  ? 31.483  10.240  -6.045  1.00 39.32  ? 27  TYR A CE1 1 
ATOM   221  C  CE2 . TYR A 1 28  ? 32.533  11.044  -4.040  1.00 40.19  ? 27  TYR A CE2 1 
ATOM   222  C  CZ  . TYR A 1 28  ? 32.464  10.125  -5.076  1.00 42.49  ? 27  TYR A CZ  1 
ATOM   223  O  OH  . TYR A 1 28  ? 33.385  9.101   -5.148  1.00 44.23  ? 27  TYR A OH  1 
ATOM   224  N  N   . GLU A 1 29  ? 31.557  15.610  -4.138  1.00 49.38  ? 28  GLU A N   1 
ATOM   225  C  CA  . GLU A 1 29  ? 32.822  16.009  -3.538  1.00 54.63  ? 28  GLU A CA  1 
ATOM   226  C  C   . GLU A 1 29  ? 32.922  15.202  -2.244  1.00 52.50  ? 28  GLU A C   1 
ATOM   227  O  O   . GLU A 1 29  ? 32.045  14.389  -1.950  1.00 54.57  ? 28  GLU A O   1 
ATOM   228  C  CB  . GLU A 1 29  ? 32.808  17.497  -3.189  1.00 62.00  ? 28  GLU A CB  1 
ATOM   229  C  CG  . GLU A 1 29  ? 32.639  18.439  -4.366  1.00 70.92  ? 28  GLU A CG  1 
ATOM   230  C  CD  . GLU A 1 29  ? 32.583  19.889  -3.920  1.00 78.00  ? 28  GLU A CD  1 
ATOM   231  O  OE1 . GLU A 1 29  ? 31.467  20.424  -3.738  1.00 83.00  ? 28  GLU A OE1 1 
ATOM   232  O  OE2 . GLU A 1 29  ? 33.661  20.490  -3.729  1.00 80.54  ? 28  GLU A OE2 1 
ATOM   233  N  N   . GLU A 1 30  ? 33.991  15.416  -1.482  1.00 49.27  ? 29  GLU A N   1 
ATOM   234  C  CA  . GLU A 1 30  ? 34.186  14.722  -0.211  1.00 42.86  ? 29  GLU A CA  1 
ATOM   235  C  C   . GLU A 1 30  ? 34.827  15.652  0.809   1.00 40.91  ? 29  GLU A C   1 
ATOM   236  O  O   . GLU A 1 30  ? 35.765  16.385  0.493   1.00 39.44  ? 29  GLU A O   1 
ATOM   237  C  CB  . GLU A 1 30  ? 35.051  13.463  -0.378  1.00 40.52  ? 29  GLU A CB  1 
ATOM   238  C  CG  . GLU A 1 30  ? 34.335  12.252  -0.983  1.00 41.58  ? 29  GLU A CG  1 
ATOM   239  C  CD  . GLU A 1 30  ? 34.979  10.915  -0.606  1.00 44.33  ? 29  GLU A CD  1 
ATOM   240  O  OE1 . GLU A 1 30  ? 34.794  10.467  0.553   1.00 47.83  ? 29  GLU A OE1 1 
ATOM   241  O  OE2 . GLU A 1 30  ? 35.653  10.304  -1.467  1.00 41.33  ? 29  GLU A OE2 1 
ATOM   242  N  N   . LYS A 1 31  ? 34.271  15.674  2.014   1.00 42.90  ? 30  LYS A N   1 
ATOM   243  C  CA  . LYS A 1 31  ? 34.808  16.505  3.085   1.00 43.60  ? 30  LYS A CA  1 
ATOM   244  C  C   . LYS A 1 31  ? 35.389  15.531  4.089   1.00 42.11  ? 30  LYS A C   1 
ATOM   245  O  O   . LYS A 1 31  ? 34.709  15.100  5.019   1.00 41.53  ? 30  LYS A O   1 
ATOM   246  C  CB  . LYS A 1 31  ? 33.704  17.341  3.740   1.00 43.04  ? 30  LYS A CB  1 
ATOM   247  C  CG  . LYS A 1 31  ? 34.131  18.742  4.164   1.00 43.19  ? 30  LYS A CG  1 
ATOM   248  C  CD  . LYS A 1 31  ? 35.268  18.718  5.165   1.00 53.55  ? 30  LYS A CD  1 
ATOM   249  C  CE  . LYS A 1 31  ? 35.618  20.125  5.636   1.00 57.27  ? 30  LYS A CE  1 
ATOM   250  N  NZ  . LYS A 1 31  ? 36.078  21.004  4.517   1.00 55.68  ? 30  LYS A NZ  1 
ATOM   251  N  N   . LYS A 1 32  ? 36.625  15.118  3.833   1.00 43.13  ? 31  LYS A N   1 
ATOM   252  C  CA  . LYS A 1 32  ? 37.320  14.185  4.709   1.00 44.24  ? 31  LYS A CA  1 
ATOM   253  C  C   . LYS A 1 32  ? 37.789  14.919  5.960   1.00 44.15  ? 31  LYS A C   1 
ATOM   254  O  O   . LYS A 1 32  ? 38.344  16.017  5.878   1.00 40.55  ? 31  LYS A O   1 
ATOM   255  C  CB  . LYS A 1 32  ? 38.507  13.564  3.974   1.00 44.43  ? 31  LYS A CB  1 
ATOM   256  C  CG  . LYS A 1 32  ? 38.114  12.824  2.694   1.00 50.05  ? 31  LYS A CG  1 
ATOM   257  C  CD  . LYS A 1 32  ? 39.336  12.477  1.840   1.00 59.20  ? 31  LYS A CD  1 
ATOM   258  C  CE  . LYS A 1 32  ? 38.961  11.762  0.536   1.00 61.18  ? 31  LYS A CE  1 
ATOM   259  N  NZ  . LYS A 1 32  ? 38.443  10.375  0.758   1.00 61.63  ? 31  LYS A NZ  1 
ATOM   260  N  N   . TYR A 1 33  ? 37.508  14.335  7.118   1.00 45.61  ? 32  TYR A N   1 
ATOM   261  C  CA  . TYR A 1 33  ? 37.900  14.923  8.391   1.00 45.91  ? 32  TYR A CA  1 
ATOM   262  C  C   . TYR A 1 33  ? 39.051  14.145  9.023   1.00 46.51  ? 32  TYR A C   1 
ATOM   263  O  O   . TYR A 1 33  ? 38.965  12.925  9.209   1.00 48.25  ? 32  TYR A O   1 
ATOM   264  C  CB  . TYR A 1 33  ? 36.707  14.956  9.349   1.00 45.93  ? 32  TYR A CB  1 
ATOM   265  C  CG  . TYR A 1 33  ? 35.620  15.935  8.960   1.00 42.98  ? 32  TYR A CG  1 
ATOM   266  C  CD1 . TYR A 1 33  ? 34.508  15.522  8.230   1.00 44.43  ? 32  TYR A CD1 1 
ATOM   267  C  CD2 . TYR A 1 33  ? 35.701  17.269  9.334   1.00 40.31  ? 32  TYR A CD2 1 
ATOM   268  C  CE1 . TYR A 1 33  ? 33.497  16.422  7.884   1.00 44.39  ? 32  TYR A CE1 1 
ATOM   269  C  CE2 . TYR A 1 33  ? 34.702  18.171  8.994   1.00 43.17  ? 32  TYR A CE2 1 
ATOM   270  C  CZ  . TYR A 1 33  ? 33.606  17.741  8.271   1.00 44.39  ? 32  TYR A CZ  1 
ATOM   271  O  OH  . TYR A 1 33  ? 32.630  18.646  7.945   1.00 43.79  ? 32  TYR A OH  1 
ATOM   272  N  N   . THR A 1 34  ? 40.123  14.852  9.357   1.00 46.52  ? 33  THR A N   1 
ATOM   273  C  CA  . THR A 1 34  ? 41.281  14.219  9.962   1.00 47.26  ? 33  THR A CA  1 
ATOM   274  C  C   . THR A 1 34  ? 41.190  14.186  11.484  1.00 48.02  ? 33  THR A C   1 
ATOM   275  O  O   . THR A 1 34  ? 40.871  15.187  12.129  1.00 49.27  ? 33  THR A O   1 
ATOM   276  C  CB  . THR A 1 34  ? 42.589  14.908  9.521   1.00 47.95  ? 33  THR A CB  1 
ATOM   277  O  OG1 . THR A 1 34  ? 42.770  14.726  8.108   1.00 52.81  ? 33  THR A OG1 1 
ATOM   278  C  CG2 . THR A 1 34  ? 43.789  14.308  10.247  1.00 48.22  ? 33  THR A CG2 1 
ATOM   279  N  N   . MET A 1 35  ? 41.426  13.004  12.042  1.00 49.65  ? 34  MET A N   1 
ATOM   280  C  CA  . MET A 1 35  ? 41.402  12.808  13.485  1.00 49.11  ? 34  MET A CA  1 
ATOM   281  C  C   . MET A 1 35  ? 42.841  12.889  14.008  1.00 49.46  ? 34  MET A C   1 
ATOM   282  O  O   . MET A 1 35  ? 43.769  12.370  13.379  1.00 43.79  ? 34  MET A O   1 
ATOM   283  C  CB  . MET A 1 35  ? 40.800  11.443  13.810  1.00 49.70  ? 34  MET A CB  1 
ATOM   284  C  CG  . MET A 1 35  ? 40.630  11.165  15.288  1.00 49.88  ? 34  MET A CG  1 
ATOM   285  S  SD  . MET A 1 35  ? 40.063  9.480   15.563  1.00 54.50  ? 34  MET A SD  1 
ATOM   286  C  CE  . MET A 1 35  ? 38.300  9.650   15.249  1.00 53.81  ? 34  MET A CE  1 
ATOM   287  N  N   . GLY A 1 36  ? 43.024  13.563  15.140  1.00 49.80  ? 35  GLY A N   1 
ATOM   288  C  CA  . GLY A 1 36  ? 44.348  13.709  15.721  1.00 52.49  ? 35  GLY A CA  1 
ATOM   289  C  C   . GLY A 1 36  ? 44.922  12.411  16.259  1.00 52.46  ? 35  GLY A C   1 
ATOM   290  O  O   . GLY A 1 36  ? 44.180  11.473  16.554  1.00 46.67  ? 35  GLY A O   1 
ATOM   291  N  N   . ASP A 1 37  ? 46.248  12.356  16.369  1.00 53.78  ? 36  ASP A N   1 
ATOM   292  C  CA  . ASP A 1 37  ? 46.938  11.172  16.880  1.00 54.25  ? 36  ASP A CA  1 
ATOM   293  C  C   . ASP A 1 37  ? 46.703  10.985  18.377  1.00 55.83  ? 36  ASP A C   1 
ATOM   294  O  O   . ASP A 1 37  ? 46.258  11.910  19.070  1.00 57.43  ? 36  ASP A O   1 
ATOM   295  C  CB  . ASP A 1 37  ? 48.444  11.273  16.610  1.00 51.70  ? 36  ASP A CB  1 
ATOM   296  C  CG  . ASP A 1 37  ? 48.792  11.117  15.144  1.00 58.31  ? 36  ASP A CG  1 
ATOM   297  O  OD1 . ASP A 1 37  ? 49.618  11.910  14.646  1.00 64.13  ? 36  ASP A OD1 1 
ATOM   298  O  OD2 . ASP A 1 37  ? 48.251  10.197  14.490  1.00 60.00  ? 36  ASP A OD2 1 
ATOM   299  N  N   . ALA A 1 38  ? 46.979  9.780   18.867  1.00 56.30  ? 37  ALA A N   1 
ATOM   300  C  CA  . ALA A 1 38  ? 46.830  9.470   20.283  1.00 58.57  ? 37  ALA A CA  1 
ATOM   301  C  C   . ALA A 1 38  ? 47.788  10.350  21.090  1.00 61.54  ? 37  ALA A C   1 
ATOM   302  O  O   . ALA A 1 38  ? 48.750  10.903  20.548  1.00 62.52  ? 37  ALA A O   1 
ATOM   303  C  CB  . ALA A 1 38  ? 47.124  7.994   20.540  1.00 55.52  ? 37  ALA A CB  1 
ATOM   304  N  N   . PRO A 1 39  ? 47.563  10.463  22.406  1.00 63.31  ? 38  PRO A N   1 
ATOM   305  C  CA  . PRO A 1 39  ? 46.484  9.817   23.158  1.00 61.81  ? 38  PRO A CA  1 
ATOM   306  C  C   . PRO A 1 39  ? 45.171  10.605  23.118  1.00 62.24  ? 38  PRO A C   1 
ATOM   307  O  O   . PRO A 1 39  ? 44.130  10.104  23.544  1.00 57.37  ? 38  PRO A O   1 
ATOM   308  C  CB  . PRO A 1 39  ? 47.060  9.764   24.569  1.00 60.38  ? 38  PRO A CB  1 
ATOM   309  C  CG  . PRO A 1 39  ? 47.770  11.080  24.662  1.00 63.51  ? 38  PRO A CG  1 
ATOM   310  C  CD  . PRO A 1 39  ? 48.465  11.201  23.315  1.00 64.56  ? 38  PRO A CD  1 
ATOM   311  N  N   . ASP A 1 40  ? 45.238  11.829  22.598  1.00 63.36  ? 39  ASP A N   1 
ATOM   312  C  CA  . ASP A 1 40  ? 44.083  12.714  22.511  1.00 61.93  ? 39  ASP A CA  1 
ATOM   313  C  C   . ASP A 1 40  ? 43.013  12.339  21.491  1.00 58.94  ? 39  ASP A C   1 
ATOM   314  O  O   . ASP A 1 40  ? 41.818  12.425  21.784  1.00 53.73  ? 39  ASP A O   1 
ATOM   315  C  CB  . ASP A 1 40  ? 44.545  14.151  22.250  1.00 68.64  ? 39  ASP A CB  1 
ATOM   316  C  CG  . ASP A 1 40  ? 44.920  14.887  23.522  1.00 72.09  ? 39  ASP A CG  1 
ATOM   317  O  OD1 . ASP A 1 40  ? 44.767  16.127  23.553  1.00 74.71  ? 39  ASP A OD1 1 
ATOM   318  O  OD2 . ASP A 1 40  ? 45.364  14.235  24.491  1.00 75.65  ? 39  ASP A OD2 1 
ATOM   319  N  N   . TYR A 1 41  ? 43.437  11.942  20.295  1.00 56.94  ? 40  TYR A N   1 
ATOM   320  C  CA  . TYR A 1 41  ? 42.500  11.598  19.231  1.00 53.87  ? 40  TYR A CA  1 
ATOM   321  C  C   . TYR A 1 41  ? 41.585  12.796  18.994  1.00 53.23  ? 40  TYR A C   1 
ATOM   322  O  O   . TYR A 1 41  ? 40.363  12.658  18.921  1.00 48.28  ? 40  TYR A O   1 
ATOM   323  C  CB  . TYR A 1 41  ? 41.688  10.362  19.609  1.00 52.15  ? 40  TYR A CB  1 
ATOM   324  C  CG  . TYR A 1 41  ? 42.503  9.095   19.680  1.00 48.92  ? 40  TYR A CG  1 
ATOM   325  C  CD1 . TYR A 1 41  ? 43.244  8.657   18.586  1.00 47.44  ? 40  TYR A CD1 1 
ATOM   326  C  CD2 . TYR A 1 41  ? 42.494  8.306   20.823  1.00 51.07  ? 40  TYR A CD2 1 
ATOM   327  C  CE1 . TYR A 1 41  ? 43.950  7.457   18.631  1.00 43.49  ? 40  TYR A CE1 1 
ATOM   328  C  CE2 . TYR A 1 41  ? 43.194  7.108   20.878  1.00 45.57  ? 40  TYR A CE2 1 
ATOM   329  C  CZ  . TYR A 1 41  ? 43.916  6.688   19.782  1.00 45.87  ? 40  TYR A CZ  1 
ATOM   330  O  OH  . TYR A 1 41  ? 44.591  5.492   19.849  1.00 47.89  ? 40  TYR A OH  1 
ATOM   331  N  N   . ASP A 1 42  ? 42.201  13.972  18.894  1.00 54.06  ? 41  ASP A N   1 
ATOM   332  C  CA  . ASP A 1 42  ? 41.496  15.229  18.689  1.00 50.69  ? 41  ASP A CA  1 
ATOM   333  C  C   . ASP A 1 42  ? 40.538  15.179  17.514  1.00 49.39  ? 41  ASP A C   1 
ATOM   334  O  O   . ASP A 1 42  ? 40.935  14.895  16.385  1.00 49.14  ? 41  ASP A O   1 
ATOM   335  C  CB  . ASP A 1 42  ? 42.502  16.360  18.501  1.00 49.83  ? 41  ASP A CB  1 
ATOM   336  C  CG  . ASP A 1 42  ? 41.836  17.692  18.275  1.00 46.16  ? 41  ASP A CG  1 
ATOM   337  O  OD1 . ASP A 1 42  ? 40.998  18.084  19.111  1.00 31.16  ? 41  ASP A OD1 1 
ATOM   338  O  OD2 . ASP A 1 42  ? 42.153  18.345  17.258  1.00 47.87  ? 41  ASP A OD2 1 
ATOM   339  N  N   . ARG A 1 43  ? 39.275  15.472  17.800  1.00 48.82  ? 42  ARG A N   1 
ATOM   340  C  CA  . ARG A 1 43  ? 38.219  15.454  16.802  1.00 49.95  ? 42  ARG A CA  1 
ATOM   341  C  C   . ARG A 1 43  ? 37.626  16.847  16.598  1.00 50.03  ? 42  ARG A C   1 
ATOM   342  O  O   . ARG A 1 43  ? 36.490  16.978  16.158  1.00 49.89  ? 42  ARG A O   1 
ATOM   343  C  CB  . ARG A 1 43  ? 37.131  14.492  17.262  1.00 49.51  ? 42  ARG A CB  1 
ATOM   344  C  CG  . ARG A 1 43  ? 37.615  13.078  17.510  1.00 54.15  ? 42  ARG A CG  1 
ATOM   345  C  CD  . ARG A 1 43  ? 36.587  12.252  18.283  1.00 58.79  ? 42  ARG A CD  1 
ATOM   346  N  NE  . ARG A 1 43  ? 35.199  12.685  18.135  1.00 65.10  ? 42  ARG A NE  1 
ATOM   347  C  CZ  . ARG A 1 43  ? 34.226  11.964  17.578  1.00 69.27  ? 42  ARG A CZ  1 
ATOM   348  N  NH1 . ARG A 1 43  ? 34.460  10.747  17.079  1.00 65.90  ? 42  ARG A NH1 1 
ATOM   349  N  NH2 . ARG A 1 43  ? 32.991  12.442  17.557  1.00 67.16  ? 42  ARG A NH2 1 
ATOM   350  N  N   . SER A 1 44  ? 38.398  17.883  16.910  1.00 53.01  ? 43  SER A N   1 
ATOM   351  C  CA  . SER A 1 44  ? 37.927  19.261  16.775  1.00 52.29  ? 43  SER A CA  1 
ATOM   352  C  C   . SER A 1 44  ? 37.648  19.686  15.346  1.00 52.44  ? 43  SER A C   1 
ATOM   353  O  O   . SER A 1 44  ? 36.771  20.512  15.105  1.00 51.35  ? 43  SER A O   1 
ATOM   354  C  CB  . SER A 1 44  ? 38.930  20.234  17.392  1.00 52.52  ? 43  SER A CB  1 
ATOM   355  O  OG  . SER A 1 44  ? 40.191  20.173  16.735  1.00 53.54  ? 43  SER A OG  1 
ATOM   356  N  N   . GLN A 1 45  ? 38.406  19.136  14.399  1.00 52.08  ? 44  GLN A N   1 
ATOM   357  C  CA  . GLN A 1 45  ? 38.231  19.478  12.991  1.00 51.66  ? 44  GLN A CA  1 
ATOM   358  C  C   . GLN A 1 45  ? 36.768  19.284  12.579  1.00 48.14  ? 44  GLN A C   1 
ATOM   359  O  O   . GLN A 1 45  ? 36.235  20.041  11.770  1.00 49.93  ? 44  GLN A O   1 
ATOM   360  C  CB  . GLN A 1 45  ? 39.168  18.639  12.109  1.00 53.01  ? 44  GLN A CB  1 
ATOM   361  C  CG  . GLN A 1 45  ? 39.450  19.268  10.742  1.00 58.95  ? 44  GLN A CG  1 
ATOM   362  C  CD  . GLN A 1 45  ? 40.425  18.468  9.889   1.00 64.77  ? 44  GLN A CD  1 
ATOM   363  O  OE1 . GLN A 1 45  ? 41.546  18.175  10.308  1.00 64.60  ? 44  GLN A OE1 1 
ATOM   364  N  NE2 . GLN A 1 45  ? 40.008  18.137  8.672   1.00 66.93  ? 44  GLN A NE2 1 
ATOM   365  N  N   . TRP A 1 46  ? 36.133  18.268  13.157  1.00 43.65  ? 45  TRP A N   1 
ATOM   366  C  CA  . TRP A 1 46  ? 34.733  17.946  12.897  1.00 37.93  ? 45  TRP A CA  1 
ATOM   367  C  C   . TRP A 1 46  ? 33.813  18.682  13.865  1.00 37.97  ? 45  TRP A C   1 
ATOM   368  O  O   . TRP A 1 46  ? 32.832  19.289  13.438  1.00 35.31  ? 45  TRP A O   1 
ATOM   369  C  CB  . TRP A 1 46  ? 34.527  16.425  12.989  1.00 33.04  ? 45  TRP A CB  1 
ATOM   370  C  CG  . TRP A 1 46  ? 33.119  15.925  13.321  1.00 29.76  ? 45  TRP A CG  1 
ATOM   371  C  CD1 . TRP A 1 46  ? 32.777  15.092  14.354  1.00 28.61  ? 45  TRP A CD1 1 
ATOM   372  C  CD2 . TRP A 1 46  ? 31.902  16.149  12.581  1.00 24.79  ? 45  TRP A CD2 1 
ATOM   373  N  NE1 . TRP A 1 46  ? 31.436  14.778  14.294  1.00 27.31  ? 45  TRP A NE1 1 
ATOM   374  C  CE2 . TRP A 1 46  ? 30.879  15.411  13.219  1.00 24.11  ? 45  TRP A CE2 1 
ATOM   375  C  CE3 . TRP A 1 46  ? 31.582  16.900  11.441  1.00 21.11  ? 45  TRP A CE3 1 
ATOM   376  C  CZ2 . TRP A 1 46  ? 29.565  15.399  12.756  1.00 24.24  ? 45  TRP A CZ2 1 
ATOM   377  C  CZ3 . TRP A 1 46  ? 30.267  16.886  10.984  1.00 25.00  ? 45  TRP A CZ3 1 
ATOM   378  C  CH2 . TRP A 1 46  ? 29.278  16.139  11.644  1.00 24.90  ? 45  TRP A CH2 1 
ATOM   379  N  N   . LEU A 1 47  ? 34.154  18.654  15.152  1.00 37.50  ? 46  LEU A N   1 
ATOM   380  C  CA  . LEU A 1 47  ? 33.342  19.290  16.185  1.00 37.24  ? 46  LEU A CA  1 
ATOM   381  C  C   . LEU A 1 47  ? 33.173  20.790  16.013  1.00 34.89  ? 46  LEU A C   1 
ATOM   382  O  O   . LEU A 1 47  ? 32.193  21.373  16.491  1.00 33.39  ? 46  LEU A O   1 
ATOM   383  C  CB  . LEU A 1 47  ? 33.899  18.968  17.576  1.00 39.78  ? 46  LEU A CB  1 
ATOM   384  C  CG  . LEU A 1 47  ? 34.019  17.479  17.944  1.00 36.77  ? 46  LEU A CG  1 
ATOM   385  C  CD1 . LEU A 1 47  ? 34.605  17.333  19.335  1.00 35.70  ? 46  LEU A CD1 1 
ATOM   386  C  CD2 . LEU A 1 47  ? 32.674  16.787  17.865  1.00 32.31  ? 46  LEU A CD2 1 
ATOM   387  N  N   . ASN A 1 48  ? 34.128  21.414  15.336  1.00 35.48  ? 47  ASN A N   1 
ATOM   388  C  CA  . ASN A 1 48  ? 34.080  22.851  15.090  1.00 44.01  ? 47  ASN A CA  1 
ATOM   389  C  C   . ASN A 1 48  ? 33.238  23.138  13.836  1.00 47.38  ? 47  ASN A C   1 
ATOM   390  O  O   . ASN A 1 48  ? 33.313  24.227  13.256  1.00 47.72  ? 47  ASN A O   1 
ATOM   391  C  CB  . ASN A 1 48  ? 35.502  23.402  14.889  1.00 50.11  ? 47  ASN A CB  1 
ATOM   392  C  CG  . ASN A 1 48  ? 36.331  23.420  16.175  1.00 50.32  ? 47  ASN A CG  1 
ATOM   393  O  OD1 . ASN A 1 48  ? 36.054  22.694  17.134  1.00 56.11  ? 47  ASN A OD1 1 
ATOM   394  N  ND2 . ASN A 1 48  ? 37.354  24.269  16.195  1.00 48.94  ? 47  ASN A ND2 1 
ATOM   395  N  N   . GLU A 1 49  ? 32.395  22.184  13.454  1.00 47.26  ? 48  GLU A N   1 
ATOM   396  C  CA  . GLU A 1 49  ? 31.581  22.323  12.254  1.00 42.91  ? 48  GLU A CA  1 
ATOM   397  C  C   . GLU A 1 49  ? 30.360  21.411  12.338  1.00 41.18  ? 48  GLU A C   1 
ATOM   398  O  O   . GLU A 1 49  ? 29.429  21.518  11.542  1.00 41.75  ? 48  GLU A O   1 
ATOM   399  C  CB  . GLU A 1 49  ? 32.446  21.921  11.053  1.00 41.20  ? 48  GLU A CB  1 
ATOM   400  C  CG  . GLU A 1 49  ? 32.006  22.438  9.696   1.00 45.35  ? 48  GLU A CG  1 
ATOM   401  C  CD  . GLU A 1 49  ? 33.010  22.090  8.603   1.00 50.77  ? 48  GLU A CD  1 
ATOM   402  O  OE1 . GLU A 1 49  ? 32.621  21.434  7.610   1.00 58.80  ? 48  GLU A OE1 1 
ATOM   403  O  OE2 . GLU A 1 49  ? 34.196  22.467  8.744   1.00 50.35  ? 48  GLU A OE2 1 
ATOM   404  N  N   . LYS A 1 50  ? 30.358  20.539  13.335  1.00 37.22  ? 49  LYS A N   1 
ATOM   405  C  CA  . LYS A 1 50  ? 29.286  19.573  13.540  1.00 37.04  ? 49  LYS A CA  1 
ATOM   406  C  C   . LYS A 1 50  ? 27.881  20.161  13.544  1.00 38.33  ? 49  LYS A C   1 
ATOM   407  O  O   . LYS A 1 50  ? 26.959  19.612  12.927  1.00 38.46  ? 49  LYS A O   1 
ATOM   408  C  CB  . LYS A 1 50  ? 29.518  18.824  14.854  1.00 34.00  ? 49  LYS A CB  1 
ATOM   409  C  CG  . LYS A 1 50  ? 28.518  17.723  15.137  1.00 33.58  ? 49  LYS A CG  1 
ATOM   410  C  CD  . LYS A 1 50  ? 28.881  16.949  16.387  1.00 36.13  ? 49  LYS A CD  1 
ATOM   411  C  CE  . LYS A 1 50  ? 28.033  15.703  16.520  1.00 33.99  ? 49  LYS A CE  1 
ATOM   412  N  NZ  . LYS A 1 50  ? 28.499  14.819  17.625  1.00 32.14  ? 49  LYS A NZ  1 
ATOM   413  N  N   . PHE A 1 51  ? 27.710  21.262  14.261  1.00 36.59  ? 50  PHE A N   1 
ATOM   414  C  CA  . PHE A 1 51  ? 26.398  21.877  14.372  1.00 33.46  ? 50  PHE A CA  1 
ATOM   415  C  C   . PHE A 1 51  ? 26.127  23.054  13.427  1.00 32.47  ? 50  PHE A C   1 
ATOM   416  O  O   . PHE A 1 51  ? 25.075  23.693  13.516  1.00 26.24  ? 50  PHE A O   1 
ATOM   417  C  CB  . PHE A 1 51  ? 26.144  22.262  15.836  1.00 36.56  ? 50  PHE A CB  1 
ATOM   418  C  CG  . PHE A 1 51  ? 26.292  21.105  16.801  1.00 38.35  ? 50  PHE A CG  1 
ATOM   419  C  CD1 . PHE A 1 51  ? 27.504  20.871  17.449  1.00 39.35  ? 50  PHE A CD1 1 
ATOM   420  C  CD2 . PHE A 1 51  ? 25.233  20.228  17.032  1.00 38.98  ? 50  PHE A CD2 1 
ATOM   421  C  CE1 . PHE A 1 51  ? 27.662  19.780  18.309  1.00 38.66  ? 50  PHE A CE1 1 
ATOM   422  C  CE2 . PHE A 1 51  ? 25.379  19.133  17.890  1.00 37.41  ? 50  PHE A CE2 1 
ATOM   423  C  CZ  . PHE A 1 51  ? 26.597  18.910  18.528  1.00 36.62  ? 50  PHE A CZ  1 
ATOM   424  N  N   . LYS A 1 52  ? 27.060  23.333  12.519  1.00 35.75  ? 51  LYS A N   1 
ATOM   425  C  CA  . LYS A 1 52  ? 26.882  24.434  11.578  1.00 43.88  ? 51  LYS A CA  1 
ATOM   426  C  C   . LYS A 1 52  ? 26.414  23.999  10.189  1.00 47.66  ? 51  LYS A C   1 
ATOM   427  O  O   . LYS A 1 52  ? 26.072  24.835  9.351   1.00 55.27  ? 51  LYS A O   1 
ATOM   428  C  CB  . LYS A 1 52  ? 28.174  25.238  11.431  1.00 47.60  ? 51  LYS A CB  1 
ATOM   429  C  CG  . LYS A 1 52  ? 28.583  26.071  12.637  1.00 55.13  ? 51  LYS A CG  1 
ATOM   430  C  CD  . LYS A 1 52  ? 29.523  25.313  13.562  1.00 55.57  ? 51  LYS A CD  1 
ATOM   431  C  CE  . LYS A 1 52  ? 30.285  26.264  14.486  1.00 54.97  ? 51  LYS A CE  1 
ATOM   432  N  NZ  . LYS A 1 52  ? 31.366  27.023  13.784  1.00 48.87  ? 51  LYS A NZ  1 
ATOM   433  N  N   . LEU A 1 53  ? 26.411  22.699  9.935   1.00 42.16  ? 52  LEU A N   1 
ATOM   434  C  CA  . LEU A 1 53  ? 26.005  22.188  8.637   1.00 37.05  ? 52  LEU A CA  1 
ATOM   435  C  C   . LEU A 1 53  ? 24.495  22.113  8.428   1.00 35.34  ? 52  LEU A C   1 
ATOM   436  O  O   . LEU A 1 53  ? 24.023  21.811  7.329   1.00 34.26  ? 52  LEU A O   1 
ATOM   437  C  CB  . LEU A 1 53  ? 26.649  20.826  8.407   1.00 36.53  ? 52  LEU A CB  1 
ATOM   438  C  CG  . LEU A 1 53  ? 28.167  20.888  8.514   1.00 32.67  ? 52  LEU A CG  1 
ATOM   439  C  CD1 . LEU A 1 53  ? 28.753  19.491  8.472   1.00 36.32  ? 52  LEU A CD1 1 
ATOM   440  C  CD2 . LEU A 1 53  ? 28.731  21.778  7.411   1.00 32.35  ? 52  LEU A CD2 1 
ATOM   441  N  N   . GLY A 1 54  ? 23.736  22.399  9.478   1.00 35.29  ? 53  GLY A N   1 
ATOM   442  C  CA  . GLY A 1 54  ? 22.291  22.350  9.364   1.00 37.30  ? 53  GLY A CA  1 
ATOM   443  C  C   . GLY A 1 54  ? 21.740  20.939  9.298   1.00 38.49  ? 53  GLY A C   1 
ATOM   444  O  O   . GLY A 1 54  ? 20.656  20.717  8.758   1.00 37.39  ? 53  GLY A O   1 
ATOM   445  N  N   . LEU A 1 55  ? 22.497  19.977  9.813   1.00 38.50  ? 54  LEU A N   1 
ATOM   446  C  CA  . LEU A 1 55  ? 22.048  18.592  9.824   1.00 37.37  ? 54  LEU A CA  1 
ATOM   447  C  C   . LEU A 1 55  ? 21.069  18.438  10.979  1.00 35.07  ? 54  LEU A C   1 
ATOM   448  O  O   . LEU A 1 55  ? 21.248  19.051  12.034  1.00 36.55  ? 54  LEU A O   1 
ATOM   449  C  CB  . LEU A 1 55  ? 23.230  17.648  10.034  1.00 39.63  ? 54  LEU A CB  1 
ATOM   450  C  CG  . LEU A 1 55  ? 24.336  17.659  8.979   1.00 41.58  ? 54  LEU A CG  1 
ATOM   451  C  CD1 . LEU A 1 55  ? 25.528  16.852  9.465   1.00 43.40  ? 54  LEU A CD1 1 
ATOM   452  C  CD2 . LEU A 1 55  ? 23.814  17.098  7.682   1.00 39.95  ? 54  LEU A CD2 1 
ATOM   453  N  N   . ASP A 1 56  ? 20.046  17.616  10.793  1.00 38.55  ? 55  ASP A N   1 
ATOM   454  C  CA  . ASP A 1 56  ? 19.056  17.406  11.848  1.00 39.80  ? 55  ASP A CA  1 
ATOM   455  C  C   . ASP A 1 56  ? 19.661  16.685  13.040  1.00 41.01  ? 55  ASP A C   1 
ATOM   456  O  O   . ASP A 1 56  ? 19.500  17.107  14.181  1.00 41.03  ? 55  ASP A O   1 
ATOM   457  C  CB  . ASP A 1 56  ? 17.853  16.646  11.301  1.00 42.33  ? 55  ASP A CB  1 
ATOM   458  C  CG  . ASP A 1 56  ? 17.075  17.463  10.300  1.00 44.81  ? 55  ASP A CG  1 
ATOM   459  O  OD1 . ASP A 1 56  ? 16.308  18.345  10.746  1.00 48.15  ? 55  ASP A OD1 1 
ATOM   460  O  OD2 . ASP A 1 56  ? 17.256  17.254  9.077   1.00 45.68  ? 55  ASP A OD2 1 
ATOM   461  N  N   . PHE A 1 57  ? 20.346  15.581  12.769  1.00 38.43  ? 56  PHE A N   1 
ATOM   462  C  CA  . PHE A 1 57  ? 21.014  14.804  13.811  1.00 34.48  ? 56  PHE A CA  1 
ATOM   463  C  C   . PHE A 1 57  ? 22.482  14.715  13.409  1.00 33.43  ? 56  PHE A C   1 
ATOM   464  O  O   . PHE A 1 57  ? 22.930  13.703  12.862  1.00 38.52  ? 56  PHE A O   1 
ATOM   465  C  CB  . PHE A 1 57  ? 20.397  13.409  13.918  1.00 31.52  ? 56  PHE A CB  1 
ATOM   466  C  CG  . PHE A 1 57  ? 18.962  13.418  14.357  1.00 30.02  ? 56  PHE A CG  1 
ATOM   467  C  CD1 . PHE A 1 57  ? 18.637  13.505  15.704  1.00 31.46  ? 56  PHE A CD1 1 
ATOM   468  C  CD2 . PHE A 1 57  ? 17.934  13.357  13.425  1.00 32.35  ? 56  PHE A CD2 1 
ATOM   469  C  CE1 . PHE A 1 57  ? 17.313  13.531  16.118  1.00 33.60  ? 56  PHE A CE1 1 
ATOM   470  C  CE2 . PHE A 1 57  ? 16.606  13.382  13.830  1.00 37.79  ? 56  PHE A CE2 1 
ATOM   471  C  CZ  . PHE A 1 57  ? 16.295  13.470  15.181  1.00 33.90  ? 56  PHE A CZ  1 
ATOM   472  N  N   . PRO A 1 58  ? 23.251  15.789  13.670  1.00 29.60  ? 57  PRO A N   1 
ATOM   473  C  CA  . PRO A 1 58  ? 24.674  15.879  13.342  1.00 27.77  ? 57  PRO A CA  1 
ATOM   474  C  C   . PRO A 1 58  ? 25.422  14.588  13.579  1.00 28.62  ? 57  PRO A C   1 
ATOM   475  O  O   . PRO A 1 58  ? 25.448  14.069  14.704  1.00 29.56  ? 57  PRO A O   1 
ATOM   476  C  CB  . PRO A 1 58  ? 25.154  16.994  14.256  1.00 28.77  ? 57  PRO A CB  1 
ATOM   477  C  CG  . PRO A 1 58  ? 24.003  17.926  14.233  1.00 30.63  ? 57  PRO A CG  1 
ATOM   478  C  CD  . PRO A 1 58  ? 22.831  16.976  14.430  1.00 29.70  ? 57  PRO A CD  1 
ATOM   479  N  N   . ASN A 1 59  ? 26.008  14.062  12.505  1.00 26.51  ? 58  ASN A N   1 
ATOM   480  C  CA  . ASN A 1 59  ? 26.755  12.814  12.584  1.00 24.00  ? 58  ASN A CA  1 
ATOM   481  C  C   . ASN A 1 59  ? 27.562  12.572  11.313  1.00 24.30  ? 58  ASN A C   1 
ATOM   482  O  O   . ASN A 1 59  ? 27.416  13.287  10.322  1.00 32.17  ? 58  ASN A O   1 
ATOM   483  C  CB  . ASN A 1 59  ? 25.783  11.645  12.807  1.00 21.23  ? 58  ASN A CB  1 
ATOM   484  C  CG  . ASN A 1 59  ? 26.439  10.449  13.488  1.00 20.87  ? 58  ASN A CG  1 
ATOM   485  O  OD1 . ASN A 1 59  ? 27.661  10.320  13.521  1.00 18.88  ? 58  ASN A OD1 1 
ATOM   486  N  ND2 . ASN A 1 59  ? 25.618  9.574   14.052  1.00 18.10  ? 58  ASN A ND2 1 
ATOM   487  N  N   . LEU A 1 60  ? 28.420  11.560  11.364  1.00 26.85  ? 59  LEU A N   1 
ATOM   488  C  CA  . LEU A 1 60  ? 29.257  11.151  10.245  1.00 27.61  ? 59  LEU A CA  1 
ATOM   489  C  C   . LEU A 1 60  ? 28.953  9.690   9.950   1.00 29.90  ? 59  LEU A C   1 
ATOM   490  O  O   . LEU A 1 60  ? 28.995  8.857   10.857  1.00 29.01  ? 59  LEU A O   1 
ATOM   491  C  CB  . LEU A 1 60  ? 30.728  11.272  10.623  1.00 27.41  ? 59  LEU A CB  1 
ATOM   492  C  CG  . LEU A 1 60  ? 31.241  12.699  10.787  1.00 33.32  ? 59  LEU A CG  1 
ATOM   493  C  CD1 . LEU A 1 60  ? 32.634  12.666  11.350  1.00 32.44  ? 59  LEU A CD1 1 
ATOM   494  C  CD2 . LEU A 1 60  ? 31.231  13.413  9.448   1.00 32.36  ? 59  LEU A CD2 1 
ATOM   495  N  N   . PRO A 1 61  ? 28.720  9.336   8.677   1.00 33.30  ? 60  PRO A N   1 
ATOM   496  C  CA  . PRO A 1 61  ? 28.740  10.210  7.507   1.00 29.41  ? 60  PRO A CA  1 
ATOM   497  C  C   . PRO A 1 61  ? 27.492  11.058  7.337   1.00 25.03  ? 60  PRO A C   1 
ATOM   498  O  O   . PRO A 1 61  ? 26.453  10.804  7.956   1.00 23.94  ? 60  PRO A O   1 
ATOM   499  C  CB  . PRO A 1 61  ? 28.847  9.216   6.361   1.00 26.72  ? 60  PRO A CB  1 
ATOM   500  C  CG  . PRO A 1 61  ? 27.994  8.100   6.837   1.00 26.16  ? 60  PRO A CG  1 
ATOM   501  C  CD  . PRO A 1 61  ? 28.449  7.943   8.274   1.00 32.43  ? 60  PRO A CD  1 
ATOM   502  N  N   . TYR A 1 62  ? 27.623  12.073  6.499   1.00 24.27  ? 61  TYR A N   1 
ATOM   503  C  CA  . TYR A 1 62  ? 26.523  12.942  6.186   1.00 26.66  ? 61  TYR A CA  1 
ATOM   504  C  C   . TYR A 1 62  ? 26.608  13.228  4.694   1.00 27.53  ? 61  TYR A C   1 
ATOM   505  O  O   . TYR A 1 62  ? 27.673  13.077  4.085   1.00 21.20  ? 61  TYR A O   1 
ATOM   506  C  CB  . TYR A 1 62  ? 26.593  14.230  7.006   1.00 23.45  ? 61  TYR A CB  1 
ATOM   507  C  CG  . TYR A 1 62  ? 27.744  15.147  6.668   1.00 27.39  ? 61  TYR A CG  1 
ATOM   508  C  CD1 . TYR A 1 62  ? 27.738  15.914  5.503   1.00 26.75  ? 61  TYR A CD1 1 
ATOM   509  C  CD2 . TYR A 1 62  ? 28.816  15.296  7.542   1.00 29.96  ? 61  TYR A CD2 1 
ATOM   510  C  CE1 . TYR A 1 62  ? 28.768  16.807  5.219   1.00 29.99  ? 61  TYR A CE1 1 
ATOM   511  C  CE2 . TYR A 1 62  ? 29.851  16.190  7.269   1.00 28.23  ? 61  TYR A CE2 1 
ATOM   512  C  CZ  . TYR A 1 62  ? 29.816  16.942  6.109   1.00 26.94  ? 61  TYR A CZ  1 
ATOM   513  O  OH  . TYR A 1 62  ? 30.805  17.852  5.849   1.00 23.69  ? 61  TYR A OH  1 
ATOM   514  N  N   . LEU A 1 63  ? 25.477  13.575  4.094   1.00 32.45  ? 62  LEU A N   1 
ATOM   515  C  CA  . LEU A 1 63  ? 25.435  13.893  2.675   1.00 30.70  ? 62  LEU A CA  1 
ATOM   516  C  C   . LEU A 1 63  ? 24.641  15.156  2.450   1.00 26.47  ? 62  LEU A C   1 
ATOM   517  O  O   . LEU A 1 63  ? 23.542  15.313  2.978   1.00 21.73  ? 62  LEU A O   1 
ATOM   518  C  CB  . LEU A 1 63  ? 24.791  12.772  1.876   1.00 26.54  ? 62  LEU A CB  1 
ATOM   519  C  CG  . LEU A 1 63  ? 24.850  13.057  0.372   1.00 26.98  ? 62  LEU A CG  1 
ATOM   520  C  CD1 . LEU A 1 63  ? 26.309  13.000  -0.108  1.00 17.69  ? 62  LEU A CD1 1 
ATOM   521  C  CD2 . LEU A 1 63  ? 23.987  12.054  -0.379  1.00 30.55  ? 62  LEU A CD2 1 
ATOM   522  N  N   . ILE A 1 64  ? 25.205  16.062  1.670   1.00 29.32  ? 63  ILE A N   1 
ATOM   523  C  CA  . ILE A 1 64  ? 24.526  17.304  1.371   1.00 39.85  ? 63  ILE A CA  1 
ATOM   524  C  C   . ILE A 1 64  ? 24.244  17.433  -0.118  1.00 39.39  ? 63  ILE A C   1 
ATOM   525  O  O   . ILE A 1 64  ? 25.153  17.576  -0.938  1.00 40.72  ? 63  ILE A O   1 
ATOM   526  C  CB  . ILE A 1 64  ? 25.322  18.511  1.881   1.00 43.91  ? 63  ILE A CB  1 
ATOM   527  C  CG1 . ILE A 1 64  ? 25.489  18.394  3.401   1.00 45.56  ? 63  ILE A CG1 1 
ATOM   528  C  CG2 . ILE A 1 64  ? 24.603  19.804  1.522   1.00 47.16  ? 63  ILE A CG2 1 
ATOM   529  C  CD1 . ILE A 1 64  ? 26.195  19.560  4.037   1.00 50.48  ? 63  ILE A CD1 1 
ATOM   530  N  N   . ASP A 1 65  ? 22.970  17.322  -0.461  1.00 40.64  ? 64  ASP A N   1 
ATOM   531  C  CA  . ASP A 1 65  ? 22.540  17.433  -1.837  1.00 44.00  ? 64  ASP A CA  1 
ATOM   532  C  C   . ASP A 1 65  ? 21.626  18.638  -1.937  1.00 46.05  ? 64  ASP A C   1 
ATOM   533  O  O   . ASP A 1 65  ? 20.410  18.518  -1.816  1.00 46.30  ? 64  ASP A O   1 
ATOM   534  C  CB  . ASP A 1 65  ? 21.810  16.157  -2.262  1.00 46.63  ? 64  ASP A CB  1 
ATOM   535  C  CG  . ASP A 1 65  ? 21.484  16.127  -3.751  1.00 46.34  ? 64  ASP A CG  1 
ATOM   536  O  OD1 . ASP A 1 65  ? 22.002  16.971  -4.518  1.00 53.11  ? 64  ASP A OD1 1 
ATOM   537  O  OD2 . ASP A 1 65  ? 20.709  15.240  -4.159  1.00 42.75  ? 64  ASP A OD2 1 
ATOM   538  N  N   . GLY A 1 66  ? 22.227  19.803  -2.153  1.00 49.19  ? 65  GLY A N   1 
ATOM   539  C  CA  . GLY A 1 66  ? 21.457  21.025  -2.266  1.00 52.11  ? 65  GLY A CA  1 
ATOM   540  C  C   . GLY A 1 66  ? 20.814  21.401  -0.949  1.00 53.92  ? 65  GLY A C   1 
ATOM   541  O  O   . GLY A 1 66  ? 21.496  21.816  -0.014  1.00 55.71  ? 65  GLY A O   1 
ATOM   542  N  N   . ALA A 1 67  ? 19.495  21.278  -0.882  1.00 56.32  ? 66  ALA A N   1 
ATOM   543  C  CA  . ALA A 1 67  ? 18.754  21.603  0.328   1.00 55.94  ? 66  ALA A CA  1 
ATOM   544  C  C   . ALA A 1 67  ? 18.599  20.383  1.222   1.00 54.41  ? 66  ALA A C   1 
ATOM   545  O  O   . ALA A 1 67  ? 18.087  20.488  2.336   1.00 56.78  ? 66  ALA A O   1 
ATOM   546  C  CB  . ALA A 1 67  ? 17.387  22.157  -0.027  1.00 57.37  ? 66  ALA A CB  1 
ATOM   547  N  N   . HIS A 1 68  ? 19.015  19.224  0.726   1.00 52.90  ? 67  HIS A N   1 
ATOM   548  C  CA  . HIS A 1 68  ? 18.909  17.996  1.491   1.00 49.46  ? 67  HIS A CA  1 
ATOM   549  C  C   . HIS A 1 68  ? 20.157  17.642  2.285   1.00 45.77  ? 67  HIS A C   1 
ATOM   550  O  O   . HIS A 1 68  ? 21.188  17.306  1.718   1.00 44.14  ? 67  HIS A O   1 
ATOM   551  C  CB  . HIS A 1 68  ? 18.525  16.847  0.578   1.00 52.99  ? 67  HIS A CB  1 
ATOM   552  C  CG  . HIS A 1 68  ? 17.170  16.987  -0.043  1.00 60.09  ? 67  HIS A CG  1 
ATOM   553  N  ND1 . HIS A 1 68  ? 16.002  16.858  0.677   1.00 63.80  ? 67  HIS A ND1 1 
ATOM   554  C  CD2 . HIS A 1 68  ? 16.798  17.261  -1.316  1.00 59.45  ? 67  HIS A CD2 1 
ATOM   555  C  CE1 . HIS A 1 68  ? 14.968  17.049  -0.125  1.00 58.55  ? 67  HIS A CE1 1 
ATOM   556  N  NE2 . HIS A 1 68  ? 15.424  17.294  -1.340  1.00 57.21  ? 67  HIS A NE2 1 
ATOM   557  N  N   . LYS A 1 69  ? 20.056  17.754  3.605   1.00 43.54  ? 68  LYS A N   1 
ATOM   558  C  CA  . LYS A 1 69  ? 21.150  17.417  4.512   1.00 41.89  ? 68  LYS A CA  1 
ATOM   559  C  C   . LYS A 1 69  ? 20.787  16.084  5.155   1.00 38.74  ? 68  LYS A C   1 
ATOM   560  O  O   . LYS A 1 69  ? 19.837  16.008  5.931   1.00 38.02  ? 68  LYS A O   1 
ATOM   561  C  CB  . LYS A 1 69  ? 21.290  18.483  5.597   1.00 47.63  ? 68  LYS A CB  1 
ATOM   562  C  CG  . LYS A 1 69  ? 21.909  19.795  5.141   1.00 52.33  ? 68  LYS A CG  1 
ATOM   563  C  CD  . LYS A 1 69  ? 20.981  20.592  4.252   1.00 53.65  ? 68  LYS A CD  1 
ATOM   564  C  CE  . LYS A 1 69  ? 21.624  21.906  3.844   1.00 58.83  ? 68  LYS A CE  1 
ATOM   565  N  NZ  . LYS A 1 69  ? 21.943  22.744  5.031   1.00 63.37  ? 68  LYS A NZ  1 
ATOM   566  N  N   . ILE A 1 70  ? 21.547  15.038  4.863   1.00 34.18  ? 69  ILE A N   1 
ATOM   567  C  CA  . ILE A 1 70  ? 21.237  13.718  5.407   1.00 33.65  ? 69  ILE A CA  1 
ATOM   568  C  C   . ILE A 1 70  ? 22.341  13.088  6.246   1.00 28.94  ? 69  ILE A C   1 
ATOM   569  O  O   . ILE A 1 70  ? 23.518  13.334  6.016   1.00 24.89  ? 69  ILE A O   1 
ATOM   570  C  CB  . ILE A 1 70  ? 20.920  12.754  4.269   1.00 35.86  ? 69  ILE A CB  1 
ATOM   571  C  CG1 . ILE A 1 70  ? 19.828  13.349  3.387   1.00 34.24  ? 69  ILE A CG1 1 
ATOM   572  C  CG2 . ILE A 1 70  ? 20.502  11.401  4.803   1.00 34.51  ? 69  ILE A CG2 1 
ATOM   573  C  CD1 . ILE A 1 70  ? 19.555  12.550  2.156   1.00 39.21  ? 69  ILE A CD1 1 
ATOM   574  N  N   . THR A 1 71  ? 21.943  12.288  7.231   1.00 27.60  ? 70  THR A N   1 
ATOM   575  C  CA  . THR A 1 71  ? 22.880  11.579  8.099   1.00 30.49  ? 70  THR A CA  1 
ATOM   576  C  C   . THR A 1 71  ? 22.381  10.144  8.202   1.00 31.41  ? 70  THR A C   1 
ATOM   577  O  O   . THR A 1 71  ? 21.274  9.837   7.740   1.00 30.50  ? 70  THR A O   1 
ATOM   578  C  CB  . THR A 1 71  ? 22.974  12.199  9.507   1.00 27.97  ? 70  THR A CB  1 
ATOM   579  O  OG1 . THR A 1 71  ? 21.677  12.218  10.108  1.00 32.28  ? 70  THR A OG1 1 
ATOM   580  C  CG2 . THR A 1 71  ? 23.541  13.633  9.439   1.00 29.84  ? 70  THR A CG2 1 
ATOM   581  N  N   . GLN A 1 72  ? 23.187  9.277   8.811   1.00 34.39  ? 71  GLN A N   1 
ATOM   582  C  CA  . GLN A 1 72  ? 22.861  7.858   8.955   1.00 33.08  ? 71  GLN A CA  1 
ATOM   583  C  C   . GLN A 1 72  ? 23.158  7.168   7.638   1.00 31.52  ? 71  GLN A C   1 
ATOM   584  O  O   . GLN A 1 72  ? 22.436  7.356   6.660   1.00 30.26  ? 71  GLN A O   1 
ATOM   585  C  CB  . GLN A 1 72  ? 21.396  7.648   9.339   1.00 34.98  ? 71  GLN A CB  1 
ATOM   586  C  CG  . GLN A 1 72  ? 21.064  8.058   10.776  1.00 41.05  ? 71  GLN A CG  1 
ATOM   587  C  CD  . GLN A 1 72  ? 21.622  7.144   11.852  1.00 39.56  ? 71  GLN A CD  1 
ATOM   588  O  OE1 . GLN A 1 72  ? 21.898  5.958   11.620  1.00 38.84  ? 71  GLN A OE1 1 
ATOM   589  N  NE2 . GLN A 1 72  ? 21.781  7.690   13.043  1.00 40.95  ? 71  GLN A NE2 1 
ATOM   590  N  N   . SER A 1 73  ? 24.217  6.362   7.626   1.00 29.54  ? 72  SER A N   1 
ATOM   591  C  CA  . SER A 1 73  ? 24.640  5.669   6.415   1.00 29.58  ? 72  SER A CA  1 
ATOM   592  C  C   . SER A 1 73  ? 23.539  5.025   5.587   1.00 27.95  ? 72  SER A C   1 
ATOM   593  O  O   . SER A 1 73  ? 23.379  5.358   4.414   1.00 29.06  ? 72  SER A O   1 
ATOM   594  C  CB  . SER A 1 73  ? 25.764  4.660   6.716   1.00 26.58  ? 72  SER A CB  1 
ATOM   595  O  OG  . SER A 1 73  ? 25.376  3.649   7.624   1.00 35.67  ? 72  SER A OG  1 
ATOM   596  N  N   . ASN A 1 74  ? 22.756  4.143   6.192   1.00 25.34  ? 73  ASN A N   1 
ATOM   597  C  CA  . ASN A 1 74  ? 21.692  3.472   5.453   1.00 26.57  ? 73  ASN A CA  1 
ATOM   598  C  C   . ASN A 1 74  ? 20.672  4.430   4.843   1.00 25.28  ? 73  ASN A C   1 
ATOM   599  O  O   . ASN A 1 74  ? 20.060  4.124   3.824   1.00 30.92  ? 73  ASN A O   1 
ATOM   600  C  CB  . ASN A 1 74  ? 21.007  2.435   6.334   1.00 25.56  ? 73  ASN A CB  1 
ATOM   601  C  CG  . ASN A 1 74  ? 21.872  1.217   6.570   1.00 23.30  ? 73  ASN A CG  1 
ATOM   602  O  OD1 . ASN A 1 74  ? 22.963  1.101   6.016   1.00 18.65  ? 73  ASN A OD1 1 
ATOM   603  N  ND2 . ASN A 1 74  ? 21.379  0.288   7.375   1.00 23.03  ? 73  ASN A ND2 1 
ATOM   604  N  N   . ALA A 1 75  ? 20.497  5.590   5.464   1.00 29.34  ? 74  ALA A N   1 
ATOM   605  C  CA  . ALA A 1 75  ? 19.561  6.597   4.982   1.00 24.91  ? 74  ALA A CA  1 
ATOM   606  C  C   . ALA A 1 75  ? 20.137  7.251   3.739   1.00 26.73  ? 74  ALA A C   1 
ATOM   607  O  O   . ALA A 1 75  ? 19.421  7.491   2.756   1.00 28.66  ? 74  ALA A O   1 
ATOM   608  C  CB  . ALA A 1 75  ? 19.320  7.638   6.045   1.00 26.39  ? 74  ALA A CB  1 
ATOM   609  N  N   . ILE A 1 76  ? 21.423  7.584   3.817   1.00 23.93  ? 75  ILE A N   1 
ATOM   610  C  CA  . ILE A 1 76  ? 22.145  8.202   2.714   1.00 25.28  ? 75  ILE A CA  1 
ATOM   611  C  C   . ILE A 1 76  ? 22.131  7.267   1.500   1.00 27.90  ? 75  ILE A C   1 
ATOM   612  O  O   . ILE A 1 76  ? 21.909  7.705   0.379   1.00 33.56  ? 75  ILE A O   1 
ATOM   613  C  CB  . ILE A 1 76  ? 23.586  8.532   3.148   1.00 22.94  ? 75  ILE A CB  1 
ATOM   614  C  CG1 . ILE A 1 76  ? 23.548  9.576   4.271   1.00 26.99  ? 75  ILE A CG1 1 
ATOM   615  C  CG2 . ILE A 1 76  ? 24.390  9.042   1.979   1.00 14.17  ? 75  ILE A CG2 1 
ATOM   616  C  CD1 . ILE A 1 76  ? 24.889  9.903   4.872   1.00 18.34  ? 75  ILE A CD1 1 
ATOM   617  N  N   . LEU A 1 77  ? 22.351  5.978   1.730   1.00 28.21  ? 76  LEU A N   1 
ATOM   618  C  CA  . LEU A 1 77  ? 22.335  4.990   0.658   1.00 31.75  ? 76  LEU A CA  1 
ATOM   619  C  C   . LEU A 1 77  ? 20.969  4.918   -0.030  1.00 34.96  ? 76  LEU A C   1 
ATOM   620  O  O   . LEU A 1 77  ? 20.895  4.883   -1.257  1.00 37.72  ? 76  LEU A O   1 
ATOM   621  C  CB  . LEU A 1 77  ? 22.704  3.604   1.199   1.00 23.91  ? 76  LEU A CB  1 
ATOM   622  C  CG  . LEU A 1 77  ? 24.154  3.320   1.605   1.00 23.89  ? 76  LEU A CG  1 
ATOM   623  C  CD1 . LEU A 1 77  ? 24.247  1.962   2.286   1.00 29.80  ? 76  LEU A CD1 1 
ATOM   624  C  CD2 . LEU A 1 77  ? 25.076  3.361   0.390   1.00 19.51  ? 76  LEU A CD2 1 
ATOM   625  N  N   . CYS A 1 78  ? 19.895  4.833   0.752   1.00 37.79  ? 77  CYS A N   1 
ATOM   626  C  CA  . CYS A 1 78  ? 18.551  4.766   0.181   1.00 43.06  ? 77  CYS A CA  1 
ATOM   627  C  C   . CYS A 1 78  ? 18.270  6.014   -0.627  1.00 39.49  ? 77  CYS A C   1 
ATOM   628  O  O   . CYS A 1 78  ? 17.588  5.957   -1.644  1.00 37.06  ? 77  CYS A O   1 
ATOM   629  C  CB  . CYS A 1 78  ? 17.487  4.652   1.272   1.00 46.73  ? 77  CYS A CB  1 
ATOM   630  S  SG  . CYS A 1 78  ? 17.333  3.039   2.021   1.00 69.01  ? 77  CYS A SG  1 
ATOM   631  N  N   . TYR A 1 79  ? 18.753  7.147   -0.131  1.00 35.95  ? 78  TYR A N   1 
ATOM   632  C  CA  . TYR A 1 79  ? 18.558  8.422   -0.798  1.00 31.29  ? 78  TYR A CA  1 
ATOM   633  C  C   . TYR A 1 79  ? 19.124  8.368   -2.209  1.00 28.14  ? 78  TYR A C   1 
ATOM   634  O  O   . TYR A 1 79  ? 18.451  8.716   -3.180  1.00 21.90  ? 78  TYR A O   1 
ATOM   635  C  CB  . TYR A 1 79  ? 19.252  9.531   -0.014  1.00 30.99  ? 78  TYR A CB  1 
ATOM   636  C  CG  . TYR A 1 79  ? 19.085  10.895  -0.629  1.00 28.14  ? 78  TYR A CG  1 
ATOM   637  C  CD1 . TYR A 1 79  ? 17.849  11.535  -0.619  1.00 27.06  ? 78  TYR A CD1 1 
ATOM   638  C  CD2 . TYR A 1 79  ? 20.162  11.554  -1.226  1.00 31.37  ? 78  TYR A CD2 1 
ATOM   639  C  CE1 . TYR A 1 79  ? 17.683  12.792  -1.187  1.00 34.68  ? 78  TYR A CE1 1 
ATOM   640  C  CE2 . TYR A 1 79  ? 20.007  12.818  -1.799  1.00 33.48  ? 78  TYR A CE2 1 
ATOM   641  C  CZ  . TYR A 1 79  ? 18.764  13.425  -1.774  1.00 33.75  ? 78  TYR A CZ  1 
ATOM   642  O  OH  . TYR A 1 79  ? 18.588  14.658  -2.345  1.00 40.29  ? 78  TYR A OH  1 
ATOM   643  N  N   . ILE A 1 80  ? 20.383  7.960   -2.301  1.00 26.99  ? 79  ILE A N   1 
ATOM   644  C  CA  . ILE A 1 80  ? 21.078  7.843   -3.570  1.00 32.19  ? 79  ILE A CA  1 
ATOM   645  C  C   . ILE A 1 80  ? 20.426  6.757   -4.434  1.00 34.59  ? 79  ILE A C   1 
ATOM   646  O  O   . ILE A 1 80  ? 20.198  6.957   -5.627  1.00 36.27  ? 79  ILE A O   1 
ATOM   647  C  CB  . ILE A 1 80  ? 22.586  7.525   -3.327  1.00 32.15  ? 79  ILE A CB  1 
ATOM   648  C  CG1 . ILE A 1 80  ? 23.213  8.625   -2.470  1.00 34.12  ? 79  ILE A CG1 1 
ATOM   649  C  CG2 . ILE A 1 80  ? 23.352  7.419   -4.648  1.00 31.89  ? 79  ILE A CG2 1 
ATOM   650  C  CD1 . ILE A 1 80  ? 24.592  8.281   -1.956  1.00 46.32  ? 79  ILE A CD1 1 
ATOM   651  N  N   . ALA A 1 81  ? 20.144  5.609   -3.827  1.00 33.58  ? 80  ALA A N   1 
ATOM   652  C  CA  . ALA A 1 81  ? 19.530  4.490   -4.527  1.00 37.26  ? 80  ALA A CA  1 
ATOM   653  C  C   . ALA A 1 81  ? 18.186  4.845   -5.158  1.00 40.55  ? 80  ALA A C   1 
ATOM   654  O  O   . ALA A 1 81  ? 17.907  4.443   -6.293  1.00 39.37  ? 80  ALA A O   1 
ATOM   655  C  CB  . ALA A 1 81  ? 19.370  3.310   -3.585  1.00 36.45  ? 80  ALA A CB  1 
ATOM   656  N  N   . ARG A 1 82  ? 17.346  5.568   -4.421  1.00 41.69  ? 81  ARG A N   1 
ATOM   657  C  CA  . ARG A 1 82  ? 16.034  5.955   -4.932  1.00 46.16  ? 81  ARG A CA  1 
ATOM   658  C  C   . ARG A 1 82  ? 16.120  6.730   -6.238  1.00 49.08  ? 81  ARG A C   1 
ATOM   659  O  O   . ARG A 1 82  ? 15.255  6.590   -7.102  1.00 52.44  ? 81  ARG A O   1 
ATOM   660  C  CB  . ARG A 1 82  ? 15.248  6.765   -3.895  1.00 48.41  ? 81  ARG A CB  1 
ATOM   661  C  CG  . ARG A 1 82  ? 14.464  5.909   -2.906  1.00 55.74  ? 81  ARG A CG  1 
ATOM   662  C  CD  . ARG A 1 82  ? 13.423  6.736   -2.155  1.00 63.48  ? 81  ARG A CD  1 
ATOM   663  N  NE  . ARG A 1 82  ? 14.024  7.773   -1.317  1.00 70.03  ? 81  ARG A NE  1 
ATOM   664  C  CZ  . ARG A 1 82  ? 14.467  7.570   -0.082  1.00 72.61  ? 81  ARG A CZ  1 
ATOM   665  N  NH1 . ARG A 1 82  ? 14.381  6.362   0.470   1.00 74.44  ? 81  ARG A NH1 1 
ATOM   666  N  NH2 . ARG A 1 82  ? 14.993  8.577   0.602   1.00 73.11  ? 81  ARG A NH2 1 
ATOM   667  N  N   . LYS A 1 83  ? 17.144  7.571   -6.361  1.00 48.15  ? 82  LYS A N   1 
ATOM   668  C  CA  . LYS A 1 83  ? 17.352  8.371   -7.563  1.00 48.82  ? 82  LYS A CA  1 
ATOM   669  C  C   . LYS A 1 83  ? 17.718  7.504   -8.764  1.00 49.17  ? 82  LYS A C   1 
ATOM   670  O  O   . LYS A 1 83  ? 17.744  8.000   -9.892  1.00 47.96  ? 82  LYS A O   1 
ATOM   671  C  CB  . LYS A 1 83  ? 18.482  9.381   -7.361  1.00 47.68  ? 82  LYS A CB  1 
ATOM   672  C  CG  . LYS A 1 83  ? 18.229  10.457  -6.336  1.00 49.51  ? 82  LYS A CG  1 
ATOM   673  C  CD  . LYS A 1 83  ? 19.436  11.384  -6.262  1.00 50.32  ? 82  LYS A CD  1 
ATOM   674  C  CE  . LYS A 1 83  ? 19.231  12.499  -5.255  1.00 52.19  ? 82  LYS A CE  1 
ATOM   675  N  NZ  . LYS A 1 83  ? 18.016  13.311  -5.549  1.00 52.57  ? 82  LYS A NZ  1 
ATOM   676  N  N   . HIS A 1 84  ? 18.069  6.242   -8.519  1.00 50.69  ? 83  HIS A N   1 
ATOM   677  C  CA  . HIS A 1 84  ? 18.461  5.333   -9.592  1.00 50.76  ? 83  HIS A CA  1 
ATOM   678  C  C   . HIS A 1 84  ? 17.748  3.984   -9.539  1.00 53.53  ? 83  HIS A C   1 
ATOM   679  O  O   . HIS A 1 84  ? 18.223  3.004   -10.122 1.00 51.62  ? 83  HIS A O   1 
ATOM   680  C  CB  . HIS A 1 84  ? 19.980  5.133   -9.586  1.00 49.58  ? 83  HIS A CB  1 
ATOM   681  C  CG  . HIS A 1 84  ? 20.753  6.412   -9.694  1.00 49.16  ? 83  HIS A CG  1 
ATOM   682  N  ND1 . HIS A 1 84  ? 20.900  7.286   -8.637  1.00 49.12  ? 83  HIS A ND1 1 
ATOM   683  C  CD2 . HIS A 1 84  ? 21.444  6.953   -10.726 1.00 49.55  ? 83  HIS A CD2 1 
ATOM   684  C  CE1 . HIS A 1 84  ? 21.652  8.306   -9.014  1.00 49.28  ? 83  HIS A CE1 1 
ATOM   685  N  NE2 . HIS A 1 84  ? 21.995  8.128   -10.276 1.00 49.79  ? 83  HIS A NE2 1 
ATOM   686  N  N   . ASN A 1 85  ? 16.605  3.948   -8.859  1.00 57.72  ? 84  ASN A N   1 
ATOM   687  C  CA  . ASN A 1 85  ? 15.788  2.743   -8.725  1.00 63.68  ? 84  ASN A CA  1 
ATOM   688  C  C   . ASN A 1 85  ? 16.576  1.507   -8.319  1.00 63.27  ? 84  ASN A C   1 
ATOM   689  O  O   . ASN A 1 85  ? 16.504  0.452   -8.963  1.00 61.69  ? 84  ASN A O   1 
ATOM   690  C  CB  . ASN A 1 85  ? 15.042  2.436   -10.019 1.00 71.36  ? 84  ASN A CB  1 
ATOM   691  C  CG  . ASN A 1 85  ? 13.885  3.396   -10.171 1.00 79.69  ? 84  ASN A CG  1 
ATOM   692  O  OD1 . ASN A 1 85  ? 14.005  4.429   -10.831 1.00 82.73  ? 84  ASN A OD1 1 
ATOM   693  N  ND2 . ASN A 1 85  ? 12.749  3.058   -9.568  1.00 81.92  ? 84  ASN A ND2 1 
ATOM   694  N  N   . LEU A 1 86  ? 17.306  1.652   -7.220  1.00 61.66  ? 85  LEU A N   1 
ATOM   695  C  CA  . LEU A 1 86  ? 18.121  0.578   -6.679  1.00 58.46  ? 85  LEU A CA  1 
ATOM   696  C  C   . LEU A 1 86  ? 17.686  0.256   -5.258  1.00 58.15  ? 85  LEU A C   1 
ATOM   697  O  O   . LEU A 1 86  ? 18.460  -0.290  -4.476  1.00 57.12  ? 85  LEU A O   1 
ATOM   698  C  CB  . LEU A 1 86  ? 19.598  0.975   -6.705  1.00 53.35  ? 85  LEU A CB  1 
ATOM   699  C  CG  . LEU A 1 86  ? 20.142  1.220   -8.111  1.00 50.88  ? 85  LEU A CG  1 
ATOM   700  C  CD1 . LEU A 1 86  ? 21.537  1.807   -8.056  1.00 49.74  ? 85  LEU A CD1 1 
ATOM   701  C  CD2 . LEU A 1 86  ? 20.122  -0.083  -8.897  1.00 55.43  ? 85  LEU A CD2 1 
ATOM   702  N  N   . CYS A 1 87  ? 16.448  0.610   -4.927  1.00 61.18  ? 86  CYS A N   1 
ATOM   703  C  CA  . CYS A 1 87  ? 15.912  0.350   -3.597  1.00 64.27  ? 86  CYS A CA  1 
ATOM   704  C  C   . CYS A 1 87  ? 14.966  -0.850  -3.583  1.00 67.83  ? 86  CYS A C   1 
ATOM   705  O  O   . CYS A 1 87  ? 14.463  -1.232  -2.525  1.00 66.41  ? 86  CYS A O   1 
ATOM   706  C  CB  . CYS A 1 87  ? 15.196  1.591   -3.057  1.00 65.50  ? 86  CYS A CB  1 
ATOM   707  S  SG  . CYS A 1 87  ? 15.886  2.246   -1.503  1.00 64.20  ? 86  CYS A SG  1 
ATOM   708  N  N   . GLY A 1 88  ? 14.759  -1.463  -4.745  1.00 71.50  ? 87  GLY A N   1 
ATOM   709  C  CA  . GLY A 1 88  ? 13.873  -2.608  -4.833  1.00 76.57  ? 87  GLY A CA  1 
ATOM   710  C  C   . GLY A 1 88  ? 12.550  -2.227  -5.465  1.00 79.83  ? 87  GLY A C   1 
ATOM   711  O  O   . GLY A 1 88  ? 12.158  -1.056  -5.446  1.00 80.86  ? 87  GLY A O   1 
ATOM   712  N  N   . GLU A 1 89  ? 11.871  -3.214  -6.042  1.00 81.72  ? 88  GLU A N   1 
ATOM   713  C  CA  . GLU A 1 89  ? 10.592  -2.984  -6.700  1.00 80.39  ? 88  GLU A CA  1 
ATOM   714  C  C   . GLU A 1 89  ? 9.513   -3.949  -6.228  1.00 77.99  ? 88  GLU A C   1 
ATOM   715  O  O   . GLU A 1 89  ? 8.469   -3.516  -5.746  1.00 77.98  ? 88  GLU A O   1 
ATOM   716  C  CB  . GLU A 1 89  ? 10.756  -3.081  -8.217  1.00 84.97  ? 88  GLU A CB  1 
ATOM   717  C  CG  . GLU A 1 89  ? 11.080  -1.694  -8.728  1.00 91.39  ? 88  GLU A CG  1 
ATOM   718  C  CD  . GLU A 1 89  ? 12.270  -1.623  -9.666  1.00 95.46  ? 88  GLU A CD  1 
ATOM   719  O  OE1 . GLU A 1 89  ? 12.765  -2.690  -10.093 1.00 94.86  ? 88  GLU A OE1 1 
ATOM   720  O  OE2 . GLU A 1 89  ? 12.717  -0.496  -9.970  1.00 94.50  ? 88  GLU A OE2 1 
ATOM   721  N  N   . THR A 1 90  ? 9.740   -5.249  -6.391  1.00 76.38  ? 89  THR A N   1 
ATOM   722  C  CA  . THR A 1 90  ? 8.747   -6.226  -5.956  1.00 78.59  ? 89  THR A CA  1 
ATOM   723  C  C   . THR A 1 90  ? 8.656   -6.237  -4.439  1.00 77.54  ? 89  THR A C   1 
ATOM   724  O  O   . THR A 1 90  ? 9.451   -5.591  -3.760  1.00 75.83  ? 89  THR A O   1 
ATOM   725  C  CB  . THR A 1 90  ? 9.046   -7.660  -6.479  1.00 81.30  ? 89  THR A CB  1 
ATOM   726  O  OG1 . THR A 1 90  ? 10.257  -8.165  -5.905  1.00 84.47  ? 89  THR A OG1 1 
ATOM   727  C  CG2 . THR A 1 90  ? 9.178   -7.658  -7.991  1.00 82.28  ? 89  THR A CG2 1 
ATOM   728  N  N   . GLU A 1 91  ? 7.646   -6.915  -3.909  1.00 78.91  ? 90  GLU A N   1 
ATOM   729  C  CA  . GLU A 1 91  ? 7.481   -6.993  -2.464  1.00 80.63  ? 90  GLU A CA  1 
ATOM   730  C  C   . GLU A 1 91  ? 8.647   -7.761  -1.861  1.00 80.69  ? 90  GLU A C   1 
ATOM   731  O  O   . GLU A 1 91  ? 9.248   -7.313  -0.886  1.00 80.94  ? 90  GLU A O   1 
ATOM   732  C  CB  . GLU A 1 91  ? 6.149   -7.664  -2.102  1.00 83.26  ? 90  GLU A CB  1 
ATOM   733  C  CG  . GLU A 1 91  ? 5.917   -7.907  -0.592  1.00 89.67  ? 90  GLU A CG  1 
ATOM   734  C  CD  . GLU A 1 91  ? 5.939   -6.634  0.264   1.00 91.94  ? 90  GLU A CD  1 
ATOM   735  O  OE1 . GLU A 1 91  ? 5.643   -5.534  -0.256  1.00 92.80  ? 90  GLU A OE1 1 
ATOM   736  O  OE2 . GLU A 1 91  ? 6.246   -6.740  1.473   1.00 91.05  ? 90  GLU A OE2 1 
ATOM   737  N  N   . GLU A 1 92  ? 8.954   -8.921  -2.437  1.00 79.71  ? 91  GLU A N   1 
ATOM   738  C  CA  . GLU A 1 92  ? 10.055  -9.734  -1.945  1.00 79.13  ? 91  GLU A CA  1 
ATOM   739  C  C   . GLU A 1 92  ? 11.395  -9.015  -2.028  1.00 76.08  ? 91  GLU A C   1 
ATOM   740  O  O   . GLU A 1 92  ? 12.259  -9.228  -1.177  1.00 76.89  ? 91  GLU A O   1 
ATOM   741  C  CB  . GLU A 1 92  ? 10.117  -11.083 -2.667  1.00 85.60  ? 91  GLU A CB  1 
ATOM   742  C  CG  . GLU A 1 92  ? 9.523   -12.257 -1.861  1.00 93.34  ? 91  GLU A CG  1 
ATOM   743  C  CD  . GLU A 1 92  ? 10.362  -12.655 -0.638  1.00 97.24  ? 91  GLU A CD  1 
ATOM   744  O  OE1 . GLU A 1 92  ? 11.589  -12.868 -0.788  1.00 99.13  ? 91  GLU A OE1 1 
ATOM   745  O  OE2 . GLU A 1 92  ? 9.788   -12.770 0.471   1.00 97.43  ? 91  GLU A OE2 1 
ATOM   746  N  N   . GLU A 1 93  ? 11.579  -8.180  -3.048  1.00 70.78  ? 92  GLU A N   1 
ATOM   747  C  CA  . GLU A 1 93  ? 12.829  -7.440  -3.176  1.00 63.38  ? 92  GLU A CA  1 
ATOM   748  C  C   . GLU A 1 93  ? 13.003  -6.502  -1.987  1.00 57.84  ? 92  GLU A C   1 
ATOM   749  O  O   . GLU A 1 93  ? 14.065  -6.465  -1.362  1.00 56.98  ? 92  GLU A O   1 
ATOM   750  C  CB  . GLU A 1 93  ? 12.885  -6.638  -4.482  1.00 61.99  ? 92  GLU A CB  1 
ATOM   751  C  CG  . GLU A 1 93  ? 13.322  -7.438  -5.706  1.00 65.78  ? 92  GLU A CG  1 
ATOM   752  C  CD  . GLU A 1 93  ? 13.609  -6.596  -6.941  1.00 67.98  ? 92  GLU A CD  1 
ATOM   753  O  OE1 . GLU A 1 93  ? 14.541  -6.944  -7.693  1.00 69.01  ? 92  GLU A OE1 1 
ATOM   754  O  OE2 . GLU A 1 93  ? 12.908  -5.586  -7.158  1.00 68.97  ? 92  GLU A OE2 1 
ATOM   755  N  N   . LYS A 1 94  ? 11.949  -5.764  -1.663  1.00 53.32  ? 93  LYS A N   1 
ATOM   756  C  CA  . LYS A 1 94  ? 11.985  -4.815  -0.557  1.00 51.29  ? 93  LYS A CA  1 
ATOM   757  C  C   . LYS A 1 94  ? 12.221  -5.481  0.796   1.00 47.58  ? 93  LYS A C   1 
ATOM   758  O  O   . LYS A 1 94  ? 12.858  -4.910  1.681   1.00 46.56  ? 93  LYS A O   1 
ATOM   759  C  CB  . LYS A 1 94  ? 10.699  -3.990  -0.542  1.00 53.16  ? 93  LYS A CB  1 
ATOM   760  C  CG  . LYS A 1 94  ? 10.515  -3.169  -1.810  1.00 60.91  ? 93  LYS A CG  1 
ATOM   761  C  CD  . LYS A 1 94  ? 9.258   -2.310  -1.782  1.00 63.51  ? 93  LYS A CD  1 
ATOM   762  C  CE  . LYS A 1 94  ? 9.163   -1.441  -3.036  1.00 65.16  ? 93  LYS A CE  1 
ATOM   763  N  NZ  . LYS A 1 94  ? 7.949   -0.572  -3.046  1.00 67.64  ? 93  LYS A NZ  1 
ATOM   764  N  N   . ILE A 1 95  ? 11.685  -6.680  0.963   1.00 44.94  ? 94  ILE A N   1 
ATOM   765  C  CA  . ILE A 1 95  ? 11.853  -7.410  2.203   1.00 40.83  ? 94  ILE A CA  1 
ATOM   766  C  C   . ILE A 1 95  ? 13.326  -7.764  2.374   1.00 42.69  ? 94  ILE A C   1 
ATOM   767  O  O   . ILE A 1 95  ? 13.914  -7.532  3.436   1.00 43.22  ? 94  ILE A O   1 
ATOM   768  C  CB  . ILE A 1 95  ? 10.996  -8.692  2.208   1.00 40.44  ? 94  ILE A CB  1 
ATOM   769  C  CG1 . ILE A 1 95  ? 9.513   -8.320  2.129   1.00 38.80  ? 94  ILE A CG1 1 
ATOM   770  C  CG2 . ILE A 1 95  ? 11.276  -9.525  3.457   1.00 42.33  ? 94  ILE A CG2 1 
ATOM   771  C  CD1 . ILE A 1 95  ? 8.577   -9.511  2.058   1.00 44.97  ? 94  ILE A CD1 1 
ATOM   772  N  N   . ARG A 1 96  ? 13.911  -8.341  1.329   1.00 42.94  ? 95  ARG A N   1 
ATOM   773  C  CA  . ARG A 1 96  ? 15.316  -8.733  1.347   1.00 42.86  ? 95  ARG A CA  1 
ATOM   774  C  C   . ARG A 1 96  ? 16.211  -7.515  1.567   1.00 41.84  ? 95  ARG A C   1 
ATOM   775  O  O   . ARG A 1 96  ? 17.206  -7.586  2.288   1.00 48.56  ? 95  ARG A O   1 
ATOM   776  C  CB  . ARG A 1 96  ? 15.691  -9.451  0.047   1.00 40.70  ? 95  ARG A CB  1 
ATOM   777  C  CG  . ARG A 1 96  ? 14.921  -10.751 -0.187  1.00 39.82  ? 95  ARG A CG  1 
ATOM   778  C  CD  . ARG A 1 96  ? 15.239  -11.372 -1.542  1.00 35.40  ? 95  ARG A CD  1 
ATOM   779  N  NE  . ARG A 1 96  ? 16.603  -11.886 -1.599  1.00 38.97  ? 95  ARG A NE  1 
ATOM   780  C  CZ  . ARG A 1 96  ? 16.943  -13.140 -1.313  1.00 39.73  ? 95  ARG A CZ  1 
ATOM   781  N  NH1 . ARG A 1 96  ? 16.017  -14.016 -0.951  1.00 32.64  ? 95  ARG A NH1 1 
ATOM   782  N  NH2 . ARG A 1 96  ? 18.211  -13.520 -1.378  1.00 36.56  ? 95  ARG A NH2 1 
ATOM   783  N  N   . VAL A 1 97  ? 15.864  -6.401  0.937   1.00 38.09  ? 96  VAL A N   1 
ATOM   784  C  CA  . VAL A 1 97  ? 16.641  -5.181  1.104   1.00 37.93  ? 96  VAL A CA  1 
ATOM   785  C  C   . VAL A 1 97  ? 16.597  -4.747  2.566   1.00 36.43  ? 96  VAL A C   1 
ATOM   786  O  O   . VAL A 1 97  ? 17.633  -4.429  3.143   1.00 33.51  ? 96  VAL A O   1 
ATOM   787  C  CB  . VAL A 1 97  ? 16.112  -4.030  0.208   1.00 37.16  ? 96  VAL A CB  1 
ATOM   788  C  CG1 . VAL A 1 97  ? 16.774  -2.705  0.569   1.00 33.56  ? 96  VAL A CG1 1 
ATOM   789  C  CG2 . VAL A 1 97  ? 16.377  -4.339  -1.245  1.00 35.93  ? 96  VAL A CG2 1 
ATOM   790  N  N   . ASP A 1 98  ? 15.401  -4.721  3.152   1.00 34.67  ? 97  ASP A N   1 
ATOM   791  C  CA  . ASP A 1 98  ? 15.244  -4.317  4.542   1.00 38.65  ? 97  ASP A CA  1 
ATOM   792  C  C   . ASP A 1 98  ? 16.029  -5.207  5.493   1.00 41.85  ? 97  ASP A C   1 
ATOM   793  O  O   . ASP A 1 98  ? 16.742  -4.713  6.365   1.00 45.83  ? 97  ASP A O   1 
ATOM   794  C  CB  . ASP A 1 98  ? 13.771  -4.296  4.940   1.00 39.50  ? 97  ASP A CB  1 
ATOM   795  C  CG  . ASP A 1 98  ? 13.004  -3.148  4.310   1.00 46.75  ? 97  ASP A CG  1 
ATOM   796  O  OD1 . ASP A 1 98  ? 13.603  -2.084  4.055   1.00 56.53  ? 97  ASP A OD1 1 
ATOM   797  O  OD2 . ASP A 1 98  ? 11.791  -3.307  4.072   1.00 48.17  ? 97  ASP A OD2 1 
ATOM   798  N  N   . ILE A 1 99  ? 15.887  -6.517  5.343   1.00 39.31  ? 98  ILE A N   1 
ATOM   799  C  CA  . ILE A 1 99  ? 16.602  -7.433  6.214   1.00 32.77  ? 98  ILE A CA  1 
ATOM   800  C  C   . ILE A 1 99  ? 18.120  -7.248  6.136   1.00 30.10  ? 98  ILE A C   1 
ATOM   801  O  O   . ILE A 1 99  ? 18.781  -7.118  7.162   1.00 31.40  ? 98  ILE A O   1 
ATOM   802  C  CB  . ILE A 1 99  ? 16.214  -8.889  5.909   1.00 33.55  ? 98  ILE A CB  1 
ATOM   803  C  CG1 . ILE A 1 99  ? 14.738  -9.105  6.257   1.00 25.94  ? 98  ILE A CG1 1 
ATOM   804  C  CG2 . ILE A 1 99  ? 17.100  -9.866  6.690   1.00 35.52  ? 98  ILE A CG2 1 
ATOM   805  C  CD1 . ILE A 1 99  ? 14.214  -10.477 5.874   1.00 23.66  ? 98  ILE A CD1 1 
ATOM   806  N  N   . LEU A 1 100 ? 18.672  -7.265  4.924   1.00 28.13  ? 99  LEU A N   1 
ATOM   807  C  CA  . LEU A 1 100 ? 20.117  -7.101  4.732   1.00 30.66  ? 99  LEU A CA  1 
ATOM   808  C  C   . LEU A 1 100 ? 20.634  -5.742  5.196   1.00 32.71  ? 99  LEU A C   1 
ATOM   809  O  O   . LEU A 1 100 ? 21.683  -5.651  5.828   1.00 34.59  ? 99  LEU A O   1 
ATOM   810  C  CB  . LEU A 1 100 ? 20.501  -7.338  3.268   1.00 32.75  ? 99  LEU A CB  1 
ATOM   811  C  CG  . LEU A 1 100 ? 20.453  -8.804  2.812   1.00 35.41  ? 99  LEU A CG  1 
ATOM   812  C  CD1 . LEU A 1 100 ? 20.892  -8.926  1.370   1.00 31.03  ? 99  LEU A CD1 1 
ATOM   813  C  CD2 . LEU A 1 100 ? 21.345  -9.650  3.712   1.00 36.54  ? 99  LEU A CD2 1 
ATOM   814  N  N   . GLU A 1 101 ? 19.911  -4.691  4.838   1.00 34.83  ? 100 GLU A N   1 
ATOM   815  C  CA  . GLU A 1 101 ? 20.250  -3.322  5.215   1.00 36.02  ? 100 GLU A CA  1 
ATOM   816  C  C   . GLU A 1 101 ? 20.687  -3.255  6.676   1.00 34.96  ? 100 GLU A C   1 
ATOM   817  O  O   . GLU A 1 101 ? 21.638  -2.552  7.034   1.00 31.79  ? 100 GLU A O   1 
ATOM   818  C  CB  . GLU A 1 101 ? 19.008  -2.446  5.010   1.00 36.86  ? 100 GLU A CB  1 
ATOM   819  C  CG  . GLU A 1 101 ? 19.147  -0.983  5.378   1.00 45.93  ? 100 GLU A CG  1 
ATOM   820  C  CD  . GLU A 1 101 ? 17.910  -0.162  5.025   1.00 51.46  ? 100 GLU A CD  1 
ATOM   821  O  OE1 . GLU A 1 101 ? 16.815  -0.750  4.866   1.00 52.34  ? 100 GLU A OE1 1 
ATOM   822  O  OE2 . GLU A 1 101 ? 18.029  1.077   4.907   1.00 56.41  ? 100 GLU A OE2 1 
ATOM   823  N  N   . ASN A 1 102 ? 19.995  -4.030  7.506   1.00 32.51  ? 101 ASN A N   1 
ATOM   824  C  CA  . ASN A 1 102 ? 20.246  -4.070  8.940   1.00 30.89  ? 101 ASN A CA  1 
ATOM   825  C  C   . ASN A 1 102 ? 21.190  -5.194  9.355   1.00 30.97  ? 101 ASN A C   1 
ATOM   826  O  O   . ASN A 1 102 ? 21.995  -5.026  10.287  1.00 30.03  ? 101 ASN A O   1 
ATOM   827  C  CB  . ASN A 1 102 ? 18.911  -4.179  9.687   1.00 31.97  ? 101 ASN A CB  1 
ATOM   828  C  CG  . ASN A 1 102 ? 18.025  -2.954  9.490   1.00 33.51  ? 101 ASN A CG  1 
ATOM   829  O  OD1 . ASN A 1 102 ? 18.328  -1.865  9.975   1.00 41.95  ? 101 ASN A OD1 1 
ATOM   830  N  ND2 . ASN A 1 102 ? 16.908  -3.137  8.803   1.00 33.87  ? 101 ASN A ND2 1 
ATOM   831  N  N   . GLN A 1 103 ? 21.078  -6.342  8.687   1.00 30.78  ? 102 GLN A N   1 
ATOM   832  C  CA  . GLN A 1 103 ? 21.920  -7.503  8.980   1.00 33.38  ? 102 GLN A CA  1 
ATOM   833  C  C   . GLN A 1 103 ? 23.393  -7.159  8.826   1.00 36.02  ? 102 GLN A C   1 
ATOM   834  O  O   . GLN A 1 103 ? 24.215  -7.480  9.689   1.00 39.29  ? 102 GLN A O   1 
ATOM   835  C  CB  . GLN A 1 103 ? 21.592  -8.652  8.033   1.00 31.47  ? 102 GLN A CB  1 
ATOM   836  C  CG  . GLN A 1 103 ? 22.349  -9.925  8.340   1.00 34.08  ? 102 GLN A CG  1 
ATOM   837  C  CD  . GLN A 1 103 ? 21.964  -10.518 9.681   1.00 35.90  ? 102 GLN A CD  1 
ATOM   838  O  OE1 . GLN A 1 103 ? 20.927  -10.176 10.247  1.00 37.19  ? 102 GLN A OE1 1 
ATOM   839  N  NE2 . GLN A 1 103 ? 22.779  -11.448 10.178  1.00 37.72  ? 102 GLN A NE2 1 
ATOM   840  N  N   . THR A 1 104 ? 23.720  -6.548  7.692   1.00 35.47  ? 103 THR A N   1 
ATOM   841  C  CA  . THR A 1 104 ? 25.083  -6.155  7.409   1.00 32.41  ? 103 THR A CA  1 
ATOM   842  C  C   . THR A 1 104 ? 25.550  -5.183  8.475   1.00 33.46  ? 103 THR A C   1 
ATOM   843  O  O   . THR A 1 104 ? 26.664  -5.304  8.981   1.00 32.02  ? 103 THR A O   1 
ATOM   844  C  CB  . THR A 1 104 ? 25.208  -5.513  6.015   1.00 30.91  ? 103 THR A CB  1 
ATOM   845  O  OG1 . THR A 1 104 ? 24.388  -4.337  5.935   1.00 32.15  ? 103 THR A OG1 1 
ATOM   846  C  CG2 . THR A 1 104 ? 24.785  -6.502  4.940   1.00 32.66  ? 103 THR A CG2 1 
ATOM   847  N  N   . MET A 1 105 ? 24.684  -4.237  8.833   1.00 35.01  ? 104 MET A N   1 
ATOM   848  C  CA  . MET A 1 105 ? 25.009  -3.248  9.850   1.00 35.30  ? 104 MET A CA  1 
ATOM   849  C  C   . MET A 1 105 ? 25.411  -3.952  11.140  1.00 33.96  ? 104 MET A C   1 
ATOM   850  O  O   . MET A 1 105 ? 26.335  -3.526  11.822  1.00 35.00  ? 104 MET A O   1 
ATOM   851  C  CB  . MET A 1 105 ? 23.816  -2.323  10.106  1.00 39.60  ? 104 MET A CB  1 
ATOM   852  C  CG  . MET A 1 105 ? 24.054  -1.284  11.196  1.00 45.13  ? 104 MET A CG  1 
ATOM   853  S  SD  . MET A 1 105 ? 24.711  0.289   10.648  1.00 60.79  ? 104 MET A SD  1 
ATOM   854  C  CE  . MET A 1 105 ? 26.481  -0.037  10.619  1.00 40.74  ? 104 MET A CE  1 
ATOM   855  N  N   . ASP A 1 106 ? 24.699  -5.021  11.472  1.00 32.71  ? 105 ASP A N   1 
ATOM   856  C  CA  . ASP A 1 106 ? 24.982  -5.788  12.673  1.00 31.65  ? 105 ASP A CA  1 
ATOM   857  C  C   . ASP A 1 106 ? 26.340  -6.462  12.570  1.00 32.59  ? 105 ASP A C   1 
ATOM   858  O  O   . ASP A 1 106 ? 27.193  -6.287  13.438  1.00 36.04  ? 105 ASP A O   1 
ATOM   859  C  CB  . ASP A 1 106 ? 23.897  -6.846  12.907  1.00 30.50  ? 105 ASP A CB  1 
ATOM   860  C  CG  . ASP A 1 106 ? 22.607  -6.268  13.490  1.00 32.76  ? 105 ASP A CG  1 
ATOM   861  O  OD1 . ASP A 1 106 ? 22.468  -5.022  13.576  1.00 38.37  ? 105 ASP A OD1 1 
ATOM   862  O  OD2 . ASP A 1 106 ? 21.729  -7.081  13.863  1.00 33.29  ? 105 ASP A OD2 1 
ATOM   863  N  N   . ASN A 1 107 ? 26.526  -7.246  11.516  1.00 34.57  ? 106 ASN A N   1 
ATOM   864  C  CA  . ASN A 1 107 ? 27.780  -7.951  11.293  1.00 37.38  ? 106 ASN A CA  1 
ATOM   865  C  C   . ASN A 1 107 ? 28.956  -6.988  11.262  1.00 39.17  ? 106 ASN A C   1 
ATOM   866  O  O   . ASN A 1 107 ? 30.050  -7.317  11.713  1.00 40.04  ? 106 ASN A O   1 
ATOM   867  C  CB  . ASN A 1 107 ? 27.718  -8.733  9.987   1.00 39.75  ? 106 ASN A CB  1 
ATOM   868  C  CG  . ASN A 1 107 ? 26.846  -9.960  10.088  1.00 42.51  ? 106 ASN A CG  1 
ATOM   869  O  OD1 . ASN A 1 107 ? 26.166  -10.332 9.135   1.00 48.29  ? 106 ASN A OD1 1 
ATOM   870  N  ND2 . ASN A 1 107 ? 26.892  -10.627 11.237  1.00 40.68  ? 106 ASN A ND2 1 
ATOM   871  N  N   . HIS A 1 108 ? 28.730  -5.804  10.704  1.00 38.40  ? 107 HIS A N   1 
ATOM   872  C  CA  . HIS A 1 108 ? 29.770  -4.801  10.620  1.00 37.07  ? 107 HIS A CA  1 
ATOM   873  C  C   . HIS A 1 108 ? 30.159  -4.356  12.013  1.00 35.55  ? 107 HIS A C   1 
ATOM   874  O  O   . HIS A 1 108 ? 31.335  -4.212  12.307  1.00 31.66  ? 107 HIS A O   1 
ATOM   875  C  CB  . HIS A 1 108 ? 29.310  -3.608  9.777   1.00 41.32  ? 107 HIS A CB  1 
ATOM   876  C  CG  . HIS A 1 108 ? 30.344  -2.531  9.626   1.00 43.80  ? 107 HIS A CG  1 
ATOM   877  N  ND1 . HIS A 1 108 ? 31.124  -2.402  8.497   1.00 46.27  ? 107 HIS A ND1 1 
ATOM   878  C  CD2 . HIS A 1 108 ? 30.712  -1.527  10.454  1.00 47.02  ? 107 HIS A CD2 1 
ATOM   879  C  CE1 . HIS A 1 108 ? 31.928  -1.362  8.636   1.00 48.70  ? 107 HIS A CE1 1 
ATOM   880  N  NE2 . HIS A 1 108 ? 31.699  -0.812  9.814   1.00 47.05  ? 107 HIS A NE2 1 
ATOM   881  N  N   . MET A 1 109 ? 29.182  -4.118  12.871  1.00 34.64  ? 108 MET A N   1 
ATOM   882  C  CA  . MET A 1 109 ? 29.499  -3.699  14.227  1.00 37.50  ? 108 MET A CA  1 
ATOM   883  C  C   . MET A 1 109 ? 30.163  -4.788  15.039  1.00 35.85  ? 108 MET A C   1 
ATOM   884  O  O   . MET A 1 109 ? 31.014  -4.514  15.873  1.00 39.00  ? 108 MET A O   1 
ATOM   885  C  CB  . MET A 1 109 ? 28.252  -3.237  14.930  1.00 40.93  ? 108 MET A CB  1 
ATOM   886  C  CG  . MET A 1 109 ? 27.791  -1.903  14.383  1.00 47.53  ? 108 MET A CG  1 
ATOM   887  S  SD  . MET A 1 109 ? 27.329  -0.912  15.799  1.00 55.82  ? 108 MET A SD  1 
ATOM   888  C  CE  . MET A 1 109 ? 25.954  -1.844  16.455  1.00 38.23  ? 108 MET A CE  1 
ATOM   889  N  N   . GLN A 1 110 ? 29.731  -6.020  14.826  1.00 31.30  ? 109 GLN A N   1 
ATOM   890  C  CA  . GLN A 1 110 ? 30.298  -7.147  15.533  1.00 29.77  ? 109 GLN A CA  1 
ATOM   891  C  C   . GLN A 1 110 ? 31.809  -7.151  15.342  1.00 31.97  ? 109 GLN A C   1 
ATOM   892  O  O   . GLN A 1 110 ? 32.569  -7.419  16.279  1.00 33.79  ? 109 GLN A O   1 
ATOM   893  C  CB  . GLN A 1 110 ? 29.700  -8.434  14.989  1.00 30.45  ? 109 GLN A CB  1 
ATOM   894  C  CG  . GLN A 1 110 ? 28.192  -8.482  15.106  1.00 33.34  ? 109 GLN A CG  1 
ATOM   895  C  CD  . GLN A 1 110 ? 27.609  -9.773  14.583  1.00 37.45  ? 109 GLN A CD  1 
ATOM   896  O  OE1 . GLN A 1 110 ? 28.266  -10.521 13.855  1.00 44.58  ? 109 GLN A OE1 1 
ATOM   897  N  NE2 . GLN A 1 110 ? 26.374  -10.059 14.976  1.00 33.58  ? 109 GLN A NE2 1 
ATOM   898  N  N   . LEU A 1 111 ? 32.223  -6.869  14.110  1.00 29.95  ? 110 LEU A N   1 
ATOM   899  C  CA  . LEU A 1 111 ? 33.627  -6.813  13.737  1.00 31.37  ? 110 LEU A CA  1 
ATOM   900  C  C   . LEU A 1 111 ? 34.256  -5.600  14.394  1.00 34.95  ? 110 LEU A C   1 
ATOM   901  O  O   . LEU A 1 111 ? 35.254  -5.717  15.098  1.00 39.29  ? 110 LEU A O   1 
ATOM   902  C  CB  . LEU A 1 111 ? 33.753  -6.688  12.224  1.00 27.88  ? 110 LEU A CB  1 
ATOM   903  C  CG  . LEU A 1 111 ? 35.168  -6.639  11.652  1.00 29.73  ? 110 LEU A CG  1 
ATOM   904  C  CD1 . LEU A 1 111 ? 35.881  -7.933  11.992  1.00 26.87  ? 110 LEU A CD1 1 
ATOM   905  C  CD2 . LEU A 1 111 ? 35.116  -6.425  10.146  1.00 34.29  ? 110 LEU A CD2 1 
ATOM   906  N  N   . GLY A 1 112 ? 33.678  -4.433  14.132  1.00 36.49  ? 111 GLY A N   1 
ATOM   907  C  CA  . GLY A 1 112 ? 34.178  -3.201  14.707  1.00 38.19  ? 111 GLY A CA  1 
ATOM   908  C  C   . GLY A 1 112 ? 34.254  -3.199  16.225  1.00 41.42  ? 111 GLY A C   1 
ATOM   909  O  O   . GLY A 1 112 ? 35.081  -2.490  16.790  1.00 42.17  ? 111 GLY A O   1 
ATOM   910  N  N   . MET A 1 113 ? 33.391  -3.966  16.888  1.00 42.82  ? 112 MET A N   1 
ATOM   911  C  CA  . MET A 1 113 ? 33.377  -4.030  18.347  1.00 45.60  ? 112 MET A CA  1 
ATOM   912  C  C   . MET A 1 113 ? 34.632  -4.631  18.935  1.00 45.74  ? 112 MET A C   1 
ATOM   913  O  O   . MET A 1 113 ? 35.174  -4.103  19.905  1.00 46.82  ? 112 MET A O   1 
ATOM   914  C  CB  . MET A 1 113 ? 32.160  -4.797  18.858  1.00 47.64  ? 112 MET A CB  1 
ATOM   915  C  CG  . MET A 1 113 ? 30.967  -3.904  19.126  1.00 58.08  ? 112 MET A CG  1 
ATOM   916  S  SD  . MET A 1 113 ? 29.606  -4.794  19.889  1.00 70.63  ? 112 MET A SD  1 
ATOM   917  C  CE  . MET A 1 113 ? 28.513  -5.063  18.479  1.00 69.20  ? 112 MET A CE  1 
ATOM   918  N  N   . ILE A 1 114 ? 35.062  -5.757  18.377  1.00 43.03  ? 113 ILE A N   1 
ATOM   919  C  CA  . ILE A 1 114 ? 36.260  -6.425  18.853  1.00 43.90  ? 113 ILE A CA  1 
ATOM   920  C  C   . ILE A 1 114 ? 37.517  -5.716  18.360  1.00 43.94  ? 113 ILE A C   1 
ATOM   921  O  O   . ILE A 1 114 ? 38.544  -5.738  19.031  1.00 48.53  ? 113 ILE A O   1 
ATOM   922  C  CB  . ILE A 1 114 ? 36.306  -7.901  18.433  1.00 46.93  ? 113 ILE A CB  1 
ATOM   923  C  CG1 . ILE A 1 114 ? 36.519  -8.019  16.930  1.00 47.74  ? 113 ILE A CG1 1 
ATOM   924  C  CG2 . ILE A 1 114 ? 35.018  -8.600  18.843  1.00 49.87  ? 113 ILE A CG2 1 
ATOM   925  C  CD1 . ILE A 1 114 ? 36.846  -9.412  16.489  1.00 55.36  ? 113 ILE A CD1 1 
ATOM   926  N  N   . CYS A 1 115 ? 37.442  -5.108  17.181  1.00 41.96  ? 114 CYS A N   1 
ATOM   927  C  CA  . CYS A 1 115 ? 38.583  -4.389  16.633  1.00 41.20  ? 114 CYS A CA  1 
ATOM   928  C  C   . CYS A 1 115 ? 38.897  -3.133  17.435  1.00 40.99  ? 114 CYS A C   1 
ATOM   929  O  O   . CYS A 1 115 ? 40.020  -2.644  17.407  1.00 42.23  ? 114 CYS A O   1 
ATOM   930  C  CB  . CYS A 1 115 ? 38.341  -4.014  15.172  1.00 40.59  ? 114 CYS A CB  1 
ATOM   931  S  SG  . CYS A 1 115 ? 38.579  -5.373  14.009  1.00 36.33  ? 114 CYS A SG  1 
ATOM   932  N  N   . TYR A 1 116 ? 37.885  -2.576  18.087  1.00 41.34  ? 115 TYR A N   1 
ATOM   933  C  CA  . TYR A 1 116 ? 38.063  -1.381  18.902  1.00 45.40  ? 115 TYR A CA  1 
ATOM   934  C  C   . TYR A 1 116 ? 38.325  -1.761  20.354  1.00 46.53  ? 115 TYR A C   1 
ATOM   935  O  O   . TYR A 1 116 ? 38.711  -0.920  21.175  1.00 44.70  ? 115 TYR A O   1 
ATOM   936  C  CB  . TYR A 1 116 ? 36.826  -0.489  18.810  1.00 47.41  ? 115 TYR A CB  1 
ATOM   937  C  CG  . TYR A 1 116 ? 36.869  0.475   17.653  1.00 45.75  ? 115 TYR A CG  1 
ATOM   938  C  CD1 . TYR A 1 116 ? 37.583  1.662   17.750  1.00 45.55  ? 115 TYR A CD1 1 
ATOM   939  C  CD2 . TYR A 1 116 ? 36.228  0.188   16.450  1.00 46.95  ? 115 TYR A CD2 1 
ATOM   940  C  CE1 . TYR A 1 116 ? 37.667  2.539   16.677  1.00 47.02  ? 115 TYR A CE1 1 
ATOM   941  C  CE2 . TYR A 1 116 ? 36.304  1.057   15.365  1.00 44.93  ? 115 TYR A CE2 1 
ATOM   942  C  CZ  . TYR A 1 116 ? 37.031  2.226   15.486  1.00 47.22  ? 115 TYR A CZ  1 
ATOM   943  O  OH  . TYR A 1 116 ? 37.185  3.052   14.405  1.00 40.60  ? 115 TYR A OH  1 
ATOM   944  N  N   . ASN A 1 117 ? 38.105  -3.034  20.666  1.00 48.80  ? 116 ASN A N   1 
ATOM   945  C  CA  . ASN A 1 117 ? 38.308  -3.541  22.015  1.00 52.89  ? 116 ASN A CA  1 
ATOM   946  C  C   . ASN A 1 117 ? 39.802  -3.714  22.275  1.00 54.55  ? 116 ASN A C   1 
ATOM   947  O  O   . ASN A 1 117 ? 40.498  -4.409  21.530  1.00 51.53  ? 116 ASN A O   1 
ATOM   948  C  CB  . ASN A 1 117 ? 37.588  -4.882  22.192  1.00 53.48  ? 116 ASN A CB  1 
ATOM   949  C  CG  . ASN A 1 117 ? 37.473  -5.301  23.647  1.00 56.48  ? 116 ASN A CG  1 
ATOM   950  O  OD1 . ASN A 1 117 ? 38.100  -4.719  24.537  1.00 57.59  ? 116 ASN A OD1 1 
ATOM   951  N  ND2 . ASN A 1 117 ? 36.652  -6.312  23.899  1.00 59.17  ? 116 ASN A ND2 1 
ATOM   952  N  N   . PRO A 1 118 ? 40.321  -3.059  23.326  1.00 56.35  ? 117 PRO A N   1 
ATOM   953  C  CA  . PRO A 1 118 ? 41.739  -3.137  23.692  1.00 56.02  ? 117 PRO A CA  1 
ATOM   954  C  C   . PRO A 1 118 ? 42.242  -4.581  23.795  1.00 55.94  ? 117 PRO A C   1 
ATOM   955  O  O   . PRO A 1 118 ? 43.403  -4.870  23.500  1.00 51.47  ? 117 PRO A O   1 
ATOM   956  C  CB  . PRO A 1 118 ? 41.769  -2.437  25.048  1.00 56.94  ? 117 PRO A CB  1 
ATOM   957  C  CG  . PRO A 1 118 ? 40.721  -1.390  24.892  1.00 57.87  ? 117 PRO A CG  1 
ATOM   958  C  CD  . PRO A 1 118 ? 39.597  -2.157  24.239  1.00 56.84  ? 117 PRO A CD  1 
ATOM   959  N  N   . GLU A 1 119 ? 41.365  -5.480  24.227  1.00 58.96  ? 118 GLU A N   1 
ATOM   960  C  CA  . GLU A 1 119 ? 41.725  -6.885  24.372  1.00 64.56  ? 118 GLU A CA  1 
ATOM   961  C  C   . GLU A 1 119 ? 41.442  -7.680  23.093  1.00 63.92  ? 118 GLU A C   1 
ATOM   962  O  O   . GLU A 1 119 ? 41.216  -8.892  23.137  1.00 64.66  ? 118 GLU A O   1 
ATOM   963  C  CB  . GLU A 1 119 ? 41.000  -7.484  25.585  1.00 69.67  ? 118 GLU A CB  1 
ATOM   964  C  CG  . GLU A 1 119 ? 41.448  -6.869  26.916  1.00 78.46  ? 118 GLU A CG  1 
ATOM   965  C  CD  . GLU A 1 119 ? 40.483  -7.130  28.056  1.00 83.82  ? 118 GLU A CD  1 
ATOM   966  O  OE1 . GLU A 1 119 ? 39.702  -6.211  28.392  1.00 87.85  ? 118 GLU A OE1 1 
ATOM   967  O  OE2 . GLU A 1 119 ? 40.509  -8.245  28.621  1.00 86.43  ? 118 GLU A OE2 1 
ATOM   968  N  N   . PHE A 1 120 ? 41.525  -6.991  21.958  1.00 62.58  ? 119 PHE A N   1 
ATOM   969  C  CA  . PHE A 1 120 ? 41.280  -7.579  20.644  1.00 58.60  ? 119 PHE A CA  1 
ATOM   970  C  C   . PHE A 1 120 ? 41.917  -8.947  20.416  1.00 58.85  ? 119 PHE A C   1 
ATOM   971  O  O   . PHE A 1 120 ? 41.270  -9.858  19.904  1.00 57.20  ? 119 PHE A O   1 
ATOM   972  C  CB  . PHE A 1 120 ? 41.735  -6.604  19.543  1.00 55.58  ? 119 PHE A CB  1 
ATOM   973  C  CG  . PHE A 1 120 ? 41.832  -7.225  18.169  1.00 54.37  ? 119 PHE A CG  1 
ATOM   974  C  CD1 . PHE A 1 120 ? 40.709  -7.360  17.366  1.00 51.64  ? 119 PHE A CD1 1 
ATOM   975  C  CD2 . PHE A 1 120 ? 43.054  -7.678  17.682  1.00 55.14  ? 119 PHE A CD2 1 
ATOM   976  C  CE1 . PHE A 1 120 ? 40.801  -7.941  16.095  1.00 47.29  ? 119 PHE A CE1 1 
ATOM   977  C  CE2 . PHE A 1 120 ? 43.154  -8.261  16.412  1.00 50.26  ? 119 PHE A CE2 1 
ATOM   978  C  CZ  . PHE A 1 120 ? 42.028  -8.391  15.623  1.00 45.91  ? 119 PHE A CZ  1 
ATOM   979  N  N   . GLU A 1 121 ? 43.191  -9.078  20.766  1.00 62.28  ? 120 GLU A N   1 
ATOM   980  C  CA  . GLU A 1 121 ? 43.909  -10.330 20.559  1.00 64.99  ? 120 GLU A CA  1 
ATOM   981  C  C   . GLU A 1 121 ? 43.285  -11.531 21.260  1.00 67.23  ? 120 GLU A C   1 
ATOM   982  O  O   . GLU A 1 121 ? 43.391  -12.663 20.783  1.00 66.60  ? 120 GLU A O   1 
ATOM   983  C  CB  . GLU A 1 121 ? 45.366  -10.174 20.992  1.00 68.84  ? 120 GLU A CB  1 
ATOM   984  C  CG  . GLU A 1 121 ? 46.357  -10.968 20.142  1.00 75.66  ? 120 GLU A CG  1 
ATOM   985  C  CD  . GLU A 1 121 ? 46.440  -10.467 18.702  1.00 81.24  ? 120 GLU A CD  1 
ATOM   986  O  OE1 . GLU A 1 121 ? 46.549  -9.235  18.494  1.00 82.48  ? 120 GLU A OE1 1 
ATOM   987  O  OE2 . GLU A 1 121 ? 46.400  -11.311 17.779  1.00 84.35  ? 120 GLU A OE2 1 
ATOM   988  N  N   . LYS A 1 122 ? 42.645  -11.277 22.393  1.00 67.45  ? 121 LYS A N   1 
ATOM   989  C  CA  . LYS A 1 122 ? 42.016  -12.330 23.170  1.00 69.52  ? 121 LYS A CA  1 
ATOM   990  C  C   . LYS A 1 122 ? 40.685  -12.796 22.583  1.00 66.49  ? 121 LYS A C   1 
ATOM   991  O  O   . LYS A 1 122 ? 40.402  -13.995 22.536  1.00 64.02  ? 121 LYS A O   1 
ATOM   992  C  CB  . LYS A 1 122 ? 41.824  -11.850 24.616  1.00 78.07  ? 121 LYS A CB  1 
ATOM   993  C  CG  . LYS A 1 122 ? 41.339  -12.926 25.586  1.00 86.99  ? 121 LYS A CG  1 
ATOM   994  C  CD  . LYS A 1 122 ? 41.250  -12.420 27.032  1.00 92.79  ? 121 LYS A CD  1 
ATOM   995  C  CE  . LYS A 1 122 ? 40.094  -11.445 27.247  1.00 95.62  ? 121 LYS A CE  1 
ATOM   996  N  NZ  . LYS A 1 122 ? 39.943  -11.058 28.685  1.00 97.61  ? 121 LYS A NZ  1 
ATOM   997  N  N   . LEU A 1 123 ? 39.866  -11.841 22.157  1.00 65.67  ? 122 LEU A N   1 
ATOM   998  C  CA  . LEU A 1 123 ? 38.546  -12.128 21.597  1.00 64.32  ? 122 LEU A CA  1 
ATOM   999  C  C   . LEU A 1 123 ? 38.567  -12.734 20.195  1.00 61.18  ? 122 LEU A C   1 
ATOM   1000 O  O   . LEU A 1 123 ? 37.627  -13.424 19.796  1.00 58.70  ? 122 LEU A O   1 
ATOM   1001 C  CB  . LEU A 1 123 ? 37.699  -10.851 21.565  1.00 67.27  ? 122 LEU A CB  1 
ATOM   1002 C  CG  . LEU A 1 123 ? 37.118  -10.254 22.848  1.00 69.56  ? 122 LEU A CG  1 
ATOM   1003 C  CD1 . LEU A 1 123 ? 38.207  -9.904  23.841  1.00 71.43  ? 122 LEU A CD1 1 
ATOM   1004 C  CD2 . LEU A 1 123 ? 36.326  -9.014  22.484  1.00 73.86  ? 122 LEU A CD2 1 
ATOM   1005 N  N   . LYS A 1 124 ? 39.635  -12.465 19.452  1.00 59.10  ? 123 LYS A N   1 
ATOM   1006 C  CA  . LYS A 1 124 ? 39.779  -12.948 18.083  1.00 56.78  ? 123 LYS A CA  1 
ATOM   1007 C  C   . LYS A 1 124 ? 39.504  -14.436 17.837  1.00 57.16  ? 123 LYS A C   1 
ATOM   1008 O  O   . LYS A 1 124 ? 38.863  -14.781 16.851  1.00 55.88  ? 123 LYS A O   1 
ATOM   1009 C  CB  . LYS A 1 124 ? 41.154  -12.558 17.531  1.00 53.75  ? 123 LYS A CB  1 
ATOM   1010 C  CG  . LYS A 1 124 ? 41.321  -12.760 16.027  1.00 52.06  ? 123 LYS A CG  1 
ATOM   1011 C  CD  . LYS A 1 124 ? 42.677  -12.242 15.547  1.00 54.35  ? 123 LYS A CD  1 
ATOM   1012 C  CE  . LYS A 1 124 ? 42.849  -12.390 14.037  1.00 59.21  ? 123 LYS A CE  1 
ATOM   1013 N  NZ  . LYS A 1 124 ? 44.129  -11.796 13.542  1.00 62.31  ? 123 LYS A NZ  1 
ATOM   1014 N  N   . PRO A 1 125 ? 40.021  -15.336 18.695  1.00 58.59  ? 124 PRO A N   1 
ATOM   1015 C  CA  . PRO A 1 125 ? 39.793  -16.777 18.514  1.00 55.04  ? 124 PRO A CA  1 
ATOM   1016 C  C   . PRO A 1 125 ? 38.318  -17.175 18.458  1.00 51.89  ? 124 PRO A C   1 
ATOM   1017 O  O   . PRO A 1 125 ? 37.925  -18.032 17.663  1.00 49.80  ? 124 PRO A O   1 
ATOM   1018 C  CB  . PRO A 1 125 ? 40.477  -17.380 19.738  1.00 56.38  ? 124 PRO A CB  1 
ATOM   1019 C  CG  . PRO A 1 125 ? 41.607  -16.456 19.965  1.00 58.74  ? 124 PRO A CG  1 
ATOM   1020 C  CD  . PRO A 1 125 ? 40.961  -15.103 19.806  1.00 60.10  ? 124 PRO A CD  1 
ATOM   1021 N  N   . LYS A 1 126 ? 37.519  -16.593 19.344  1.00 49.14  ? 125 LYS A N   1 
ATOM   1022 C  CA  . LYS A 1 126 ? 36.097  -16.886 19.392  1.00 49.89  ? 125 LYS A CA  1 
ATOM   1023 C  C   . LYS A 1 126 ? 35.368  -16.318 18.174  1.00 48.65  ? 125 LYS A C   1 
ATOM   1024 O  O   . LYS A 1 126 ? 34.537  -16.995 17.571  1.00 47.84  ? 125 LYS A O   1 
ATOM   1025 C  CB  . LYS A 1 126 ? 35.502  -16.320 20.678  1.00 52.32  ? 125 LYS A CB  1 
ATOM   1026 C  CG  . LYS A 1 126 ? 34.025  -16.567 20.837  1.00 56.99  ? 125 LYS A CG  1 
ATOM   1027 C  CD  . LYS A 1 126 ? 33.514  -15.882 22.085  1.00 63.06  ? 125 LYS A CD  1 
ATOM   1028 C  CE  . LYS A 1 126 ? 31.990  -15.975 22.149  1.00 65.39  ? 125 LYS A CE  1 
ATOM   1029 N  NZ  . LYS A 1 126 ? 31.245  -14.764 21.697  1.00 66.16  ? 125 LYS A NZ  1 
ATOM   1030 N  N   . TYR A 1 127 ? 35.663  -15.065 17.840  1.00 48.05  ? 126 TYR A N   1 
ATOM   1031 C  CA  . TYR A 1 127 ? 35.040  -14.403 16.701  1.00 45.43  ? 126 TYR A CA  1 
ATOM   1032 C  C   . TYR A 1 127 ? 35.263  -15.201 15.422  1.00 43.79  ? 126 TYR A C   1 
ATOM   1033 O  O   . TYR A 1 127 ? 34.362  -15.319 14.593  1.00 44.48  ? 126 TYR A O   1 
ATOM   1034 C  CB  . TYR A 1 127 ? 35.593  -12.981 16.544  1.00 45.96  ? 126 TYR A CB  1 
ATOM   1035 C  CG  . TYR A 1 127 ? 34.932  -12.159 15.452  1.00 46.50  ? 126 TYR A CG  1 
ATOM   1036 C  CD1 . TYR A 1 127 ? 33.975  -11.196 15.758  1.00 43.50  ? 126 TYR A CD1 1 
ATOM   1037 C  CD2 . TYR A 1 127 ? 35.269  -12.340 14.110  1.00 47.35  ? 126 TYR A CD2 1 
ATOM   1038 C  CE1 . TYR A 1 127 ? 33.377  -10.434 14.755  1.00 42.99  ? 126 TYR A CE1 1 
ATOM   1039 C  CE2 . TYR A 1 127 ? 34.674  -11.585 13.102  1.00 45.65  ? 126 TYR A CE2 1 
ATOM   1040 C  CZ  . TYR A 1 127 ? 33.729  -10.636 13.428  1.00 44.55  ? 126 TYR A CZ  1 
ATOM   1041 O  OH  . TYR A 1 127 ? 33.137  -9.895  12.426  1.00 43.99  ? 126 TYR A OH  1 
ATOM   1042 N  N   . LEU A 1 128 ? 36.479  -15.705 15.250  1.00 42.09  ? 127 LEU A N   1 
ATOM   1043 C  CA  . LEU A 1 128 ? 36.829  -16.494 14.074  1.00 43.13  ? 127 LEU A CA  1 
ATOM   1044 C  C   . LEU A 1 128 ? 36.083  -17.815 14.049  1.00 47.29  ? 127 LEU A C   1 
ATOM   1045 O  O   . LEU A 1 128 ? 35.760  -18.326 12.978  1.00 51.11  ? 127 LEU A O   1 
ATOM   1046 C  CB  . LEU A 1 128 ? 38.337  -16.764 14.029  1.00 35.21  ? 127 LEU A CB  1 
ATOM   1047 C  CG  . LEU A 1 128 ? 39.270  -15.609 13.655  1.00 29.99  ? 127 LEU A CG  1 
ATOM   1048 C  CD1 . LEU A 1 128 ? 40.712  -16.027 13.864  1.00 28.07  ? 127 LEU A CD1 1 
ATOM   1049 C  CD2 . LEU A 1 128 ? 39.044  -15.202 12.214  1.00 28.65  ? 127 LEU A CD2 1 
ATOM   1050 N  N   . GLU A 1 129 ? 35.861  -18.387 15.228  1.00 51.45  ? 128 GLU A N   1 
ATOM   1051 C  CA  . GLU A 1 129 ? 35.157  -19.657 15.354  1.00 55.95  ? 128 GLU A CA  1 
ATOM   1052 C  C   . GLU A 1 129 ? 33.710  -19.545 14.866  1.00 56.26  ? 128 GLU A C   1 
ATOM   1053 O  O   . GLU A 1 129 ? 33.167  -20.486 14.281  1.00 58.89  ? 128 GLU A O   1 
ATOM   1054 C  CB  . GLU A 1 129 ? 35.177  -20.116 16.812  1.00 60.75  ? 128 GLU A CB  1 
ATOM   1055 C  CG  . GLU A 1 129 ? 34.520  -21.429 17.204  1.00 67.97  ? 128 GLU A CG  1 
ATOM   1056 C  CD  . GLU A 1 129 ? 33.011  -21.442 17.403  1.00 76.05  ? 128 GLU A CD  1 
ATOM   1057 O  OE1 . GLU A 1 129 ? 32.539  -20.780 18.352  1.00 82.40  ? 128 GLU A OE1 1 
ATOM   1058 O  OE2 . GLU A 1 129 ? 32.297  -22.114 16.623  1.00 74.79  ? 128 GLU A OE2 1 
ATOM   1059 N  N   . GLU A 1 130 ? 33.104  -18.384 15.095  1.00 54.24  ? 129 GLU A N   1 
ATOM   1060 C  CA  . GLU A 1 130 ? 31.717  -18.124 14.713  1.00 55.70  ? 129 GLU A CA  1 
ATOM   1061 C  C   . GLU A 1 130 ? 31.535  -17.574 13.296  1.00 53.58  ? 129 GLU A C   1 
ATOM   1062 O  O   . GLU A 1 130 ? 30.463  -17.724 12.692  1.00 53.58  ? 129 GLU A O   1 
ATOM   1063 C  CB  . GLU A 1 130 ? 31.093  -17.148 15.710  1.00 59.07  ? 129 GLU A CB  1 
ATOM   1064 C  CG  . GLU A 1 130 ? 31.234  -17.525 17.187  1.00 65.45  ? 129 GLU A CG  1 
ATOM   1065 C  CD  . GLU A 1 130 ? 30.767  -16.445 18.150  1.00 69.71  ? 129 GLU A CD  1 
ATOM   1066 O  OE1 . GLU A 1 130 ? 30.314  -15.376 17.677  1.00 74.19  ? 129 GLU A OE1 1 
ATOM   1067 O  OE2 . GLU A 1 130 ? 30.862  -16.660 19.380  1.00 69.59  ? 129 GLU A OE2 1 
ATOM   1068 N  N   . LEU A 1 131 ? 32.573  -16.918 12.784  1.00 52.13  ? 130 LEU A N   1 
ATOM   1069 C  CA  . LEU A 1 131 ? 32.550  -16.316 11.454  1.00 52.02  ? 130 LEU A CA  1 
ATOM   1070 C  C   . LEU A 1 131 ? 32.059  -17.205 10.310  1.00 52.09  ? 130 LEU A C   1 
ATOM   1071 O  O   . LEU A 1 131 ? 31.274  -16.754 9.478   1.00 51.27  ? 130 LEU A O   1 
ATOM   1072 C  CB  . LEU A 1 131 ? 33.923  -15.735 11.099  1.00 49.52  ? 130 LEU A CB  1 
ATOM   1073 C  CG  . LEU A 1 131 ? 34.010  -15.079 9.718   1.00 46.27  ? 130 LEU A CG  1 
ATOM   1074 C  CD1 . LEU A 1 131 ? 33.075  -13.887 9.669   1.00 41.75  ? 130 LEU A CD1 1 
ATOM   1075 C  CD2 . LEU A 1 131 ? 35.433  -14.662 9.416   1.00 40.63  ? 130 LEU A CD2 1 
ATOM   1076 N  N   . PRO A 1 132 ? 32.546  -18.456 10.222  1.00 52.07  ? 131 PRO A N   1 
ATOM   1077 C  CA  . PRO A 1 132 ? 32.105  -19.340 9.139   1.00 49.53  ? 131 PRO A CA  1 
ATOM   1078 C  C   . PRO A 1 132 ? 30.588  -19.442 9.053   1.00 47.60  ? 131 PRO A C   1 
ATOM   1079 O  O   . PRO A 1 132 ? 30.013  -19.474 7.963   1.00 47.18  ? 131 PRO A O   1 
ATOM   1080 C  CB  . PRO A 1 132 ? 32.731  -20.677 9.526   1.00 50.91  ? 131 PRO A CB  1 
ATOM   1081 C  CG  . PRO A 1 132 ? 33.997  -20.261 10.190  1.00 51.33  ? 131 PRO A CG  1 
ATOM   1082 C  CD  . PRO A 1 132 ? 33.521  -19.147 11.082  1.00 53.23  ? 131 PRO A CD  1 
ATOM   1083 N  N   . GLU A 1 133 ? 29.951  -19.520 10.212  1.00 45.29  ? 132 GLU A N   1 
ATOM   1084 C  CA  . GLU A 1 133 ? 28.507  -19.613 10.272  1.00 46.14  ? 132 GLU A CA  1 
ATOM   1085 C  C   . GLU A 1 133 ? 27.884  -18.347 9.707   1.00 43.72  ? 132 GLU A C   1 
ATOM   1086 O  O   . GLU A 1 133 ? 26.933  -18.412 8.931   1.00 40.92  ? 132 GLU A O   1 
ATOM   1087 C  CB  . GLU A 1 133 ? 28.059  -19.808 11.713  1.00 50.50  ? 132 GLU A CB  1 
ATOM   1088 C  CG  . GLU A 1 133 ? 26.591  -20.116 11.870  1.00 60.08  ? 132 GLU A CG  1 
ATOM   1089 C  CD  . GLU A 1 133 ? 25.963  -20.997 10.804  1.00 68.60  ? 132 GLU A CD  1 
ATOM   1090 O  OE1 . GLU A 1 133 ? 26.677  -21.853 10.229  1.00 70.88  ? 132 GLU A OE1 1 
ATOM   1091 O  OE2 . GLU A 1 133 ? 24.747  -20.837 10.547  1.00 69.09  ? 132 GLU A OE2 1 
ATOM   1092 N  N   . LYS A 1 134 ? 28.396  -17.197 10.133  1.00 44.57  ? 133 LYS A N   1 
ATOM   1093 C  CA  . LYS A 1 134 ? 27.881  -15.921 9.650   1.00 44.02  ? 133 LYS A CA  1 
ATOM   1094 C  C   . LYS A 1 134 ? 27.950  -15.861 8.125   1.00 41.24  ? 133 LYS A C   1 
ATOM   1095 O  O   . LYS A 1 134 ? 26.982  -15.480 7.464   1.00 40.20  ? 133 LYS A O   1 
ATOM   1096 C  CB  . LYS A 1 134 ? 28.678  -14.756 10.235  1.00 44.22  ? 133 LYS A CB  1 
ATOM   1097 C  CG  . LYS A 1 134 ? 28.584  -14.601 11.734  1.00 45.21  ? 133 LYS A CG  1 
ATOM   1098 C  CD  . LYS A 1 134 ? 29.363  -13.376 12.165  1.00 46.17  ? 133 LYS A CD  1 
ATOM   1099 C  CE  . LYS A 1 134 ? 29.595  -13.382 13.651  1.00 42.47  ? 133 LYS A CE  1 
ATOM   1100 N  NZ  . LYS A 1 134 ? 30.568  -12.339 14.032  1.00 49.76  ? 133 LYS A NZ  1 
ATOM   1101 N  N   . LEU A 1 135 ? 29.115  -16.201 7.586   1.00 39.16  ? 134 LEU A N   1 
ATOM   1102 C  CA  . LEU A 1 135 ? 29.345  -16.209 6.150   1.00 38.87  ? 134 LEU A CA  1 
ATOM   1103 C  C   . LEU A 1 135 ? 28.403  -17.165 5.454   1.00 39.19  ? 134 LEU A C   1 
ATOM   1104 O  O   . LEU A 1 135 ? 27.855  -16.848 4.404   1.00 39.52  ? 134 LEU A O   1 
ATOM   1105 C  CB  . LEU A 1 135 ? 30.788  -16.608 5.864   1.00 37.58  ? 134 LEU A CB  1 
ATOM   1106 C  CG  . LEU A 1 135 ? 31.811  -15.491 5.626   1.00 38.55  ? 134 LEU A CG  1 
ATOM   1107 C  CD1 . LEU A 1 135 ? 31.416  -14.194 6.327   1.00 37.16  ? 134 LEU A CD1 1 
ATOM   1108 C  CD2 . LEU A 1 135 ? 33.181  -15.977 6.074   1.00 38.57  ? 134 LEU A CD2 1 
ATOM   1109 N  N   . LYS A 1 136 ? 28.254  -18.351 6.029   1.00 42.83  ? 135 LYS A N   1 
ATOM   1110 C  CA  . LYS A 1 136 ? 27.367  -19.370 5.489   1.00 46.61  ? 135 LYS A CA  1 
ATOM   1111 C  C   . LYS A 1 136 ? 25.973  -18.793 5.289   1.00 44.49  ? 135 LYS A C   1 
ATOM   1112 O  O   . LYS A 1 136 ? 25.348  -19.015 4.261   1.00 43.83  ? 135 LYS A O   1 
ATOM   1113 C  CB  . LYS A 1 136 ? 27.298  -20.561 6.447   1.00 51.36  ? 135 LYS A CB  1 
ATOM   1114 C  CG  . LYS A 1 136 ? 26.306  -21.649 6.060   1.00 53.95  ? 135 LYS A CG  1 
ATOM   1115 C  CD  . LYS A 1 136 ? 26.170  -22.672 7.184   1.00 65.67  ? 135 LYS A CD  1 
ATOM   1116 C  CE  . LYS A 1 136 ? 25.027  -23.642 6.925   1.00 70.84  ? 135 LYS A CE  1 
ATOM   1117 N  NZ  . LYS A 1 136 ? 24.831  -24.603 8.044   1.00 73.11  ? 135 LYS A NZ  1 
ATOM   1118 N  N   . LEU A 1 137 ? 25.489  -18.059 6.284   1.00 44.17  ? 136 LEU A N   1 
ATOM   1119 C  CA  . LEU A 1 137 ? 24.166  -17.450 6.218   1.00 43.66  ? 136 LEU A CA  1 
ATOM   1120 C  C   . LEU A 1 137 ? 23.981  -16.602 4.968   1.00 41.76  ? 136 LEU A C   1 
ATOM   1121 O  O   . LEU A 1 137 ? 22.932  -16.657 4.331   1.00 39.47  ? 136 LEU A O   1 
ATOM   1122 C  CB  . LEU A 1 137 ? 23.900  -16.622 7.476   1.00 42.88  ? 136 LEU A CB  1 
ATOM   1123 C  CG  . LEU A 1 137 ? 23.762  -17.445 8.764   1.00 46.70  ? 136 LEU A CG  1 
ATOM   1124 C  CD1 . LEU A 1 137 ? 23.439  -16.538 9.949   1.00 45.40  ? 136 LEU A CD1 1 
ATOM   1125 C  CD2 . LEU A 1 137 ? 22.671  -18.503 8.587   1.00 45.72  ? 136 LEU A CD2 1 
ATOM   1126 N  N   . TYR A 1 138 ? 24.977  -15.782 4.651   1.00 42.02  ? 137 TYR A N   1 
ATOM   1127 C  CA  . TYR A 1 138 ? 24.919  -14.946 3.463   1.00 45.15  ? 137 TYR A CA  1 
ATOM   1128 C  C   . TYR A 1 138 ? 24.879  -15.823 2.217   1.00 48.94  ? 137 TYR A C   1 
ATOM   1129 O  O   . TYR A 1 138 ? 24.164  -15.526 1.265   1.00 49.33  ? 137 TYR A O   1 
ATOM   1130 C  CB  . TYR A 1 138 ? 26.122  -14.017 3.407   1.00 42.85  ? 137 TYR A CB  1 
ATOM   1131 C  CG  . TYR A 1 138 ? 25.990  -12.797 4.285   1.00 47.71  ? 137 TYR A CG  1 
ATOM   1132 C  CD1 . TYR A 1 138 ? 25.161  -11.742 3.913   1.00 47.81  ? 137 TYR A CD1 1 
ATOM   1133 C  CD2 . TYR A 1 138 ? 26.703  -12.689 5.483   1.00 49.13  ? 137 TYR A CD2 1 
ATOM   1134 C  CE1 . TYR A 1 138 ? 25.042  -10.603 4.709   1.00 46.49  ? 137 TYR A CE1 1 
ATOM   1135 C  CE2 . TYR A 1 138 ? 26.586  -11.551 6.289   1.00 47.60  ? 137 TYR A CE2 1 
ATOM   1136 C  CZ  . TYR A 1 138 ? 25.755  -10.514 5.891   1.00 45.62  ? 137 TYR A CZ  1 
ATOM   1137 O  OH  . TYR A 1 138 ? 25.633  -9.373  6.643   1.00 43.95  ? 137 TYR A OH  1 
ATOM   1138 N  N   . SER A 1 139 ? 25.677  -16.886 2.224   1.00 50.87  ? 138 SER A N   1 
ATOM   1139 C  CA  . SER A 1 139 ? 25.736  -17.839 1.118   1.00 50.78  ? 138 SER A CA  1 
ATOM   1140 C  C   . SER A 1 139 ? 24.343  -18.450 0.889   1.00 51.23  ? 138 SER A C   1 
ATOM   1141 O  O   . SER A 1 139 ? 23.793  -18.380 -0.213  1.00 51.46  ? 138 SER A O   1 
ATOM   1142 C  CB  . SER A 1 139 ? 26.760  -18.931 1.450   1.00 51.05  ? 138 SER A CB  1 
ATOM   1143 O  OG  . SER A 1 139 ? 26.852  -19.922 0.444   1.00 53.66  ? 138 SER A OG  1 
ATOM   1144 N  N   . GLU A 1 140 ? 23.765  -19.011 1.949   1.00 52.98  ? 139 GLU A N   1 
ATOM   1145 C  CA  . GLU A 1 140 ? 22.439  -19.621 1.899   1.00 53.95  ? 139 GLU A CA  1 
ATOM   1146 C  C   . GLU A 1 140 ? 21.439  -18.643 1.297   1.00 52.85  ? 139 GLU A C   1 
ATOM   1147 O  O   . GLU A 1 140 ? 20.600  -19.011 0.471   1.00 52.16  ? 139 GLU A O   1 
ATOM   1148 C  CB  . GLU A 1 140 ? 21.947  -19.950 3.316   1.00 59.60  ? 139 GLU A CB  1 
ATOM   1149 C  CG  . GLU A 1 140 ? 22.911  -20.721 4.197   1.00 69.38  ? 139 GLU A CG  1 
ATOM   1150 C  CD  . GLU A 1 140 ? 22.941  -22.196 3.887   1.00 73.91  ? 139 GLU A CD  1 
ATOM   1151 O  OE1 . GLU A 1 140 ? 23.450  -22.569 2.806   1.00 74.83  ? 139 GLU A OE1 1 
ATOM   1152 O  OE2 . GLU A 1 140 ? 22.463  -22.979 4.737   1.00 74.61  ? 139 GLU A OE2 1 
ATOM   1153 N  N   . PHE A 1 141 ? 21.496  -17.410 1.783   1.00 52.69  ? 140 PHE A N   1 
ATOM   1154 C  CA  . PHE A 1 141 ? 20.599  -16.352 1.358   1.00 49.58  ? 140 PHE A CA  1 
ATOM   1155 C  C   . PHE A 1 141 ? 20.709  -16.020 -0.121  1.00 47.76  ? 140 PHE A C   1 
ATOM   1156 O  O   . PHE A 1 141 ? 19.702  -15.950 -0.815  1.00 48.09  ? 140 PHE A O   1 
ATOM   1157 C  CB  . PHE A 1 141 ? 20.851  -15.100 2.198   1.00 48.78  ? 140 PHE A CB  1 
ATOM   1158 C  CG  . PHE A 1 141 ? 19.719  -14.125 2.184   1.00 46.80  ? 140 PHE A CG  1 
ATOM   1159 C  CD1 . PHE A 1 141 ? 18.407  -14.568 2.310   1.00 46.61  ? 140 PHE A CD1 1 
ATOM   1160 C  CD2 . PHE A 1 141 ? 19.953  -12.761 2.056   1.00 48.65  ? 140 PHE A CD2 1 
ATOM   1161 C  CE1 . PHE A 1 141 ? 17.336  -13.666 2.307   1.00 45.66  ? 140 PHE A CE1 1 
ATOM   1162 C  CE2 . PHE A 1 141 ? 18.889  -11.849 2.054   1.00 47.87  ? 140 PHE A CE2 1 
ATOM   1163 C  CZ  . PHE A 1 141 ? 17.578  -12.306 2.179   1.00 44.10  ? 140 PHE A CZ  1 
ATOM   1164 N  N   . LEU A 1 142 ? 21.929  -15.772 -0.584  1.00 45.46  ? 141 LEU A N   1 
ATOM   1165 C  CA  . LEU A 1 142 ? 22.175  -15.434 -1.981  1.00 45.82  ? 141 LEU A CA  1 
ATOM   1166 C  C   . LEU A 1 142 ? 21.754  -16.564 -2.901  1.00 48.40  ? 141 LEU A C   1 
ATOM   1167 O  O   . LEU A 1 142 ? 20.983  -16.354 -3.840  1.00 48.73  ? 141 LEU A O   1 
ATOM   1168 C  CB  . LEU A 1 142 ? 23.657  -15.122 -2.206  1.00 41.50  ? 141 LEU A CB  1 
ATOM   1169 C  CG  . LEU A 1 142 ? 24.054  -14.705 -3.628  1.00 39.15  ? 141 LEU A CG  1 
ATOM   1170 C  CD1 . LEU A 1 142 ? 23.307  -13.442 -4.044  1.00 31.75  ? 141 LEU A CD1 1 
ATOM   1171 C  CD2 . LEU A 1 142 ? 25.554  -14.486 -3.706  1.00 30.29  ? 141 LEU A CD2 1 
ATOM   1172 N  N   . GLY A 1 143 ? 22.258  -17.762 -2.626  1.00 52.47  ? 142 GLY A N   1 
ATOM   1173 C  CA  . GLY A 1 143 ? 21.931  -18.914 -3.445  1.00 53.75  ? 142 GLY A CA  1 
ATOM   1174 C  C   . GLY A 1 143 ? 22.476  -18.794 -4.858  1.00 55.65  ? 142 GLY A C   1 
ATOM   1175 O  O   . GLY A 1 143 ? 23.650  -18.458 -5.056  1.00 54.76  ? 142 GLY A O   1 
ATOM   1176 N  N   . LYS A 1 144 ? 21.632  -19.093 -5.846  1.00 55.29  ? 143 LYS A N   1 
ATOM   1177 C  CA  . LYS A 1 144 ? 22.043  -19.012 -7.247  1.00 55.57  ? 143 LYS A CA  1 
ATOM   1178 C  C   . LYS A 1 144 ? 21.746  -17.654 -7.865  1.00 50.83  ? 143 LYS A C   1 
ATOM   1179 O  O   . LYS A 1 144 ? 21.935  -17.452 -9.064  1.00 49.66  ? 143 LYS A O   1 
ATOM   1180 C  CB  . LYS A 1 144 ? 21.403  -20.135 -8.068  1.00 62.59  ? 143 LYS A CB  1 
ATOM   1181 C  CG  . LYS A 1 144 ? 21.841  -21.522 -7.626  1.00 68.49  ? 143 LYS A CG  1 
ATOM   1182 C  CD  . LYS A 1 144 ? 23.359  -21.643 -7.653  1.00 74.99  ? 143 LYS A CD  1 
ATOM   1183 C  CE  . LYS A 1 144 ? 23.836  -22.875 -6.900  1.00 81.16  ? 143 LYS A CE  1 
ATOM   1184 N  NZ  . LYS A 1 144 ? 23.346  -24.137 -7.516  1.00 86.53  ? 143 LYS A NZ  1 
ATOM   1185 N  N   . ARG A 1 145 ? 21.276  -16.724 -7.044  1.00 48.92  ? 144 ARG A N   1 
ATOM   1186 C  CA  . ARG A 1 145 ? 20.966  -15.382 -7.520  1.00 45.27  ? 144 ARG A CA  1 
ATOM   1187 C  C   . ARG A 1 145 ? 22.238  -14.624 -7.876  1.00 41.53  ? 144 ARG A C   1 
ATOM   1188 O  O   . ARG A 1 145 ? 23.310  -14.884 -7.327  1.00 38.01  ? 144 ARG A O   1 
ATOM   1189 C  CB  . ARG A 1 145 ? 20.197  -14.587 -6.459  1.00 45.00  ? 144 ARG A CB  1 
ATOM   1190 C  CG  . ARG A 1 145 ? 18.828  -15.132 -6.110  1.00 44.47  ? 144 ARG A CG  1 
ATOM   1191 C  CD  . ARG A 1 145 ? 18.179  -14.294 -5.022  1.00 46.52  ? 144 ARG A CD  1 
ATOM   1192 N  NE  . ARG A 1 145 ? 16.966  -14.927 -4.514  1.00 46.36  ? 144 ARG A NE  1 
ATOM   1193 C  CZ  . ARG A 1 145 ? 16.948  -16.032 -3.770  1.00 42.58  ? 144 ARG A CZ  1 
ATOM   1194 N  NH1 . ARG A 1 145 ? 18.078  -16.640 -3.435  1.00 41.48  ? 144 ARG A NH1 1 
ATOM   1195 N  NH2 . ARG A 1 145 ? 15.793  -16.539 -3.364  1.00 38.03  ? 144 ARG A NH2 1 
ATOM   1196 N  N   . PRO A 1 146 ? 22.144  -13.724 -8.859  1.00 41.83  ? 145 PRO A N   1 
ATOM   1197 C  CA  . PRO A 1 146 ? 23.304  -12.936 -9.271  1.00 41.80  ? 145 PRO A CA  1 
ATOM   1198 C  C   . PRO A 1 146 ? 23.547  -11.839 -8.239  1.00 39.89  ? 145 PRO A C   1 
ATOM   1199 O  O   . PRO A 1 146 ? 24.689  -11.472 -7.961  1.00 36.97  ? 145 PRO A O   1 
ATOM   1200 C  CB  . PRO A 1 146 ? 22.862  -12.370 -10.620 1.00 42.98  ? 145 PRO A CB  1 
ATOM   1201 C  CG  . PRO A 1 146 ? 21.373  -12.233 -10.464 1.00 42.64  ? 145 PRO A CG  1 
ATOM   1202 C  CD  . PRO A 1 146 ? 21.003  -13.515 -9.771  1.00 44.10  ? 145 PRO A CD  1 
ATOM   1203 N  N   . TRP A 1 147 ? 22.457  -11.330 -7.675  1.00 38.91  ? 146 TRP A N   1 
ATOM   1204 C  CA  . TRP A 1 147 ? 22.501  -10.283 -6.660  1.00 39.37  ? 146 TRP A CA  1 
ATOM   1205 C  C   . TRP A 1 147 ? 21.657  -10.717 -5.480  1.00 39.34  ? 146 TRP A C   1 
ATOM   1206 O  O   . TRP A 1 147 ? 20.885  -11.668 -5.583  1.00 42.80  ? 146 TRP A O   1 
ATOM   1207 C  CB  . TRP A 1 147 ? 21.959  -8.970  -7.216  1.00 40.49  ? 146 TRP A CB  1 
ATOM   1208 C  CG  . TRP A 1 147 ? 22.709  -8.509  -8.417  1.00 38.36  ? 146 TRP A CG  1 
ATOM   1209 C  CD1 . TRP A 1 147 ? 22.214  -8.342  -9.674  1.00 37.46  ? 146 TRP A CD1 1 
ATOM   1210 C  CD2 . TRP A 1 147 ? 24.098  -8.176  -8.484  1.00 39.42  ? 146 TRP A CD2 1 
ATOM   1211 N  NE1 . TRP A 1 147 ? 23.206  -7.925  -10.523 1.00 43.50  ? 146 TRP A NE1 1 
ATOM   1212 C  CE2 . TRP A 1 147 ? 24.375  -7.815  -9.819  1.00 41.01  ? 146 TRP A CE2 1 
ATOM   1213 C  CE3 . TRP A 1 147 ? 25.138  -8.148  -7.548  1.00 39.53  ? 146 TRP A CE3 1 
ATOM   1214 C  CZ2 . TRP A 1 147 ? 25.649  -7.428  -10.242 1.00 42.60  ? 146 TRP A CZ2 1 
ATOM   1215 C  CZ3 . TRP A 1 147 ? 26.405  -7.764  -7.967  1.00 42.00  ? 146 TRP A CZ3 1 
ATOM   1216 C  CH2 . TRP A 1 147 ? 26.648  -7.409  -9.303  1.00 44.78  ? 146 TRP A CH2 1 
ATOM   1217 N  N   . PHE A 1 148 ? 21.800  -10.015 -4.361  1.00 38.07  ? 147 PHE A N   1 
ATOM   1218 C  CA  . PHE A 1 148 ? 21.053  -10.349 -3.154  1.00 35.72  ? 147 PHE A CA  1 
ATOM   1219 C  C   . PHE A 1 148 ? 19.563  -10.067 -3.185  1.00 38.22  ? 147 PHE A C   1 
ATOM   1220 O  O   . PHE A 1 148 ? 18.772  -10.883 -2.714  1.00 38.55  ? 147 PHE A O   1 
ATOM   1221 C  CB  . PHE A 1 148 ? 21.703  -9.716  -1.930  1.00 29.00  ? 147 PHE A CB  1 
ATOM   1222 C  CG  . PHE A 1 148 ? 22.914  -10.451 -1.474  1.00 21.39  ? 147 PHE A CG  1 
ATOM   1223 C  CD1 . PHE A 1 148 ? 24.177  -10.078 -1.914  1.00 19.60  ? 147 PHE A CD1 1 
ATOM   1224 C  CD2 . PHE A 1 148 ? 22.790  -11.550 -0.641  1.00 19.69  ? 147 PHE A CD2 1 
ATOM   1225 C  CE1 . PHE A 1 148 ? 25.294  -10.794 -1.542  1.00 10.88  ? 147 PHE A CE1 1 
ATOM   1226 C  CE2 . PHE A 1 148 ? 23.908  -12.278 -0.259  1.00 15.77  ? 147 PHE A CE2 1 
ATOM   1227 C  CZ  . PHE A 1 148 ? 25.159  -11.897 -0.707  1.00 16.96  ? 147 PHE A CZ  1 
ATOM   1228 N  N   . ALA A 1 149 ? 19.176  -8.915  -3.718  1.00 41.87  ? 148 ALA A N   1 
ATOM   1229 C  CA  . ALA A 1 149 ? 17.763  -8.577  -3.798  1.00 44.93  ? 148 ALA A CA  1 
ATOM   1230 C  C   . ALA A 1 149 ? 17.049  -9.557  -4.731  1.00 48.95  ? 148 ALA A C   1 
ATOM   1231 O  O   . ALA A 1 149 ? 15.917  -9.965  -4.475  1.00 47.90  ? 148 ALA A O   1 
ATOM   1232 C  CB  . ALA A 1 149 ? 17.589  -7.156  -4.288  1.00 41.96  ? 148 ALA A CB  1 
ATOM   1233 N  N   . GLY A 1 150 ? 17.728  -9.939  -5.807  1.00 52.18  ? 149 GLY A N   1 
ATOM   1234 C  CA  . GLY A 1 150 ? 17.164  -10.860 -6.771  1.00 54.38  ? 149 GLY A CA  1 
ATOM   1235 C  C   . GLY A 1 150 ? 17.981  -10.811 -8.041  1.00 57.36  ? 149 GLY A C   1 
ATOM   1236 O  O   . GLY A 1 150 ? 19.196  -10.997 -8.008  1.00 57.14  ? 149 GLY A O   1 
ATOM   1237 N  N   . ASN A 1 151 ? 17.324  -10.554 -9.164  1.00 61.70  ? 150 ASN A N   1 
ATOM   1238 C  CA  . ASN A 1 151 ? 18.027  -10.480 -10.440 1.00 64.97  ? 150 ASN A CA  1 
ATOM   1239 C  C   . ASN A 1 151 ? 18.631  -9.114  -10.666 1.00 62.06  ? 150 ASN A C   1 
ATOM   1240 O  O   . ASN A 1 151 ? 19.503  -8.952  -11.512 1.00 58.10  ? 150 ASN A O   1 
ATOM   1241 C  CB  . ASN A 1 151 ? 17.100  -10.821 -11.603 1.00 68.76  ? 150 ASN A CB  1 
ATOM   1242 C  CG  . ASN A 1 151 ? 16.813  -12.297 -11.694 1.00 73.98  ? 150 ASN A CG  1 
ATOM   1243 O  OD1 . ASN A 1 151 ? 15.657  -12.717 -11.663 1.00 77.95  ? 150 ASN A OD1 1 
ATOM   1244 N  ND2 . ASN A 1 151 ? 17.866  -13.102 -11.801 1.00 77.39  ? 150 ASN A ND2 1 
ATOM   1245 N  N   . LYS A 1 152 ? 18.107  -8.117  -9.965  1.00 63.02  ? 151 LYS A N   1 
ATOM   1246 C  CA  . LYS A 1 152 ? 18.623  -6.768  -10.099 1.00 62.75  ? 151 LYS A CA  1 
ATOM   1247 C  C   . LYS A 1 152 ? 19.480  -6.364  -8.923  1.00 61.52  ? 151 LYS A C   1 
ATOM   1248 O  O   . LYS A 1 152 ? 19.221  -6.744  -7.779  1.00 63.97  ? 151 LYS A O   1 
ATOM   1249 C  CB  . LYS A 1 152 ? 17.643  -5.714  -10.580 1.00 63.79  ? 151 LYS A CB  1 
ATOM   1250 C  CG  . LYS A 1 152 ? 16.656  -5.215  -9.558  1.00 69.81  ? 151 LYS A CG  1 
ATOM   1251 C  CD  . LYS A 1 152 ? 16.512  -3.708  -9.650  1.00 74.02  ? 151 LYS A CD  1 
ATOM   1252 C  CE  . LYS A 1 152 ? 15.471  -3.152  -8.748  1.00 77.47  ? 151 LYS A CE  1 
ATOM   1253 N  NZ  . LYS A 1 152 ? 15.080  -4.088  -7.651  1.00 75.31  ? 151 LYS A NZ  1 
ATOM   1254 N  N   . ILE A 1 153 ? 20.529  -5.617  -9.227  1.00 57.41  ? 152 ILE A N   1 
ATOM   1255 C  CA  . ILE A 1 153 ? 21.438  -5.131  -8.209  1.00 55.36  ? 152 ILE A CA  1 
ATOM   1256 C  C   . ILE A 1 153 ? 20.743  -4.012  -7.436  1.00 54.31  ? 152 ILE A C   1 
ATOM   1257 O  O   . ILE A 1 153 ? 19.992  -3.214  -8.007  1.00 51.75  ? 152 ILE A O   1 
ATOM   1258 C  CB  . ILE A 1 153 ? 22.750  -4.597  -8.844  1.00 56.51  ? 152 ILE A CB  1 
ATOM   1259 C  CG1 . ILE A 1 153 ? 23.674  -4.023  -7.765  1.00 58.63  ? 152 ILE A CG1 1 
ATOM   1260 C  CG2 . ILE A 1 153 ? 22.438  -3.558  -9.918  1.00 58.12  ? 152 ILE A CG2 1 
ATOM   1261 C  CD1 . ILE A 1 153 ? 24.966  -3.466  -8.295  1.00 61.61  ? 152 ILE A CD1 1 
ATOM   1262 N  N   . THR A 1 154 ? 20.992  -3.971  -6.136  1.00 52.09  ? 153 THR A N   1 
ATOM   1263 C  CA  . THR A 1 154 ? 20.418  -2.958  -5.270  1.00 48.76  ? 153 THR A CA  1 
ATOM   1264 C  C   . THR A 1 154 ? 21.514  -2.423  -4.366  1.00 44.86  ? 153 THR A C   1 
ATOM   1265 O  O   . THR A 1 154 ? 22.627  -2.959  -4.343  1.00 44.34  ? 153 THR A O   1 
ATOM   1266 C  CB  . THR A 1 154 ? 19.292  -3.542  -4.421  1.00 47.97  ? 153 THR A CB  1 
ATOM   1267 O  OG1 . THR A 1 154 ? 19.605  -4.901  -4.097  1.00 55.74  ? 153 THR A OG1 1 
ATOM   1268 C  CG2 . THR A 1 154 ? 17.988  -3.512  -5.176  1.00 50.98  ? 153 THR A CG2 1 
ATOM   1269 N  N   . PHE A 1 155 ? 21.213  -1.364  -3.622  1.00 40.02  ? 154 PHE A N   1 
ATOM   1270 C  CA  . PHE A 1 155 ? 22.211  -0.786  -2.740  1.00 36.12  ? 154 PHE A CA  1 
ATOM   1271 C  C   . PHE A 1 155 ? 22.714  -1.761  -1.680  1.00 31.19  ? 154 PHE A C   1 
ATOM   1272 O  O   . PHE A 1 155 ? 23.825  -1.612  -1.184  1.00 32.18  ? 154 PHE A O   1 
ATOM   1273 C  CB  . PHE A 1 155 ? 21.719  0.530   -2.119  1.00 32.30  ? 154 PHE A CB  1 
ATOM   1274 C  CG  . PHE A 1 155 ? 20.791  0.359   -0.944  1.00 28.34  ? 154 PHE A CG  1 
ATOM   1275 C  CD1 . PHE A 1 155 ? 21.284  0.327   0.356   1.00 30.61  ? 154 PHE A CD1 1 
ATOM   1276 C  CD2 . PHE A 1 155 ? 19.419  0.281   -1.128  1.00 27.24  ? 154 PHE A CD2 1 
ATOM   1277 C  CE1 . PHE A 1 155 ? 20.420  0.223   1.449   1.00 27.75  ? 154 PHE A CE1 1 
ATOM   1278 C  CE2 . PHE A 1 155 ? 18.553  0.177   -0.038  1.00 26.20  ? 154 PHE A CE2 1 
ATOM   1279 C  CZ  . PHE A 1 155 ? 19.060  0.150   1.248   1.00 24.79  ? 154 PHE A CZ  1 
ATOM   1280 N  N   . VAL A 1 156 ? 21.905  -2.752  -1.328  1.00 26.61  ? 155 VAL A N   1 
ATOM   1281 C  CA  . VAL A 1 156 ? 22.343  -3.719  -0.330  1.00 28.86  ? 155 VAL A CA  1 
ATOM   1282 C  C   . VAL A 1 156 ? 23.530  -4.547  -0.799  1.00 28.27  ? 155 VAL A C   1 
ATOM   1283 O  O   . VAL A 1 156 ? 24.266  -5.110  0.013   1.00 30.43  ? 155 VAL A O   1 
ATOM   1284 C  CB  . VAL A 1 156 ? 21.200  -4.669  0.144   1.00 30.33  ? 155 VAL A CB  1 
ATOM   1285 C  CG1 . VAL A 1 156 ? 20.199  -3.894  0.986   1.00 29.90  ? 155 VAL A CG1 1 
ATOM   1286 C  CG2 . VAL A 1 156 ? 20.523  -5.361  -1.036  1.00 25.10  ? 155 VAL A CG2 1 
ATOM   1287 N  N   . ASP A 1 157 ? 23.679  -4.677  -2.111  1.00 27.77  ? 156 ASP A N   1 
ATOM   1288 C  CA  . ASP A 1 157 ? 24.790  -5.440  -2.662  1.00 31.75  ? 156 ASP A CA  1 
ATOM   1289 C  C   . ASP A 1 157 ? 26.109  -4.751  -2.298  1.00 32.30  ? 156 ASP A C   1 
ATOM   1290 O  O   . ASP A 1 157 ? 27.144  -5.399  -2.150  1.00 32.92  ? 156 ASP A O   1 
ATOM   1291 C  CB  . ASP A 1 157 ? 24.627  -5.593  -4.176  1.00 32.89  ? 156 ASP A CB  1 
ATOM   1292 C  CG  . ASP A 1 157 ? 23.461  -6.494  -4.545  1.00 40.10  ? 156 ASP A CG  1 
ATOM   1293 O  OD1 . ASP A 1 157 ? 23.582  -7.728  -4.356  1.00 44.71  ? 156 ASP A OD1 1 
ATOM   1294 O  OD2 . ASP A 1 157 ? 22.424  -5.972  -5.013  1.00 37.66  ? 156 ASP A OD2 1 
ATOM   1295 N  N   . PHE A 1 158 ? 26.049  -3.434  -2.137  1.00 31.23  ? 157 PHE A N   1 
ATOM   1296 C  CA  . PHE A 1 158 ? 27.210  -2.650  -1.762  1.00 29.59  ? 157 PHE A CA  1 
ATOM   1297 C  C   . PHE A 1 158 ? 27.524  -2.894  -0.296  1.00 25.24  ? 157 PHE A C   1 
ATOM   1298 O  O   . PHE A 1 158 ? 28.687  -2.990  0.095   1.00 26.29  ? 157 PHE A O   1 
ATOM   1299 C  CB  . PHE A 1 158 ? 26.943  -1.168  -2.018  1.00 33.33  ? 157 PHE A CB  1 
ATOM   1300 C  CG  . PHE A 1 158 ? 26.778  -0.836  -3.469  1.00 38.01  ? 157 PHE A CG  1 
ATOM   1301 C  CD1 . PHE A 1 158 ? 25.691  -1.323  -4.187  1.00 39.74  ? 157 PHE A CD1 1 
ATOM   1302 C  CD2 . PHE A 1 158 ? 27.728  -0.066  -4.133  1.00 37.28  ? 157 PHE A CD2 1 
ATOM   1303 C  CE1 . PHE A 1 158 ? 25.547  -1.054  -5.541  1.00 34.87  ? 157 PHE A CE1 1 
ATOM   1304 C  CE2 . PHE A 1 158 ? 27.592  0.208   -5.489  1.00 37.93  ? 157 PHE A CE2 1 
ATOM   1305 C  CZ  . PHE A 1 158 ? 26.496  -0.290  -6.192  1.00 37.06  ? 157 PHE A CZ  1 
ATOM   1306 N  N   . LEU A 1 159 ? 26.477  -2.976  0.516   1.00 21.31  ? 158 LEU A N   1 
ATOM   1307 C  CA  . LEU A 1 159 ? 26.627  -3.222  1.947   1.00 20.35  ? 158 LEU A CA  1 
ATOM   1308 C  C   . LEU A 1 159 ? 27.134  -4.634  2.200   1.00 24.48  ? 158 LEU A C   1 
ATOM   1309 O  O   . LEU A 1 159 ? 27.990  -4.849  3.062   1.00 26.38  ? 158 LEU A O   1 
ATOM   1310 C  CB  . LEU A 1 159 ? 25.299  -3.008  2.679   1.00 14.75  ? 158 LEU A CB  1 
ATOM   1311 C  CG  . LEU A 1 159 ? 24.801  -1.568  2.805   1.00 18.15  ? 158 LEU A CG  1 
ATOM   1312 C  CD1 . LEU A 1 159 ? 23.421  -1.534  3.454   1.00 9.16   ? 158 LEU A CD1 1 
ATOM   1313 C  CD2 . LEU A 1 159 ? 25.791  -0.766  3.629   1.00 16.34  ? 158 LEU A CD2 1 
ATOM   1314 N  N   . VAL A 1 160 ? 26.583  -5.600  1.476   1.00 25.89  ? 159 VAL A N   1 
ATOM   1315 C  CA  . VAL A 1 160 ? 27.008  -6.975  1.631   1.00 28.77  ? 159 VAL A CA  1 
ATOM   1316 C  C   . VAL A 1 160 ? 28.453  -7.131  1.170   1.00 30.79  ? 159 VAL A C   1 
ATOM   1317 O  O   . VAL A 1 160 ? 29.247  -7.819  1.819   1.00 35.07  ? 159 VAL A O   1 
ATOM   1318 C  CB  . VAL A 1 160 ? 26.132  -7.928  0.830   1.00 28.37  ? 159 VAL A CB  1 
ATOM   1319 C  CG1 . VAL A 1 160 ? 26.628  -9.340  0.996   1.00 25.68  ? 159 VAL A CG1 1 
ATOM   1320 C  CG2 . VAL A 1 160 ? 24.696  -7.832  1.299   1.00 31.36  ? 159 VAL A CG2 1 
ATOM   1321 N  N   . TYR A 1 161 ? 28.782  -6.540  0.025   1.00 31.43  ? 160 TYR A N   1 
ATOM   1322 C  CA  . TYR A 1 161 ? 30.139  -6.629  -0.486  1.00 33.55  ? 160 TYR A CA  1 
ATOM   1323 C  C   . TYR A 1 161 ? 31.119  -6.121  0.565   1.00 34.25  ? 160 TYR A C   1 
ATOM   1324 O  O   . TYR A 1 161 ? 32.047  -6.834  0.951   1.00 35.48  ? 160 TYR A O   1 
ATOM   1325 C  CB  . TYR A 1 161 ? 30.288  -5.824  -1.785  1.00 30.42  ? 160 TYR A CB  1 
ATOM   1326 C  CG  . TYR A 1 161 ? 31.731  -5.552  -2.170  1.00 32.79  ? 160 TYR A CG  1 
ATOM   1327 C  CD1 . TYR A 1 161 ? 32.293  -4.287  -1.967  1.00 34.43  ? 160 TYR A CD1 1 
ATOM   1328 C  CD2 . TYR A 1 161 ? 32.549  -6.566  -2.689  1.00 34.23  ? 160 TYR A CD2 1 
ATOM   1329 C  CE1 . TYR A 1 161 ? 33.629  -4.034  -2.262  1.00 32.09  ? 160 TYR A CE1 1 
ATOM   1330 C  CE2 . TYR A 1 161 ? 33.891  -6.323  -2.987  1.00 37.14  ? 160 TYR A CE2 1 
ATOM   1331 C  CZ  . TYR A 1 161 ? 34.425  -5.055  -2.770  1.00 36.02  ? 160 TYR A CZ  1 
ATOM   1332 O  OH  . TYR A 1 161 ? 35.755  -4.802  -3.043  1.00 37.33  ? 160 TYR A OH  1 
ATOM   1333 N  N   . ASP A 1 162 ? 30.909  -4.885  1.008   1.00 33.71  ? 161 ASP A N   1 
ATOM   1334 C  CA  . ASP A 1 162 ? 31.761  -4.247  2.001   1.00 31.39  ? 161 ASP A CA  1 
ATOM   1335 C  C   . ASP A 1 162 ? 32.082  -5.195  3.146   1.00 28.57  ? 161 ASP A C   1 
ATOM   1336 O  O   . ASP A 1 162 ? 33.244  -5.360  3.516   1.00 28.38  ? 161 ASP A O   1 
ATOM   1337 C  CB  . ASP A 1 162 ? 31.077  -2.986  2.532   1.00 31.29  ? 161 ASP A CB  1 
ATOM   1338 C  CG  . ASP A 1 162 ? 31.963  -2.178  3.463   1.00 35.64  ? 161 ASP A CG  1 
ATOM   1339 O  OD1 . ASP A 1 162 ? 33.152  -2.516  3.628   1.00 30.14  ? 161 ASP A OD1 1 
ATOM   1340 O  OD2 . ASP A 1 162 ? 31.459  -1.184  4.031   1.00 43.21  ? 161 ASP A OD2 1 
ATOM   1341 N  N   . VAL A 1 163 ? 31.042  -5.789  3.715   1.00 27.49  ? 162 VAL A N   1 
ATOM   1342 C  CA  . VAL A 1 163 ? 31.188  -6.718  4.820   1.00 30.02  ? 162 VAL A CA  1 
ATOM   1343 C  C   . VAL A 1 163 ? 32.055  -7.903  4.410   1.00 30.15  ? 162 VAL A C   1 
ATOM   1344 O  O   . VAL A 1 163 ? 33.030  -8.219  5.088   1.00 32.67  ? 162 VAL A O   1 
ATOM   1345 C  CB  . VAL A 1 163 ? 29.795  -7.184  5.319   1.00 31.07  ? 162 VAL A CB  1 
ATOM   1346 C  CG1 . VAL A 1 163 ? 29.906  -8.368  6.251   1.00 39.09  ? 162 VAL A CG1 1 
ATOM   1347 C  CG2 . VAL A 1 163 ? 29.105  -6.033  6.025   1.00 39.02  ? 162 VAL A CG2 1 
ATOM   1348 N  N   . LEU A 1 164 ? 31.705  -8.554  3.307   1.00 31.64  ? 163 LEU A N   1 
ATOM   1349 C  CA  . LEU A 1 164 ? 32.466  -9.703  2.836   1.00 32.50  ? 163 LEU A CA  1 
ATOM   1350 C  C   . LEU A 1 164 ? 33.922  -9.327  2.572   1.00 31.30  ? 163 LEU A C   1 
ATOM   1351 O  O   . LEU A 1 164 ? 34.834  -10.057 2.970   1.00 33.88  ? 163 LEU A O   1 
ATOM   1352 C  CB  . LEU A 1 164 ? 31.818  -10.284 1.582   1.00 35.42  ? 163 LEU A CB  1 
ATOM   1353 C  CG  . LEU A 1 164 ? 30.346  -10.706 1.731   1.00 34.09  ? 163 LEU A CG  1 
ATOM   1354 C  CD1 . LEU A 1 164 ? 29.757  -11.040 0.373   1.00 37.97  ? 163 LEU A CD1 1 
ATOM   1355 C  CD2 . LEU A 1 164 ? 30.208  -11.886 2.680   1.00 34.28  ? 163 LEU A CD2 1 
ATOM   1356 N  N   . ASP A 1 165 ? 34.138  -8.190  1.912   1.00 31.22  ? 164 ASP A N   1 
ATOM   1357 C  CA  . ASP A 1 165 ? 35.492  -7.738  1.626   1.00 33.67  ? 164 ASP A CA  1 
ATOM   1358 C  C   . ASP A 1 165 ? 36.263  -7.557  2.935   1.00 34.63  ? 164 ASP A C   1 
ATOM   1359 O  O   . ASP A 1 165 ? 37.359  -8.104  3.095   1.00 35.65  ? 164 ASP A O   1 
ATOM   1360 C  CB  . ASP A 1 165 ? 35.491  -6.433  0.816   1.00 35.24  ? 164 ASP A CB  1 
ATOM   1361 C  CG  . ASP A 1 165 ? 36.901  -5.975  0.425   1.00 39.04  ? 164 ASP A CG  1 
ATOM   1362 O  OD1 . ASP A 1 165 ? 37.720  -6.822  0.006   1.00 36.78  ? 164 ASP A OD1 1 
ATOM   1363 O  OD2 . ASP A 1 165 ? 37.195  -4.765  0.533   1.00 44.17  ? 164 ASP A OD2 1 
ATOM   1364 N  N   . LEU A 1 166 ? 35.704  -6.783  3.862   1.00 33.70  ? 165 LEU A N   1 
ATOM   1365 C  CA  . LEU A 1 166 ? 36.351  -6.560  5.153   1.00 36.34  ? 165 LEU A CA  1 
ATOM   1366 C  C   . LEU A 1 166 ? 36.791  -7.868  5.806   1.00 37.45  ? 165 LEU A C   1 
ATOM   1367 O  O   . LEU A 1 166 ? 37.762  -7.890  6.560   1.00 40.97  ? 165 LEU A O   1 
ATOM   1368 C  CB  . LEU A 1 166 ? 35.417  -5.821  6.112   1.00 30.43  ? 165 LEU A CB  1 
ATOM   1369 C  CG  . LEU A 1 166 ? 35.199  -4.342  5.849   1.00 25.63  ? 165 LEU A CG  1 
ATOM   1370 C  CD1 . LEU A 1 166 ? 34.172  -3.809  6.822   1.00 22.08  ? 165 LEU A CD1 1 
ATOM   1371 C  CD2 . LEU A 1 166 ? 36.507  -3.594  6.008   1.00 19.11  ? 165 LEU A CD2 1 
ATOM   1372 N  N   . HIS A 1 167 ? 36.054  -8.941  5.543   1.00 35.05  ? 166 HIS A N   1 
ATOM   1373 C  CA  . HIS A 1 167 ? 36.375  -10.231 6.121   1.00 32.61  ? 166 HIS A CA  1 
ATOM   1374 C  C   . HIS A 1 167 ? 37.443  -11.023 5.394   1.00 33.88  ? 166 HIS A C   1 
ATOM   1375 O  O   . HIS A 1 167 ? 38.173  -11.772 6.032   1.00 33.04  ? 166 HIS A O   1 
ATOM   1376 C  CB  . HIS A 1 167 ? 35.108  -11.057 6.362   1.00 30.24  ? 166 HIS A CB  1 
ATOM   1377 C  CG  . HIS A 1 167 ? 34.324  -10.588 7.550   1.00 33.70  ? 166 HIS A CG  1 
ATOM   1378 N  ND1 . HIS A 1 167 ? 33.417  -9.552  7.484   1.00 42.11  ? 166 HIS A ND1 1 
ATOM   1379 C  CD2 . HIS A 1 167 ? 34.391  -10.945 8.852   1.00 33.86  ? 166 HIS A CD2 1 
ATOM   1380 C  CE1 . HIS A 1 167 ? 32.969  -9.284  8.695   1.00 37.52  ? 166 HIS A CE1 1 
ATOM   1381 N  NE2 . HIS A 1 167 ? 33.539  -10.114 9.548   1.00 34.47  ? 166 HIS A NE2 1 
ATOM   1382 N  N   . ARG A 1 168 ? 37.531  -10.894 4.073   1.00 36.85  ? 167 ARG A N   1 
ATOM   1383 C  CA  . ARG A 1 168 ? 38.582  -11.602 3.338   1.00 43.00  ? 167 ARG A CA  1 
ATOM   1384 C  C   . ARG A 1 168 ? 39.891  -10.900 3.716   1.00 43.47  ? 167 ARG A C   1 
ATOM   1385 O  O   . ARG A 1 168 ? 40.973  -11.475 3.612   1.00 44.05  ? 167 ARG A O   1 
ATOM   1386 C  CB  . ARG A 1 168 ? 38.354  -11.539 1.816   1.00 48.03  ? 167 ARG A CB  1 
ATOM   1387 C  CG  . ARG A 1 168 ? 38.814  -10.243 1.166   1.00 56.39  ? 167 ARG A CG  1 
ATOM   1388 C  CD  . ARG A 1 168 ? 37.942  -9.860  -0.013  1.00 60.79  ? 167 ARG A CD  1 
ATOM   1389 N  NE  . ARG A 1 168 ? 38.359  -10.447 -1.281  1.00 64.35  ? 167 ARG A NE  1 
ATOM   1390 C  CZ  . ARG A 1 168 ? 38.280  -9.810  -2.447  1.00 65.93  ? 167 ARG A CZ  1 
ATOM   1391 N  NH1 . ARG A 1 168 ? 37.805  -8.570  -2.503  1.00 64.73  ? 167 ARG A NH1 1 
ATOM   1392 N  NH2 . ARG A 1 168 ? 38.656  -10.417 -3.564  1.00 66.09  ? 167 ARG A NH2 1 
ATOM   1393 N  N   . ILE A 1 169 ? 39.773  -9.637  4.121   1.00 44.00  ? 168 ILE A N   1 
ATOM   1394 C  CA  . ILE A 1 169 ? 40.913  -8.834  4.547   1.00 44.13  ? 168 ILE A CA  1 
ATOM   1395 C  C   . ILE A 1 169 ? 41.368  -9.285  5.940   1.00 44.48  ? 168 ILE A C   1 
ATOM   1396 O  O   . ILE A 1 169 ? 42.563  -9.350  6.228   1.00 40.70  ? 168 ILE A O   1 
ATOM   1397 C  CB  . ILE A 1 169 ? 40.533  -7.342  4.598   1.00 43.80  ? 168 ILE A CB  1 
ATOM   1398 C  CG1 . ILE A 1 169 ? 40.303  -6.820  3.181   1.00 45.44  ? 168 ILE A CG1 1 
ATOM   1399 C  CG2 . ILE A 1 169 ? 41.611  -6.537  5.305   1.00 39.57  ? 168 ILE A CG2 1 
ATOM   1400 C  CD1 . ILE A 1 169 ? 39.899  -5.359  3.117   1.00 48.98  ? 168 ILE A CD1 1 
ATOM   1401 N  N   . PHE A 1 170 ? 40.400  -9.599  6.792   1.00 45.76  ? 169 PHE A N   1 
ATOM   1402 C  CA  . PHE A 1 170 ? 40.655  -10.033 8.162   1.00 47.87  ? 169 PHE A CA  1 
ATOM   1403 C  C   . PHE A 1 170 ? 41.104  -11.500 8.212   1.00 50.10  ? 169 PHE A C   1 
ATOM   1404 O  O   . PHE A 1 170 ? 42.026  -11.855 8.944   1.00 50.74  ? 169 PHE A O   1 
ATOM   1405 C  CB  . PHE A 1 170 ? 39.376  -9.838  8.977   1.00 46.52  ? 169 PHE A CB  1 
ATOM   1406 C  CG  . PHE A 1 170 ? 39.574  -9.902  10.461  1.00 48.17  ? 169 PHE A CG  1 
ATOM   1407 C  CD1 . PHE A 1 170 ? 40.069  -8.804  11.158  1.00 43.76  ? 169 PHE A CD1 1 
ATOM   1408 C  CD2 . PHE A 1 170 ? 39.211  -11.042 11.172  1.00 49.74  ? 169 PHE A CD2 1 
ATOM   1409 C  CE1 . PHE A 1 170 ? 40.197  -8.839  12.544  1.00 46.17  ? 169 PHE A CE1 1 
ATOM   1410 C  CE2 . PHE A 1 170 ? 39.336  -11.084 12.562  1.00 51.55  ? 169 PHE A CE2 1 
ATOM   1411 C  CZ  . PHE A 1 170 ? 39.828  -9.980  13.247  1.00 45.26  ? 169 PHE A CZ  1 
ATOM   1412 N  N   . GLU A 1 171 ? 40.415  -12.345 7.456   1.00 53.03  ? 170 GLU A N   1 
ATOM   1413 C  CA  . GLU A 1 171 ? 40.706  -13.773 7.381   1.00 55.36  ? 170 GLU A CA  1 
ATOM   1414 C  C   . GLU A 1 171 ? 40.500  -14.174 5.924   1.00 55.31  ? 170 GLU A C   1 
ATOM   1415 O  O   . GLU A 1 171 ? 39.424  -14.614 5.529   1.00 54.45  ? 170 GLU A O   1 
ATOM   1416 C  CB  . GLU A 1 171 ? 39.762  -14.559 8.295   1.00 56.22  ? 170 GLU A CB  1 
ATOM   1417 C  CG  . GLU A 1 171 ? 39.884  -16.081 8.209   1.00 62.90  ? 170 GLU A CG  1 
ATOM   1418 C  CD  . GLU A 1 171 ? 41.252  -16.594 8.613   1.00 67.85  ? 170 GLU A CD  1 
ATOM   1419 O  OE1 . GLU A 1 171 ? 41.702  -16.281 9.739   1.00 71.59  ? 170 GLU A OE1 1 
ATOM   1420 O  OE2 . GLU A 1 171 ? 41.874  -17.316 7.802   1.00 71.99  ? 170 GLU A OE2 1 
ATOM   1421 N  N   . PRO A 1 172 ? 41.556  -14.058 5.118   1.00 56.02  ? 171 PRO A N   1 
ATOM   1422 C  CA  . PRO A 1 172 ? 41.610  -14.367 3.688   1.00 61.08  ? 171 PRO A CA  1 
ATOM   1423 C  C   . PRO A 1 172 ? 40.939  -15.653 3.233   1.00 63.28  ? 171 PRO A C   1 
ATOM   1424 O  O   . PRO A 1 172 ? 40.263  -15.677 2.201   1.00 66.15  ? 171 PRO A O   1 
ATOM   1425 C  CB  . PRO A 1 172 ? 43.107  -14.391 3.418   1.00 62.35  ? 171 PRO A CB  1 
ATOM   1426 C  CG  . PRO A 1 172 ? 43.612  -13.336 4.354   1.00 60.70  ? 171 PRO A CG  1 
ATOM   1427 C  CD  . PRO A 1 172 ? 42.889  -13.689 5.619   1.00 56.42  ? 171 PRO A CD  1 
ATOM   1428 N  N   . LYS A 1 173 ? 41.162  -16.728 3.977   1.00 62.39  ? 172 LYS A N   1 
ATOM   1429 C  CA  . LYS A 1 173 ? 40.582  -18.020 3.636   1.00 60.94  ? 172 LYS A CA  1 
ATOM   1430 C  C   . LYS A 1 173 ? 39.088  -18.142 3.956   1.00 58.21  ? 172 LYS A C   1 
ATOM   1431 O  O   . LYS A 1 173 ? 38.432  -19.079 3.505   1.00 58.41  ? 172 LYS A O   1 
ATOM   1432 C  CB  . LYS A 1 173 ? 41.344  -19.137 4.358   1.00 67.23  ? 172 LYS A CB  1 
ATOM   1433 C  CG  . LYS A 1 173 ? 42.785  -19.337 3.898   1.00 70.20  ? 172 LYS A CG  1 
ATOM   1434 C  CD  . LYS A 1 173 ? 43.509  -20.322 4.819   1.00 72.60  ? 172 LYS A CD  1 
ATOM   1435 C  CE  . LYS A 1 173 ? 44.913  -20.662 4.323   1.00 70.76  ? 172 LYS A CE  1 
ATOM   1436 N  NZ  . LYS A 1 173 ? 44.899  -21.471 3.071   1.00 66.52  ? 172 LYS A NZ  1 
ATOM   1437 N  N   . CYS A 1 174 ? 38.559  -17.196 4.725   1.00 54.85  ? 173 CYS A N   1 
ATOM   1438 C  CA  . CYS A 1 174 ? 37.158  -17.228 5.141   1.00 52.53  ? 173 CYS A CA  1 
ATOM   1439 C  C   . CYS A 1 174 ? 36.104  -17.483 4.069   1.00 50.08  ? 173 CYS A C   1 
ATOM   1440 O  O   . CYS A 1 174 ? 35.068  -18.081 4.355   1.00 47.95  ? 173 CYS A O   1 
ATOM   1441 C  CB  . CYS A 1 174 ? 36.799  -15.957 5.912   1.00 54.57  ? 173 CYS A CB  1 
ATOM   1442 S  SG  . CYS A 1 174 ? 36.816  -14.426 4.944   1.00 55.02  ? 173 CYS A SG  1 
ATOM   1443 N  N   . LEU A 1 175 ? 36.359  -17.024 2.849   1.00 51.52  ? 174 LEU A N   1 
ATOM   1444 C  CA  . LEU A 1 175 ? 35.409  -17.188 1.753   1.00 54.71  ? 174 LEU A CA  1 
ATOM   1445 C  C   . LEU A 1 175 ? 35.591  -18.413 0.867   1.00 55.18  ? 174 LEU A C   1 
ATOM   1446 O  O   . LEU A 1 175 ? 34.717  -18.722 0.056   1.00 53.97  ? 174 LEU A O   1 
ATOM   1447 C  CB  . LEU A 1 175 ? 35.415  -15.941 0.871   1.00 56.66  ? 174 LEU A CB  1 
ATOM   1448 C  CG  . LEU A 1 175 ? 34.446  -14.805 1.190   1.00 58.60  ? 174 LEU A CG  1 
ATOM   1449 C  CD1 . LEU A 1 175 ? 34.258  -14.625 2.686   1.00 57.03  ? 174 LEU A CD1 1 
ATOM   1450 C  CD2 . LEU A 1 175 ? 34.968  -13.533 0.555   1.00 58.31  ? 174 LEU A CD2 1 
ATOM   1451 N  N   . ASP A 1 176 ? 36.718  -19.103 1.008   1.00 56.12  ? 175 ASP A N   1 
ATOM   1452 C  CA  . ASP A 1 176 ? 37.006  -20.277 0.185   1.00 58.62  ? 175 ASP A CA  1 
ATOM   1453 C  C   . ASP A 1 176 ? 35.898  -21.325 0.146   1.00 59.54  ? 175 ASP A C   1 
ATOM   1454 O  O   . ASP A 1 176 ? 35.652  -21.941 -0.896  1.00 59.68  ? 175 ASP A O   1 
ATOM   1455 C  CB  . ASP A 1 176 ? 38.319  -20.928 0.627   1.00 58.63  ? 175 ASP A CB  1 
ATOM   1456 C  CG  . ASP A 1 176 ? 39.505  -19.984 0.528   1.00 62.76  ? 175 ASP A CG  1 
ATOM   1457 O  OD1 . ASP A 1 176 ? 39.331  -18.817 0.119   1.00 64.81  ? 175 ASP A OD1 1 
ATOM   1458 O  OD2 . ASP A 1 176 ? 40.624  -20.411 0.876   1.00 68.49  ? 175 ASP A OD2 1 
ATOM   1459 N  N   . ALA A 1 177 ? 35.239  -21.530 1.281   1.00 59.76  ? 176 ALA A N   1 
ATOM   1460 C  CA  . ALA A 1 177 ? 34.167  -22.514 1.380   1.00 59.61  ? 176 ALA A CA  1 
ATOM   1461 C  C   . ALA A 1 177 ? 32.867  -22.094 0.699   1.00 60.39  ? 176 ALA A C   1 
ATOM   1462 O  O   . ALA A 1 177 ? 31.956  -22.907 0.556   1.00 60.97  ? 176 ALA A O   1 
ATOM   1463 C  CB  . ALA A 1 177 ? 33.903  -22.848 2.843   1.00 57.79  ? 176 ALA A CB  1 
ATOM   1464 N  N   . PHE A 1 178 ? 32.775  -20.835 0.282   1.00 60.54  ? 177 PHE A N   1 
ATOM   1465 C  CA  . PHE A 1 178 ? 31.562  -20.330 -0.359  1.00 60.64  ? 177 PHE A CA  1 
ATOM   1466 C  C   . PHE A 1 178 ? 31.827  -19.753 -1.746  1.00 59.86  ? 177 PHE A C   1 
ATOM   1467 O  O   . PHE A 1 178 ? 31.942  -18.536 -1.925  1.00 57.42  ? 177 PHE A O   1 
ATOM   1468 C  CB  . PHE A 1 178 ? 30.897  -19.282 0.538   1.00 61.37  ? 177 PHE A CB  1 
ATOM   1469 C  CG  . PHE A 1 178 ? 30.846  -19.678 1.986   1.00 59.13  ? 177 PHE A CG  1 
ATOM   1470 C  CD1 . PHE A 1 178 ? 29.921  -20.613 2.437   1.00 57.16  ? 177 PHE A CD1 1 
ATOM   1471 C  CD2 . PHE A 1 178 ? 31.758  -19.147 2.889   1.00 59.75  ? 177 PHE A CD2 1 
ATOM   1472 C  CE1 . PHE A 1 178 ? 29.909  -21.016 3.766   1.00 59.67  ? 177 PHE A CE1 1 
ATOM   1473 C  CE2 . PHE A 1 178 ? 31.752  -19.544 4.221   1.00 64.34  ? 177 PHE A CE2 1 
ATOM   1474 C  CZ  . PHE A 1 178 ? 30.827  -20.480 4.662   1.00 61.77  ? 177 PHE A CZ  1 
ATOM   1475 N  N   . PRO A 1 179 ? 31.892  -20.629 -2.761  1.00 61.66  ? 178 PRO A N   1 
ATOM   1476 C  CA  . PRO A 1 179 ? 32.146  -20.206 -4.140  1.00 59.22  ? 178 PRO A CA  1 
ATOM   1477 C  C   . PRO A 1 179 ? 31.211  -19.124 -4.670  1.00 53.99  ? 178 PRO A C   1 
ATOM   1478 O  O   . PRO A 1 179 ? 31.659  -18.196 -5.337  1.00 54.34  ? 178 PRO A O   1 
ATOM   1479 C  CB  . PRO A 1 179 ? 32.036  -21.515 -4.930  1.00 60.55  ? 178 PRO A CB  1 
ATOM   1480 C  CG  . PRO A 1 179 ? 31.168  -22.385 -4.071  1.00 61.79  ? 178 PRO A CG  1 
ATOM   1481 C  CD  . PRO A 1 179 ? 31.679  -22.085 -2.694  1.00 61.91  ? 178 PRO A CD  1 
ATOM   1482 N  N   . ASN A 1 180 ? 29.918  -19.246 -4.383  1.00 48.90  ? 179 ASN A N   1 
ATOM   1483 C  CA  . ASN A 1 180 ? 28.942  -18.262 -4.851  1.00 49.15  ? 179 ASN A CA  1 
ATOM   1484 C  C   . ASN A 1 180 ? 29.222  -16.855 -4.334  1.00 48.25  ? 179 ASN A C   1 
ATOM   1485 O  O   . ASN A 1 180 ? 28.934  -15.872 -5.021  1.00 45.24  ? 179 ASN A O   1 
ATOM   1486 C  CB  . ASN A 1 180 ? 27.520  -18.691 -4.486  1.00 49.95  ? 179 ASN A CB  1 
ATOM   1487 C  CG  . ASN A 1 180 ? 27.286  -18.747 -2.990  1.00 50.06  ? 179 ASN A CG  1 
ATOM   1488 O  OD1 . ASN A 1 180 ? 26.153  -18.632 -2.532  1.00 51.92  ? 179 ASN A OD1 1 
ATOM   1489 N  ND2 . ASN A 1 180 ? 28.352  -18.933 -2.225  1.00 50.79  ? 179 ASN A ND2 1 
ATOM   1490 N  N   . LEU A 1 181 ? 29.773  -16.765 -3.127  1.00 46.97  ? 180 LEU A N   1 
ATOM   1491 C  CA  . LEU A 1 181 ? 30.099  -15.477 -2.531  1.00 45.99  ? 180 LEU A CA  1 
ATOM   1492 C  C   . LEU A 1 181 ? 31.301  -14.886 -3.246  1.00 51.29  ? 180 LEU A C   1 
ATOM   1493 O  O   . LEU A 1 181 ? 31.403  -13.665 -3.417  1.00 53.03  ? 180 LEU A O   1 
ATOM   1494 C  CB  . LEU A 1 181 ? 30.408  -15.615 -1.036  1.00 42.89  ? 180 LEU A CB  1 
ATOM   1495 C  CG  . LEU A 1 181 ? 29.273  -16.003 -0.082  1.00 40.44  ? 180 LEU A CG  1 
ATOM   1496 C  CD1 . LEU A 1 181 ? 29.747  -15.839 1.357   1.00 44.97  ? 180 LEU A CD1 1 
ATOM   1497 C  CD2 . LEU A 1 181 ? 28.054  -15.132 -0.338  1.00 40.17  ? 180 LEU A CD2 1 
ATOM   1498 N  N   . LYS A 1 182 ? 32.247  -15.752 -3.596  1.00 52.82  ? 181 LYS A N   1 
ATOM   1499 C  CA  . LYS A 1 182 ? 33.429  -15.315 -4.313  1.00 53.00  ? 181 LYS A CA  1 
ATOM   1500 C  C   . LYS A 1 182 ? 32.988  -14.775 -5.661  1.00 53.40  ? 181 LYS A C   1 
ATOM   1501 O  O   . LYS A 1 182 ? 33.457  -13.728 -6.094  1.00 51.37  ? 181 LYS A O   1 
ATOM   1502 C  CB  . LYS A 1 182 ? 34.399  -16.473 -4.507  1.00 55.40  ? 181 LYS A CB  1 
ATOM   1503 C  CG  . LYS A 1 182 ? 35.350  -16.670 -3.351  1.00 61.32  ? 181 LYS A CG  1 
ATOM   1504 C  CD  . LYS A 1 182 ? 36.279  -17.830 -3.620  1.00 66.75  ? 181 LYS A CD  1 
ATOM   1505 C  CE  . LYS A 1 182 ? 37.395  -17.877 -2.602  1.00 71.96  ? 181 LYS A CE  1 
ATOM   1506 N  NZ  . LYS A 1 182 ? 38.230  -19.090 -2.789  1.00 76.34  ? 181 LYS A NZ  1 
ATOM   1507 N  N   . ASP A 1 183 ? 32.075  -15.494 -6.311  1.00 55.01  ? 182 ASP A N   1 
ATOM   1508 C  CA  . ASP A 1 183 ? 31.562  -15.079 -7.605  1.00 55.65  ? 182 ASP A CA  1 
ATOM   1509 C  C   . ASP A 1 183 ? 30.896  -13.725 -7.477  1.00 55.24  ? 182 ASP A C   1 
ATOM   1510 O  O   . ASP A 1 183 ? 30.932  -12.922 -8.407  1.00 54.60  ? 182 ASP A O   1 
ATOM   1511 C  CB  . ASP A 1 183 ? 30.565  -16.100 -8.140  1.00 59.50  ? 182 ASP A CB  1 
ATOM   1512 C  CG  . ASP A 1 183 ? 31.208  -17.441 -8.445  1.00 62.33  ? 182 ASP A CG  1 
ATOM   1513 O  OD1 . ASP A 1 183 ? 32.446  -17.496 -8.635  1.00 60.02  ? 182 ASP A OD1 1 
ATOM   1514 O  OD2 . ASP A 1 183 ? 30.467  -18.447 -8.493  1.00 63.58  ? 182 ASP A OD2 1 
ATOM   1515 N  N   . PHE A 1 184 ? 30.262  -13.490 -6.333  1.00 52.97  ? 183 PHE A N   1 
ATOM   1516 C  CA  . PHE A 1 184 ? 29.596  -12.228 -6.074  1.00 50.26  ? 183 PHE A CA  1 
ATOM   1517 C  C   . PHE A 1 184 ? 30.631  -11.116 -6.111  1.00 48.77  ? 183 PHE A C   1 
ATOM   1518 O  O   . PHE A 1 184 ? 30.437  -10.101 -6.773  1.00 50.30  ? 183 PHE A O   1 
ATOM   1519 C  CB  . PHE A 1 184 ? 28.896  -12.271 -4.710  1.00 53.22  ? 183 PHE A CB  1 
ATOM   1520 C  CG  . PHE A 1 184 ? 28.411  -10.929 -4.231  1.00 55.83  ? 183 PHE A CG  1 
ATOM   1521 C  CD1 . PHE A 1 184 ? 27.208  -10.404 -4.688  1.00 56.31  ? 183 PHE A CD1 1 
ATOM   1522 C  CD2 . PHE A 1 184 ? 29.174  -10.180 -3.341  1.00 56.13  ? 183 PHE A CD2 1 
ATOM   1523 C  CE1 . PHE A 1 184 ? 26.771  -9.139  -4.269  1.00 54.61  ? 183 PHE A CE1 1 
ATOM   1524 C  CE2 . PHE A 1 184 ? 28.748  -8.914  -2.917  1.00 58.80  ? 183 PHE A CE2 1 
ATOM   1525 C  CZ  . PHE A 1 184 ? 27.543  -8.394  -3.384  1.00 56.01  ? 183 PHE A CZ  1 
ATOM   1526 N  N   . ILE A 1 185 ? 31.724  -11.309 -5.383  1.00 46.82  ? 184 ILE A N   1 
ATOM   1527 C  CA  . ILE A 1 185 ? 32.797  -10.320 -5.324  1.00 44.16  ? 184 ILE A CA  1 
ATOM   1528 C  C   . ILE A 1 185 ? 33.423  -10.059 -6.696  1.00 42.69  ? 184 ILE A C   1 
ATOM   1529 O  O   . ILE A 1 185 ? 33.770  -8.920  -7.021  1.00 34.84  ? 184 ILE A O   1 
ATOM   1530 C  CB  . ILE A 1 185 ? 33.879  -10.753 -4.315  1.00 43.87  ? 184 ILE A CB  1 
ATOM   1531 C  CG1 . ILE A 1 185 ? 33.253  -10.861 -2.919  1.00 45.65  ? 184 ILE A CG1 1 
ATOM   1532 C  CG2 . ILE A 1 185 ? 35.035  -9.759  -4.298  1.00 41.35  ? 184 ILE A CG2 1 
ATOM   1533 C  CD1 . ILE A 1 185 ? 34.233  -11.225 -1.837  1.00 51.37  ? 184 ILE A CD1 1 
ATOM   1534 N  N   . SER A 1 186 ? 33.607  -11.119 -7.476  1.00 46.75  ? 185 SER A N   1 
ATOM   1535 C  CA  . SER A 1 186 ? 34.172  -10.989 -8.813  1.00 48.95  ? 185 SER A CA  1 
ATOM   1536 C  C   . SER A 1 186 ? 33.193  -10.157 -9.637  1.00 49.35  ? 185 SER A C   1 
ATOM   1537 O  O   . SER A 1 186 ? 33.562  -9.153  -10.255 1.00 51.01  ? 185 SER A O   1 
ATOM   1538 C  CB  . SER A 1 186 ? 34.331  -12.366 -9.465  1.00 52.48  ? 185 SER A CB  1 
ATOM   1539 O  OG  . SER A 1 186 ? 35.195  -13.215 -8.724  1.00 55.34  ? 185 SER A OG  1 
ATOM   1540 N  N   . ARG A 1 187 ? 31.940  -10.603 -9.636  1.00 46.91  ? 186 ARG A N   1 
ATOM   1541 C  CA  . ARG A 1 187 ? 30.859  -9.956  -10.363 1.00 46.06  ? 186 ARG A CA  1 
ATOM   1542 C  C   . ARG A 1 187 ? 30.717  -8.499  -9.957  1.00 47.42  ? 186 ARG A C   1 
ATOM   1543 O  O   . ARG A 1 187 ? 30.481  -7.646  -10.811 1.00 50.30  ? 186 ARG A O   1 
ATOM   1544 C  CB  . ARG A 1 187 ? 29.559  -10.728 -10.114 1.00 45.57  ? 186 ARG A CB  1 
ATOM   1545 C  CG  . ARG A 1 187 ? 28.343  -10.260 -10.885 1.00 42.43  ? 186 ARG A CG  1 
ATOM   1546 C  CD  . ARG A 1 187 ? 27.311  -11.393 -11.013 1.00 47.21  ? 186 ARG A CD  1 
ATOM   1547 N  NE  . ARG A 1 187 ? 26.941  -12.000 -9.731  1.00 45.53  ? 186 ARG A NE  1 
ATOM   1548 C  CZ  . ARG A 1 187 ? 27.202  -13.261 -9.391  1.00 50.20  ? 186 ARG A CZ  1 
ATOM   1549 N  NH1 . ARG A 1 187 ? 27.839  -14.063 -10.232 1.00 50.25  ? 186 ARG A NH1 1 
ATOM   1550 N  NH2 . ARG A 1 187 ? 26.825  -13.722 -8.205  1.00 50.75  ? 186 ARG A NH2 1 
ATOM   1551 N  N   . PHE A 1 188 ? 30.847  -8.216  -8.660  1.00 46.25  ? 187 PHE A N   1 
ATOM   1552 C  CA  . PHE A 1 188 ? 30.733  -6.849  -8.157  1.00 39.99  ? 187 PHE A CA  1 
ATOM   1553 C  C   . PHE A 1 188 ? 31.932  -5.996  -8.573  1.00 39.43  ? 187 PHE A C   1 
ATOM   1554 O  O   . PHE A 1 188 ? 31.770  -4.884  -9.085  1.00 39.19  ? 187 PHE A O   1 
ATOM   1555 C  CB  . PHE A 1 188 ? 30.580  -6.825  -6.626  1.00 39.08  ? 187 PHE A CB  1 
ATOM   1556 C  CG  . PHE A 1 188 ? 30.348  -5.434  -6.059  1.00 36.68  ? 187 PHE A CG  1 
ATOM   1557 C  CD1 . PHE A 1 188 ? 29.060  -4.909  -5.968  1.00 33.01  ? 187 PHE A CD1 1 
ATOM   1558 C  CD2 . PHE A 1 188 ? 31.419  -4.636  -5.660  1.00 39.27  ? 187 PHE A CD2 1 
ATOM   1559 C  CE1 . PHE A 1 188 ? 28.843  -3.607  -5.499  1.00 36.31  ? 187 PHE A CE1 1 
ATOM   1560 C  CE2 . PHE A 1 188 ? 31.215  -3.331  -5.189  1.00 39.89  ? 187 PHE A CE2 1 
ATOM   1561 C  CZ  . PHE A 1 188 ? 29.926  -2.818  -5.110  1.00 39.39  ? 187 PHE A CZ  1 
ATOM   1562 N  N   . GLU A 1 189 ? 33.133  -6.487  -8.287  1.00 39.53  ? 188 GLU A N   1 
ATOM   1563 C  CA  . GLU A 1 189 ? 34.346  -5.762  -8.643  1.00 43.26  ? 188 GLU A CA  1 
ATOM   1564 C  C   . GLU A 1 189 ? 34.505  -5.752  -10.157 1.00 44.88  ? 188 GLU A C   1 
ATOM   1565 O  O   . GLU A 1 189 ? 35.324  -5.010  -10.698 1.00 46.87  ? 188 GLU A O   1 
ATOM   1566 C  CB  . GLU A 1 189 ? 35.564  -6.397  -7.972  1.00 44.31  ? 188 GLU A CB  1 
ATOM   1567 C  CG  . GLU A 1 189 ? 35.551  -6.269  -6.448  1.00 50.93  ? 188 GLU A CG  1 
ATOM   1568 C  CD  . GLU A 1 189 ? 36.705  -6.988  -5.763  1.00 56.40  ? 188 GLU A CD  1 
ATOM   1569 O  OE1 . GLU A 1 189 ? 37.252  -7.951  -6.349  1.00 59.89  ? 188 GLU A OE1 1 
ATOM   1570 O  OE2 . GLU A 1 189 ? 37.051  -6.600  -4.623  1.00 55.65  ? 188 GLU A OE2 1 
ATOM   1571 N  N   . GLY A 1 190 ? 33.717  -6.586  -10.829 1.00 45.57  ? 189 GLY A N   1 
ATOM   1572 C  CA  . GLY A 1 190 ? 33.754  -6.666  -12.276 1.00 43.76  ? 189 GLY A CA  1 
ATOM   1573 C  C   . GLY A 1 190 ? 32.923  -5.595  -12.959 1.00 42.36  ? 189 GLY A C   1 
ATOM   1574 O  O   . GLY A 1 190 ? 33.028  -5.402  -14.171 1.00 41.89  ? 189 GLY A O   1 
ATOM   1575 N  N   . LEU A 1 191 ? 32.061  -4.927  -12.201 1.00 43.10  ? 190 LEU A N   1 
ATOM   1576 C  CA  . LEU A 1 191 ? 31.222  -3.876  -12.763 1.00 43.88  ? 190 LEU A CA  1 
ATOM   1577 C  C   . LEU A 1 191 ? 32.132  -2.780  -13.293 1.00 42.78  ? 190 LEU A C   1 
ATOM   1578 O  O   . LEU A 1 191 ? 33.110  -2.417  -12.646 1.00 42.93  ? 190 LEU A O   1 
ATOM   1579 C  CB  . LEU A 1 191 ? 30.260  -3.331  -11.705 1.00 42.46  ? 190 LEU A CB  1 
ATOM   1580 C  CG  . LEU A 1 191 ? 29.259  -4.363  -11.162 1.00 44.10  ? 190 LEU A CG  1 
ATOM   1581 C  CD1 . LEU A 1 191 ? 28.405  -3.745  -10.067 1.00 43.52  ? 190 LEU A CD1 1 
ATOM   1582 C  CD2 . LEU A 1 191 ? 28.382  -4.903  -12.285 1.00 42.96  ? 190 LEU A CD2 1 
ATOM   1583 N  N   . GLU A 1 192 ? 31.803  -2.266  -14.473 1.00 45.31  ? 191 GLU A N   1 
ATOM   1584 C  CA  . GLU A 1 192 ? 32.608  -1.242  -15.121 1.00 48.83  ? 191 GLU A CA  1 
ATOM   1585 C  C   . GLU A 1 192 ? 33.030  -0.086  -14.228 1.00 45.69  ? 191 GLU A C   1 
ATOM   1586 O  O   . GLU A 1 192 ? 34.219  0.106   -13.982 1.00 44.74  ? 191 GLU A O   1 
ATOM   1587 C  CB  . GLU A 1 192 ? 31.897  -0.696  -16.361 1.00 56.36  ? 191 GLU A CB  1 
ATOM   1588 C  CG  . GLU A 1 192 ? 32.867  0.084   -17.231 1.00 65.49  ? 191 GLU A CG  1 
ATOM   1589 C  CD  . GLU A 1 192 ? 32.171  1.150   -18.057 1.00 73.21  ? 191 GLU A CD  1 
ATOM   1590 O  OE1 . GLU A 1 192 ? 32.680  2.295   -18.092 1.00 76.87  ? 191 GLU A OE1 1 
ATOM   1591 O  OE2 . GLU A 1 192 ? 31.126  0.845   -18.677 1.00 75.55  ? 191 GLU A OE2 1 
ATOM   1592 N  N   . LYS A 1 193 ? 32.065  0.707   -13.778 1.00 44.31  ? 192 LYS A N   1 
ATOM   1593 C  CA  . LYS A 1 193 ? 32.377  1.853   -12.934 1.00 46.56  ? 192 LYS A CA  1 
ATOM   1594 C  C   . LYS A 1 193 ? 33.027  1.487   -11.602 1.00 48.01  ? 192 LYS A C   1 
ATOM   1595 O  O   . LYS A 1 193 ? 33.729  2.307   -11.006 1.00 47.43  ? 192 LYS A O   1 
ATOM   1596 C  CB  . LYS A 1 193 ? 31.134  2.709   -12.723 1.00 45.04  ? 192 LYS A CB  1 
ATOM   1597 C  CG  . LYS A 1 193 ? 30.395  2.946   -14.015 1.00 51.32  ? 192 LYS A CG  1 
ATOM   1598 C  CD  . LYS A 1 193 ? 30.245  4.400   -14.398 1.00 61.21  ? 192 LYS A CD  1 
ATOM   1599 C  CE  . LYS A 1 193 ? 31.376  4.817   -15.326 1.00 66.66  ? 192 LYS A CE  1 
ATOM   1600 N  NZ  . LYS A 1 193 ? 31.373  4.003   -16.585 1.00 71.62  ? 192 LYS A NZ  1 
ATOM   1601 N  N   . ILE A 1 194 ? 32.763  0.273   -11.125 1.00 47.21  ? 193 ILE A N   1 
ATOM   1602 C  CA  . ILE A 1 194 ? 33.354  -0.193  -9.875  1.00 46.44  ? 193 ILE A CA  1 
ATOM   1603 C  C   . ILE A 1 194 ? 34.842  -0.474  -10.103 1.00 47.73  ? 193 ILE A C   1 
ATOM   1604 O  O   . ILE A 1 194 ? 35.687  -0.070  -9.304  1.00 45.44  ? 193 ILE A O   1 
ATOM   1605 C  CB  . ILE A 1 194 ? 32.643  -1.470  -9.341  1.00 47.95  ? 193 ILE A CB  1 
ATOM   1606 C  CG1 . ILE A 1 194 ? 31.224  -1.122  -8.867  1.00 47.23  ? 193 ILE A CG1 1 
ATOM   1607 C  CG2 . ILE A 1 194 ? 33.453  -2.117  -8.219  1.00 48.92  ? 193 ILE A CG2 1 
ATOM   1608 C  CD1 . ILE A 1 194 ? 31.151  -0.028  -7.814  1.00 41.75  ? 193 ILE A CD1 1 
ATOM   1609 N  N   . SER A 1 195 ? 35.148  -1.161  -11.199 1.00 47.65  ? 194 SER A N   1 
ATOM   1610 C  CA  . SER A 1 195 ? 36.526  -1.492  -11.548 1.00 48.86  ? 194 SER A CA  1 
ATOM   1611 C  C   . SER A 1 195 ? 37.333  -0.207  -11.751 1.00 48.77  ? 194 SER A C   1 
ATOM   1612 O  O   . SER A 1 195 ? 38.375  -0.004  -11.124 1.00 49.44  ? 194 SER A O   1 
ATOM   1613 C  CB  . SER A 1 195 ? 36.549  -2.346  -12.822 1.00 47.60  ? 194 SER A CB  1 
ATOM   1614 O  OG  . SER A 1 195 ? 37.843  -2.859  -13.100 1.00 51.54  ? 194 SER A OG  1 
ATOM   1615 N  N   . ALA A 1 196 ? 36.828  0.664   -12.618 1.00 50.97  ? 195 ALA A N   1 
ATOM   1616 C  CA  . ALA A 1 196 ? 37.468  1.936   -12.927 1.00 51.65  ? 195 ALA A CA  1 
ATOM   1617 C  C   . ALA A 1 196 ? 37.811  2.725   -11.669 1.00 52.26  ? 195 ALA A C   1 
ATOM   1618 O  O   . ALA A 1 196 ? 38.910  3.262   -11.551 1.00 52.32  ? 195 ALA A O   1 
ATOM   1619 C  CB  . ALA A 1 196 ? 36.560  2.766   -13.823 1.00 53.86  ? 195 ALA A CB  1 
ATOM   1620 N  N   . TYR A 1 197 ? 36.841  2.845   -10.769 1.00 51.34  ? 196 TYR A N   1 
ATOM   1621 C  CA  . TYR A 1 197 ? 37.026  3.571   -9.518  1.00 48.66  ? 196 TYR A CA  1 
ATOM   1622 C  C   . TYR A 1 197 ? 38.062  2.905   -8.630  1.00 48.00  ? 196 TYR A C   1 
ATOM   1623 O  O   . TYR A 1 197 ? 38.809  3.583   -7.926  1.00 47.91  ? 196 TYR A O   1 
ATOM   1624 C  CB  . TYR A 1 197 ? 35.694  3.671   -8.766  1.00 47.57  ? 196 TYR A CB  1 
ATOM   1625 C  CG  . TYR A 1 197 ? 35.803  4.195   -7.343  1.00 45.24  ? 196 TYR A CG  1 
ATOM   1626 C  CD1 . TYR A 1 197 ? 36.076  5.541   -7.094  1.00 44.41  ? 196 TYR A CD1 1 
ATOM   1627 C  CD2 . TYR A 1 197 ? 35.611  3.345   -6.246  1.00 42.52  ? 196 TYR A CD2 1 
ATOM   1628 C  CE1 . TYR A 1 197 ? 36.150  6.034   -5.788  1.00 46.92  ? 196 TYR A CE1 1 
ATOM   1629 C  CE2 . TYR A 1 197 ? 35.685  3.825   -4.935  1.00 38.64  ? 196 TYR A CE2 1 
ATOM   1630 C  CZ  . TYR A 1 197 ? 35.952  5.171   -4.714  1.00 45.10  ? 196 TYR A CZ  1 
ATOM   1631 O  OH  . TYR A 1 197 ? 36.014  5.666   -3.426  1.00 43.40  ? 196 TYR A OH  1 
ATOM   1632 N  N   . MET A 1 198 ? 38.072  1.577   -8.615  1.00 45.57  ? 197 MET A N   1 
ATOM   1633 C  CA  . MET A 1 198 ? 39.031  0.858   -7.788  1.00 42.82  ? 197 MET A CA  1 
ATOM   1634 C  C   . MET A 1 198 ? 40.454  1.104   -8.263  1.00 43.95  ? 197 MET A C   1 
ATOM   1635 O  O   . MET A 1 198 ? 41.414  0.942   -7.502  1.00 43.90  ? 197 MET A O   1 
ATOM   1636 C  CB  . MET A 1 198 ? 38.711  -0.637  -7.756  1.00 41.03  ? 197 MET A CB  1 
ATOM   1637 C  CG  . MET A 1 198 ? 37.495  -0.959  -6.898  1.00 41.29  ? 197 MET A CG  1 
ATOM   1638 S  SD  . MET A 1 198 ? 37.047  -2.692  -6.869  1.00 43.90  ? 197 MET A SD  1 
ATOM   1639 C  CE  . MET A 1 198 ? 38.068  -3.260  -5.486  1.00 48.32  ? 197 MET A CE  1 
ATOM   1640 N  N   . LYS A 1 199 ? 40.583  1.500   -9.523  1.00 45.07  ? 198 LYS A N   1 
ATOM   1641 C  CA  . LYS A 1 199 ? 41.880  1.777   -10.110 1.00 46.58  ? 198 LYS A CA  1 
ATOM   1642 C  C   . LYS A 1 199 ? 42.217  3.262   -10.078 1.00 45.16  ? 198 LYS A C   1 
ATOM   1643 O  O   . LYS A 1 199 ? 43.348  3.648   -10.388 1.00 45.45  ? 198 LYS A O   1 
ATOM   1644 C  CB  . LYS A 1 199 ? 41.939  1.229   -11.540 1.00 50.58  ? 198 LYS A CB  1 
ATOM   1645 C  CG  . LYS A 1 199 ? 41.919  -0.300  -11.594 1.00 60.13  ? 198 LYS A CG  1 
ATOM   1646 C  CD  . LYS A 1 199 ? 41.754  -0.853  -13.009 1.00 68.53  ? 198 LYS A CD  1 
ATOM   1647 C  CE  . LYS A 1 199 ? 40.359  -0.588  -13.564 1.00 75.72  ? 198 LYS A CE  1 
ATOM   1648 N  NZ  . LYS A 1 199 ? 40.108  -1.275  -14.865 1.00 79.48  ? 198 LYS A NZ  1 
ATOM   1649 N  N   . SER A 1 200 ? 41.248  4.096   -9.712  1.00 44.55  ? 199 SER A N   1 
ATOM   1650 C  CA  . SER A 1 200 ? 41.498  5.531   -9.654  1.00 44.43  ? 199 SER A CA  1 
ATOM   1651 C  C   . SER A 1 200 ? 42.222  5.970   -8.382  1.00 43.92  ? 199 SER A C   1 
ATOM   1652 O  O   . SER A 1 200 ? 42.555  5.155   -7.513  1.00 45.56  ? 199 SER A O   1 
ATOM   1653 C  CB  . SER A 1 200 ? 40.202  6.336   -9.866  1.00 44.24  ? 199 SER A CB  1 
ATOM   1654 O  OG  . SER A 1 200 ? 39.290  6.227   -8.785  1.00 45.32  ? 199 SER A OG  1 
ATOM   1655 N  N   . SER A 1 201 ? 42.541  7.256   -8.325  1.00 45.88  ? 200 SER A N   1 
ATOM   1656 C  CA  . SER A 1 201 ? 43.235  7.828   -7.184  1.00 45.35  ? 200 SER A CA  1 
ATOM   1657 C  C   . SER A 1 201 ? 42.283  8.049   -6.024  1.00 43.55  ? 200 SER A C   1 
ATOM   1658 O  O   . SER A 1 201 ? 42.716  8.256   -4.886  1.00 46.00  ? 200 SER A O   1 
ATOM   1659 C  CB  . SER A 1 201 ? 43.867  9.160   -7.579  1.00 49.18  ? 200 SER A CB  1 
ATOM   1660 O  OG  . SER A 1 201 ? 42.887  10.056  -8.083  1.00 52.24  ? 200 SER A OG  1 
ATOM   1661 N  N   . ARG A 1 202 ? 40.988  8.025   -6.326  1.00 41.12  ? 201 ARG A N   1 
ATOM   1662 C  CA  . ARG A 1 202 ? 39.932  8.232   -5.339  1.00 39.42  ? 201 ARG A CA  1 
ATOM   1663 C  C   . ARG A 1 202 ? 39.708  7.046   -4.395  1.00 39.68  ? 201 ARG A C   1 
ATOM   1664 O  O   . ARG A 1 202 ? 39.283  7.228   -3.250  1.00 40.22  ? 201 ARG A O   1 
ATOM   1665 C  CB  . ARG A 1 202 ? 38.621  8.564   -6.052  1.00 39.02  ? 201 ARG A CB  1 
ATOM   1666 C  CG  . ARG A 1 202 ? 38.684  9.787   -6.949  1.00 42.39  ? 201 ARG A CG  1 
ATOM   1667 C  CD  . ARG A 1 202 ? 37.311  10.126  -7.529  1.00 40.70  ? 201 ARG A CD  1 
ATOM   1668 N  NE  . ARG A 1 202 ? 36.741  9.032   -8.316  1.00 34.72  ? 201 ARG A NE  1 
ATOM   1669 C  CZ  . ARG A 1 202 ? 37.183  8.649   -9.511  1.00 31.36  ? 201 ARG A CZ  1 
ATOM   1670 N  NH1 . ARG A 1 202 ? 38.210  9.273   -10.067 1.00 27.54  ? 201 ARG A NH1 1 
ATOM   1671 N  NH2 . ARG A 1 202 ? 36.607  7.632   -10.143 1.00 32.36  ? 201 ARG A NH2 1 
ATOM   1672 N  N   . PHE A 1 203 ? 40.004  5.842   -4.874  1.00 40.38  ? 202 PHE A N   1 
ATOM   1673 C  CA  . PHE A 1 203 ? 39.826  4.616   -4.097  1.00 38.52  ? 202 PHE A CA  1 
ATOM   1674 C  C   . PHE A 1 203 ? 40.524  4.639   -2.730  1.00 38.73  ? 202 PHE A C   1 
ATOM   1675 O  O   . PHE A 1 203 ? 41.754  4.677   -2.654  1.00 37.58  ? 202 PHE A O   1 
ATOM   1676 C  CB  . PHE A 1 203 ? 40.328  3.427   -4.912  1.00 35.55  ? 202 PHE A CB  1 
ATOM   1677 C  CG  . PHE A 1 203 ? 40.001  2.096   -4.305  1.00 27.95  ? 202 PHE A CG  1 
ATOM   1678 C  CD1 . PHE A 1 203 ? 38.740  1.847   -3.775  1.00 22.15  ? 202 PHE A CD1 1 
ATOM   1679 C  CD2 . PHE A 1 203 ? 40.950  1.079   -4.284  1.00 29.45  ? 202 PHE A CD2 1 
ATOM   1680 C  CE1 . PHE A 1 203 ? 38.427  0.604   -3.236  1.00 26.08  ? 202 PHE A CE1 1 
ATOM   1681 C  CE2 . PHE A 1 203 ? 40.646  -0.170  -3.747  1.00 26.26  ? 202 PHE A CE2 1 
ATOM   1682 C  CZ  . PHE A 1 203 ? 39.382  -0.405  -3.222  1.00 27.06  ? 202 PHE A CZ  1 
ATOM   1683 N  N   . LEU A 1 204 ? 39.742  4.530   -1.658  1.00 36.49  ? 203 LEU A N   1 
ATOM   1684 C  CA  . LEU A 1 204 ? 40.271  4.561   -0.295  1.00 39.50  ? 203 LEU A CA  1 
ATOM   1685 C  C   . LEU A 1 204 ? 39.834  3.334   0.499   1.00 41.15  ? 203 LEU A C   1 
ATOM   1686 O  O   . LEU A 1 204 ? 38.955  3.419   1.344   1.00 43.04  ? 203 LEU A O   1 
ATOM   1687 C  CB  . LEU A 1 204 ? 39.784  5.837   0.413   1.00 35.09  ? 203 LEU A CB  1 
ATOM   1688 C  CG  . LEU A 1 204 ? 40.205  6.164   1.856   1.00 37.42  ? 203 LEU A CG  1 
ATOM   1689 C  CD1 . LEU A 1 204 ? 41.719  6.351   1.963   1.00 38.33  ? 203 LEU A CD1 1 
ATOM   1690 C  CD2 . LEU A 1 204 ? 39.491  7.435   2.312   1.00 33.53  ? 203 LEU A CD2 1 
ATOM   1691 N  N   . PRO A 1 205 ? 40.477  2.180   0.259   1.00 44.21  ? 204 PRO A N   1 
ATOM   1692 C  CA  . PRO A 1 205 ? 40.135  0.935   0.964   1.00 46.48  ? 204 PRO A CA  1 
ATOM   1693 C  C   . PRO A 1 205 ? 40.629  0.833   2.416   1.00 45.90  ? 204 PRO A C   1 
ATOM   1694 O  O   . PRO A 1 205 ? 40.174  -0.035  3.166   1.00 42.14  ? 204 PRO A O   1 
ATOM   1695 C  CB  . PRO A 1 205 ? 40.777  -0.133  0.080   1.00 44.62  ? 204 PRO A CB  1 
ATOM   1696 C  CG  . PRO A 1 205 ? 42.050  0.552   -0.360  1.00 44.94  ? 204 PRO A CG  1 
ATOM   1697 C  CD  . PRO A 1 205 ? 41.570  1.963   -0.707  1.00 44.26  ? 204 PRO A CD  1 
ATOM   1698 N  N   . ARG A 1 206 ? 41.593  1.677   2.782   1.00 45.30  ? 205 ARG A N   1 
ATOM   1699 C  CA  . ARG A 1 206 ? 42.170  1.696   4.132   1.00 48.72  ? 205 ARG A CA  1 
ATOM   1700 C  C   . ARG A 1 206 ? 42.561  3.129   4.493   1.00 47.03  ? 205 ARG A C   1 
ATOM   1701 O  O   . ARG A 1 206 ? 42.799  3.954   3.610   1.00 48.39  ? 205 ARG A O   1 
ATOM   1702 C  CB  . ARG A 1 206 ? 43.403  0.792   4.209   1.00 54.64  ? 205 ARG A CB  1 
ATOM   1703 C  CG  . ARG A 1 206 ? 43.086  -0.681  4.048   1.00 69.20  ? 205 ARG A CG  1 
ATOM   1704 C  CD  . ARG A 1 206 ? 44.299  -1.487  3.643   1.00 77.33  ? 205 ARG A CD  1 
ATOM   1705 N  NE  . ARG A 1 206 ? 43.924  -2.557  2.721   1.00 82.85  ? 205 ARG A NE  1 
ATOM   1706 C  CZ  . ARG A 1 206 ? 44.048  -3.853  2.982   1.00 86.53  ? 205 ARG A CZ  1 
ATOM   1707 N  NH1 . ARG A 1 206 ? 44.543  -4.264  4.146   1.00 85.22  ? 205 ARG A NH1 1 
ATOM   1708 N  NH2 . ARG A 1 206 ? 43.673  -4.741  2.072   1.00 89.10  ? 205 ARG A NH2 1 
ATOM   1709 N  N   . PRO A 1 207 ? 42.656  3.449   5.796   1.00 43.04  ? 206 PRO A N   1 
ATOM   1710 C  CA  . PRO A 1 207 ? 42.420  2.577   6.950   1.00 40.31  ? 206 PRO A CA  1 
ATOM   1711 C  C   . PRO A 1 207 ? 40.982  2.097   7.011   1.00 38.44  ? 206 PRO A C   1 
ATOM   1712 O  O   . PRO A 1 207 ? 40.057  2.826   6.642   1.00 35.00  ? 206 PRO A O   1 
ATOM   1713 C  CB  . PRO A 1 207 ? 42.711  3.502   8.137   1.00 43.59  ? 206 PRO A CB  1 
ATOM   1714 C  CG  . PRO A 1 207 ? 43.589  4.572   7.566   1.00 43.88  ? 206 PRO A CG  1 
ATOM   1715 C  CD  . PRO A 1 207 ? 42.963  4.815   6.235   1.00 45.23  ? 206 PRO A CD  1 
ATOM   1716 N  N   . VAL A 1 208 ? 40.805  0.851   7.431   1.00 35.98  ? 207 VAL A N   1 
ATOM   1717 C  CA  . VAL A 1 208 ? 39.477  0.272   7.575   1.00 32.46  ? 207 VAL A CA  1 
ATOM   1718 C  C   . VAL A 1 208 ? 38.692  0.991   8.683   1.00 31.73  ? 207 VAL A C   1 
ATOM   1719 O  O   . VAL A 1 208 ? 37.507  1.294   8.507   1.00 36.64  ? 207 VAL A O   1 
ATOM   1720 C  CB  . VAL A 1 208 ? 39.573  -1.230  7.889   1.00 29.99  ? 207 VAL A CB  1 
ATOM   1721 C  CG1 . VAL A 1 208 ? 38.192  -1.807  8.171   1.00 28.96  ? 207 VAL A CG1 1 
ATOM   1722 C  CG2 . VAL A 1 208 ? 40.242  -1.961  6.719   1.00 29.14  ? 207 VAL A CG2 1 
ATOM   1723 N  N   . PHE A 1 209 ? 39.351  1.257   9.813   1.00 29.76  ? 208 PHE A N   1 
ATOM   1724 C  CA  . PHE A 1 209 ? 38.729  1.952   10.948  1.00 29.76  ? 208 PHE A CA  1 
ATOM   1725 C  C   . PHE A 1 209 ? 39.490  3.228   11.312  1.00 29.15  ? 208 PHE A C   1 
ATOM   1726 O  O   . PHE A 1 209 ? 40.393  3.656   10.581  1.00 24.22  ? 208 PHE A O   1 
ATOM   1727 C  CB  . PHE A 1 209 ? 38.645  1.032   12.174  1.00 30.75  ? 208 PHE A CB  1 
ATOM   1728 C  CG  . PHE A 1 209 ? 37.753  -0.156  11.972  1.00 28.91  ? 208 PHE A CG  1 
ATOM   1729 C  CD1 . PHE A 1 209 ? 36.398  0.018   11.710  1.00 27.63  ? 208 PHE A CD1 1 
ATOM   1730 C  CD2 . PHE A 1 209 ? 38.270  -1.446  12.003  1.00 28.74  ? 208 PHE A CD2 1 
ATOM   1731 C  CE1 . PHE A 1 209 ? 35.564  -1.081  11.470  1.00 27.73  ? 208 PHE A CE1 1 
ATOM   1732 C  CE2 . PHE A 1 209 ? 37.446  -2.555  11.764  1.00 28.39  ? 208 PHE A CE2 1 
ATOM   1733 C  CZ  . PHE A 1 209 ? 36.088  -2.370  11.497  1.00 23.26  ? 208 PHE A CZ  1 
ATOM   1734 N  N   . SER A 1 210 ? 39.114  3.849   12.425  1.00 31.35  ? 209 SER A N   1 
ATOM   1735 C  CA  . SER A 1 210 ? 39.771  5.072   12.869  1.00 35.81  ? 209 SER A CA  1 
ATOM   1736 C  C   . SER A 1 210 ? 41.067  4.751   13.597  1.00 39.23  ? 209 SER A C   1 
ATOM   1737 O  O   . SER A 1 210 ? 41.453  3.586   13.742  1.00 38.13  ? 209 SER A O   1 
ATOM   1738 C  CB  . SER A 1 210 ? 38.844  5.894   13.776  1.00 33.14  ? 209 SER A CB  1 
ATOM   1739 O  OG  . SER A 1 210 ? 38.882  5.458   15.127  1.00 37.63  ? 209 SER A OG  1 
ATOM   1740 N  N   . LYS A 1 211 ? 41.752  5.797   14.039  1.00 40.48  ? 210 LYS A N   1 
ATOM   1741 C  CA  . LYS A 1 211 ? 43.004  5.629   14.752  1.00 39.63  ? 210 LYS A CA  1 
ATOM   1742 C  C   . LYS A 1 211 ? 42.827  4.944   16.110  1.00 36.98  ? 210 LYS A C   1 
ATOM   1743 O  O   . LYS A 1 211 ? 43.767  4.341   16.625  1.00 37.73  ? 210 LYS A O   1 
ATOM   1744 C  CB  . LYS A 1 211 ? 43.688  6.988   14.917  1.00 43.43  ? 210 LYS A CB  1 
ATOM   1745 C  CG  . LYS A 1 211 ? 44.068  7.651   13.596  1.00 42.56  ? 210 LYS A CG  1 
ATOM   1746 C  CD  . LYS A 1 211 ? 44.729  9.007   13.808  1.00 43.25  ? 210 LYS A CD  1 
ATOM   1747 C  CE  . LYS A 1 211 ? 45.183  9.597   12.481  1.00 50.32  ? 210 LYS A CE  1 
ATOM   1748 N  NZ  . LYS A 1 211 ? 45.897  10.892  12.645  1.00 47.69  ? 210 LYS A NZ  1 
ATOM   1749 N  N   . MET A 1 212 ? 41.629  5.037   16.683  1.00 34.56  ? 211 MET A N   1 
ATOM   1750 C  CA  . MET A 1 212 ? 41.349  4.430   17.987  1.00 36.61  ? 211 MET A CA  1 
ATOM   1751 C  C   . MET A 1 212 ? 41.341  2.908   17.946  1.00 39.48  ? 211 MET A C   1 
ATOM   1752 O  O   . MET A 1 212 ? 41.391  2.253   18.986  1.00 42.93  ? 211 MET A O   1 
ATOM   1753 C  CB  . MET A 1 212 ? 39.994  4.911   18.522  1.00 35.37  ? 211 MET A CB  1 
ATOM   1754 C  CG  . MET A 1 212 ? 39.818  6.423   18.508  1.00 40.76  ? 211 MET A CG  1 
ATOM   1755 S  SD  . MET A 1 212 ? 38.276  6.984   19.245  1.00 50.08  ? 211 MET A SD  1 
ATOM   1756 C  CE  . MET A 1 212 ? 37.169  6.899   17.811  1.00 48.96  ? 211 MET A CE  1 
ATOM   1757 N  N   . ALA A 1 213 ? 41.263  2.345   16.749  1.00 40.22  ? 212 ALA A N   1 
ATOM   1758 C  CA  . ALA A 1 213 ? 41.199  0.897   16.599  1.00 42.51  ? 212 ALA A CA  1 
ATOM   1759 C  C   . ALA A 1 213 ? 42.478  0.149   16.942  1.00 43.57  ? 212 ALA A C   1 
ATOM   1760 O  O   . ALA A 1 213 ? 43.575  0.700   16.879  1.00 41.32  ? 212 ALA A O   1 
ATOM   1761 C  CB  . ALA A 1 213 ? 40.735  0.528   15.185  1.00 41.87  ? 212 ALA A CB  1 
ATOM   1762 N  N   . VAL A 1 214 ? 42.311  -1.108  17.337  1.00 44.92  ? 213 VAL A N   1 
ATOM   1763 C  CA  . VAL A 1 214 ? 43.421  -1.988  17.670  1.00 44.64  ? 213 VAL A CA  1 
ATOM   1764 C  C   . VAL A 1 214 ? 43.834  -2.694  16.370  1.00 45.64  ? 213 VAL A C   1 
ATOM   1765 O  O   . VAL A 1 214 ? 45.017  -2.978  16.158  1.00 42.41  ? 213 VAL A O   1 
ATOM   1766 C  CB  . VAL A 1 214 ? 42.998  -3.024  18.739  1.00 47.52  ? 213 VAL A CB  1 
ATOM   1767 C  CG1 . VAL A 1 214 ? 44.183  -3.873  19.167  1.00 45.95  ? 213 VAL A CG1 1 
ATOM   1768 C  CG2 . VAL A 1 214 ? 42.390  -2.314  19.947  1.00 46.10  ? 213 VAL A CG2 1 
ATOM   1769 N  N   . TRP A 1 215 ? 42.853  -2.964  15.506  1.00 45.44  ? 214 TRP A N   1 
ATOM   1770 C  CA  . TRP A 1 215 ? 43.096  -3.607  14.218  1.00 45.36  ? 214 TRP A CA  1 
ATOM   1771 C  C   . TRP A 1 215 ? 42.563  -2.737  13.075  1.00 44.19  ? 214 TRP A C   1 
ATOM   1772 O  O   . TRP A 1 215 ? 41.521  -2.100  13.205  1.00 44.83  ? 214 TRP A O   1 
ATOM   1773 C  CB  . TRP A 1 215 ? 42.436  -4.986  14.174  1.00 45.42  ? 214 TRP A CB  1 
ATOM   1774 C  CG  . TRP A 1 215 ? 42.758  -5.757  12.933  1.00 44.25  ? 214 TRP A CG  1 
ATOM   1775 C  CD1 . TRP A 1 215 ? 43.738  -6.690  12.783  1.00 48.24  ? 214 TRP A CD1 1 
ATOM   1776 C  CD2 . TRP A 1 215 ? 42.117  -5.636  11.659  1.00 46.62  ? 214 TRP A CD2 1 
ATOM   1777 N  NE1 . TRP A 1 215 ? 43.753  -7.160  11.489  1.00 50.45  ? 214 TRP A NE1 1 
ATOM   1778 C  CE2 . TRP A 1 215 ? 42.770  -6.527  10.778  1.00 48.42  ? 214 TRP A CE2 1 
ATOM   1779 C  CE3 . TRP A 1 215 ? 41.057  -4.861  11.174  1.00 48.12  ? 214 TRP A CE3 1 
ATOM   1780 C  CZ2 . TRP A 1 215 ? 42.397  -6.663  9.439   1.00 50.26  ? 214 TRP A CZ2 1 
ATOM   1781 C  CZ3 . TRP A 1 215 ? 40.686  -4.996  9.843   1.00 49.55  ? 214 TRP A CZ3 1 
ATOM   1782 C  CH2 . TRP A 1 215 ? 41.358  -5.891  8.991   1.00 50.16  ? 214 TRP A CH2 1 
ATOM   1783 N  N   . GLY A 1 216 ? 43.272  -2.732  11.951  1.00 46.77  ? 215 GLY A N   1 
ATOM   1784 C  CA  . GLY A 1 216 ? 42.849  -1.944  10.808  1.00 47.79  ? 215 GLY A CA  1 
ATOM   1785 C  C   . GLY A 1 216 ? 42.825  -0.453  11.074  1.00 48.88  ? 215 GLY A C   1 
ATOM   1786 O  O   . GLY A 1 216 ? 42.105  0.289   10.408  1.00 48.63  ? 215 GLY A O   1 
ATOM   1787 N  N   . ASN A 1 217 ? 43.601  -0.017  12.058  1.00 48.01  ? 216 ASN A N   1 
ATOM   1788 C  CA  . ASN A 1 217 ? 43.668  1.395   12.415  1.00 46.32  ? 216 ASN A CA  1 
ATOM   1789 C  C   . ASN A 1 217 ? 44.526  2.191   11.441  1.00 44.50  ? 216 ASN A C   1 
ATOM   1790 O  O   . ASN A 1 217 ? 44.448  3.422   11.388  1.00 44.02  ? 216 ASN A O   1 
ATOM   1791 C  CB  . ASN A 1 217 ? 44.220  1.553   13.833  1.00 51.61  ? 216 ASN A CB  1 
ATOM   1792 C  CG  . ASN A 1 217 ? 45.662  1.096   13.959  1.00 53.21  ? 216 ASN A CG  1 
ATOM   1793 O  OD1 . ASN A 1 217 ? 46.549  1.894   14.271  1.00 51.53  ? 216 ASN A OD1 1 
ATOM   1794 N  ND2 . ASN A 1 217 ? 45.905  -0.194  13.728  1.00 54.10  ? 216 ASN A ND2 1 
ATOM   1795 N  N   . LYS A 1 218 ? 45.333  1.482   10.659  1.00 46.65  ? 217 LYS A N   1 
ATOM   1796 C  CA  . LYS A 1 218 ? 46.228  2.108   9.695   1.00 48.95  ? 217 LYS A CA  1 
ATOM   1797 C  C   . LYS A 1 218 ? 46.104  1.451   8.323   1.00 50.08  ? 217 LYS A C   1 
ATOM   1798 O  O   . LYS A 1 218 ? 45.909  0.215   8.280   1.00 52.92  ? 217 LYS A O   1 
ATOM   1799 C  CB  . LYS A 1 218 ? 47.673  1.990   10.187  1.00 49.97  ? 217 LYS A CB  1 
ATOM   1800 C  CG  . LYS A 1 218 ? 48.158  3.170   10.973  1.00 56.21  ? 217 LYS A CG  1 
ATOM   1801 C  CD  . LYS A 1 218 ? 49.307  2.835   11.913  1.00 61.85  ? 217 LYS A CD  1 
ATOM   1802 C  CE  . LYS A 1 218 ? 49.204  1.392   12.432  1.00 68.43  ? 217 LYS A CE  1 
ATOM   1803 N  NZ  . LYS A 1 218 ? 50.481  0.613   12.377  1.00 68.18  ? 217 LYS A NZ  1 
ATOM   1804 O  OXT . LYS A 1 218 ? 46.219  2.177   7.308   1.00 50.88  ? 217 LYS A OXT 1 
ATOM   1805 N  N   . PRO B 1 2   ? -2.796  -16.945 11.774  1.00 77.72  ? 1   PRO B N   1 
ATOM   1806 C  CA  . PRO B 1 2   ? -2.503  -15.495 11.863  1.00 77.05  ? 1   PRO B CA  1 
ATOM   1807 C  C   . PRO B 1 2   ? -1.003  -15.242 12.005  1.00 77.30  ? 1   PRO B C   1 
ATOM   1808 O  O   . PRO B 1 2   ? -0.212  -16.182 12.131  1.00 75.92  ? 1   PRO B O   1 
ATOM   1809 C  CB  . PRO B 1 2   ? -3.241  -14.978 13.090  1.00 74.97  ? 1   PRO B CB  1 
ATOM   1810 C  CG  . PRO B 1 2   ? -3.263  -16.229 13.968  1.00 74.09  ? 1   PRO B CG  1 
ATOM   1811 C  CD  . PRO B 1 2   ? -3.504  -17.392 12.991  1.00 76.77  ? 1   PRO B CD  1 
ATOM   1812 N  N   . MET B 1 3   ? -0.625  -13.968 11.958  1.00 76.27  ? 2   MET B N   1 
ATOM   1813 C  CA  . MET B 1 3   ? 0.768   -13.567 12.100  1.00 73.89  ? 2   MET B CA  1 
ATOM   1814 C  C   . MET B 1 3   ? 1.298   -14.036 13.446  1.00 72.97  ? 2   MET B C   1 
ATOM   1815 O  O   . MET B 1 3   ? 0.530   -14.219 14.392  1.00 72.11  ? 2   MET B O   1 
ATOM   1816 C  CB  . MET B 1 3   ? 0.881   -12.049 12.026  1.00 70.87  ? 2   MET B CB  1 
ATOM   1817 C  CG  . MET B 1 3   ? 1.424   -11.527 10.725  1.00 70.25  ? 2   MET B CG  1 
ATOM   1818 S  SD  . MET B 1 3   ? 1.138   -9.759  10.606  1.00 74.45  ? 2   MET B SD  1 
ATOM   1819 C  CE  . MET B 1 3   ? 0.101   -9.697  9.166   1.00 75.25  ? 2   MET B CE  1 
ATOM   1820 N  N   . ILE B 1 4   ? 2.603   -14.258 13.527  1.00 71.13  ? 3   ILE B N   1 
ATOM   1821 C  CA  . ILE B 1 4   ? 3.218   -14.692 14.772  1.00 68.24  ? 3   ILE B CA  1 
ATOM   1822 C  C   . ILE B 1 4   ? 4.521   -13.942 15.010  1.00 64.84  ? 3   ILE B C   1 
ATOM   1823 O  O   . ILE B 1 4   ? 5.395   -13.892 14.148  1.00 63.18  ? 3   ILE B O   1 
ATOM   1824 C  CB  . ILE B 1 4   ? 3.412   -16.226 14.828  1.00 69.15  ? 3   ILE B CB  1 
ATOM   1825 C  CG1 . ILE B 1 4   ? 4.438   -16.599 15.899  1.00 73.00  ? 3   ILE B CG1 1 
ATOM   1826 C  CG2 . ILE B 1 4   ? 3.753   -16.775 13.464  1.00 67.96  ? 3   ILE B CG2 1 
ATOM   1827 C  CD1 . ILE B 1 4   ? 4.672   -18.081 16.023  1.00 75.58  ? 3   ILE B CD1 1 
ATOM   1828 N  N   . LEU B 1 5   ? 4.606   -13.323 16.180  1.00 61.22  ? 4   LEU B N   1 
ATOM   1829 C  CA  . LEU B 1 5   ? 5.752   -12.524 16.578  1.00 58.20  ? 4   LEU B CA  1 
ATOM   1830 C  C   . LEU B 1 5   ? 6.564   -13.170 17.697  1.00 57.95  ? 4   LEU B C   1 
ATOM   1831 O  O   . LEU B 1 5   ? 6.170   -13.145 18.869  1.00 59.44  ? 4   LEU B O   1 
ATOM   1832 C  CB  . LEU B 1 5   ? 5.258   -11.151 17.021  1.00 55.03  ? 4   LEU B CB  1 
ATOM   1833 C  CG  . LEU B 1 5   ? 6.216   -10.220 17.741  1.00 51.30  ? 4   LEU B CG  1 
ATOM   1834 C  CD1 . LEU B 1 5   ? 7.260   -9.723  16.754  1.00 48.79  ? 4   LEU B CD1 1 
ATOM   1835 C  CD2 . LEU B 1 5   ? 5.428   -9.058  18.337  1.00 49.26  ? 4   LEU B CD2 1 
ATOM   1836 N  N   . GLY B 1 6   ? 7.700   -13.747 17.329  1.00 57.00  ? 5   GLY B N   1 
ATOM   1837 C  CA  . GLY B 1 6   ? 8.558   -14.374 18.311  1.00 55.24  ? 5   GLY B CA  1 
ATOM   1838 C  C   . GLY B 1 6   ? 9.490   -13.358 18.935  1.00 55.89  ? 5   GLY B C   1 
ATOM   1839 O  O   . GLY B 1 6   ? 9.983   -12.452 18.254  1.00 54.04  ? 5   GLY B O   1 
ATOM   1840 N  N   . TYR B 1 7   ? 9.737   -13.512 20.231  1.00 55.47  ? 6   TYR B N   1 
ATOM   1841 C  CA  . TYR B 1 7   ? 10.616  -12.612 20.963  1.00 50.70  ? 6   TYR B CA  1 
ATOM   1842 C  C   . TYR B 1 7   ? 10.741  -13.058 22.412  1.00 50.64  ? 6   TYR B C   1 
ATOM   1843 O  O   . TYR B 1 7   ? 10.091  -14.007 22.834  1.00 49.03  ? 6   TYR B O   1 
ATOM   1844 C  CB  . TYR B 1 7   ? 10.071  -11.185 20.920  1.00 46.40  ? 6   TYR B CB  1 
ATOM   1845 C  CG  . TYR B 1 7   ? 11.076  -10.156 21.362  1.00 39.79  ? 6   TYR B CG  1 
ATOM   1846 C  CD1 . TYR B 1 7   ? 12.306  -10.041 20.712  1.00 38.90  ? 6   TYR B CD1 1 
ATOM   1847 C  CD2 . TYR B 1 7   ? 10.804  -9.297  22.424  1.00 38.91  ? 6   TYR B CD2 1 
ATOM   1848 C  CE1 . TYR B 1 7   ? 13.238  -9.096  21.107  1.00 34.45  ? 6   TYR B CE1 1 
ATOM   1849 C  CE2 . TYR B 1 7   ? 11.730  -8.343  22.828  1.00 31.51  ? 6   TYR B CE2 1 
ATOM   1850 C  CZ  . TYR B 1 7   ? 12.940  -8.252  22.162  1.00 32.96  ? 6   TYR B CZ  1 
ATOM   1851 O  OH  . TYR B 1 7   ? 13.851  -7.308  22.532  1.00 35.08  ? 6   TYR B OH  1 
ATOM   1852 N  N   . TRP B 1 8   ? 11.624  -12.404 23.154  1.00 52.92  ? 7   TRP B N   1 
ATOM   1853 C  CA  . TRP B 1 8   ? 11.808  -12.714 24.561  1.00 55.52  ? 7   TRP B CA  1 
ATOM   1854 C  C   . TRP B 1 8   ? 10.569  -12.237 25.305  1.00 58.76  ? 7   TRP B C   1 
ATOM   1855 O  O   . TRP B 1 8   ? 9.819   -11.403 24.791  1.00 59.09  ? 7   TRP B O   1 
ATOM   1856 C  CB  . TRP B 1 8   ? 13.038  -11.991 25.099  1.00 54.01  ? 7   TRP B CB  1 
ATOM   1857 C  CG  . TRP B 1 8   ? 14.317  -12.471 24.488  1.00 55.17  ? 7   TRP B CG  1 
ATOM   1858 C  CD1 . TRP B 1 8   ? 15.127  -11.782 23.635  1.00 56.18  ? 7   TRP B CD1 1 
ATOM   1859 C  CD2 . TRP B 1 8   ? 14.930  -13.755 24.678  1.00 55.82  ? 7   TRP B CD2 1 
ATOM   1860 N  NE1 . TRP B 1 8   ? 16.205  -12.558 23.278  1.00 55.70  ? 7   TRP B NE1 1 
ATOM   1861 C  CE2 . TRP B 1 8   ? 16.109  -13.772 23.903  1.00 54.47  ? 7   TRP B CE2 1 
ATOM   1862 C  CE3 . TRP B 1 8   ? 14.595  -14.894 25.426  1.00 57.18  ? 7   TRP B CE3 1 
ATOM   1863 C  CZ2 . TRP B 1 8   ? 16.958  -14.884 23.855  1.00 53.77  ? 7   TRP B CZ2 1 
ATOM   1864 C  CZ3 . TRP B 1 8   ? 15.441  -16.002 25.378  1.00 58.11  ? 7   TRP B CZ3 1 
ATOM   1865 C  CH2 . TRP B 1 8   ? 16.607  -15.986 24.595  1.00 56.53  ? 7   TRP B CH2 1 
ATOM   1866 N  N   . ASP B 1 9   ? 10.354  -12.757 26.510  1.00 60.12  ? 8   ASP B N   1 
ATOM   1867 C  CA  . ASP B 1 9   ? 9.201   -12.362 27.314  1.00 61.60  ? 8   ASP B CA  1 
ATOM   1868 C  C   . ASP B 1 9   ? 9.517   -11.018 27.979  1.00 62.00  ? 8   ASP B C   1 
ATOM   1869 O  O   . ASP B 1 9   ? 9.455   -10.879 29.202  1.00 63.40  ? 8   ASP B O   1 
ATOM   1870 C  CB  . ASP B 1 9   ? 8.887   -13.442 28.366  1.00 63.59  ? 8   ASP B CB  1 
ATOM   1871 C  CG  . ASP B 1 9   ? 7.481   -13.308 28.970  1.00 63.48  ? 8   ASP B CG  1 
ATOM   1872 O  OD1 . ASP B 1 9   ? 7.099   -14.196 29.763  1.00 63.80  ? 8   ASP B OD1 1 
ATOM   1873 O  OD2 . ASP B 1 9   ? 6.754   -12.333 28.662  1.00 62.94  ? 8   ASP B OD2 1 
ATOM   1874 N  N   . ILE B 1 10  ? 9.879   -10.038 27.154  1.00 60.91  ? 9   ILE B N   1 
ATOM   1875 C  CA  . ILE B 1 10  ? 10.219  -8.694  27.621  1.00 59.17  ? 9   ILE B CA  1 
ATOM   1876 C  C   . ILE B 1 10  ? 9.808   -7.640  26.598  1.00 58.55  ? 9   ILE B C   1 
ATOM   1877 O  O   . ILE B 1 10  ? 9.371   -7.967  25.496  1.00 59.97  ? 9   ILE B O   1 
ATOM   1878 C  CB  . ILE B 1 10  ? 11.740  -8.529  27.825  1.00 59.59  ? 9   ILE B CB  1 
ATOM   1879 C  CG1 . ILE B 1 10  ? 12.464  -8.719  26.487  1.00 58.05  ? 9   ILE B CG1 1 
ATOM   1880 C  CG2 . ILE B 1 10  ? 12.253  -9.498  28.880  1.00 59.58  ? 9   ILE B CG2 1 
ATOM   1881 C  CD1 . ILE B 1 10  ? 13.911  -8.326  26.514  1.00 56.07  ? 9   ILE B CD1 1 
ATOM   1882 N  N   . ARG B 1 11  ? 9.986   -6.374  26.962  1.00 56.37  ? 10  ARG B N   1 
ATOM   1883 C  CA  . ARG B 1 11  ? 9.665   -5.254  26.085  1.00 52.06  ? 10  ARG B CA  1 
ATOM   1884 C  C   . ARG B 1 11  ? 10.684  -5.220  24.937  1.00 48.36  ? 10  ARG B C   1 
ATOM   1885 O  O   . ARG B 1 11  ? 10.386  -5.621  23.804  1.00 43.23  ? 10  ARG B O   1 
ATOM   1886 C  CB  . ARG B 1 11  ? 9.701   -3.962  26.896  1.00 49.43  ? 10  ARG B CB  1 
ATOM   1887 C  CG  . ARG B 1 11  ? 9.542   -2.699  26.100  1.00 48.43  ? 10  ARG B CG  1 
ATOM   1888 C  CD  . ARG B 1 11  ? 9.361   -1.534  27.043  1.00 51.44  ? 10  ARG B CD  1 
ATOM   1889 N  NE  . ARG B 1 11  ? 9.323   -0.244  26.367  1.00 50.91  ? 10  ARG B NE  1 
ATOM   1890 C  CZ  . ARG B 1 11  ? 8.695   0.820   26.852  1.00 54.12  ? 10  ARG B CZ  1 
ATOM   1891 N  NH1 . ARG B 1 11  ? 8.046   0.736   28.008  1.00 52.74  ? 10  ARG B NH1 1 
ATOM   1892 N  NH2 . ARG B 1 11  ? 8.747   1.977   26.206  1.00 56.83  ? 10  ARG B NH2 1 
ATOM   1893 N  N   . GLY B 1 12  ? 11.895  -4.772  25.251  1.00 46.32  ? 11  GLY B N   1 
ATOM   1894 C  CA  . GLY B 1 12  ? 12.957  -4.710  24.265  1.00 46.01  ? 11  GLY B CA  1 
ATOM   1895 C  C   . GLY B 1 12  ? 12.636  -4.050  22.939  1.00 46.74  ? 11  GLY B C   1 
ATOM   1896 O  O   . GLY B 1 12  ? 12.107  -2.948  22.872  1.00 47.50  ? 11  GLY B O   1 
ATOM   1897 N  N   . LEU B 1 13  ? 12.971  -4.748  21.861  1.00 43.92  ? 12  LEU B N   1 
ATOM   1898 C  CA  . LEU B 1 13  ? 12.762  -4.246  20.507  1.00 41.93  ? 12  LEU B CA  1 
ATOM   1899 C  C   . LEU B 1 13  ? 11.399  -4.553  19.909  1.00 41.61  ? 12  LEU B C   1 
ATOM   1900 O  O   . LEU B 1 13  ? 11.026  -3.982  18.876  1.00 44.76  ? 12  LEU B O   1 
ATOM   1901 C  CB  . LEU B 1 13  ? 13.854  -4.774  19.573  1.00 36.06  ? 12  LEU B CB  1 
ATOM   1902 C  CG  . LEU B 1 13  ? 15.267  -4.329  19.932  1.00 35.77  ? 12  LEU B CG  1 
ATOM   1903 C  CD1 . LEU B 1 13  ? 16.234  -5.005  19.004  1.00 25.66  ? 12  LEU B CD1 1 
ATOM   1904 C  CD2 . LEU B 1 13  ? 15.375  -2.814  19.825  1.00 32.54  ? 12  LEU B CD2 1 
ATOM   1905 N  N   . ALA B 1 14  ? 10.674  -5.469  20.543  1.00 38.45  ? 13  ALA B N   1 
ATOM   1906 C  CA  . ALA B 1 14  ? 9.351   -5.860  20.082  1.00 34.77  ? 13  ALA B CA  1 
ATOM   1907 C  C   . ALA B 1 14  ? 8.274   -4.850  20.447  1.00 32.39  ? 13  ALA B C   1 
ATOM   1908 O  O   . ALA B 1 14  ? 7.196   -4.860  19.859  1.00 33.00  ? 13  ALA B O   1 
ATOM   1909 C  CB  . ALA B 1 14  ? 8.989   -7.221  20.633  1.00 38.00  ? 13  ALA B CB  1 
ATOM   1910 N  N   . HIS B 1 15  ? 8.584   -3.956  21.380  1.00 30.94  ? 14  HIS B N   1 
ATOM   1911 C  CA  . HIS B 1 15  ? 7.612   -2.971  21.817  1.00 31.49  ? 14  HIS B CA  1 
ATOM   1912 C  C   . HIS B 1 15  ? 6.953   -2.202  20.677  1.00 30.90  ? 14  HIS B C   1 
ATOM   1913 O  O   . HIS B 1 15  ? 5.745   -2.272  20.491  1.00 26.38  ? 14  HIS B O   1 
ATOM   1914 C  CB  . HIS B 1 15  ? 8.235   -1.990  22.805  1.00 32.21  ? 14  HIS B CB  1 
ATOM   1915 C  CG  . HIS B 1 15  ? 7.233   -1.321  23.697  1.00 33.78  ? 14  HIS B CG  1 
ATOM   1916 N  ND1 . HIS B 1 15  ? 6.430   -2.026  24.565  1.00 39.10  ? 14  HIS B ND1 1 
ATOM   1917 C  CD2 . HIS B 1 15  ? 6.886   -0.022  23.841  1.00 37.77  ? 14  HIS B CD2 1 
ATOM   1918 C  CE1 . HIS B 1 15  ? 5.625   -1.197  25.203  1.00 35.65  ? 14  HIS B CE1 1 
ATOM   1919 N  NE2 . HIS B 1 15  ? 5.880   0.030   24.783  1.00 37.30  ? 14  HIS B NE2 1 
ATOM   1920 N  N   . ALA B 1 16  ? 7.743   -1.446  19.929  1.00 31.47  ? 15  ALA B N   1 
ATOM   1921 C  CA  . ALA B 1 16  ? 7.210   -0.665  18.824  1.00 33.18  ? 15  ALA B CA  1 
ATOM   1922 C  C   . ALA B 1 16  ? 6.457   -1.533  17.828  1.00 30.79  ? 15  ALA B C   1 
ATOM   1923 O  O   . ALA B 1 16  ? 5.511   -1.071  17.197  1.00 28.65  ? 15  ALA B O   1 
ATOM   1924 C  CB  . ALA B 1 16  ? 8.327   0.076   18.129  1.00 32.09  ? 15  ALA B CB  1 
ATOM   1925 N  N   . ILE B 1 17  ? 6.920   -2.764  17.643  1.00 29.82  ? 16  ILE B N   1 
ATOM   1926 C  CA  . ILE B 1 17  ? 6.277   -3.694  16.719  1.00 30.18  ? 16  ILE B CA  1 
ATOM   1927 C  C   . ILE B 1 17  ? 4.874   -3.986  17.228  1.00 30.39  ? 16  ILE B C   1 
ATOM   1928 O  O   . ILE B 1 17  ? 3.896   -3.897  16.483  1.00 31.31  ? 16  ILE B O   1 
ATOM   1929 C  CB  . ILE B 1 17  ? 7.044   -5.026  16.636  1.00 32.12  ? 16  ILE B CB  1 
ATOM   1930 C  CG1 . ILE B 1 17  ? 8.441   -4.791  16.064  1.00 30.86  ? 16  ILE B CG1 1 
ATOM   1931 C  CG2 . ILE B 1 17  ? 6.269   -6.035  15.806  1.00 34.96  ? 16  ILE B CG2 1 
ATOM   1932 C  CD1 . ILE B 1 17  ? 9.336   -6.018  16.128  1.00 27.95  ? 16  ILE B CD1 1 
ATOM   1933 N  N   . ARG B 1 18  ? 4.807   -4.419  18.482  1.00 27.78  ? 17  ARG B N   1 
ATOM   1934 C  CA  . ARG B 1 18  ? 3.546   -4.718  19.129  1.00 29.86  ? 17  ARG B CA  1 
ATOM   1935 C  C   . ARG B 1 18  ? 2.615   -3.528  18.967  1.00 31.60  ? 17  ARG B C   1 
ATOM   1936 O  O   . ARG B 1 18  ? 1.504   -3.669  18.462  1.00 34.66  ? 17  ARG B O   1 
ATOM   1937 C  CB  . ARG B 1 18  ? 3.788   -5.019  20.604  1.00 30.43  ? 17  ARG B CB  1 
ATOM   1938 C  CG  . ARG B 1 18  ? 4.518   -6.328  20.820  1.00 35.33  ? 17  ARG B CG  1 
ATOM   1939 C  CD  . ARG B 1 18  ? 4.915   -6.535  22.270  1.00 38.10  ? 17  ARG B CD  1 
ATOM   1940 N  NE  . ARG B 1 18  ? 5.507   -7.856  22.452  1.00 52.45  ? 17  ARG B NE  1 
ATOM   1941 C  CZ  . ARG B 1 18  ? 6.531   -8.119  23.253  1.00 53.19  ? 17  ARG B CZ  1 
ATOM   1942 N  NH1 . ARG B 1 18  ? 7.094   -7.149  23.969  1.00 49.92  ? 17  ARG B NH1 1 
ATOM   1943 N  NH2 . ARG B 1 18  ? 7.015   -9.353  23.309  1.00 55.19  ? 17  ARG B NH2 1 
ATOM   1944 N  N   . LEU B 1 19  ? 3.092   -2.348  19.347  1.00 33.79  ? 18  LEU B N   1 
ATOM   1945 C  CA  . LEU B 1 19  ? 2.307   -1.132  19.225  1.00 35.10  ? 18  LEU B CA  1 
ATOM   1946 C  C   . LEU B 1 19  ? 1.810   -0.955  17.796  1.00 35.58  ? 18  LEU B C   1 
ATOM   1947 O  O   . LEU B 1 19  ? 0.667   -0.549  17.575  1.00 36.29  ? 18  LEU B O   1 
ATOM   1948 C  CB  . LEU B 1 19  ? 3.151   0.078   19.611  1.00 37.93  ? 18  LEU B CB  1 
ATOM   1949 C  CG  . LEU B 1 19  ? 3.682   0.104   21.043  1.00 39.33  ? 18  LEU B CG  1 
ATOM   1950 C  CD1 . LEU B 1 19  ? 4.597   1.304   21.222  1.00 44.99  ? 18  LEU B CD1 1 
ATOM   1951 C  CD2 . LEU B 1 19  ? 2.519   0.171   22.018  1.00 38.32  ? 18  LEU B CD2 1 
ATOM   1952 N  N   . LEU B 1 20  ? 2.685   -1.220  16.832  1.00 36.93  ? 19  LEU B N   1 
ATOM   1953 C  CA  . LEU B 1 20  ? 2.334   -1.078  15.428  1.00 42.37  ? 19  LEU B CA  1 
ATOM   1954 C  C   . LEU B 1 20  ? 1.269   -2.067  15.035  1.00 44.20  ? 19  LEU B C   1 
ATOM   1955 O  O   . LEU B 1 20  ? 0.320   -1.696  14.366  1.00 47.65  ? 19  LEU B O   1 
ATOM   1956 C  CB  . LEU B 1 20  ? 3.555   -1.256  14.526  1.00 45.11  ? 19  LEU B CB  1 
ATOM   1957 C  CG  . LEU B 1 20  ? 3.229   -1.043  13.043  1.00 44.67  ? 19  LEU B CG  1 
ATOM   1958 C  CD1 . LEU B 1 20  ? 2.706   0.367   12.853  1.00 40.11  ? 19  LEU B CD1 1 
ATOM   1959 C  CD2 . LEU B 1 20  ? 4.451   -1.289  12.160  1.00 40.67  ? 19  LEU B CD2 1 
ATOM   1960 N  N   . LEU B 1 21  ? 1.460   -3.328  15.409  1.00 44.48  ? 20  LEU B N   1 
ATOM   1961 C  CA  . LEU B 1 21  ? 0.499   -4.381  15.110  1.00 45.89  ? 20  LEU B CA  1 
ATOM   1962 C  C   . LEU B 1 21  ? -0.905  -4.054  15.640  1.00 49.42  ? 20  LEU B C   1 
ATOM   1963 O  O   . LEU B 1 21  ? -1.920  -4.350  15.005  1.00 51.33  ? 20  LEU B O   1 
ATOM   1964 C  CB  . LEU B 1 21  ? 0.969   -5.686  15.737  1.00 42.46  ? 20  LEU B CB  1 
ATOM   1965 C  CG  . LEU B 1 21  ? 2.046   -6.453  14.985  1.00 44.04  ? 20  LEU B CG  1 
ATOM   1966 C  CD1 . LEU B 1 21  ? 2.587   -7.573  15.854  1.00 37.76  ? 20  LEU B CD1 1 
ATOM   1967 C  CD2 . LEU B 1 21  ? 1.454   -7.014  13.702  1.00 45.49  ? 20  LEU B CD2 1 
ATOM   1968 N  N   . GLU B 1 22  ? -0.960  -3.516  16.851  1.00 51.67  ? 21  GLU B N   1 
ATOM   1969 C  CA  . GLU B 1 22  ? -2.229  -3.168  17.456  1.00 54.51  ? 21  GLU B CA  1 
ATOM   1970 C  C   . GLU B 1 22  ? -2.920  -2.028  16.731  1.00 53.88  ? 21  GLU B C   1 
ATOM   1971 O  O   . GLU B 1 22  ? -4.124  -2.088  16.478  1.00 56.43  ? 21  GLU B O   1 
ATOM   1972 C  CB  . GLU B 1 22  ? -2.036  -2.835  18.933  1.00 57.25  ? 21  GLU B CB  1 
ATOM   1973 C  CG  . GLU B 1 22  ? -1.788  -4.068  19.802  1.00 59.12  ? 21  GLU B CG  1 
ATOM   1974 C  CD  . GLU B 1 22  ? -3.021  -4.949  19.953  1.00 63.74  ? 21  GLU B CD  1 
ATOM   1975 O  OE1 . GLU B 1 22  ? -4.157  -4.436  19.802  1.00 65.59  ? 21  GLU B OE1 1 
ATOM   1976 O  OE2 . GLU B 1 22  ? -2.850  -6.156  20.239  1.00 62.33  ? 21  GLU B OE2 1 
ATOM   1977 N  N   . TYR B 1 23  ? -2.171  -0.972  16.434  1.00 52.41  ? 22  TYR B N   1 
ATOM   1978 C  CA  . TYR B 1 23  ? -2.721  0.185   15.736  1.00 54.33  ? 22  TYR B CA  1 
ATOM   1979 C  C   . TYR B 1 23  ? -3.200  -0.191  14.343  1.00 53.68  ? 22  TYR B C   1 
ATOM   1980 O  O   . TYR B 1 23  ? -4.119  0.428   13.805  1.00 53.93  ? 22  TYR B O   1 
ATOM   1981 C  CB  . TYR B 1 23  ? -1.681  1.295   15.639  1.00 53.61  ? 22  TYR B CB  1 
ATOM   1982 C  CG  . TYR B 1 23  ? -2.130  2.492   14.832  1.00 53.57  ? 22  TYR B CG  1 
ATOM   1983 C  CD1 . TYR B 1 23  ? -2.745  3.574   15.449  1.00 53.06  ? 22  TYR B CD1 1 
ATOM   1984 C  CD2 . TYR B 1 23  ? -1.913  2.553   13.452  1.00 52.65  ? 22  TYR B CD2 1 
ATOM   1985 C  CE1 . TYR B 1 23  ? -3.130  4.697   14.720  1.00 50.83  ? 22  TYR B CE1 1 
ATOM   1986 C  CE2 . TYR B 1 23  ? -2.295  3.670   12.709  1.00 51.20  ? 22  TYR B CE2 1 
ATOM   1987 C  CZ  . TYR B 1 23  ? -2.903  4.741   13.351  1.00 50.80  ? 22  TYR B CZ  1 
ATOM   1988 O  OH  . TYR B 1 23  ? -3.277  5.867   12.644  1.00 47.84  ? 22  TYR B OH  1 
ATOM   1989 N  N   . THR B 1 24  ? -2.533  -1.160  13.736  1.00 52.41  ? 23  THR B N   1 
ATOM   1990 C  CA  . THR B 1 24  ? -2.907  -1.617  12.410  1.00 50.66  ? 23  THR B CA  1 
ATOM   1991 C  C   . THR B 1 24  ? -4.039  -2.640  12.489  1.00 52.01  ? 23  THR B C   1 
ATOM   1992 O  O   . THR B 1 24  ? -4.572  -3.086  11.464  1.00 53.14  ? 23  THR B O   1 
ATOM   1993 C  CB  . THR B 1 24  ? -1.698  -2.206  11.667  1.00 48.89  ? 23  THR B CB  1 
ATOM   1994 O  OG1 . THR B 1 24  ? -1.096  -3.243  12.451  1.00 48.12  ? 23  THR B OG1 1 
ATOM   1995 C  CG2 . THR B 1 24  ? -0.679  -1.115  11.389  1.00 49.16  ? 23  THR B CG2 1 
ATOM   1996 N  N   . ASP B 1 25  ? -4.442  -2.958  13.715  1.00 53.25  ? 24  ASP B N   1 
ATOM   1997 C  CA  . ASP B 1 25  ? -5.515  -3.915  13.976  1.00 54.07  ? 24  ASP B CA  1 
ATOM   1998 C  C   . ASP B 1 25  ? -5.195  -5.270  13.343  1.00 52.65  ? 24  ASP B C   1 
ATOM   1999 O  O   . ASP B 1 25  ? -6.096  -6.025  12.959  1.00 48.79  ? 24  ASP B O   1 
ATOM   2000 C  CB  . ASP B 1 25  ? -6.835  -3.376  13.467  1.00 56.93  ? 24  ASP B CB  1 
ATOM   2001 C  CG  . ASP B 1 25  ? -7.989  -3.543  14.446  1.00 63.24  ? 24  ASP B CG  1 
ATOM   2002 O  OD1 . ASP B 1 25  ? -7.997  -4.536  15.210  1.00 66.34  ? 24  ASP B OD1 1 
ATOM   2003 O  OD2 . ASP B 1 25  ? -8.883  -2.672  14.462  1.00 63.26  ? 24  ASP B OD2 1 
ATOM   2004 N  N   . SER B 1 26  ? -3.905  -5.571  13.263  1.00 54.64  ? 25  SER B N   1 
ATOM   2005 C  CA  . SER B 1 26  ? -3.434  -6.816  12.685  1.00 57.72  ? 25  SER B CA  1 
ATOM   2006 C  C   . SER B 1 26  ? -3.788  -8.017  13.555  1.00 59.58  ? 25  SER B C   1 
ATOM   2007 O  O   . SER B 1 26  ? -3.903  -7.914  14.782  1.00 58.58  ? 25  SER B O   1 
ATOM   2008 C  CB  . SER B 1 26  ? -1.917  -6.757  12.448  1.00 57.86  ? 25  SER B CB  1 
ATOM   2009 O  OG  . SER B 1 26  ? -1.576  -5.880  11.381  1.00 55.57  ? 25  SER B OG  1 
ATOM   2010 N  N   . SER B 1 27  ? -3.997  -9.149  12.893  1.00 63.09  ? 26  SER B N   1 
ATOM   2011 C  CA  . SER B 1 27  ? -4.329  -10.403 13.560  1.00 67.82  ? 26  SER B CA  1 
ATOM   2012 C  C   . SER B 1 27  ? -3.002  -11.095 13.854  1.00 69.30  ? 26  SER B C   1 
ATOM   2013 O  O   . SER B 1 27  ? -2.241  -11.394 12.925  1.00 71.18  ? 26  SER B O   1 
ATOM   2014 C  CB  . SER B 1 27  ? -5.188  -11.267 12.626  1.00 68.55  ? 26  SER B CB  1 
ATOM   2015 O  OG  . SER B 1 27  ? -5.594  -12.483 13.235  1.00 70.55  ? 26  SER B OG  1 
ATOM   2016 N  N   . TYR B 1 28  ? -2.711  -11.347 15.129  1.00 68.99  ? 27  TYR B N   1 
ATOM   2017 C  CA  . TYR B 1 28  ? -1.439  -11.980 15.468  1.00 69.39  ? 27  TYR B CA  1 
ATOM   2018 C  C   . TYR B 1 28  ? -1.371  -12.706 16.801  1.00 71.87  ? 27  TYR B C   1 
ATOM   2019 O  O   . TYR B 1 28  ? -2.154  -12.450 17.713  1.00 71.88  ? 27  TYR B O   1 
ATOM   2020 C  CB  . TYR B 1 28  ? -0.332  -10.930 15.458  1.00 66.40  ? 27  TYR B CB  1 
ATOM   2021 C  CG  . TYR B 1 28  ? -0.358  -10.027 16.670  1.00 62.68  ? 27  TYR B CG  1 
ATOM   2022 C  CD1 . TYR B 1 28  ? -1.231  -8.942  16.742  1.00 62.52  ? 27  TYR B CD1 1 
ATOM   2023 C  CD2 . TYR B 1 28  ? 0.483   -10.271 17.756  1.00 64.43  ? 27  TYR B CD2 1 
ATOM   2024 C  CE1 . TYR B 1 28  ? -1.264  -8.119  17.872  1.00 61.54  ? 27  TYR B CE1 1 
ATOM   2025 C  CE2 . TYR B 1 28  ? 0.457   -9.461  18.889  1.00 62.17  ? 27  TYR B CE2 1 
ATOM   2026 C  CZ  . TYR B 1 28  ? -0.417  -8.390  18.942  1.00 61.00  ? 27  TYR B CZ  1 
ATOM   2027 O  OH  . TYR B 1 28  ? -0.454  -7.612  20.075  1.00 57.85  ? 27  TYR B OH  1 
ATOM   2028 N  N   . GLU B 1 29  ? -0.375  -13.576 16.909  1.00 75.75  ? 28  GLU B N   1 
ATOM   2029 C  CA  . GLU B 1 29  ? -0.094  -14.340 18.119  1.00 78.64  ? 28  GLU B CA  1 
ATOM   2030 C  C   . GLU B 1 29  ? 1.289   -13.872 18.584  1.00 78.25  ? 28  GLU B C   1 
ATOM   2031 O  O   . GLU B 1 29  ? 1.890   -12.983 17.976  1.00 78.40  ? 28  GLU B O   1 
ATOM   2032 C  CB  . GLU B 1 29  ? -0.004  -15.838 17.809  1.00 82.70  ? 28  GLU B CB  1 
ATOM   2033 C  CG  . GLU B 1 29  ? -1.250  -16.476 17.183  1.00 87.53  ? 28  GLU B CG  1 
ATOM   2034 C  CD  . GLU B 1 29  ? -1.453  -17.909 17.654  1.00 90.77  ? 28  GLU B CD  1 
ATOM   2035 O  OE1 . GLU B 1 29  ? -0.451  -18.594 17.956  1.00 92.89  ? 28  GLU B OE1 1 
ATOM   2036 O  OE2 . GLU B 1 29  ? -2.618  -18.348 17.735  1.00 92.09  ? 28  GLU B OE2 1 
ATOM   2037 N  N   . GLU B 1 30  ? 1.795   -14.473 19.656  1.00 76.03  ? 29  GLU B N   1 
ATOM   2038 C  CA  . GLU B 1 30  ? 3.116   -14.134 20.175  1.00 71.08  ? 29  GLU B CA  1 
ATOM   2039 C  C   . GLU B 1 30  ? 3.815   -15.372 20.705  1.00 69.79  ? 29  GLU B C   1 
ATOM   2040 O  O   . GLU B 1 30  ? 3.224   -16.172 21.430  1.00 68.87  ? 29  GLU B O   1 
ATOM   2041 C  CB  . GLU B 1 30  ? 3.035   -13.074 21.280  1.00 67.98  ? 29  GLU B CB  1 
ATOM   2042 C  CG  . GLU B 1 30  ? 2.798   -11.655 20.776  1.00 68.63  ? 29  GLU B CG  1 
ATOM   2043 C  CD  . GLU B 1 30  ? 3.268   -10.589 21.754  1.00 67.20  ? 29  GLU B CD  1 
ATOM   2044 O  OE1 . GLU B 1 30  ? 4.498   -10.461 21.955  1.00 64.79  ? 29  GLU B OE1 1 
ATOM   2045 O  OE2 . GLU B 1 30  ? 2.410   -9.867  22.307  1.00 63.56  ? 29  GLU B OE2 1 
ATOM   2046 N  N   . LYS B 1 31  ? 5.053   -15.573 20.276  1.00 68.48  ? 30  LYS B N   1 
ATOM   2047 C  CA  . LYS B 1 31  ? 5.827   -16.709 20.743  1.00 69.10  ? 30  LYS B CA  1 
ATOM   2048 C  C   . LYS B 1 31  ? 6.874   -16.139 21.689  1.00 70.40  ? 30  LYS B C   1 
ATOM   2049 O  O   . LYS B 1 31  ? 7.996   -15.845 21.285  1.00 71.21  ? 30  LYS B O   1 
ATOM   2050 C  CB  . LYS B 1 31  ? 6.496   -17.433 19.572  1.00 68.04  ? 30  LYS B CB  1 
ATOM   2051 C  CG  . LYS B 1 31  ? 6.614   -18.950 19.744  1.00 69.14  ? 30  LYS B CG  1 
ATOM   2052 C  CD  . LYS B 1 31  ? 7.422   -19.353 20.979  1.00 71.80  ? 30  LYS B CD  1 
ATOM   2053 C  CE  . LYS B 1 31  ? 7.574   -20.865 21.092  1.00 67.64  ? 30  LYS B CE  1 
ATOM   2054 N  NZ  . LYS B 1 31  ? 6.261   -21.548 21.238  1.00 66.18  ? 30  LYS B NZ  1 
ATOM   2055 N  N   . LYS B 1 32  ? 6.467   -15.921 22.935  1.00 71.57  ? 31  LYS B N   1 
ATOM   2056 C  CA  . LYS B 1 32  ? 7.353   -15.379 23.958  1.00 72.16  ? 31  LYS B CA  1 
ATOM   2057 C  C   . LYS B 1 32  ? 8.329   -16.463 24.430  1.00 73.37  ? 31  LYS B C   1 
ATOM   2058 O  O   . LYS B 1 32  ? 7.923   -17.597 24.704  1.00 74.03  ? 31  LYS B O   1 
ATOM   2059 C  CB  . LYS B 1 32  ? 6.521   -14.844 25.131  1.00 72.36  ? 31  LYS B CB  1 
ATOM   2060 C  CG  . LYS B 1 32  ? 5.509   -13.765 24.732  1.00 72.45  ? 31  LYS B CG  1 
ATOM   2061 C  CD  . LYS B 1 32  ? 4.574   -13.435 25.885  1.00 76.85  ? 31  LYS B CD  1 
ATOM   2062 C  CE  . LYS B 1 32  ? 3.544   -12.378 25.502  1.00 81.36  ? 31  LYS B CE  1 
ATOM   2063 N  NZ  . LYS B 1 32  ? 4.151   -11.037 25.247  1.00 86.05  ? 31  LYS B NZ  1 
ATOM   2064 N  N   . TYR B 1 33  ? 9.617   -16.128 24.455  1.00 72.94  ? 32  TYR B N   1 
ATOM   2065 C  CA  . TYR B 1 33  ? 10.653  -17.059 24.891  1.00 71.70  ? 32  TYR B CA  1 
ATOM   2066 C  C   . TYR B 1 33  ? 11.177  -16.658 26.264  1.00 73.60  ? 32  TYR B C   1 
ATOM   2067 O  O   . TYR B 1 33  ? 11.565  -15.506 26.484  1.00 71.78  ? 32  TYR B O   1 
ATOM   2068 C  CB  . TYR B 1 33  ? 11.806  -17.093 23.883  1.00 71.27  ? 32  TYR B CB  1 
ATOM   2069 C  CG  . TYR B 1 33  ? 11.461  -17.725 22.549  1.00 71.28  ? 32  TYR B CG  1 
ATOM   2070 C  CD1 . TYR B 1 33  ? 11.003  -16.947 21.476  1.00 69.43  ? 32  TYR B CD1 1 
ATOM   2071 C  CD2 . TYR B 1 33  ? 11.626  -19.094 22.345  1.00 70.16  ? 32  TYR B CD2 1 
ATOM   2072 C  CE1 . TYR B 1 33  ? 10.722  -17.518 20.234  1.00 68.38  ? 32  TYR B CE1 1 
ATOM   2073 C  CE2 . TYR B 1 33  ? 11.348  -19.680 21.108  1.00 66.74  ? 32  TYR B CE2 1 
ATOM   2074 C  CZ  . TYR B 1 33  ? 10.898  -18.885 20.057  1.00 67.57  ? 32  TYR B CZ  1 
ATOM   2075 O  OH  . TYR B 1 33  ? 10.628  -19.462 18.838  1.00 64.95  ? 32  TYR B OH  1 
ATOM   2076 N  N   . THR B 1 34  ? 11.180  -17.611 27.188  1.00 76.39  ? 33  THR B N   1 
ATOM   2077 C  CA  . THR B 1 34  ? 11.661  -17.362 28.543  1.00 80.52  ? 33  THR B CA  1 
ATOM   2078 C  C   . THR B 1 34  ? 13.164  -17.654 28.682  1.00 81.56  ? 33  THR B C   1 
ATOM   2079 O  O   . THR B 1 34  ? 13.660  -18.687 28.227  1.00 81.87  ? 33  THR B O   1 
ATOM   2080 C  CB  . THR B 1 34  ? 10.858  -18.199 29.585  1.00 80.78  ? 33  THR B CB  1 
ATOM   2081 O  OG1 . THR B 1 34  ? 9.474   -17.814 29.555  1.00 82.39  ? 33  THR B OG1 1 
ATOM   2082 C  CG2 . THR B 1 34  ? 11.405  -17.982 30.997  1.00 81.97  ? 33  THR B CG2 1 
ATOM   2083 N  N   . MET B 1 35  ? 13.890  -16.706 29.266  1.00 83.16  ? 34  MET B N   1 
ATOM   2084 C  CA  . MET B 1 35  ? 15.324  -16.849 29.494  1.00 85.55  ? 34  MET B CA  1 
ATOM   2085 C  C   . MET B 1 35  ? 15.527  -17.329 30.939  1.00 88.94  ? 34  MET B C   1 
ATOM   2086 O  O   . MET B 1 35  ? 14.813  -16.893 31.848  1.00 90.01  ? 34  MET B O   1 
ATOM   2087 C  CB  . MET B 1 35  ? 16.020  -15.500 29.277  1.00 85.67  ? 34  MET B CB  1 
ATOM   2088 C  CG  . MET B 1 35  ? 17.541  -15.535 29.357  1.00 84.40  ? 34  MET B CG  1 
ATOM   2089 S  SD  . MET B 1 35  ? 18.279  -13.890 29.207  1.00 82.45  ? 34  MET B SD  1 
ATOM   2090 C  CE  . MET B 1 35  ? 18.128  -13.612 27.452  1.00 88.19  ? 34  MET B CE  1 
ATOM   2091 N  N   . GLY B 1 36  ? 16.464  -18.250 31.144  1.00 90.33  ? 35  GLY B N   1 
ATOM   2092 C  CA  . GLY B 1 36  ? 16.723  -18.763 32.481  1.00 91.43  ? 35  GLY B CA  1 
ATOM   2093 C  C   . GLY B 1 36  ? 17.376  -17.760 33.420  1.00 92.15  ? 35  GLY B C   1 
ATOM   2094 O  O   . GLY B 1 36  ? 17.997  -16.792 32.975  1.00 92.78  ? 35  GLY B O   1 
ATOM   2095 N  N   . ASP B 1 37  ? 17.219  -17.982 34.724  1.00 91.18  ? 36  ASP B N   1 
ATOM   2096 C  CA  . ASP B 1 37  ? 17.802  -17.102 35.735  1.00 89.96  ? 36  ASP B CA  1 
ATOM   2097 C  C   . ASP B 1 37  ? 19.316  -17.214 35.768  1.00 89.75  ? 36  ASP B C   1 
ATOM   2098 O  O   . ASP B 1 37  ? 19.896  -18.155 35.223  1.00 88.63  ? 36  ASP B O   1 
ATOM   2099 C  CB  . ASP B 1 37  ? 17.262  -17.439 37.130  1.00 89.64  ? 36  ASP B CB  1 
ATOM   2100 C  CG  . ASP B 1 37  ? 15.819  -17.025 37.320  1.00 90.63  ? 36  ASP B CG  1 
ATOM   2101 O  OD1 . ASP B 1 37  ? 15.047  -17.828 37.889  1.00 89.09  ? 36  ASP B OD1 1 
ATOM   2102 O  OD2 . ASP B 1 37  ? 15.461  -15.894 36.921  1.00 92.39  ? 36  ASP B OD2 1 
ATOM   2103 N  N   . ALA B 1 38  ? 19.946  -16.251 36.433  1.00 89.87  ? 37  ALA B N   1 
ATOM   2104 C  CA  . ALA B 1 38  ? 21.395  -16.231 36.581  1.00 90.02  ? 37  ALA B CA  1 
ATOM   2105 C  C   . ALA B 1 38  ? 21.828  -17.455 37.392  1.00 90.43  ? 37  ALA B C   1 
ATOM   2106 O  O   . ALA B 1 38  ? 21.028  -18.024 38.143  1.00 90.84  ? 37  ALA B O   1 
ATOM   2107 C  CB  . ALA B 1 38  ? 21.826  -14.949 37.288  1.00 90.37  ? 37  ALA B CB  1 
ATOM   2108 N  N   . PRO B 1 39  ? 23.114  -17.835 37.310  1.00 90.61  ? 38  PRO B N   1 
ATOM   2109 C  CA  . PRO B 1 39  ? 24.175  -17.209 36.511  1.00 91.50  ? 38  PRO B CA  1 
ATOM   2110 C  C   . PRO B 1 39  ? 24.253  -17.713 35.065  1.00 92.40  ? 38  PRO B C   1 
ATOM   2111 O  O   . PRO B 1 39  ? 25.004  -17.170 34.249  1.00 89.75  ? 38  PRO B O   1 
ATOM   2112 C  CB  . PRO B 1 39  ? 25.430  -17.587 37.291  1.00 91.26  ? 38  PRO B CB  1 
ATOM   2113 C  CG  . PRO B 1 39  ? 25.115  -18.991 37.708  1.00 90.57  ? 38  PRO B CG  1 
ATOM   2114 C  CD  . PRO B 1 39  ? 23.672  -18.890 38.180  1.00 90.93  ? 38  PRO B CD  1 
ATOM   2115 N  N   . ASP B 1 40  ? 23.480  -18.754 34.765  1.00 94.12  ? 39  ASP B N   1 
ATOM   2116 C  CA  . ASP B 1 40  ? 23.462  -19.360 33.436  1.00 94.82  ? 39  ASP B CA  1 
ATOM   2117 C  C   . ASP B 1 40  ? 22.750  -18.601 32.327  1.00 93.01  ? 39  ASP B C   1 
ATOM   2118 O  O   . ASP B 1 40  ? 23.225  -18.591 31.188  1.00 91.12  ? 39  ASP B O   1 
ATOM   2119 C  CB  . ASP B 1 40  ? 22.892  -20.777 33.510  1.00 97.41  ? 39  ASP B CB  1 
ATOM   2120 C  CG  . ASP B 1 40  ? 23.956  -21.821 33.781  1.00 99.67  ? 39  ASP B CG  1 
ATOM   2121 O  OD1 . ASP B 1 40  ? 23.789  -22.962 33.303  1.00 100.00 ? 39  ASP B OD1 1 
ATOM   2122 O  OD2 . ASP B 1 40  ? 24.957  -21.505 34.461  1.00 98.58  ? 39  ASP B OD2 1 
ATOM   2123 N  N   . TYR B 1 41  ? 21.610  -17.992 32.651  1.00 91.93  ? 40  TYR B N   1 
ATOM   2124 C  CA  . TYR B 1 41  ? 20.817  -17.257 31.666  1.00 90.47  ? 40  TYR B CA  1 
ATOM   2125 C  C   . TYR B 1 41  ? 20.547  -18.189 30.490  1.00 89.11  ? 40  TYR B C   1 
ATOM   2126 O  O   . TYR B 1 41  ? 20.797  -17.850 29.329  1.00 86.33  ? 40  TYR B O   1 
ATOM   2127 C  CB  . TYR B 1 41  ? 21.549  -15.995 31.195  1.00 91.30  ? 40  TYR B CB  1 
ATOM   2128 C  CG  . TYR B 1 41  ? 21.718  -14.945 32.266  1.00 91.82  ? 40  TYR B CG  1 
ATOM   2129 C  CD1 . TYR B 1 41  ? 20.618  -14.461 32.973  1.00 91.19  ? 40  TYR B CD1 1 
ATOM   2130 C  CD2 . TYR B 1 41  ? 22.977  -14.422 32.563  1.00 92.46  ? 40  TYR B CD2 1 
ATOM   2131 C  CE1 . TYR B 1 41  ? 20.765  -13.481 33.952  1.00 92.27  ? 40  TYR B CE1 1 
ATOM   2132 C  CE2 . TYR B 1 41  ? 23.137  -13.441 33.538  1.00 93.06  ? 40  TYR B CE2 1 
ATOM   2133 C  CZ  . TYR B 1 41  ? 22.026  -12.976 34.228  1.00 93.38  ? 40  TYR B CZ  1 
ATOM   2134 O  OH  . TYR B 1 41  ? 22.174  -12.012 35.195  1.00 95.82  ? 40  TYR B OH  1 
ATOM   2135 N  N   . ASP B 1 42  ? 20.092  -19.392 30.824  1.00 89.59  ? 41  ASP B N   1 
ATOM   2136 C  CA  . ASP B 1 42  ? 19.789  -20.422 29.841  1.00 89.84  ? 41  ASP B CA  1 
ATOM   2137 C  C   . ASP B 1 42  ? 18.861  -19.924 28.737  1.00 89.32  ? 41  ASP B C   1 
ATOM   2138 O  O   . ASP B 1 42  ? 17.724  -19.510 28.985  1.00 89.33  ? 41  ASP B O   1 
ATOM   2139 C  CB  . ASP B 1 42  ? 19.189  -21.647 30.535  1.00 90.66  ? 41  ASP B CB  1 
ATOM   2140 C  CG  . ASP B 1 42  ? 18.842  -22.757 29.564  1.00 91.61  ? 41  ASP B CG  1 
ATOM   2141 O  OD1 . ASP B 1 42  ? 19.742  -23.205 28.819  1.00 89.99  ? 41  ASP B OD1 1 
ATOM   2142 O  OD2 . ASP B 1 42  ? 17.666  -23.181 29.552  1.00 90.24  ? 41  ASP B OD2 1 
ATOM   2143 N  N   . ARG B 1 43  ? 19.360  -19.992 27.511  1.00 88.62  ? 42  ARG B N   1 
ATOM   2144 C  CA  . ARG B 1 43  ? 18.610  -19.533 26.354  1.00 89.42  ? 42  ARG B CA  1 
ATOM   2145 C  C   . ARG B 1 43  ? 18.212  -20.704 25.460  1.00 86.33  ? 42  ARG B C   1 
ATOM   2146 O  O   . ARG B 1 43  ? 17.947  -20.510 24.276  1.00 86.73  ? 42  ARG B O   1 
ATOM   2147 C  CB  . ARG B 1 43  ? 19.467  -18.533 25.565  1.00 91.54  ? 42  ARG B CB  1 
ATOM   2148 C  CG  . ARG B 1 43  ? 19.954  -17.331 26.381  1.00 94.66  ? 42  ARG B CG  1 
ATOM   2149 C  CD  . ARG B 1 43  ? 20.991  -16.515 25.620  1.00 96.07  ? 42  ARG B CD  1 
ATOM   2150 N  NE  . ARG B 1 43  ? 20.554  -16.268 24.252  1.00 99.78  ? 42  ARG B NE  1 
ATOM   2151 C  CZ  . ARG B 1 43  ? 21.355  -15.885 23.261  1.00 100.00 ? 42  ARG B CZ  1 
ATOM   2152 N  NH1 . ARG B 1 43  ? 22.653  -15.688 23.473  1.00 100.00 ? 42  ARG B NH1 1 
ATOM   2153 N  NH2 . ARG B 1 43  ? 20.861  -15.727 22.039  1.00 100.00 ? 42  ARG B NH2 1 
ATOM   2154 N  N   . SER B 1 44  ? 18.166  -21.908 26.028  1.00 82.69  ? 43  SER B N   1 
ATOM   2155 C  CA  . SER B 1 44  ? 17.820  -23.113 25.272  1.00 78.80  ? 43  SER B CA  1 
ATOM   2156 C  C   . SER B 1 44  ? 16.418  -23.127 24.658  1.00 75.18  ? 43  SER B C   1 
ATOM   2157 O  O   . SER B 1 44  ? 16.214  -23.693 23.585  1.00 70.05  ? 43  SER B O   1 
ATOM   2158 C  CB  . SER B 1 44  ? 18.014  -24.362 26.139  1.00 80.90  ? 43  SER B CB  1 
ATOM   2159 O  OG  . SER B 1 44  ? 17.162  -24.350 27.276  1.00 79.71  ? 43  SER B OG  1 
ATOM   2160 N  N   . GLN B 1 45  ? 15.453  -22.508 25.334  1.00 73.02  ? 44  GLN B N   1 
ATOM   2161 C  CA  . GLN B 1 45  ? 14.079  -22.474 24.837  1.00 70.00  ? 44  GLN B CA  1 
ATOM   2162 C  C   . GLN B 1 45  ? 14.010  -21.894 23.424  1.00 68.84  ? 44  GLN B C   1 
ATOM   2163 O  O   . GLN B 1 45  ? 13.145  -22.269 22.629  1.00 67.05  ? 44  GLN B O   1 
ATOM   2164 C  CB  . GLN B 1 45  ? 13.184  -21.676 25.791  1.00 70.82  ? 44  GLN B CB  1 
ATOM   2165 C  CG  . GLN B 1 45  ? 11.691  -21.894 25.567  1.00 70.93  ? 44  GLN B CG  1 
ATOM   2166 C  CD  . GLN B 1 45  ? 10.824  -21.154 26.571  1.00 71.17  ? 44  GLN B CD  1 
ATOM   2167 O  OE1 . GLN B 1 45  ? 11.071  -21.197 27.777  1.00 68.57  ? 44  GLN B OE1 1 
ATOM   2168 N  NE2 . GLN B 1 45  ? 9.788   -20.492 26.077  1.00 71.06  ? 44  GLN B NE2 1 
ATOM   2169 N  N   . TRP B 1 46  ? 14.925  -20.973 23.134  1.00 67.49  ? 45  TRP B N   1 
ATOM   2170 C  CA  . TRP B 1 46  ? 15.015  -20.321 21.832  1.00 64.75  ? 45  TRP B CA  1 
ATOM   2171 C  C   . TRP B 1 46  ? 15.999  -21.031 20.901  1.00 64.08  ? 45  TRP B C   1 
ATOM   2172 O  O   . TRP B 1 46  ? 15.709  -21.212 19.719  1.00 66.07  ? 45  TRP B O   1 
ATOM   2173 C  CB  . TRP B 1 46  ? 15.399  -18.843 22.019  1.00 65.72  ? 45  TRP B CB  1 
ATOM   2174 C  CG  . TRP B 1 46  ? 16.068  -18.154 20.837  1.00 64.64  ? 45  TRP B CG  1 
ATOM   2175 C  CD1 . TRP B 1 46  ? 17.285  -17.529 20.845  1.00 64.76  ? 45  TRP B CD1 1 
ATOM   2176 C  CD2 . TRP B 1 46  ? 15.544  -17.979 19.510  1.00 64.93  ? 45  TRP B CD2 1 
ATOM   2177 N  NE1 . TRP B 1 46  ? 17.545  -16.975 19.617  1.00 65.18  ? 45  TRP B NE1 1 
ATOM   2178 C  CE2 . TRP B 1 46  ? 16.494  -17.237 18.779  1.00 64.47  ? 45  TRP B CE2 1 
ATOM   2179 C  CE3 . TRP B 1 46  ? 14.360  -18.378 18.873  1.00 65.91  ? 45  TRP B CE3 1 
ATOM   2180 C  CZ2 . TRP B 1 46  ? 16.300  -16.881 17.441  1.00 62.66  ? 45  TRP B CZ2 1 
ATOM   2181 C  CZ3 . TRP B 1 46  ? 14.167  -18.023 17.537  1.00 65.28  ? 45  TRP B CZ3 1 
ATOM   2182 C  CH2 . TRP B 1 46  ? 15.134  -17.282 16.839  1.00 64.00  ? 45  TRP B CH2 1 
ATOM   2183 N  N   . LEU B 1 47  ? 17.158  -21.420 21.428  1.00 61.67  ? 46  LEU B N   1 
ATOM   2184 C  CA  . LEU B 1 47  ? 18.181  -22.097 20.633  1.00 62.67  ? 46  LEU B CA  1 
ATOM   2185 C  C   . LEU B 1 47  ? 17.731  -23.446 20.075  1.00 64.31  ? 46  LEU B C   1 
ATOM   2186 O  O   . LEU B 1 47  ? 18.219  -23.881 19.030  1.00 66.09  ? 46  LEU B O   1 
ATOM   2187 C  CB  . LEU B 1 47  ? 19.474  -22.256 21.438  1.00 62.96  ? 46  LEU B CB  1 
ATOM   2188 C  CG  . LEU B 1 47  ? 20.110  -20.950 21.936  1.00 64.33  ? 46  LEU B CG  1 
ATOM   2189 C  CD1 . LEU B 1 47  ? 21.378  -21.229 22.739  1.00 62.66  ? 46  LEU B CD1 1 
ATOM   2190 C  CD2 . LEU B 1 47  ? 20.411  -20.039 20.759  1.00 64.94  ? 46  LEU B CD2 1 
ATOM   2191 N  N   . ASN B 1 48  ? 16.809  -24.101 20.774  1.00 66.30  ? 47  ASN B N   1 
ATOM   2192 C  CA  . ASN B 1 48  ? 16.271  -25.399 20.354  1.00 68.42  ? 47  ASN B CA  1 
ATOM   2193 C  C   . ASN B 1 48  ? 15.162  -25.216 19.312  1.00 67.78  ? 47  ASN B C   1 
ATOM   2194 O  O   . ASN B 1 48  ? 14.376  -26.132 19.058  1.00 70.45  ? 47  ASN B O   1 
ATOM   2195 C  CB  . ASN B 1 48  ? 15.686  -26.140 21.563  1.00 70.91  ? 47  ASN B CB  1 
ATOM   2196 C  CG  . ASN B 1 48  ? 16.747  -26.629 22.534  1.00 72.49  ? 47  ASN B CG  1 
ATOM   2197 O  OD1 . ASN B 1 48  ? 17.879  -26.141 22.552  1.00 73.43  ? 47  ASN B OD1 1 
ATOM   2198 N  ND2 . ASN B 1 48  ? 16.385  -27.617 23.343  1.00 75.32  ? 47  ASN B ND2 1 
ATOM   2199 N  N   . GLU B 1 49  ? 15.117  -24.046 18.687  1.00 65.53  ? 48  GLU B N   1 
ATOM   2200 C  CA  . GLU B 1 49  ? 14.079  -23.741 17.712  1.00 64.44  ? 48  GLU B CA  1 
ATOM   2201 C  C   . GLU B 1 49  ? 14.559  -22.639 16.769  1.00 65.41  ? 48  GLU B C   1 
ATOM   2202 O  O   . GLU B 1 49  ? 13.914  -22.341 15.762  1.00 65.56  ? 48  GLU B O   1 
ATOM   2203 C  CB  . GLU B 1 49  ? 12.835  -23.267 18.469  1.00 61.40  ? 48  GLU B CB  1 
ATOM   2204 C  CG  . GLU B 1 49  ? 11.540  -23.266 17.685  1.00 62.26  ? 48  GLU B CG  1 
ATOM   2205 C  CD  . GLU B 1 49  ? 10.349  -22.885 18.548  1.00 61.06  ? 48  GLU B CD  1 
ATOM   2206 O  OE1 . GLU B 1 49  ? 9.572   -21.994 18.143  1.00 64.25  ? 48  GLU B OE1 1 
ATOM   2207 O  OE2 . GLU B 1 49  ? 10.195  -23.478 19.638  1.00 62.39  ? 48  GLU B OE2 1 
ATOM   2208 N  N   . LYS B 1 50  ? 15.716  -22.068 17.093  1.00 64.86  ? 49  LYS B N   1 
ATOM   2209 C  CA  . LYS B 1 50  ? 16.319  -20.982 16.328  1.00 64.45  ? 49  LYS B CA  1 
ATOM   2210 C  C   . LYS B 1 50  ? 16.476  -21.250 14.833  1.00 64.76  ? 49  LYS B C   1 
ATOM   2211 O  O   . LYS B 1 50  ? 16.159  -20.392 14.005  1.00 63.70  ? 49  LYS B O   1 
ATOM   2212 C  CB  . LYS B 1 50  ? 17.687  -20.622 16.926  1.00 61.22  ? 49  LYS B CB  1 
ATOM   2213 C  CG  . LYS B 1 50  ? 18.375  -19.457 16.241  1.00 59.05  ? 49  LYS B CG  1 
ATOM   2214 C  CD  . LYS B 1 50  ? 19.663  -19.070 16.936  1.00 62.52  ? 49  LYS B CD  1 
ATOM   2215 C  CE  . LYS B 1 50  ? 20.261  -17.816 16.316  1.00 65.03  ? 49  LYS B CE  1 
ATOM   2216 N  NZ  . LYS B 1 50  ? 21.455  -17.343 17.067  1.00 69.60  ? 49  LYS B NZ  1 
ATOM   2217 N  N   . PHE B 1 51  ? 16.982  -22.430 14.495  1.00 66.48  ? 50  PHE B N   1 
ATOM   2218 C  CA  . PHE B 1 51  ? 17.215  -22.780 13.101  1.00 70.40  ? 50  PHE B CA  1 
ATOM   2219 C  C   . PHE B 1 51  ? 16.130  -23.629 12.423  1.00 72.89  ? 50  PHE B C   1 
ATOM   2220 O  O   . PHE B 1 51  ? 16.280  -24.017 11.263  1.00 74.90  ? 50  PHE B O   1 
ATOM   2221 C  CB  . PHE B 1 51  ? 18.589  -23.448 12.966  1.00 70.53  ? 50  PHE B CB  1 
ATOM   2222 C  CG  . PHE B 1 51  ? 19.723  -22.617 13.517  1.00 75.22  ? 50  PHE B CG  1 
ATOM   2223 C  CD1 . PHE B 1 51  ? 20.172  -22.801 14.823  1.00 78.15  ? 50  PHE B CD1 1 
ATOM   2224 C  CD2 . PHE B 1 51  ? 20.325  -21.629 12.741  1.00 76.09  ? 50  PHE B CD2 1 
ATOM   2225 C  CE1 . PHE B 1 51  ? 21.203  -22.014 15.345  1.00 80.42  ? 50  PHE B CE1 1 
ATOM   2226 C  CE2 . PHE B 1 51  ? 21.357  -20.837 13.256  1.00 77.94  ? 50  PHE B CE2 1 
ATOM   2227 C  CZ  . PHE B 1 51  ? 21.793  -21.028 14.559  1.00 80.71  ? 50  PHE B CZ  1 
ATOM   2228 N  N   . LYS B 1 52  ? 15.045  -23.920 13.133  1.00 73.40  ? 51  LYS B N   1 
ATOM   2229 C  CA  . LYS B 1 52  ? 13.970  -24.722 12.557  1.00 74.67  ? 51  LYS B CA  1 
ATOM   2230 C  C   . LYS B 1 52  ? 12.829  -23.895 12.007  1.00 74.01  ? 51  LYS B C   1 
ATOM   2231 O  O   . LYS B 1 52  ? 11.964  -24.413 11.301  1.00 75.14  ? 51  LYS B O   1 
ATOM   2232 C  CB  . LYS B 1 52  ? 13.400  -25.700 13.576  1.00 77.05  ? 51  LYS B CB  1 
ATOM   2233 C  CG  . LYS B 1 52  ? 14.294  -26.863 13.902  1.00 83.45  ? 51  LYS B CG  1 
ATOM   2234 C  CD  . LYS B 1 52  ? 15.337  -26.488 14.933  1.00 89.83  ? 51  LYS B CD  1 
ATOM   2235 C  CE  . LYS B 1 52  ? 15.779  -27.718 15.681  1.00 93.10  ? 51  LYS B CE  1 
ATOM   2236 N  NZ  . LYS B 1 52  ? 14.612  -28.301 16.413  1.00 93.83  ? 51  LYS B NZ  1 
ATOM   2237 N  N   . LEU B 1 53  ? 12.808  -22.615 12.344  1.00 74.18  ? 52  LEU B N   1 
ATOM   2238 C  CA  . LEU B 1 53  ? 11.738  -21.743 11.887  1.00 74.21  ? 52  LEU B CA  1 
ATOM   2239 C  C   . LEU B 1 53  ? 11.839  -21.328 10.421  1.00 72.42  ? 52  LEU B C   1 
ATOM   2240 O  O   . LEU B 1 53  ? 10.938  -20.669 9.899   1.00 72.55  ? 52  LEU B O   1 
ATOM   2241 C  CB  . LEU B 1 53  ? 11.657  -20.522 12.797  1.00 75.18  ? 52  LEU B CB  1 
ATOM   2242 C  CG  . LEU B 1 53  ? 11.445  -20.901 14.267  1.00 75.80  ? 52  LEU B CG  1 
ATOM   2243 C  CD1 . LEU B 1 53  ? 11.563  -19.679 15.155  1.00 76.25  ? 52  LEU B CD1 1 
ATOM   2244 C  CD2 . LEU B 1 53  ? 10.091  -21.575 14.447  1.00 77.05  ? 52  LEU B CD2 1 
ATOM   2245 N  N   . GLY B 1 54  ? 12.919  -21.729 9.755   1.00 69.58  ? 53  GLY B N   1 
ATOM   2246 C  CA  . GLY B 1 54  ? 13.098  -21.380 8.357   1.00 64.52  ? 53  GLY B CA  1 
ATOM   2247 C  C   . GLY B 1 54  ? 13.428  -19.912 8.143   1.00 62.73  ? 53  GLY B C   1 
ATOM   2248 O  O   . GLY B 1 54  ? 13.161  -19.354 7.078   1.00 61.98  ? 53  GLY B O   1 
ATOM   2249 N  N   . LEU B 1 55  ? 13.974  -19.276 9.174   1.00 59.58  ? 54  LEU B N   1 
ATOM   2250 C  CA  . LEU B 1 55  ? 14.355  -17.873 9.092   1.00 52.05  ? 54  LEU B CA  1 
ATOM   2251 C  C   . LEU B 1 55  ? 15.675  -17.777 8.337   1.00 50.69  ? 54  LEU B C   1 
ATOM   2252 O  O   . LEU B 1 55  ? 16.562  -18.609 8.526   1.00 51.02  ? 54  LEU B O   1 
ATOM   2253 C  CB  . LEU B 1 55  ? 14.524  -17.286 10.495  1.00 49.19  ? 54  LEU B CB  1 
ATOM   2254 C  CG  . LEU B 1 55  ? 13.280  -17.209 11.376  1.00 48.21  ? 54  LEU B CG  1 
ATOM   2255 C  CD1 . LEU B 1 55  ? 13.688  -16.839 12.785  1.00 47.48  ? 54  LEU B CD1 1 
ATOM   2256 C  CD2 . LEU B 1 55  ? 12.296  -16.193 10.814  1.00 46.35  ? 54  LEU B CD2 1 
ATOM   2257 N  N   . ASP B 1 56  ? 15.803  -16.760 7.491   1.00 48.57  ? 55  ASP B N   1 
ATOM   2258 C  CA  . ASP B 1 56  ? 17.024  -16.557 6.718   1.00 44.04  ? 55  ASP B CA  1 
ATOM   2259 C  C   . ASP B 1 56  ? 18.210  -16.263 7.633   1.00 42.02  ? 55  ASP B C   1 
ATOM   2260 O  O   . ASP B 1 56  ? 19.254  -16.909 7.542   1.00 44.67  ? 55  ASP B O   1 
ATOM   2261 C  CB  . ASP B 1 56  ? 16.820  -15.438 5.702   1.00 43.85  ? 55  ASP B CB  1 
ATOM   2262 C  CG  . ASP B 1 56  ? 15.885  -15.841 4.588   1.00 40.35  ? 55  ASP B CG  1 
ATOM   2263 O  OD1 . ASP B 1 56  ? 16.322  -16.609 3.709   1.00 38.40  ? 55  ASP B OD1 1 
ATOM   2264 O  OD2 . ASP B 1 56  ? 14.715  -15.409 4.599   1.00 39.65  ? 55  ASP B OD2 1 
ATOM   2265 N  N   . PHE B 1 57  ? 18.048  -15.281 8.510   1.00 37.29  ? 56  PHE B N   1 
ATOM   2266 C  CA  . PHE B 1 57  ? 19.095  -14.927 9.466   1.00 35.82  ? 56  PHE B CA  1 
ATOM   2267 C  C   . PHE B 1 57  ? 18.464  -15.053 10.851  1.00 37.60  ? 56  PHE B C   1 
ATOM   2268 O  O   . PHE B 1 57  ? 18.016  -14.067 11.440  1.00 38.35  ? 56  PHE B O   1 
ATOM   2269 C  CB  . PHE B 1 57  ? 19.612  -13.501 9.211   1.00 29.67  ? 56  PHE B CB  1 
ATOM   2270 C  CG  . PHE B 1 57  ? 20.304  -13.327 7.877   1.00 19.86  ? 56  PHE B CG  1 
ATOM   2271 C  CD1 . PHE B 1 57  ? 21.661  -13.597 7.744   1.00 21.41  ? 56  PHE B CD1 1 
ATOM   2272 C  CD2 . PHE B 1 57  ? 19.600  -12.894 6.753   1.00 26.30  ? 56  PHE B CD2 1 
ATOM   2273 C  CE1 . PHE B 1 57  ? 22.310  -13.444 6.516   1.00 20.95  ? 56  PHE B CE1 1 
ATOM   2274 C  CE2 . PHE B 1 57  ? 20.245  -12.739 5.520   1.00 22.34  ? 56  PHE B CE2 1 
ATOM   2275 C  CZ  . PHE B 1 57  ? 21.600  -13.015 5.405   1.00 18.85  ? 56  PHE B CZ  1 
ATOM   2276 N  N   . PRO B 1 58  ? 18.394  -16.291 11.378  1.00 41.43  ? 57  PRO B N   1 
ATOM   2277 C  CA  . PRO B 1 58  ? 17.808  -16.577 12.691  1.00 41.05  ? 57  PRO B CA  1 
ATOM   2278 C  C   . PRO B 1 58  ? 18.143  -15.533 13.741  1.00 40.34  ? 57  PRO B C   1 
ATOM   2279 O  O   . PRO B 1 58  ? 19.311  -15.328 14.085  1.00 36.37  ? 57  PRO B O   1 
ATOM   2280 C  CB  . PRO B 1 58  ? 18.380  -17.946 13.016  1.00 37.68  ? 57  PRO B CB  1 
ATOM   2281 C  CG  . PRO B 1 58  ? 18.364  -18.602 11.674  1.00 39.79  ? 57  PRO B CG  1 
ATOM   2282 C  CD  . PRO B 1 58  ? 18.956  -17.522 10.790  1.00 38.20  ? 57  PRO B CD  1 
ATOM   2283 N  N   . ASN B 1 59  ? 17.100  -14.865 14.224  1.00 40.45  ? 58  ASN B N   1 
ATOM   2284 C  CA  . ASN B 1 59  ? 17.260  -13.815 15.218  1.00 43.75  ? 58  ASN B CA  1 
ATOM   2285 C  C   . ASN B 1 59  ? 15.930  -13.460 15.902  1.00 45.58  ? 58  ASN B C   1 
ATOM   2286 O  O   . ASN B 1 59  ? 14.863  -13.945 15.511  1.00 48.21  ? 58  ASN B O   1 
ATOM   2287 C  CB  . ASN B 1 59  ? 17.839  -12.576 14.527  1.00 46.41  ? 58  ASN B CB  1 
ATOM   2288 C  CG  . ASN B 1 59  ? 18.589  -11.673 15.478  1.00 50.20  ? 58  ASN B CG  1 
ATOM   2289 O  OD1 . ASN B 1 59  ? 18.473  -11.796 16.691  1.00 54.47  ? 58  ASN B OD1 1 
ATOM   2290 N  ND2 . ASN B 1 59  ? 19.372  -10.755 14.927  1.00 51.71  ? 58  ASN B ND2 1 
ATOM   2291 N  N   . LEU B 1 60  ? 16.012  -12.643 16.948  1.00 45.52  ? 59  LEU B N   1 
ATOM   2292 C  CA  . LEU B 1 60  ? 14.849  -12.178 17.700  1.00 44.72  ? 59  LEU B CA  1 
ATOM   2293 C  C   . LEU B 1 60  ? 14.881  -10.659 17.698  1.00 43.90  ? 59  LEU B C   1 
ATOM   2294 O  O   . LEU B 1 60  ? 15.895  -10.055 18.038  1.00 41.63  ? 59  LEU B O   1 
ATOM   2295 C  CB  . LEU B 1 60  ? 14.897  -12.682 19.143  1.00 44.52  ? 59  LEU B CB  1 
ATOM   2296 C  CG  . LEU B 1 60  ? 14.697  -14.188 19.313  1.00 44.07  ? 59  LEU B CG  1 
ATOM   2297 C  CD1 . LEU B 1 60  ? 14.866  -14.575 20.762  1.00 45.25  ? 59  LEU B CD1 1 
ATOM   2298 C  CD2 . LEU B 1 60  ? 13.316  -14.586 18.825  1.00 40.02  ? 59  LEU B CD2 1 
ATOM   2299 N  N   . PRO B 1 61  ? 13.752  -10.012 17.396  1.00 42.92  ? 60  PRO B N   1 
ATOM   2300 C  CA  . PRO B 1 61  ? 12.459  -10.606 17.062  1.00 42.81  ? 60  PRO B CA  1 
ATOM   2301 C  C   . PRO B 1 61  ? 12.382  -11.157 15.650  1.00 44.78  ? 60  PRO B C   1 
ATOM   2302 O  O   . PRO B 1 61  ? 13.246  -10.893 14.806  1.00 44.52  ? 60  PRO B O   1 
ATOM   2303 C  CB  . PRO B 1 61  ? 11.520  -9.415  17.190  1.00 38.85  ? 60  PRO B CB  1 
ATOM   2304 C  CG  . PRO B 1 61  ? 12.360  -8.312  16.614  1.00 36.50  ? 60  PRO B CG  1 
ATOM   2305 C  CD  . PRO B 1 61  ? 13.686  -8.541  17.307  1.00 40.83  ? 60  PRO B CD  1 
ATOM   2306 N  N   . TYR B 1 62  ? 11.321  -11.908 15.404  1.00 44.87  ? 61  TYR B N   1 
ATOM   2307 C  CA  . TYR B 1 62  ? 11.058  -12.466 14.099  1.00 44.00  ? 61  TYR B CA  1 
ATOM   2308 C  C   . TYR B 1 62  ? 9.547   -12.411 13.898  1.00 41.32  ? 61  TYR B C   1 
ATOM   2309 O  O   . TYR B 1 62  ? 8.787   -12.341 14.869  1.00 36.52  ? 61  TYR B O   1 
ATOM   2310 C  CB  . TYR B 1 62  ? 11.595  -13.896 13.982  1.00 44.08  ? 61  TYR B CB  1 
ATOM   2311 C  CG  . TYR B 1 62  ? 10.875  -14.929 14.808  1.00 48.61  ? 61  TYR B CG  1 
ATOM   2312 C  CD1 . TYR B 1 62  ? 9.618   -15.404 14.429  1.00 49.70  ? 61  TYR B CD1 1 
ATOM   2313 C  CD2 . TYR B 1 62  ? 11.462  -15.459 15.954  1.00 52.52  ? 61  TYR B CD2 1 
ATOM   2314 C  CE1 . TYR B 1 62  ? 8.962   -16.378 15.170  1.00 54.83  ? 61  TYR B CE1 1 
ATOM   2315 C  CE2 . TYR B 1 62  ? 10.819  -16.438 16.707  1.00 56.09  ? 61  TYR B CE2 1 
ATOM   2316 C  CZ  . TYR B 1 62  ? 9.569   -16.892 16.308  1.00 59.24  ? 61  TYR B CZ  1 
ATOM   2317 O  OH  . TYR B 1 62  ? 8.920   -17.856 17.042  1.00 62.72  ? 61  TYR B OH  1 
ATOM   2318 N  N   . LEU B 1 63  ? 9.118   -12.356 12.647  1.00 40.86  ? 62  LEU B N   1 
ATOM   2319 C  CA  . LEU B 1 63  ? 7.698   -12.320 12.356  1.00 42.13  ? 62  LEU B CA  1 
ATOM   2320 C  C   . LEU B 1 63  ? 7.380   -13.316 11.262  1.00 44.92  ? 62  LEU B C   1 
ATOM   2321 O  O   . LEU B 1 63  ? 8.053   -13.356 10.230  1.00 45.79  ? 62  LEU B O   1 
ATOM   2322 C  CB  . LEU B 1 63  ? 7.266   -10.924 11.919  1.00 38.79  ? 62  LEU B CB  1 
ATOM   2323 C  CG  . LEU B 1 63  ? 5.758   -10.810 11.667  1.00 40.40  ? 62  LEU B CG  1 
ATOM   2324 C  CD1 . LEU B 1 63  ? 5.008   -10.912 12.994  1.00 38.05  ? 62  LEU B CD1 1 
ATOM   2325 C  CD2 . LEU B 1 63  ? 5.434   -9.499  10.976  1.00 40.98  ? 62  LEU B CD2 1 
ATOM   2326 N  N   . ILE B 1 64  ? 6.365   -14.137 11.494  1.00 45.66  ? 63  ILE B N   1 
ATOM   2327 C  CA  . ILE B 1 64  ? 5.973   -15.118 10.503  1.00 47.35  ? 63  ILE B CA  1 
ATOM   2328 C  C   . ILE B 1 64  ? 4.566   -14.823 9.996   1.00 49.41  ? 63  ILE B C   1 
ATOM   2329 O  O   . ILE B 1 64  ? 3.590   -14.880 10.746  1.00 48.83  ? 63  ILE B O   1 
ATOM   2330 C  CB  . ILE B 1 64  ? 6.082   -16.551 11.054  1.00 44.74  ? 63  ILE B CB  1 
ATOM   2331 C  CG1 . ILE B 1 64  ? 7.542   -16.849 11.422  1.00 47.37  ? 63  ILE B CG1 1 
ATOM   2332 C  CG2 . ILE B 1 64  ? 5.564   -17.555 10.027  1.00 44.55  ? 63  ILE B CG2 1 
ATOM   2333 C  CD1 . ILE B 1 64  ? 7.774   -18.224 12.024  1.00 50.24  ? 63  ILE B CD1 1 
ATOM   2334 N  N   . ASP B 1 65  ? 4.488   -14.423 8.732   1.00 48.55  ? 64  ASP B N   1 
ATOM   2335 C  CA  . ASP B 1 65  ? 3.224   -14.122 8.092   1.00 51.32  ? 64  ASP B CA  1 
ATOM   2336 C  C   . ASP B 1 65  ? 3.058   -15.060 6.908   1.00 53.92  ? 64  ASP B C   1 
ATOM   2337 O  O   . ASP B 1 65  ? 3.341   -14.701 5.762   1.00 51.48  ? 64  ASP B O   1 
ATOM   2338 C  CB  . ASP B 1 65  ? 3.184   -12.671 7.620   1.00 53.34  ? 64  ASP B CB  1 
ATOM   2339 C  CG  . ASP B 1 65  ? 1.819   -12.271 7.074   1.00 53.65  ? 64  ASP B CG  1 
ATOM   2340 O  OD1 . ASP B 1 65  ? 0.843   -13.036 7.233   1.00 51.47  ? 64  ASP B OD1 1 
ATOM   2341 O  OD2 . ASP B 1 65  ? 1.713   -11.178 6.483   1.00 55.89  ? 64  ASP B OD2 1 
ATOM   2342 N  N   . GLY B 1 66  ? 2.578   -16.262 7.196   1.00 57.44  ? 65  GLY B N   1 
ATOM   2343 C  CA  . GLY B 1 66  ? 2.371   -17.248 6.156   1.00 61.10  ? 65  GLY B CA  1 
ATOM   2344 C  C   . GLY B 1 66  ? 3.688   -17.757 5.616   1.00 64.02  ? 65  GLY B C   1 
ATOM   2345 O  O   . GLY B 1 66  ? 4.429   -18.455 6.316   1.00 64.31  ? 65  GLY B O   1 
ATOM   2346 N  N   . ALA B 1 67  ? 3.968   -17.418 4.361   1.00 64.87  ? 66  ALA B N   1 
ATOM   2347 C  CA  . ALA B 1 67  ? 5.200   -17.836 3.708   1.00 66.32  ? 66  ALA B CA  1 
ATOM   2348 C  C   . ALA B 1 67  ? 6.338   -16.875 4.007   1.00 66.42  ? 66  ALA B C   1 
ATOM   2349 O  O   . ALA B 1 67  ? 7.496   -17.159 3.694   1.00 65.95  ? 66  ALA B O   1 
ATOM   2350 C  CB  . ALA B 1 67  ? 4.987   -17.938 2.208   1.00 68.46  ? 66  ALA B CB  1 
ATOM   2351 N  N   . HIS B 1 68  ? 6.005   -15.730 4.593   1.00 67.79  ? 67  HIS B N   1 
ATOM   2352 C  CA  . HIS B 1 68  ? 7.003   -14.718 4.927   1.00 67.63  ? 67  HIS B CA  1 
ATOM   2353 C  C   . HIS B 1 68  ? 7.588   -14.827 6.337   1.00 64.92  ? 67  HIS B C   1 
ATOM   2354 O  O   . HIS B 1 68  ? 6.899   -14.610 7.325   1.00 63.28  ? 67  HIS B O   1 
ATOM   2355 C  CB  . HIS B 1 68  ? 6.339   -13.374 4.699   1.00 68.64  ? 67  HIS B CB  1 
ATOM   2356 C  CG  . HIS B 1 68  ? 6.038   -13.079 3.262   1.00 69.38  ? 67  HIS B CG  1 
ATOM   2357 N  ND1 . HIS B 1 68  ? 7.020   -12.962 2.304   1.00 69.27  ? 67  HIS B ND1 1 
ATOM   2358 C  CD2 . HIS B 1 68  ? 4.862   -12.889 2.621   1.00 67.95  ? 67  HIS B CD2 1 
ATOM   2359 C  CE1 . HIS B 1 68  ? 6.462   -12.713 1.131   1.00 69.31  ? 67  HIS B CE1 1 
ATOM   2360 N  NE2 . HIS B 1 68  ? 5.155   -12.663 1.296   1.00 66.72  ? 67  HIS B NE2 1 
ATOM   2361 N  N   . LYS B 1 69  ? 8.859   -15.202 6.415   1.00 64.14  ? 68  LYS B N   1 
ATOM   2362 C  CA  . LYS B 1 69  ? 9.568   -15.306 7.688   1.00 63.62  ? 68  LYS B CA  1 
ATOM   2363 C  C   . LYS B 1 69  ? 10.539  -14.133 7.717   1.00 61.35  ? 68  LYS B C   1 
ATOM   2364 O  O   . LYS B 1 69  ? 11.450  -14.052 6.882   1.00 61.69  ? 68  LYS B O   1 
ATOM   2365 C  CB  . LYS B 1 69  ? 10.340  -16.621 7.775   1.00 67.37  ? 68  LYS B CB  1 
ATOM   2366 C  CG  . LYS B 1 69  ? 9.479   -17.842 8.049   1.00 70.59  ? 68  LYS B CG  1 
ATOM   2367 C  CD  . LYS B 1 69  ? 8.594   -18.194 6.869   1.00 72.88  ? 68  LYS B CD  1 
ATOM   2368 C  CE  . LYS B 1 69  ? 7.859   -19.503 7.099   1.00 74.24  ? 68  LYS B CE  1 
ATOM   2369 N  NZ  . LYS B 1 69  ? 8.791   -20.655 7.267   1.00 68.17  ? 68  LYS B NZ  1 
ATOM   2370 N  N   . ILE B 1 70  ? 10.340  -13.222 8.663   1.00 58.43  ? 69  ILE B N   1 
ATOM   2371 C  CA  . ILE B 1 70  ? 11.174  -12.027 8.767   1.00 55.82  ? 69  ILE B CA  1 
ATOM   2372 C  C   . ILE B 1 70  ? 11.912  -11.871 10.102  1.00 52.00  ? 69  ILE B C   1 
ATOM   2373 O  O   . ILE B 1 70  ? 11.462  -12.355 11.142  1.00 49.19  ? 69  ILE B O   1 
ATOM   2374 C  CB  . ILE B 1 70  ? 10.309  -10.762 8.517   1.00 57.50  ? 69  ILE B CB  1 
ATOM   2375 C  CG1 . ILE B 1 70  ? 9.605   -10.873 7.164   1.00 59.17  ? 69  ILE B CG1 1 
ATOM   2376 C  CG2 . ILE B 1 70  ? 11.157  -9.490  8.557   1.00 56.01  ? 69  ILE B CG2 1 
ATOM   2377 C  CD1 . ILE B 1 70  ? 8.682   -9.721  6.865   1.00 59.75  ? 69  ILE B CD1 1 
ATOM   2378 N  N   . THR B 1 71  ? 13.075  -11.229 10.042  1.00 49.63  ? 70  THR B N   1 
ATOM   2379 C  CA  . THR B 1 71  ? 13.899  -10.935 11.214  1.00 44.43  ? 70  THR B CA  1 
ATOM   2380 C  C   . THR B 1 71  ? 14.351  -9.478  11.061  1.00 42.20  ? 70  THR B C   1 
ATOM   2381 O  O   . THR B 1 71  ? 14.148  -8.874  9.995   1.00 38.30  ? 70  THR B O   1 
ATOM   2382 C  CB  . THR B 1 71  ? 15.113  -11.860 11.300  1.00 39.54  ? 70  THR B CB  1 
ATOM   2383 O  OG1 . THR B 1 71  ? 15.831  -11.814 10.064  1.00 35.34  ? 70  THR B OG1 1 
ATOM   2384 C  CG2 . THR B 1 71  ? 14.673  -13.296 11.555  1.00 39.06  ? 70  THR B CG2 1 
ATOM   2385 N  N   . GLN B 1 72  ? 14.944  -8.922  12.118  1.00 37.91  ? 71  GLN B N   1 
ATOM   2386 C  CA  . GLN B 1 72  ? 15.401  -7.526  12.145  1.00 34.79  ? 71  GLN B CA  1 
ATOM   2387 C  C   . GLN B 1 72  ? 14.221  -6.609  12.419  1.00 31.61  ? 71  GLN B C   1 
ATOM   2388 O  O   . GLN B 1 72  ? 13.420  -6.347  11.530  1.00 27.07  ? 71  GLN B O   1 
ATOM   2389 C  CB  . GLN B 1 72  ? 16.069  -7.109  10.830  1.00 31.65  ? 71  GLN B CB  1 
ATOM   2390 C  CG  . GLN B 1 72  ? 17.414  -7.769  10.551  1.00 29.44  ? 71  GLN B CG  1 
ATOM   2391 C  CD  . GLN B 1 72  ? 18.484  -7.335  11.523  1.00 26.51  ? 71  GLN B CD  1 
ATOM   2392 O  OE1 . GLN B 1 72  ? 18.420  -6.241  12.086  1.00 26.20  ? 71  GLN B OE1 1 
ATOM   2393 N  NE2 . GLN B 1 72  ? 19.469  -8.190  11.735  1.00 17.37  ? 71  GLN B NE2 1 
ATOM   2394 N  N   . SER B 1 73  ? 14.144  -6.092  13.640  1.00 30.78  ? 72  SER B N   1 
ATOM   2395 C  CA  . SER B 1 73  ? 13.043  -5.224  14.024  1.00 27.09  ? 72  SER B CA  1 
ATOM   2396 C  C   . SER B 1 73  ? 12.606  -4.192  12.992  1.00 24.89  ? 72  SER B C   1 
ATOM   2397 O  O   . SER B 1 73  ? 11.418  -4.111  12.677  1.00 20.27  ? 72  SER B O   1 
ATOM   2398 C  CB  . SER B 1 73  ? 13.309  -4.551  15.377  1.00 27.14  ? 72  SER B CB  1 
ATOM   2399 O  OG  . SER B 1 73  ? 14.266  -3.511  15.276  1.00 25.73  ? 72  SER B OG  1 
ATOM   2400 N  N   . ASN B 1 74  ? 13.547  -3.403  12.476  1.00 26.89  ? 73  ASN B N   1 
ATOM   2401 C  CA  . ASN B 1 74  ? 13.216  -2.369  11.490  1.00 32.63  ? 73  ASN B CA  1 
ATOM   2402 C  C   . ASN B 1 74  ? 12.602  -2.934  10.213  1.00 35.37  ? 73  ASN B C   1 
ATOM   2403 O  O   . ASN B 1 74  ? 11.770  -2.285  9.586   1.00 36.40  ? 73  ASN B O   1 
ATOM   2404 C  CB  . ASN B 1 74  ? 14.435  -1.499  11.167  1.00 33.83  ? 73  ASN B CB  1 
ATOM   2405 C  CG  . ASN B 1 74  ? 14.728  -0.479  12.253  1.00 33.60  ? 73  ASN B CG  1 
ATOM   2406 O  OD1 . ASN B 1 74  ? 14.046  -0.422  13.274  1.00 35.40  ? 73  ASN B OD1 1 
ATOM   2407 N  ND2 . ASN B 1 74  ? 15.736  0.345   12.027  1.00 35.36  ? 73  ASN B ND2 1 
ATOM   2408 N  N   . ALA B 1 75  ? 13.015  -4.138  9.834   1.00 35.63  ? 74  ALA B N   1 
ATOM   2409 C  CA  . ALA B 1 75  ? 12.492  -4.804  8.651   1.00 33.66  ? 74  ALA B CA  1 
ATOM   2410 C  C   . ALA B 1 75  ? 11.032  -5.214  8.897   1.00 38.62  ? 74  ALA B C   1 
ATOM   2411 O  O   . ALA B 1 75  ? 10.151  -4.997  8.053   1.00 43.72  ? 74  ALA B O   1 
ATOM   2412 C  CB  . ALA B 1 75  ? 13.337  -6.025  8.336   1.00 35.73  ? 74  ALA B CB  1 
ATOM   2413 N  N   . ILE B 1 76  ? 10.797  -5.838  10.048  1.00 37.42  ? 75  ILE B N   1 
ATOM   2414 C  CA  . ILE B 1 76  ? 9.472   -6.278  10.447  1.00 36.12  ? 75  ILE B CA  1 
ATOM   2415 C  C   . ILE B 1 76  ? 8.523   -5.082  10.452  1.00 39.16  ? 75  ILE B C   1 
ATOM   2416 O  O   . ILE B 1 76  ? 7.402   -5.171  9.945   1.00 39.87  ? 75  ILE B O   1 
ATOM   2417 C  CB  . ILE B 1 76  ? 9.519   -6.922  11.841  1.00 30.23  ? 75  ILE B CB  1 
ATOM   2418 C  CG1 . ILE B 1 76  ? 10.368  -8.196  11.796  1.00 30.15  ? 75  ILE B CG1 1 
ATOM   2419 C  CG2 . ILE B 1 76  ? 8.126   -7.250  12.316  1.00 27.46  ? 75  ILE B CG2 1 
ATOM   2420 C  CD1 . ILE B 1 76  ? 10.612  -8.823  13.156  1.00 26.62  ? 75  ILE B CD1 1 
ATOM   2421 N  N   . LEU B 1 77  ? 8.982   -3.963  11.006  1.00 42.72  ? 76  LEU B N   1 
ATOM   2422 C  CA  . LEU B 1 77  ? 8.175   -2.751  11.068  1.00 45.06  ? 76  LEU B CA  1 
ATOM   2423 C  C   . LEU B 1 77  ? 7.753   -2.248  9.700   1.00 45.35  ? 76  LEU B C   1 
ATOM   2424 O  O   . LEU B 1 77  ? 6.607   -1.850  9.523   1.00 47.00  ? 76  LEU B O   1 
ATOM   2425 C  CB  . LEU B 1 77  ? 8.916   -1.643  11.812  1.00 41.92  ? 76  LEU B CB  1 
ATOM   2426 C  CG  . LEU B 1 77  ? 9.053   -1.860  13.318  1.00 34.18  ? 76  LEU B CG  1 
ATOM   2427 C  CD1 . LEU B 1 77  ? 9.984   -0.817  13.918  1.00 34.72  ? 76  LEU B CD1 1 
ATOM   2428 C  CD2 . LEU B 1 77  ? 7.677   -1.773  13.969  1.00 28.50  ? 76  LEU B CD2 1 
ATOM   2429 N  N   . CYS B 1 78  ? 8.691   -2.206  8.760   1.00 47.25  ? 77  CYS B N   1 
ATOM   2430 C  CA  . CYS B 1 78  ? 8.397   -1.747  7.401   1.00 53.92  ? 77  CYS B CA  1 
ATOM   2431 C  C   . CYS B 1 78  ? 7.431   -2.700  6.723   1.00 54.18  ? 77  CYS B C   1 
ATOM   2432 O  O   . CYS B 1 78  ? 6.605   -2.282  5.912   1.00 52.58  ? 77  CYS B O   1 
ATOM   2433 C  CB  . CYS B 1 78  ? 9.663   -1.678  6.555   1.00 58.38  ? 77  CYS B CB  1 
ATOM   2434 S  SG  . CYS B 1 78  ? 10.797  -0.359  6.984   1.00 75.25  ? 77  CYS B SG  1 
ATOM   2435 N  N   . TYR B 1 79  ? 7.596   -3.989  7.000   1.00 55.15  ? 78  TYR B N   1 
ATOM   2436 C  CA  . TYR B 1 79  ? 6.733   -5.007  6.424   1.00 56.43  ? 78  TYR B CA  1 
ATOM   2437 C  C   . TYR B 1 79  ? 5.284   -4.740  6.809   1.00 56.71  ? 78  TYR B C   1 
ATOM   2438 O  O   . TYR B 1 79  ? 4.392   -4.756  5.958   1.00 58.32  ? 78  TYR B O   1 
ATOM   2439 C  CB  . TYR B 1 79  ? 7.142   -6.390  6.913   1.00 57.45  ? 78  TYR B CB  1 
ATOM   2440 C  CG  . TYR B 1 79  ? 6.295   -7.482  6.326   1.00 62.15  ? 78  TYR B CG  1 
ATOM   2441 C  CD1 . TYR B 1 79  ? 6.286   -7.713  4.953   1.00 65.34  ? 78  TYR B CD1 1 
ATOM   2442 C  CD2 . TYR B 1 79  ? 5.504   -8.291  7.136   1.00 66.64  ? 78  TYR B CD2 1 
ATOM   2443 C  CE1 . TYR B 1 79  ? 5.509   -8.728  4.395   1.00 67.00  ? 78  TYR B CE1 1 
ATOM   2444 C  CE2 . TYR B 1 79  ? 4.723   -9.312  6.588   1.00 69.07  ? 78  TYR B CE2 1 
ATOM   2445 C  CZ  . TYR B 1 79  ? 4.734   -9.522  5.218   1.00 67.35  ? 78  TYR B CZ  1 
ATOM   2446 O  OH  . TYR B 1 79  ? 3.982   -10.527 4.660   1.00 65.97  ? 78  TYR B OH  1 
ATOM   2447 N  N   . ILE B 1 80  ? 5.061   -4.552  8.106   1.00 54.96  ? 79  ILE B N   1 
ATOM   2448 C  CA  . ILE B 1 80  ? 3.742   -4.274  8.645   1.00 53.27  ? 79  ILE B CA  1 
ATOM   2449 C  C   . ILE B 1 80  ? 3.253   -2.925  8.136   1.00 55.17  ? 79  ILE B C   1 
ATOM   2450 O  O   . ILE B 1 80  ? 2.105   -2.797  7.722   1.00 58.50  ? 79  ILE B O   1 
ATOM   2451 C  CB  . ILE B 1 80  ? 3.777   -4.265  10.180  1.00 53.60  ? 79  ILE B CB  1 
ATOM   2452 C  CG1 . ILE B 1 80  ? 4.234   -5.634  10.689  1.00 51.45  ? 79  ILE B CG1 1 
ATOM   2453 C  CG2 . ILE B 1 80  ? 2.411   -3.928  10.743  1.00 46.60  ? 79  ILE B CG2 1 
ATOM   2454 C  CD1 . ILE B 1 80  ? 4.604   -5.651  12.146  1.00 52.62  ? 79  ILE B CD1 1 
ATOM   2455 N  N   . ALA B 1 81  ? 4.133   -1.931  8.146   1.00 55.89  ? 80  ALA B N   1 
ATOM   2456 C  CA  . ALA B 1 81  ? 3.780   -0.590  7.686   1.00 57.51  ? 80  ALA B CA  1 
ATOM   2457 C  C   . ALA B 1 81  ? 3.378   -0.513  6.215   1.00 54.65  ? 80  ALA B C   1 
ATOM   2458 O  O   . ALA B 1 81  ? 2.467   0.235   5.867   1.00 49.76  ? 80  ALA B O   1 
ATOM   2459 C  CB  . ALA B 1 81  ? 4.909   0.385   7.965   1.00 58.22  ? 80  ALA B CB  1 
ATOM   2460 N  N   . ARG B 1 82  ? 4.073   -1.247  5.350   1.00 54.89  ? 81  ARG B N   1 
ATOM   2461 C  CA  . ARG B 1 82  ? 3.746   -1.228  3.923   1.00 55.19  ? 81  ARG B CA  1 
ATOM   2462 C  C   . ARG B 1 82  ? 2.319   -1.694  3.641   1.00 53.40  ? 81  ARG B C   1 
ATOM   2463 O  O   . ARG B 1 82  ? 1.685   -1.234  2.689   1.00 51.00  ? 81  ARG B O   1 
ATOM   2464 C  CB  . ARG B 1 82  ? 4.738   -2.069  3.113   1.00 53.69  ? 81  ARG B CB  1 
ATOM   2465 C  CG  . ARG B 1 82  ? 6.004   -1.308  2.709   1.00 57.61  ? 81  ARG B CG  1 
ATOM   2466 C  CD  . ARG B 1 82  ? 6.809   -2.044  1.633   1.00 60.18  ? 81  ARG B CD  1 
ATOM   2467 N  NE  . ARG B 1 82  ? 7.321   -3.330  2.102   1.00 64.76  ? 81  ARG B NE  1 
ATOM   2468 C  CZ  . ARG B 1 82  ? 8.446   -3.483  2.796   1.00 66.36  ? 81  ARG B CZ  1 
ATOM   2469 N  NH1 . ARG B 1 82  ? 9.194   -2.430  3.109   1.00 65.99  ? 81  ARG B NH1 1 
ATOM   2470 N  NH2 . ARG B 1 82  ? 8.826   -4.696  3.175   1.00 68.76  ? 81  ARG B NH2 1 
ATOM   2471 N  N   . LYS B 1 83  ? 1.839   -2.633  4.450   1.00 52.27  ? 82  LYS B N   1 
ATOM   2472 C  CA  . LYS B 1 83  ? 0.488   -3.157  4.302   1.00 54.65  ? 82  LYS B CA  1 
ATOM   2473 C  C   . LYS B 1 83  ? -0.571  -2.108  4.654   1.00 55.26  ? 82  LYS B C   1 
ATOM   2474 O  O   . LYS B 1 83  ? -1.743  -2.264  4.308   1.00 57.29  ? 82  LYS B O   1 
ATOM   2475 C  CB  . LYS B 1 83  ? 0.278   -4.371  5.210   1.00 52.52  ? 82  LYS B CB  1 
ATOM   2476 C  CG  . LYS B 1 83  ? 1.132   -5.571  4.910   1.00 53.97  ? 82  LYS B CG  1 
ATOM   2477 C  CD  . LYS B 1 83  ? 0.757   -6.707  5.854   1.00 56.05  ? 82  LYS B CD  1 
ATOM   2478 C  CE  . LYS B 1 83  ? 1.524   -7.978  5.543   1.00 57.14  ? 82  LYS B CE  1 
ATOM   2479 N  NZ  . LYS B 1 83  ? 1.311   -8.441  4.139   1.00 62.45  ? 82  LYS B NZ  1 
ATOM   2480 N  N   . HIS B 1 84  ? -0.169  -1.074  5.387   1.00 53.90  ? 83  HIS B N   1 
ATOM   2481 C  CA  . HIS B 1 84  ? -1.098  -0.033  5.806   1.00 52.40  ? 83  HIS B CA  1 
ATOM   2482 C  C   . HIS B 1 84  ? -0.656  1.378   5.433   1.00 53.19  ? 83  HIS B C   1 
ATOM   2483 O  O   . HIS B 1 84  ? -1.086  2.351   6.052   1.00 53.14  ? 83  HIS B O   1 
ATOM   2484 C  CB  . HIS B 1 84  ? -1.358  -0.097  7.306   1.00 51.07  ? 83  HIS B CB  1 
ATOM   2485 C  CG  . HIS B 1 84  ? -1.882  -1.433  7.728   1.00 49.59  ? 83  HIS B CG  1 
ATOM   2486 N  ND1 . HIS B 1 84  ? -1.064  -2.530  7.914   1.00 49.91  ? 83  HIS B ND1 1 
ATOM   2487 C  CD2 . HIS B 1 84  ? -3.135  -1.841  8.033   1.00 50.22  ? 83  HIS B CD2 1 
ATOM   2488 C  CE1 . HIS B 1 84  ? -1.796  -3.554  8.320   1.00 48.63  ? 83  HIS B CE1 1 
ATOM   2489 N  NE2 . HIS B 1 84  ? -3.055  -3.163  8.400   1.00 54.32  ? 83  HIS B NE2 1 
ATOM   2490 N  N   . ASN B 1 85  ? 0.208   1.484   4.432   1.00 56.11  ? 84  ASN B N   1 
ATOM   2491 C  CA  . ASN B 1 85  ? 0.698   2.779   3.966   1.00 59.81  ? 84  ASN B CA  1 
ATOM   2492 C  C   . ASN B 1 85  ? 1.195   3.709   5.061   1.00 58.61  ? 84  ASN B C   1 
ATOM   2493 O  O   . ASN B 1 85  ? 0.792   4.874   5.144   1.00 60.02  ? 84  ASN B O   1 
ATOM   2494 C  CB  . ASN B 1 85  ? -0.396  3.438   3.156   1.00 64.39  ? 84  ASN B CB  1 
ATOM   2495 C  CG  . ASN B 1 85  ? -0.679  2.563   1.982   1.00 71.19  ? 84  ASN B CG  1 
ATOM   2496 O  OD1 . ASN B 1 85  ? 0.084   1.651   1.661   1.00 75.09  ? 84  ASN B OD1 1 
ATOM   2497 N  ND2 . ASN B 1 85  ? -1.761  2.870   1.289   1.00 72.53  ? 84  ASN B ND2 1 
ATOM   2498 N  N   . LEU B 1 86  ? 2.091   3.186   5.886   1.00 56.93  ? 85  LEU B N   1 
ATOM   2499 C  CA  . LEU B 1 86  ? 2.667   3.944   6.984   1.00 52.98  ? 85  LEU B CA  1 
ATOM   2500 C  C   . LEU B 1 86  ? 4.183   3.984   6.841   1.00 52.84  ? 85  LEU B C   1 
ATOM   2501 O  O   . LEU B 1 86  ? 4.901   4.115   7.828   1.00 51.05  ? 85  LEU B O   1 
ATOM   2502 C  CB  . LEU B 1 86  ? 2.271   3.306   8.316   1.00 52.73  ? 85  LEU B CB  1 
ATOM   2503 C  CG  . LEU B 1 86  ? 0.766   3.271   8.602   1.00 49.92  ? 85  LEU B CG  1 
ATOM   2504 C  CD1 . LEU B 1 86  ? 0.462   2.364   9.794   1.00 43.18  ? 85  LEU B CD1 1 
ATOM   2505 C  CD2 . LEU B 1 86  ? 0.263   4.689   8.841   1.00 47.00  ? 85  LEU B CD2 1 
ATOM   2506 N  N   . CYS B 1 87  ? 4.659   3.857   5.605   1.00 54.99  ? 86  CYS B N   1 
ATOM   2507 C  CA  . CYS B 1 87  ? 6.085   3.875   5.322   1.00 59.46  ? 86  CYS B CA  1 
ATOM   2508 C  C   . CYS B 1 87  ? 6.519   5.194   4.693   1.00 63.33  ? 86  CYS B C   1 
ATOM   2509 O  O   . CYS B 1 87  ? 7.703   5.398   4.423   1.00 63.27  ? 86  CYS B O   1 
ATOM   2510 C  CB  . CYS B 1 87  ? 6.453   2.712   4.400   1.00 60.46  ? 86  CYS B CB  1 
ATOM   2511 S  SG  . CYS B 1 87  ? 7.809   1.676   5.013   1.00 63.41  ? 86  CYS B SG  1 
ATOM   2512 N  N   . GLY B 1 88  ? 5.565   6.102   4.506   1.00 67.34  ? 87  GLY B N   1 
ATOM   2513 C  CA  . GLY B 1 88  ? 5.870   7.386   3.903   1.00 71.65  ? 87  GLY B CA  1 
ATOM   2514 C  C   . GLY B 1 88  ? 5.455   7.411   2.446   1.00 74.84  ? 87  GLY B C   1 
ATOM   2515 O  O   . GLY B 1 88  ? 5.356   6.363   1.802   1.00 75.77  ? 87  GLY B O   1 
ATOM   2516 N  N   . GLU B 1 89  ? 5.193   8.604   1.928   1.00 75.71  ? 88  GLU B N   1 
ATOM   2517 C  CA  . GLU B 1 89  ? 4.772   8.754   0.543   1.00 77.09  ? 88  GLU B CA  1 
ATOM   2518 C  C   . GLU B 1 89  ? 5.649   9.746   -0.195  1.00 75.97  ? 88  GLU B C   1 
ATOM   2519 O  O   . GLU B 1 89  ? 6.278   9.398   -1.194  1.00 78.08  ? 88  GLU B O   1 
ATOM   2520 C  CB  . GLU B 1 89  ? 3.307   9.197   0.487   1.00 81.19  ? 88  GLU B CB  1 
ATOM   2521 C  CG  . GLU B 1 89  ? 2.355   8.224   1.177   1.00 87.39  ? 88  GLU B CG  1 
ATOM   2522 C  CD  . GLU B 1 89  ? 1.029   8.853   1.571   1.00 92.74  ? 88  GLU B CD  1 
ATOM   2523 O  OE1 . GLU B 1 89  ? 1.036   9.975   2.120   1.00 94.76  ? 88  GLU B OE1 1 
ATOM   2524 O  OE2 . GLU B 1 89  ? -0.022  8.212   1.353   1.00 96.06  ? 88  GLU B OE2 1 
ATOM   2525 N  N   . THR B 1 90  ? 5.678   10.986  0.283   1.00 74.18  ? 89  THR B N   1 
ATOM   2526 C  CA  . THR B 1 90  ? 6.489   12.010  -0.362  1.00 74.53  ? 89  THR B CA  1 
ATOM   2527 C  C   . THR B 1 90  ? 7.975   11.694  -0.238  1.00 73.94  ? 89  THR B C   1 
ATOM   2528 O  O   . THR B 1 90  ? 8.372   10.771  0.479   1.00 72.35  ? 89  THR B O   1 
ATOM   2529 C  CB  . THR B 1 90  ? 6.188   13.442  0.184   1.00 75.28  ? 89  THR B CB  1 
ATOM   2530 O  OG1 . THR B 1 90  ? 6.461   13.515  1.587   1.00 73.47  ? 89  THR B OG1 1 
ATOM   2531 C  CG2 . THR B 1 90  ? 4.734   13.804  -0.041  1.00 77.75  ? 89  THR B CG2 1 
ATOM   2532 N  N   . GLU B 1 91  ? 8.790   12.413  -1.001  1.00 75.17  ? 90  GLU B N   1 
ATOM   2533 C  CA  . GLU B 1 91  ? 10.226  12.209  -0.952  1.00 74.58  ? 90  GLU B CA  1 
ATOM   2534 C  C   . GLU B 1 91  ? 10.733  12.562  0.443   1.00 72.86  ? 90  GLU B C   1 
ATOM   2535 O  O   . GLU B 1 91  ? 11.435  11.769  1.070   1.00 72.61  ? 90  GLU B O   1 
ATOM   2536 C  CB  . GLU B 1 91  ? 10.922  13.066  -2.016  1.00 78.64  ? 90  GLU B CB  1 
ATOM   2537 C  CG  . GLU B 1 91  ? 12.456  12.974  -2.019  1.00 84.28  ? 90  GLU B CG  1 
ATOM   2538 C  CD  . GLU B 1 91  ? 12.992  11.549  -2.191  1.00 88.00  ? 90  GLU B CD  1 
ATOM   2539 O  OE1 . GLU B 1 91  ? 12.327  10.727  -2.860  1.00 90.38  ? 90  GLU B OE1 1 
ATOM   2540 O  OE2 . GLU B 1 91  ? 14.088  11.249  -1.660  1.00 88.57  ? 90  GLU B OE2 1 
ATOM   2541 N  N   . GLU B 1 92  ? 10.366  13.748  0.924   1.00 70.23  ? 91  GLU B N   1 
ATOM   2542 C  CA  . GLU B 1 92  ? 10.788  14.195  2.248   1.00 66.83  ? 91  GLU B CA  1 
ATOM   2543 C  C   . GLU B 1 92  ? 10.322  13.269  3.366   1.00 61.60  ? 91  GLU B C   1 
ATOM   2544 O  O   . GLU B 1 92  ? 11.007  13.132  4.379   1.00 60.43  ? 91  GLU B O   1 
ATOM   2545 C  CB  . GLU B 1 92  ? 10.332  15.636  2.515   1.00 67.88  ? 91  GLU B CB  1 
ATOM   2546 C  CG  . GLU B 1 92  ? 11.442  16.691  2.354   1.00 71.31  ? 91  GLU B CG  1 
ATOM   2547 C  CD  . GLU B 1 92  ? 12.540  16.597  3.423   1.00 72.78  ? 91  GLU B CD  1 
ATOM   2548 O  OE1 . GLU B 1 92  ? 12.208  16.478  4.624   1.00 72.33  ? 91  GLU B OE1 1 
ATOM   2549 O  OE2 . GLU B 1 92  ? 13.738  16.658  3.065   1.00 72.89  ? 91  GLU B OE2 1 
ATOM   2550 N  N   . GLU B 1 93  ? 9.160   12.649  3.189   1.00 56.92  ? 92  GLU B N   1 
ATOM   2551 C  CA  . GLU B 1 93  ? 8.634   11.735  4.193   1.00 54.82  ? 92  GLU B CA  1 
ATOM   2552 C  C   . GLU B 1 93  ? 9.537   10.523  4.326   1.00 53.31  ? 92  GLU B C   1 
ATOM   2553 O  O   . GLU B 1 93  ? 9.883   10.118  5.431   1.00 56.69  ? 92  GLU B O   1 
ATOM   2554 C  CB  . GLU B 1 93  ? 7.207   11.275  3.851   1.00 57.92  ? 92  GLU B CB  1 
ATOM   2555 C  CG  . GLU B 1 93  ? 6.080   12.235  4.285   1.00 65.06  ? 92  GLU B CG  1 
ATOM   2556 C  CD  . GLU B 1 93  ? 4.678   11.626  4.142   1.00 70.13  ? 92  GLU B CD  1 
ATOM   2557 O  OE1 . GLU B 1 93  ? 3.911   11.625  5.134   1.00 73.30  ? 92  GLU B OE1 1 
ATOM   2558 O  OE2 . GLU B 1 93  ? 4.341   11.150  3.036   1.00 71.94  ? 92  GLU B OE2 1 
ATOM   2559 N  N   . LYS B 1 94  ? 9.910   9.934   3.200   1.00 50.40  ? 93  LYS B N   1 
ATOM   2560 C  CA  . LYS B 1 94  ? 10.769  8.757   3.205   1.00 46.97  ? 93  LYS B CA  1 
ATOM   2561 C  C   . LYS B 1 94  ? 12.157  9.048   3.781   1.00 43.04  ? 93  LYS B C   1 
ATOM   2562 O  O   . LYS B 1 94  ? 12.771  8.191   4.426   1.00 39.94  ? 93  LYS B O   1 
ATOM   2563 C  CB  . LYS B 1 94  ? 10.866  8.192   1.792   1.00 50.48  ? 93  LYS B CB  1 
ATOM   2564 C  CG  . LYS B 1 94  ? 9.516   7.767   1.239   1.00 59.38  ? 93  LYS B CG  1 
ATOM   2565 C  CD  . LYS B 1 94  ? 9.626   7.177   -0.149  1.00 65.17  ? 93  LYS B CD  1 
ATOM   2566 C  CE  . LYS B 1 94  ? 8.288   6.610   -0.589  1.00 71.82  ? 93  LYS B CE  1 
ATOM   2567 N  NZ  . LYS B 1 94  ? 8.367   5.961   -1.928  1.00 78.87  ? 93  LYS B NZ  1 
ATOM   2568 N  N   . ILE B 1 95  ? 12.659  10.249  3.522   1.00 38.37  ? 94  ILE B N   1 
ATOM   2569 C  CA  . ILE B 1 95  ? 13.957  10.649  4.024   1.00 37.51  ? 94  ILE B CA  1 
ATOM   2570 C  C   . ILE B 1 95  ? 13.903  10.632  5.542   1.00 35.88  ? 94  ILE B C   1 
ATOM   2571 O  O   . ILE B 1 95  ? 14.715  9.969   6.193   1.00 35.58  ? 94  ILE B O   1 
ATOM   2572 C  CB  . ILE B 1 95  ? 14.327  12.067  3.547   1.00 41.03  ? 94  ILE B CB  1 
ATOM   2573 C  CG1 . ILE B 1 95  ? 14.462  12.079  2.025   1.00 45.20  ? 94  ILE B CG1 1 
ATOM   2574 C  CG2 . ILE B 1 95  ? 15.621  12.532  4.200   1.00 39.72  ? 94  ILE B CG2 1 
ATOM   2575 C  CD1 . ILE B 1 95  ? 14.770  13.440  1.441   1.00 41.87  ? 94  ILE B CD1 1 
ATOM   2576 N  N   . ARG B 1 96  ? 12.939  11.368  6.093   1.00 33.79  ? 95  ARG B N   1 
ATOM   2577 C  CA  . ARG B 1 96  ? 12.755  11.467  7.535   1.00 34.66  ? 95  ARG B CA  1 
ATOM   2578 C  C   . ARG B 1 96  ? 12.593  10.089  8.163   1.00 36.39  ? 95  ARG B C   1 
ATOM   2579 O  O   . ARG B 1 96  ? 13.143  9.810   9.230   1.00 35.26  ? 95  ARG B O   1 
ATOM   2580 C  CB  . ARG B 1 96  ? 11.550  12.348  7.859   1.00 33.00  ? 95  ARG B CB  1 
ATOM   2581 C  CG  . ARG B 1 96  ? 11.680  13.774  7.337   1.00 36.25  ? 95  ARG B CG  1 
ATOM   2582 C  CD  . ARG B 1 96  ? 10.442  14.594  7.632   1.00 33.58  ? 95  ARG B CD  1 
ATOM   2583 N  NE  . ARG B 1 96  ? 10.295  14.869  9.053   1.00 38.55  ? 95  ARG B NE  1 
ATOM   2584 C  CZ  . ARG B 1 96  ? 10.670  16.005  9.634   1.00 41.70  ? 95  ARG B CZ  1 
ATOM   2585 N  NH1 . ARG B 1 96  ? 11.222  16.971  8.908   1.00 39.99  ? 95  ARG B NH1 1 
ATOM   2586 N  NH2 . ARG B 1 96  ? 10.477  16.188  10.936  1.00 41.65  ? 95  ARG B NH2 1 
ATOM   2587 N  N   . VAL B 1 97  ? 11.837  9.228   7.499   1.00 36.53  ? 96  VAL B N   1 
ATOM   2588 C  CA  . VAL B 1 97  ? 11.617  7.879   7.993   1.00 34.75  ? 96  VAL B CA  1 
ATOM   2589 C  C   . VAL B 1 97  ? 12.941  7.140   8.070   1.00 35.68  ? 96  VAL B C   1 
ATOM   2590 O  O   . VAL B 1 97  ? 13.255  6.521   9.086   1.00 34.54  ? 96  VAL B O   1 
ATOM   2591 C  CB  . VAL B 1 97  ? 10.619  7.101   7.089   1.00 30.30  ? 96  VAL B CB  1 
ATOM   2592 C  CG1 . VAL B 1 97  ? 10.596  5.611   7.444   1.00 33.06  ? 96  VAL B CG1 1 
ATOM   2593 C  CG2 . VAL B 1 97  ? 9.214   7.691   7.243   1.00 25.25  ? 96  VAL B CG2 1 
ATOM   2594 N  N   . ASP B 1 98  ? 13.714  7.202   6.991   1.00 35.25  ? 97  ASP B N   1 
ATOM   2595 C  CA  . ASP B 1 98  ? 15.001  6.524   6.955   1.00 39.85  ? 97  ASP B CA  1 
ATOM   2596 C  C   . ASP B 1 98  ? 15.929  7.018   8.056   1.00 39.77  ? 97  ASP B C   1 
ATOM   2597 O  O   . ASP B 1 98  ? 16.523  6.220   8.770   1.00 42.74  ? 97  ASP B O   1 
ATOM   2598 C  CB  . ASP B 1 98  ? 15.656  6.690   5.583   1.00 39.81  ? 97  ASP B CB  1 
ATOM   2599 C  CG  . ASP B 1 98  ? 14.916  5.943   4.471   1.00 43.28  ? 97  ASP B CG  1 
ATOM   2600 O  OD1 . ASP B 1 98  ? 14.308  4.874   4.732   1.00 48.03  ? 97  ASP B OD1 1 
ATOM   2601 O  OD2 . ASP B 1 98  ? 14.954  6.435   3.329   1.00 43.75  ? 97  ASP B OD2 1 
ATOM   2602 N  N   . ILE B 1 99  ? 16.050  8.331   8.198   1.00 37.64  ? 98  ILE B N   1 
ATOM   2603 C  CA  . ILE B 1 99  ? 16.913  8.905   9.225   1.00 33.43  ? 98  ILE B CA  1 
ATOM   2604 C  C   . ILE B 1 99  ? 16.513  8.437   10.632  1.00 32.48  ? 98  ILE B C   1 
ATOM   2605 O  O   . ILE B 1 99  ? 17.350  7.925   11.379  1.00 30.78  ? 98  ILE B O   1 
ATOM   2606 C  CB  . ILE B 1 99  ? 16.891  10.454  9.172   1.00 32.31  ? 98  ILE B CB  1 
ATOM   2607 C  CG1 . ILE B 1 99  ? 17.433  10.942  7.825   1.00 32.19  ? 98  ILE B CG1 1 
ATOM   2608 C  CG2 . ILE B 1 99  ? 17.721  11.048  10.297  1.00 29.71  ? 98  ILE B CG2 1 
ATOM   2609 C  CD1 . ILE B 1 99  ? 17.513  12.453  7.699   1.00 26.92  ? 98  ILE B CD1 1 
ATOM   2610 N  N   . LEU B 1 100 ? 15.247  8.643   10.996  1.00 29.85  ? 99  LEU B N   1 
ATOM   2611 C  CA  . LEU B 1 100 ? 14.745  8.241   12.308  1.00 29.30  ? 99  LEU B CA  1 
ATOM   2612 C  C   . LEU B 1 100 ? 14.822  6.740   12.551  1.00 31.17  ? 99  LEU B C   1 
ATOM   2613 O  O   . LEU B 1 100 ? 15.170  6.301   13.645  1.00 32.84  ? 99  LEU B O   1 
ATOM   2614 C  CB  . LEU B 1 100 ? 13.308  8.726   12.501  1.00 28.16  ? 99  LEU B CB  1 
ATOM   2615 C  CG  . LEU B 1 100 ? 13.169  10.243  12.677  1.00 30.70  ? 99  LEU B CG  1 
ATOM   2616 C  CD1 . LEU B 1 100 ? 11.713  10.611  12.819  1.00 28.93  ? 99  LEU B CD1 1 
ATOM   2617 C  CD2 . LEU B 1 100 ? 13.944  10.695  13.904  1.00 29.50  ? 99  LEU B CD2 1 
ATOM   2618 N  N   . GLU B 1 101 ? 14.456  5.962   11.543  1.00 31.76  ? 100 GLU B N   1 
ATOM   2619 C  CA  . GLU B 1 101 ? 14.488  4.504   11.612  1.00 33.56  ? 100 GLU B CA  1 
ATOM   2620 C  C   . GLU B 1 101 ? 15.819  4.015   12.193  1.00 35.50  ? 100 GLU B C   1 
ATOM   2621 O  O   . GLU B 1 101 ? 15.864  3.063   12.978  1.00 38.94  ? 100 GLU B O   1 
ATOM   2622 C  CB  . GLU B 1 101 ? 14.294  3.952   10.195  1.00 38.59  ? 100 GLU B CB  1 
ATOM   2623 C  CG  . GLU B 1 101 ? 14.400  2.445   10.037  1.00 45.23  ? 100 GLU B CG  1 
ATOM   2624 C  CD  . GLU B 1 101 ? 14.179  1.987   8.601   1.00 50.43  ? 100 GLU B CD  1 
ATOM   2625 O  OE1 . GLU B 1 101 ? 14.336  2.815   7.675   1.00 56.55  ? 100 GLU B OE1 1 
ATOM   2626 O  OE2 . GLU B 1 101 ? 13.852  0.798   8.391   1.00 56.06  ? 100 GLU B OE2 1 
ATOM   2627 N  N   . ASN B 1 102 ? 16.897  4.697   11.819  1.00 29.80  ? 101 ASN B N   1 
ATOM   2628 C  CA  . ASN B 1 102 ? 18.231  4.347   12.272  1.00 30.42  ? 101 ASN B CA  1 
ATOM   2629 C  C   . ASN B 1 102 ? 18.658  5.132   13.505  1.00 33.53  ? 101 ASN B C   1 
ATOM   2630 O  O   . ASN B 1 102 ? 19.372  4.606   14.363  1.00 38.43  ? 101 ASN B O   1 
ATOM   2631 C  CB  . ASN B 1 102 ? 19.236  4.582   11.147  1.00 30.41  ? 101 ASN B CB  1 
ATOM   2632 C  CG  . ASN B 1 102 ? 19.076  3.598   10.009  1.00 31.46  ? 101 ASN B CG  1 
ATOM   2633 O  OD1 . ASN B 1 102 ? 19.234  2.395   10.189  1.00 36.40  ? 101 ASN B OD1 1 
ATOM   2634 N  ND2 . ASN B 1 102 ? 18.773  4.108   8.822   1.00 36.25  ? 101 ASN B ND2 1 
ATOM   2635 N  N   . GLN B 1 103 ? 18.265  6.400   13.576  1.00 31.44  ? 102 GLN B N   1 
ATOM   2636 C  CA  . GLN B 1 103 ? 18.620  7.256   14.704  1.00 25.91  ? 102 GLN B CA  1 
ATOM   2637 C  C   . GLN B 1 103 ? 18.138  6.672   16.014  1.00 26.77  ? 102 GLN B C   1 
ATOM   2638 O  O   . GLN B 1 103 ? 18.880  6.591   16.994  1.00 22.52  ? 102 GLN B O   1 
ATOM   2639 C  CB  . GLN B 1 103 ? 18.002  8.635   14.541  1.00 26.24  ? 102 GLN B CB  1 
ATOM   2640 C  CG  . GLN B 1 103 ? 18.424  9.603   15.617  1.00 25.87  ? 102 GLN B CG  1 
ATOM   2641 C  CD  . GLN B 1 103 ? 19.891  9.984   15.519  1.00 29.38  ? 102 GLN B CD  1 
ATOM   2642 O  OE1 . GLN B 1 103 ? 20.552  9.714   14.518  1.00 32.23  ? 102 GLN B OE1 1 
ATOM   2643 N  NE2 . GLN B 1 103 ? 20.395  10.659  16.543  1.00 34.68  ? 102 GLN B NE2 1 
ATOM   2644 N  N   . THR B 1 104 ? 16.866  6.309   16.030  1.00 28.19  ? 103 THR B N   1 
ATOM   2645 C  CA  . THR B 1 104 ? 16.251  5.728   17.208  1.00 29.78  ? 103 THR B CA  1 
ATOM   2646 C  C   . THR B 1 104 ? 16.996  4.460   17.628  1.00 30.75  ? 103 THR B C   1 
ATOM   2647 O  O   . THR B 1 104 ? 17.268  4.242   18.809  1.00 33.48  ? 103 THR B O   1 
ATOM   2648 C  CB  . THR B 1 104 ? 14.752  5.428   16.949  1.00 31.53  ? 103 THR B CB  1 
ATOM   2649 O  OG1 . THR B 1 104 ? 14.609  4.479   15.875  1.00 22.99  ? 103 THR B OG1 1 
ATOM   2650 C  CG2 . THR B 1 104 ? 14.018  6.727   16.593  1.00 27.88  ? 103 THR B CG2 1 
ATOM   2651 N  N   . MET B 1 105 ? 17.331  3.628   16.652  1.00 29.96  ? 104 MET B N   1 
ATOM   2652 C  CA  . MET B 1 105 ? 18.052  2.390   16.899  1.00 36.30  ? 104 MET B CA  1 
ATOM   2653 C  C   . MET B 1 105 ? 19.363  2.695   17.617  1.00 33.30  ? 104 MET B C   1 
ATOM   2654 O  O   . MET B 1 105 ? 19.778  1.952   18.507  1.00 34.45  ? 104 MET B O   1 
ATOM   2655 C  CB  . MET B 1 105 ? 18.335  1.669   15.576  1.00 44.63  ? 104 MET B CB  1 
ATOM   2656 C  CG  . MET B 1 105 ? 19.103  0.367   15.719  1.00 50.84  ? 104 MET B CG  1 
ATOM   2657 S  SD  . MET B 1 105 ? 18.241  -0.895  16.679  1.00 52.33  ? 104 MET B SD  1 
ATOM   2658 C  CE  . MET B 1 105 ? 17.685  -1.946  15.359  1.00 56.04  ? 104 MET B CE  1 
ATOM   2659 N  N   . ASP B 1 106 ? 20.005  3.791   17.226  1.00 32.96  ? 105 ASP B N   1 
ATOM   2660 C  CA  . ASP B 1 106 ? 21.267  4.209   17.831  1.00 31.33  ? 105 ASP B CA  1 
ATOM   2661 C  C   . ASP B 1 106 ? 21.055  4.618   19.270  1.00 33.22  ? 105 ASP B C   1 
ATOM   2662 O  O   . ASP B 1 106 ? 21.693  4.074   20.175  1.00 34.53  ? 105 ASP B O   1 
ATOM   2663 C  CB  . ASP B 1 106 ? 21.899  5.381   17.060  1.00 27.76  ? 105 ASP B CB  1 
ATOM   2664 C  CG  . ASP B 1 106 ? 22.523  4.954   15.726  1.00 30.26  ? 105 ASP B CG  1 
ATOM   2665 O  OD1 . ASP B 1 106 ? 22.603  3.740   15.427  1.00 42.97  ? 105 ASP B OD1 1 
ATOM   2666 O  OD2 . ASP B 1 106 ? 22.947  5.850   14.969  1.00 30.55  ? 105 ASP B OD2 1 
ATOM   2667 N  N   . ASN B 1 107 ? 20.159  5.582   19.468  1.00 34.30  ? 106 ASN B N   1 
ATOM   2668 C  CA  . ASN B 1 107 ? 19.837  6.080   20.798  1.00 36.95  ? 106 ASN B CA  1 
ATOM   2669 C  C   . ASN B 1 107 ? 19.379  4.950   21.712  1.00 38.52  ? 106 ASN B C   1 
ATOM   2670 O  O   . ASN B 1 107 ? 19.672  4.952   22.912  1.00 42.69  ? 106 ASN B O   1 
ATOM   2671 C  CB  . ASN B 1 107 ? 18.765  7.164   20.719  1.00 32.98  ? 106 ASN B CB  1 
ATOM   2672 C  CG  . ASN B 1 107 ? 19.294  8.471   20.169  1.00 34.54  ? 106 ASN B CG  1 
ATOM   2673 O  OD1 . ASN B 1 107 ? 18.596  9.187   19.456  1.00 40.50  ? 106 ASN B OD1 1 
ATOM   2674 N  ND2 . ASN B 1 107 ? 20.527  8.811   20.530  1.00 32.18  ? 106 ASN B ND2 1 
ATOM   2675 N  N   . HIS B 1 108 ? 18.666  3.983   21.145  1.00 37.44  ? 107 HIS B N   1 
ATOM   2676 C  CA  . HIS B 1 108 ? 18.178  2.854   21.916  1.00 36.99  ? 107 HIS B CA  1 
ATOM   2677 C  C   . HIS B 1 108 ? 19.366  2.035   22.404  1.00 39.25  ? 107 HIS B C   1 
ATOM   2678 O  O   . HIS B 1 108 ? 19.446  1.682   23.578  1.00 39.27  ? 107 HIS B O   1 
ATOM   2679 C  CB  . HIS B 1 108 ? 17.221  2.001   21.076  1.00 37.43  ? 107 HIS B CB  1 
ATOM   2680 C  CG  . HIS B 1 108 ? 16.640  0.826   21.811  1.00 39.94  ? 107 HIS B CG  1 
ATOM   2681 N  ND1 . HIS B 1 108 ? 15.380  0.846   22.375  1.00 39.27  ? 107 HIS B ND1 1 
ATOM   2682 C  CD2 . HIS B 1 108 ? 17.140  -0.405  22.056  1.00 37.60  ? 107 HIS B CD2 1 
ATOM   2683 C  CE1 . HIS B 1 108 ? 15.131  -0.324  22.932  1.00 37.28  ? 107 HIS B CE1 1 
ATOM   2684 N  NE2 . HIS B 1 108 ? 16.184  -1.103  22.755  1.00 35.34  ? 107 HIS B NE2 1 
ATOM   2685 N  N   . MET B 1 109 ? 20.309  1.752   21.522  1.00 40.69  ? 108 MET B N   1 
ATOM   2686 C  CA  . MET B 1 109 ? 21.477  0.993   21.938  1.00 45.52  ? 108 MET B CA  1 
ATOM   2687 C  C   . MET B 1 109 ? 22.305  1.733   22.977  1.00 43.80  ? 108 MET B C   1 
ATOM   2688 O  O   . MET B 1 109 ? 22.782  1.138   23.935  1.00 45.31  ? 108 MET B O   1 
ATOM   2689 C  CB  . MET B 1 109 ? 22.307  0.661   20.727  1.00 51.11  ? 108 MET B CB  1 
ATOM   2690 C  CG  . MET B 1 109 ? 21.790  -0.513  19.930  1.00 58.53  ? 108 MET B CG  1 
ATOM   2691 S  SD  . MET B 1 109 ? 23.109  -1.264  18.961  1.00 66.29  ? 108 MET B SD  1 
ATOM   2692 C  CE  . MET B 1 109 ? 23.855  0.164   18.145  1.00 59.04  ? 108 MET B CE  1 
ATOM   2693 N  N   . GLN B 1 110 ? 22.483  3.030   22.768  1.00 42.84  ? 109 GLN B N   1 
ATOM   2694 C  CA  . GLN B 1 110 ? 23.233  3.863   23.688  1.00 40.40  ? 109 GLN B CA  1 
ATOM   2695 C  C   . GLN B 1 110 ? 22.735  3.626   25.091  1.00 39.41  ? 109 GLN B C   1 
ATOM   2696 O  O   . GLN B 1 110 ? 23.517  3.544   26.036  1.00 41.63  ? 109 GLN B O   1 
ATOM   2697 C  CB  . GLN B 1 110 ? 23.039  5.325   23.334  1.00 41.90  ? 109 GLN B CB  1 
ATOM   2698 C  CG  . GLN B 1 110 ? 23.467  5.653   21.932  1.00 43.97  ? 109 GLN B CG  1 
ATOM   2699 C  CD  . GLN B 1 110 ? 23.295  7.111   21.593  1.00 43.47  ? 109 GLN B CD  1 
ATOM   2700 O  OE1 . GLN B 1 110 ? 22.692  7.872   22.342  1.00 50.61  ? 109 GLN B OE1 1 
ATOM   2701 N  NE2 . GLN B 1 110 ? 23.858  7.517   20.468  1.00 47.26  ? 109 GLN B NE2 1 
ATOM   2702 N  N   . LEU B 1 111 ? 21.421  3.567   25.222  1.00 37.71  ? 110 LEU B N   1 
ATOM   2703 C  CA  . LEU B 1 111 ? 20.793  3.323   26.501  1.00 40.32  ? 110 LEU B CA  1 
ATOM   2704 C  C   . LEU B 1 111 ? 21.089  1.884   26.902  1.00 42.50  ? 110 LEU B C   1 
ATOM   2705 O  O   . LEU B 1 111 ? 21.621  1.625   27.980  1.00 42.69  ? 110 LEU B O   1 
ATOM   2706 C  CB  . LEU B 1 111 ? 19.285  3.524   26.377  1.00 37.42  ? 110 LEU B CB  1 
ATOM   2707 C  CG  . LEU B 1 111 ? 18.443  3.380   27.650  1.00 42.63  ? 110 LEU B CG  1 
ATOM   2708 C  CD1 . LEU B 1 111 ? 18.873  4.415   28.684  1.00 44.63  ? 110 LEU B CD1 1 
ATOM   2709 C  CD2 . LEU B 1 111 ? 16.969  3.543   27.321  1.00 42.42  ? 110 LEU B CD2 1 
ATOM   2710 N  N   . GLY B 1 112 ? 20.743  0.952   26.021  1.00 46.52  ? 111 GLY B N   1 
ATOM   2711 C  CA  . GLY B 1 112 ? 20.959  -0.457  26.293  1.00 50.78  ? 111 GLY B CA  1 
ATOM   2712 C  C   . GLY B 1 112 ? 22.383  -0.842  26.627  1.00 53.26  ? 111 GLY B C   1 
ATOM   2713 O  O   . GLY B 1 112 ? 22.610  -1.794  27.371  1.00 50.97  ? 111 GLY B O   1 
ATOM   2714 N  N   . MET B 1 113 ? 23.341  -0.123  26.058  1.00 56.49  ? 112 MET B N   1 
ATOM   2715 C  CA  . MET B 1 113 ? 24.751  -0.397  26.290  1.00 63.31  ? 112 MET B CA  1 
ATOM   2716 C  C   . MET B 1 113 ? 25.174  -0.210  27.735  1.00 65.19  ? 112 MET B C   1 
ATOM   2717 O  O   . MET B 1 113 ? 25.838  -1.080  28.305  1.00 66.59  ? 112 MET B O   1 
ATOM   2718 C  CB  . MET B 1 113 ? 25.626  0.469   25.386  1.00 66.49  ? 112 MET B CB  1 
ATOM   2719 C  CG  . MET B 1 113 ? 25.846  -0.121  24.010  1.00 72.94  ? 112 MET B CG  1 
ATOM   2720 S  SD  . MET B 1 113 ? 26.987  0.872   23.044  1.00 82.14  ? 112 MET B SD  1 
ATOM   2721 C  CE  . MET B 1 113 ? 25.884  1.691   21.895  1.00 80.77  ? 112 MET B CE  1 
ATOM   2722 N  N   . ILE B 1 114 ? 24.832  0.943   28.305  1.00 64.89  ? 113 ILE B N   1 
ATOM   2723 C  CA  . ILE B 1 114 ? 25.186  1.245   29.688  1.00 64.00  ? 113 ILE B CA  1 
ATOM   2724 C  C   . ILE B 1 114 ? 24.344  0.465   30.693  1.00 62.81  ? 113 ILE B C   1 
ATOM   2725 O  O   . ILE B 1 114 ? 24.791  0.201   31.806  1.00 65.94  ? 113 ILE B O   1 
ATOM   2726 C  CB  . ILE B 1 114 ? 25.079  2.754   30.006  1.00 63.99  ? 113 ILE B CB  1 
ATOM   2727 C  CG1 . ILE B 1 114 ? 23.617  3.184   30.074  1.00 63.78  ? 113 ILE B CG1 1 
ATOM   2728 C  CG2 . ILE B 1 114 ? 25.821  3.561   28.956  1.00 66.03  ? 113 ILE B CG2 1 
ATOM   2729 C  CD1 . ILE B 1 114 ? 23.425  4.530   30.702  1.00 68.85  ? 113 ILE B CD1 1 
ATOM   2730 N  N   . CYS B 1 115 ? 23.113  0.137   30.320  1.00 60.06  ? 114 CYS B N   1 
ATOM   2731 C  CA  . CYS B 1 115 ? 22.241  -0.614  31.211  1.00 62.14  ? 114 CYS B CA  1 
ATOM   2732 C  C   . CYS B 1 115 ? 22.670  -2.069  31.324  1.00 63.73  ? 114 CYS B C   1 
ATOM   2733 O  O   . CYS B 1 115 ? 22.306  -2.759  32.278  1.00 64.15  ? 114 CYS B O   1 
ATOM   2734 C  CB  . CYS B 1 115 ? 20.788  -0.516  30.751  1.00 61.72  ? 114 CYS B CB  1 
ATOM   2735 S  SG  . CYS B 1 115 ? 20.085  1.134   30.998  1.00 58.02  ? 114 CYS B SG  1 
ATOM   2736 N  N   . TYR B 1 116 ? 23.406  -2.541  30.324  1.00 63.62  ? 115 TYR B N   1 
ATOM   2737 C  CA  . TYR B 1 116 ? 23.907  -3.909  30.308  1.00 66.47  ? 115 TYR B CA  1 
ATOM   2738 C  C   . TYR B 1 116 ? 25.338  -3.937  30.839  1.00 70.30  ? 115 TYR B C   1 
ATOM   2739 O  O   . TYR B 1 116 ? 25.875  -5.001  31.179  1.00 72.93  ? 115 TYR B O   1 
ATOM   2740 C  CB  . TYR B 1 116 ? 23.864  -4.469  28.886  1.00 68.23  ? 115 TYR B CB  1 
ATOM   2741 C  CG  . TYR B 1 116 ? 22.557  -5.141  28.538  1.00 68.69  ? 115 TYR B CG  1 
ATOM   2742 C  CD1 . TYR B 1 116 ? 22.316  -6.453  28.927  1.00 68.76  ? 115 TYR B CD1 1 
ATOM   2743 C  CD2 . TYR B 1 116 ? 21.554  -4.460  27.844  1.00 67.68  ? 115 TYR B CD2 1 
ATOM   2744 C  CE1 . TYR B 1 116 ? 21.112  -7.074  28.647  1.00 67.30  ? 115 TYR B CE1 1 
ATOM   2745 C  CE2 . TYR B 1 116 ? 20.341  -5.072  27.555  1.00 68.07  ? 115 TYR B CE2 1 
ATOM   2746 C  CZ  . TYR B 1 116 ? 20.131  -6.381  27.969  1.00 68.55  ? 115 TYR B CZ  1 
ATOM   2747 O  OH  . TYR B 1 116 ? 18.923  -6.990  27.776  1.00 72.20  ? 115 TYR B OH  1 
ATOM   2748 N  N   . ASN B 1 117 ? 25.945  -2.758  30.918  1.00 71.70  ? 116 ASN B N   1 
ATOM   2749 C  CA  . ASN B 1 117 ? 27.307  -2.619  31.407  1.00 74.70  ? 116 ASN B CA  1 
ATOM   2750 C  C   . ASN B 1 117 ? 27.315  -2.790  32.927  1.00 77.80  ? 116 ASN B C   1 
ATOM   2751 O  O   . ASN B 1 117 ? 26.596  -2.082  33.633  1.00 75.78  ? 116 ASN B O   1 
ATOM   2752 C  CB  . ASN B 1 117 ? 27.850  -1.239  31.029  1.00 73.26  ? 116 ASN B CB  1 
ATOM   2753 C  CG  . ASN B 1 117 ? 29.357  -1.134  31.196  1.00 73.79  ? 116 ASN B CG  1 
ATOM   2754 O  OD1 . ASN B 1 117 ? 29.985  -1.943  31.882  1.00 73.75  ? 116 ASN B OD1 1 
ATOM   2755 N  ND2 . ASN B 1 117 ? 29.947  -0.134  30.557  1.00 72.28  ? 116 ASN B ND2 1 
ATOM   2756 N  N   . PRO B 1 118 ? 28.095  -3.764  33.445  1.00 81.52  ? 117 PRO B N   1 
ATOM   2757 C  CA  . PRO B 1 118 ? 28.205  -4.044  34.882  1.00 83.03  ? 117 PRO B CA  1 
ATOM   2758 C  C   . PRO B 1 118 ? 28.495  -2.813  35.743  1.00 84.24  ? 117 PRO B C   1 
ATOM   2759 O  O   . PRO B 1 118 ? 28.086  -2.754  36.908  1.00 84.44  ? 117 PRO B O   1 
ATOM   2760 C  CB  . PRO B 1 118 ? 29.345  -5.054  34.938  1.00 83.07  ? 117 PRO B CB  1 
ATOM   2761 C  CG  . PRO B 1 118 ? 29.121  -5.843  33.693  1.00 83.57  ? 117 PRO B CG  1 
ATOM   2762 C  CD  . PRO B 1 118 ? 28.869  -4.752  32.670  1.00 82.33  ? 117 PRO B CD  1 
ATOM   2763 N  N   . GLU B 1 119 ? 29.210  -1.845  35.177  1.00 85.98  ? 118 GLU B N   1 
ATOM   2764 C  CA  . GLU B 1 119 ? 29.545  -0.613  35.889  1.00 89.03  ? 118 GLU B CA  1 
ATOM   2765 C  C   . GLU B 1 119 ? 28.536  0.503   35.607  1.00 88.63  ? 118 GLU B C   1 
ATOM   2766 O  O   . GLU B 1 119 ? 28.873  1.687   35.655  1.00 87.48  ? 118 GLU B O   1 
ATOM   2767 C  CB  . GLU B 1 119 ? 30.954  -0.167  35.510  1.00 91.75  ? 118 GLU B CB  1 
ATOM   2768 C  CG  . GLU B 1 119 ? 32.019  -1.161  35.927  1.00 97.80  ? 118 GLU B CG  1 
ATOM   2769 C  CD  . GLU B 1 119 ? 33.314  -0.962  35.179  1.00 100.00 ? 118 GLU B CD  1 
ATOM   2770 O  OE1 . GLU B 1 119 ? 33.599  -1.772  34.270  1.00 100.00 ? 118 GLU B OE1 1 
ATOM   2771 O  OE2 . GLU B 1 119 ? 34.045  0.000   35.497  1.00 100.00 ? 118 GLU B OE2 1 
ATOM   2772 N  N   . PHE B 1 120 ? 27.291  0.098   35.362  1.00 88.62  ? 119 PHE B N   1 
ATOM   2773 C  CA  . PHE B 1 120 ? 26.181  1.002   35.063  1.00 87.93  ? 119 PHE B CA  1 
ATOM   2774 C  C   . PHE B 1 120 ? 26.108  2.235   35.957  1.00 87.47  ? 119 PHE B C   1 
ATOM   2775 O  O   . PHE B 1 120 ? 25.958  3.354   35.466  1.00 86.81  ? 119 PHE B O   1 
ATOM   2776 C  CB  . PHE B 1 120 ? 24.852  0.224   35.127  1.00 87.57  ? 119 PHE B CB  1 
ATOM   2777 C  CG  . PHE B 1 120 ? 23.618  1.098   35.173  1.00 87.96  ? 119 PHE B CG  1 
ATOM   2778 C  CD1 . PHE B 1 120 ? 23.085  1.643   34.009  1.00 87.17  ? 119 PHE B CD1 1 
ATOM   2779 C  CD2 . PHE B 1 120 ? 22.992  1.375   36.390  1.00 88.13  ? 119 PHE B CD2 1 
ATOM   2780 C  CE1 . PHE B 1 120 ? 21.949  2.451   34.058  1.00 87.18  ? 119 PHE B CE1 1 
ATOM   2781 C  CE2 . PHE B 1 120 ? 21.858  2.182   36.446  1.00 87.53  ? 119 PHE B CE2 1 
ATOM   2782 C  CZ  . PHE B 1 120 ? 21.336  2.721   35.280  1.00 87.22  ? 119 PHE B CZ  1 
ATOM   2783 N  N   . GLU B 1 121 ? 26.202  2.029   37.266  1.00 88.49  ? 120 GLU B N   1 
ATOM   2784 C  CA  . GLU B 1 121 ? 26.108  3.130   38.214  1.00 88.13  ? 120 GLU B CA  1 
ATOM   2785 C  C   . GLU B 1 121 ? 27.141  4.237   38.000  1.00 86.85  ? 120 GLU B C   1 
ATOM   2786 O  O   . GLU B 1 121 ? 26.880  5.404   38.304  1.00 85.40  ? 120 GLU B O   1 
ATOM   2787 C  CB  . GLU B 1 121 ? 26.183  2.597   39.646  1.00 88.11  ? 120 GLU B CB  1 
ATOM   2788 C  CG  . GLU B 1 121 ? 25.296  3.351   40.638  1.00 88.90  ? 120 GLU B CG  1 
ATOM   2789 C  CD  . GLU B 1 121 ? 23.806  3.216   40.337  1.00 89.98  ? 120 GLU B CD  1 
ATOM   2790 O  OE1 . GLU B 1 121 ? 23.318  2.071   40.192  1.00 88.23  ? 120 GLU B OE1 1 
ATOM   2791 O  OE2 . GLU B 1 121 ? 23.120  4.259   40.261  1.00 89.65  ? 120 GLU B OE2 1 
ATOM   2792 N  N   . LYS B 1 122 ? 28.307  3.866   37.480  1.00 86.89  ? 121 LYS B N   1 
ATOM   2793 C  CA  . LYS B 1 122 ? 29.382  4.821   37.231  1.00 88.37  ? 121 LYS B CA  1 
ATOM   2794 C  C   . LYS B 1 122 ? 29.191  5.641   35.945  1.00 87.51  ? 121 LYS B C   1 
ATOM   2795 O  O   . LYS B 1 122 ? 29.488  6.844   35.912  1.00 85.21  ? 121 LYS B O   1 
ATOM   2796 C  CB  . LYS B 1 122 ? 30.726  4.085   37.194  1.00 90.63  ? 121 LYS B CB  1 
ATOM   2797 C  CG  . LYS B 1 122 ? 31.940  5.003   37.117  1.00 96.15  ? 121 LYS B CG  1 
ATOM   2798 C  CD  . LYS B 1 122 ? 33.255  4.224   37.101  1.00 97.83  ? 121 LYS B CD  1 
ATOM   2799 C  CE  . LYS B 1 122 ? 33.456  3.458   35.801  1.00 100.00 ? 121 LYS B CE  1 
ATOM   2800 N  NZ  . LYS B 1 122 ? 34.793  2.801   35.756  1.00 100.00 ? 121 LYS B NZ  1 
ATOM   2801 N  N   . LEU B 1 123 ? 28.719  4.980   34.888  1.00 87.48  ? 122 LEU B N   1 
ATOM   2802 C  CA  . LEU B 1 123 ? 28.491  5.613   33.581  1.00 86.41  ? 122 LEU B CA  1 
ATOM   2803 C  C   . LEU B 1 123 ? 27.267  6.531   33.520  1.00 84.69  ? 122 LEU B C   1 
ATOM   2804 O  O   . LEU B 1 123 ? 27.221  7.465   32.710  1.00 83.70  ? 122 LEU B O   1 
ATOM   2805 C  CB  . LEU B 1 123 ? 28.350  4.545   32.488  1.00 87.17  ? 122 LEU B CB  1 
ATOM   2806 C  CG  . LEU B 1 123 ? 29.568  3.775   31.967  1.00 86.73  ? 122 LEU B CG  1 
ATOM   2807 C  CD1 . LEU B 1 123 ? 30.256  2.988   33.072  1.00 88.39  ? 122 LEU B CD1 1 
ATOM   2808 C  CD2 . LEU B 1 123 ? 29.109  2.845   30.864  1.00 86.13  ? 122 LEU B CD2 1 
ATOM   2809 N  N   . LYS B 1 124 ? 26.277  6.238   34.362  1.00 81.51  ? 123 LYS B N   1 
ATOM   2810 C  CA  . LYS B 1 124 ? 25.021  6.987   34.434  1.00 78.84  ? 123 LYS B CA  1 
ATOM   2811 C  C   . LYS B 1 124 ? 25.141  8.519   34.471  1.00 77.41  ? 123 LYS B C   1 
ATOM   2812 O  O   . LYS B 1 124 ? 24.408  9.207   33.760  1.00 75.86  ? 123 LYS B O   1 
ATOM   2813 C  CB  . LYS B 1 124 ? 24.179  6.479   35.620  1.00 79.19  ? 123 LYS B CB  1 
ATOM   2814 C  CG  . LYS B 1 124 ? 22.732  6.975   35.671  1.00 80.30  ? 123 LYS B CG  1 
ATOM   2815 C  CD  . LYS B 1 124 ? 21.957  6.300   36.807  1.00 86.51  ? 123 LYS B CD  1 
ATOM   2816 C  CE  . LYS B 1 124 ? 20.477  6.682   36.801  1.00 90.36  ? 123 LYS B CE  1 
ATOM   2817 N  NZ  . LYS B 1 124 ? 19.695  6.011   37.884  1.00 93.00  ? 123 LYS B NZ  1 
ATOM   2818 N  N   . PRO B 1 125 ? 26.038  9.073   35.312  1.00 77.21  ? 124 PRO B N   1 
ATOM   2819 C  CA  . PRO B 1 125 ? 26.201  10.531  35.396  1.00 75.90  ? 124 PRO B CA  1 
ATOM   2820 C  C   . PRO B 1 125 ? 26.507  11.203  34.059  1.00 74.11  ? 124 PRO B C   1 
ATOM   2821 O  O   . PRO B 1 125 ? 26.020  12.299  33.775  1.00 74.51  ? 124 PRO B O   1 
ATOM   2822 C  CB  . PRO B 1 125 ? 27.373  10.679  36.365  1.00 76.15  ? 124 PRO B CB  1 
ATOM   2823 C  CG  . PRO B 1 125 ? 27.187  9.519   37.281  1.00 79.22  ? 124 PRO B CG  1 
ATOM   2824 C  CD  . PRO B 1 125 ? 26.887  8.403   36.316  1.00 78.17  ? 124 PRO B CD  1 
ATOM   2825 N  N   . LYS B 1 126 ? 27.364  10.565  33.274  1.00 72.90  ? 125 LYS B N   1 
ATOM   2826 C  CA  . LYS B 1 126 ? 27.748  11.092  31.977  1.00 72.61  ? 125 LYS B CA  1 
ATOM   2827 C  C   . LYS B 1 126 ? 26.603  11.008  30.975  1.00 71.53  ? 125 LYS B C   1 
ATOM   2828 O  O   . LYS B 1 126 ? 26.354  11.957  30.232  1.00 70.89  ? 125 LYS B O   1 
ATOM   2829 C  CB  . LYS B 1 126 ? 28.956  10.327  31.450  1.00 74.18  ? 125 LYS B CB  1 
ATOM   2830 C  CG  . LYS B 1 126 ? 29.430  10.794  30.097  1.00 77.00  ? 125 LYS B CG  1 
ATOM   2831 C  CD  . LYS B 1 126 ? 30.619  9.975   29.637  1.00 83.85  ? 125 LYS B CD  1 
ATOM   2832 C  CE  . LYS B 1 126 ? 31.037  10.345  28.217  1.00 86.44  ? 125 LYS B CE  1 
ATOM   2833 N  NZ  . LYS B 1 126 ? 29.973  10.029  27.213  1.00 89.29  ? 125 LYS B NZ  1 
ATOM   2834 N  N   . TYR B 1 127 ? 25.943  9.853   30.936  1.00 68.99  ? 126 TYR B N   1 
ATOM   2835 C  CA  . TYR B 1 127 ? 24.825  9.627   30.023  1.00 66.44  ? 126 TYR B CA  1 
ATOM   2836 C  C   . TYR B 1 127 ? 23.707  10.640  30.248  1.00 64.09  ? 126 TYR B C   1 
ATOM   2837 O  O   . TYR B 1 127 ? 23.087  11.105  29.290  1.00 65.95  ? 126 TYR B O   1 
ATOM   2838 C  CB  . TYR B 1 127 ? 24.285  8.202   30.183  1.00 67.62  ? 126 TYR B CB  1 
ATOM   2839 C  CG  . TYR B 1 127 ? 23.224  7.805   29.168  1.00 68.86  ? 126 TYR B CG  1 
ATOM   2840 C  CD1 . TYR B 1 127 ? 23.553  7.042   28.046  1.00 69.04  ? 126 TYR B CD1 1 
ATOM   2841 C  CD2 . TYR B 1 127 ? 21.885  8.159   29.346  1.00 68.92  ? 126 TYR B CD2 1 
ATOM   2842 C  CE1 . TYR B 1 127 ? 22.576  6.638   27.130  1.00 68.90  ? 126 TYR B CE1 1 
ATOM   2843 C  CE2 . TYR B 1 127 ? 20.904  7.761   28.436  1.00 69.64  ? 126 TYR B CE2 1 
ATOM   2844 C  CZ  . TYR B 1 127 ? 21.257  7.001   27.334  1.00 69.51  ? 126 TYR B CZ  1 
ATOM   2845 O  OH  . TYR B 1 127 ? 20.293  6.596   26.441  1.00 69.97  ? 126 TYR B OH  1 
ATOM   2846 N  N   . LEU B 1 128 ? 23.412  10.929  31.512  1.00 61.10  ? 127 LEU B N   1 
ATOM   2847 C  CA  . LEU B 1 128 ? 22.373  11.891  31.864  1.00 57.61  ? 127 LEU B CA  1 
ATOM   2848 C  C   . LEU B 1 128 ? 22.759  13.303  31.457  1.00 56.24  ? 127 LEU B C   1 
ATOM   2849 O  O   . LEU B 1 128 ? 21.893  14.122  31.154  1.00 54.93  ? 127 LEU B O   1 
ATOM   2850 C  CB  . LEU B 1 128 ? 22.096  11.866  33.363  1.00 54.58  ? 127 LEU B CB  1 
ATOM   2851 C  CG  . LEU B 1 128 ? 21.315  10.676  33.910  1.00 52.62  ? 127 LEU B CG  1 
ATOM   2852 C  CD1 . LEU B 1 128 ? 21.310  10.727  35.421  1.00 54.89  ? 127 LEU B CD1 1 
ATOM   2853 C  CD2 . LEU B 1 128 ? 19.898  10.699  33.373  1.00 53.09  ? 127 LEU B CD2 1 
ATOM   2854 N  N   . GLU B 1 129 ? 24.053  13.598  31.510  1.00 57.61  ? 128 GLU B N   1 
ATOM   2855 C  CA  . GLU B 1 129 ? 24.552  14.916  31.142  1.00 58.33  ? 128 GLU B CA  1 
ATOM   2856 C  C   . GLU B 1 129 ? 24.320  15.176  29.660  1.00 54.26  ? 128 GLU B C   1 
ATOM   2857 O  O   . GLU B 1 129 ? 23.999  16.298  29.265  1.00 53.56  ? 128 GLU B O   1 
ATOM   2858 C  CB  . GLU B 1 129 ? 26.050  15.023  31.448  1.00 64.28  ? 128 GLU B CB  1 
ATOM   2859 C  CG  . GLU B 1 129 ? 26.667  16.373  31.076  1.00 73.46  ? 128 GLU B CG  1 
ATOM   2860 C  CD  . GLU B 1 129 ? 28.187  16.378  31.129  1.00 80.03  ? 128 GLU B CD  1 
ATOM   2861 O  OE1 . GLU B 1 129 ? 28.792  17.245  30.460  1.00 83.30  ? 128 GLU B OE1 1 
ATOM   2862 O  OE2 . GLU B 1 129 ? 28.780  15.528  31.831  1.00 83.27  ? 128 GLU B OE2 1 
ATOM   2863 N  N   . GLU B 1 130 ? 24.466  14.127  28.853  1.00 50.63  ? 129 GLU B N   1 
ATOM   2864 C  CA  . GLU B 1 130 ? 24.308  14.212  27.400  1.00 49.54  ? 129 GLU B CA  1 
ATOM   2865 C  C   . GLU B 1 130 ? 22.884  14.054  26.879  1.00 48.04  ? 129 GLU B C   1 
ATOM   2866 O  O   . GLU B 1 130 ? 22.571  14.514  25.776  1.00 47.21  ? 129 GLU B O   1 
ATOM   2867 C  CB  . GLU B 1 130 ? 25.180  13.162  26.724  1.00 50.51  ? 129 GLU B CB  1 
ATOM   2868 C  CG  . GLU B 1 130 ? 26.628  13.191  27.150  1.00 51.43  ? 129 GLU B CG  1 
ATOM   2869 C  CD  . GLU B 1 130 ? 27.411  12.035  26.572  1.00 53.65  ? 129 GLU B CD  1 
ATOM   2870 O  OE1 . GLU B 1 130 ? 26.901  10.891  26.582  1.00 55.06  ? 129 GLU B OE1 1 
ATOM   2871 O  OE2 . GLU B 1 130 ? 28.545  12.272  26.108  1.00 53.40  ? 129 GLU B OE2 1 
ATOM   2872 N  N   . LEU B 1 131 ? 22.038  13.386  27.660  1.00 43.41  ? 130 LEU B N   1 
ATOM   2873 C  CA  . LEU B 1 131 ? 20.648  13.140  27.284  1.00 38.59  ? 130 LEU B CA  1 
ATOM   2874 C  C   . LEU B 1 131 ? 19.821  14.355  26.854  1.00 39.64  ? 130 LEU B C   1 
ATOM   2875 O  O   . LEU B 1 131 ? 19.104  14.282  25.858  1.00 40.97  ? 130 LEU B O   1 
ATOM   2876 C  CB  . LEU B 1 131 ? 19.913  12.392  28.398  1.00 33.45  ? 130 LEU B CB  1 
ATOM   2877 C  CG  . LEU B 1 131 ? 18.451  12.017  28.109  1.00 32.93  ? 130 LEU B CG  1 
ATOM   2878 C  CD1 . LEU B 1 131 ? 18.373  11.064  26.926  1.00 28.64  ? 130 LEU B CD1 1 
ATOM   2879 C  CD2 . LEU B 1 131 ? 17.819  11.385  29.333  1.00 25.73  ? 130 LEU B CD2 1 
ATOM   2880 N  N   . PRO B 1 132 ? 19.873  15.468  27.611  1.00 39.01  ? 131 PRO B N   1 
ATOM   2881 C  CA  . PRO B 1 132 ? 19.096  16.650  27.238  1.00 37.37  ? 131 PRO B CA  1 
ATOM   2882 C  C   . PRO B 1 132 ? 19.314  17.056  25.799  1.00 32.27  ? 131 PRO B C   1 
ATOM   2883 O  O   . PRO B 1 132 ? 18.379  17.444  25.113  1.00 36.00  ? 131 PRO B O   1 
ATOM   2884 C  CB  . PRO B 1 132 ? 19.622  17.713  28.191  1.00 37.33  ? 131 PRO B CB  1 
ATOM   2885 C  CG  . PRO B 1 132 ? 19.903  16.920  29.412  1.00 42.32  ? 131 PRO B CG  1 
ATOM   2886 C  CD  . PRO B 1 132 ? 20.618  15.720  28.855  1.00 36.47  ? 131 PRO B CD  1 
ATOM   2887 N  N   . GLU B 1 133 ? 20.559  16.992  25.357  1.00 30.17  ? 132 GLU B N   1 
ATOM   2888 C  CA  . GLU B 1 133 ? 20.891  17.346  23.996  1.00 32.21  ? 132 GLU B CA  1 
ATOM   2889 C  C   . GLU B 1 133 ? 20.263  16.364  23.022  1.00 34.97  ? 132 GLU B C   1 
ATOM   2890 O  O   . GLU B 1 133 ? 19.760  16.762  21.979  1.00 31.00  ? 132 GLU B O   1 
ATOM   2891 C  CB  . GLU B 1 133 ? 22.393  17.328  23.829  1.00 37.74  ? 132 GLU B CB  1 
ATOM   2892 C  CG  . GLU B 1 133 ? 22.866  17.565  22.411  1.00 44.08  ? 132 GLU B CG  1 
ATOM   2893 C  CD  . GLU B 1 133 ? 22.439  18.877  21.795  1.00 51.91  ? 132 GLU B CD  1 
ATOM   2894 O  OE1 . GLU B 1 133 ? 22.133  18.909  20.577  1.00 52.92  ? 132 GLU B OE1 1 
ATOM   2895 O  OE2 . GLU B 1 133 ? 22.399  19.882  22.534  1.00 60.73  ? 132 GLU B OE2 1 
ATOM   2896 N  N   . LYS B 1 134 ? 20.353  15.075  23.332  1.00 39.49  ? 133 LYS B N   1 
ATOM   2897 C  CA  . LYS B 1 134 ? 19.780  14.042  22.470  1.00 41.46  ? 133 LYS B CA  1 
ATOM   2898 C  C   . LYS B 1 134 ? 18.292  14.299  22.275  1.00 40.82  ? 133 LYS B C   1 
ATOM   2899 O  O   . LYS B 1 134 ? 17.776  14.225  21.154  1.00 43.87  ? 133 LYS B O   1 
ATOM   2900 C  CB  . LYS B 1 134 ? 19.966  12.657  23.087  1.00 42.30  ? 133 LYS B CB  1 
ATOM   2901 C  CG  . LYS B 1 134 ? 21.404  12.190  23.205  1.00 47.29  ? 133 LYS B CG  1 
ATOM   2902 C  CD  . LYS B 1 134 ? 21.440  10.760  23.716  1.00 46.68  ? 133 LYS B CD  1 
ATOM   2903 C  CE  . LYS B 1 134 ? 22.832  10.367  24.144  1.00 49.58  ? 133 LYS B CE  1 
ATOM   2904 N  NZ  . LYS B 1 134 ? 22.804  9.053   24.834  1.00 53.03  ? 133 LYS B NZ  1 
ATOM   2905 N  N   . LEU B 1 135 ? 17.604  14.533  23.390  1.00 39.39  ? 134 LEU B N   1 
ATOM   2906 C  CA  . LEU B 1 135 ? 16.176  14.814  23.402  1.00 39.26  ? 134 LEU B CA  1 
ATOM   2907 C  C   . LEU B 1 135 ? 15.886  16.069  22.592  1.00 41.08  ? 134 LEU B C   1 
ATOM   2908 O  O   . LEU B 1 135 ? 14.998  16.076  21.738  1.00 40.95  ? 134 LEU B O   1 
ATOM   2909 C  CB  . LEU B 1 135 ? 15.703  14.992  24.845  1.00 40.60  ? 134 LEU B CB  1 
ATOM   2910 C  CG  . LEU B 1 135 ? 15.157  13.759  25.574  1.00 43.68  ? 134 LEU B CG  1 
ATOM   2911 C  CD1 . LEU B 1 135 ? 15.647  12.479  24.937  1.00 46.10  ? 134 LEU B CD1 1 
ATOM   2912 C  CD2 . LEU B 1 135 ? 15.531  13.817  27.034  1.00 48.93  ? 134 LEU B CD2 1 
ATOM   2913 N  N   . LYS B 1 136 ? 16.638  17.126  22.869  1.00 38.98  ? 135 LYS B N   1 
ATOM   2914 C  CA  . LYS B 1 136 ? 16.497  18.391  22.166  1.00 40.66  ? 135 LYS B CA  1 
ATOM   2915 C  C   . LYS B 1 136 ? 16.454  18.170  20.660  1.00 38.56  ? 135 LYS B C   1 
ATOM   2916 O  O   . LYS B 1 136 ? 15.653  18.785  19.968  1.00 37.44  ? 135 LYS B O   1 
ATOM   2917 C  CB  . LYS B 1 136 ? 17.671  19.308  22.518  1.00 45.14  ? 135 LYS B CB  1 
ATOM   2918 C  CG  . LYS B 1 136 ? 17.768  20.586  21.703  1.00 46.48  ? 135 LYS B CG  1 
ATOM   2919 C  CD  . LYS B 1 136 ? 19.209  20.931  21.363  1.00 54.28  ? 135 LYS B CD  1 
ATOM   2920 C  CE  . LYS B 1 136 ? 19.578  22.390  21.599  1.00 60.65  ? 135 LYS B CE  1 
ATOM   2921 N  NZ  . LYS B 1 136 ? 20.910  22.752  21.028  1.00 59.42  ? 135 LYS B NZ  1 
ATOM   2922 N  N   . LEU B 1 137 ? 17.325  17.295  20.165  1.00 36.50  ? 136 LEU B N   1 
ATOM   2923 C  CA  . LEU B 1 137 ? 17.402  16.997  18.740  1.00 35.49  ? 136 LEU B CA  1 
ATOM   2924 C  C   . LEU B 1 137 ? 16.065  16.531  18.201  1.00 36.52  ? 136 LEU B C   1 
ATOM   2925 O  O   . LEU B 1 137 ? 15.607  17.009  17.158  1.00 34.97  ? 136 LEU B O   1 
ATOM   2926 C  CB  . LEU B 1 137 ? 18.489  15.959  18.464  1.00 31.52  ? 136 LEU B CB  1 
ATOM   2927 C  CG  . LEU B 1 137 ? 19.895  16.470  18.774  1.00 33.10  ? 136 LEU B CG  1 
ATOM   2928 C  CD1 . LEU B 1 137 ? 20.925  15.415  18.394  1.00 37.86  ? 136 LEU B CD1 1 
ATOM   2929 C  CD2 . LEU B 1 137 ? 20.151  17.782  18.026  1.00 21.68  ? 136 LEU B CD2 1 
ATOM   2930 N  N   . TYR B 1 138 ? 15.453  15.581  18.900  1.00 35.55  ? 137 TYR B N   1 
ATOM   2931 C  CA  . TYR B 1 138 ? 14.152  15.077  18.501  1.00 37.38  ? 137 TYR B CA  1 
ATOM   2932 C  C   . TYR B 1 138 ? 13.135  16.215  18.497  1.00 37.64  ? 137 TYR B C   1 
ATOM   2933 O  O   . TYR B 1 138 ? 12.301  16.296  17.596  1.00 38.74  ? 137 TYR B O   1 
ATOM   2934 C  CB  . TYR B 1 138 ? 13.702  13.993  19.457  1.00 38.34  ? 137 TYR B CB  1 
ATOM   2935 C  CG  . TYR B 1 138 ? 14.337  12.665  19.197  1.00 41.14  ? 137 TYR B CG  1 
ATOM   2936 C  CD1 . TYR B 1 138 ? 14.022  11.947  18.052  1.00 42.07  ? 137 TYR B CD1 1 
ATOM   2937 C  CD2 . TYR B 1 138 ? 15.221  12.104  20.109  1.00 40.73  ? 137 TYR B CD2 1 
ATOM   2938 C  CE1 . TYR B 1 138 ? 14.565  10.695  17.819  1.00 44.68  ? 137 TYR B CE1 1 
ATOM   2939 C  CE2 . TYR B 1 138 ? 15.772  10.852  19.887  1.00 41.78  ? 137 TYR B CE2 1 
ATOM   2940 C  CZ  . TYR B 1 138 ? 15.437  10.149  18.739  1.00 41.90  ? 137 TYR B CZ  1 
ATOM   2941 O  OH  . TYR B 1 138 ? 15.939  8.889   18.500  1.00 43.36  ? 137 TYR B OH  1 
ATOM   2942 N  N   . SER B 1 139 ? 13.194  17.062  19.525  1.00 38.69  ? 138 SER B N   1 
ATOM   2943 C  CA  . SER B 1 139 ? 12.306  18.213  19.656  1.00 35.90  ? 138 SER B CA  1 
ATOM   2944 C  C   . SER B 1 139 ? 12.484  19.092  18.427  1.00 35.95  ? 138 SER B C   1 
ATOM   2945 O  O   . SER B 1 139 ? 11.528  19.368  17.702  1.00 33.34  ? 138 SER B O   1 
ATOM   2946 C  CB  . SER B 1 139 ? 12.665  19.000  20.920  1.00 36.30  ? 138 SER B CB  1 
ATOM   2947 O  OG  . SER B 1 139 ? 11.923  20.201  21.066  1.00 32.01  ? 138 SER B OG  1 
ATOM   2948 N  N   . GLU B 1 140 ? 13.728  19.491  18.176  1.00 38.33  ? 139 GLU B N   1 
ATOM   2949 C  CA  . GLU B 1 140 ? 14.078  20.332  17.035  1.00 43.14  ? 139 GLU B CA  1 
ATOM   2950 C  C   . GLU B 1 140 ? 13.513  19.755  15.742  1.00 43.98  ? 139 GLU B C   1 
ATOM   2951 O  O   . GLU B 1 140 ? 13.013  20.487  14.878  1.00 40.15  ? 139 GLU B O   1 
ATOM   2952 C  CB  . GLU B 1 140 ? 15.604  20.394  16.880  1.00 48.06  ? 139 GLU B CB  1 
ATOM   2953 C  CG  . GLU B 1 140 ? 16.412  20.759  18.123  1.00 54.81  ? 139 GLU B CG  1 
ATOM   2954 C  CD  . GLU B 1 140 ? 16.374  22.232  18.472  1.00 60.23  ? 139 GLU B CD  1 
ATOM   2955 O  OE1 . GLU B 1 140 ? 15.319  22.703  18.955  1.00 64.47  ? 139 GLU B OE1 1 
ATOM   2956 O  OE2 . GLU B 1 140 ? 17.405  22.914  18.263  1.00 56.65  ? 139 GLU B OE2 1 
ATOM   2957 N  N   . PHE B 1 141 ? 13.663  18.441  15.603  1.00 44.22  ? 140 PHE B N   1 
ATOM   2958 C  CA  . PHE B 1 141 ? 13.228  17.713  14.426  1.00 38.90  ? 140 PHE B CA  1 
ATOM   2959 C  C   . PHE B 1 141 ? 11.727  17.697  14.198  1.00 36.88  ? 140 PHE B C   1 
ATOM   2960 O  O   . PHE B 1 141 ? 11.272  17.908  13.073  1.00 39.10  ? 140 PHE B O   1 
ATOM   2961 C  CB  . PHE B 1 141 ? 13.757  16.280  14.478  1.00 38.99  ? 140 PHE B CB  1 
ATOM   2962 C  CG  . PHE B 1 141 ? 13.757  15.592  13.147  1.00 38.95  ? 140 PHE B CG  1 
ATOM   2963 C  CD1 . PHE B 1 141 ? 14.184  16.265  12.007  1.00 36.78  ? 140 PHE B CD1 1 
ATOM   2964 C  CD2 . PHE B 1 141 ? 13.335  14.277  13.030  1.00 35.61  ? 140 PHE B CD2 1 
ATOM   2965 C  CE1 . PHE B 1 141 ? 14.192  15.639  10.775  1.00 35.44  ? 140 PHE B CE1 1 
ATOM   2966 C  CE2 . PHE B 1 141 ? 13.341  13.641  11.800  1.00 31.73  ? 140 PHE B CE2 1 
ATOM   2967 C  CZ  . PHE B 1 141 ? 13.770  14.322  10.668  1.00 33.53  ? 140 PHE B CZ  1 
ATOM   2968 N  N   . LEU B 1 142 ? 10.972  17.369  15.244  1.00 34.74  ? 141 LEU B N   1 
ATOM   2969 C  CA  . LEU B 1 142 ? 9.512   17.311  15.173  1.00 36.16  ? 141 LEU B CA  1 
ATOM   2970 C  C   . LEU B 1 142 ? 8.921   18.675  14.885  1.00 37.58  ? 141 LEU B C   1 
ATOM   2971 O  O   . LEU B 1 142 ? 8.109   18.829  13.971  1.00 37.94  ? 141 LEU B O   1 
ATOM   2972 C  CB  . LEU B 1 142 ? 8.928   16.802  16.486  1.00 35.26  ? 141 LEU B CB  1 
ATOM   2973 C  CG  . LEU B 1 142 ? 7.407   16.668  16.515  1.00 36.60  ? 141 LEU B CG  1 
ATOM   2974 C  CD1 . LEU B 1 142 ? 6.978   15.604  15.521  1.00 23.11  ? 141 LEU B CD1 1 
ATOM   2975 C  CD2 . LEU B 1 142 ? 6.940   16.290  17.914  1.00 35.11  ? 141 LEU B CD2 1 
ATOM   2976 N  N   . GLY B 1 143 ? 9.315   19.654  15.690  1.00 39.94  ? 142 GLY B N   1 
ATOM   2977 C  CA  . GLY B 1 143 ? 8.822   21.005  15.521  1.00 38.11  ? 142 GLY B CA  1 
ATOM   2978 C  C   . GLY B 1 143 ? 7.335   21.112  15.782  1.00 40.31  ? 142 GLY B C   1 
ATOM   2979 O  O   . GLY B 1 143 ? 6.823   20.578  16.770  1.00 41.91  ? 142 GLY B O   1 
ATOM   2980 N  N   . LYS B 1 144 ? 6.642   21.824  14.899  1.00 42.12  ? 143 LYS B N   1 
ATOM   2981 C  CA  . LYS B 1 144 ? 5.206   22.014  15.031  1.00 42.97  ? 143 LYS B CA  1 
ATOM   2982 C  C   . LYS B 1 144 ? 4.395   20.916  14.347  1.00 39.48  ? 143 LYS B C   1 
ATOM   2983 O  O   . LYS B 1 144 ? 3.166   20.989  14.275  1.00 40.94  ? 143 LYS B O   1 
ATOM   2984 C  CB  . LYS B 1 144 ? 4.813   23.402  14.515  1.00 45.85  ? 143 LYS B CB  1 
ATOM   2985 C  CG  . LYS B 1 144 ? 5.471   24.497  15.352  1.00 54.33  ? 143 LYS B CG  1 
ATOM   2986 C  CD  . LYS B 1 144 ? 5.384   25.895  14.727  1.00 64.31  ? 143 LYS B CD  1 
ATOM   2987 C  CE  . LYS B 1 144 ? 5.553   27.011  15.752  1.00 67.74  ? 143 LYS B CE  1 
ATOM   2988 N  NZ  . LYS B 1 144 ? 6.907   27.010  16.381  1.00 74.40  ? 143 LYS B NZ  1 
ATOM   2989 N  N   . ARG B 1 145 ? 5.088   19.898  13.849  1.00 36.97  ? 144 ARG B N   1 
ATOM   2990 C  CA  . ARG B 1 145 ? 4.439   18.776  13.178  1.00 36.41  ? 144 ARG B CA  1 
ATOM   2991 C  C   . ARG B 1 145 ? 3.714   17.877  14.166  1.00 35.61  ? 144 ARG B C   1 
ATOM   2992 O  O   . ARG B 1 145 ? 4.154   17.697  15.301  1.00 37.51  ? 144 ARG B O   1 
ATOM   2993 C  CB  . ARG B 1 145 ? 5.462   17.922  12.431  1.00 37.46  ? 144 ARG B CB  1 
ATOM   2994 C  CG  . ARG B 1 145 ? 6.179   18.618  11.308  1.00 42.40  ? 144 ARG B CG  1 
ATOM   2995 C  CD  . ARG B 1 145 ? 7.166   17.669  10.650  1.00 42.36  ? 144 ARG B CD  1 
ATOM   2996 N  NE  . ARG B 1 145 ? 8.014   18.368  9.691   1.00 46.28  ? 144 ARG B NE  1 
ATOM   2997 C  CZ  . ARG B 1 145 ? 8.958   19.244  10.025  1.00 47.43  ? 144 ARG B CZ  1 
ATOM   2998 N  NH1 . ARG B 1 145 ? 9.192   19.535  11.299  1.00 47.02  ? 144 ARG B NH1 1 
ATOM   2999 N  NH2 . ARG B 1 145 ? 9.659   19.851  9.081   1.00 46.85  ? 144 ARG B NH2 1 
ATOM   3000 N  N   . PRO B 1 146 ? 2.579   17.305  13.744  1.00 35.70  ? 145 PRO B N   1 
ATOM   3001 C  CA  . PRO B 1 146 ? 1.796   16.414  14.599  1.00 36.40  ? 145 PRO B CA  1 
ATOM   3002 C  C   . PRO B 1 146 ? 2.531   15.096  14.736  1.00 36.61  ? 145 PRO B C   1 
ATOM   3003 O  O   . PRO B 1 146 ? 2.476   14.448  15.781  1.00 38.89  ? 145 PRO B O   1 
ATOM   3004 C  CB  . PRO B 1 146 ? 0.502   16.246  13.807  1.00 38.25  ? 145 PRO B CB  1 
ATOM   3005 C  CG  . PRO B 1 146 ? 0.958   16.340  12.400  1.00 33.18  ? 145 PRO B CG  1 
ATOM   3006 C  CD  . PRO B 1 146 ? 1.908   17.507  12.449  1.00 35.30  ? 145 PRO B CD  1 
ATOM   3007 N  N   . TRP B 1 147 ? 3.198   14.704  13.655  1.00 34.44  ? 146 TRP B N   1 
ATOM   3008 C  CA  . TRP B 1 147 ? 3.971   13.475  13.603  1.00 31.90  ? 146 TRP B CA  1 
ATOM   3009 C  C   . TRP B 1 147 ? 5.366   13.778  13.074  1.00 30.53  ? 146 TRP B C   1 
ATOM   3010 O  O   . TRP B 1 147 ? 5.620   14.858  12.527  1.00 27.59  ? 146 TRP B O   1 
ATOM   3011 C  CB  . TRP B 1 147 ? 3.279   12.449  12.713  1.00 35.96  ? 146 TRP B CB  1 
ATOM   3012 C  CG  . TRP B 1 147 ? 1.896   12.141  13.168  1.00 43.44  ? 146 TRP B CG  1 
ATOM   3013 C  CD1 . TRP B 1 147 ? 0.739   12.390  12.497  1.00 47.06  ? 146 TRP B CD1 1 
ATOM   3014 C  CD2 . TRP B 1 147 ? 1.517   11.552  14.419  1.00 48.30  ? 146 TRP B CD2 1 
ATOM   3015 N  NE1 . TRP B 1 147 ? -0.342  11.995  13.249  1.00 47.25  ? 146 TRP B NE1 1 
ATOM   3016 C  CE2 . TRP B 1 147 ? 0.107   11.480  14.435  1.00 48.69  ? 146 TRP B CE2 1 
ATOM   3017 C  CE3 . TRP B 1 147 ? 2.229   11.082  15.531  1.00 49.29  ? 146 TRP B CE3 1 
ATOM   3018 C  CZ2 . TRP B 1 147 ? -0.604  10.955  15.521  1.00 49.53  ? 146 TRP B CZ2 1 
ATOM   3019 C  CZ3 . TRP B 1 147 ? 1.521   10.559  16.613  1.00 51.31  ? 146 TRP B CZ3 1 
ATOM   3020 C  CH2 . TRP B 1 147 ? 0.119   10.502  16.597  1.00 50.62  ? 146 TRP B CH2 1 
ATOM   3021 N  N   . PHE B 1 148 ? 6.276   12.832  13.272  1.00 28.93  ? 147 PHE B N   1 
ATOM   3022 C  CA  . PHE B 1 148 ? 7.651   13.002  12.837  1.00 28.24  ? 147 PHE B CA  1 
ATOM   3023 C  C   . PHE B 1 148 ? 7.849   12.995  11.342  1.00 31.94  ? 147 PHE B C   1 
ATOM   3024 O  O   . PHE B 1 148 ? 8.653   13.764  10.833  1.00 36.67  ? 147 PHE B O   1 
ATOM   3025 C  CB  . PHE B 1 148 ? 8.573   11.984  13.509  1.00 30.58  ? 147 PHE B CB  1 
ATOM   3026 C  CG  . PHE B 1 148 ? 8.956   12.361  14.914  1.00 28.74  ? 147 PHE B CG  1 
ATOM   3027 C  CD1 . PHE B 1 148 ? 8.268   11.836  16.004  1.00 30.07  ? 147 PHE B CD1 1 
ATOM   3028 C  CD2 . PHE B 1 148 ? 9.970   13.284  15.146  1.00 24.44  ? 147 PHE B CD2 1 
ATOM   3029 C  CE1 . PHE B 1 148 ? 8.583   12.230  17.300  1.00 23.38  ? 147 PHE B CE1 1 
ATOM   3030 C  CE2 . PHE B 1 148 ? 10.290  13.682  16.442  1.00 24.28  ? 147 PHE B CE2 1 
ATOM   3031 C  CZ  . PHE B 1 148 ? 9.595   13.157  17.517  1.00 19.53  ? 147 PHE B CZ  1 
ATOM   3032 N  N   . ALA B 1 149 ? 7.162   12.107  10.635  1.00 37.95  ? 148 ALA B N   1 
ATOM   3033 C  CA  . ALA B 1 149 ? 7.301   12.060  9.184   1.00 40.51  ? 148 ALA B CA  1 
ATOM   3034 C  C   . ALA B 1 149 ? 6.722   13.331  8.555   1.00 40.87  ? 148 ALA B C   1 
ATOM   3035 O  O   . ALA B 1 149 ? 7.242   13.839  7.557   1.00 39.87  ? 148 ALA B O   1 
ATOM   3036 C  CB  . ALA B 1 149 ? 6.608   10.838  8.636   1.00 39.08  ? 148 ALA B CB  1 
ATOM   3037 N  N   . GLY B 1 150 ? 5.649   13.840  9.158   1.00 41.51  ? 149 GLY B N   1 
ATOM   3038 C  CA  . GLY B 1 150 ? 4.992   15.041  8.668   1.00 45.34  ? 149 GLY B CA  1 
ATOM   3039 C  C   . GLY B 1 150 ? 3.600   15.153  9.261   1.00 47.20  ? 149 GLY B C   1 
ATOM   3040 O  O   . GLY B 1 150 ? 3.438   15.130  10.481  1.00 50.81  ? 149 GLY B O   1 
ATOM   3041 N  N   . ASN B 1 151 ? 2.591   15.283  8.405   1.00 48.56  ? 150 ASN B N   1 
ATOM   3042 C  CA  . ASN B 1 151 ? 1.208   15.383  8.871   1.00 49.96  ? 150 ASN B CA  1 
ATOM   3043 C  C   . ASN B 1 151 ? 0.621   14.003  9.130   1.00 50.10  ? 150 ASN B C   1 
ATOM   3044 O  O   . ASN B 1 151 ? -0.367  13.863  9.849   1.00 45.88  ? 150 ASN B O   1 
ATOM   3045 C  CB  . ASN B 1 151 ? 0.328   16.119  7.852   1.00 53.01  ? 150 ASN B CB  1 
ATOM   3046 C  CG  . ASN B 1 151 ? 0.553   17.618  7.853   1.00 57.74  ? 150 ASN B CG  1 
ATOM   3047 O  OD1 . ASN B 1 151 ? 0.773   18.226  6.799   1.00 55.77  ? 150 ASN B OD1 1 
ATOM   3048 N  ND2 . ASN B 1 151 ? 0.487   18.229  9.036   1.00 61.00  ? 150 ASN B ND2 1 
ATOM   3049 N  N   . LYS B 1 152 ? 1.190   12.992  8.486   1.00 53.14  ? 151 LYS B N   1 
ATOM   3050 C  CA  . LYS B 1 152 ? 0.714   11.633  8.659   1.00 58.68  ? 151 LYS B CA  1 
ATOM   3051 C  C   . LYS B 1 152 ? 1.596   10.799  9.576   1.00 57.08  ? 151 LYS B C   1 
ATOM   3052 O  O   . LYS B 1 152 ? 2.825   10.930  9.582   1.00 60.14  ? 151 LYS B O   1 
ATOM   3053 C  CB  . LYS B 1 152 ? 0.574   10.931  7.307   1.00 65.86  ? 151 LYS B CB  1 
ATOM   3054 C  CG  . LYS B 1 152 ? -0.680  11.297  6.540   1.00 75.85  ? 151 LYS B CG  1 
ATOM   3055 C  CD  . LYS B 1 152 ? -0.808  10.444  5.291   1.00 82.11  ? 151 LYS B CD  1 
ATOM   3056 C  CE  . LYS B 1 152 ? -2.092  10.741  4.527   1.00 84.21  ? 151 LYS B CE  1 
ATOM   3057 N  NZ  . LYS B 1 152 ? -2.141  12.140  3.998   1.00 87.16  ? 151 LYS B NZ  1 
ATOM   3058 N  N   . ILE B 1 153 ? 0.951   9.944   10.359  1.00 50.97  ? 152 ILE B N   1 
ATOM   3059 C  CA  . ILE B 1 153 ? 1.663   9.065   11.266  1.00 48.14  ? 152 ILE B CA  1 
ATOM   3060 C  C   . ILE B 1 153 ? 2.333   7.963   10.461  1.00 46.57  ? 152 ILE B C   1 
ATOM   3061 O  O   . ILE B 1 153 ? 1.768   7.457   9.494   1.00 48.22  ? 152 ILE B O   1 
ATOM   3062 C  CB  . ILE B 1 153 ? 0.718   8.418   12.301  1.00 48.09  ? 152 ILE B CB  1 
ATOM   3063 C  CG1 . ILE B 1 153 ? 1.499   7.403   13.147  1.00 48.65  ? 152 ILE B CG1 1 
ATOM   3064 C  CG2 . ILE B 1 153 ? -0.467  7.762   11.601  1.00 44.44  ? 152 ILE B CG2 1 
ATOM   3065 C  CD1 . ILE B 1 153 ? 0.689   6.702   14.195  1.00 44.11  ? 152 ILE B CD1 1 
ATOM   3066 N  N   . THR B 1 154 ? 3.534   7.593   10.876  1.00 44.00  ? 153 THR B N   1 
ATOM   3067 C  CA  . THR B 1 154 ? 4.290   6.544   10.212  1.00 45.20  ? 153 THR B CA  1 
ATOM   3068 C  C   . THR B 1 154 ? 4.842   5.603   11.263  1.00 44.89  ? 153 THR B C   1 
ATOM   3069 O  O   . THR B 1 154 ? 4.735   5.882   12.463  1.00 48.55  ? 153 THR B O   1 
ATOM   3070 C  CB  . THR B 1 154 ? 5.419   7.142   9.390   1.00 47.09  ? 153 THR B CB  1 
ATOM   3071 O  OG1 . THR B 1 154 ? 5.965   8.265   10.094  1.00 46.49  ? 153 THR B OG1 1 
ATOM   3072 C  CG2 . THR B 1 154 ? 4.892   7.603   8.032   1.00 50.27  ? 153 THR B CG2 1 
ATOM   3073 N  N   . PHE B 1 155 ? 5.413   4.481   10.834  1.00 42.10  ? 154 PHE B N   1 
ATOM   3074 C  CA  . PHE B 1 155 ? 5.945   3.517   11.792  1.00 41.11  ? 154 PHE B CA  1 
ATOM   3075 C  C   . PHE B 1 155 ? 7.074   4.067   12.666  1.00 40.30  ? 154 PHE B C   1 
ATOM   3076 O  O   . PHE B 1 155 ? 7.348   3.529   13.738  1.00 39.02  ? 154 PHE B O   1 
ATOM   3077 C  CB  . PHE B 1 155 ? 6.369   2.218   11.100  1.00 41.04  ? 154 PHE B CB  1 
ATOM   3078 C  CG  . PHE B 1 155 ? 7.708   2.286   10.432  1.00 36.15  ? 154 PHE B CG  1 
ATOM   3079 C  CD1 . PHE B 1 155 ? 8.864   1.926   11.125  1.00 38.96  ? 154 PHE B CD1 1 
ATOM   3080 C  CD2 . PHE B 1 155 ? 7.816   2.684   9.106   1.00 39.39  ? 154 PHE B CD2 1 
ATOM   3081 C  CE1 . PHE B 1 155 ? 10.111  1.959   10.501  1.00 36.94  ? 154 PHE B CE1 1 
ATOM   3082 C  CE2 . PHE B 1 155 ? 9.055   2.720   8.473   1.00 41.59  ? 154 PHE B CE2 1 
ATOM   3083 C  CZ  . PHE B 1 155 ? 10.206  2.355   9.174   1.00 39.42  ? 154 PHE B CZ  1 
ATOM   3084 N  N   . VAL B 1 156 ? 7.757   5.107   12.195  1.00 38.05  ? 155 VAL B N   1 
ATOM   3085 C  CA  . VAL B 1 156 ? 8.830   5.705   12.978  1.00 38.51  ? 155 VAL B CA  1 
ATOM   3086 C  C   . VAL B 1 156 ? 8.308   6.399   14.237  1.00 38.40  ? 155 VAL B C   1 
ATOM   3087 O  O   . VAL B 1 156 ? 9.037   6.540   15.220  1.00 39.24  ? 155 VAL B O   1 
ATOM   3088 C  CB  . VAL B 1 156 ? 9.691   6.695   12.153  1.00 39.25  ? 155 VAL B CB  1 
ATOM   3089 C  CG1 . VAL B 1 156 ? 10.434  5.948   11.067  1.00 38.57  ? 155 VAL B CG1 1 
ATOM   3090 C  CG2 . VAL B 1 156 ? 8.852   7.814   11.556  1.00 41.96  ? 155 VAL B CG2 1 
ATOM   3091 N  N   . ASP B 1 157 ? 7.064   6.868   14.196  1.00 35.82  ? 156 ASP B N   1 
ATOM   3092 C  CA  . ASP B 1 157 ? 6.474   7.533   15.352  1.00 39.34  ? 156 ASP B CA  1 
ATOM   3093 C  C   . ASP B 1 157 ? 6.393   6.547   16.513  1.00 37.06  ? 156 ASP B C   1 
ATOM   3094 O  O   . ASP B 1 157 ? 6.355   6.944   17.679  1.00 33.98  ? 156 ASP B O   1 
ATOM   3095 C  CB  . ASP B 1 157 ? 5.098   8.083   15.008  1.00 42.96  ? 156 ASP B CB  1 
ATOM   3096 C  CG  . ASP B 1 157 ? 5.168   9.235   14.032  1.00 43.97  ? 156 ASP B CG  1 
ATOM   3097 O  OD1 . ASP B 1 157 ? 5.472   10.360  14.474  1.00 50.85  ? 156 ASP B OD1 1 
ATOM   3098 O  OD2 . ASP B 1 157 ? 4.926   9.018   12.827  1.00 45.88  ? 156 ASP B OD2 1 
ATOM   3099 N  N   . PHE B 1 158 ? 6.343   5.262   16.174  1.00 36.34  ? 157 PHE B N   1 
ATOM   3100 C  CA  . PHE B 1 158 ? 6.308   4.204   17.174  1.00 38.33  ? 157 PHE B CA  1 
ATOM   3101 C  C   . PHE B 1 158 ? 7.715   4.039   17.745  1.00 33.72  ? 157 PHE B C   1 
ATOM   3102 O  O   . PHE B 1 158 ? 7.889   3.864   18.950  1.00 37.96  ? 157 PHE B O   1 
ATOM   3103 C  CB  . PHE B 1 158 ? 5.830   2.884   16.552  1.00 42.85  ? 157 PHE B CB  1 
ATOM   3104 C  CG  . PHE B 1 158 ? 4.397   2.914   16.091  1.00 43.10  ? 157 PHE B CG  1 
ATOM   3105 C  CD1 . PHE B 1 158 ? 4.028   3.648   14.964  1.00 44.96  ? 157 PHE B CD1 1 
ATOM   3106 C  CD2 . PHE B 1 158 ? 3.412   2.219   16.791  1.00 40.13  ? 157 PHE B CD2 1 
ATOM   3107 C  CE1 . PHE B 1 158 ? 2.702   3.691   14.542  1.00 43.96  ? 157 PHE B CE1 1 
ATOM   3108 C  CE2 . PHE B 1 158 ? 2.083   2.258   16.373  1.00 43.45  ? 157 PHE B CE2 1 
ATOM   3109 C  CZ  . PHE B 1 158 ? 1.730   2.998   15.246  1.00 43.83  ? 157 PHE B CZ  1 
ATOM   3110 N  N   . LEU B 1 159 ? 8.712   4.070   16.864  1.00 30.61  ? 158 LEU B N   1 
ATOM   3111 C  CA  . LEU B 1 159 ? 10.107  3.939   17.259  1.00 32.57  ? 158 LEU B CA  1 
ATOM   3112 C  C   . LEU B 1 159 ? 10.538  5.118   18.121  1.00 36.79  ? 158 LEU B C   1 
ATOM   3113 O  O   . LEU B 1 159 ? 11.227  4.939   19.127  1.00 40.48  ? 158 LEU B O   1 
ATOM   3114 C  CB  . LEU B 1 159 ? 11.000  3.828   16.021  1.00 31.84  ? 158 LEU B CB  1 
ATOM   3115 C  CG  . LEU B 1 159 ? 10.906  2.503   15.254  1.00 33.03  ? 158 LEU B CG  1 
ATOM   3116 C  CD1 . LEU B 1 159 ? 11.714  2.563   13.980  1.00 24.10  ? 158 LEU B CD1 1 
ATOM   3117 C  CD2 . LEU B 1 159 ? 11.390  1.360   16.127  1.00 29.74  ? 158 LEU B CD2 1 
ATOM   3118 N  N   . VAL B 1 160 ? 10.143  6.321   17.716  1.00 37.13  ? 159 VAL B N   1 
ATOM   3119 C  CA  . VAL B 1 160 ? 10.492  7.515   18.472  1.00 36.45  ? 159 VAL B CA  1 
ATOM   3120 C  C   . VAL B 1 160 ? 9.790   7.506   19.823  1.00 36.99  ? 159 VAL B C   1 
ATOM   3121 O  O   . VAL B 1 160 ? 10.379  7.897   20.831  1.00 39.51  ? 159 VAL B O   1 
ATOM   3122 C  CB  . VAL B 1 160 ? 10.110  8.810   17.728  1.00 34.98  ? 159 VAL B CB  1 
ATOM   3123 C  CG1 . VAL B 1 160 ? 10.435  10.009  18.579  1.00 27.50  ? 159 VAL B CG1 1 
ATOM   3124 C  CG2 . VAL B 1 160 ? 10.846  8.902   16.419  1.00 28.10  ? 159 VAL B CG2 1 
ATOM   3125 N  N   . TYR B 1 161 ? 8.519   7.111   19.835  1.00 34.12  ? 160 TYR B N   1 
ATOM   3126 C  CA  . TYR B 1 161 ? 7.760   7.063   21.075  1.00 36.93  ? 160 TYR B CA  1 
ATOM   3127 C  C   . TYR B 1 161 ? 8.476   6.163   22.068  1.00 38.62  ? 160 TYR B C   1 
ATOM   3128 O  O   . TYR B 1 161 ? 8.754   6.571   23.190  1.00 40.71  ? 160 TYR B O   1 
ATOM   3129 C  CB  . TYR B 1 161 ? 6.336   6.539   20.830  1.00 34.11  ? 160 TYR B CB  1 
ATOM   3130 C  CG  . TYR B 1 161 ? 5.640   6.070   22.097  1.00 37.13  ? 160 TYR B CG  1 
ATOM   3131 C  CD1 . TYR B 1 161 ? 5.420   4.710   22.329  1.00 36.02  ? 160 TYR B CD1 1 
ATOM   3132 C  CD2 . TYR B 1 161 ? 5.271   6.978   23.095  1.00 35.75  ? 160 TYR B CD2 1 
ATOM   3133 C  CE1 . TYR B 1 161 ? 4.862   4.261   23.524  1.00 32.44  ? 160 TYR B CE1 1 
ATOM   3134 C  CE2 . TYR B 1 161 ? 4.712   6.543   24.295  1.00 32.29  ? 160 TYR B CE2 1 
ATOM   3135 C  CZ  . TYR B 1 161 ? 4.510   5.179   24.503  1.00 32.22  ? 160 TYR B CZ  1 
ATOM   3136 O  OH  . TYR B 1 161 ? 3.957   4.722   25.689  1.00 30.88  ? 160 TYR B OH  1 
ATOM   3137 N  N   . ASP B 1 162 ? 8.733   4.927   21.655  1.00 36.65  ? 161 ASP B N   1 
ATOM   3138 C  CA  . ASP B 1 162 ? 9.402   3.943   22.495  1.00 37.58  ? 161 ASP B CA  1 
ATOM   3139 C  C   . ASP B 1 162 ? 10.634  4.541   23.153  1.00 33.57  ? 161 ASP B C   1 
ATOM   3140 O  O   . ASP B 1 162 ? 10.822  4.447   24.367  1.00 28.26  ? 161 ASP B O   1 
ATOM   3141 C  CB  . ASP B 1 162 ? 9.806   2.746   21.637  1.00 44.16  ? 161 ASP B CB  1 
ATOM   3142 C  CG  . ASP B 1 162 ? 10.362  1.587   22.451  1.00 50.90  ? 161 ASP B CG  1 
ATOM   3143 O  OD1 . ASP B 1 162 ? 10.336  1.635   23.698  1.00 49.45  ? 161 ASP B OD1 1 
ATOM   3144 O  OD2 . ASP B 1 162 ? 10.824  0.605   21.828  1.00 60.33  ? 161 ASP B OD2 1 
ATOM   3145 N  N   . VAL B 1 163 ? 11.497  5.115   22.334  1.00 29.61  ? 162 VAL B N   1 
ATOM   3146 C  CA  . VAL B 1 163 ? 12.705  5.721   22.847  1.00 33.32  ? 162 VAL B CA  1 
ATOM   3147 C  C   . VAL B 1 163 ? 12.360  6.773   23.896  1.00 33.20  ? 162 VAL B C   1 
ATOM   3148 O  O   . VAL B 1 163 ? 12.846  6.704   25.018  1.00 38.37  ? 162 VAL B O   1 
ATOM   3149 C  CB  . VAL B 1 163 ? 13.540  6.330   21.702  1.00 36.73  ? 162 VAL B CB  1 
ATOM   3150 C  CG1 . VAL B 1 163 ? 14.705  7.137   22.247  1.00 44.37  ? 162 VAL B CG1 1 
ATOM   3151 C  CG2 . VAL B 1 163 ? 14.062  5.221   20.814  1.00 38.39  ? 162 VAL B CG2 1 
ATOM   3152 N  N   . LEU B 1 164 ? 11.522  7.735   23.536  1.00 31.89  ? 163 LEU B N   1 
ATOM   3153 C  CA  . LEU B 1 164 ? 11.134  8.788   24.461  1.00 34.26  ? 163 LEU B CA  1 
ATOM   3154 C  C   . LEU B 1 164 ? 10.540  8.222   25.758  1.00 37.34  ? 163 LEU B C   1 
ATOM   3155 O  O   . LEU B 1 164 ? 10.846  8.704   26.857  1.00 39.69  ? 163 LEU B O   1 
ATOM   3156 C  CB  . LEU B 1 164 ? 10.132  9.717   23.788  1.00 32.54  ? 163 LEU B CB  1 
ATOM   3157 C  CG  . LEU B 1 164 ? 10.622  10.423  22.521  1.00 32.50  ? 163 LEU B CG  1 
ATOM   3158 C  CD1 . LEU B 1 164 ? 9.466   11.152  21.861  1.00 40.42  ? 163 LEU B CD1 1 
ATOM   3159 C  CD2 . LEU B 1 164 ? 11.747  11.392  22.846  1.00 30.47  ? 163 LEU B CD2 1 
ATOM   3160 N  N   . ASP B 1 165 ? 9.673   7.221   25.623  1.00 37.56  ? 164 ASP B N   1 
ATOM   3161 C  CA  . ASP B 1 165 ? 9.038   6.597   26.777  1.00 38.77  ? 164 ASP B CA  1 
ATOM   3162 C  C   . ASP B 1 165 ? 10.102  5.987   27.674  1.00 38.72  ? 164 ASP B C   1 
ATOM   3163 O  O   . ASP B 1 165 ? 10.112  6.219   28.885  1.00 40.12  ? 164 ASP B O   1 
ATOM   3164 C  CB  . ASP B 1 165 ? 8.043   5.515   26.332  1.00 39.67  ? 164 ASP B CB  1 
ATOM   3165 C  CG  . ASP B 1 165 ? 7.175   5.000   27.475  1.00 37.39  ? 164 ASP B CG  1 
ATOM   3166 O  OD1 . ASP B 1 165 ? 6.613   5.825   28.226  1.00 31.81  ? 164 ASP B OD1 1 
ATOM   3167 O  OD2 . ASP B 1 165 ? 7.024   3.764   27.607  1.00 40.46  ? 164 ASP B OD2 1 
ATOM   3168 N  N   . LEU B 1 166 ? 10.980  5.182   27.085  1.00 38.24  ? 165 LEU B N   1 
ATOM   3169 C  CA  . LEU B 1 166 ? 12.056  4.542   27.838  1.00 41.05  ? 165 LEU B CA  1 
ATOM   3170 C  C   . LEU B 1 166 ? 12.850  5.541   28.673  1.00 42.15  ? 165 LEU B C   1 
ATOM   3171 O  O   . LEU B 1 166 ? 13.382  5.200   29.734  1.00 39.31  ? 165 LEU B O   1 
ATOM   3172 C  CB  . LEU B 1 166 ? 12.998  3.792   26.893  1.00 43.27  ? 165 LEU B CB  1 
ATOM   3173 C  CG  . LEU B 1 166 ? 12.431  2.495   26.309  1.00 47.00  ? 165 LEU B CG  1 
ATOM   3174 C  CD1 . LEU B 1 166 ? 13.387  1.900   25.302  1.00 47.53  ? 165 LEU B CD1 1 
ATOM   3175 C  CD2 . LEU B 1 166 ? 12.154  1.510   27.432  1.00 47.30  ? 165 LEU B CD2 1 
ATOM   3176 N  N   . HIS B 1 167 ? 12.937  6.774   28.188  1.00 44.27  ? 166 HIS B N   1 
ATOM   3177 C  CA  . HIS B 1 167 ? 13.673  7.805   28.891  1.00 43.80  ? 166 HIS B CA  1 
ATOM   3178 C  C   . HIS B 1 167 ? 12.918  8.545   29.989  1.00 44.16  ? 166 HIS B C   1 
ATOM   3179 O  O   . HIS B 1 167 ? 13.542  9.034   30.929  1.00 45.77  ? 166 HIS B O   1 
ATOM   3180 C  CB  . HIS B 1 167 ? 14.324  8.764   27.896  1.00 40.80  ? 166 HIS B CB  1 
ATOM   3181 C  CG  . HIS B 1 167 ? 15.502  8.160   27.187  1.00 42.38  ? 166 HIS B CG  1 
ATOM   3182 N  ND1 . HIS B 1 167 ? 15.379  7.416   26.033  1.00 45.00  ? 166 HIS B ND1 1 
ATOM   3183 C  CD2 . HIS B 1 167 ? 16.812  8.124   27.520  1.00 42.33  ? 166 HIS B CD2 1 
ATOM   3184 C  CE1 . HIS B 1 167 ? 16.561  6.940   25.692  1.00 41.51  ? 166 HIS B CE1 1 
ATOM   3185 N  NE2 . HIS B 1 167 ? 17.449  7.350   26.575  1.00 39.27  ? 166 HIS B NE2 1 
ATOM   3186 N  N   . ARG B 1 168 ? 11.596  8.659   29.874  1.00 45.15  ? 167 ARG B N   1 
ATOM   3187 C  CA  . ARG B 1 168 ? 10.833  9.324   30.927  1.00 48.88  ? 167 ARG B CA  1 
ATOM   3188 C  C   . ARG B 1 168 ? 10.831  8.329   32.086  1.00 46.15  ? 167 ARG B C   1 
ATOM   3189 O  O   . ARG B 1 168 ? 10.754  8.706   33.248  1.00 47.96  ? 167 ARG B O   1 
ATOM   3190 C  CB  . ARG B 1 168 ? 9.401   9.652   30.473  1.00 54.80  ? 167 ARG B CB  1 
ATOM   3191 C  CG  . ARG B 1 168 ? 8.427   8.479   30.551  1.00 62.77  ? 167 ARG B CG  1 
ATOM   3192 C  CD  . ARG B 1 168 ? 7.356   8.538   29.470  1.00 67.74  ? 167 ARG B CD  1 
ATOM   3193 N  NE  . ARG B 1 168 ? 6.169   9.306   29.836  1.00 67.41  ? 167 ARG B NE  1 
ATOM   3194 C  CZ  . ARG B 1 168 ? 4.942   9.028   29.397  1.00 67.19  ? 167 ARG B CZ  1 
ATOM   3195 N  NH1 . ARG B 1 168 ? 4.738   7.992   28.583  1.00 65.30  ? 167 ARG B NH1 1 
ATOM   3196 N  NH2 . ARG B 1 168 ? 3.925   9.813   29.726  1.00 64.18  ? 167 ARG B NH2 1 
ATOM   3197 N  N   . ILE B 1 169 ? 10.919  7.048   31.750  1.00 45.56  ? 168 ILE B N   1 
ATOM   3198 C  CA  . ILE B 1 169 ? 10.956  5.989   32.745  1.00 47.95  ? 168 ILE B CA  1 
ATOM   3199 C  C   . ILE B 1 169 ? 12.306  6.030   33.465  1.00 48.50  ? 168 ILE B C   1 
ATOM   3200 O  O   . ILE B 1 169 ? 12.374  5.878   34.686  1.00 51.43  ? 168 ILE B O   1 
ATOM   3201 C  CB  . ILE B 1 169 ? 10.761  4.594   32.082  1.00 48.73  ? 168 ILE B CB  1 
ATOM   3202 C  CG1 . ILE B 1 169 ? 9.349   4.477   31.497  1.00 47.36  ? 168 ILE B CG1 1 
ATOM   3203 C  CG2 . ILE B 1 169 ? 11.012  3.473   33.086  1.00 44.49  ? 168 ILE B CG2 1 
ATOM   3204 C  CD1 . ILE B 1 169 ? 9.074   3.142   30.818  1.00 45.38  ? 168 ILE B CD1 1 
ATOM   3205 N  N   . PHE B 1 170 ? 13.369  6.238   32.696  1.00 48.06  ? 169 PHE B N   1 
ATOM   3206 C  CA  . PHE B 1 170 ? 14.729  6.297   33.216  1.00 49.55  ? 169 PHE B CA  1 
ATOM   3207 C  C   . PHE B 1 170 ? 14.978  7.615   33.954  1.00 50.87  ? 169 PHE B C   1 
ATOM   3208 O  O   . PHE B 1 170 ? 15.587  7.640   35.025  1.00 53.28  ? 169 PHE B O   1 
ATOM   3209 C  CB  . PHE B 1 170 ? 15.711  6.149   32.050  1.00 52.05  ? 169 PHE B CB  1 
ATOM   3210 C  CG  . PHE B 1 170 ? 17.131  5.890   32.469  1.00 56.36  ? 169 PHE B CG  1 
ATOM   3211 C  CD1 . PHE B 1 170 ? 17.523  4.620   32.888  1.00 58.26  ? 169 PHE B CD1 1 
ATOM   3212 C  CD2 . PHE B 1 170 ? 18.085  6.908   32.429  1.00 56.39  ? 169 PHE B CD2 1 
ATOM   3213 C  CE1 . PHE B 1 170 ? 18.846  4.360   33.261  1.00 60.63  ? 169 PHE B CE1 1 
ATOM   3214 C  CE2 . PHE B 1 170 ? 19.412  6.661   32.799  1.00 57.77  ? 169 PHE B CE2 1 
ATOM   3215 C  CZ  . PHE B 1 170 ? 19.792  5.383   33.217  1.00 60.01  ? 169 PHE B CZ  1 
ATOM   3216 N  N   . GLU B 1 171 ? 14.538  8.709   33.350  1.00 52.77  ? 170 GLU B N   1 
ATOM   3217 C  CA  . GLU B 1 171 ? 14.691  10.036  33.925  1.00 53.58  ? 170 GLU B CA  1 
ATOM   3218 C  C   . GLU B 1 171 ? 13.403  10.787  33.622  1.00 52.65  ? 170 GLU B C   1 
ATOM   3219 O  O   . GLU B 1 171 ? 13.297  11.481  32.619  1.00 48.52  ? 170 GLU B O   1 
ATOM   3220 C  CB  . GLU B 1 171 ? 15.893  10.750  33.305  1.00 56.49  ? 170 GLU B CB  1 
ATOM   3221 C  CG  . GLU B 1 171 ? 16.108  12.183  33.780  1.00 64.21  ? 170 GLU B CG  1 
ATOM   3222 C  CD  . GLU B 1 171 ? 16.314  12.291  35.278  1.00 72.00  ? 170 GLU B CD  1 
ATOM   3223 O  OE1 . GLU B 1 171 ? 17.225  11.614  35.809  1.00 72.50  ? 170 GLU B OE1 1 
ATOM   3224 O  OE2 . GLU B 1 171 ? 15.560  13.055  35.921  1.00 76.44  ? 170 GLU B OE2 1 
ATOM   3225 N  N   . PRO B 1 172 ? 12.412  10.669  34.513  1.00 55.10  ? 171 PRO B N   1 
ATOM   3226 C  CA  . PRO B 1 172 ? 11.085  11.290  34.431  1.00 57.95  ? 171 PRO B CA  1 
ATOM   3227 C  C   . PRO B 1 172 ? 11.023  12.759  34.026  1.00 60.08  ? 171 PRO B C   1 
ATOM   3228 O  O   . PRO B 1 172 ? 10.167  13.145  33.233  1.00 62.62  ? 171 PRO B O   1 
ATOM   3229 C  CB  . PRO B 1 172 ? 10.534  11.073  35.835  1.00 56.38  ? 171 PRO B CB  1 
ATOM   3230 C  CG  . PRO B 1 172 ? 11.124  9.747   36.204  1.00 56.97  ? 171 PRO B CG  1 
ATOM   3231 C  CD  . PRO B 1 172 ? 12.553  9.917   35.772  1.00 55.06  ? 171 PRO B CD  1 
ATOM   3232 N  N   . LYS B 1 173 ? 11.886  13.584  34.606  1.00 61.38  ? 172 LYS B N   1 
ATOM   3233 C  CA  . LYS B 1 173 ? 11.899  15.011  34.294  1.00 59.67  ? 172 LYS B CA  1 
ATOM   3234 C  C   . LYS B 1 173 ? 12.549  15.344  32.946  1.00 55.40  ? 172 LYS B C   1 
ATOM   3235 O  O   . LYS B 1 173 ? 12.512  16.496  32.509  1.00 52.61  ? 172 LYS B O   1 
ATOM   3236 C  CB  . LYS B 1 173 ? 12.635  15.783  35.401  1.00 66.55  ? 172 LYS B CB  1 
ATOM   3237 C  CG  . LYS B 1 173 ? 11.958  15.794  36.775  1.00 72.53  ? 172 LYS B CG  1 
ATOM   3238 C  CD  . LYS B 1 173 ? 12.895  16.375  37.849  1.00 75.96  ? 172 LYS B CD  1 
ATOM   3239 C  CE  . LYS B 1 173 ? 12.234  16.479  39.230  1.00 74.38  ? 172 LYS B CE  1 
ATOM   3240 N  NZ  . LYS B 1 173 ? 11.187  17.541  39.307  1.00 76.65  ? 172 LYS B NZ  1 
ATOM   3241 N  N   . CYS B 1 174 ? 13.147  14.347  32.296  1.00 52.76  ? 173 CYS B N   1 
ATOM   3242 C  CA  . CYS B 1 174 ? 13.842  14.563  31.025  1.00 51.97  ? 173 CYS B CA  1 
ATOM   3243 C  C   . CYS B 1 174 ? 13.072  15.288  29.936  1.00 53.52  ? 173 CYS B C   1 
ATOM   3244 O  O   . CYS B 1 174 ? 13.649  16.084  29.189  1.00 52.52  ? 173 CYS B O   1 
ATOM   3245 C  CB  . CYS B 1 174 ? 14.406  13.251  30.471  1.00 49.52  ? 173 CYS B CB  1 
ATOM   3246 S  SG  . CYS B 1 174 ? 13.201  12.034  29.941  1.00 47.45  ? 173 CYS B SG  1 
ATOM   3247 N  N   . LEU B 1 175 ? 11.770  15.033  29.855  1.00 55.96  ? 174 LEU B N   1 
ATOM   3248 C  CA  . LEU B 1 175 ? 10.932  15.650  28.830  1.00 56.09  ? 174 LEU B CA  1 
ATOM   3249 C  C   . LEU B 1 175 ? 10.332  17.007  29.157  1.00 55.36  ? 174 LEU B C   1 
ATOM   3250 O  O   . LEU B 1 175 ? 9.872   17.703  28.254  1.00 55.46  ? 174 LEU B O   1 
ATOM   3251 C  CB  . LEU B 1 175 ? 9.807   14.695  28.434  1.00 57.73  ? 174 LEU B CB  1 
ATOM   3252 C  CG  . LEU B 1 175 ? 10.080  13.682  27.322  1.00 60.30  ? 174 LEU B CG  1 
ATOM   3253 C  CD1 . LEU B 1 175 ? 11.522  13.210  27.334  1.00 64.17  ? 174 LEU B CD1 1 
ATOM   3254 C  CD2 . LEU B 1 175 ? 9.136   12.508  27.484  1.00 61.68  ? 174 LEU B CD2 1 
ATOM   3255 N  N   . ASP B 1 176 ? 10.324  17.376  30.436  1.00 53.37  ? 175 ASP B N   1 
ATOM   3256 C  CA  . ASP B 1 176 ? 9.737   18.639  30.885  1.00 51.67  ? 175 ASP B CA  1 
ATOM   3257 C  C   . ASP B 1 176 ? 10.125  19.859  30.071  1.00 49.94  ? 175 ASP B C   1 
ATOM   3258 O  O   . ASP B 1 176 ? 9.317   20.765  29.884  1.00 50.42  ? 175 ASP B O   1 
ATOM   3259 C  CB  . ASP B 1 176 ? 10.068  18.903  32.356  1.00 54.41  ? 175 ASP B CB  1 
ATOM   3260 C  CG  . ASP B 1 176 ? 9.607   17.785  33.280  1.00 61.14  ? 175 ASP B CG  1 
ATOM   3261 O  OD1 . ASP B 1 176 ? 9.004   16.796  32.805  1.00 62.76  ? 175 ASP B OD1 1 
ATOM   3262 O  OD2 . ASP B 1 176 ? 9.866   17.898  34.498  1.00 66.46  ? 175 ASP B OD2 1 
ATOM   3263 N  N   . ALA B 1 177 ? 11.368  19.899  29.611  1.00 49.18  ? 176 ALA B N   1 
ATOM   3264 C  CA  . ALA B 1 177 ? 11.852  21.038  28.837  1.00 49.66  ? 176 ALA B CA  1 
ATOM   3265 C  C   . ALA B 1 177 ? 11.379  21.075  27.380  1.00 50.65  ? 176 ALA B C   1 
ATOM   3266 O  O   . ALA B 1 177 ? 11.573  22.082  26.693  1.00 50.70  ? 176 ALA B O   1 
ATOM   3267 C  CB  . ALA B 1 177 ? 13.376  21.102  28.905  1.00 47.70  ? 176 ALA B CB  1 
ATOM   3268 N  N   . PHE B 1 178 ? 10.766  19.989  26.909  1.00 50.04  ? 177 PHE B N   1 
ATOM   3269 C  CA  . PHE B 1 178 ? 10.281  19.915  25.528  1.00 46.77  ? 177 PHE B CA  1 
ATOM   3270 C  C   . PHE B 1 178 ? 8.798   19.591  25.496  1.00 48.84  ? 177 PHE B C   1 
ATOM   3271 O  O   . PHE B 1 178 ? 8.402   18.427  25.389  1.00 49.84  ? 177 PHE B O   1 
ATOM   3272 C  CB  . PHE B 1 178 ? 11.069  18.867  24.749  1.00 45.08  ? 177 PHE B CB  1 
ATOM   3273 C  CG  . PHE B 1 178 ? 12.533  18.894  25.046  1.00 43.75  ? 177 PHE B CG  1 
ATOM   3274 C  CD1 . PHE B 1 178 ? 13.336  19.912  24.544  1.00 36.27  ? 177 PHE B CD1 1 
ATOM   3275 C  CD2 . PHE B 1 178 ? 13.098  17.948  25.902  1.00 44.79  ? 177 PHE B CD2 1 
ATOM   3276 C  CE1 . PHE B 1 178 ? 14.677  19.995  24.891  1.00 33.74  ? 177 PHE B CE1 1 
ATOM   3277 C  CE2 . PHE B 1 178 ? 14.440  18.022  26.256  1.00 41.59  ? 177 PHE B CE2 1 
ATOM   3278 C  CZ  . PHE B 1 178 ? 15.232  19.049  25.749  1.00 35.04  ? 177 PHE B CZ  1 
ATOM   3279 N  N   . PRO B 1 179 ? 7.955   20.632  25.585  1.00 50.66  ? 178 PRO B N   1 
ATOM   3280 C  CA  . PRO B 1 179 ? 6.502   20.469  25.573  1.00 49.12  ? 178 PRO B CA  1 
ATOM   3281 C  C   . PRO B 1 179 ? 5.977   19.750  24.335  1.00 43.71  ? 178 PRO B C   1 
ATOM   3282 O  O   . PRO B 1 179 ? 5.108   18.891  24.442  1.00 43.95  ? 178 PRO B O   1 
ATOM   3283 C  CB  . PRO B 1 179 ? 5.994   21.909  25.679  1.00 48.69  ? 178 PRO B CB  1 
ATOM   3284 C  CG  . PRO B 1 179 ? 7.097   22.719  25.054  1.00 51.98  ? 178 PRO B CG  1 
ATOM   3285 C  CD  . PRO B 1 179 ? 8.322   22.060  25.626  1.00 50.58  ? 178 PRO B CD  1 
ATOM   3286 N  N   . ASN B 1 180 ? 6.520   20.083  23.169  1.00 41.10  ? 179 ASN B N   1 
ATOM   3287 C  CA  . ASN B 1 180 ? 6.081   19.449  21.931  1.00 43.92  ? 179 ASN B CA  1 
ATOM   3288 C  C   . ASN B 1 180 ? 6.283   17.936  21.931  1.00 44.53  ? 179 ASN B C   1 
ATOM   3289 O  O   . ASN B 1 180 ? 5.542   17.215  21.257  1.00 47.65  ? 179 ASN B O   1 
ATOM   3290 C  CB  . ASN B 1 180 ? 6.758   20.083  20.715  1.00 44.69  ? 179 ASN B CB  1 
ATOM   3291 C  CG  . ASN B 1 180 ? 8.247   19.865  20.694  1.00 46.18  ? 179 ASN B CG  1 
ATOM   3292 O  OD1 . ASN B 1 180 ? 8.858   19.862  19.634  1.00 48.14  ? 179 ASN B OD1 1 
ATOM   3293 N  ND2 . ASN B 1 180 ? 8.845   19.694  21.870  1.00 50.41  ? 179 ASN B ND2 1 
ATOM   3294 N  N   . LEU B 1 181 ? 7.282   17.460  22.673  1.00 45.01  ? 180 LEU B N   1 
ATOM   3295 C  CA  . LEU B 1 181 ? 7.554   16.027  22.771  1.00 42.91  ? 180 LEU B CA  1 
ATOM   3296 C  C   . LEU B 1 181 ? 6.550   15.378  23.708  1.00 41.95  ? 180 LEU B C   1 
ATOM   3297 O  O   . LEU B 1 181 ? 6.249   14.188  23.589  1.00 42.91  ? 180 LEU B O   1 
ATOM   3298 C  CB  . LEU B 1 181 ? 8.964   15.764  23.299  1.00 44.51  ? 180 LEU B CB  1 
ATOM   3299 C  CG  . LEU B 1 181 ? 10.155  16.173  22.435  1.00 46.88  ? 180 LEU B CG  1 
ATOM   3300 C  CD1 . LEU B 1 181 ? 11.422  15.666  23.106  1.00 52.05  ? 180 LEU B CD1 1 
ATOM   3301 C  CD2 . LEU B 1 181 ? 10.025  15.580  21.040  1.00 45.44  ? 180 LEU B CD2 1 
ATOM   3302 N  N   . LYS B 1 182 ? 6.107   16.140  24.698  1.00 41.93  ? 181 LYS B N   1 
ATOM   3303 C  CA  . LYS B 1 182 ? 5.116   15.639  25.637  1.00 48.07  ? 181 LYS B CA  1 
ATOM   3304 C  C   . LYS B 1 182 ? 3.787   15.517  24.892  1.00 49.62  ? 181 LYS B C   1 
ATOM   3305 O  O   . LYS B 1 182 ? 3.068   14.525  25.046  1.00 50.80  ? 181 LYS B O   1 
ATOM   3306 C  CB  . LYS B 1 182 ? 4.982   16.577  26.837  1.00 53.05  ? 181 LYS B CB  1 
ATOM   3307 C  CG  . LYS B 1 182 ? 5.969   16.287  27.960  1.00 59.10  ? 181 LYS B CG  1 
ATOM   3308 C  CD  . LYS B 1 182 ? 5.813   17.301  29.072  1.00 63.43  ? 181 LYS B CD  1 
ATOM   3309 C  CE  . LYS B 1 182 ? 6.515   16.859  30.329  1.00 65.48  ? 181 LYS B CE  1 
ATOM   3310 N  NZ  . LYS B 1 182 ? 6.432   17.920  31.368  1.00 68.63  ? 181 LYS B NZ  1 
ATOM   3311 N  N   . ASP B 1 183 ? 3.484   16.518  24.066  1.00 47.53  ? 182 ASP B N   1 
ATOM   3312 C  CA  . ASP B 1 183 ? 2.263   16.517  23.272  1.00 47.19  ? 182 ASP B CA  1 
ATOM   3313 C  C   . ASP B 1 183 ? 2.269   15.328  22.326  1.00 46.26  ? 182 ASP B C   1 
ATOM   3314 O  O   . ASP B 1 183 ? 1.213   14.815  21.964  1.00 45.12  ? 182 ASP B O   1 
ATOM   3315 C  CB  . ASP B 1 183 ? 2.139   17.808  22.469  1.00 47.01  ? 182 ASP B CB  1 
ATOM   3316 C  CG  . ASP B 1 183 ? 1.912   19.025  23.347  1.00 50.29  ? 182 ASP B CG  1 
ATOM   3317 O  OD1 . ASP B 1 183 ? 1.502   18.860  24.521  1.00 48.73  ? 182 ASP B OD1 1 
ATOM   3318 O  OD2 . ASP B 1 183 ? 2.150   20.153  22.858  1.00 51.72  ? 182 ASP B OD2 1 
ATOM   3319 N  N   . PHE B 1 184 ? 3.460   14.934  21.882  1.00 42.74  ? 183 PHE B N   1 
ATOM   3320 C  CA  . PHE B 1 184 ? 3.599   13.788  21.000  1.00 42.09  ? 183 PHE B CA  1 
ATOM   3321 C  C   . PHE B 1 184 ? 3.160   12.536  21.754  1.00 41.52  ? 183 PHE B C   1 
ATOM   3322 O  O   . PHE B 1 184 ? 2.393   11.722  21.235  1.00 41.20  ? 183 PHE B O   1 
ATOM   3323 C  CB  . PHE B 1 184 ? 5.057   13.638  20.529  1.00 45.09  ? 183 PHE B CB  1 
ATOM   3324 C  CG  . PHE B 1 184 ? 5.336   12.334  19.805  1.00 49.67  ? 183 PHE B CG  1 
ATOM   3325 C  CD1 . PHE B 1 184 ? 4.982   12.167  18.467  1.00 51.40  ? 183 PHE B CD1 1 
ATOM   3326 C  CD2 . PHE B 1 184 ? 5.917   11.262  20.474  1.00 49.78  ? 183 PHE B CD2 1 
ATOM   3327 C  CE1 . PHE B 1 184 ? 5.197   10.942  17.806  1.00 47.88  ? 183 PHE B CE1 1 
ATOM   3328 C  CE2 . PHE B 1 184 ? 6.135   10.038  19.824  1.00 49.86  ? 183 PHE B CE2 1 
ATOM   3329 C  CZ  . PHE B 1 184 ? 5.772   9.881   18.484  1.00 48.50  ? 183 PHE B CZ  1 
ATOM   3330 N  N   . ILE B 1 185 ? 3.678   12.369  22.966  1.00 42.24  ? 184 ILE B N   1 
ATOM   3331 C  CA  . ILE B 1 185 ? 3.341   11.206  23.789  1.00 47.78  ? 184 ILE B CA  1 
ATOM   3332 C  C   . ILE B 1 185 ? 1.841   11.156  24.106  1.00 49.48  ? 184 ILE B C   1 
ATOM   3333 O  O   . ILE B 1 185 ? 1.231   10.073  24.119  1.00 48.17  ? 184 ILE B O   1 
ATOM   3334 C  CB  . ILE B 1 185 ? 4.184   11.179  25.096  1.00 46.95  ? 184 ILE B CB  1 
ATOM   3335 C  CG1 . ILE B 1 185 ? 5.673   11.095  24.740  1.00 46.46  ? 184 ILE B CG1 1 
ATOM   3336 C  CG2 . ILE B 1 185 ? 3.794   9.981   25.971  1.00 38.85  ? 184 ILE B CG2 1 
ATOM   3337 C  CD1 . ILE B 1 185 ? 6.577   10.975  25.941  1.00 51.43  ? 184 ILE B CD1 1 
ATOM   3338 N  N   . SER B 1 186 ? 1.265   12.323  24.387  1.00 49.93  ? 185 SER B N   1 
ATOM   3339 C  CA  . SER B 1 186 ? -0.161  12.426  24.681  1.00 50.23  ? 185 SER B CA  1 
ATOM   3340 C  C   . SER B 1 186 ? -0.924  11.989  23.429  1.00 48.24  ? 185 SER B C   1 
ATOM   3341 O  O   . SER B 1 186 ? -1.762  11.081  23.459  1.00 48.52  ? 185 SER B O   1 
ATOM   3342 C  CB  . SER B 1 186 ? -0.521  13.875  25.024  1.00 52.79  ? 185 SER B CB  1 
ATOM   3343 O  OG  . SER B 1 186 ? 0.203   14.334  26.155  1.00 59.86  ? 185 SER B OG  1 
ATOM   3344 N  N   . ARG B 1 187 ? -0.591  12.640  22.323  1.00 46.25  ? 186 ARG B N   1 
ATOM   3345 C  CA  . ARG B 1 187 ? -1.200  12.369  21.038  1.00 43.90  ? 186 ARG B CA  1 
ATOM   3346 C  C   . ARG B 1 187 ? -1.051  10.899  20.640  1.00 40.77  ? 186 ARG B C   1 
ATOM   3347 O  O   . ARG B 1 187 ? -1.973  10.309  20.076  1.00 41.21  ? 186 ARG B O   1 
ATOM   3348 C  CB  . ARG B 1 187 ? -0.580  13.302  19.999  1.00 41.43  ? 186 ARG B CB  1 
ATOM   3349 C  CG  . ARG B 1 187 ? -1.179  13.254  18.622  1.00 42.70  ? 186 ARG B CG  1 
ATOM   3350 C  CD  . ARG B 1 187 ? -0.900  14.555  17.869  1.00 48.56  ? 186 ARG B CD  1 
ATOM   3351 N  NE  . ARG B 1 187 ? 0.520   14.912  17.856  1.00 46.63  ? 186 ARG B NE  1 
ATOM   3352 C  CZ  . ARG B 1 187 ? 1.030   15.982  18.462  1.00 41.76  ? 186 ARG B CZ  1 
ATOM   3353 N  NH1 . ARG B 1 187 ? 0.237   16.805  19.135  1.00 41.98  ? 186 ARG B NH1 1 
ATOM   3354 N  NH2 . ARG B 1 187 ? 2.333   16.233  18.389  1.00 31.41  ? 186 ARG B NH2 1 
ATOM   3355 N  N   . PHE B 1 188 ? 0.098   10.305  20.941  1.00 39.92  ? 187 PHE B N   1 
ATOM   3356 C  CA  . PHE B 1 188 ? 0.321   8.906   20.596  1.00 41.17  ? 187 PHE B CA  1 
ATOM   3357 C  C   . PHE B 1 188 ? -0.458  7.955   21.499  1.00 43.85  ? 187 PHE B C   1 
ATOM   3358 O  O   . PHE B 1 188 ? -1.094  7.015   21.016  1.00 42.69  ? 187 PHE B O   1 
ATOM   3359 C  CB  . PHE B 1 188 ? 1.814   8.559   20.621  1.00 37.54  ? 187 PHE B CB  1 
ATOM   3360 C  CG  . PHE B 1 188 ? 2.122   7.141   20.185  1.00 35.47  ? 187 PHE B CG  1 
ATOM   3361 C  CD1 . PHE B 1 188 ? 2.325   6.838   18.841  1.00 37.49  ? 187 PHE B CD1 1 
ATOM   3362 C  CD2 . PHE B 1 188 ? 2.197   6.104   21.114  1.00 32.09  ? 187 PHE B CD2 1 
ATOM   3363 C  CE1 . PHE B 1 188 ? 2.597   5.511   18.420  1.00 30.60  ? 187 PHE B CE1 1 
ATOM   3364 C  CE2 . PHE B 1 188 ? 2.467   4.783   20.704  1.00 27.67  ? 187 PHE B CE2 1 
ATOM   3365 C  CZ  . PHE B 1 188 ? 2.666   4.495   19.350  1.00 26.72  ? 187 PHE B CZ  1 
ATOM   3366 N  N   . GLU B 1 189 ? -0.325  8.127   22.810  1.00 49.16  ? 188 GLU B N   1 
ATOM   3367 C  CA  . GLU B 1 189 ? -1.053  7.274   23.745  1.00 50.46  ? 188 GLU B CA  1 
ATOM   3368 C  C   . GLU B 1 189 ? -2.540  7.628   23.654  1.00 50.58  ? 188 GLU B C   1 
ATOM   3369 O  O   . GLU B 1 189 ? -3.394  6.906   24.173  1.00 50.81  ? 188 GLU B O   1 
ATOM   3370 C  CB  . GLU B 1 189 ? -0.529  7.463   25.172  1.00 53.81  ? 188 GLU B CB  1 
ATOM   3371 C  CG  . GLU B 1 189 ? 0.912   7.000   25.363  1.00 58.48  ? 188 GLU B CG  1 
ATOM   3372 C  CD  . GLU B 1 189 ? 1.491   7.355   26.730  1.00 62.62  ? 188 GLU B CD  1 
ATOM   3373 O  OE1 . GLU B 1 189 ? 1.023   8.328   27.363  1.00 67.15  ? 188 GLU B OE1 1 
ATOM   3374 O  OE2 . GLU B 1 189 ? 2.438   6.663   27.166  1.00 64.09  ? 188 GLU B OE2 1 
ATOM   3375 N  N   . GLY B 1 190 ? -2.824  8.742   22.977  1.00 49.10  ? 189 GLY B N   1 
ATOM   3376 C  CA  . GLY B 1 190 ? -4.186  9.212   22.785  1.00 50.93  ? 189 GLY B CA  1 
ATOM   3377 C  C   . GLY B 1 190 ? -4.927  8.506   21.660  1.00 50.21  ? 189 GLY B C   1 
ATOM   3378 O  O   . GLY B 1 190 ? -6.150  8.607   21.558  1.00 49.67  ? 189 GLY B O   1 
ATOM   3379 N  N   . LEU B 1 191 ? -4.187  7.824   20.793  1.00 51.76  ? 190 LEU B N   1 
ATOM   3380 C  CA  . LEU B 1 191 ? -4.781  7.086   19.691  1.00 52.68  ? 190 LEU B CA  1 
ATOM   3381 C  C   . LEU B 1 191 ? -5.674  5.981   20.261  1.00 54.33  ? 190 LEU B C   1 
ATOM   3382 O  O   . LEU B 1 191 ? -5.296  5.290   21.208  1.00 50.96  ? 190 LEU B O   1 
ATOM   3383 C  CB  . LEU B 1 191 ? -3.690  6.509   18.781  1.00 51.46  ? 190 LEU B CB  1 
ATOM   3384 C  CG  . LEU B 1 191 ? -2.768  7.546   18.123  1.00 52.08  ? 190 LEU B CG  1 
ATOM   3385 C  CD1 . LEU B 1 191 ? -1.660  6.857   17.346  1.00 50.31  ? 190 LEU B CD1 1 
ATOM   3386 C  CD2 . LEU B 1 191 ? -3.565  8.477   17.215  1.00 46.94  ? 190 LEU B CD2 1 
ATOM   3387 N  N   . GLU B 1 192 ? -6.861  5.838   19.675  1.00 56.07  ? 191 GLU B N   1 
ATOM   3388 C  CA  . GLU B 1 192 ? -7.845  4.862   20.118  1.00 57.16  ? 191 GLU B CA  1 
ATOM   3389 C  C   . GLU B 1 192 ? -7.314  3.456   20.373  1.00 55.44  ? 191 GLU B C   1 
ATOM   3390 O  O   . GLU B 1 192 ? -7.400  2.956   21.491  1.00 54.74  ? 191 GLU B O   1 
ATOM   3391 C  CB  . GLU B 1 192 ? -9.008  4.804   19.133  1.00 66.61  ? 191 GLU B CB  1 
ATOM   3392 C  CG  . GLU B 1 192 ? -10.190 3.979   19.625  1.00 82.03  ? 191 GLU B CG  1 
ATOM   3393 C  CD  . GLU B 1 192 ? -11.223 3.728   18.541  1.00 90.58  ? 191 GLU B CD  1 
ATOM   3394 O  OE1 . GLU B 1 192 ? -11.394 2.554   18.141  1.00 95.54  ? 191 GLU B OE1 1 
ATOM   3395 O  OE2 . GLU B 1 192 ? -11.858 4.701   18.084  1.00 93.72  ? 191 GLU B OE2 1 
ATOM   3396 N  N   . LYS B 1 193 ? -6.789  2.810   19.338  1.00 55.93  ? 192 LYS B N   1 
ATOM   3397 C  CA  . LYS B 1 193 ? -6.280  1.449   19.496  1.00 58.75  ? 192 LYS B CA  1 
ATOM   3398 C  C   . LYS B 1 193 ? -5.064  1.338   20.404  1.00 55.54  ? 192 LYS B C   1 
ATOM   3399 O  O   . LYS B 1 193 ? -4.799  0.276   20.975  1.00 55.53  ? 192 LYS B O   1 
ATOM   3400 C  CB  . LYS B 1 193 ? -6.000  0.814   18.136  1.00 63.48  ? 192 LYS B CB  1 
ATOM   3401 C  CG  . LYS B 1 193 ? -7.259  0.609   17.332  1.00 68.43  ? 192 LYS B CG  1 
ATOM   3402 C  CD  . LYS B 1 193 ? -7.011  -0.157  16.056  1.00 74.04  ? 192 LYS B CD  1 
ATOM   3403 C  CE  . LYS B 1 193 ? -8.238  -0.077  15.163  1.00 77.06  ? 192 LYS B CE  1 
ATOM   3404 N  NZ  . LYS B 1 193 ? -8.548  1.346   14.825  1.00 79.50  ? 192 LYS B NZ  1 
ATOM   3405 N  N   . ILE B 1 194 ? -4.310  2.427   20.508  1.00 51.91  ? 193 ILE B N   1 
ATOM   3406 C  CA  . ILE B 1 194 ? -3.126  2.441   21.357  1.00 51.30  ? 193 ILE B CA  1 
ATOM   3407 C  C   . ILE B 1 194 ? -3.592  2.487   22.805  1.00 53.21  ? 193 ILE B C   1 
ATOM   3408 O  O   . ILE B 1 194 ? -3.120  1.711   23.641  1.00 49.67  ? 193 ILE B O   1 
ATOM   3409 C  CB  . ILE B 1 194 ? -2.193  3.652   21.039  1.00 48.59  ? 193 ILE B CB  1 
ATOM   3410 C  CG1 . ILE B 1 194 ? -1.563  3.481   19.657  1.00 46.64  ? 193 ILE B CG1 1 
ATOM   3411 C  CG2 . ILE B 1 194 ? -1.089  3.777   22.080  1.00 47.68  ? 193 ILE B CG2 1 
ATOM   3412 C  CD1 . ILE B 1 194 ? -0.737  2.219   19.508  1.00 39.69  ? 193 ILE B CD1 1 
ATOM   3413 N  N   . SER B 1 195 ? -4.531  3.386   23.089  1.00 55.27  ? 194 SER B N   1 
ATOM   3414 C  CA  . SER B 1 195 ? -5.065  3.533   24.437  1.00 58.62  ? 194 SER B CA  1 
ATOM   3415 C  C   . SER B 1 195 ? -5.694  2.222   24.895  1.00 59.77  ? 194 SER B C   1 
ATOM   3416 O  O   . SER B 1 195 ? -5.381  1.714   25.970  1.00 61.76  ? 194 SER B O   1 
ATOM   3417 C  CB  . SER B 1 195 ? -6.100  4.654   24.472  1.00 56.77  ? 194 SER B CB  1 
ATOM   3418 O  OG  . SER B 1 195 ? -6.553  4.887   25.797  1.00 61.91  ? 194 SER B OG  1 
ATOM   3419 N  N   . ALA B 1 196 ? -6.569  1.675   24.060  1.00 62.13  ? 195 ALA B N   1 
ATOM   3420 C  CA  . ALA B 1 196 ? -7.245  0.422   24.358  1.00 65.00  ? 195 ALA B CA  1 
ATOM   3421 C  C   . ALA B 1 196 ? -6.247  -0.684  24.693  1.00 64.85  ? 195 ALA B C   1 
ATOM   3422 O  O   . ALA B 1 196 ? -6.421  -1.408  25.674  1.00 66.73  ? 195 ALA B O   1 
ATOM   3423 C  CB  . ALA B 1 196 ? -8.113  0.012   23.174  1.00 67.55  ? 195 ALA B CB  1 
ATOM   3424 N  N   . TYR B 1 197 ? -5.229  -0.825  23.852  1.00 65.21  ? 196 TYR B N   1 
ATOM   3425 C  CA  . TYR B 1 197 ? -4.202  -1.838  24.046  1.00 67.25  ? 196 TYR B CA  1 
ATOM   3426 C  C   . TYR B 1 197 ? -3.413  -1.613  25.333  1.00 68.94  ? 196 TYR B C   1 
ATOM   3427 O  O   . TYR B 1 197 ? -2.994  -2.568  25.983  1.00 69.73  ? 196 TYR B O   1 
ATOM   3428 C  CB  . TYR B 1 197 ? -3.257  -1.865  22.842  1.00 67.21  ? 196 TYR B CB  1 
ATOM   3429 C  CG  . TYR B 1 197 ? -2.035  -2.738  23.030  1.00 67.02  ? 196 TYR B CG  1 
ATOM   3430 C  CD1 . TYR B 1 197 ? -2.144  -4.126  23.077  1.00 67.69  ? 196 TYR B CD1 1 
ATOM   3431 C  CD2 . TYR B 1 197 ? -0.767  -2.171  23.167  1.00 66.28  ? 196 TYR B CD2 1 
ATOM   3432 C  CE1 . TYR B 1 197 ? -1.019  -4.933  23.255  1.00 71.22  ? 196 TYR B CE1 1 
ATOM   3433 C  CE2 . TYR B 1 197 ? 0.366   -2.966  23.348  1.00 67.82  ? 196 TYR B CE2 1 
ATOM   3434 C  CZ  . TYR B 1 197 ? 0.233   -4.348  23.392  1.00 69.92  ? 196 TYR B CZ  1 
ATOM   3435 O  OH  . TYR B 1 197 ? 1.342   -5.145  23.583  1.00 72.87  ? 196 TYR B OH  1 
ATOM   3436 N  N   . MET B 1 198 ? -3.155  -0.354  25.669  1.00 68.86  ? 197 MET B N   1 
ATOM   3437 C  CA  . MET B 1 198 ? -2.415  -0.055  26.886  1.00 68.04  ? 197 MET B CA  1 
ATOM   3438 C  C   . MET B 1 198 ? -3.212  -0.463  28.120  1.00 68.66  ? 197 MET B C   1 
ATOM   3439 O  O   . MET B 1 198 ? -2.648  -0.699  29.190  1.00 68.88  ? 197 MET B O   1 
ATOM   3440 C  CB  . MET B 1 198 ? -2.032  1.426   26.941  1.00 66.49  ? 197 MET B CB  1 
ATOM   3441 C  CG  . MET B 1 198 ? -0.898  1.796   25.989  1.00 65.60  ? 197 MET B CG  1 
ATOM   3442 S  SD  . MET B 1 198 ? -0.425  3.534   26.065  1.00 66.03  ? 197 MET B SD  1 
ATOM   3443 C  CE  . MET B 1 198 ? 0.909   3.439   27.204  1.00 71.32  ? 197 MET B CE  1 
ATOM   3444 N  N   . LYS B 1 199 ? -4.526  -0.557  27.962  1.00 70.53  ? 198 LYS B N   1 
ATOM   3445 C  CA  . LYS B 1 199 ? -5.399  -0.947  29.056  1.00 72.11  ? 198 LYS B CA  1 
ATOM   3446 C  C   . LYS B 1 199 ? -5.733  -2.441  29.054  1.00 73.48  ? 198 LYS B C   1 
ATOM   3447 O  O   . LYS B 1 199 ? -6.361  -2.940  29.991  1.00 75.67  ? 198 LYS B O   1 
ATOM   3448 C  CB  . LYS B 1 199 ? -6.675  -0.100  29.032  1.00 71.36  ? 198 LYS B CB  1 
ATOM   3449 C  CG  . LYS B 1 199 ? -6.429  1.359   29.402  1.00 73.23  ? 198 LYS B CG  1 
ATOM   3450 C  CD  . LYS B 1 199 ? -7.665  2.231   29.214  1.00 76.48  ? 198 LYS B CD  1 
ATOM   3451 C  CE  . LYS B 1 199 ? -8.018  2.416   27.743  1.00 79.07  ? 198 LYS B CE  1 
ATOM   3452 N  NZ  . LYS B 1 199 ? -9.093  3.434   27.554  1.00 77.40  ? 198 LYS B NZ  1 
ATOM   3453 N  N   . SER B 1 200 ? -5.332  -3.153  28.007  1.00 74.58  ? 199 SER B N   1 
ATOM   3454 C  CA  . SER B 1 200 ? -5.611  -4.580  27.939  1.00 77.83  ? 199 SER B CA  1 
ATOM   3455 C  C   . SER B 1 200 ? -4.599  -5.413  28.723  1.00 80.76  ? 199 SER B C   1 
ATOM   3456 O  O   . SER B 1 200 ? -3.672  -4.880  29.342  1.00 80.71  ? 199 SER B O   1 
ATOM   3457 C  CB  . SER B 1 200 ? -5.695  -5.060  26.484  1.00 78.26  ? 199 SER B CB  1 
ATOM   3458 O  OG  . SER B 1 200 ? -4.439  -5.047  25.828  1.00 80.02  ? 199 SER B OG  1 
ATOM   3459 N  N   . SER B 1 201 ? -4.838  -6.720  28.759  1.00 84.08  ? 200 SER B N   1 
ATOM   3460 C  CA  . SER B 1 201 ? -3.967  -7.656  29.462  1.00 86.29  ? 200 SER B CA  1 
ATOM   3461 C  C   . SER B 1 201 ? -2.710  -7.955  28.651  1.00 86.65  ? 200 SER B C   1 
ATOM   3462 O  O   . SER B 1 201 ? -1.714  -8.457  29.186  1.00 87.39  ? 200 SER B O   1 
ATOM   3463 C  CB  . SER B 1 201 ? -4.716  -8.964  29.723  1.00 87.88  ? 200 SER B CB  1 
ATOM   3464 O  OG  . SER B 1 201 ? -5.208  -9.520  28.510  1.00 91.95  ? 200 SER B OG  1 
ATOM   3465 N  N   . ARG B 1 202 ? -2.774  -7.662  27.356  1.00 85.83  ? 201 ARG B N   1 
ATOM   3466 C  CA  . ARG B 1 202 ? -1.667  -7.905  26.439  1.00 83.89  ? 201 ARG B CA  1 
ATOM   3467 C  C   . ARG B 1 202 ? -0.469  -6.971  26.633  1.00 82.78  ? 201 ARG B C   1 
ATOM   3468 O  O   . ARG B 1 202 ? 0.668   -7.367  26.388  1.00 83.18  ? 201 ARG B O   1 
ATOM   3469 C  CB  . ARG B 1 202 ? -2.167  -7.821  24.989  1.00 83.32  ? 201 ARG B CB  1 
ATOM   3470 C  CG  . ARG B 1 202 ? -3.313  -8.781  24.644  1.00 80.63  ? 201 ARG B CG  1 
ATOM   3471 C  CD  . ARG B 1 202 ? -3.655  -8.754  23.150  1.00 78.72  ? 201 ARG B CD  1 
ATOM   3472 N  NE  . ARG B 1 202 ? -4.057  -7.428  22.689  1.00 78.31  ? 201 ARG B NE  1 
ATOM   3473 C  CZ  . ARG B 1 202 ? -5.232  -6.862  22.950  1.00 79.54  ? 201 ARG B CZ  1 
ATOM   3474 N  NH1 . ARG B 1 202 ? -6.142  -7.503  23.675  1.00 81.91  ? 201 ARG B NH1 1 
ATOM   3475 N  NH2 . ARG B 1 202 ? -5.498  -5.649  22.490  1.00 76.14  ? 201 ARG B NH2 1 
ATOM   3476 N  N   . PHE B 1 203 ? -0.734  -5.749  27.090  1.00 83.16  ? 202 PHE B N   1 
ATOM   3477 C  CA  . PHE B 1 203 ? 0.293   -4.726  27.311  1.00 84.18  ? 202 PHE B CA  1 
ATOM   3478 C  C   . PHE B 1 203 ? 1.464   -5.165  28.209  1.00 84.79  ? 202 PHE B C   1 
ATOM   3479 O  O   . PHE B 1 203 ? 1.289   -5.428  29.404  1.00 84.83  ? 202 PHE B O   1 
ATOM   3480 C  CB  . PHE B 1 203 ? -0.371  -3.462  27.868  1.00 84.53  ? 202 PHE B CB  1 
ATOM   3481 C  CG  . PHE B 1 203 ? 0.541   -2.272  27.953  1.00 84.86  ? 202 PHE B CG  1 
ATOM   3482 C  CD1 . PHE B 1 203 ? 1.271   -1.852  26.847  1.00 85.57  ? 202 PHE B CD1 1 
ATOM   3483 C  CD2 . PHE B 1 203 ? 0.655   -1.555  29.139  1.00 85.36  ? 202 PHE B CD2 1 
ATOM   3484 C  CE1 . PHE B 1 203 ? 2.102   -0.732  26.921  1.00 86.98  ? 202 PHE B CE1 1 
ATOM   3485 C  CE2 . PHE B 1 203 ? 1.481   -0.435  29.226  1.00 85.40  ? 202 PHE B CE2 1 
ATOM   3486 C  CZ  . PHE B 1 203 ? 2.207   -0.023  28.112  1.00 85.99  ? 202 PHE B CZ  1 
ATOM   3487 N  N   . LEU B 1 204 ? 2.673   -5.157  27.647  1.00 84.19  ? 203 LEU B N   1 
ATOM   3488 C  CA  . LEU B 1 204 ? 3.883   -5.573  28.365  1.00 83.32  ? 203 LEU B CA  1 
ATOM   3489 C  C   . LEU B 1 204 ? 4.960   -4.484  28.345  1.00 81.27  ? 203 LEU B C   1 
ATOM   3490 O  O   . LEU B 1 204 ? 5.942   -4.579  27.613  1.00 80.81  ? 203 LEU B O   1 
ATOM   3491 C  CB  . LEU B 1 204 ? 4.425   -6.864  27.732  1.00 84.38  ? 203 LEU B CB  1 
ATOM   3492 C  CG  . LEU B 1 204 ? 5.668   -7.572  28.283  1.00 84.53  ? 203 LEU B CG  1 
ATOM   3493 C  CD1 . LEU B 1 204 ? 5.425   -8.040  29.699  1.00 84.38  ? 203 LEU B CD1 1 
ATOM   3494 C  CD2 . LEU B 1 204 ? 6.004   -8.762  27.394  1.00 84.92  ? 203 LEU B CD2 1 
ATOM   3495 N  N   . PRO B 1 205 ? 4.806   -3.451  29.193  1.00 79.63  ? 204 PRO B N   1 
ATOM   3496 C  CA  . PRO B 1 205 ? 5.774   -2.352  29.249  1.00 77.66  ? 204 PRO B CA  1 
ATOM   3497 C  C   . PRO B 1 205 ? 7.099   -2.704  29.921  1.00 76.43  ? 204 PRO B C   1 
ATOM   3498 O  O   . PRO B 1 205 ? 8.089   -1.985  29.761  1.00 72.88  ? 204 PRO B O   1 
ATOM   3499 C  CB  . PRO B 1 205 ? 5.020   -1.286  30.040  1.00 75.96  ? 204 PRO B CB  1 
ATOM   3500 C  CG  . PRO B 1 205 ? 4.261   -2.117  31.035  1.00 76.83  ? 204 PRO B CG  1 
ATOM   3501 C  CD  . PRO B 1 205 ? 3.726   -3.252  30.179  1.00 77.69  ? 204 PRO B CD  1 
ATOM   3502 N  N   . ARG B 1 206 ? 7.095   -3.779  30.708  1.00 75.76  ? 205 ARG B N   1 
ATOM   3503 C  CA  . ARG B 1 206 ? 8.282   -4.233  31.438  1.00 76.12  ? 205 ARG B CA  1 
ATOM   3504 C  C   . ARG B 1 206 ? 8.276   -5.757  31.554  1.00 72.77  ? 205 ARG B C   1 
ATOM   3505 O  O   . ARG B 1 206 ? 7.219   -6.379  31.456  1.00 74.51  ? 205 ARG B O   1 
ATOM   3506 C  CB  . ARG B 1 206 ? 8.312   -3.607  32.840  1.00 79.64  ? 205 ARG B CB  1 
ATOM   3507 C  CG  . ARG B 1 206 ? 8.438   -2.095  32.829  1.00 85.79  ? 205 ARG B CG  1 
ATOM   3508 C  CD  . ARG B 1 206 ? 7.959   -1.478  34.124  1.00 90.89  ? 205 ARG B CD  1 
ATOM   3509 N  NE  . ARG B 1 206 ? 7.374   -0.159  33.892  1.00 93.19  ? 205 ARG B NE  1 
ATOM   3510 C  CZ  . ARG B 1 206 ? 7.924   0.990   34.273  1.00 93.33  ? 205 ARG B CZ  1 
ATOM   3511 N  NH1 . ARG B 1 206 ? 9.087   0.998   34.913  1.00 91.61  ? 205 ARG B NH1 1 
ATOM   3512 N  NH2 . ARG B 1 206 ? 7.310   2.134   34.008  1.00 91.93  ? 205 ARG B NH2 1 
ATOM   3513 N  N   . PRO B 1 207 ? 9.452   -6.382  31.768  1.00 68.48  ? 206 PRO B N   1 
ATOM   3514 C  CA  . PRO B 1 207 ? 10.788  -5.793  31.909  1.00 66.82  ? 206 PRO B CA  1 
ATOM   3515 C  C   . PRO B 1 207 ? 11.216  -5.073  30.637  1.00 65.79  ? 206 PRO B C   1 
ATOM   3516 O  O   . PRO B 1 207 ? 10.880  -5.510  29.534  1.00 66.06  ? 206 PRO B O   1 
ATOM   3517 C  CB  . PRO B 1 207 ? 11.683  -7.014  32.143  1.00 66.49  ? 206 PRO B CB  1 
ATOM   3518 C  CG  . PRO B 1 207 ? 10.762  -8.034  32.695  1.00 66.14  ? 206 PRO B CG  1 
ATOM   3519 C  CD  . PRO B 1 207 ? 9.531   -7.851  31.867  1.00 64.25  ? 206 PRO B CD  1 
ATOM   3520 N  N   . VAL B 1 208 ? 11.906  -3.947  30.799  1.00 64.37  ? 207 VAL B N   1 
ATOM   3521 C  CA  . VAL B 1 208 ? 12.403  -3.164  29.668  1.00 63.47  ? 207 VAL B CA  1 
ATOM   3522 C  C   . VAL B 1 208 ? 13.459  -3.966  28.896  1.00 66.17  ? 207 VAL B C   1 
ATOM   3523 O  O   . VAL B 1 208 ? 13.432  -4.024  27.662  1.00 65.13  ? 207 VAL B O   1 
ATOM   3524 C  CB  . VAL B 1 208 ? 13.031  -1.845  30.148  1.00 60.32  ? 207 VAL B CB  1 
ATOM   3525 C  CG1 . VAL B 1 208 ? 13.658  -1.106  28.991  1.00 58.63  ? 207 VAL B CG1 1 
ATOM   3526 C  CG2 . VAL B 1 208 ? 11.978  -0.986  30.824  1.00 61.45  ? 207 VAL B CG2 1 
ATOM   3527 N  N   . PHE B 1 209 ? 14.384  -4.575  29.636  1.00 71.42  ? 208 PHE B N   1 
ATOM   3528 C  CA  . PHE B 1 209 ? 15.457  -5.380  29.055  1.00 74.39  ? 208 PHE B CA  1 
ATOM   3529 C  C   . PHE B 1 209 ? 15.417  -6.830  29.549  1.00 77.33  ? 208 PHE B C   1 
ATOM   3530 O  O   . PHE B 1 209 ? 14.455  -7.247  30.207  1.00 78.33  ? 208 PHE B O   1 
ATOM   3531 C  CB  . PHE B 1 209 ? 16.818  -4.749  29.368  1.00 72.58  ? 208 PHE B CB  1 
ATOM   3532 C  CG  . PHE B 1 209 ? 17.022  -3.399  28.730  1.00 72.67  ? 208 PHE B CG  1 
ATOM   3533 C  CD1 . PHE B 1 209 ? 17.063  -3.266  27.340  1.00 73.47  ? 208 PHE B CD1 1 
ATOM   3534 C  CD2 . PHE B 1 209 ? 17.175  -2.259  29.513  1.00 70.90  ? 208 PHE B CD2 1 
ATOM   3535 C  CE1 . PHE B 1 209 ? 17.247  -2.013  26.739  1.00 70.36  ? 208 PHE B CE1 1 
ATOM   3536 C  CE2 . PHE B 1 209 ? 17.360  -1.000  28.923  1.00 70.44  ? 208 PHE B CE2 1 
ATOM   3537 C  CZ  . PHE B 1 209 ? 17.399  -0.877  27.533  1.00 66.76  ? 208 PHE B CZ  1 
ATOM   3538 N  N   . SER B 1 210 ? 16.435  -7.607  29.189  1.00 78.67  ? 209 SER B N   1 
ATOM   3539 C  CA  . SER B 1 210 ? 16.509  -9.005  29.603  1.00 80.09  ? 209 SER B CA  1 
ATOM   3540 C  C   . SER B 1 210 ? 17.041  -9.104  31.035  1.00 84.03  ? 209 SER B C   1 
ATOM   3541 O  O   . SER B 1 210 ? 17.315  -8.085  31.678  1.00 86.13  ? 209 SER B O   1 
ATOM   3542 C  CB  . SER B 1 210 ? 17.371  -9.826  28.625  1.00 77.05  ? 209 SER B CB  1 
ATOM   3543 O  OG  . SER B 1 210 ? 18.736  -9.893  29.012  1.00 77.04  ? 209 SER B OG  1 
ATOM   3544 N  N   . LYS B 1 211 ? 17.146  -10.330 31.545  1.00 86.85  ? 210 LYS B N   1 
ATOM   3545 C  CA  . LYS B 1 211 ? 17.636  -10.562 32.903  1.00 87.62  ? 210 LYS B CA  1 
ATOM   3546 C  C   . LYS B 1 211 ? 19.124  -10.213 33.096  1.00 87.21  ? 210 LYS B C   1 
ATOM   3547 O  O   . LYS B 1 211 ? 19.561  -9.946  34.218  1.00 87.73  ? 210 LYS B O   1 
ATOM   3548 C  CB  . LYS B 1 211 ? 17.359  -12.013 33.323  1.00 88.36  ? 210 LYS B CB  1 
ATOM   3549 C  CG  . LYS B 1 211 ? 15.872  -12.379 33.331  1.00 92.02  ? 210 LYS B CG  1 
ATOM   3550 C  CD  . LYS B 1 211 ? 15.647  -13.836 33.715  1.00 93.99  ? 210 LYS B CD  1 
ATOM   3551 C  CE  . LYS B 1 211 ? 14.160  -14.180 33.727  1.00 95.58  ? 210 LYS B CE  1 
ATOM   3552 N  NZ  . LYS B 1 211 ? 13.899  -15.600 34.113  1.00 95.31  ? 210 LYS B NZ  1 
ATOM   3553 N  N   . MET B 1 212 ? 19.887  -10.214 32.002  1.00 85.84  ? 211 MET B N   1 
ATOM   3554 C  CA  . MET B 1 212 ? 21.319  -9.902  32.035  1.00 83.16  ? 211 MET B CA  1 
ATOM   3555 C  C   . MET B 1 212 ? 21.581  -8.432  32.341  1.00 81.67  ? 211 MET B C   1 
ATOM   3556 O  O   . MET B 1 212 ? 22.719  -8.040  32.590  1.00 81.63  ? 211 MET B O   1 
ATOM   3557 C  CB  . MET B 1 212 ? 21.970  -10.220 30.683  1.00 85.70  ? 211 MET B CB  1 
ATOM   3558 C  CG  . MET B 1 212 ? 21.713  -11.612 30.137  1.00 87.90  ? 211 MET B CG  1 
ATOM   3559 S  SD  . MET B 1 212 ? 22.610  -11.892 28.595  1.00 93.86  ? 211 MET B SD  1 
ATOM   3560 C  CE  . MET B 1 212 ? 21.398  -11.348 27.365  1.00 94.39  ? 211 MET B CE  1 
ATOM   3561 N  N   . ALA B 1 213 ? 20.535  -7.617  32.272  1.00 81.51  ? 212 ALA B N   1 
ATOM   3562 C  CA  . ALA B 1 213 ? 20.650  -6.181  32.502  1.00 81.31  ? 212 ALA B CA  1 
ATOM   3563 C  C   . ALA B 1 213 ? 20.874  -5.762  33.945  1.00 80.45  ? 212 ALA B C   1 
ATOM   3564 O  O   . ALA B 1 213 ? 20.498  -6.465  34.882  1.00 78.35  ? 212 ALA B O   1 
ATOM   3565 C  CB  . ALA B 1 213 ? 19.428  -5.461  31.935  1.00 79.90  ? 212 ALA B CB  1 
ATOM   3566 N  N   . VAL B 1 214 ? 21.495  -4.599  34.102  1.00 80.07  ? 213 VAL B N   1 
ATOM   3567 C  CA  . VAL B 1 214 ? 21.770  -4.030  35.411  1.00 78.81  ? 213 VAL B CA  1 
ATOM   3568 C  C   . VAL B 1 214 ? 20.599  -3.130  35.800  1.00 79.31  ? 213 VAL B C   1 
ATOM   3569 O  O   . VAL B 1 214 ? 20.302  -2.956  36.984  1.00 80.75  ? 213 VAL B O   1 
ATOM   3570 C  CB  . VAL B 1 214 ? 23.076  -3.212  35.397  1.00 77.05  ? 213 VAL B CB  1 
ATOM   3571 C  CG1 . VAL B 1 214 ? 23.368  -2.661  36.784  1.00 76.87  ? 213 VAL B CG1 1 
ATOM   3572 C  CG2 . VAL B 1 214 ? 24.231  -4.089  34.914  1.00 75.53  ? 213 VAL B CG2 1 
ATOM   3573 N  N   . TRP B 1 215 ? 19.956  -2.541  34.795  1.00 79.56  ? 214 TRP B N   1 
ATOM   3574 C  CA  . TRP B 1 215 ? 18.805  -1.673  35.018  1.00 79.59  ? 214 TRP B CA  1 
ATOM   3575 C  C   . TRP B 1 215 ? 17.639  -2.127  34.144  1.00 80.23  ? 214 TRP B C   1 
ATOM   3576 O  O   . TRP B 1 215 ? 17.839  -2.548  33.001  1.00 81.24  ? 214 TRP B O   1 
ATOM   3577 C  CB  . TRP B 1 215 ? 19.152  -0.217  34.696  1.00 79.98  ? 214 TRP B CB  1 
ATOM   3578 C  CG  . TRP B 1 215 ? 18.033  0.741   34.998  1.00 80.85  ? 214 TRP B CG  1 
ATOM   3579 C  CD1 . TRP B 1 215 ? 17.841  1.435   36.157  1.00 82.02  ? 214 TRP B CD1 1 
ATOM   3580 C  CD2 . TRP B 1 215 ? 16.930  1.076   34.143  1.00 81.21  ? 214 TRP B CD2 1 
ATOM   3581 N  NE1 . TRP B 1 215 ? 16.685  2.176   36.083  1.00 82.77  ? 214 TRP B NE1 1 
ATOM   3582 C  CE2 . TRP B 1 215 ? 16.104  1.973   34.858  1.00 81.26  ? 214 TRP B CE2 1 
ATOM   3583 C  CE3 . TRP B 1 215 ? 16.554  0.703   32.844  1.00 81.58  ? 214 TRP B CE3 1 
ATOM   3584 C  CZ2 . TRP B 1 215 ? 14.927  2.501   34.317  1.00 80.63  ? 214 TRP B CZ2 1 
ATOM   3585 C  CZ3 . TRP B 1 215 ? 15.382  1.229   32.307  1.00 80.22  ? 214 TRP B CZ3 1 
ATOM   3586 C  CH2 . TRP B 1 215 ? 14.583  2.118   33.046  1.00 78.30  ? 214 TRP B CH2 1 
ATOM   3587 N  N   . GLY B 1 216 ? 16.422  -1.997  34.670  1.00 82.03  ? 215 GLY B N   1 
ATOM   3588 C  CA  . GLY B 1 216 ? 15.235  -2.395  33.930  1.00 85.01  ? 215 GLY B CA  1 
ATOM   3589 C  C   . GLY B 1 216 ? 15.212  -3.873  33.590  1.00 87.69  ? 215 GLY B C   1 
ATOM   3590 O  O   . GLY B 1 216 ? 14.545  -4.290  32.644  1.00 86.24  ? 215 GLY B O   1 
ATOM   3591 N  N   . ASN B 1 217 ? 15.968  -4.657  34.353  1.00 90.27  ? 216 ASN B N   1 
ATOM   3592 C  CA  . ASN B 1 217 ? 16.055  -6.102  34.159  1.00 91.94  ? 216 ASN B CA  1 
ATOM   3593 C  C   . ASN B 1 217 ? 14.776  -6.797  34.618  1.00 92.42  ? 216 ASN B C   1 
ATOM   3594 O  O   . ASN B 1 217 ? 14.479  -7.921  34.197  1.00 91.57  ? 216 ASN B O   1 
ATOM   3595 C  CB  . ASN B 1 217 ? 17.242  -6.667  34.944  1.00 92.79  ? 216 ASN B CB  1 
ATOM   3596 C  CG  . ASN B 1 217 ? 17.054  -6.557  36.452  1.00 95.39  ? 216 ASN B CG  1 
ATOM   3597 O  OD1 . ASN B 1 217 ? 16.946  -7.568  37.150  1.00 96.24  ? 216 ASN B OD1 1 
ATOM   3598 N  ND2 . ASN B 1 217 ? 17.006  -5.327  36.960  1.00 93.68  ? 216 ASN B ND2 1 
ATOM   3599 N  N   . LYS B 1 218 ? 14.037  -6.123  35.496  1.00 94.08  ? 217 LYS B N   1 
ATOM   3600 C  CA  . LYS B 1 218 ? 12.795  -6.653  36.045  1.00 94.95  ? 217 LYS B CA  1 
ATOM   3601 C  C   . LYS B 1 218 ? 11.640  -5.670  35.849  1.00 93.82  ? 217 LYS B C   1 
ATOM   3602 O  O   . LYS B 1 218 ? 11.862  -4.448  36.005  1.00 92.25  ? 217 LYS B O   1 
ATOM   3603 C  CB  . LYS B 1 218 ? 12.977  -6.957  37.536  1.00 97.51  ? 217 LYS B CB  1 
ATOM   3604 C  CG  . LYS B 1 218 ? 12.296  -8.234  38.007  1.00 99.67  ? 217 LYS B CG  1 
ATOM   3605 C  CD  . LYS B 1 218 ? 13.257  -9.429  38.056  1.00 100.00 ? 217 LYS B CD  1 
ATOM   3606 C  CE  . LYS B 1 218 ? 13.881  -9.752  36.697  1.00 100.00 ? 217 LYS B CE  1 
ATOM   3607 N  NZ  . LYS B 1 218 ? 12.871  -10.029 35.627  1.00 100.00 ? 217 LYS B NZ  1 
ATOM   3608 O  OXT . LYS B 1 218 ? 10.523  -6.136  35.534  1.00 93.63  ? 217 LYS B OXT 1 
ATOM   3609 N  N   . PRO C 1 2   ? 30.576  11.357  -14.292 1.00 40.46  ? 1   PRO C N   1 
ATOM   3610 C  CA  . PRO C 1 2   ? 29.487  11.437  -15.282 1.00 45.25  ? 1   PRO C CA  1 
ATOM   3611 C  C   . PRO C 1 2   ? 29.788  12.409  -16.406 1.00 48.89  ? 1   PRO C C   1 
ATOM   3612 O  O   . PRO C 1 2   ? 30.787  13.133  -16.373 1.00 53.41  ? 1   PRO C O   1 
ATOM   3613 C  CB  . PRO C 1 2   ? 28.253  11.901  -14.528 1.00 41.11  ? 1   PRO C CB  1 
ATOM   3614 C  CG  . PRO C 1 2   ? 28.872  12.748  -13.451 1.00 37.29  ? 1   PRO C CG  1 
ATOM   3615 C  CD  . PRO C 1 2   ? 30.122  11.957  -13.023 1.00 38.31  ? 1   PRO C CD  1 
ATOM   3616 N  N   . MET C 1 3   ? 28.924  12.397  -17.413 1.00 46.36  ? 2   MET C N   1 
ATOM   3617 C  CA  . MET C 1 3   ? 29.054  13.295  -18.547 1.00 42.07  ? 2   MET C CA  1 
ATOM   3618 C  C   . MET C 1 3   ? 29.001  14.709  -18.005 1.00 38.40  ? 2   MET C C   1 
ATOM   3619 O  O   . MET C 1 3   ? 28.474  14.946  -16.912 1.00 34.02  ? 2   MET C O   1 
ATOM   3620 C  CB  . MET C 1 3   ? 27.877  13.095  -19.504 1.00 46.58  ? 2   MET C CB  1 
ATOM   3621 C  CG  . MET C 1 3   ? 28.213  12.404  -20.796 1.00 46.49  ? 2   MET C CG  1 
ATOM   3622 S  SD  . MET C 1 3   ? 26.746  11.733  -21.575 1.00 45.59  ? 2   MET C SD  1 
ATOM   3623 C  CE  . MET C 1 3   ? 27.086  9.997   -21.508 1.00 48.92  ? 2   MET C CE  1 
ATOM   3624 N  N   . ILE C 1 4   ? 29.573  15.644  -18.748 1.00 35.02  ? 3   ILE C N   1 
ATOM   3625 C  CA  . ILE C 1 4   ? 29.538  17.043  -18.354 1.00 35.11  ? 3   ILE C CA  1 
ATOM   3626 C  C   . ILE C 1 4   ? 29.289  17.918  -19.583 1.00 32.25  ? 3   ILE C C   1 
ATOM   3627 O  O   . ILE C 1 4   ? 29.933  17.770  -20.628 1.00 27.07  ? 3   ILE C O   1 
ATOM   3628 C  CB  . ILE C 1 4   ? 30.785  17.484  -17.532 1.00 34.62  ? 3   ILE C CB  1 
ATOM   3629 C  CG1 . ILE C 1 4   ? 30.951  19.005  -17.604 1.00 36.30  ? 3   ILE C CG1 1 
ATOM   3630 C  CG2 . ILE C 1 4   ? 32.027  16.709  -17.944 1.00 37.32  ? 3   ILE C CG2 1 
ATOM   3631 C  CD1 . ILE C 1 4   ? 32.172  19.521  -16.902 1.00 48.05  ? 3   ILE C CD1 1 
ATOM   3632 N  N   . LEU C 1 5   ? 28.284  18.773  -19.454 1.00 28.12  ? 4   LEU C N   1 
ATOM   3633 C  CA  . LEU C 1 5   ? 27.866  19.653  -20.517 1.00 27.99  ? 4   LEU C CA  1 
ATOM   3634 C  C   . LEU C 1 5   ? 28.178  21.093  -20.182 1.00 25.43  ? 4   LEU C C   1 
ATOM   3635 O  O   . LEU C 1 5   ? 27.568  21.688  -19.294 1.00 19.34  ? 4   LEU C O   1 
ATOM   3636 C  CB  . LEU C 1 5   ? 26.362  19.482  -20.744 1.00 28.20  ? 4   LEU C CB  1 
ATOM   3637 C  CG  . LEU C 1 5   ? 25.624  20.525  -21.586 1.00 24.03  ? 4   LEU C CG  1 
ATOM   3638 C  CD1 . LEU C 1 5   ? 26.081  20.450  -23.031 1.00 23.40  ? 4   LEU C CD1 1 
ATOM   3639 C  CD2 . LEU C 1 5   ? 24.141  20.259  -21.485 1.00 21.21  ? 4   LEU C CD2 1 
ATOM   3640 N  N   . GLY C 1 6   ? 29.110  21.668  -20.917 1.00 28.19  ? 5   GLY C N   1 
ATOM   3641 C  CA  . GLY C 1 6   ? 29.450  23.045  -20.658 1.00 35.62  ? 5   GLY C CA  1 
ATOM   3642 C  C   . GLY C 1 6   ? 28.693  23.942  -21.599 1.00 39.23  ? 5   GLY C C   1 
ATOM   3643 O  O   . GLY C 1 6   ? 28.486  23.589  -22.761 1.00 40.24  ? 5   GLY C O   1 
ATOM   3644 N  N   . TYR C 1 7   ? 28.282  25.100  -21.101 1.00 38.94  ? 6   TYR C N   1 
ATOM   3645 C  CA  . TYR C 1 7   ? 27.559  26.071  -21.907 1.00 40.28  ? 6   TYR C CA  1 
ATOM   3646 C  C   . TYR C 1 7   ? 27.264  27.309  -21.083 1.00 41.83  ? 6   TYR C C   1 
ATOM   3647 O  O   . TYR C 1 7   ? 27.549  27.344  -19.888 1.00 44.19  ? 6   TYR C O   1 
ATOM   3648 C  CB  . TYR C 1 7   ? 26.245  25.483  -22.401 1.00 42.37  ? 6   TYR C CB  1 
ATOM   3649 C  CG  . TYR C 1 7   ? 25.599  26.317  -23.473 1.00 45.33  ? 6   TYR C CG  1 
ATOM   3650 C  CD1 . TYR C 1 7   ? 26.235  26.517  -24.693 1.00 46.92  ? 6   TYR C CD1 1 
ATOM   3651 C  CD2 . TYR C 1 7   ? 24.338  26.883  -23.286 1.00 48.00  ? 6   TYR C CD2 1 
ATOM   3652 C  CE1 . TYR C 1 7   ? 25.636  27.255  -25.709 1.00 47.11  ? 6   TYR C CE1 1 
ATOM   3653 C  CE2 . TYR C 1 7   ? 23.724  27.626  -24.298 1.00 47.12  ? 6   TYR C CE2 1 
ATOM   3654 C  CZ  . TYR C 1 7   ? 24.383  27.801  -25.506 1.00 46.55  ? 6   TYR C CZ  1 
ATOM   3655 O  OH  . TYR C 1 7   ? 23.796  28.492  -26.530 1.00 45.47  ? 6   TYR C OH  1 
ATOM   3656 N  N   . TRP C 1 8   ? 26.726  28.341  -21.720 1.00 40.51  ? 7   TRP C N   1 
ATOM   3657 C  CA  . TRP C 1 8   ? 26.381  29.543  -20.981 1.00 46.03  ? 7   TRP C CA  1 
ATOM   3658 C  C   . TRP C 1 8   ? 25.204  29.229  -20.068 1.00 49.34  ? 7   TRP C C   1 
ATOM   3659 O  O   . TRP C 1 8   ? 24.545  28.195  -20.216 1.00 47.26  ? 7   TRP C O   1 
ATOM   3660 C  CB  . TRP C 1 8   ? 26.026  30.681  -21.930 1.00 48.66  ? 7   TRP C CB  1 
ATOM   3661 C  CG  . TRP C 1 8   ? 27.171  31.067  -22.811 1.00 52.59  ? 7   TRP C CG  1 
ATOM   3662 C  CD1 . TRP C 1 8   ? 27.347  30.727  -24.119 1.00 53.36  ? 7   TRP C CD1 1 
ATOM   3663 C  CD2 . TRP C 1 8   ? 28.317  31.848  -22.441 1.00 52.36  ? 7   TRP C CD2 1 
ATOM   3664 N  NE1 . TRP C 1 8   ? 28.534  31.243  -24.587 1.00 49.10  ? 7   TRP C NE1 1 
ATOM   3665 C  CE2 . TRP C 1 8   ? 29.148  31.936  -23.580 1.00 49.97  ? 7   TRP C CE2 1 
ATOM   3666 C  CE3 . TRP C 1 8   ? 28.724  32.479  -21.257 1.00 53.56  ? 7   TRP C CE3 1 
ATOM   3667 C  CZ2 . TRP C 1 8   ? 30.364  32.634  -23.569 1.00 51.81  ? 7   TRP C CZ2 1 
ATOM   3668 C  CZ3 . TRP C 1 8   ? 29.939  33.175  -21.249 1.00 51.84  ? 7   TRP C CZ3 1 
ATOM   3669 C  CH2 . TRP C 1 8   ? 30.741  33.243  -22.397 1.00 53.02  ? 7   TRP C CH2 1 
ATOM   3670 N  N   . ASP C 1 9   ? 24.963  30.110  -19.103 1.00 55.60  ? 8   ASP C N   1 
ATOM   3671 C  CA  . ASP C 1 9   ? 23.868  29.931  -18.162 1.00 59.22  ? 8   ASP C CA  1 
ATOM   3672 C  C   . ASP C 1 9   ? 22.596  30.424  -18.846 1.00 59.45  ? 8   ASP C C   1 
ATOM   3673 O  O   . ASP C 1 9   ? 21.928  31.337  -18.354 1.00 61.77  ? 8   ASP C O   1 
ATOM   3674 C  CB  . ASP C 1 9   ? 24.146  30.726  -16.876 1.00 65.70  ? 8   ASP C CB  1 
ATOM   3675 C  CG  . ASP C 1 9   ? 23.234  30.320  -15.711 1.00 72.79  ? 8   ASP C CG  1 
ATOM   3676 O  OD1 . ASP C 1 9   ? 23.319  30.973  -14.647 1.00 78.61  ? 8   ASP C OD1 1 
ATOM   3677 O  OD2 . ASP C 1 9   ? 22.445  29.353  -15.847 1.00 69.70  ? 8   ASP C OD2 1 
ATOM   3678 N  N   . ILE C 1 10  ? 22.308  29.849  -20.012 1.00 57.68  ? 9   ILE C N   1 
ATOM   3679 C  CA  . ILE C 1 10  ? 21.130  30.199  -20.802 1.00 54.48  ? 9   ILE C CA  1 
ATOM   3680 C  C   . ILE C 1 10  ? 20.616  28.986  -21.574 1.00 52.37  ? 9   ILE C C   1 
ATOM   3681 O  O   . ILE C 1 10  ? 21.223  27.910  -21.551 1.00 52.54  ? 9   ILE C O   1 
ATOM   3682 C  CB  . ILE C 1 10  ? 21.419  31.310  -21.837 1.00 55.63  ? 9   ILE C CB  1 
ATOM   3683 C  CG1 . ILE C 1 10  ? 22.452  30.822  -22.859 1.00 53.83  ? 9   ILE C CG1 1 
ATOM   3684 C  CG2 . ILE C 1 10  ? 21.855  32.593  -21.138 1.00 52.66  ? 9   ILE C CG2 1 
ATOM   3685 C  CD1 . ILE C 1 10  ? 22.559  31.696  -24.080 1.00 50.53  ? 9   ILE C CD1 1 
ATOM   3686 N  N   . ARG C 1 11  ? 19.494  29.183  -22.257 1.00 49.14  ? 10  ARG C N   1 
ATOM   3687 C  CA  . ARG C 1 11  ? 18.866  28.134  -23.048 1.00 48.67  ? 10  ARG C CA  1 
ATOM   3688 C  C   . ARG C 1 11  ? 19.702  27.878  -24.302 1.00 46.34  ? 10  ARG C C   1 
ATOM   3689 O  O   . ARG C 1 11  ? 20.324  26.819  -24.447 1.00 43.53  ? 10  ARG C O   1 
ATOM   3690 C  CB  . ARG C 1 11  ? 17.452  28.563  -23.433 1.00 48.02  ? 10  ARG C CB  1 
ATOM   3691 C  CG  . ARG C 1 11  ? 16.712  27.578  -24.298 1.00 48.90  ? 10  ARG C CG  1 
ATOM   3692 C  CD  . ARG C 1 11  ? 15.347  28.124  -24.636 1.00 52.18  ? 10  ARG C CD  1 
ATOM   3693 N  NE  . ARG C 1 11  ? 14.605  27.258  -25.542 1.00 52.08  ? 10  ARG C NE  1 
ATOM   3694 C  CZ  . ARG C 1 11  ? 13.294  27.045  -25.461 1.00 51.33  ? 10  ARG C CZ  1 
ATOM   3695 N  NH1 . ARG C 1 11  ? 12.570  27.625  -24.505 1.00 49.17  ? 10  ARG C NH1 1 
ATOM   3696 N  NH2 . ARG C 1 11  ? 12.695  26.280  -26.361 1.00 45.97  ? 10  ARG C NH2 1 
ATOM   3697 N  N   . GLY C 1 12  ? 19.678  28.850  -25.215 1.00 42.79  ? 11  GLY C N   1 
ATOM   3698 C  CA  . GLY C 1 12  ? 20.437  28.766  -26.452 1.00 41.04  ? 11  GLY C CA  1 
ATOM   3699 C  C   . GLY C 1 12  ? 20.400  27.443  -27.197 1.00 41.73  ? 11  GLY C C   1 
ATOM   3700 O  O   . GLY C 1 12  ? 19.325  26.877  -27.451 1.00 41.49  ? 11  GLY C O   1 
ATOM   3701 N  N   . LEU C 1 13  ? 21.591  26.968  -27.560 1.00 39.01  ? 12  LEU C N   1 
ATOM   3702 C  CA  . LEU C 1 13  ? 21.776  25.727  -28.305 1.00 37.14  ? 12  LEU C CA  1 
ATOM   3703 C  C   . LEU C 1 13  ? 21.873  24.470  -27.450 1.00 38.83  ? 12  LEU C C   1 
ATOM   3704 O  O   . LEU C 1 13  ? 21.965  23.357  -27.986 1.00 36.29  ? 12  LEU C O   1 
ATOM   3705 C  CB  . LEU C 1 13  ? 23.034  25.833  -29.162 1.00 34.24  ? 12  LEU C CB  1 
ATOM   3706 C  CG  . LEU C 1 13  ? 22.997  26.919  -30.230 1.00 34.92  ? 12  LEU C CG  1 
ATOM   3707 C  CD1 . LEU C 1 13  ? 24.325  26.999  -30.956 1.00 27.76  ? 12  LEU C CD1 1 
ATOM   3708 C  CD2 . LEU C 1 13  ? 21.886  26.600  -31.210 1.00 36.39  ? 12  LEU C CD2 1 
ATOM   3709 N  N   . ALA C 1 14  ? 21.898  24.651  -26.131 1.00 40.52  ? 13  ALA C N   1 
ATOM   3710 C  CA  . ALA C 1 14  ? 21.998  23.537  -25.193 1.00 37.22  ? 13  ALA C CA  1 
ATOM   3711 C  C   . ALA C 1 14  ? 20.644  22.925  -24.871 1.00 33.35  ? 13  ALA C C   1 
ATOM   3712 O  O   . ALA C 1 14  ? 20.557  21.775  -24.422 1.00 30.67  ? 13  ALA C O   1 
ATOM   3713 C  CB  . ALA C 1 14  ? 22.663  23.993  -23.920 1.00 40.97  ? 13  ALA C CB  1 
ATOM   3714 N  N   . HIS C 1 15  ? 19.595  23.690  -25.139 1.00 31.59  ? 14  HIS C N   1 
ATOM   3715 C  CA  . HIS C 1 15  ? 18.245  23.250  -24.852 1.00 29.51  ? 14  HIS C CA  1 
ATOM   3716 C  C   . HIS C 1 15  ? 17.931  21.839  -25.326 1.00 25.43  ? 14  HIS C C   1 
ATOM   3717 O  O   . HIS C 1 15  ? 17.623  20.959  -24.526 1.00 24.07  ? 14  HIS C O   1 
ATOM   3718 C  CB  . HIS C 1 15  ? 17.224  24.232  -25.415 1.00 26.31  ? 14  HIS C CB  1 
ATOM   3719 C  CG  . HIS C 1 15  ? 15.919  24.201  -24.686 1.00 25.35  ? 14  HIS C CG  1 
ATOM   3720 N  ND1 . HIS C 1 15  ? 15.819  24.494  -23.348 1.00 30.06  ? 14  HIS C ND1 1 
ATOM   3721 C  CD2 . HIS C 1 15  ? 14.672  23.862  -25.088 1.00 22.83  ? 14  HIS C CD2 1 
ATOM   3722 C  CE1 . HIS C 1 15  ? 14.575  24.334  -22.947 1.00 29.59  ? 14  HIS C CE1 1 
ATOM   3723 N  NE2 . HIS C 1 15  ? 13.853  23.948  -23.986 1.00 18.34  ? 14  HIS C NE2 1 
ATOM   3724 N  N   . ALA C 1 16  ? 17.981  21.630  -26.632 1.00 23.02  ? 15  ALA C N   1 
ATOM   3725 C  CA  . ALA C 1 16  ? 17.690  20.322  -27.189 1.00 26.41  ? 15  ALA C CA  1 
ATOM   3726 C  C   . ALA C 1 16  ? 18.561  19.230  -26.593 1.00 28.59  ? 15  ALA C C   1 
ATOM   3727 O  O   . ALA C 1 16  ? 18.116  18.090  -26.413 1.00 25.03  ? 15  ALA C O   1 
ATOM   3728 C  CB  . ALA C 1 16  ? 17.852  20.357  -28.688 1.00 19.06  ? 15  ALA C CB  1 
ATOM   3729 N  N   . ILE C 1 17  ? 19.818  19.577  -26.323 1.00 30.38  ? 16  ILE C N   1 
ATOM   3730 C  CA  . ILE C 1 17  ? 20.787  18.633  -25.765 1.00 32.82  ? 16  ILE C CA  1 
ATOM   3731 C  C   . ILE C 1 17  ? 20.329  18.178  -24.402 1.00 34.46  ? 16  ILE C C   1 
ATOM   3732 O  O   . ILE C 1 17  ? 20.303  16.984  -24.114 1.00 32.72  ? 16  ILE C O   1 
ATOM   3733 C  CB  . ILE C 1 17  ? 22.196  19.267  -25.636 1.00 31.19  ? 16  ILE C CB  1 
ATOM   3734 C  CG1 . ILE C 1 17  ? 22.701  19.708  -27.017 1.00 25.98  ? 16  ILE C CG1 1 
ATOM   3735 C  CG2 . ILE C 1 17  ? 23.163  18.275  -24.998 1.00 30.43  ? 16  ILE C CG2 1 
ATOM   3736 C  CD1 . ILE C 1 17  ? 24.076  20.364  -27.016 1.00 27.20  ? 16  ILE C CD1 1 
ATOM   3737 N  N   . ARG C 1 18  ? 20.021  19.151  -23.554 1.00 34.04  ? 17  ARG C N   1 
ATOM   3738 C  CA  . ARG C 1 18  ? 19.557  18.882  -22.205 1.00 35.80  ? 17  ARG C CA  1 
ATOM   3739 C  C   . ARG C 1 18  ? 18.339  17.984  -22.307 1.00 37.44  ? 17  ARG C C   1 
ATOM   3740 O  O   . ARG C 1 18  ? 18.315  16.891  -21.736 1.00 38.94  ? 17  ARG C O   1 
ATOM   3741 C  CB  . ARG C 1 18  ? 19.206  20.197  -21.521 1.00 32.96  ? 17  ARG C CB  1 
ATOM   3742 C  CG  . ARG C 1 18  ? 20.420  21.064  -21.244 1.00 34.96  ? 17  ARG C CG  1 
ATOM   3743 C  CD  . ARG C 1 18  ? 20.051  22.505  -20.945 1.00 33.25  ? 17  ARG C CD  1 
ATOM   3744 N  NE  . ARG C 1 18  ? 21.216  23.264  -20.504 1.00 36.75  ? 17  ARG C NE  1 
ATOM   3745 C  CZ  . ARG C 1 18  ? 21.367  24.576  -20.667 1.00 39.34  ? 17  ARG C CZ  1 
ATOM   3746 N  NH1 . ARG C 1 18  ? 20.424  25.293  -21.268 1.00 34.84  ? 17  ARG C NH1 1 
ATOM   3747 N  NH2 . ARG C 1 18  ? 22.464  25.177  -20.218 1.00 43.08  ? 17  ARG C NH2 1 
ATOM   3748 N  N   . LEU C 1 19  ? 17.356  18.425  -23.092 1.00 37.40  ? 18  LEU C N   1 
ATOM   3749 C  CA  . LEU C 1 19  ? 16.136  17.659  -23.295 1.00 33.57  ? 18  LEU C CA  1 
ATOM   3750 C  C   . LEU C 1 19  ? 16.494  16.237  -23.698 1.00 31.01  ? 18  LEU C C   1 
ATOM   3751 O  O   . LEU C 1 19  ? 15.903  15.272  -23.205 1.00 27.37  ? 18  LEU C O   1 
ATOM   3752 C  CB  . LEU C 1 19  ? 15.298  18.298  -24.397 1.00 36.44  ? 18  LEU C CB  1 
ATOM   3753 C  CG  . LEU C 1 19  ? 14.839  19.730  -24.139 1.00 34.27  ? 18  LEU C CG  1 
ATOM   3754 C  CD1 . LEU C 1 19  ? 14.148  20.267  -25.361 1.00 33.44  ? 18  LEU C CD1 1 
ATOM   3755 C  CD2 . LEU C 1 19  ? 13.917  19.780  -22.942 1.00 30.79  ? 18  LEU C CD2 1 
ATOM   3756 N  N   . LEU C 1 20  ? 17.461  16.118  -24.604 1.00 29.15  ? 19  LEU C N   1 
ATOM   3757 C  CA  . LEU C 1 20  ? 17.890  14.817  -25.082 1.00 31.38  ? 19  LEU C CA  1 
ATOM   3758 C  C   . LEU C 1 20  ? 18.492  13.985  -23.963 1.00 34.45  ? 19  LEU C C   1 
ATOM   3759 O  O   . LEU C 1 20  ? 18.168  12.806  -23.810 1.00 33.50  ? 19  LEU C O   1 
ATOM   3760 C  CB  . LEU C 1 20  ? 18.891  14.970  -26.219 1.00 26.91  ? 19  LEU C CB  1 
ATOM   3761 C  CG  . LEU C 1 20  ? 19.278  13.626  -26.834 1.00 27.64  ? 19  LEU C CG  1 
ATOM   3762 C  CD1 . LEU C 1 20  ? 18.052  12.920  -27.400 1.00 27.01  ? 19  LEU C CD1 1 
ATOM   3763 C  CD2 . LEU C 1 20  ? 20.313  13.838  -27.913 1.00 28.21  ? 19  LEU C CD2 1 
ATOM   3764 N  N   . LEU C 1 21  ? 19.397  14.600  -23.212 1.00 35.95  ? 20  LEU C N   1 
ATOM   3765 C  CA  . LEU C 1 21  ? 20.056  13.931  -22.099 1.00 34.89  ? 20  LEU C CA  1 
ATOM   3766 C  C   . LEU C 1 21  ? 19.035  13.387  -21.117 1.00 35.63  ? 20  LEU C C   1 
ATOM   3767 O  O   . LEU C 1 21  ? 19.160  12.264  -20.628 1.00 38.34  ? 20  LEU C O   1 
ATOM   3768 C  CB  . LEU C 1 21  ? 20.978  14.909  -21.373 1.00 31.64  ? 20  LEU C CB  1 
ATOM   3769 C  CG  . LEU C 1 21  ? 22.333  15.152  -22.033 1.00 23.25  ? 20  LEU C CG  1 
ATOM   3770 C  CD1 . LEU C 1 21  ? 23.022  16.344  -21.405 1.00 21.22  ? 20  LEU C CD1 1 
ATOM   3771 C  CD2 . LEU C 1 21  ? 23.187  13.902  -21.913 1.00 27.07  ? 20  LEU C CD2 1 
ATOM   3772 N  N   . GLU C 1 22  ? 18.063  14.226  -20.774 1.00 32.79  ? 21  GLU C N   1 
ATOM   3773 C  CA  . GLU C 1 22  ? 17.013  13.839  -19.851 1.00 34.71  ? 21  GLU C CA  1 
ATOM   3774 C  C   . GLU C 1 22  ? 16.207  12.652  -20.353 1.00 35.76  ? 21  GLU C C   1 
ATOM   3775 O  O   . GLU C 1 22  ? 16.020  11.675  -19.624 1.00 38.37  ? 21  GLU C O   1 
ATOM   3776 C  CB  . GLU C 1 22  ? 16.107  15.027  -19.591 1.00 34.86  ? 21  GLU C CB  1 
ATOM   3777 C  CG  . GLU C 1 22  ? 16.765  16.089  -18.725 1.00 41.48  ? 21  GLU C CG  1 
ATOM   3778 C  CD  . GLU C 1 22  ? 16.999  15.620  -17.291 1.00 48.11  ? 21  GLU C CD  1 
ATOM   3779 O  OE1 . GLU C 1 22  ? 16.348  14.645  -16.849 1.00 52.56  ? 21  GLU C OE1 1 
ATOM   3780 O  OE2 . GLU C 1 22  ? 17.836  16.239  -16.598 1.00 44.63  ? 21  GLU C OE2 1 
ATOM   3781 N  N   . TYR C 1 23  ? 15.718  12.752  -21.587 1.00 32.15  ? 22  TYR C N   1 
ATOM   3782 C  CA  . TYR C 1 23  ? 14.940  11.686  -22.200 1.00 26.56  ? 22  TYR C CA  1 
ATOM   3783 C  C   . TYR C 1 23  ? 15.719  10.375  -22.262 1.00 24.82  ? 22  TYR C C   1 
ATOM   3784 O  O   . TYR C 1 23  ? 15.137  9.295   -22.168 1.00 23.02  ? 22  TYR C O   1 
ATOM   3785 C  CB  . TYR C 1 23  ? 14.493  12.103  -23.603 1.00 26.28  ? 22  TYR C CB  1 
ATOM   3786 C  CG  . TYR C 1 23  ? 13.772  11.014  -24.355 1.00 22.36  ? 22  TYR C CG  1 
ATOM   3787 C  CD1 . TYR C 1 23  ? 12.407  10.807  -24.177 1.00 24.35  ? 22  TYR C CD1 1 
ATOM   3788 C  CD2 . TYR C 1 23  ? 14.461  10.163  -25.223 1.00 21.80  ? 22  TYR C CD2 1 
ATOM   3789 C  CE1 . TYR C 1 23  ? 11.745  9.777   -24.844 1.00 28.38  ? 22  TYR C CE1 1 
ATOM   3790 C  CE2 . TYR C 1 23  ? 13.812  9.131   -25.892 1.00 22.41  ? 22  TYR C CE2 1 
ATOM   3791 C  CZ  . TYR C 1 23  ? 12.455  8.943   -25.699 1.00 27.61  ? 22  TYR C CZ  1 
ATOM   3792 O  OH  . TYR C 1 23  ? 11.813  7.920   -26.360 1.00 33.68  ? 22  TYR C OH  1 
ATOM   3793 N  N   . THR C 1 24  ? 17.023  10.471  -22.490 1.00 26.92  ? 23  THR C N   1 
ATOM   3794 C  CA  . THR C 1 24  ? 17.888  9.295   -22.575 1.00 31.62  ? 23  THR C CA  1 
ATOM   3795 C  C   . THR C 1 24  ? 18.286  8.796   -21.193 1.00 34.26  ? 23  THR C C   1 
ATOM   3796 O  O   . THR C 1 24  ? 18.956  7.766   -21.062 1.00 29.38  ? 23  THR C O   1 
ATOM   3797 C  CB  . THR C 1 24  ? 19.161  9.592   -23.388 1.00 32.25  ? 23  THR C CB  1 
ATOM   3798 O  OG1 . THR C 1 24  ? 19.758  10.807  -22.926 1.00 33.95  ? 23  THR C OG1 1 
ATOM   3799 C  CG2 . THR C 1 24  ? 18.832  9.738   -24.858 1.00 32.37  ? 23  THR C CG2 1 
ATOM   3800 N  N   . ASP C 1 25  ? 17.822  9.511   -20.170 1.00 40.51  ? 24  ASP C N   1 
ATOM   3801 C  CA  . ASP C 1 25  ? 18.095  9.190   -18.772 1.00 48.43  ? 24  ASP C CA  1 
ATOM   3802 C  C   . ASP C 1 25  ? 19.600  9.124   -18.501 1.00 48.44  ? 24  ASP C C   1 
ATOM   3803 O  O   . ASP C 1 25  ? 20.074  8.393   -17.623 1.00 47.26  ? 24  ASP C O   1 
ATOM   3804 C  CB  . ASP C 1 25  ? 17.396  7.882   -18.373 1.00 57.47  ? 24  ASP C CB  1 
ATOM   3805 C  CG  . ASP C 1 25  ? 17.056  7.831   -16.889 1.00 64.68  ? 24  ASP C CG  1 
ATOM   3806 O  OD1 . ASP C 1 25  ? 16.533  8.839   -16.362 1.00 69.93  ? 24  ASP C OD1 1 
ATOM   3807 O  OD2 . ASP C 1 25  ? 17.309  6.788   -16.249 1.00 67.25  ? 24  ASP C OD2 1 
ATOM   3808 N  N   . SER C 1 26  ? 20.337  9.924   -19.260 1.00 50.49  ? 25  SER C N   1 
ATOM   3809 C  CA  . SER C 1 26  ? 21.782  9.994   -19.148 1.00 52.36  ? 25  SER C CA  1 
ATOM   3810 C  C   . SER C 1 26  ? 22.250  10.646  -17.847 1.00 52.77  ? 25  SER C C   1 
ATOM   3811 O  O   . SER C 1 26  ? 21.600  11.547  -17.304 1.00 49.02  ? 25  SER C O   1 
ATOM   3812 C  CB  . SER C 1 26  ? 22.362  10.738  -20.356 1.00 53.05  ? 25  SER C CB  1 
ATOM   3813 O  OG  . SER C 1 26  ? 22.359  9.923   -21.521 1.00 54.36  ? 25  SER C OG  1 
ATOM   3814 N  N   . SER C 1 27  ? 23.378  10.158  -17.345 1.00 53.65  ? 26  SER C N   1 
ATOM   3815 C  CA  . SER C 1 27  ? 23.972  10.680  -16.125 1.00 51.51  ? 26  SER C CA  1 
ATOM   3816 C  C   . SER C 1 27  ? 24.861  11.857  -16.526 1.00 45.36  ? 26  SER C C   1 
ATOM   3817 O  O   . SER C 1 27  ? 25.818  11.679  -17.277 1.00 44.15  ? 26  SER C O   1 
ATOM   3818 C  CB  . SER C 1 27  ? 24.802  9.581   -15.470 1.00 53.82  ? 26  SER C CB  1 
ATOM   3819 O  OG  . SER C 1 27  ? 25.231  9.981   -14.185 1.00 63.74  ? 26  SER C OG  1 
ATOM   3820 N  N   . TYR C 1 28  ? 24.558  13.054  -16.039 1.00 38.36  ? 27  TYR C N   1 
ATOM   3821 C  CA  . TYR C 1 28  ? 25.356  14.211  -16.426 1.00 36.39  ? 27  TYR C CA  1 
ATOM   3822 C  C   . TYR C 1 28  ? 25.346  15.398  -15.464 1.00 37.25  ? 27  TYR C C   1 
ATOM   3823 O  O   . TYR C 1 28  ? 24.416  15.574  -14.670 1.00 35.58  ? 27  TYR C O   1 
ATOM   3824 C  CB  . TYR C 1 28  ? 24.883  14.710  -17.792 1.00 32.31  ? 27  TYR C CB  1 
ATOM   3825 C  CG  . TYR C 1 28  ? 23.583  15.504  -17.736 1.00 28.69  ? 27  TYR C CG  1 
ATOM   3826 C  CD1 . TYR C 1 28  ? 22.344  14.857  -17.666 1.00 30.87  ? 27  TYR C CD1 1 
ATOM   3827 C  CD2 . TYR C 1 28  ? 23.594  16.903  -17.721 1.00 18.82  ? 27  TYR C CD2 1 
ATOM   3828 C  CE1 . TYR C 1 28  ? 21.157  15.583  -17.577 1.00 25.61  ? 27  TYR C CE1 1 
ATOM   3829 C  CE2 . TYR C 1 28  ? 22.415  17.636  -17.635 1.00 10.16  ? 27  TYR C CE2 1 
ATOM   3830 C  CZ  . TYR C 1 28  ? 21.207  16.970  -17.562 1.00 19.87  ? 27  TYR C CZ  1 
ATOM   3831 O  OH  . TYR C 1 28  ? 20.046  17.694  -17.458 1.00 26.23  ? 27  TYR C OH  1 
ATOM   3832 N  N   . GLU C 1 29  ? 26.374  16.235  -15.584 1.00 40.10  ? 28  GLU C N   1 
ATOM   3833 C  CA  . GLU C 1 29  ? 26.510  17.450  -14.786 1.00 46.17  ? 28  GLU C CA  1 
ATOM   3834 C  C   . GLU C 1 29  ? 26.393  18.605  -15.765 1.00 48.58  ? 28  GLU C C   1 
ATOM   3835 O  O   . GLU C 1 29  ? 26.177  18.392  -16.955 1.00 55.96  ? 28  GLU C O   1 
ATOM   3836 C  CB  . GLU C 1 29  ? 27.893  17.539  -14.148 1.00 49.17  ? 28  GLU C CB  1 
ATOM   3837 C  CG  . GLU C 1 29  ? 28.297  16.385  -13.271 1.00 57.02  ? 28  GLU C CG  1 
ATOM   3838 C  CD  . GLU C 1 29  ? 29.712  16.560  -12.762 1.00 63.46  ? 28  GLU C CD  1 
ATOM   3839 O  OE1 . GLU C 1 29  ? 30.611  15.839  -13.241 1.00 67.87  ? 28  GLU C OE1 1 
ATOM   3840 O  OE2 . GLU C 1 29  ? 29.933  17.443  -11.904 1.00 66.35  ? 28  GLU C OE2 1 
ATOM   3841 N  N   . GLU C 1 30  ? 26.580  19.824  -15.274 1.00 49.33  ? 29  GLU C N   1 
ATOM   3842 C  CA  . GLU C 1 30  ? 26.516  21.007  -16.126 1.00 45.97  ? 29  GLU C CA  1 
ATOM   3843 C  C   . GLU C 1 30  ? 27.496  22.076  -15.670 1.00 45.79  ? 29  GLU C C   1 
ATOM   3844 O  O   . GLU C 1 30  ? 27.558  22.414  -14.490 1.00 46.96  ? 29  GLU C O   1 
ATOM   3845 C  CB  . GLU C 1 30  ? 25.105  21.596  -16.151 1.00 44.92  ? 29  GLU C CB  1 
ATOM   3846 C  CG  . GLU C 1 30  ? 24.140  20.897  -17.092 1.00 45.58  ? 29  GLU C CG  1 
ATOM   3847 C  CD  . GLU C 1 30  ? 23.032  21.820  -17.555 1.00 47.89  ? 29  GLU C CD  1 
ATOM   3848 O  OE1 . GLU C 1 30  ? 23.331  22.759  -18.330 1.00 50.09  ? 29  GLU C OE1 1 
ATOM   3849 O  OE2 . GLU C 1 30  ? 21.869  21.619  -17.138 1.00 47.47  ? 29  GLU C OE2 1 
ATOM   3850 N  N   . LYS C 1 31  ? 28.291  22.578  -16.605 1.00 48.15  ? 30  LYS C N   1 
ATOM   3851 C  CA  . LYS C 1 31  ? 29.261  23.621  -16.301 1.00 48.55  ? 30  LYS C CA  1 
ATOM   3852 C  C   . LYS C 1 31  ? 28.721  24.904  -16.919 1.00 46.69  ? 30  LYS C C   1 
ATOM   3853 O  O   . LYS C 1 31  ? 29.102  25.280  -18.026 1.00 45.49  ? 30  LYS C O   1 
ATOM   3854 C  CB  . LYS C 1 31  ? 30.635  23.273  -16.896 1.00 48.89  ? 30  LYS C CB  1 
ATOM   3855 C  CG  . LYS C 1 31  ? 31.832  23.722  -16.060 1.00 50.98  ? 30  LYS C CG  1 
ATOM   3856 C  CD  . LYS C 1 31  ? 31.815  25.220  -15.776 1.00 53.07  ? 30  LYS C CD  1 
ATOM   3857 C  CE  . LYS C 1 31  ? 32.808  25.734  -14.736 1.00 57.03  ? 30  LYS C CE  1 
ATOM   3858 N  NZ  . LYS C 1 31  ? 34.249  25.777  -15.122 1.00 62.08  ? 30  LYS C NZ  1 
ATOM   3859 N  N   . LYS C 1 32  ? 27.786  25.542  -16.228 1.00 48.73  ? 31  LYS C N   1 
ATOM   3860 C  CA  . LYS C 1 32  ? 27.198  26.778  -16.731 1.00 51.87  ? 31  LYS C CA  1 
ATOM   3861 C  C   . LYS C 1 32  ? 28.207  27.910  -16.588 1.00 51.34  ? 31  LYS C C   1 
ATOM   3862 O  O   . LYS C 1 32  ? 28.880  28.021  -15.559 1.00 57.38  ? 31  LYS C O   1 
ATOM   3863 C  CB  . LYS C 1 32  ? 25.904  27.095  -15.979 1.00 55.94  ? 31  LYS C CB  1 
ATOM   3864 C  CG  . LYS C 1 32  ? 24.828  26.006  -16.105 1.00 60.49  ? 31  LYS C CG  1 
ATOM   3865 C  CD  . LYS C 1 32  ? 23.694  26.225  -15.113 1.00 66.40  ? 31  LYS C CD  1 
ATOM   3866 C  CE  . LYS C 1 32  ? 22.730  25.047  -15.094 1.00 69.09  ? 31  LYS C CE  1 
ATOM   3867 N  NZ  . LYS C 1 32  ? 21.976  24.905  -16.371 1.00 74.14  ? 31  LYS C NZ  1 
ATOM   3868 N  N   . TYR C 1 33  ? 28.351  28.709  -17.640 1.00 48.63  ? 32  TYR C N   1 
ATOM   3869 C  CA  . TYR C 1 33  ? 29.288  29.826  -17.644 1.00 49.03  ? 32  TYR C CA  1 
ATOM   3870 C  C   . TYR C 1 33  ? 28.534  31.148  -17.608 1.00 52.06  ? 32  TYR C C   1 
ATOM   3871 O  O   . TYR C 1 33  ? 27.693  31.415  -18.465 1.00 52.52  ? 32  TYR C O   1 
ATOM   3872 C  CB  . TYR C 1 33  ? 30.195  29.768  -18.886 1.00 45.50  ? 32  TYR C CB  1 
ATOM   3873 C  CG  . TYR C 1 33  ? 31.221  28.641  -18.877 1.00 44.97  ? 32  TYR C CG  1 
ATOM   3874 C  CD1 . TYR C 1 33  ? 30.933  27.404  -19.454 1.00 44.02  ? 32  TYR C CD1 1 
ATOM   3875 C  CD2 . TYR C 1 33  ? 32.472  28.810  -18.280 1.00 41.08  ? 32  TYR C CD2 1 
ATOM   3876 C  CE1 . TYR C 1 33  ? 31.863  26.366  -19.432 1.00 42.68  ? 32  TYR C CE1 1 
ATOM   3877 C  CE2 . TYR C 1 33  ? 33.401  27.778  -18.257 1.00 40.37  ? 32  TYR C CE2 1 
ATOM   3878 C  CZ  . TYR C 1 33  ? 33.088  26.564  -18.830 1.00 42.20  ? 32  TYR C CZ  1 
ATOM   3879 O  OH  . TYR C 1 33  ? 33.996  25.538  -18.794 1.00 44.40  ? 32  TYR C OH  1 
ATOM   3880 N  N   . THR C 1 34  ? 28.842  31.981  -16.624 1.00 58.45  ? 33  THR C N   1 
ATOM   3881 C  CA  . THR C 1 34  ? 28.173  33.267  -16.495 1.00 61.54  ? 33  THR C CA  1 
ATOM   3882 C  C   . THR C 1 34  ? 28.883  34.358  -17.296 1.00 62.41  ? 33  THR C C   1 
ATOM   3883 O  O   . THR C 1 34  ? 30.108  34.491  -17.248 1.00 63.17  ? 33  THR C O   1 
ATOM   3884 C  CB  . THR C 1 34  ? 28.046  33.691  -15.002 1.00 63.53  ? 33  THR C CB  1 
ATOM   3885 O  OG1 . THR C 1 34  ? 27.204  32.761  -14.304 1.00 63.55  ? 33  THR C OG1 1 
ATOM   3886 C  CG2 . THR C 1 34  ? 27.439  35.085  -14.879 1.00 66.08  ? 33  THR C CG2 1 
ATOM   3887 N  N   . MET C 1 35  ? 28.108  35.100  -18.078 1.00 65.48  ? 34  MET C N   1 
ATOM   3888 C  CA  . MET C 1 35  ? 28.650  36.192  -18.870 1.00 70.53  ? 34  MET C CA  1 
ATOM   3889 C  C   . MET C 1 35  ? 28.423  37.498  -18.108 1.00 72.39  ? 34  MET C C   1 
ATOM   3890 O  O   . MET C 1 35  ? 27.373  37.689  -17.489 1.00 70.62  ? 34  MET C O   1 
ATOM   3891 C  CB  . MET C 1 35  ? 27.949  36.247  -20.221 1.00 75.45  ? 34  MET C CB  1 
ATOM   3892 C  CG  . MET C 1 35  ? 28.511  37.278  -21.170 1.00 80.75  ? 34  MET C CG  1 
ATOM   3893 S  SD  . MET C 1 35  ? 27.517  37.338  -22.659 1.00 89.99  ? 34  MET C SD  1 
ATOM   3894 C  CE  . MET C 1 35  ? 28.042  35.828  -23.463 1.00 85.28  ? 34  MET C CE  1 
ATOM   3895 N  N   . GLY C 1 36  ? 29.407  38.388  -18.144 1.00 75.13  ? 35  GLY C N   1 
ATOM   3896 C  CA  . GLY C 1 36  ? 29.285  39.654  -17.440 1.00 81.79  ? 35  GLY C CA  1 
ATOM   3897 C  C   . GLY C 1 36  ? 28.263  40.599  -18.045 1.00 86.26  ? 35  GLY C C   1 
ATOM   3898 O  O   . GLY C 1 36  ? 27.886  40.458  -19.211 1.00 88.80  ? 35  GLY C O   1 
ATOM   3899 N  N   . ASP C 1 37  ? 27.794  41.551  -17.244 1.00 88.26  ? 36  ASP C N   1 
ATOM   3900 C  CA  . ASP C 1 37  ? 26.817  42.525  -17.710 1.00 90.35  ? 36  ASP C CA  1 
ATOM   3901 C  C   . ASP C 1 37  ? 27.448  43.542  -18.646 1.00 91.80  ? 36  ASP C C   1 
ATOM   3902 O  O   . ASP C 1 37  ? 28.671  43.665  -18.722 1.00 91.69  ? 36  ASP C O   1 
ATOM   3903 C  CB  . ASP C 1 37  ? 26.183  43.262  -16.528 1.00 93.08  ? 36  ASP C CB  1 
ATOM   3904 C  CG  . ASP C 1 37  ? 25.284  42.371  -15.700 1.00 97.49  ? 36  ASP C CG  1 
ATOM   3905 O  OD1 . ASP C 1 37  ? 25.422  42.388  -14.455 1.00 99.02  ? 36  ASP C OD1 1 
ATOM   3906 O  OD2 . ASP C 1 37  ? 24.440  41.662  -16.292 1.00 96.61  ? 36  ASP C OD2 1 
ATOM   3907 N  N   . ALA C 1 38  ? 26.595  44.268  -19.360 1.00 92.94  ? 37  ALA C N   1 
ATOM   3908 C  CA  . ALA C 1 38  ? 27.038  45.301  -20.285 1.00 94.50  ? 37  ALA C CA  1 
ATOM   3909 C  C   . ALA C 1 38  ? 27.780  46.388  -19.504 1.00 97.30  ? 37  ALA C C   1 
ATOM   3910 O  O   . ALA C 1 38  ? 27.606  46.518  -18.292 1.00 99.72  ? 37  ALA C O   1 
ATOM   3911 C  CB  . ALA C 1 38  ? 25.835  45.898  -21.001 1.00 93.26  ? 37  ALA C CB  1 
ATOM   3912 N  N   . PRO C 1 39  ? 28.581  47.212  -20.197 1.00 98.67  ? 38  PRO C N   1 
ATOM   3913 C  CA  . PRO C 1 39  ? 28.819  47.172  -21.641 1.00 99.25  ? 38  PRO C CA  1 
ATOM   3914 C  C   . PRO C 1 39  ? 29.923  46.191  -22.061 1.00 98.57  ? 38  PRO C C   1 
ATOM   3915 O  O   . PRO C 1 39  ? 30.108  45.931  -23.248 1.00 100.00 ? 38  PRO C O   1 
ATOM   3916 C  CB  . PRO C 1 39  ? 29.208  48.615  -21.949 1.00 100.00 ? 38  PRO C CB  1 
ATOM   3917 C  CG  . PRO C 1 39  ? 30.004  48.992  -20.736 1.00 100.00 ? 38  PRO C CG  1 
ATOM   3918 C  CD  . PRO C 1 39  ? 29.161  48.437  -19.605 1.00 99.70  ? 38  PRO C CD  1 
ATOM   3919 N  N   . ASP C 1 40  ? 30.645  45.654  -21.081 1.00 96.19  ? 39  ASP C N   1 
ATOM   3920 C  CA  . ASP C 1 40  ? 31.745  44.726  -21.334 1.00 93.56  ? 39  ASP C CA  1 
ATOM   3921 C  C   . ASP C 1 40  ? 31.378  43.322  -21.798 1.00 91.69  ? 39  ASP C C   1 
ATOM   3922 O  O   . ASP C 1 40  ? 32.029  42.779  -22.693 1.00 91.68  ? 39  ASP C O   1 
ATOM   3923 C  CB  . ASP C 1 40  ? 32.637  44.620  -20.096 1.00 94.50  ? 39  ASP C CB  1 
ATOM   3924 C  CG  . ASP C 1 40  ? 33.661  45.733  -20.018 1.00 96.29  ? 39  ASP C CG  1 
ATOM   3925 O  OD1 . ASP C 1 40  ? 34.780  45.459  -19.541 1.00 97.23  ? 39  ASP C OD1 1 
ATOM   3926 O  OD2 . ASP C 1 40  ? 33.358  46.871  -20.432 1.00 96.83  ? 39  ASP C OD2 1 
ATOM   3927 N  N   . TYR C 1 41  ? 30.349  42.738  -21.189 1.00 88.94  ? 40  TYR C N   1 
ATOM   3928 C  CA  . TYR C 1 41  ? 29.927  41.377  -21.520 1.00 83.57  ? 40  TYR C CA  1 
ATOM   3929 C  C   . TYR C 1 41  ? 31.124  40.464  -21.336 1.00 80.22  ? 40  TYR C C   1 
ATOM   3930 O  O   . TYR C 1 41  ? 31.483  39.687  -22.220 1.00 79.43  ? 40  TYR C O   1 
ATOM   3931 C  CB  . TYR C 1 41  ? 29.398  41.293  -22.954 1.00 83.14  ? 40  TYR C CB  1 
ATOM   3932 C  CG  . TYR C 1 41  ? 28.113  42.054  -23.153 1.00 82.44  ? 40  TYR C CG  1 
ATOM   3933 C  CD1 . TYR C 1 41  ? 27.000  41.797  -22.349 1.00 84.40  ? 40  TYR C CD1 1 
ATOM   3934 C  CD2 . TYR C 1 41  ? 28.007  43.037  -24.133 1.00 80.25  ? 40  TYR C CD2 1 
ATOM   3935 C  CE1 . TYR C 1 41  ? 25.811  42.500  -22.516 1.00 85.31  ? 40  TYR C CE1 1 
ATOM   3936 C  CE2 . TYR C 1 41  ? 26.822  43.747  -24.310 1.00 82.09  ? 40  TYR C CE2 1 
ATOM   3937 C  CZ  . TYR C 1 41  ? 25.729  43.474  -23.497 1.00 85.17  ? 40  TYR C CZ  1 
ATOM   3938 O  OH  . TYR C 1 41  ? 24.561  44.183  -23.653 1.00 85.94  ? 40  TYR C OH  1 
ATOM   3939 N  N   . ASP C 1 42  ? 31.762  40.617  -20.181 1.00 77.91  ? 41  ASP C N   1 
ATOM   3940 C  CA  . ASP C 1 42  ? 32.939  39.848  -19.816 1.00 78.34  ? 41  ASP C CA  1 
ATOM   3941 C  C   . ASP C 1 42  ? 32.723  38.340  -19.955 1.00 78.43  ? 41  ASP C C   1 
ATOM   3942 O  O   . ASP C 1 42  ? 31.852  37.757  -19.307 1.00 79.28  ? 41  ASP C O   1 
ATOM   3943 C  CB  . ASP C 1 42  ? 33.361  40.206  -18.390 1.00 78.15  ? 41  ASP C CB  1 
ATOM   3944 C  CG  . ASP C 1 42  ? 34.567  39.422  -17.929 1.00 75.65  ? 41  ASP C CG  1 
ATOM   3945 O  OD1 . ASP C 1 42  ? 35.645  39.579  -18.539 1.00 73.28  ? 41  ASP C OD1 1 
ATOM   3946 O  OD2 . ASP C 1 42  ? 34.429  38.638  -16.965 1.00 72.98  ? 41  ASP C OD2 1 
ATOM   3947 N  N   . ARG C 1 43  ? 33.544  37.717  -20.792 1.00 76.15  ? 42  ARG C N   1 
ATOM   3948 C  CA  . ARG C 1 43  ? 33.451  36.287  -21.046 1.00 74.73  ? 42  ARG C CA  1 
ATOM   3949 C  C   . ARG C 1 43  ? 34.680  35.546  -20.520 1.00 72.49  ? 42  ARG C C   1 
ATOM   3950 O  O   . ARG C 1 43  ? 34.994  34.445  -20.983 1.00 71.67  ? 42  ARG C O   1 
ATOM   3951 C  CB  . ARG C 1 43  ? 33.321  36.058  -22.551 1.00 75.05  ? 42  ARG C CB  1 
ATOM   3952 C  CG  . ARG C 1 43  ? 32.190  36.838  -23.207 1.00 79.37  ? 42  ARG C CG  1 
ATOM   3953 C  CD  . ARG C 1 43  ? 32.206  36.781  -24.739 1.00 82.20  ? 42  ARG C CD  1 
ATOM   3954 N  NE  . ARG C 1 43  ? 33.375  36.190  -25.382 1.00 87.17  ? 42  ARG C NE  1 
ATOM   3955 C  CZ  . ARG C 1 43  ? 33.348  35.069  -26.096 1.00 88.39  ? 42  ARG C CZ  1 
ATOM   3956 N  NH1 . ARG C 1 43  ? 32.208  34.406  -26.256 1.00 86.82  ? 42  ARG C NH1 1 
ATOM   3957 N  NH2 . ARG C 1 43  ? 34.454  34.624  -26.680 1.00 85.09  ? 42  ARG C NH2 1 
ATOM   3958 N  N   . SER C 1 44  ? 35.369  36.158  -19.560 1.00 68.99  ? 43  SER C N   1 
ATOM   3959 C  CA  . SER C 1 44  ? 36.583  35.586  -18.968 1.00 64.81  ? 43  SER C CA  1 
ATOM   3960 C  C   . SER C 1 44  ? 36.382  34.248  -18.269 1.00 60.79  ? 43  SER C C   1 
ATOM   3961 O  O   . SER C 1 44  ? 37.271  33.399  -18.275 1.00 55.79  ? 43  SER C O   1 
ATOM   3962 C  CB  . SER C 1 44  ? 37.213  36.575  -17.987 1.00 65.63  ? 43  SER C CB  1 
ATOM   3963 O  OG  . SER C 1 44  ? 36.341  36.854  -16.901 1.00 63.66  ? 43  SER C OG  1 
ATOM   3964 N  N   . GLN C 1 45  ? 35.222  34.065  -17.651 1.00 58.99  ? 44  GLN C N   1 
ATOM   3965 C  CA  . GLN C 1 45  ? 34.934  32.823  -16.949 1.00 56.53  ? 44  GLN C CA  1 
ATOM   3966 C  C   . GLN C 1 45  ? 35.099  31.615  -17.876 1.00 52.48  ? 44  GLN C C   1 
ATOM   3967 O  O   . GLN C 1 45  ? 35.460  30.525  -17.430 1.00 51.25  ? 44  GLN C O   1 
ATOM   3968 C  CB  . GLN C 1 45  ? 33.522  32.869  -16.362 1.00 60.82  ? 44  GLN C CB  1 
ATOM   3969 C  CG  . GLN C 1 45  ? 33.294  31.878  -15.226 1.00 65.41  ? 44  GLN C CG  1 
ATOM   3970 C  CD  . GLN C 1 45  ? 31.919  32.009  -14.582 1.00 70.04  ? 44  GLN C CD  1 
ATOM   3971 O  OE1 . GLN C 1 45  ? 31.504  33.100  -14.175 1.00 72.43  ? 44  GLN C OE1 1 
ATOM   3972 N  NE2 . GLN C 1 45  ? 31.219  30.883  -14.457 1.00 70.76  ? 44  GLN C NE2 1 
ATOM   3973 N  N   . TRP C 1 46  ? 34.816  31.818  -19.160 1.00 48.61  ? 45  TRP C N   1 
ATOM   3974 C  CA  . TRP C 1 46  ? 34.940  30.776  -20.182 1.00 44.93  ? 45  TRP C CA  1 
ATOM   3975 C  C   . TRP C 1 46  ? 36.323  30.800  -20.846 1.00 45.75  ? 45  TRP C C   1 
ATOM   3976 O  O   . TRP C 1 46  ? 36.960  29.754  -21.030 1.00 41.56  ? 45  TRP C O   1 
ATOM   3977 C  CB  . TRP C 1 46  ? 33.831  30.950  -21.237 1.00 45.96  ? 45  TRP C CB  1 
ATOM   3978 C  CG  . TRP C 1 46  ? 34.096  30.350  -22.604 1.00 43.75  ? 45  TRP C CG  1 
ATOM   3979 C  CD1 . TRP C 1 46  ? 34.125  31.022  -23.798 1.00 43.63  ? 45  TRP C CD1 1 
ATOM   3980 C  CD2 . TRP C 1 46  ? 34.340  28.974  -22.921 1.00 43.05  ? 45  TRP C CD2 1 
ATOM   3981 N  NE1 . TRP C 1 46  ? 34.368  30.151  -24.832 1.00 40.66  ? 45  TRP C NE1 1 
ATOM   3982 C  CE2 . TRP C 1 46  ? 34.499  28.887  -24.320 1.00 42.49  ? 45  TRP C CE2 1 
ATOM   3983 C  CE3 . TRP C 1 46  ? 34.433  27.803  -22.154 1.00 42.91  ? 45  TRP C CE3 1 
ATOM   3984 C  CZ2 . TRP C 1 46  ? 34.751  27.678  -24.972 1.00 42.01  ? 45  TRP C CZ2 1 
ATOM   3985 C  CZ3 . TRP C 1 46  ? 34.686  26.596  -22.807 1.00 39.18  ? 45  TRP C CZ3 1 
ATOM   3986 C  CH2 . TRP C 1 46  ? 34.838  26.546  -24.199 1.00 42.24  ? 45  TRP C CH2 1 
ATOM   3987 N  N   . LEU C 1 47  ? 36.780  31.992  -21.212 1.00 45.92  ? 46  LEU C N   1 
ATOM   3988 C  CA  . LEU C 1 47  ? 38.072  32.143  -21.864 1.00 49.87  ? 46  LEU C CA  1 
ATOM   3989 C  C   . LEU C 1 47  ? 39.248  31.618  -21.037 1.00 51.74  ? 46  LEU C C   1 
ATOM   3990 O  O   . LEU C 1 47  ? 40.237  31.132  -21.599 1.00 54.32  ? 46  LEU C O   1 
ATOM   3991 C  CB  . LEU C 1 47  ? 38.282  33.606  -22.263 1.00 49.98  ? 46  LEU C CB  1 
ATOM   3992 C  CG  . LEU C 1 47  ? 37.199  34.113  -23.222 1.00 48.54  ? 46  LEU C CG  1 
ATOM   3993 C  CD1 . LEU C 1 47  ? 37.458  35.558  -23.610 1.00 43.44  ? 46  LEU C CD1 1 
ATOM   3994 C  CD2 . LEU C 1 47  ? 37.137  33.214  -24.451 1.00 45.72  ? 46  LEU C CD2 1 
ATOM   3995 N  N   . ASN C 1 48  ? 39.133  31.716  -19.713 1.00 54.12  ? 47  ASN C N   1 
ATOM   3996 C  CA  . ASN C 1 48  ? 40.171  31.250  -18.787 1.00 57.27  ? 47  ASN C CA  1 
ATOM   3997 C  C   . ASN C 1 48  ? 40.113  29.736  -18.629 1.00 57.42  ? 47  ASN C C   1 
ATOM   3998 O  O   . ASN C 1 48  ? 40.689  29.186  -17.690 1.00 60.46  ? 47  ASN C O   1 
ATOM   3999 C  CB  . ASN C 1 48  ? 39.989  31.877  -17.392 1.00 58.64  ? 47  ASN C CB  1 
ATOM   4000 C  CG  . ASN C 1 48  ? 40.345  33.347  -17.351 1.00 61.31  ? 47  ASN C CG  1 
ATOM   4001 O  OD1 . ASN C 1 48  ? 40.258  34.050  -18.354 1.00 70.00  ? 47  ASN C OD1 1 
ATOM   4002 N  ND2 . ASN C 1 48  ? 40.739  33.826  -16.175 1.00 63.65  ? 47  ASN C ND2 1 
ATOM   4003 N  N   . GLU C 1 49  ? 39.426  29.054  -19.536 1.00 57.06  ? 48  GLU C N   1 
ATOM   4004 C  CA  . GLU C 1 49  ? 39.289  27.606  -19.435 1.00 57.31  ? 48  GLU C CA  1 
ATOM   4005 C  C   . GLU C 1 49  ? 39.021  27.003  -20.813 1.00 55.21  ? 48  GLU C C   1 
ATOM   4006 O  O   . GLU C 1 49  ? 39.064  25.780  -20.993 1.00 54.53  ? 48  GLU C O   1 
ATOM   4007 C  CB  . GLU C 1 49  ? 38.132  27.295  -18.479 1.00 59.33  ? 48  GLU C CB  1 
ATOM   4008 C  CG  . GLU C 1 49  ? 38.141  25.913  -17.832 1.00 68.37  ? 48  GLU C CG  1 
ATOM   4009 C  CD  . GLU C 1 49  ? 36.984  25.725  -16.842 1.00 72.60  ? 48  GLU C CD  1 
ATOM   4010 O  OE1 . GLU C 1 49  ? 36.182  24.774  -17.002 1.00 71.16  ? 48  GLU C OE1 1 
ATOM   4011 O  OE2 . GLU C 1 49  ? 36.876  26.538  -15.898 1.00 80.29  ? 48  GLU C OE2 1 
ATOM   4012 N  N   . LYS C 1 50  ? 38.808  27.884  -21.788 1.00 51.19  ? 49  LYS C N   1 
ATOM   4013 C  CA  . LYS C 1 50  ? 38.511  27.499  -23.163 1.00 44.13  ? 49  LYS C CA  1 
ATOM   4014 C  C   . LYS C 1 50  ? 39.498  26.506  -23.754 1.00 41.40  ? 49  LYS C C   1 
ATOM   4015 O  O   . LYS C 1 50  ? 39.098  25.478  -24.305 1.00 36.56  ? 49  LYS C O   1 
ATOM   4016 C  CB  . LYS C 1 50  ? 38.443  28.744  -24.050 1.00 42.33  ? 49  LYS C CB  1 
ATOM   4017 C  CG  . LYS C 1 50  ? 38.135  28.450  -25.504 1.00 44.26  ? 49  LYS C CG  1 
ATOM   4018 C  CD  . LYS C 1 50  ? 37.873  29.732  -26.273 1.00 40.80  ? 49  LYS C CD  1 
ATOM   4019 C  CE  . LYS C 1 50  ? 37.361  29.440  -27.668 1.00 33.71  ? 49  LYS C CE  1 
ATOM   4020 N  NZ  . LYS C 1 50  ? 37.002  30.702  -28.374 1.00 37.31  ? 49  LYS C NZ  1 
ATOM   4021 N  N   . PHE C 1 51  ? 40.786  26.793  -23.612 1.00 40.84  ? 50  PHE C N   1 
ATOM   4022 C  CA  . PHE C 1 51  ? 41.797  25.922  -24.184 1.00 40.75  ? 50  PHE C CA  1 
ATOM   4023 C  C   . PHE C 1 51  ? 42.390  24.868  -23.260 1.00 41.90  ? 50  PHE C C   1 
ATOM   4024 O  O   . PHE C 1 51  ? 43.269  24.106  -23.664 1.00 39.65  ? 50  PHE C O   1 
ATOM   4025 C  CB  . PHE C 1 51  ? 42.891  26.771  -24.816 1.00 39.39  ? 50  PHE C CB  1 
ATOM   4026 C  CG  . PHE C 1 51  ? 42.368  27.763  -25.821 1.00 40.95  ? 50  PHE C CG  1 
ATOM   4027 C  CD1 . PHE C 1 51  ? 42.110  29.081  -25.448 1.00 42.39  ? 50  PHE C CD1 1 
ATOM   4028 C  CD2 . PHE C 1 51  ? 42.113  27.372  -27.135 1.00 36.65  ? 50  PHE C CD2 1 
ATOM   4029 C  CE1 . PHE C 1 51  ? 41.603  30.002  -26.368 1.00 43.19  ? 50  PHE C CE1 1 
ATOM   4030 C  CE2 . PHE C 1 51  ? 41.607  28.285  -28.058 1.00 41.46  ? 50  PHE C CE2 1 
ATOM   4031 C  CZ  . PHE C 1 51  ? 41.351  29.606  -27.670 1.00 41.88  ? 50  PHE C CZ  1 
ATOM   4032 N  N   . LYS C 1 52  ? 41.909  24.809  -22.026 1.00 43.51  ? 51  LYS C N   1 
ATOM   4033 C  CA  . LYS C 1 52  ? 42.429  23.832  -21.077 1.00 47.38  ? 51  LYS C CA  1 
ATOM   4034 C  C   . LYS C 1 52  ? 41.645  22.532  -21.009 1.00 45.20  ? 51  LYS C C   1 
ATOM   4035 O  O   . LYS C 1 52  ? 42.112  21.545  -20.441 1.00 41.95  ? 51  LYS C O   1 
ATOM   4036 C  CB  . LYS C 1 52  ? 42.519  24.436  -19.672 1.00 48.82  ? 51  LYS C CB  1 
ATOM   4037 C  CG  . LYS C 1 52  ? 43.575  25.513  -19.512 1.00 50.47  ? 51  LYS C CG  1 
ATOM   4038 C  CD  . LYS C 1 52  ? 42.954  26.884  -19.475 1.00 52.76  ? 51  LYS C CD  1 
ATOM   4039 C  CE  . LYS C 1 52  ? 43.987  27.945  -19.114 1.00 56.83  ? 51  LYS C CE  1 
ATOM   4040 N  NZ  . LYS C 1 52  ? 43.997  28.250  -17.662 1.00 63.06  ? 51  LYS C NZ  1 
ATOM   4041 N  N   . LEU C 1 53  ? 40.453  22.532  -21.587 1.00 41.82  ? 52  LEU C N   1 
ATOM   4042 C  CA  . LEU C 1 53  ? 39.595  21.357  -21.543 1.00 38.34  ? 52  LEU C CA  1 
ATOM   4043 C  C   . LEU C 1 53  ? 39.958  20.229  -22.497 1.00 39.64  ? 52  LEU C C   1 
ATOM   4044 O  O   . LEU C 1 53  ? 39.366  19.147  -22.438 1.00 39.60  ? 52  LEU C O   1 
ATOM   4045 C  CB  . LEU C 1 53  ? 38.146  21.776  -21.745 1.00 34.77  ? 52  LEU C CB  1 
ATOM   4046 C  CG  . LEU C 1 53  ? 37.738  22.857  -20.749 1.00 35.52  ? 52  LEU C CG  1 
ATOM   4047 C  CD1 . LEU C 1 53  ? 36.405  23.458  -21.135 1.00 36.78  ? 52  LEU C CD1 1 
ATOM   4048 C  CD2 . LEU C 1 53  ? 37.700  22.277  -19.348 1.00 35.80  ? 52  LEU C CD2 1 
ATOM   4049 N  N   . GLY C 1 54  ? 40.946  20.459  -23.357 1.00 41.60  ? 53  GLY C N   1 
ATOM   4050 C  CA  . GLY C 1 54  ? 41.353  19.424  -24.295 1.00 37.25  ? 53  GLY C CA  1 
ATOM   4051 C  C   . GLY C 1 54  ? 40.385  19.233  -25.453 1.00 37.36  ? 53  GLY C C   1 
ATOM   4052 O  O   . GLY C 1 54  ? 40.311  18.160  -26.054 1.00 35.46  ? 53  GLY C O   1 
ATOM   4053 N  N   . LEU C 1 55  ? 39.639  20.284  -25.771 1.00 34.38  ? 54  LEU C N   1 
ATOM   4054 C  CA  . LEU C 1 55  ? 38.682  20.235  -26.868 1.00 28.83  ? 54  LEU C CA  1 
ATOM   4055 C  C   . LEU C 1 55  ? 39.421  20.514  -28.164 1.00 25.61  ? 54  LEU C C   1 
ATOM   4056 O  O   . LEU C 1 55  ? 40.232  21.438  -28.224 1.00 24.49  ? 54  LEU C O   1 
ATOM   4057 C  CB  . LEU C 1 55  ? 37.593  21.291  -26.665 1.00 28.15  ? 54  LEU C CB  1 
ATOM   4058 C  CG  . LEU C 1 55  ? 36.706  21.187  -25.415 1.00 26.01  ? 54  LEU C CG  1 
ATOM   4059 C  CD1 . LEU C 1 55  ? 35.873  22.451  -25.297 1.00 20.57  ? 54  LEU C CD1 1 
ATOM   4060 C  CD2 . LEU C 1 55  ? 35.822  19.940  -25.474 1.00 25.21  ? 54  LEU C CD2 1 
ATOM   4061 N  N   . ASP C 1 56  ? 39.140  19.729  -29.199 1.00 26.02  ? 55  ASP C N   1 
ATOM   4062 C  CA  . ASP C 1 56  ? 39.797  19.913  -30.488 1.00 25.41  ? 55  ASP C CA  1 
ATOM   4063 C  C   . ASP C 1 56  ? 39.498  21.278  -31.058 1.00 26.51  ? 55  ASP C C   1 
ATOM   4064 O  O   . ASP C 1 56  ? 40.394  21.967  -31.532 1.00 25.42  ? 55  ASP C O   1 
ATOM   4065 C  CB  . ASP C 1 56  ? 39.357  18.842  -31.463 1.00 27.62  ? 55  ASP C CB  1 
ATOM   4066 C  CG  . ASP C 1 56  ? 39.802  17.473  -31.033 1.00 28.50  ? 55  ASP C CG  1 
ATOM   4067 O  OD1 . ASP C 1 56  ? 40.987  17.150  -31.253 1.00 27.61  ? 55  ASP C OD1 1 
ATOM   4068 O  OD2 . ASP C 1 56  ? 38.976  16.727  -30.461 1.00 32.08  ? 55  ASP C OD2 1 
ATOM   4069 N  N   . PHE C 1 57  ? 38.227  21.658  -31.035 1.00 23.91  ? 56  PHE C N   1 
ATOM   4070 C  CA  . PHE C 1 57  ? 37.831  22.969  -31.528 1.00 26.05  ? 56  PHE C CA  1 
ATOM   4071 C  C   . PHE C 1 57  ? 37.054  23.665  -30.423 1.00 27.55  ? 56  PHE C C   1 
ATOM   4072 O  O   . PHE C 1 57  ? 35.829  23.634  -30.391 1.00 30.51  ? 56  PHE C O   1 
ATOM   4073 C  CB  . PHE C 1 57  ? 37.003  22.838  -32.804 1.00 25.16  ? 56  PHE C CB  1 
ATOM   4074 C  CG  . PHE C 1 57  ? 37.771  22.262  -33.969 1.00 17.24  ? 56  PHE C CG  1 
ATOM   4075 C  CD1 . PHE C 1 57  ? 38.438  23.097  -34.859 1.00 12.92  ? 56  PHE C CD1 1 
ATOM   4076 C  CD2 . PHE C 1 57  ? 37.834  20.885  -34.166 1.00 13.51  ? 56  PHE C CD2 1 
ATOM   4077 C  CE1 . PHE C 1 57  ? 39.163  22.565  -35.929 1.00 17.90  ? 56  PHE C CE1 1 
ATOM   4078 C  CE2 . PHE C 1 57  ? 38.558  20.342  -35.234 1.00 14.80  ? 56  PHE C CE2 1 
ATOM   4079 C  CZ  . PHE C 1 57  ? 39.221  21.183  -36.115 1.00 17.97  ? 56  PHE C CZ  1 
ATOM   4080 N  N   . PRO C 1 58  ? 37.775  24.264  -29.464 1.00 33.47  ? 57  PRO C N   1 
ATOM   4081 C  CA  . PRO C 1 58  ? 37.197  24.974  -28.328 1.00 33.54  ? 57  PRO C CA  1 
ATOM   4082 C  C   . PRO C 1 58  ? 35.980  25.794  -28.683 1.00 34.30  ? 57  PRO C C   1 
ATOM   4083 O  O   . PRO C 1 58  ? 36.059  26.736  -29.474 1.00 35.86  ? 57  PRO C O   1 
ATOM   4084 C  CB  . PRO C 1 58  ? 38.357  25.836  -27.862 1.00 31.83  ? 57  PRO C CB  1 
ATOM   4085 C  CG  . PRO C 1 58  ? 39.484  24.888  -28.011 1.00 31.08  ? 57  PRO C CG  1 
ATOM   4086 C  CD  . PRO C 1 58  ? 39.244  24.324  -29.398 1.00 32.51  ? 57  PRO C CD  1 
ATOM   4087 N  N   . ASN C 1 59  ? 34.853  25.395  -28.099 1.00 33.30  ? 58  ASN C N   1 
ATOM   4088 C  CA  . ASN C 1 59  ? 33.586  26.067  -28.326 1.00 34.47  ? 58  ASN C CA  1 
ATOM   4089 C  C   . ASN C 1 59  ? 32.517  25.652  -27.327 1.00 36.71  ? 58  ASN C C   1 
ATOM   4090 O  O   . ASN C 1 59  ? 32.684  24.686  -26.570 1.00 36.49  ? 58  ASN C O   1 
ATOM   4091 C  CB  . ASN C 1 59  ? 33.082  25.793  -29.745 1.00 37.06  ? 58  ASN C CB  1 
ATOM   4092 C  CG  . ASN C 1 59  ? 32.287  26.949  -30.302 1.00 32.84  ? 58  ASN C CG  1 
ATOM   4093 O  OD1 . ASN C 1 59  ? 31.816  27.807  -29.555 1.00 31.54  ? 58  ASN C OD1 1 
ATOM   4094 N  ND2 . ASN C 1 59  ? 32.166  27.009  -31.624 1.00 36.42  ? 58  ASN C ND2 1 
ATOM   4095 N  N   . LEU C 1 60  ? 31.434  26.421  -27.311 1.00 36.77  ? 59  LEU C N   1 
ATOM   4096 C  CA  . LEU C 1 60  ? 30.281  26.182  -26.450 1.00 37.82  ? 59  LEU C CA  1 
ATOM   4097 C  C   . LEU C 1 60  ? 29.095  25.913  -27.367 1.00 38.98  ? 59  LEU C C   1 
ATOM   4098 O  O   . LEU C 1 60  ? 28.878  26.634  -28.315 1.00 41.21  ? 59  LEU C O   1 
ATOM   4099 C  CB  . LEU C 1 60  ? 29.995  27.420  -25.590 1.00 38.51  ? 59  LEU C CB  1 
ATOM   4100 C  CG  . LEU C 1 60  ? 30.984  27.683  -24.452 1.00 38.33  ? 59  LEU C CG  1 
ATOM   4101 C  CD1 . LEU C 1 60  ? 30.646  28.970  -23.740 1.00 37.86  ? 59  LEU C CD1 1 
ATOM   4102 C  CD2 . LEU C 1 60  ? 30.955  26.518  -23.480 1.00 38.56  ? 59  LEU C CD2 1 
ATOM   4103 N  N   . PRO C 1 61  ? 28.316  24.865  -27.106 1.00 38.02  ? 60  PRO C N   1 
ATOM   4104 C  CA  . PRO C 1 61  ? 28.452  23.897  -26.027 1.00 34.69  ? 60  PRO C CA  1 
ATOM   4105 C  C   . PRO C 1 61  ? 29.526  22.862  -26.302 1.00 34.45  ? 60  PRO C C   1 
ATOM   4106 O  O   . PRO C 1 61  ? 29.991  22.700  -27.439 1.00 37.54  ? 60  PRO C O   1 
ATOM   4107 C  CB  . PRO C 1 61  ? 27.088  23.226  -26.031 1.00 36.44  ? 60  PRO C CB  1 
ATOM   4108 C  CG  . PRO C 1 61  ? 26.766  23.183  -27.498 1.00 34.76  ? 60  PRO C CG  1 
ATOM   4109 C  CD  . PRO C 1 61  ? 27.102  24.593  -27.898 1.00 35.27  ? 60  PRO C CD  1 
ATOM   4110 N  N   . TYR C 1 62  ? 29.894  22.151  -25.246 1.00 32.52  ? 61  TYR C N   1 
ATOM   4111 C  CA  . TYR C 1 62  ? 30.870  21.087  -25.346 1.00 29.52  ? 61  TYR C CA  1 
ATOM   4112 C  C   . TYR C 1 62  ? 30.385  19.995  -24.429 1.00 26.78  ? 61  TYR C C   1 
ATOM   4113 O  O   . TYR C 1 62  ? 29.622  20.257  -23.497 1.00 21.78  ? 61  TYR C O   1 
ATOM   4114 C  CB  . TYR C 1 62  ? 32.265  21.558  -24.937 1.00 31.90  ? 61  TYR C CB  1 
ATOM   4115 C  CG  . TYR C 1 62  ? 32.429  21.938  -23.490 1.00 38.21  ? 61  TYR C CG  1 
ATOM   4116 C  CD1 . TYR C 1 62  ? 32.586  20.960  -22.508 1.00 38.73  ? 61  TYR C CD1 1 
ATOM   4117 C  CD2 . TYR C 1 62  ? 32.498  23.277  -23.109 1.00 38.00  ? 61  TYR C CD2 1 
ATOM   4118 C  CE1 . TYR C 1 62  ? 32.814  21.300  -21.183 1.00 41.15  ? 61  TYR C CE1 1 
ATOM   4119 C  CE2 . TYR C 1 62  ? 32.728  23.637  -21.781 1.00 41.93  ? 61  TYR C CE2 1 
ATOM   4120 C  CZ  . TYR C 1 62  ? 32.889  22.642  -20.818 1.00 43.12  ? 61  TYR C CZ  1 
ATOM   4121 O  OH  . TYR C 1 62  ? 33.137  22.978  -19.494 1.00 42.86  ? 61  TYR C OH  1 
ATOM   4122 N  N   . LEU C 1 63  ? 30.784  18.768  -24.710 1.00 24.18  ? 62  LEU C N   1 
ATOM   4123 C  CA  . LEU C 1 63  ? 30.374  17.668  -23.876 1.00 22.30  ? 62  LEU C CA  1 
ATOM   4124 C  C   . LEU C 1 63  ? 31.562  16.787  -23.610 1.00 25.20  ? 62  LEU C C   1 
ATOM   4125 O  O   . LEU C 1 63  ? 32.276  16.385  -24.530 1.00 15.91  ? 62  LEU C O   1 
ATOM   4126 C  CB  . LEU C 1 63  ? 29.285  16.843  -24.545 1.00 19.41  ? 62  LEU C CB  1 
ATOM   4127 C  CG  . LEU C 1 63  ? 28.868  15.668  -23.662 1.00 26.76  ? 62  LEU C CG  1 
ATOM   4128 C  CD1 . LEU C 1 63  ? 27.904  16.142  -22.580 1.00 25.37  ? 62  LEU C CD1 1 
ATOM   4129 C  CD2 . LEU C 1 63  ? 28.255  14.563  -24.493 1.00 27.45  ? 62  LEU C CD2 1 
ATOM   4130 N  N   . ILE C 1 64  ? 31.755  16.459  -22.344 1.00 29.85  ? 63  ILE C N   1 
ATOM   4131 C  CA  . ILE C 1 64  ? 32.862  15.617  -21.975 1.00 35.06  ? 63  ILE C CA  1 
ATOM   4132 C  C   . ILE C 1 64  ? 32.373  14.290  -21.419 1.00 35.54  ? 63  ILE C C   1 
ATOM   4133 O  O   . ILE C 1 64  ? 31.761  14.239  -20.352 1.00 40.25  ? 63  ILE C O   1 
ATOM   4134 C  CB  . ILE C 1 64  ? 33.769  16.345  -20.987 1.00 33.56  ? 63  ILE C CB  1 
ATOM   4135 C  CG1 . ILE C 1 64  ? 34.276  17.636  -21.636 1.00 38.05  ? 63  ILE C CG1 1 
ATOM   4136 C  CG2 . ILE C 1 64  ? 34.927  15.466  -20.599 1.00 33.93  ? 63  ILE C CG2 1 
ATOM   4137 C  CD1 . ILE C 1 64  ? 35.127  18.486  -20.739 1.00 44.60  ? 63  ILE C CD1 1 
ATOM   4138 N  N   . ASP C 1 65  ? 32.585  13.223  -22.178 1.00 34.51  ? 64  ASP C N   1 
ATOM   4139 C  CA  . ASP C 1 65  ? 32.180  11.899  -21.743 1.00 37.10  ? 64  ASP C CA  1 
ATOM   4140 C  C   . ASP C 1 65  ? 33.418  11.023  -21.600 1.00 38.09  ? 64  ASP C C   1 
ATOM   4141 O  O   . ASP C 1 65  ? 33.754  10.250  -22.497 1.00 37.36  ? 64  ASP C O   1 
ATOM   4142 C  CB  . ASP C 1 65  ? 31.192  11.280  -22.738 1.00 41.11  ? 64  ASP C CB  1 
ATOM   4143 C  CG  . ASP C 1 65  ? 30.657  9.923   -22.280 1.00 43.38  ? 64  ASP C CG  1 
ATOM   4144 O  OD1 . ASP C 1 65  ? 30.781  9.586   -21.081 1.00 45.35  ? 64  ASP C OD1 1 
ATOM   4145 O  OD2 . ASP C 1 65  ? 30.105  9.192   -23.129 1.00 40.90  ? 64  ASP C OD2 1 
ATOM   4146 N  N   . GLY C 1 66  ? 34.074  11.123  -20.449 1.00 38.92  ? 65  GLY C N   1 
ATOM   4147 C  CA  . GLY C 1 66  ? 35.267  10.338  -20.219 1.00 36.56  ? 65  GLY C CA  1 
ATOM   4148 C  C   . GLY C 1 66  ? 36.395  10.842  -21.091 1.00 36.20  ? 65  GLY C C   1 
ATOM   4149 O  O   . GLY C 1 66  ? 36.872  11.967  -20.913 1.00 36.83  ? 65  GLY C O   1 
ATOM   4150 N  N   . ALA C 1 67  ? 36.829  10.003  -22.025 1.00 37.19  ? 66  ALA C N   1 
ATOM   4151 C  CA  . ALA C 1 67  ? 37.910  10.363  -22.934 1.00 38.94  ? 66  ALA C CA  1 
ATOM   4152 C  C   . ALA C 1 67  ? 37.417  11.186  -24.119 1.00 40.19  ? 66  ALA C C   1 
ATOM   4153 O  O   . ALA C 1 67  ? 38.226  11.769  -24.852 1.00 37.91  ? 66  ALA C O   1 
ATOM   4154 C  CB  . ALA C 1 67  ? 38.607  9.110   -23.438 1.00 42.62  ? 66  ALA C CB  1 
ATOM   4155 N  N   . HIS C 1 68  ? 36.100  11.212  -24.316 1.00 40.36  ? 67  HIS C N   1 
ATOM   4156 C  CA  . HIS C 1 68  ? 35.496  11.941  -25.427 1.00 38.33  ? 67  HIS C CA  1 
ATOM   4157 C  C   . HIS C 1 68  ? 35.112  13.386  -25.157 1.00 34.78  ? 67  HIS C C   1 
ATOM   4158 O  O   . HIS C 1 68  ? 34.186  13.659  -24.401 1.00 30.99  ? 67  HIS C O   1 
ATOM   4159 C  CB  . HIS C 1 68  ? 34.303  11.186  -25.967 1.00 42.39  ? 67  HIS C CB  1 
ATOM   4160 C  CG  . HIS C 1 68  ? 34.576  9.782   -26.417 1.00 49.84  ? 67  HIS C CG  1 
ATOM   4161 N  ND1 . HIS C 1 68  ? 35.173  9.491   -27.626 1.00 47.63  ? 67  HIS C ND1 1 
ATOM   4162 C  CD2 . HIS C 1 68  ? 34.355  8.591   -25.811 1.00 49.45  ? 67  HIS C CD2 1 
ATOM   4163 C  CE1 . HIS C 1 68  ? 35.311  8.181   -27.744 1.00 47.05  ? 67  HIS C CE1 1 
ATOM   4164 N  NE2 . HIS C 1 68  ? 34.822  7.612   -26.656 1.00 45.63  ? 67  HIS C NE2 1 
ATOM   4165 N  N   . LYS C 1 69  ? 35.844  14.307  -25.771 1.00 34.50  ? 68  LYS C N   1 
ATOM   4166 C  CA  . LYS C 1 69  ? 35.572  15.731  -25.635 1.00 39.20  ? 68  LYS C CA  1 
ATOM   4167 C  C   . LYS C 1 69  ? 34.946  16.158  -26.958 1.00 37.08  ? 68  LYS C C   1 
ATOM   4168 O  O   . LYS C 1 69  ? 35.564  16.028  -28.019 1.00 32.27  ? 68  LYS C O   1 
ATOM   4169 C  CB  . LYS C 1 69  ? 36.857  16.524  -25.371 1.00 43.65  ? 68  LYS C CB  1 
ATOM   4170 C  CG  . LYS C 1 69  ? 37.434  16.376  -23.957 1.00 47.89  ? 68  LYS C CG  1 
ATOM   4171 C  CD  . LYS C 1 69  ? 38.019  14.991  -23.714 1.00 50.00  ? 68  LYS C CD  1 
ATOM   4172 C  CE  . LYS C 1 69  ? 38.606  14.873  -22.313 1.00 47.81  ? 68  LYS C CE  1 
ATOM   4173 N  NZ  . LYS C 1 69  ? 39.671  15.875  -22.064 1.00 55.43  ? 68  LYS C NZ  1 
ATOM   4174 N  N   . ILE C 1 70  ? 33.719  16.668  -26.890 1.00 35.14  ? 69  ILE C N   1 
ATOM   4175 C  CA  . ILE C 1 70  ? 32.987  17.073  -28.083 1.00 32.05  ? 69  ILE C CA  1 
ATOM   4176 C  C   . ILE C 1 70  ? 32.476  18.508  -28.096 1.00 29.85  ? 69  ILE C C   1 
ATOM   4177 O  O   . ILE C 1 70  ? 32.187  19.095  -27.057 1.00 29.89  ? 69  ILE C O   1 
ATOM   4178 C  CB  . ILE C 1 70  ? 31.782  16.143  -28.294 1.00 31.92  ? 69  ILE C CB  1 
ATOM   4179 C  CG1 . ILE C 1 70  ? 32.245  14.685  -28.247 1.00 34.51  ? 69  ILE C CG1 1 
ATOM   4180 C  CG2 . ILE C 1 70  ? 31.117  16.438  -29.628 1.00 36.77  ? 69  ILE C CG2 1 
ATOM   4181 C  CD1 . ILE C 1 70  ? 31.139  13.692  -28.269 1.00 35.55  ? 69  ILE C CD1 1 
ATOM   4182 N  N   . THR C 1 71  ? 32.441  19.084  -29.288 1.00 29.36  ? 70  THR C N   1 
ATOM   4183 C  CA  . THR C 1 71  ? 31.918  20.427  -29.495 1.00 28.52  ? 70  THR C CA  1 
ATOM   4184 C  C   . THR C 1 71  ? 30.980  20.320  -30.695 1.00 30.74  ? 70  THR C C   1 
ATOM   4185 O  O   . THR C 1 71  ? 30.870  19.242  -31.307 1.00 24.61  ? 70  THR C O   1 
ATOM   4186 C  CB  . THR C 1 71  ? 33.023  21.476  -29.754 1.00 22.88  ? 70  THR C CB  1 
ATOM   4187 O  OG1 . THR C 1 71  ? 33.882  21.028  -30.807 1.00 27.44  ? 70  THR C OG1 1 
ATOM   4188 C  CG2 . THR C 1 71  ? 33.849  21.711  -28.494 1.00 33.85  ? 70  THR C CG2 1 
ATOM   4189 N  N   . GLN C 1 72  ? 30.292  21.418  -31.008 1.00 29.37  ? 71  GLN C N   1 
ATOM   4190 C  CA  . GLN C 1 72  ? 29.334  21.451  -32.107 1.00 20.95  ? 71  GLN C CA  1 
ATOM   4191 C  C   . GLN C 1 72  ? 28.041  20.769  -31.669 1.00 21.43  ? 71  GLN C C   1 
ATOM   4192 O  O   . GLN C 1 72  ? 27.970  19.539  -31.594 1.00 20.24  ? 71  GLN C O   1 
ATOM   4193 C  CB  . GLN C 1 72  ? 29.902  20.778  -33.354 1.00 17.23  ? 71  GLN C CB  1 
ATOM   4194 C  CG  . GLN C 1 72  ? 31.008  21.564  -34.025 1.00 20.36  ? 71  GLN C CG  1 
ATOM   4195 C  CD  . GLN C 1 72  ? 30.534  22.919  -34.492 1.00 22.95  ? 71  GLN C CD  1 
ATOM   4196 O  OE1 . GLN C 1 72  ? 29.366  23.097  -34.828 1.00 28.17  ? 71  GLN C OE1 1 
ATOM   4197 N  NE2 . GLN C 1 72  ? 31.431  23.887  -34.513 1.00 24.43  ? 71  GLN C NE2 1 
ATOM   4198 N  N   . SER C 1 73  ? 27.031  21.582  -31.362 1.00 22.36  ? 72  SER C N   1 
ATOM   4199 C  CA  . SER C 1 73  ? 25.746  21.079  -30.893 1.00 24.72  ? 72  SER C CA  1 
ATOM   4200 C  C   . SER C 1 73  ? 25.236  19.838  -31.606 1.00 24.71  ? 72  SER C C   1 
ATOM   4201 O  O   . SER C 1 73  ? 24.988  18.820  -30.956 1.00 23.49  ? 72  SER C O   1 
ATOM   4202 C  CB  . SER C 1 73  ? 24.694  22.191  -30.899 1.00 24.71  ? 72  SER C CB  1 
ATOM   4203 O  OG  . SER C 1 73  ? 24.535  22.695  -32.210 1.00 39.66  ? 72  SER C OG  1 
ATOM   4204 N  N   . ASN C 1 74  ? 25.136  19.890  -32.932 1.00 24.90  ? 73  ASN C N   1 
ATOM   4205 C  CA  . ASN C 1 74  ? 24.635  18.737  -33.686 1.00 31.27  ? 73  ASN C CA  1 
ATOM   4206 C  C   . ASN C 1 74  ? 25.482  17.492  -33.504 1.00 30.95  ? 73  ASN C C   1 
ATOM   4207 O  O   . ASN C 1 74  ? 24.968  16.366  -33.493 1.00 27.04  ? 73  ASN C O   1 
ATOM   4208 C  CB  . ASN C 1 74  ? 24.469  19.075  -35.164 1.00 34.47  ? 73  ASN C CB  1 
ATOM   4209 C  CG  . ASN C 1 74  ? 23.352  20.077  -35.411 1.00 36.91  ? 73  ASN C CG  1 
ATOM   4210 O  OD1 . ASN C 1 74  ? 22.598  20.437  -34.499 1.00 37.97  ? 73  ASN C OD1 1 
ATOM   4211 N  ND2 . ASN C 1 74  ? 23.236  20.531  -36.651 1.00 44.76  ? 73  ASN C ND2 1 
ATOM   4212 N  N   . ALA C 1 75  ? 26.781  17.705  -33.337 1.00 31.28  ? 74  ALA C N   1 
ATOM   4213 C  CA  . ALA C 1 75  ? 27.724  16.617  -33.114 1.00 30.71  ? 74  ALA C CA  1 
ATOM   4214 C  C   . ALA C 1 75  ? 27.432  15.971  -31.770 1.00 32.58  ? 74  ALA C C   1 
ATOM   4215 O  O   . ALA C 1 75  ? 27.411  14.744  -31.643 1.00 33.66  ? 74  ALA C O   1 
ATOM   4216 C  CB  . ALA C 1 75  ? 29.139  17.148  -33.130 1.00 26.73  ? 74  ALA C CB  1 
ATOM   4217 N  N   . ILE C 1 76  ? 27.244  16.812  -30.760 1.00 32.11  ? 75  ILE C N   1 
ATOM   4218 C  CA  . ILE C 1 76  ? 26.946  16.363  -29.403 1.00 34.07  ? 75  ILE C CA  1 
ATOM   4219 C  C   . ILE C 1 76  ? 25.682  15.517  -29.375 1.00 38.02  ? 75  ILE C C   1 
ATOM   4220 O  O   . ILE C 1 76  ? 25.661  14.434  -28.778 1.00 41.37  ? 75  ILE C O   1 
ATOM   4221 C  CB  . ILE C 1 76  ? 26.802  17.574  -28.464 1.00 34.99  ? 75  ILE C CB  1 
ATOM   4222 C  CG1 . ILE C 1 76  ? 28.152  18.307  -28.386 1.00 32.41  ? 75  ILE C CG1 1 
ATOM   4223 C  CG2 . ILE C 1 76  ? 26.329  17.133  -27.089 1.00 38.89  ? 75  ILE C CG2 1 
ATOM   4224 C  CD1 . ILE C 1 76  ? 28.124  19.609  -27.634 1.00 25.06  ? 75  ILE C CD1 1 
ATOM   4225 N  N   . LEU C 1 77  ? 24.639  16.019  -30.035 1.00 39.25  ? 76  LEU C N   1 
ATOM   4226 C  CA  . LEU C 1 77  ? 23.355  15.337  -30.118 1.00 38.61  ? 76  LEU C CA  1 
ATOM   4227 C  C   . LEU C 1 77  ? 23.465  13.966  -30.756 1.00 40.81  ? 76  LEU C C   1 
ATOM   4228 O  O   . LEU C 1 77  ? 22.904  13.008  -30.228 1.00 43.34  ? 76  LEU C O   1 
ATOM   4229 C  CB  . LEU C 1 77  ? 22.349  16.188  -30.883 1.00 33.10  ? 76  LEU C CB  1 
ATOM   4230 C  CG  . LEU C 1 77  ? 21.878  17.439  -30.146 1.00 25.91  ? 76  LEU C CG  1 
ATOM   4231 C  CD1 . LEU C 1 77  ? 21.214  18.424  -31.091 1.00 23.95  ? 76  LEU C CD1 1 
ATOM   4232 C  CD2 . LEU C 1 77  ? 20.929  17.018  -29.058 1.00 18.41  ? 76  LEU C CD2 1 
ATOM   4233 N  N   . CYS C 1 78  ? 24.146  13.868  -31.899 1.00 41.29  ? 77  CYS C N   1 
ATOM   4234 C  CA  . CYS C 1 78  ? 24.300  12.569  -32.568 1.00 43.87  ? 77  CYS C CA  1 
ATOM   4235 C  C   . CYS C 1 78  ? 25.034  11.597  -31.665 1.00 41.40  ? 77  CYS C C   1 
ATOM   4236 O  O   . CYS C 1 78  ? 24.747  10.394  -31.669 1.00 37.96  ? 77  CYS C O   1 
ATOM   4237 C  CB  . CYS C 1 78  ? 25.076  12.693  -33.879 1.00 47.37  ? 77  CYS C CB  1 
ATOM   4238 S  SG  . CYS C 1 78  ? 24.265  13.600  -35.218 1.00 59.82  ? 77  CYS C SG  1 
ATOM   4239 N  N   . TYR C 1 79  ? 26.023  12.118  -30.938 1.00 41.59  ? 78  TYR C N   1 
ATOM   4240 C  CA  . TYR C 1 79  ? 26.821  11.309  -30.025 1.00 42.95  ? 78  TYR C CA  1 
ATOM   4241 C  C   . TYR C 1 79  ? 25.914  10.622  -29.011 1.00 41.49  ? 78  TYR C C   1 
ATOM   4242 O  O   . TYR C 1 79  ? 25.974  9.405   -28.815 1.00 40.83  ? 78  TYR C O   1 
ATOM   4243 C  CB  . TYR C 1 79  ? 27.842  12.186  -29.289 1.00 46.53  ? 78  TYR C CB  1 
ATOM   4244 C  CG  . TYR C 1 79  ? 28.725  11.414  -28.325 1.00 50.73  ? 78  TYR C CG  1 
ATOM   4245 C  CD1 . TYR C 1 79  ? 29.517  10.354  -28.777 1.00 52.99  ? 78  TYR C CD1 1 
ATOM   4246 C  CD2 . TYR C 1 79  ? 28.747  11.720  -26.965 1.00 49.05  ? 78  TYR C CD2 1 
ATOM   4247 C  CE1 . TYR C 1 79  ? 30.300  9.620   -27.907 1.00 50.40  ? 78  TYR C CE1 1 
ATOM   4248 C  CE2 . TYR C 1 79  ? 29.531  10.989  -26.086 1.00 50.62  ? 78  TYR C CE2 1 
ATOM   4249 C  CZ  . TYR C 1 79  ? 30.303  9.942   -26.565 1.00 48.50  ? 78  TYR C CZ  1 
ATOM   4250 O  OH  . TYR C 1 79  ? 31.086  9.221   -25.701 1.00 47.14  ? 78  TYR C OH  1 
ATOM   4251 N  N   . ILE C 1 80  ? 25.130  11.437  -28.321 1.00 39.18  ? 79  ILE C N   1 
ATOM   4252 C  CA  . ILE C 1 80  ? 24.194  10.951  -27.322 1.00 40.67  ? 79  ILE C CA  1 
ATOM   4253 C  C   . ILE C 1 80  ? 23.179  10.021  -27.986 1.00 41.16  ? 79  ILE C C   1 
ATOM   4254 O  O   . ILE C 1 80  ? 22.931  8.916   -27.501 1.00 39.71  ? 79  ILE C O   1 
ATOM   4255 C  CB  . ILE C 1 80  ? 23.469  12.144  -26.645 1.00 39.85  ? 79  ILE C CB  1 
ATOM   4256 C  CG1 . ILE C 1 80  ? 24.510  13.112  -26.073 1.00 37.41  ? 79  ILE C CG1 1 
ATOM   4257 C  CG2 . ILE C 1 80  ? 22.548  11.655  -25.524 1.00 35.53  ? 79  ILE C CG2 1 
ATOM   4258 C  CD1 . ILE C 1 80  ? 23.949  14.458  -25.668 1.00 38.89  ? 79  ILE C CD1 1 
ATOM   4259 N  N   . ALA C 1 81  ? 22.614  10.471  -29.103 1.00 43.85  ? 80  ALA C N   1 
ATOM   4260 C  CA  . ALA C 1 81  ? 21.623  9.705   -29.855 1.00 44.52  ? 80  ALA C CA  1 
ATOM   4261 C  C   . ALA C 1 81  ? 22.107  8.314   -30.260 1.00 46.62  ? 80  ALA C C   1 
ATOM   4262 O  O   . ALA C 1 81  ? 21.375  7.336   -30.112 1.00 46.77  ? 80  ALA C O   1 
ATOM   4263 C  CB  . ALA C 1 81  ? 21.178  10.485  -31.091 1.00 45.19  ? 80  ALA C CB  1 
ATOM   4264 N  N   . ARG C 1 82  ? 23.320  8.229   -30.797 1.00 48.13  ? 81  ARG C N   1 
ATOM   4265 C  CA  . ARG C 1 82  ? 23.863  6.946   -31.216 1.00 51.35  ? 81  ARG C CA  1 
ATOM   4266 C  C   . ARG C 1 82  ? 23.902  5.924   -30.090 1.00 53.34  ? 81  ARG C C   1 
ATOM   4267 O  O   . ARG C 1 82  ? 23.813  4.722   -30.337 1.00 57.00  ? 81  ARG C O   1 
ATOM   4268 C  CB  . ARG C 1 82  ? 25.255  7.107   -31.824 1.00 50.41  ? 81  ARG C CB  1 
ATOM   4269 C  CG  . ARG C 1 82  ? 25.251  7.405   -33.311 1.00 51.14  ? 81  ARG C CG  1 
ATOM   4270 C  CD  . ARG C 1 82  ? 26.637  7.228   -33.901 1.00 53.56  ? 81  ARG C CD  1 
ATOM   4271 N  NE  . ARG C 1 82  ? 27.618  8.140   -33.313 1.00 57.16  ? 81  ARG C NE  1 
ATOM   4272 C  CZ  . ARG C 1 82  ? 27.802  9.401   -33.699 1.00 60.14  ? 81  ARG C CZ  1 
ATOM   4273 N  NH1 . ARG C 1 82  ? 27.068  9.917   -34.680 1.00 62.08  ? 81  ARG C NH1 1 
ATOM   4274 N  NH2 . ARG C 1 82  ? 28.725  10.148  -33.106 1.00 55.44  ? 81  ARG C NH2 1 
ATOM   4275 N  N   . LYS C 1 83  ? 24.081  6.393   -28.861 1.00 53.24  ? 82  LYS C N   1 
ATOM   4276 C  CA  . LYS C 1 83  ? 24.121  5.501   -27.709 1.00 55.00  ? 82  LYS C CA  1 
ATOM   4277 C  C   . LYS C 1 83  ? 22.742  4.917   -27.396 1.00 56.62  ? 82  LYS C C   1 
ATOM   4278 O  O   . LYS C 1 83  ? 22.632  3.945   -26.645 1.00 57.04  ? 82  LYS C O   1 
ATOM   4279 C  CB  . LYS C 1 83  ? 24.626  6.242   -26.472 1.00 56.85  ? 82  LYS C CB  1 
ATOM   4280 C  CG  . LYS C 1 83  ? 26.061  6.718   -26.535 1.00 62.95  ? 82  LYS C CG  1 
ATOM   4281 C  CD  . LYS C 1 83  ? 26.448  7.379   -25.215 1.00 66.59  ? 82  LYS C CD  1 
ATOM   4282 C  CE  . LYS C 1 83  ? 27.895  7.832   -25.210 1.00 70.47  ? 82  LYS C CE  1 
ATOM   4283 N  NZ  . LYS C 1 83  ? 28.852  6.705   -25.403 1.00 71.68  ? 82  LYS C NZ  1 
ATOM   4284 N  N   . HIS C 1 84  ? 21.689  5.543   -27.918 1.00 58.89  ? 83  HIS C N   1 
ATOM   4285 C  CA  . HIS C 1 84  ? 20.324  5.081   -27.667 1.00 60.22  ? 83  HIS C CA  1 
ATOM   4286 C  C   . HIS C 1 84  ? 19.501  4.845   -28.938 1.00 61.02  ? 83  HIS C C   1 
ATOM   4287 O  O   . HIS C 1 84  ? 18.267  4.860   -28.896 1.00 59.67  ? 83  HIS C O   1 
ATOM   4288 C  CB  . HIS C 1 84  ? 19.599  6.074   -26.758 1.00 61.53  ? 83  HIS C CB  1 
ATOM   4289 C  CG  . HIS C 1 84  ? 20.331  6.417   -25.500 1.00 62.88  ? 83  HIS C CG  1 
ATOM   4290 N  ND1 . HIS C 1 84  ? 21.508  7.134   -25.494 1.00 64.08  ? 83  HIS C ND1 1 
ATOM   4291 C  CD2 . HIS C 1 84  ? 20.057  6.136   -24.205 1.00 61.50  ? 83  HIS C CD2 1 
ATOM   4292 C  CE1 . HIS C 1 84  ? 21.926  7.282   -24.250 1.00 62.39  ? 83  HIS C CE1 1 
ATOM   4293 N  NE2 . HIS C 1 84  ? 21.064  6.685   -23.448 1.00 60.62  ? 83  HIS C NE2 1 
ATOM   4294 N  N   . ASN C 1 85  ? 20.190  4.631   -30.056 1.00 61.15  ? 84  ASN C N   1 
ATOM   4295 C  CA  . ASN C 1 85  ? 19.558  4.372   -31.348 1.00 63.46  ? 84  ASN C CA  1 
ATOM   4296 C  C   . ASN C 1 85  ? 18.469  5.372   -31.723 1.00 62.71  ? 84  ASN C C   1 
ATOM   4297 O  O   . ASN C 1 85  ? 17.344  4.998   -32.065 1.00 64.33  ? 84  ASN C O   1 
ATOM   4298 C  CB  . ASN C 1 85  ? 19.003  2.946   -31.395 1.00 66.12  ? 84  ASN C CB  1 
ATOM   4299 C  CG  . ASN C 1 85  ? 20.094  1.899   -31.316 1.00 69.60  ? 84  ASN C CG  1 
ATOM   4300 O  OD1 . ASN C 1 85  ? 20.161  1.127   -30.360 1.00 72.21  ? 84  ASN C OD1 1 
ATOM   4301 N  ND2 . ASN C 1 85  ? 20.955  1.858   -32.329 1.00 69.39  ? 84  ASN C ND2 1 
ATOM   4302 N  N   . LEU C 1 86  ? 18.828  6.647   -31.681 1.00 59.60  ? 85  LEU C N   1 
ATOM   4303 C  CA  . LEU C 1 86  ? 17.909  7.723   -32.011 1.00 56.90  ? 85  LEU C CA  1 
ATOM   4304 C  C   . LEU C 1 86  ? 18.488  8.566   -33.137 1.00 57.36  ? 85  LEU C C   1 
ATOM   4305 O  O   . LEU C 1 86  ? 18.231  9.772   -33.232 1.00 54.43  ? 85  LEU C O   1 
ATOM   4306 C  CB  . LEU C 1 86  ? 17.667  8.588   -30.777 1.00 55.37  ? 85  LEU C CB  1 
ATOM   4307 C  CG  . LEU C 1 86  ? 17.041  7.843   -29.597 1.00 52.48  ? 85  LEU C CG  1 
ATOM   4308 C  CD1 . LEU C 1 86  ? 17.062  8.712   -28.352 1.00 56.21  ? 85  LEU C CD1 1 
ATOM   4309 C  CD2 . LEU C 1 86  ? 15.621  7.425   -29.955 1.00 53.42  ? 85  LEU C CD2 1 
ATOM   4310 N  N   . CYS C 1 87  ? 19.298  7.928   -33.972 1.00 59.83  ? 86  CYS C N   1 
ATOM   4311 C  CA  . CYS C 1 87  ? 19.921  8.613   -35.096 1.00 64.67  ? 86  CYS C CA  1 
ATOM   4312 C  C   . CYS C 1 87  ? 19.330  8.171   -36.430 1.00 66.02  ? 86  CYS C C   1 
ATOM   4313 O  O   . CYS C 1 87  ? 19.725  8.659   -37.495 1.00 65.18  ? 86  CYS C O   1 
ATOM   4314 C  CB  . CYS C 1 87  ? 21.437  8.404   -35.079 1.00 64.64  ? 86  CYS C CB  1 
ATOM   4315 S  SG  . CYS C 1 87  ? 22.341  9.898   -34.619 1.00 68.53  ? 86  CYS C SG  1 
ATOM   4316 N  N   . GLY C 1 88  ? 18.329  7.300   -36.359 1.00 66.17  ? 87  GLY C N   1 
ATOM   4317 C  CA  . GLY C 1 88  ? 17.704  6.807   -37.570 1.00 68.08  ? 87  GLY C CA  1 
ATOM   4318 C  C   . GLY C 1 88  ? 18.235  5.434   -37.926 1.00 68.83  ? 87  GLY C C   1 
ATOM   4319 O  O   . GLY C 1 88  ? 19.335  5.052   -37.516 1.00 68.86  ? 87  GLY C O   1 
ATOM   4320 N  N   . GLU C 1 89  ? 17.447  4.682   -38.682 1.00 71.67  ? 88  GLU C N   1 
ATOM   4321 C  CA  . GLU C 1 89  ? 17.830  3.336   -39.081 1.00 73.02  ? 88  GLU C CA  1 
ATOM   4322 C  C   . GLU C 1 89  ? 17.670  3.143   -40.583 1.00 72.18  ? 88  GLU C C   1 
ATOM   4323 O  O   . GLU C 1 89  ? 18.621  2.757   -41.259 1.00 71.95  ? 88  GLU C O   1 
ATOM   4324 C  CB  . GLU C 1 89  ? 16.981  2.310   -38.331 1.00 76.84  ? 88  GLU C CB  1 
ATOM   4325 C  CG  . GLU C 1 89  ? 17.094  2.408   -36.814 1.00 83.57  ? 88  GLU C CG  1 
ATOM   4326 C  CD  . GLU C 1 89  ? 15.977  1.678   -36.088 1.00 86.30  ? 88  GLU C CD  1 
ATOM   4327 O  OE1 . GLU C 1 89  ? 14.803  2.090   -36.230 1.00 86.16  ? 88  GLU C OE1 1 
ATOM   4328 O  OE2 . GLU C 1 89  ? 16.274  0.701   -35.365 1.00 86.56  ? 88  GLU C OE2 1 
ATOM   4329 N  N   . THR C 1 90  ? 16.463  3.366   -41.096 1.00 71.11  ? 89  THR C N   1 
ATOM   4330 C  CA  . THR C 1 90  ? 16.213  3.209   -42.527 1.00 70.35  ? 89  THR C CA  1 
ATOM   4331 C  C   . THR C 1 90  ? 16.908  4.305   -43.324 1.00 69.47  ? 89  THR C C   1 
ATOM   4332 O  O   . THR C 1 90  ? 17.415  5.275   -42.753 1.00 66.64  ? 89  THR C O   1 
ATOM   4333 C  CB  . THR C 1 90  ? 14.701  3.205   -42.868 1.00 71.56  ? 89  THR C CB  1 
ATOM   4334 O  OG1 . THR C 1 90  ? 14.103  4.451   -42.487 1.00 71.39  ? 89  THR C OG1 1 
ATOM   4335 C  CG2 . THR C 1 90  ? 13.997  2.060   -42.145 1.00 71.80  ? 89  THR C CG2 1 
ATOM   4336 N  N   . GLU C 1 91  ? 16.976  4.120   -44.638 1.00 69.75  ? 90  GLU C N   1 
ATOM   4337 C  CA  . GLU C 1 91  ? 17.609  5.103   -45.504 1.00 68.57  ? 90  GLU C CA  1 
ATOM   4338 C  C   . GLU C 1 91  ? 16.855  6.429   -45.441 1.00 67.66  ? 90  GLU C C   1 
ATOM   4339 O  O   . GLU C 1 91  ? 17.461  7.482   -45.251 1.00 65.38  ? 90  GLU C O   1 
ATOM   4340 C  CB  . GLU C 1 91  ? 17.678  4.587   -46.948 1.00 72.82  ? 90  GLU C CB  1 
ATOM   4341 C  CG  . GLU C 1 91  ? 18.235  5.593   -47.978 1.00 77.77  ? 90  GLU C CG  1 
ATOM   4342 C  CD  . GLU C 1 91  ? 19.646  6.104   -47.664 1.00 82.11  ? 90  GLU C CD  1 
ATOM   4343 O  OE1 . GLU C 1 91  ? 20.408  5.410   -46.953 1.00 82.99  ? 90  GLU C OE1 1 
ATOM   4344 O  OE2 . GLU C 1 91  ? 19.998  7.208   -48.140 1.00 83.13  ? 90  GLU C OE2 1 
ATOM   4345 N  N   . GLU C 1 92  ? 15.537  6.373   -45.611 1.00 66.78  ? 91  GLU C N   1 
ATOM   4346 C  CA  . GLU C 1 92  ? 14.723  7.583   -45.561 1.00 66.64  ? 91  GLU C CA  1 
ATOM   4347 C  C   . GLU C 1 92  ? 14.771  8.283   -44.202 1.00 62.87  ? 91  GLU C C   1 
ATOM   4348 O  O   . GLU C 1 92  ? 14.675  9.507   -44.139 1.00 59.71  ? 91  GLU C O   1 
ATOM   4349 C  CB  . GLU C 1 92  ? 13.275  7.295   -45.981 1.00 70.48  ? 91  GLU C CB  1 
ATOM   4350 C  CG  . GLU C 1 92  ? 12.958  7.657   -47.446 1.00 71.59  ? 91  GLU C CG  1 
ATOM   4351 C  CD  . GLU C 1 92  ? 12.894  9.165   -47.697 1.00 72.49  ? 91  GLU C CD  1 
ATOM   4352 O  OE1 . GLU C 1 92  ? 12.243  9.880   -46.901 1.00 70.43  ? 91  GLU C OE1 1 
ATOM   4353 O  OE2 . GLU C 1 92  ? 13.480  9.637   -48.697 1.00 71.80  ? 91  GLU C OE2 1 
ATOM   4354 N  N   . GLU C 1 93  ? 14.908  7.514   -43.122 1.00 61.23  ? 92  GLU C N   1 
ATOM   4355 C  CA  . GLU C 1 93  ? 14.983  8.099   -41.783 1.00 59.57  ? 92  GLU C CA  1 
ATOM   4356 C  C   . GLU C 1 93  ? 16.215  8.983   -41.660 1.00 56.04  ? 92  GLU C C   1 
ATOM   4357 O  O   . GLU C 1 93  ? 16.133  10.121  -41.194 1.00 55.91  ? 92  GLU C O   1 
ATOM   4358 C  CB  . GLU C 1 93  ? 15.019  7.017   -40.696 1.00 61.42  ? 92  GLU C CB  1 
ATOM   4359 C  CG  . GLU C 1 93  ? 13.648  6.476   -40.297 1.00 65.62  ? 92  GLU C CG  1 
ATOM   4360 C  CD  . GLU C 1 93  ? 13.705  5.572   -39.077 1.00 71.84  ? 92  GLU C CD  1 
ATOM   4361 O  OE1 . GLU C 1 93  ? 13.070  5.904   -38.052 1.00 76.13  ? 92  GLU C OE1 1 
ATOM   4362 O  OE2 . GLU C 1 93  ? 14.380  4.525   -39.142 1.00 74.02  ? 92  GLU C OE2 1 
ATOM   4363 N  N   . LYS C 1 94  ? 17.355  8.445   -42.077 1.00 53.22  ? 93  LYS C N   1 
ATOM   4364 C  CA  . LYS C 1 94  ? 18.616  9.165   -42.023 1.00 49.98  ? 93  LYS C CA  1 
ATOM   4365 C  C   . LYS C 1 94  ? 18.585  10.431  -42.874 1.00 46.06  ? 93  LYS C C   1 
ATOM   4366 O  O   . LYS C 1 94  ? 19.118  11.469  -42.467 1.00 44.78  ? 93  LYS C O   1 
ATOM   4367 C  CB  . LYS C 1 94  ? 19.760  8.243   -42.446 1.00 55.70  ? 93  LYS C CB  1 
ATOM   4368 C  CG  . LYS C 1 94  ? 19.906  7.013   -41.546 1.00 58.57  ? 93  LYS C CG  1 
ATOM   4369 C  CD  . LYS C 1 94  ? 21.104  6.156   -41.932 1.00 61.05  ? 93  LYS C CD  1 
ATOM   4370 C  CE  . LYS C 1 94  ? 21.343  5.051   -40.903 1.00 69.08  ? 93  LYS C CE  1 
ATOM   4371 N  NZ  . LYS C 1 94  ? 22.545  4.225   -41.228 1.00 72.46  ? 93  LYS C NZ  1 
ATOM   4372 N  N   . ILE C 1 95  ? 17.967  10.340  -44.053 1.00 41.70  ? 94  ILE C N   1 
ATOM   4373 C  CA  . ILE C 1 95  ? 17.844  11.482  -44.966 1.00 39.11  ? 94  ILE C CA  1 
ATOM   4374 C  C   . ILE C 1 95  ? 17.091  12.615  -44.274 1.00 36.68  ? 94  ILE C C   1 
ATOM   4375 O  O   . ILE C 1 95  ? 17.533  13.770  -44.284 1.00 32.41  ? 94  ILE C O   1 
ATOM   4376 C  CB  . ILE C 1 95  ? 17.076  11.099  -46.259 1.00 39.69  ? 94  ILE C CB  1 
ATOM   4377 C  CG1 . ILE C 1 95  ? 17.783  9.949   -46.973 1.00 41.10  ? 94  ILE C CG1 1 
ATOM   4378 C  CG2 . ILE C 1 95  ? 16.998  12.287  -47.196 1.00 28.58  ? 94  ILE C CG2 1 
ATOM   4379 C  CD1 . ILE C 1 95  ? 17.127  9.539   -48.275 1.00 40.22  ? 94  ILE C CD1 1 
ATOM   4380 N  N   . ARG C 1 96  ? 15.926  12.284  -43.717 1.00 35.43  ? 95  ARG C N   1 
ATOM   4381 C  CA  . ARG C 1 96  ? 15.095  13.256  -43.006 1.00 36.97  ? 95  ARG C CA  1 
ATOM   4382 C  C   . ARG C 1 96  ? 15.856  13.852  -41.817 1.00 39.05  ? 95  ARG C C   1 
ATOM   4383 O  O   . ARG C 1 96  ? 15.772  15.059  -41.562 1.00 38.80  ? 95  ARG C O   1 
ATOM   4384 C  CB  . ARG C 1 96  ? 13.791  12.602  -42.535 1.00 35.16  ? 95  ARG C CB  1 
ATOM   4385 C  CG  . ARG C 1 96  ? 12.919  12.070  -43.668 1.00 30.27  ? 95  ARG C CG  1 
ATOM   4386 C  CD  . ARG C 1 96  ? 11.646  11.399  -43.158 1.00 29.92  ? 95  ARG C CD  1 
ATOM   4387 N  NE  . ARG C 1 96  ? 10.742  12.348  -42.511 1.00 37.30  ? 95  ARG C NE  1 
ATOM   4388 C  CZ  . ARG C 1 96  ? 9.730   12.969  -43.115 1.00 39.08  ? 95  ARG C CZ  1 
ATOM   4389 N  NH1 . ARG C 1 96  ? 9.472   12.745  -44.397 1.00 40.51  ? 95  ARG C NH1 1 
ATOM   4390 N  NH2 . ARG C 1 96  ? 8.988   13.840  -42.442 1.00 43.15  ? 95  ARG C NH2 1 
ATOM   4391 N  N   . VAL C 1 97  ? 16.590  13.006  -41.092 1.00 37.01  ? 96  VAL C N   1 
ATOM   4392 C  CA  . VAL C 1 97  ? 17.377  13.463  -39.948 1.00 34.47  ? 96  VAL C CA  1 
ATOM   4393 C  C   . VAL C 1 97  ? 18.432  14.471  -40.395 1.00 31.81  ? 96  VAL C C   1 
ATOM   4394 O  O   . VAL C 1 97  ? 18.592  15.528  -39.781 1.00 29.27  ? 96  VAL C O   1 
ATOM   4395 C  CB  . VAL C 1 97  ? 18.082  12.297  -39.249 1.00 35.82  ? 96  VAL C CB  1 
ATOM   4396 C  CG1 . VAL C 1 97  ? 19.053  12.824  -38.213 1.00 33.41  ? 96  VAL C CG1 1 
ATOM   4397 C  CG2 . VAL C 1 97  ? 17.060  11.388  -38.593 1.00 36.24  ? 96  VAL C CG2 1 
ATOM   4398 N  N   . ASP C 1 98  ? 19.164  14.140  -41.455 1.00 30.60  ? 97  ASP C N   1 
ATOM   4399 C  CA  . ASP C 1 98  ? 20.197  15.046  -41.957 1.00 33.48  ? 97  ASP C CA  1 
ATOM   4400 C  C   . ASP C 1 98  ? 19.610  16.387  -42.378 1.00 35.29  ? 97  ASP C C   1 
ATOM   4401 O  O   . ASP C 1 98  ? 20.126  17.437  -41.998 1.00 37.52  ? 97  ASP C O   1 
ATOM   4402 C  CB  . ASP C 1 98  ? 20.969  14.425  -43.132 1.00 39.67  ? 97  ASP C CB  1 
ATOM   4403 C  CG  . ASP C 1 98  ? 21.825  13.240  -42.718 1.00 44.07  ? 97  ASP C CG  1 
ATOM   4404 O  OD1 . ASP C 1 98  ? 22.344  13.244  -41.580 1.00 52.35  ? 97  ASP C OD1 1 
ATOM   4405 O  OD2 . ASP C 1 98  ? 21.989  12.305  -43.532 1.00 46.37  ? 97  ASP C OD2 1 
ATOM   4406 N  N   . ILE C 1 99  ? 18.550  16.359  -43.183 1.00 32.46  ? 98  ILE C N   1 
ATOM   4407 C  CA  . ILE C 1 99  ? 17.941  17.601  -43.641 1.00 30.47  ? 98  ILE C CA  1 
ATOM   4408 C  C   . ILE C 1 99  ? 17.509  18.479  -42.468 1.00 30.67  ? 98  ILE C C   1 
ATOM   4409 O  O   . ILE C 1 99  ? 17.847  19.669  -42.421 1.00 32.12  ? 98  ILE C O   1 
ATOM   4410 C  CB  . ILE C 1 99  ? 16.732  17.349  -44.584 1.00 32.94  ? 98  ILE C CB  1 
ATOM   4411 C  CG1 . ILE C 1 99  ? 17.168  16.485  -45.769 1.00 32.92  ? 98  ILE C CG1 1 
ATOM   4412 C  CG2 . ILE C 1 99  ? 16.174  18.685  -45.097 1.00 27.77  ? 98  ILE C CG2 1 
ATOM   4413 C  CD1 . ILE C 1 99  ? 16.074  16.165  -46.740 1.00 30.39  ? 98  ILE C CD1 1 
ATOM   4414 N  N   . LEU C 1 100 ? 16.739  17.906  -41.542 1.00 29.25  ? 99  LEU C N   1 
ATOM   4415 C  CA  . LEU C 1 100 ? 16.263  18.652  -40.377 1.00 27.44  ? 99  LEU C CA  1 
ATOM   4416 C  C   . LEU C 1 100 ? 17.399  19.151  -39.488 1.00 27.69  ? 99  LEU C C   1 
ATOM   4417 O  O   . LEU C 1 100 ? 17.392  20.305  -39.048 1.00 27.69  ? 99  LEU C O   1 
ATOM   4418 C  CB  . LEU C 1 100 ? 15.294  17.803  -39.558 1.00 26.70  ? 99  LEU C CB  1 
ATOM   4419 C  CG  . LEU C 1 100 ? 13.886  17.692  -40.143 1.00 27.11  ? 99  LEU C CG  1 
ATOM   4420 C  CD1 . LEU C 1 100 ? 13.040  16.793  -39.265 1.00 22.30  ? 99  LEU C CD1 1 
ATOM   4421 C  CD2 . LEU C 1 100 ? 13.259  19.083  -40.260 1.00 29.33  ? 99  LEU C CD2 1 
ATOM   4422 N  N   . GLU C 1 101 ? 18.340  18.257  -39.197 1.00 27.59  ? 100 GLU C N   1 
ATOM   4423 C  CA  . GLU C 1 101 ? 19.499  18.570  -38.378 1.00 27.34  ? 100 GLU C CA  1 
ATOM   4424 C  C   . GLU C 1 101 ? 20.039  19.940  -38.767 1.00 26.64  ? 100 GLU C C   1 
ATOM   4425 O  O   . GLU C 1 101 ? 20.286  20.790  -37.920 1.00 25.24  ? 100 GLU C O   1 
ATOM   4426 C  CB  . GLU C 1 101 ? 20.560  17.488  -38.594 1.00 31.09  ? 100 GLU C CB  1 
ATOM   4427 C  CG  . GLU C 1 101 ? 21.911  17.729  -37.928 1.00 38.22  ? 100 GLU C CG  1 
ATOM   4428 C  CD  . GLU C 1 101 ? 22.807  16.492  -37.958 1.00 43.98  ? 100 GLU C CD  1 
ATOM   4429 O  OE1 . GLU C 1 101 ? 22.801  15.756  -38.969 1.00 40.15  ? 100 GLU C OE1 1 
ATOM   4430 O  OE2 . GLU C 1 101 ? 23.524  16.254  -36.963 1.00 50.34  ? 100 GLU C OE2 1 
ATOM   4431 N  N   . ASN C 1 102 ? 20.160  20.168  -40.066 1.00 28.51  ? 101 ASN C N   1 
ATOM   4432 C  CA  . ASN C 1 102 ? 20.660  21.439  -40.582 1.00 26.93  ? 101 ASN C CA  1 
ATOM   4433 C  C   . ASN C 1 102 ? 19.595  22.516  -40.760 1.00 28.81  ? 101 ASN C C   1 
ATOM   4434 O  O   . ASN C 1 102 ? 19.882  23.706  -40.592 1.00 28.37  ? 101 ASN C O   1 
ATOM   4435 C  CB  . ASN C 1 102 ? 21.373  21.214  -41.914 1.00 25.30  ? 101 ASN C CB  1 
ATOM   4436 C  CG  . ASN C 1 102 ? 22.620  20.369  -41.770 1.00 26.11  ? 101 ASN C CG  1 
ATOM   4437 O  OD1 . ASN C 1 102 ? 23.653  20.854  -41.314 1.00 28.30  ? 101 ASN C OD1 1 
ATOM   4438 N  ND2 . ASN C 1 102 ? 22.534  19.104  -42.165 1.00 24.33  ? 101 ASN C ND2 1 
ATOM   4439 N  N   . GLN C 1 103 ? 18.387  22.113  -41.156 1.00 28.93  ? 102 GLN C N   1 
ATOM   4440 C  CA  . GLN C 1 103 ? 17.294  23.065  -41.368 1.00 27.97  ? 102 GLN C CA  1 
ATOM   4441 C  C   . GLN C 1 103 ? 16.988  23.833  -40.102 1.00 30.93  ? 102 GLN C C   1 
ATOM   4442 O  O   . GLN C 1 103 ? 16.961  25.072  -40.097 1.00 34.15  ? 102 GLN C O   1 
ATOM   4443 C  CB  . GLN C 1 103 ? 16.021  22.355  -41.833 1.00 23.99  ? 102 GLN C CB  1 
ATOM   4444 C  CG  . GLN C 1 103 ? 14.888  23.315  -42.190 1.00 18.22  ? 102 GLN C CG  1 
ATOM   4445 C  CD  . GLN C 1 103 ? 15.204  24.175  -43.407 1.00 20.53  ? 102 GLN C CD  1 
ATOM   4446 O  OE1 . GLN C 1 103 ? 15.946  23.763  -44.297 1.00 25.62  ? 102 GLN C OE1 1 
ATOM   4447 N  NE2 . GLN C 1 103 ? 14.592  25.349  -43.478 1.00 24.93  ? 102 GLN C NE2 1 
ATOM   4448 N  N   . THR C 1 104 ? 16.759  23.086  -39.029 1.00 30.20  ? 103 THR C N   1 
ATOM   4449 C  CA  . THR C 1 104 ? 16.443  23.686  -37.743 1.00 29.61  ? 103 THR C CA  1 
ATOM   4450 C  C   . THR C 1 104 ? 17.511  24.681  -37.333 1.00 30.23  ? 103 THR C C   1 
ATOM   4451 O  O   . THR C 1 104 ? 17.196  25.749  -36.797 1.00 28.53  ? 103 THR C O   1 
ATOM   4452 C  CB  . THR C 1 104 ? 16.297  22.625  -36.642 1.00 27.55  ? 103 THR C CB  1 
ATOM   4453 O  OG1 . THR C 1 104 ? 17.512  21.875  -36.525 1.00 31.25  ? 103 THR C OG1 1 
ATOM   4454 C  CG2 . THR C 1 104 ? 15.168  21.671  -36.966 1.00 27.64  ? 103 THR C CG2 1 
ATOM   4455 N  N   . MET C 1 105 ? 18.771  24.324  -37.584 1.00 28.29  ? 104 MET C N   1 
ATOM   4456 C  CA  . MET C 1 105 ? 19.895  25.189  -37.256 1.00 33.52  ? 104 MET C CA  1 
ATOM   4457 C  C   . MET C 1 105 ? 19.763  26.500  -38.019 1.00 32.05  ? 104 MET C C   1 
ATOM   4458 O  O   . MET C 1 105 ? 20.042  27.564  -37.475 1.00 33.40  ? 104 MET C O   1 
ATOM   4459 C  CB  . MET C 1 105 ? 21.224  24.503  -37.602 1.00 39.19  ? 104 MET C CB  1 
ATOM   4460 C  CG  . MET C 1 105 ? 22.470  25.376  -37.412 1.00 48.73  ? 104 MET C CG  1 
ATOM   4461 S  SD  . MET C 1 105 ? 22.720  25.938  -35.733 1.00 52.16  ? 104 MET C SD  1 
ATOM   4462 C  CE  . MET C 1 105 ? 24.043  24.877  -35.098 1.00 62.42  ? 104 MET C CE  1 
ATOM   4463 N  N   . ASP C 1 106 ? 19.362  26.418  -39.284 1.00 34.20  ? 105 ASP C N   1 
ATOM   4464 C  CA  . ASP C 1 106 ? 19.190  27.611  -40.114 1.00 35.51  ? 105 ASP C CA  1 
ATOM   4465 C  C   . ASP C 1 106 ? 18.104  28.519  -39.554 1.00 34.20  ? 105 ASP C C   1 
ATOM   4466 O  O   . ASP C 1 106 ? 18.308  29.724  -39.386 1.00 28.76  ? 105 ASP C O   1 
ATOM   4467 C  CB  . ASP C 1 106 ? 18.805  27.230  -41.546 1.00 37.76  ? 105 ASP C CB  1 
ATOM   4468 C  CG  . ASP C 1 106 ? 19.957  26.641  -42.336 1.00 44.78  ? 105 ASP C CG  1 
ATOM   4469 O  OD1 . ASP C 1 106 ? 21.072  26.501  -41.794 1.00 51.02  ? 105 ASP C OD1 1 
ATOM   4470 O  OD2 . ASP C 1 106 ? 19.744  26.321  -43.522 1.00 46.12  ? 105 ASP C OD2 1 
ATOM   4471 N  N   . ASN C 1 107 ? 16.934  27.933  -39.322 1.00 34.65  ? 106 ASN C N   1 
ATOM   4472 C  CA  . ASN C 1 107 ? 15.795  28.666  -38.791 1.00 40.33  ? 106 ASN C CA  1 
ATOM   4473 C  C   . ASN C 1 107 ? 16.108  29.265  -37.421 1.00 43.20  ? 106 ASN C C   1 
ATOM   4474 O  O   . ASN C 1 107 ? 15.679  30.380  -37.103 1.00 45.48  ? 106 ASN C O   1 
ATOM   4475 C  CB  . ASN C 1 107 ? 14.568  27.752  -38.709 1.00 43.89  ? 106 ASN C CB  1 
ATOM   4476 C  CG  . ASN C 1 107 ? 13.964  27.467  -40.067 1.00 42.69  ? 106 ASN C CG  1 
ATOM   4477 O  OD1 . ASN C 1 107 ? 13.553  26.347  -40.357 1.00 38.54  ? 106 ASN C OD1 1 
ATOM   4478 N  ND2 . ASN C 1 107 ? 13.869  28.497  -40.893 1.00 36.20  ? 106 ASN C ND2 1 
ATOM   4479 N  N   . HIS C 1 108 ? 16.844  28.508  -36.609 1.00 44.03  ? 107 HIS C N   1 
ATOM   4480 C  CA  . HIS C 1 108 ? 17.232  28.956  -35.281 1.00 45.78  ? 107 HIS C CA  1 
ATOM   4481 C  C   . HIS C 1 108 ? 18.052  30.228  -35.409 1.00 46.47  ? 107 HIS C C   1 
ATOM   4482 O  O   . HIS C 1 108 ? 17.848  31.197  -34.684 1.00 47.14  ? 107 HIS C O   1 
ATOM   4483 C  CB  . HIS C 1 108 ? 18.066  27.881  -34.584 1.00 50.29  ? 107 HIS C CB  1 
ATOM   4484 C  CG  . HIS C 1 108 ? 18.470  28.244  -33.190 1.00 54.75  ? 107 HIS C CG  1 
ATOM   4485 N  ND1 . HIS C 1 108 ? 17.828  27.745  -32.076 1.00 54.78  ? 107 HIS C ND1 1 
ATOM   4486 C  CD2 . HIS C 1 108 ? 19.431  29.077  -32.726 1.00 58.46  ? 107 HIS C CD2 1 
ATOM   4487 C  CE1 . HIS C 1 108 ? 18.370  28.260  -30.990 1.00 58.79  ? 107 HIS C CE1 1 
ATOM   4488 N  NE2 . HIS C 1 108 ? 19.348  29.069  -31.355 1.00 60.29  ? 107 HIS C NE2 1 
ATOM   4489 N  N   . MET C 1 109 ? 19.014  30.194  -36.315 1.00 45.60  ? 108 MET C N   1 
ATOM   4490 C  CA  . MET C 1 109 ? 19.865  31.328  -36.550 1.00 45.99  ? 108 MET C CA  1 
ATOM   4491 C  C   . MET C 1 109 ? 19.145  32.545  -37.114 1.00 48.25  ? 108 MET C C   1 
ATOM   4492 O  O   . MET C 1 109 ? 19.478  33.668  -36.747 1.00 51.18  ? 108 MET C O   1 
ATOM   4493 C  CB  . MET C 1 109 ? 20.987  30.923  -37.473 1.00 47.15  ? 108 MET C CB  1 
ATOM   4494 C  CG  . MET C 1 109 ? 22.083  30.110  -36.827 1.00 53.61  ? 108 MET C CG  1 
ATOM   4495 S  SD  . MET C 1 109 ? 23.601  30.602  -37.630 1.00 61.74  ? 108 MET C SD  1 
ATOM   4496 C  CE  . MET C 1 109 ? 24.804  29.334  -37.253 1.00 61.94  ? 108 MET C CE  1 
ATOM   4497 N  N   . GLN C 1 110 ? 18.224  32.338  -38.056 1.00 49.99  ? 109 GLN C N   1 
ATOM   4498 C  CA  . GLN C 1 110 ? 17.481  33.456  -38.651 1.00 50.36  ? 109 GLN C CA  1 
ATOM   4499 C  C   . GLN C 1 110 ? 16.814  34.262  -37.548 1.00 51.45  ? 109 GLN C C   1 
ATOM   4500 O  O   . GLN C 1 110 ? 16.760  35.490  -37.614 1.00 49.19  ? 109 GLN C O   1 
ATOM   4501 C  CB  . GLN C 1 110 ? 16.425  32.949  -39.625 1.00 46.45  ? 109 GLN C CB  1 
ATOM   4502 C  CG  . GLN C 1 110 ? 16.993  32.029  -40.660 1.00 41.90  ? 109 GLN C CG  1 
ATOM   4503 C  CD  . GLN C 1 110 ? 15.934  31.310  -41.444 1.00 38.84  ? 109 GLN C CD  1 
ATOM   4504 O  OE1 . GLN C 1 110 ? 14.784  31.214  -41.024 1.00 44.02  ? 109 GLN C OE1 1 
ATOM   4505 N  NE2 . GLN C 1 110 ? 16.315  30.801  -42.605 1.00 39.74  ? 109 GLN C NE2 1 
ATOM   4506 N  N   . LEU C 1 111 ? 16.302  33.545  -36.549 1.00 54.86  ? 110 LEU C N   1 
ATOM   4507 C  CA  . LEU C 1 111 ? 15.648  34.142  -35.393 1.00 56.75  ? 110 LEU C CA  1 
ATOM   4508 C  C   . LEU C 1 111 ? 16.706  34.860  -34.560 1.00 57.44  ? 110 LEU C C   1 
ATOM   4509 O  O   . LEU C 1 111 ? 16.572  36.045  -34.249 1.00 56.48  ? 110 LEU C O   1 
ATOM   4510 C  CB  . LEU C 1 111 ? 14.989  33.044  -34.559 1.00 58.79  ? 110 LEU C CB  1 
ATOM   4511 C  CG  . LEU C 1 111 ? 14.285  33.490  -33.280 1.00 64.14  ? 110 LEU C CG  1 
ATOM   4512 C  CD1 . LEU C 1 111 ? 13.168  34.459  -33.631 1.00 67.79  ? 110 LEU C CD1 1 
ATOM   4513 C  CD2 . LEU C 1 111 ? 13.741  32.279  -32.538 1.00 65.13  ? 110 LEU C CD2 1 
ATOM   4514 N  N   . GLY C 1 112 ? 17.756  34.125  -34.210 1.00 56.39  ? 111 GLY C N   1 
ATOM   4515 C  CA  . GLY C 1 112 ? 18.830  34.691  -33.424 1.00 57.97  ? 111 GLY C CA  1 
ATOM   4516 C  C   . GLY C 1 112 ? 19.474  35.897  -34.078 1.00 60.76  ? 111 GLY C C   1 
ATOM   4517 O  O   . GLY C 1 112 ? 19.900  36.816  -33.384 1.00 61.76  ? 111 GLY C O   1 
ATOM   4518 N  N   . MET C 1 113 ? 19.556  35.895  -35.404 1.00 63.84  ? 112 MET C N   1 
ATOM   4519 C  CA  . MET C 1 113 ? 20.169  36.999  -36.128 1.00 69.55  ? 112 MET C CA  1 
ATOM   4520 C  C   . MET C 1 113 ? 19.498  38.337  -35.878 1.00 69.97  ? 112 MET C C   1 
ATOM   4521 O  O   . MET C 1 113 ? 20.173  39.336  -35.614 1.00 68.54  ? 112 MET C O   1 
ATOM   4522 C  CB  . MET C 1 113 ? 20.193  36.718  -37.631 1.00 75.56  ? 112 MET C CB  1 
ATOM   4523 C  CG  . MET C 1 113 ? 21.441  35.996  -38.104 1.00 80.99  ? 112 MET C CG  1 
ATOM   4524 S  SD  . MET C 1 113 ? 21.503  35.870  -39.896 1.00 87.44  ? 112 MET C SD  1 
ATOM   4525 C  CE  . MET C 1 113 ? 21.060  34.132  -40.118 1.00 87.30  ? 112 MET C CE  1 
ATOM   4526 N  N   . ILE C 1 114 ? 18.175  38.359  -36.007 1.00 69.89  ? 113 ILE C N   1 
ATOM   4527 C  CA  . ILE C 1 114 ? 17.408  39.584  -35.809 1.00 69.92  ? 113 ILE C CA  1 
ATOM   4528 C  C   . ILE C 1 114 ? 17.293  39.957  -34.338 1.00 68.48  ? 113 ILE C C   1 
ATOM   4529 O  O   . ILE C 1 114 ? 17.162  41.133  -33.999 1.00 70.06  ? 113 ILE C O   1 
ATOM   4530 C  CB  . ILE C 1 114 ? 15.987  39.487  -36.410 1.00 68.37  ? 113 ILE C CB  1 
ATOM   4531 C  CG1 . ILE C 1 114 ? 15.125  38.513  -35.606 1.00 66.31  ? 113 ILE C CG1 1 
ATOM   4532 C  CG2 . ILE C 1 114 ? 16.065  39.043  -37.865 1.00 70.16  ? 113 ILE C CG2 1 
ATOM   4533 C  CD1 . ILE C 1 114 ? 13.650  38.647  -35.873 1.00 67.27  ? 113 ILE C CD1 1 
ATOM   4534 N  N   . CYS C 1 115 ? 17.292  38.949  -33.472 1.00 65.03  ? 114 CYS C N   1 
ATOM   4535 C  CA  . CYS C 1 115 ? 17.193  39.192  -32.045 1.00 61.08  ? 114 CYS C CA  1 
ATOM   4536 C  C   . CYS C 1 115 ? 18.461  39.826  -31.502 1.00 63.71  ? 114 CYS C C   1 
ATOM   4537 O  O   . CYS C 1 115 ? 18.418  40.547  -30.509 1.00 64.62  ? 114 CYS C O   1 
ATOM   4538 C  CB  . CYS C 1 115 ? 16.874  37.905  -31.298 1.00 54.59  ? 114 CYS C CB  1 
ATOM   4539 S  SG  . CYS C 1 115 ? 15.159  37.382  -31.505 1.00 48.64  ? 114 CYS C SG  1 
ATOM   4540 N  N   . TYR C 1 116 ? 19.588  39.537  -32.149 1.00 66.35  ? 115 TYR C N   1 
ATOM   4541 C  CA  . TYR C 1 116 ? 20.884  40.091  -31.759 1.00 69.88  ? 115 TYR C CA  1 
ATOM   4542 C  C   . TYR C 1 116 ? 21.153  41.409  -32.488 1.00 73.32  ? 115 TYR C C   1 
ATOM   4543 O  O   . TYR C 1 116 ? 22.068  42.159  -32.121 1.00 72.84  ? 115 TYR C O   1 
ATOM   4544 C  CB  . TYR C 1 116 ? 22.013  39.093  -32.057 1.00 71.48  ? 115 TYR C CB  1 
ATOM   4545 C  CG  . TYR C 1 116 ? 22.272  38.100  -30.942 1.00 74.75  ? 115 TYR C CG  1 
ATOM   4546 C  CD1 . TYR C 1 116 ? 23.019  38.467  -29.820 1.00 75.17  ? 115 TYR C CD1 1 
ATOM   4547 C  CD2 . TYR C 1 116 ? 21.748  36.802  -30.992 1.00 75.90  ? 115 TYR C CD2 1 
ATOM   4548 C  CE1 . TYR C 1 116 ? 23.233  37.573  -28.773 1.00 75.99  ? 115 TYR C CE1 1 
ATOM   4549 C  CE2 . TYR C 1 116 ? 21.957  35.896  -29.951 1.00 76.48  ? 115 TYR C CE2 1 
ATOM   4550 C  CZ  . TYR C 1 116 ? 22.695  36.294  -28.844 1.00 76.83  ? 115 TYR C CZ  1 
ATOM   4551 O  OH  . TYR C 1 116 ? 22.844  35.445  -27.780 1.00 77.20  ? 115 TYR C OH  1 
ATOM   4552 N  N   . ASN C 1 117 ? 20.368  41.677  -33.531 1.00 76.10  ? 116 ASN C N   1 
ATOM   4553 C  CA  . ASN C 1 117 ? 20.518  42.899  -34.317 1.00 76.90  ? 116 ASN C CA  1 
ATOM   4554 C  C   . ASN C 1 117 ? 19.966  44.094  -33.544 1.00 76.72  ? 116 ASN C C   1 
ATOM   4555 O  O   . ASN C 1 117 ? 18.820  44.074  -33.088 1.00 75.28  ? 116 ASN C O   1 
ATOM   4556 C  CB  . ASN C 1 117 ? 19.796  42.766  -35.664 1.00 78.15  ? 116 ASN C CB  1 
ATOM   4557 C  CG  . ASN C 1 117 ? 20.202  43.847  -36.664 1.00 77.89  ? 116 ASN C CG  1 
ATOM   4558 O  OD1 . ASN C 1 117 ? 20.861  44.830  -36.318 1.00 75.64  ? 116 ASN C OD1 1 
ATOM   4559 N  ND2 . ASN C 1 117 ? 19.820  43.654  -37.920 1.00 75.99  ? 116 ASN C ND2 1 
ATOM   4560 N  N   . PRO C 1 118 ? 20.790  45.143  -33.366 1.00 77.37  ? 117 PRO C N   1 
ATOM   4561 C  CA  . PRO C 1 118 ? 20.395  46.356  -32.645 1.00 78.17  ? 117 PRO C CA  1 
ATOM   4562 C  C   . PRO C 1 118 ? 19.066  46.931  -33.125 1.00 79.58  ? 117 PRO C C   1 
ATOM   4563 O  O   . PRO C 1 118 ? 18.296  47.486  -32.337 1.00 80.37  ? 117 PRO C O   1 
ATOM   4564 C  CB  . PRO C 1 118 ? 21.551  47.309  -32.943 1.00 77.96  ? 117 PRO C CB  1 
ATOM   4565 C  CG  . PRO C 1 118 ? 22.725  46.387  -32.992 1.00 79.06  ? 117 PRO C CG  1 
ATOM   4566 C  CD  . PRO C 1 118 ? 22.196  45.234  -33.810 1.00 78.53  ? 117 PRO C CD  1 
ATOM   4567 N  N   . GLU C 1 119 ? 18.816  46.813  -34.423 1.00 81.76  ? 118 GLU C N   1 
ATOM   4568 C  CA  . GLU C 1 119 ? 17.591  47.327  -35.020 1.00 83.15  ? 118 GLU C CA  1 
ATOM   4569 C  C   . GLU C 1 119 ? 16.491  46.271  -35.075 1.00 82.30  ? 118 GLU C C   1 
ATOM   4570 O  O   . GLU C 1 119 ? 15.657  46.274  -35.979 1.00 82.03  ? 118 GLU C O   1 
ATOM   4571 C  CB  . GLU C 1 119 ? 17.898  47.891  -36.409 1.00 85.39  ? 118 GLU C CB  1 
ATOM   4572 C  CG  . GLU C 1 119 ? 18.873  49.069  -36.365 1.00 89.82  ? 118 GLU C CG  1 
ATOM   4573 C  CD  . GLU C 1 119 ? 19.559  49.335  -37.692 1.00 91.92  ? 118 GLU C CD  1 
ATOM   4574 O  OE1 . GLU C 1 119 ? 20.748  48.972  -37.828 1.00 91.84  ? 118 GLU C OE1 1 
ATOM   4575 O  OE2 . GLU C 1 119 ? 18.918  49.915  -38.592 1.00 93.89  ? 118 GLU C OE2 1 
ATOM   4576 N  N   . PHE C 1 120 ? 16.476  45.407  -34.065 1.00 82.39  ? 119 PHE C N   1 
ATOM   4577 C  CA  . PHE C 1 120 ? 15.501  44.330  -33.942 1.00 81.56  ? 119 PHE C CA  1 
ATOM   4578 C  C   . PHE C 1 120 ? 14.057  44.760  -34.192 1.00 82.07  ? 119 PHE C C   1 
ATOM   4579 O  O   . PHE C 1 120 ? 13.318  44.084  -34.909 1.00 83.12  ? 119 PHE C O   1 
ATOM   4580 C  CB  . PHE C 1 120 ? 15.614  43.697  -32.549 1.00 80.86  ? 119 PHE C CB  1 
ATOM   4581 C  CG  . PHE C 1 120 ? 14.450  42.815  -32.178 1.00 81.66  ? 119 PHE C CG  1 
ATOM   4582 C  CD1 . PHE C 1 120 ? 14.349  41.520  -32.676 1.00 81.00  ? 119 PHE C CD1 1 
ATOM   4583 C  CD2 . PHE C 1 120 ? 13.444  43.288  -31.340 1.00 81.15  ? 119 PHE C CD2 1 
ATOM   4584 C  CE1 . PHE C 1 120 ? 13.260  40.708  -32.344 1.00 80.42  ? 119 PHE C CE1 1 
ATOM   4585 C  CE2 . PHE C 1 120 ? 12.353  42.484  -31.003 1.00 80.06  ? 119 PHE C CE2 1 
ATOM   4586 C  CZ  . PHE C 1 120 ? 12.260  41.194  -31.507 1.00 78.06  ? 119 PHE C CZ  1 
ATOM   4587 N  N   . GLU C 1 121 ? 13.647  45.857  -33.564 1.00 83.32  ? 120 GLU C N   1 
ATOM   4588 C  CA  . GLU C 1 121 ? 12.279  46.350  -33.699 1.00 86.16  ? 120 GLU C CA  1 
ATOM   4589 C  C   . GLU C 1 121 ? 11.849  46.658  -35.134 1.00 85.48  ? 120 GLU C C   1 
ATOM   4590 O  O   . GLU C 1 121 ? 10.669  46.550  -35.469 1.00 84.27  ? 120 GLU C O   1 
ATOM   4591 C  CB  . GLU C 1 121 ? 12.071  47.583  -32.816 1.00 89.66  ? 120 GLU C CB  1 
ATOM   4592 C  CG  . GLU C 1 121 ? 10.666  47.688  -32.210 1.00 96.51  ? 120 GLU C CG  1 
ATOM   4593 C  CD  . GLU C 1 121 ? 10.363  46.581  -31.192 1.00 100.00 ? 120 GLU C CD  1 
ATOM   4594 O  OE1 . GLU C 1 121 ? 11.186  46.372  -30.272 1.00 100.00 ? 120 GLU C OE1 1 
ATOM   4595 O  OE2 . GLU C 1 121 ? 9.300   45.927  -31.304 1.00 99.50  ? 120 GLU C OE2 1 
ATOM   4596 N  N   . LYS C 1 122 ? 12.802  47.059  -35.968 1.00 85.38  ? 121 LYS C N   1 
ATOM   4597 C  CA  . LYS C 1 122 ? 12.521  47.388  -37.361 1.00 85.16  ? 121 LYS C CA  1 
ATOM   4598 C  C   . LYS C 1 122 ? 12.386  46.148  -38.265 1.00 83.14  ? 121 LYS C C   1 
ATOM   4599 O  O   . LYS C 1 122 ? 11.537  46.107  -39.164 1.00 81.15  ? 121 LYS C O   1 
ATOM   4600 C  CB  . LYS C 1 122 ? 13.620  48.318  -37.895 1.00 89.32  ? 121 LYS C CB  1 
ATOM   4601 C  CG  . LYS C 1 122 ? 13.351  48.898  -39.283 1.00 93.48  ? 121 LYS C CG  1 
ATOM   4602 C  CD  . LYS C 1 122 ? 14.455  49.855  -39.747 1.00 93.75  ? 121 LYS C CD  1 
ATOM   4603 C  CE  . LYS C 1 122 ? 15.773  49.138  -40.027 1.00 93.71  ? 121 LYS C CE  1 
ATOM   4604 N  NZ  . LYS C 1 122 ? 16.813  50.065  -40.571 1.00 92.28  ? 121 LYS C NZ  1 
ATOM   4605 N  N   . LEU C 1 123 ? 13.244  45.157  -38.037 1.00 81.85  ? 122 LEU C N   1 
ATOM   4606 C  CA  . LEU C 1 123 ? 13.253  43.924  -38.822 1.00 80.96  ? 122 LEU C CA  1 
ATOM   4607 C  C   . LEU C 1 123 ? 12.122  42.961  -38.494 1.00 79.58  ? 122 LEU C C   1 
ATOM   4608 O  O   . LEU C 1 123 ? 11.752  42.128  -39.323 1.00 78.36  ? 122 LEU C O   1 
ATOM   4609 C  CB  . LEU C 1 123 ? 14.588  43.194  -38.645 1.00 83.62  ? 122 LEU C CB  1 
ATOM   4610 C  CG  . LEU C 1 123 ? 15.864  43.731  -39.306 1.00 85.65  ? 122 LEU C CG  1 
ATOM   4611 C  CD1 . LEU C 1 123 ? 16.197  45.141  -38.835 1.00 86.15  ? 122 LEU C CD1 1 
ATOM   4612 C  CD2 . LEU C 1 123 ? 17.009  42.785  -38.987 1.00 87.62  ? 122 LEU C CD2 1 
ATOM   4613 N  N   . LYS C 1 124 ? 11.595  43.069  -37.278 1.00 79.31  ? 123 LYS C N   1 
ATOM   4614 C  CA  . LYS C 1 124 ? 10.518  42.209  -36.794 1.00 81.81  ? 123 LYS C CA  1 
ATOM   4615 C  C   . LYS C 1 124 ? 9.305   42.036  -37.728 1.00 82.43  ? 123 LYS C C   1 
ATOM   4616 O  O   . LYS C 1 124 ? 8.820   40.919  -37.912 1.00 81.20  ? 123 LYS C O   1 
ATOM   4617 C  CB  . LYS C 1 124 ? 10.069  42.675  -35.403 1.00 82.88  ? 123 LYS C CB  1 
ATOM   4618 C  CG  . LYS C 1 124 ? 9.139   41.712  -34.685 1.00 86.53  ? 123 LYS C CG  1 
ATOM   4619 C  CD  . LYS C 1 124 ? 8.878   42.168  -33.260 1.00 88.78  ? 123 LYS C CD  1 
ATOM   4620 C  CE  . LYS C 1 124 ? 8.069   41.136  -32.492 1.00 91.70  ? 123 LYS C CE  1 
ATOM   4621 N  NZ  . LYS C 1 124 ? 7.890   41.519  -31.064 1.00 93.39  ? 123 LYS C NZ  1 
ATOM   4622 N  N   . PRO C 1 125 ? 8.776   43.138  -38.298 1.00 84.29  ? 124 PRO C N   1 
ATOM   4623 C  CA  . PRO C 1 125 ? 7.618   43.062  -39.201 1.00 83.27  ? 124 PRO C CA  1 
ATOM   4624 C  C   . PRO C 1 125 ? 7.799   42.114  -40.386 1.00 80.79  ? 124 PRO C C   1 
ATOM   4625 O  O   . PRO C 1 125 ? 6.868   41.406  -40.776 1.00 77.25  ? 124 PRO C O   1 
ATOM   4626 C  CB  . PRO C 1 125 ? 7.471   44.506  -39.676 1.00 83.32  ? 124 PRO C CB  1 
ATOM   4627 C  CG  . PRO C 1 125 ? 7.896   45.285  -38.480 1.00 83.09  ? 124 PRO C CG  1 
ATOM   4628 C  CD  . PRO C 1 125 ? 9.145   44.546  -38.057 1.00 84.44  ? 124 PRO C CD  1 
ATOM   4629 N  N   . LYS C 1 126 ? 8.982   42.158  -40.985 1.00 79.63  ? 125 LYS C N   1 
ATOM   4630 C  CA  . LYS C 1 126 ? 9.303   41.317  -42.127 1.00 78.93  ? 125 LYS C CA  1 
ATOM   4631 C  C   . LYS C 1 126 ? 9.466   39.846  -41.731 1.00 79.37  ? 125 LYS C C   1 
ATOM   4632 O  O   . LYS C 1 126 ? 8.992   38.950  -42.435 1.00 78.67  ? 125 LYS C O   1 
ATOM   4633 C  CB  . LYS C 1 126 ? 10.573  41.833  -42.801 1.00 78.00  ? 125 LYS C CB  1 
ATOM   4634 C  CG  . LYS C 1 126 ? 10.977  41.054  -44.028 1.00 77.15  ? 125 LYS C CG  1 
ATOM   4635 C  CD  . LYS C 1 126 ? 12.266  41.591  -44.610 1.00 78.79  ? 125 LYS C CD  1 
ATOM   4636 C  CE  . LYS C 1 126 ? 12.769  40.703  -45.741 1.00 78.14  ? 125 LYS C CE  1 
ATOM   4637 N  NZ  . LYS C 1 126 ? 13.056  39.312  -45.281 1.00 76.61  ? 125 LYS C NZ  1 
ATOM   4638 N  N   . TYR C 1 127 ? 10.161  39.604  -40.621 1.00 79.48  ? 126 TYR C N   1 
ATOM   4639 C  CA  . TYR C 1 127 ? 10.389  38.248  -40.122 1.00 77.31  ? 126 TYR C CA  1 
ATOM   4640 C  C   . TYR C 1 127 ? 9.069   37.534  -39.839 1.00 76.30  ? 126 TYR C C   1 
ATOM   4641 O  O   . TYR C 1 127 ? 8.932   36.337  -40.110 1.00 76.12  ? 126 TYR C O   1 
ATOM   4642 C  CB  . TYR C 1 127 ? 11.248  38.287  -38.850 1.00 76.44  ? 126 TYR C CB  1 
ATOM   4643 C  CG  . TYR C 1 127 ? 11.641  36.922  -38.304 1.00 75.30  ? 126 TYR C CG  1 
ATOM   4644 C  CD1 . TYR C 1 127 ? 12.878  36.354  -38.610 1.00 72.02  ? 126 TYR C CD1 1 
ATOM   4645 C  CD2 . TYR C 1 127 ? 10.780  36.203  -37.474 1.00 74.34  ? 126 TYR C CD2 1 
ATOM   4646 C  CE1 . TYR C 1 127 ? 13.245  35.106  -38.102 1.00 71.85  ? 126 TYR C CE1 1 
ATOM   4647 C  CE2 . TYR C 1 127 ? 11.139  34.956  -36.964 1.00 72.20  ? 126 TYR C CE2 1 
ATOM   4648 C  CZ  . TYR C 1 127 ? 12.367  34.415  -37.281 1.00 73.43  ? 126 TYR C CZ  1 
ATOM   4649 O  OH  . TYR C 1 127 ? 12.704  33.181  -36.774 1.00 75.76  ? 126 TYR C OH  1 
ATOM   4650 N  N   . LEU C 1 128 ? 8.125   38.259  -39.242 1.00 75.70  ? 127 LEU C N   1 
ATOM   4651 C  CA  . LEU C 1 128 ? 6.808   37.710  -38.919 1.00 76.50  ? 127 LEU C CA  1 
ATOM   4652 C  C   . LEU C 1 128 ? 6.006   37.374  -40.175 1.00 75.64  ? 127 LEU C C   1 
ATOM   4653 O  O   . LEU C 1 128 ? 5.257   36.396  -40.201 1.00 71.91  ? 127 LEU C O   1 
ATOM   4654 C  CB  . LEU C 1 128 ? 6.014   38.693  -38.044 1.00 79.26  ? 127 LEU C CB  1 
ATOM   4655 C  CG  . LEU C 1 128 ? 6.428   38.846  -36.571 1.00 82.21  ? 127 LEU C CG  1 
ATOM   4656 C  CD1 . LEU C 1 128 ? 5.674   40.000  -35.924 1.00 83.32  ? 127 LEU C CD1 1 
ATOM   4657 C  CD2 . LEU C 1 128 ? 6.161   37.551  -35.806 1.00 82.61  ? 127 LEU C CD2 1 
ATOM   4658 N  N   . GLU C 1 129 ? 6.135   38.215  -41.196 1.00 76.72  ? 128 GLU C N   1 
ATOM   4659 C  CA  . GLU C 1 129 ? 5.431   38.016  -42.453 1.00 75.91  ? 128 GLU C CA  1 
ATOM   4660 C  C   . GLU C 1 129 ? 5.852   36.706  -43.115 1.00 72.41  ? 128 GLU C C   1 
ATOM   4661 O  O   . GLU C 1 129 ? 5.028   36.025  -43.729 1.00 74.05  ? 128 GLU C O   1 
ATOM   4662 C  CB  . GLU C 1 129 ? 5.718   39.182  -43.399 1.00 81.58  ? 128 GLU C CB  1 
ATOM   4663 C  CG  . GLU C 1 129 ? 5.020   39.078  -44.754 1.00 90.81  ? 128 GLU C CG  1 
ATOM   4664 C  CD  . GLU C 1 129 ? 5.535   40.081  -45.781 1.00 96.35  ? 128 GLU C CD  1 
ATOM   4665 O  OE1 . GLU C 1 129 ? 5.391   39.808  -46.993 1.00 97.94  ? 128 GLU C OE1 1 
ATOM   4666 O  OE2 . GLU C 1 129 ? 6.085   41.134  -45.388 1.00 99.86  ? 128 GLU C OE2 1 
ATOM   4667 N  N   . GLU C 1 130 ? 7.131   36.360  -42.981 1.00 65.84  ? 129 GLU C N   1 
ATOM   4668 C  CA  . GLU C 1 130 ? 7.693   35.150  -43.580 1.00 62.62  ? 129 GLU C CA  1 
ATOM   4669 C  C   . GLU C 1 130 ? 7.571   33.901  -42.717 1.00 60.30  ? 129 GLU C C   1 
ATOM   4670 O  O   . GLU C 1 130 ? 7.619   32.777  -43.220 1.00 58.30  ? 129 GLU C O   1 
ATOM   4671 C  CB  . GLU C 1 130 ? 9.169   35.374  -43.907 1.00 63.57  ? 129 GLU C CB  1 
ATOM   4672 C  CG  . GLU C 1 130 ? 9.444   36.604  -44.760 1.00 68.33  ? 129 GLU C CG  1 
ATOM   4673 C  CD  . GLU C 1 130 ? 10.927  36.900  -44.915 1.00 69.46  ? 129 GLU C CD  1 
ATOM   4674 O  OE1 . GLU C 1 130 ? 11.678  36.765  -43.923 1.00 71.43  ? 129 GLU C OE1 1 
ATOM   4675 O  OE2 . GLU C 1 130 ? 11.342  37.273  -46.034 1.00 72.57  ? 129 GLU C OE2 1 
ATOM   4676 N  N   . LEU C 1 131 ? 7.416   34.106  -41.418 1.00 56.42  ? 130 LEU C N   1 
ATOM   4677 C  CA  . LEU C 1 131 ? 7.319   33.009  -40.470 1.00 55.49  ? 130 LEU C CA  1 
ATOM   4678 C  C   . LEU C 1 131 ? 6.283   31.921  -40.765 1.00 53.57  ? 130 LEU C C   1 
ATOM   4679 O  O   . LEU C 1 131 ? 6.585   30.729  -40.692 1.00 51.11  ? 130 LEU C O   1 
ATOM   4680 C  CB  . LEU C 1 131 ? 7.104   33.562  -39.060 1.00 56.16  ? 130 LEU C CB  1 
ATOM   4681 C  CG  . LEU C 1 131 ? 7.007   32.518  -37.945 1.00 56.70  ? 130 LEU C CG  1 
ATOM   4682 C  CD1 . LEU C 1 131 ? 8.231   31.614  -37.959 1.00 55.08  ? 130 LEU C CD1 1 
ATOM   4683 C  CD2 . LEU C 1 131 ? 6.867   33.206  -36.595 1.00 54.24  ? 130 LEU C CD2 1 
ATOM   4684 N  N   . PRO C 1 132 ? 5.035   32.318  -41.054 1.00 53.68  ? 131 PRO C N   1 
ATOM   4685 C  CA  . PRO C 1 132 ? 3.981   31.337  -41.341 1.00 53.42  ? 131 PRO C CA  1 
ATOM   4686 C  C   . PRO C 1 132 ? 4.417   30.309  -42.369 1.00 54.59  ? 131 PRO C C   1 
ATOM   4687 O  O   . PRO C 1 132 ? 4.131   29.119  -42.238 1.00 52.79  ? 131 PRO C O   1 
ATOM   4688 C  CB  . PRO C 1 132 ? 2.853   32.210  -41.881 1.00 51.29  ? 131 PRO C CB  1 
ATOM   4689 C  CG  . PRO C 1 132 ? 3.037   33.483  -41.126 1.00 52.32  ? 131 PRO C CG  1 
ATOM   4690 C  CD  . PRO C 1 132 ? 4.522   33.690  -41.220 1.00 53.58  ? 131 PRO C CD  1 
ATOM   4691 N  N   . GLU C 1 133 ? 5.092   30.789  -43.405 1.00 55.00  ? 132 GLU C N   1 
ATOM   4692 C  CA  . GLU C 1 133 ? 5.575   29.929  -44.468 1.00 55.96  ? 132 GLU C CA  1 
ATOM   4693 C  C   . GLU C 1 133 ? 6.579   28.931  -43.906 1.00 52.61  ? 132 GLU C C   1 
ATOM   4694 O  O   . GLU C 1 133 ? 6.514   27.742  -44.212 1.00 53.12  ? 132 GLU C O   1 
ATOM   4695 C  CB  . GLU C 1 133 ? 6.232   30.777  -45.547 1.00 62.35  ? 132 GLU C CB  1 
ATOM   4696 C  CG  . GLU C 1 133 ? 6.630   30.022  -46.797 1.00 67.57  ? 132 GLU C CG  1 
ATOM   4697 C  CD  . GLU C 1 133 ? 5.414   29.289  -47.325 1.00 73.34  ? 132 GLU C CD  1 
ATOM   4698 O  OE1 . GLU C 1 133 ? 4.274   29.653  -46.956 1.00 72.82  ? 132 GLU C OE1 1 
ATOM   4699 O  OE2 . GLU C 1 133 ? 5.598   28.350  -48.123 1.00 74.81  ? 132 GLU C OE2 1 
ATOM   4700 N  N   . LYS C 1 134 ? 7.519   29.429  -43.107 1.00 48.92  ? 133 LYS C N   1 
ATOM   4701 C  CA  . LYS C 1 134 ? 8.535   28.581  -42.499 1.00 46.44  ? 133 LYS C CA  1 
ATOM   4702 C  C   . LYS C 1 134 ? 7.872   27.460  -41.726 1.00 44.49  ? 133 LYS C C   1 
ATOM   4703 O  O   . LYS C 1 134 ? 8.243   26.289  -41.856 1.00 44.05  ? 133 LYS C O   1 
ATOM   4704 C  CB  . LYS C 1 134 ? 9.415   29.396  -41.550 1.00 45.77  ? 133 LYS C CB  1 
ATOM   4705 C  CG  . LYS C 1 134 ? 10.285  30.440  -42.221 1.00 49.36  ? 133 LYS C CG  1 
ATOM   4706 C  CD  . LYS C 1 134 ? 11.106  31.185  -41.187 1.00 48.83  ? 133 LYS C CD  1 
ATOM   4707 C  CE  . LYS C 1 134 ? 11.722  32.446  -41.775 1.00 52.24  ? 133 LYS C CE  1 
ATOM   4708 N  NZ  . LYS C 1 134 ? 12.362  33.290  -40.729 1.00 49.39  ? 133 LYS C NZ  1 
ATOM   4709 N  N   . LEU C 1 135 ? 6.907   27.838  -40.895 1.00 44.37  ? 134 LEU C N   1 
ATOM   4710 C  CA  . LEU C 1 135 ? 6.169   26.887  -40.073 1.00 44.55  ? 134 LEU C CA  1 
ATOM   4711 C  C   . LEU C 1 135 ? 5.431   25.882  -40.943 1.00 43.98  ? 134 LEU C C   1 
ATOM   4712 O  O   . LEU C 1 135 ? 5.454   24.673  -40.679 1.00 41.60  ? 134 LEU C O   1 
ATOM   4713 C  CB  . LEU C 1 135 ? 5.181   27.631  -39.169 1.00 45.44  ? 134 LEU C CB  1 
ATOM   4714 C  CG  . LEU C 1 135 ? 5.623   28.090  -37.769 1.00 46.04  ? 134 LEU C CG  1 
ATOM   4715 C  CD1 . LEU C 1 135 ? 7.131   28.080  -37.609 1.00 46.51  ? 134 LEU C CD1 1 
ATOM   4716 C  CD2 . LEU C 1 135 ? 5.065   29.469  -37.490 1.00 47.42  ? 134 LEU C CD2 1 
ATOM   4717 N  N   . LYS C 1 136 ? 4.772   26.402  -41.974 1.00 43.42  ? 135 LYS C N   1 
ATOM   4718 C  CA  . LYS C 1 136 ? 4.023   25.585  -42.911 1.00 40.57  ? 135 LYS C CA  1 
ATOM   4719 C  C   . LYS C 1 136 ? 4.890   24.431  -43.409 1.00 37.21  ? 135 LYS C C   1 
ATOM   4720 O  O   . LYS C 1 136 ? 4.449   23.281  -43.450 1.00 29.71  ? 135 LYS C O   1 
ATOM   4721 C  CB  . LYS C 1 136 ? 3.556   26.449  -44.091 1.00 42.76  ? 135 LYS C CB  1 
ATOM   4722 C  CG  . LYS C 1 136 ? 2.779   25.699  -45.176 1.00 47.97  ? 135 LYS C CG  1 
ATOM   4723 C  CD  . LYS C 1 136 ? 1.905   26.616  -46.037 1.00 54.03  ? 135 LYS C CD  1 
ATOM   4724 C  CE  . LYS C 1 136 ? 1.814   26.175  -47.490 1.00 59.10  ? 135 LYS C CE  1 
ATOM   4725 N  NZ  . LYS C 1 136 ? 2.560   27.099  -48.399 1.00 57.63  ? 135 LYS C NZ  1 
ATOM   4726 N  N   . LEU C 1 137 ? 6.128   24.750  -43.777 1.00 33.04  ? 136 LEU C N   1 
ATOM   4727 C  CA  . LEU C 1 137 ? 7.060   23.755  -44.285 1.00 34.43  ? 136 LEU C CA  1 
ATOM   4728 C  C   . LEU C 1 137 ? 7.230   22.598  -43.324 1.00 36.11  ? 136 LEU C C   1 
ATOM   4729 O  O   . LEU C 1 137 ? 7.207   21.436  -43.730 1.00 36.66  ? 136 LEU C O   1 
ATOM   4730 C  CB  . LEU C 1 137 ? 8.402   24.406  -44.576 1.00 32.18  ? 136 LEU C CB  1 
ATOM   4731 C  CG  . LEU C 1 137 ? 8.311   25.467  -45.665 1.00 35.41  ? 136 LEU C CG  1 
ATOM   4732 C  CD1 . LEU C 1 137 ? 9.655   26.137  -45.877 1.00 39.51  ? 136 LEU C CD1 1 
ATOM   4733 C  CD2 . LEU C 1 137 ? 7.827   24.796  -46.938 1.00 39.66  ? 136 LEU C CD2 1 
ATOM   4734 N  N   . TYR C 1 138 ? 7.436   22.917  -42.053 1.00 33.73  ? 137 TYR C N   1 
ATOM   4735 C  CA  . TYR C 1 138 ? 7.586   21.884  -41.044 1.00 33.02  ? 137 TYR C CA  1 
ATOM   4736 C  C   . TYR C 1 138 ? 6.318   21.055  -40.984 1.00 32.91  ? 137 TYR C C   1 
ATOM   4737 O  O   . TYR C 1 138 ? 6.366   19.825  -40.878 1.00 31.65  ? 137 TYR C O   1 
ATOM   4738 C  CB  . TYR C 1 138 ? 7.859   22.509  -39.685 1.00 33.04  ? 137 TYR C CB  1 
ATOM   4739 C  CG  . TYR C 1 138 ? 9.293   22.940  -39.504 1.00 33.21  ? 137 TYR C CG  1 
ATOM   4740 C  CD1 . TYR C 1 138 ? 10.300  21.994  -39.303 1.00 32.12  ? 137 TYR C CD1 1 
ATOM   4741 C  CD2 . TYR C 1 138 ? 9.641   24.290  -39.531 1.00 32.96  ? 137 TYR C CD2 1 
ATOM   4742 C  CE1 . TYR C 1 138 ? 11.612  22.383  -39.130 1.00 35.32  ? 137 TYR C CE1 1 
ATOM   4743 C  CE2 . TYR C 1 138 ? 10.957  24.691  -39.361 1.00 33.89  ? 137 TYR C CE2 1 
ATOM   4744 C  CZ  . TYR C 1 138 ? 11.934  23.734  -39.161 1.00 35.93  ? 137 TYR C CZ  1 
ATOM   4745 O  OH  . TYR C 1 138 ? 13.236  24.123  -38.993 1.00 35.52  ? 137 TYR C OH  1 
ATOM   4746 N  N   . SER C 1 139 ? 5.189   21.752  -41.024 1.00 33.73  ? 138 SER C N   1 
ATOM   4747 C  CA  . SER C 1 139 ? 3.887   21.109  -40.998 1.00 37.98  ? 138 SER C CA  1 
ATOM   4748 C  C   . SER C 1 139 ? 3.800   20.123  -42.171 1.00 41.55  ? 138 SER C C   1 
ATOM   4749 O  O   . SER C 1 139 ? 3.576   18.919  -41.968 1.00 38.50  ? 138 SER C O   1 
ATOM   4750 C  CB  . SER C 1 139 ? 2.798   22.184  -41.103 1.00 35.78  ? 138 SER C CB  1 
ATOM   4751 O  OG  . SER C 1 139 ? 1.490   21.647  -41.002 1.00 37.46  ? 138 SER C OG  1 
ATOM   4752 N  N   . GLU C 1 140 ? 4.023   20.637  -43.385 1.00 42.76  ? 139 GLU C N   1 
ATOM   4753 C  CA  . GLU C 1 140 ? 3.982   19.837  -44.608 1.00 45.03  ? 139 GLU C CA  1 
ATOM   4754 C  C   . GLU C 1 140 ? 4.862   18.603  -44.451 1.00 43.87  ? 139 GLU C C   1 
ATOM   4755 O  O   . GLU C 1 140 ? 4.469   17.479  -44.796 1.00 38.59  ? 139 GLU C O   1 
ATOM   4756 C  CB  . GLU C 1 140 ? 4.531   20.640  -45.797 1.00 52.82  ? 139 GLU C CB  1 
ATOM   4757 C  CG  . GLU C 1 140 ? 3.370   21.168  -46.645 1.00 60.58  ? 139 GLU C CG  1 
ATOM   4758 C  CD  . GLU C 1 140 ? 3.478   22.631  -46.970 1.00 63.56  ? 139 GLU C CD  1 
ATOM   4759 O  OE1 . GLU C 1 140 ? 2.443   23.326  -46.920 1.00 61.96  ? 139 GLU C OE1 1 
ATOM   4760 O  OE2 . GLU C 1 140 ? 4.602   23.084  -47.272 1.00 64.06  ? 139 GLU C OE2 1 
ATOM   4761 N  N   . PHE C 1 141 ? 6.074   18.845  -43.963 1.00 42.14  ? 140 PHE C N   1 
ATOM   4762 C  CA  . PHE C 1 141 ? 7.058   17.802  -43.781 1.00 41.05  ? 140 PHE C CA  1 
ATOM   4763 C  C   . PHE C 1 141 ? 6.635   16.682  -42.832 1.00 41.65  ? 140 PHE C C   1 
ATOM   4764 O  O   . PHE C 1 141 ? 6.742   15.496  -43.172 1.00 43.62  ? 140 PHE C O   1 
ATOM   4765 C  CB  . PHE C 1 141 ? 8.382   18.425  -43.343 1.00 39.44  ? 140 PHE C CB  1 
ATOM   4766 C  CG  . PHE C 1 141 ? 9.553   17.511  -43.525 1.00 42.14  ? 140 PHE C CG  1 
ATOM   4767 C  CD1 . PHE C 1 141 ? 9.598   16.640  -44.606 1.00 41.64  ? 140 PHE C CD1 1 
ATOM   4768 C  CD2 . PHE C 1 141 ? 10.588  17.487  -42.606 1.00 44.72  ? 140 PHE C CD2 1 
ATOM   4769 C  CE1 . PHE C 1 141 ? 10.650  15.758  -44.768 1.00 40.60  ? 140 PHE C CE1 1 
ATOM   4770 C  CE2 . PHE C 1 141 ? 11.651  16.602  -42.761 1.00 44.81  ? 140 PHE C CE2 1 
ATOM   4771 C  CZ  . PHE C 1 141 ? 11.679  15.739  -43.842 1.00 45.31  ? 140 PHE C CZ  1 
ATOM   4772 N  N   . LEU C 1 142 ? 6.197   17.057  -41.635 1.00 41.18  ? 141 LEU C N   1 
ATOM   4773 C  CA  . LEU C 1 142 ? 5.757   16.088  -40.632 1.00 38.95  ? 141 LEU C CA  1 
ATOM   4774 C  C   . LEU C 1 142 ? 4.583   15.253  -41.131 1.00 43.64  ? 141 LEU C C   1 
ATOM   4775 O  O   . LEU C 1 142 ? 4.651   14.019  -41.143 1.00 45.36  ? 141 LEU C O   1 
ATOM   4776 C  CB  . LEU C 1 142 ? 5.358   16.808  -39.338 1.00 30.89  ? 141 LEU C CB  1 
ATOM   4777 C  CG  . LEU C 1 142 ? 4.794   15.931  -38.207 1.00 34.32  ? 141 LEU C CG  1 
ATOM   4778 C  CD1 . LEU C 1 142 ? 5.794   14.853  -37.808 1.00 34.68  ? 141 LEU C CD1 1 
ATOM   4779 C  CD2 . LEU C 1 142 ? 4.418   16.804  -37.014 1.00 24.71  ? 141 LEU C CD2 1 
ATOM   4780 N  N   . GLY C 1 143 ? 3.512   15.939  -41.530 1.00 45.84  ? 142 GLY C N   1 
ATOM   4781 C  CA  . GLY C 1 143 ? 2.324   15.267  -42.018 1.00 47.67  ? 142 GLY C CA  1 
ATOM   4782 C  C   . GLY C 1 143 ? 1.560   14.546  -40.926 1.00 50.69  ? 142 GLY C C   1 
ATOM   4783 O  O   . GLY C 1 143 ? 1.294   15.103  -39.855 1.00 51.34  ? 142 GLY C O   1 
ATOM   4784 N  N   . LYS C 1 144 ? 1.177   13.306  -41.213 1.00 54.34  ? 143 LYS C N   1 
ATOM   4785 C  CA  . LYS C 1 144 ? 0.424   12.502  -40.260 1.00 59.57  ? 143 LYS C CA  1 
ATOM   4786 C  C   . LYS C 1 144 ? 1.342   11.616  -39.428 1.00 56.70  ? 143 LYS C C   1 
ATOM   4787 O  O   . LYS C 1 144 ? 0.894   10.714  -38.714 1.00 58.54  ? 143 LYS C O   1 
ATOM   4788 C  CB  . LYS C 1 144 ? -0.647  11.674  -40.987 1.00 67.26  ? 143 LYS C CB  1 
ATOM   4789 C  CG  . LYS C 1 144 ? -1.705  12.523  -41.706 1.00 76.48  ? 143 LYS C CG  1 
ATOM   4790 C  CD  . LYS C 1 144 ? -2.395  13.482  -40.737 1.00 83.18  ? 143 LYS C CD  1 
ATOM   4791 C  CE  . LYS C 1 144 ? -3.254  14.512  -41.463 1.00 86.40  ? 143 LYS C CE  1 
ATOM   4792 N  NZ  . LYS C 1 144 ? -4.407  13.902  -42.179 1.00 90.82  ? 143 LYS C NZ  1 
ATOM   4793 N  N   . ARG C 1 145 ? 2.638   11.872  -39.539 1.00 52.11  ? 144 ARG C N   1 
ATOM   4794 C  CA  . ARG C 1 145 ? 3.627   11.116  -38.791 1.00 48.89  ? 144 ARG C CA  1 
ATOM   4795 C  C   . ARG C 1 145 ? 3.640   11.552  -37.330 1.00 48.56  ? 144 ARG C C   1 
ATOM   4796 O  O   . ARG C 1 145 ? 3.395   12.720  -37.018 1.00 47.59  ? 144 ARG C O   1 
ATOM   4797 C  CB  . ARG C 1 145 ? 5.019   11.335  -39.379 1.00 45.85  ? 144 ARG C CB  1 
ATOM   4798 C  CG  . ARG C 1 145 ? 5.229   10.761  -40.757 1.00 45.72  ? 144 ARG C CG  1 
ATOM   4799 C  CD  . ARG C 1 145 ? 6.650   11.011  -41.220 1.00 46.73  ? 144 ARG C CD  1 
ATOM   4800 N  NE  . ARG C 1 145 ? 6.811   10.717  -42.638 1.00 47.87  ? 144 ARG C NE  1 
ATOM   4801 C  CZ  . ARG C 1 145 ? 6.443   11.537  -43.616 1.00 48.54  ? 144 ARG C CZ  1 
ATOM   4802 N  NH1 . ARG C 1 145 ? 5.890   12.718  -43.349 1.00 46.16  ? 144 ARG C NH1 1 
ATOM   4803 N  NH2 . ARG C 1 145 ? 6.632   11.171  -44.873 1.00 48.33  ? 144 ARG C NH2 1 
ATOM   4804 N  N   . PRO C 1 146 ? 3.859   10.601  -36.409 1.00 46.24  ? 145 PRO C N   1 
ATOM   4805 C  CA  . PRO C 1 146 ? 3.896   10.953  -34.987 1.00 45.47  ? 145 PRO C CA  1 
ATOM   4806 C  C   . PRO C 1 146 ? 5.186   11.728  -34.692 1.00 44.38  ? 145 PRO C C   1 
ATOM   4807 O  O   . PRO C 1 146 ? 5.194   12.646  -33.871 1.00 42.63  ? 145 PRO C O   1 
ATOM   4808 C  CB  . PRO C 1 146 ? 3.853   9.584   -34.294 1.00 44.67  ? 145 PRO C CB  1 
ATOM   4809 C  CG  . PRO C 1 146 ? 4.489   8.665   -35.290 1.00 45.63  ? 145 PRO C CG  1 
ATOM   4810 C  CD  . PRO C 1 146 ? 3.933   9.141   -36.603 1.00 46.35  ? 145 PRO C CD  1 
ATOM   4811 N  N   . TRP C 1 147 ? 6.255   11.375  -35.406 1.00 42.58  ? 146 TRP C N   1 
ATOM   4812 C  CA  . TRP C 1 147 ? 7.564   12.017  -35.269 1.00 41.08  ? 146 TRP C CA  1 
ATOM   4813 C  C   . TRP C 1 147 ? 8.076   12.436  -36.644 1.00 42.33  ? 146 TRP C C   1 
ATOM   4814 O  O   . TRP C 1 147 ? 7.586   11.949  -37.666 1.00 45.91  ? 146 TRP C O   1 
ATOM   4815 C  CB  . TRP C 1 147 ? 8.567   11.057  -34.622 1.00 37.76  ? 146 TRP C CB  1 
ATOM   4816 C  CG  . TRP C 1 147 ? 8.123   10.577  -33.283 1.00 37.70  ? 146 TRP C CG  1 
ATOM   4817 C  CD1 . TRP C 1 147 ? 7.898   9.285   -32.906 1.00 36.03  ? 146 TRP C CD1 1 
ATOM   4818 C  CD2 . TRP C 1 147 ? 7.825   11.389  -32.141 1.00 34.90  ? 146 TRP C CD2 1 
ATOM   4819 N  NE1 . TRP C 1 147 ? 7.482   9.239   -31.597 1.00 34.61  ? 146 TRP C NE1 1 
ATOM   4820 C  CE2 . TRP C 1 147 ? 7.426   10.517  -31.104 1.00 32.59  ? 146 TRP C CE2 1 
ATOM   4821 C  CE3 . TRP C 1 147 ? 7.854   12.771  -31.889 1.00 38.36  ? 146 TRP C CE3 1 
ATOM   4822 C  CZ2 . TRP C 1 147 ? 7.059   10.981  -29.833 1.00 28.25  ? 146 TRP C CZ2 1 
ATOM   4823 C  CZ3 . TRP C 1 147 ? 7.487   13.235  -30.620 1.00 35.87  ? 146 TRP C CZ3 1 
ATOM   4824 C  CH2 . TRP C 1 147 ? 7.096   12.339  -29.612 1.00 33.59  ? 146 TRP C CH2 1 
ATOM   4825 N  N   . PHE C 1 148 ? 9.062   13.333  -36.671 1.00 41.86  ? 147 PHE C N   1 
ATOM   4826 C  CA  . PHE C 1 148 ? 9.624   13.814  -37.932 1.00 40.07  ? 147 PHE C CA  1 
ATOM   4827 C  C   . PHE C 1 148 ? 10.393  12.793  -38.761 1.00 41.21  ? 147 PHE C C   1 
ATOM   4828 O  O   . PHE C 1 148 ? 10.261  12.763  -39.979 1.00 39.92  ? 147 PHE C O   1 
ATOM   4829 C  CB  . PHE C 1 148 ? 10.467  15.059  -37.703 1.00 33.91  ? 147 PHE C CB  1 
ATOM   4830 C  CG  . PHE C 1 148 ? 9.651   16.290  -37.504 1.00 30.61  ? 147 PHE C CG  1 
ATOM   4831 C  CD1 . PHE C 1 148 ? 9.200   16.645  -36.238 1.00 28.99  ? 147 PHE C CD1 1 
ATOM   4832 C  CD2 . PHE C 1 148 ? 9.284   17.075  -38.587 1.00 29.24  ? 147 PHE C CD2 1 
ATOM   4833 C  CE1 . PHE C 1 148 ? 8.390   17.771  -36.058 1.00 21.74  ? 147 PHE C CE1 1 
ATOM   4834 C  CE2 . PHE C 1 148 ? 8.474   18.209  -38.417 1.00 22.16  ? 147 PHE C CE2 1 
ATOM   4835 C  CZ  . PHE C 1 148 ? 8.029   18.551  -37.151 1.00 17.38  ? 147 PHE C CZ  1 
ATOM   4836 N  N   . ALA C 1 149 ? 11.209  11.972  -38.112 1.00 44.97  ? 148 ALA C N   1 
ATOM   4837 C  CA  . ALA C 1 149 ? 11.968  10.951  -38.824 1.00 45.13  ? 148 ALA C CA  1 
ATOM   4838 C  C   . ALA C 1 149 ? 11.026  9.904   -39.416 1.00 45.64  ? 148 ALA C C   1 
ATOM   4839 O  O   . ALA C 1 149 ? 11.280  9.363   -40.490 1.00 45.98  ? 148 ALA C O   1 
ATOM   4840 C  CB  . ALA C 1 149 ? 12.943  10.286  -37.886 1.00 46.02  ? 148 ALA C CB  1 
ATOM   4841 N  N   . GLY C 1 150 ? 9.951   9.612   -38.694 1.00 44.25  ? 149 GLY C N   1 
ATOM   4842 C  CA  . GLY C 1 150 ? 8.987   8.627   -39.139 1.00 45.54  ? 149 GLY C CA  1 
ATOM   4843 C  C   . GLY C 1 150 ? 8.137   8.193   -37.968 1.00 47.97  ? 149 GLY C C   1 
ATOM   4844 O  O   . GLY C 1 150 ? 7.559   9.030   -37.277 1.00 48.49  ? 149 GLY C O   1 
ATOM   4845 N  N   . ASN C 1 151 ? 8.051   6.888   -37.737 1.00 50.19  ? 150 ASN C N   1 
ATOM   4846 C  CA  . ASN C 1 151 ? 7.262   6.377   -36.617 1.00 54.89  ? 150 ASN C CA  1 
ATOM   4847 C  C   . ASN C 1 151 ? 8.051   6.417   -35.315 1.00 54.83  ? 150 ASN C C   1 
ATOM   4848 O  O   . ASN C 1 151 ? 7.478   6.374   -34.226 1.00 54.34  ? 150 ASN C O   1 
ATOM   4849 C  CB  . ASN C 1 151 ? 6.772   4.953   -36.895 1.00 59.13  ? 150 ASN C CB  1 
ATOM   4850 C  CG  . ASN C 1 151 ? 5.653   4.913   -37.927 1.00 64.01  ? 150 ASN C CG  1 
ATOM   4851 O  OD1 . ASN C 1 151 ? 5.777   4.263   -38.968 1.00 62.70  ? 150 ASN C OD1 1 
ATOM   4852 N  ND2 . ASN C 1 151 ? 4.554   5.619   -37.646 1.00 62.75  ? 150 ASN C ND2 1 
ATOM   4853 N  N   . LYS C 1 152 ? 9.374   6.450   -35.435 1.00 55.41  ? 151 LYS C N   1 
ATOM   4854 C  CA  . LYS C 1 152 ? 10.232  6.505   -34.269 1.00 55.01  ? 151 LYS C CA  1 
ATOM   4855 C  C   . LYS C 1 152 ? 10.788  7.891   -34.031 1.00 50.32  ? 151 LYS C C   1 
ATOM   4856 O  O   . LYS C 1 152 ? 11.095  8.641   -34.965 1.00 48.74  ? 151 LYS C O   1 
ATOM   4857 C  CB  . LYS C 1 152 ? 11.401  5.553   -34.317 1.00 59.92  ? 151 LYS C CB  1 
ATOM   4858 C  CG  . LYS C 1 152 ? 12.565  6.033   -35.138 1.00 74.10  ? 151 LYS C CG  1 
ATOM   4859 C  CD  . LYS C 1 152 ? 13.835  5.342   -34.706 1.00 81.37  ? 151 LYS C CD  1 
ATOM   4860 C  CE  . LYS C 1 152 ? 15.060  5.673   -35.513 1.00 87.26  ? 151 LYS C CE  1 
ATOM   4861 N  NZ  . LYS C 1 152 ? 14.921  6.831   -36.448 1.00 92.72  ? 151 LYS C NZ  1 
ATOM   4862 N  N   . ILE C 1 153 ? 10.887  8.229   -32.756 1.00 43.38  ? 152 ILE C N   1 
ATOM   4863 C  CA  . ILE C 1 153 ? 11.406  9.513   -32.346 1.00 38.01  ? 152 ILE C CA  1 
ATOM   4864 C  C   . ILE C 1 153 ? 12.910  9.493   -32.539 1.00 36.27  ? 152 ILE C C   1 
ATOM   4865 O  O   . ILE C 1 153 ? 13.554  8.446   -32.387 1.00 39.50  ? 152 ILE C O   1 
ATOM   4866 C  CB  . ILE C 1 153 ? 11.060  9.791   -30.862 1.00 38.39  ? 152 ILE C CB  1 
ATOM   4867 C  CG1 . ILE C 1 153 ? 11.655  11.127  -30.420 1.00 31.84  ? 152 ILE C CG1 1 
ATOM   4868 C  CG2 . ILE C 1 153 ? 11.510  8.625   -29.989 1.00 35.36  ? 152 ILE C CG2 1 
ATOM   4869 C  CD1 . ILE C 1 153 ? 11.267  11.521  -29.040 1.00 24.06  ? 152 ILE C CD1 1 
ATOM   4870 N  N   . THR C 1 154 ? 13.455  10.640  -32.920 1.00 30.70  ? 153 THR C N   1 
ATOM   4871 C  CA  . THR C 1 154 ? 14.889  10.773  -33.125 1.00 29.02  ? 153 THR C CA  1 
ATOM   4872 C  C   . THR C 1 154 ? 15.338  12.086  -32.515 1.00 27.46  ? 153 THR C C   1 
ATOM   4873 O  O   . THR C 1 154 ? 14.504  12.890  -32.075 1.00 30.20  ? 153 THR C O   1 
ATOM   4874 C  CB  . THR C 1 154 ? 15.280  10.718  -34.620 1.00 32.96  ? 153 THR C CB  1 
ATOM   4875 O  OG1 . THR C 1 154 ? 14.461  11.618  -35.369 1.00 34.92  ? 153 THR C OG1 1 
ATOM   4876 C  CG2 . THR C 1 154 ? 15.125  9.299   -35.166 1.00 29.69  ? 153 THR C CG2 1 
ATOM   4877 N  N   . PHE C 1 155 ? 16.649  12.300  -32.467 1.00 26.65  ? 154 PHE C N   1 
ATOM   4878 C  CA  . PHE C 1 155 ? 17.158  13.522  -31.870 1.00 29.31  ? 154 PHE C CA  1 
ATOM   4879 C  C   . PHE C 1 155 ? 16.673  14.788  -32.568 1.00 30.14  ? 154 PHE C C   1 
ATOM   4880 O  O   . PHE C 1 155 ? 16.621  15.854  -31.948 1.00 30.09  ? 154 PHE C O   1 
ATOM   4881 C  CB  . PHE C 1 155 ? 18.694  13.474  -31.729 1.00 27.41  ? 154 PHE C CB  1 
ATOM   4882 C  CG  . PHE C 1 155 ? 19.453  13.754  -32.997 1.00 28.51  ? 154 PHE C CG  1 
ATOM   4883 C  CD1 . PHE C 1 155 ? 19.824  15.058  -33.321 1.00 25.81  ? 154 PHE C CD1 1 
ATOM   4884 C  CD2 . PHE C 1 155 ? 19.817  12.717  -33.853 1.00 29.48  ? 154 PHE C CD2 1 
ATOM   4885 C  CE1 . PHE C 1 155 ? 20.542  15.333  -34.474 1.00 18.78  ? 154 PHE C CE1 1 
ATOM   4886 C  CE2 . PHE C 1 155 ? 20.534  12.977  -35.009 1.00 27.42  ? 154 PHE C CE2 1 
ATOM   4887 C  CZ  . PHE C 1 155 ? 20.897  14.292  -35.322 1.00 30.67  ? 154 PHE C CZ  1 
ATOM   4888 N  N   . VAL C 1 156 ? 16.278  14.671  -33.835 1.00 31.83  ? 155 VAL C N   1 
ATOM   4889 C  CA  . VAL C 1 156 ? 15.816  15.843  -34.579 1.00 31.00  ? 155 VAL C CA  1 
ATOM   4890 C  C   . VAL C 1 156 ? 14.490  16.356  -34.045 1.00 28.61  ? 155 VAL C C   1 
ATOM   4891 O  O   . VAL C 1 156 ? 14.149  17.528  -34.215 1.00 31.63  ? 155 VAL C O   1 
ATOM   4892 C  CB  . VAL C 1 156 ? 15.676  15.573  -36.087 1.00 28.70  ? 155 VAL C CB  1 
ATOM   4893 C  CG1 . VAL C 1 156 ? 17.043  15.454  -36.728 1.00 27.16  ? 155 VAL C CG1 1 
ATOM   4894 C  CG2 . VAL C 1 156 ? 14.885  14.309  -36.318 1.00 31.10  ? 155 VAL C CG2 1 
ATOM   4895 N  N   . ASP C 1 157 ? 13.724  15.460  -33.437 1.00 28.06  ? 156 ASP C N   1 
ATOM   4896 C  CA  . ASP C 1 157 ? 12.448  15.847  -32.861 1.00 29.92  ? 156 ASP C CA  1 
ATOM   4897 C  C   . ASP C 1 157 ? 12.691  16.885  -31.761 1.00 30.56  ? 156 ASP C C   1 
ATOM   4898 O  O   . ASP C 1 157 ? 11.880  17.793  -31.546 1.00 31.58  ? 156 ASP C O   1 
ATOM   4899 C  CB  . ASP C 1 157 ? 11.722  14.606  -32.359 1.00 23.47  ? 156 ASP C CB  1 
ATOM   4900 C  CG  . ASP C 1 157 ? 11.242  13.730  -33.499 1.00 30.45  ? 156 ASP C CG  1 
ATOM   4901 O  OD1 . ASP C 1 157 ? 10.364  14.196  -34.249 1.00 26.47  ? 156 ASP C OD1 1 
ATOM   4902 O  OD2 . ASP C 1 157 ? 11.748  12.601  -33.667 1.00 33.17  ? 156 ASP C OD2 1 
ATOM   4903 N  N   . PHE C 1 158 ? 13.841  16.777  -31.107 1.00 29.08  ? 157 PHE C N   1 
ATOM   4904 C  CA  . PHE C 1 158 ? 14.201  17.721  -30.075 1.00 28.46  ? 157 PHE C CA  1 
ATOM   4905 C  C   . PHE C 1 158 ? 14.597  19.038  -30.723 1.00 28.69  ? 157 PHE C C   1 
ATOM   4906 O  O   . PHE C 1 158 ? 14.295  20.109  -30.205 1.00 30.21  ? 157 PHE C O   1 
ATOM   4907 C  CB  . PHE C 1 158 ? 15.358  17.183  -29.243 1.00 26.61  ? 157 PHE C CB  1 
ATOM   4908 C  CG  . PHE C 1 158 ? 15.022  15.947  -28.480 1.00 29.24  ? 157 PHE C CG  1 
ATOM   4909 C  CD1 . PHE C 1 158 ? 14.841  14.735  -29.137 1.00 28.40  ? 157 PHE C CD1 1 
ATOM   4910 C  CD2 . PHE C 1 158 ? 14.900  15.989  -27.097 1.00 27.33  ? 157 PHE C CD2 1 
ATOM   4911 C  CE1 . PHE C 1 158 ? 14.541  13.567  -28.423 1.00 27.40  ? 157 PHE C CE1 1 
ATOM   4912 C  CE2 . PHE C 1 158 ? 14.601  14.828  -26.368 1.00 29.77  ? 157 PHE C CE2 1 
ATOM   4913 C  CZ  . PHE C 1 158 ? 14.424  13.610  -27.038 1.00 28.37  ? 157 PHE C CZ  1 
ATOM   4914 N  N   . LEU C 1 159 ? 15.328  18.960  -31.828 1.00 26.82  ? 158 LEU C N   1 
ATOM   4915 C  CA  . LEU C 1 159 ? 15.752  20.165  -32.526 1.00 27.75  ? 158 LEU C CA  1 
ATOM   4916 C  C   . LEU C 1 159 ? 14.556  20.920  -33.098 1.00 30.90  ? 158 LEU C C   1 
ATOM   4917 O  O   . LEU C 1 159 ? 14.507  22.154  -33.060 1.00 28.44  ? 158 LEU C O   1 
ATOM   4918 C  CB  . LEU C 1 159 ? 16.731  19.809  -33.643 1.00 29.45  ? 158 LEU C CB  1 
ATOM   4919 C  CG  . LEU C 1 159 ? 18.149  19.429  -33.212 1.00 29.16  ? 158 LEU C CG  1 
ATOM   4920 C  CD1 . LEU C 1 159 ? 18.936  18.912  -34.413 1.00 27.20  ? 158 LEU C CD1 1 
ATOM   4921 C  CD2 . LEU C 1 159 ? 18.832  20.645  -32.597 1.00 24.58  ? 158 LEU C CD2 1 
ATOM   4922 N  N   . VAL C 1 160 ? 13.604  20.176  -33.653 1.00 31.76  ? 159 VAL C N   1 
ATOM   4923 C  CA  . VAL C 1 160 ? 12.407  20.782  -34.227 1.00 34.36  ? 159 VAL C CA  1 
ATOM   4924 C  C   . VAL C 1 160 ? 11.545  21.399  -33.137 1.00 34.41  ? 159 VAL C C   1 
ATOM   4925 O  O   . VAL C 1 160 ? 11.046  22.516  -33.293 1.00 34.33  ? 159 VAL C O   1 
ATOM   4926 C  CB  . VAL C 1 160 ? 11.557  19.765  -35.015 1.00 31.38  ? 159 VAL C CB  1 
ATOM   4927 C  CG1 . VAL C 1 160 ? 10.335  20.458  -35.578 1.00 19.25  ? 159 VAL C CG1 1 
ATOM   4928 C  CG2 . VAL C 1 160 ? 12.371  19.164  -36.148 1.00 25.53  ? 159 VAL C CG2 1 
ATOM   4929 N  N   . TYR C 1 161 ? 11.359  20.665  -32.044 1.00 33.64  ? 160 TYR C N   1 
ATOM   4930 C  CA  . TYR C 1 161 ? 10.561  21.164  -30.937 1.00 34.53  ? 160 TYR C CA  1 
ATOM   4931 C  C   . TYR C 1 161 ? 11.099  22.507  -30.484 1.00 34.95  ? 160 TYR C C   1 
ATOM   4932 O  O   . TYR C 1 161 ? 10.376  23.505  -30.434 1.00 31.99  ? 160 TYR C O   1 
ATOM   4933 C  CB  . TYR C 1 161 ? 10.589  20.184  -29.764 1.00 33.32  ? 160 TYR C CB  1 
ATOM   4934 C  CG  . TYR C 1 161 ? 10.145  20.809  -28.459 1.00 35.59  ? 160 TYR C CG  1 
ATOM   4935 C  CD1 . TYR C 1 161 ? 11.070  21.125  -27.471 1.00 35.05  ? 160 TYR C CD1 1 
ATOM   4936 C  CD2 . TYR C 1 161 ? 8.810   21.130  -28.231 1.00 41.08  ? 160 TYR C CD2 1 
ATOM   4937 C  CE1 . TYR C 1 161 ? 10.684  21.749  -26.293 1.00 33.29  ? 160 TYR C CE1 1 
ATOM   4938 C  CE2 . TYR C 1 161 ? 8.414   21.760  -27.048 1.00 42.51  ? 160 TYR C CE2 1 
ATOM   4939 C  CZ  . TYR C 1 161 ? 9.365   22.067  -26.084 1.00 39.30  ? 160 TYR C CZ  1 
ATOM   4940 O  OH  . TYR C 1 161 ? 9.015   22.715  -24.917 1.00 43.53  ? 160 TYR C OH  1 
ATOM   4941 N  N   . ASP C 1 162 ? 12.374  22.508  -30.126 1.00 34.06  ? 161 ASP C N   1 
ATOM   4942 C  CA  . ASP C 1 162 ? 13.037  23.711  -29.660 1.00 34.65  ? 161 ASP C CA  1 
ATOM   4943 C  C   . ASP C 1 162 ? 12.664  24.879  -30.561 1.00 32.78  ? 161 ASP C C   1 
ATOM   4944 O  O   . ASP C 1 162 ? 12.188  25.907  -30.091 1.00 29.62  ? 161 ASP C O   1 
ATOM   4945 C  CB  . ASP C 1 162 ? 14.538  23.493  -29.636 1.00 38.18  ? 161 ASP C CB  1 
ATOM   4946 C  CG  . ASP C 1 162 ? 15.241  24.654  -28.915 1.00 43.05  ? 161 ASP C CG  1 
ATOM   4947 O  OD1 . ASP C 1 162 ? 14.656  25.251  -27.984 1.00 41.73  ? 161 ASP C OD1 1 
ATOM   4948 O  OD2 . ASP C 1 162 ? 16.398  24.968  -29.274 1.00 48.17  ? 161 ASP C OD2 1 
ATOM   4949 N  N   . VAL C 1 163 ? 12.870  24.713  -31.858 1.00 34.26  ? 162 VAL C N   1 
ATOM   4950 C  CA  . VAL C 1 163 ? 12.557  25.781  -32.795 1.00 35.31  ? 162 VAL C CA  1 
ATOM   4951 C  C   . VAL C 1 163 ? 11.091  26.214  -32.716 1.00 35.00  ? 162 VAL C C   1 
ATOM   4952 O  O   . VAL C 1 163 ? 10.799  27.414  -32.648 1.00 32.71  ? 162 VAL C O   1 
ATOM   4953 C  CB  . VAL C 1 163 ? 12.913  25.375  -34.232 1.00 35.88  ? 162 VAL C CB  1 
ATOM   4954 C  CG1 . VAL C 1 163 ? 12.597  26.506  -35.194 1.00 34.43  ? 162 VAL C CG1 1 
ATOM   4955 C  CG2 . VAL C 1 163 ? 14.382  25.008  -34.306 1.00 37.20  ? 162 VAL C CG2 1 
ATOM   4956 N  N   . LEU C 1 164 ? 10.177  25.245  -32.775 1.00 35.17  ? 163 LEU C N   1 
ATOM   4957 C  CA  . LEU C 1 164 ? 8.747   25.541  -32.699 1.00 37.25  ? 163 LEU C CA  1 
ATOM   4958 C  C   . LEU C 1 164 ? 8.429   26.267  -31.399 1.00 38.96  ? 163 LEU C C   1 
ATOM   4959 O  O   . LEU C 1 164 ? 7.764   27.304  -31.419 1.00 38.47  ? 163 LEU C O   1 
ATOM   4960 C  CB  . LEU C 1 164 ? 7.919   24.258  -32.790 1.00 37.75  ? 163 LEU C CB  1 
ATOM   4961 C  CG  . LEU C 1 164 ? 8.099   23.450  -34.076 1.00 42.73  ? 163 LEU C CG  1 
ATOM   4962 C  CD1 . LEU C 1 164 ? 7.318   22.150  -34.020 1.00 37.16  ? 163 LEU C CD1 1 
ATOM   4963 C  CD2 . LEU C 1 164 ? 7.675   24.278  -35.274 1.00 39.19  ? 163 LEU C CD2 1 
ATOM   4964 N  N   . ASP C 1 165 ? 8.905   25.718  -30.278 1.00 41.32  ? 164 ASP C N   1 
ATOM   4965 C  CA  . ASP C 1 165 ? 8.675   26.320  -28.968 1.00 40.25  ? 164 ASP C CA  1 
ATOM   4966 C  C   . ASP C 1 165 ? 9.172   27.761  -28.934 1.00 38.24  ? 164 ASP C C   1 
ATOM   4967 O  O   . ASP C 1 165 ? 8.477   28.652  -28.458 1.00 34.61  ? 164 ASP C O   1 
ATOM   4968 C  CB  . ASP C 1 165 ? 9.356   25.501  -27.862 1.00 44.54  ? 164 ASP C CB  1 
ATOM   4969 C  CG  . ASP C 1 165 ? 9.079   26.056  -26.457 1.00 48.47  ? 164 ASP C CG  1 
ATOM   4970 O  OD1 . ASP C 1 165 ? 7.950   26.521  -26.193 1.00 50.57  ? 164 ASP C OD1 1 
ATOM   4971 O  OD2 . ASP C 1 165 ? 9.984   26.021  -25.598 1.00 49.19  ? 164 ASP C OD2 1 
ATOM   4972 N  N   . LEU C 1 166 ? 10.380  27.981  -29.433 1.00 39.50  ? 165 LEU C N   1 
ATOM   4973 C  CA  . LEU C 1 166 ? 10.961  29.312  -29.449 1.00 42.62  ? 165 LEU C CA  1 
ATOM   4974 C  C   . LEU C 1 166 ? 10.067  30.287  -30.193 1.00 45.10  ? 165 LEU C C   1 
ATOM   4975 O  O   . LEU C 1 166 ? 10.082  31.494  -29.931 1.00 46.83  ? 165 LEU C O   1 
ATOM   4976 C  CB  . LEU C 1 166 ? 12.354  29.279  -30.090 1.00 42.49  ? 165 LEU C CB  1 
ATOM   4977 C  CG  . LEU C 1 166 ? 13.491  28.724  -29.221 1.00 45.19  ? 165 LEU C CG  1 
ATOM   4978 C  CD1 . LEU C 1 166 ? 14.784  28.683  -30.016 1.00 49.37  ? 165 LEU C CD1 1 
ATOM   4979 C  CD2 . LEU C 1 166 ? 13.664  29.588  -27.982 1.00 44.50  ? 165 LEU C CD2 1 
ATOM   4980 N  N   . HIS C 1 167 ? 9.284   29.759  -31.121 1.00 46.64  ? 166 HIS C N   1 
ATOM   4981 C  CA  . HIS C 1 167 ? 8.405   30.607  -31.903 1.00 49.31  ? 166 HIS C CA  1 
ATOM   4982 C  C   . HIS C 1 167 ? 7.039   30.876  -31.292 1.00 51.67  ? 166 HIS C C   1 
ATOM   4983 O  O   . HIS C 1 167 ? 6.474   31.950  -31.511 1.00 54.27  ? 166 HIS C O   1 
ATOM   4984 C  CB  . HIS C 1 167 ? 8.324   30.112  -33.349 1.00 46.27  ? 166 HIS C CB  1 
ATOM   4985 C  CG  . HIS C 1 167 ? 9.554   30.439  -34.144 1.00 44.61  ? 166 HIS C CG  1 
ATOM   4986 N  ND1 . HIS C 1 167 ? 10.608  29.560  -34.281 1.00 45.54  ? 166 HIS C ND1 1 
ATOM   4987 C  CD2 . HIS C 1 167 ? 9.944   31.588  -34.737 1.00 40.67  ? 166 HIS C CD2 1 
ATOM   4988 C  CE1 . HIS C 1 167 ? 11.598  30.159  -34.914 1.00 45.77  ? 166 HIS C CE1 1 
ATOM   4989 N  NE2 . HIS C 1 167 ? 11.226  31.391  -35.201 1.00 40.05  ? 166 HIS C NE2 1 
ATOM   4990 N  N   . ARG C 1 168 ? 6.508   29.922  -30.530 1.00 51.52  ? 167 ARG C N   1 
ATOM   4991 C  CA  . ARG C 1 168 ? 5.216   30.140  -29.886 1.00 54.05  ? 167 ARG C CA  1 
ATOM   4992 C  C   . ARG C 1 168 ? 5.480   31.171  -28.793 1.00 55.36  ? 167 ARG C C   1 
ATOM   4993 O  O   . ARG C 1 168 ? 4.571   31.872  -28.349 1.00 55.78  ? 167 ARG C O   1 
ATOM   4994 C  CB  . ARG C 1 168 ? 4.660   28.847  -29.281 1.00 55.57  ? 167 ARG C CB  1 
ATOM   4995 C  CG  . ARG C 1 168 ? 5.240   28.494  -27.929 1.00 59.94  ? 167 ARG C CG  1 
ATOM   4996 C  CD  . ARG C 1 168 ? 5.327   26.995  -27.740 1.00 63.62  ? 167 ARG C CD  1 
ATOM   4997 N  NE  . ARG C 1 168 ? 4.123   26.396  -27.176 1.00 65.64  ? 167 ARG C NE  1 
ATOM   4998 C  CZ  . ARG C 1 168 ? 4.124   25.352  -26.346 1.00 65.55  ? 167 ARG C CZ  1 
ATOM   4999 N  NH1 . ARG C 1 168 ? 5.268   24.787  -25.971 1.00 66.51  ? 167 ARG C NH1 1 
ATOM   5000 N  NH2 . ARG C 1 168 ? 2.978   24.853  -25.901 1.00 61.48  ? 167 ARG C NH2 1 
ATOM   5001 N  N   . ILE C 1 169 ? 6.734   31.231  -28.347 1.00 56.01  ? 168 ILE C N   1 
ATOM   5002 C  CA  . ILE C 1 169 ? 7.156   32.177  -27.322 1.00 57.87  ? 168 ILE C CA  1 
ATOM   5003 C  C   . ILE C 1 169 ? 7.278   33.570  -27.952 1.00 58.53  ? 168 ILE C C   1 
ATOM   5004 O  O   . ILE C 1 169 ? 6.870   34.573  -27.359 1.00 56.90  ? 168 ILE C O   1 
ATOM   5005 C  CB  . ILE C 1 169 ? 8.513   31.746  -26.692 1.00 57.33  ? 168 ILE C CB  1 
ATOM   5006 C  CG1 . ILE C 1 169 ? 8.333   30.456  -25.880 1.00 55.73  ? 168 ILE C CG1 1 
ATOM   5007 C  CG2 . ILE C 1 169 ? 9.071   32.850  -25.802 1.00 51.34  ? 168 ILE C CG2 1 
ATOM   5008 C  CD1 . ILE C 1 169 ? 9.617   29.931  -25.262 1.00 53.12  ? 168 ILE C CD1 1 
ATOM   5009 N  N   . PHE C 1 170 ? 7.827   33.614  -29.163 1.00 60.10  ? 169 PHE C N   1 
ATOM   5010 C  CA  . PHE C 1 170 ? 8.011   34.861  -29.901 1.00 63.09  ? 169 PHE C CA  1 
ATOM   5011 C  C   . PHE C 1 170 ? 6.676   35.372  -30.463 1.00 64.55  ? 169 PHE C C   1 
ATOM   5012 O  O   . PHE C 1 170 ? 6.373   36.566  -30.388 1.00 62.50  ? 169 PHE C O   1 
ATOM   5013 C  CB  . PHE C 1 170 ? 9.016   34.629  -31.036 1.00 64.95  ? 169 PHE C CB  1 
ATOM   5014 C  CG  . PHE C 1 170 ? 9.559   35.894  -31.647 1.00 68.53  ? 169 PHE C CG  1 
ATOM   5015 C  CD1 . PHE C 1 170 ? 10.502  36.661  -30.970 1.00 66.84  ? 169 PHE C CD1 1 
ATOM   5016 C  CD2 . PHE C 1 170 ? 9.147   36.305  -32.914 1.00 69.66  ? 169 PHE C CD2 1 
ATOM   5017 C  CE1 . PHE C 1 170 ? 11.030  37.821  -31.541 1.00 67.63  ? 169 PHE C CE1 1 
ATOM   5018 C  CE2 . PHE C 1 170 ? 9.668   37.463  -33.495 1.00 71.41  ? 169 PHE C CE2 1 
ATOM   5019 C  CZ  . PHE C 1 170 ? 10.613  38.222  -32.806 1.00 70.44  ? 169 PHE C CZ  1 
ATOM   5020 N  N   . GLU C 1 171 ? 5.917   34.471  -31.080 1.00 66.11  ? 170 GLU C N   1 
ATOM   5021 C  CA  . GLU C 1 171 ? 4.609   34.783  -31.649 1.00 66.79  ? 170 GLU C CA  1 
ATOM   5022 C  C   . GLU C 1 171 ? 3.697   33.610  -31.309 1.00 65.21  ? 170 GLU C C   1 
ATOM   5023 O  O   . GLU C 1 171 ? 3.572   32.663  -32.074 1.00 63.23  ? 170 GLU C O   1 
ATOM   5024 C  CB  . GLU C 1 171 ? 4.705   34.969  -33.167 1.00 68.92  ? 170 GLU C CB  1 
ATOM   5025 C  CG  . GLU C 1 171 ? 3.364   35.194  -33.879 1.00 73.75  ? 170 GLU C CG  1 
ATOM   5026 C  CD  . GLU C 1 171 ? 2.642   36.455  -33.430 1.00 76.79  ? 170 GLU C CD  1 
ATOM   5027 O  OE1 . GLU C 1 171 ? 3.231   37.557  -33.523 1.00 74.37  ? 170 GLU C OE1 1 
ATOM   5028 O  OE2 . GLU C 1 171 ? 1.475   36.341  -32.992 1.00 80.16  ? 170 GLU C OE2 1 
ATOM   5029 N  N   . PRO C 1 172 ? 3.023   33.686  -30.155 1.00 66.33  ? 171 PRO C N   1 
ATOM   5030 C  CA  . PRO C 1 172 ? 2.103   32.674  -29.626 1.00 68.04  ? 171 PRO C CA  1 
ATOM   5031 C  C   . PRO C 1 172 ? 1.090   32.086  -30.607 1.00 69.26  ? 171 PRO C C   1 
ATOM   5032 O  O   . PRO C 1 172 ? 0.856   30.872  -30.610 1.00 68.34  ? 171 PRO C O   1 
ATOM   5033 C  CB  . PRO C 1 172 ? 1.416   33.415  -28.482 1.00 67.13  ? 171 PRO C CB  1 
ATOM   5034 C  CG  . PRO C 1 172 ? 2.493   34.329  -27.995 1.00 66.75  ? 171 PRO C CG  1 
ATOM   5035 C  CD  . PRO C 1 172 ? 3.046   34.872  -29.281 1.00 66.60  ? 171 PRO C CD  1 
ATOM   5036 N  N   . LYS C 1 173 ? 0.475   32.949  -31.411 1.00 71.52  ? 172 LYS C N   1 
ATOM   5037 C  CA  . LYS C 1 173 ? -0.532  32.525  -32.384 1.00 72.21  ? 172 LYS C CA  1 
ATOM   5038 C  C   . LYS C 1 173 ? 0.045   31.810  -33.604 1.00 69.48  ? 172 LYS C C   1 
ATOM   5039 O  O   . LYS C 1 173 ? -0.690  31.175  -34.360 1.00 68.99  ? 172 LYS C O   1 
ATOM   5040 C  CB  . LYS C 1 173 ? -1.360  33.733  -32.845 1.00 77.49  ? 172 LYS C CB  1 
ATOM   5041 C  CG  . LYS C 1 173 ? -2.283  34.328  -31.778 1.00 83.03  ? 172 LYS C CG  1 
ATOM   5042 C  CD  . LYS C 1 173 ? -2.877  35.659  -32.243 1.00 88.99  ? 172 LYS C CD  1 
ATOM   5043 C  CE  . LYS C 1 173 ? -3.880  36.237  -31.246 1.00 90.41  ? 172 LYS C CE  1 
ATOM   5044 N  NZ  . LYS C 1 173 ? -5.142  35.441  -31.193 1.00 93.28  ? 172 LYS C NZ  1 
ATOM   5045 N  N   . CYS C 1 174 ? 1.356   31.911  -33.790 1.00 66.95  ? 173 CYS C N   1 
ATOM   5046 C  CA  . CYS C 1 174 ? 2.031   31.305  -34.935 1.00 65.79  ? 173 CYS C CA  1 
ATOM   5047 C  C   . CYS C 1 174 ? 1.678   29.854  -35.268 1.00 63.78  ? 173 CYS C C   1 
ATOM   5048 O  O   . CYS C 1 174 ? 1.601   29.490  -36.442 1.00 63.97  ? 173 CYS C O   1 
ATOM   5049 C  CB  . CYS C 1 174 ? 3.548   31.433  -34.777 1.00 66.63  ? 173 CYS C CB  1 
ATOM   5050 S  SG  . CYS C 1 174 ? 4.278   30.414  -33.468 1.00 65.08  ? 173 CYS C SG  1 
ATOM   5051 N  N   . LEU C 1 175 ? 1.481   29.032  -34.242 1.00 62.94  ? 174 LEU C N   1 
ATOM   5052 C  CA  . LEU C 1 175 ? 1.167   27.619  -34.430 1.00 63.28  ? 174 LEU C CA  1 
ATOM   5053 C  C   . LEU C 1 175 ? -0.293  27.244  -34.596 1.00 62.97  ? 174 LEU C C   1 
ATOM   5054 O  O   . LEU C 1 175 ? -0.595  26.107  -34.961 1.00 61.22  ? 174 LEU C O   1 
ATOM   5055 C  CB  . LEU C 1 175 ? 1.744   26.803  -33.280 1.00 67.07  ? 174 LEU C CB  1 
ATOM   5056 C  CG  . LEU C 1 175 ? 3.166   26.278  -33.466 1.00 72.65  ? 174 LEU C CG  1 
ATOM   5057 C  CD1 . LEU C 1 175 ? 4.058   27.323  -34.116 1.00 74.16  ? 174 LEU C CD1 1 
ATOM   5058 C  CD2 . LEU C 1 175 ? 3.719   25.870  -32.124 1.00 74.26  ? 174 LEU C CD2 1 
ATOM   5059 N  N   . ASP C 1 176 ? -1.193  28.177  -34.299 1.00 63.52  ? 175 ASP C N   1 
ATOM   5060 C  CA  . ASP C 1 176 ? -2.634  27.930  -34.390 1.00 65.25  ? 175 ASP C CA  1 
ATOM   5061 C  C   . ASP C 1 176 ? -3.087  27.334  -35.723 1.00 61.99  ? 175 ASP C C   1 
ATOM   5062 O  O   . ASP C 1 176 ? -3.970  26.469  -35.758 1.00 61.93  ? 175 ASP C O   1 
ATOM   5063 C  CB  . ASP C 1 176 ? -3.414  29.223  -34.104 1.00 73.37  ? 175 ASP C CB  1 
ATOM   5064 C  CG  . ASP C 1 176 ? -3.108  29.813  -32.727 1.00 81.36  ? 175 ASP C CG  1 
ATOM   5065 O  OD1 . ASP C 1 176 ? -2.306  29.223  -31.967 1.00 82.72  ? 175 ASP C OD1 1 
ATOM   5066 O  OD2 . ASP C 1 176 ? -3.668  30.886  -32.411 1.00 84.78  ? 175 ASP C OD2 1 
ATOM   5067 N  N   . ALA C 1 177 ? -2.471  27.795  -36.809 1.00 56.54  ? 176 ALA C N   1 
ATOM   5068 C  CA  . ALA C 1 177 ? -2.804  27.339  -38.154 1.00 53.61  ? 176 ALA C CA  1 
ATOM   5069 C  C   . ALA C 1 177 ? -2.319  25.931  -38.502 1.00 52.79  ? 176 ALA C C   1 
ATOM   5070 O  O   . ALA C 1 177 ? -2.675  25.392  -39.552 1.00 49.40  ? 176 ALA C O   1 
ATOM   5071 C  CB  . ALA C 1 177 ? -2.274  28.335  -39.175 1.00 52.71  ? 176 ALA C CB  1 
ATOM   5072 N  N   . PHE C 1 178 ? -1.524  25.332  -37.622 1.00 52.78  ? 177 PHE C N   1 
ATOM   5073 C  CA  . PHE C 1 178 ? -0.977  23.999  -37.867 1.00 50.65  ? 177 PHE C CA  1 
ATOM   5074 C  C   . PHE C 1 178 ? -1.258  23.066  -36.708 1.00 51.40  ? 177 PHE C C   1 
ATOM   5075 O  O   . PHE C 1 178 ? -0.436  22.909  -35.802 1.00 51.88  ? 177 PHE C O   1 
ATOM   5076 C  CB  . PHE C 1 178 ? 0.532   24.094  -38.120 1.00 43.99  ? 177 PHE C CB  1 
ATOM   5077 C  CG  . PHE C 1 178 ? 0.907   25.232  -39.006 1.00 35.20  ? 177 PHE C CG  1 
ATOM   5078 C  CD1 . PHE C 1 178 ? 0.794   25.121  -40.386 1.00 32.09  ? 177 PHE C CD1 1 
ATOM   5079 C  CD2 . PHE C 1 178 ? 1.273   26.451  -38.457 1.00 32.35  ? 177 PHE C CD2 1 
ATOM   5080 C  CE1 . PHE C 1 178 ? 1.033   26.214  -41.204 1.00 35.22  ? 177 PHE C CE1 1 
ATOM   5081 C  CE2 . PHE C 1 178 ? 1.516   27.558  -39.266 1.00 33.46  ? 177 PHE C CE2 1 
ATOM   5082 C  CZ  . PHE C 1 178 ? 1.394   27.442  -40.641 1.00 36.21  ? 177 PHE C CZ  1 
ATOM   5083 N  N   . PRO C 1 179 ? -2.438  22.436  -36.717 1.00 51.55  ? 178 PRO C N   1 
ATOM   5084 C  CA  . PRO C 1 179 ? -2.846  21.507  -35.662 1.00 50.43  ? 178 PRO C CA  1 
ATOM   5085 C  C   . PRO C 1 179 ? -1.865  20.364  -35.422 1.00 48.17  ? 178 PRO C C   1 
ATOM   5086 O  O   . PRO C 1 179 ? -1.597  20.013  -34.272 1.00 47.67  ? 178 PRO C O   1 
ATOM   5087 C  CB  . PRO C 1 179 ? -4.207  21.006  -36.158 1.00 49.20  ? 178 PRO C CB  1 
ATOM   5088 C  CG  . PRO C 1 179 ? -4.119  21.166  -37.645 1.00 49.10  ? 178 PRO C CG  1 
ATOM   5089 C  CD  . PRO C 1 179 ? -3.461  22.509  -37.772 1.00 50.48  ? 178 PRO C CD  1 
ATOM   5090 N  N   . ASN C 1 180 ? -1.356  19.772  -36.501 1.00 44.00  ? 179 ASN C N   1 
ATOM   5091 C  CA  . ASN C 1 180 ? -0.400  18.662  -36.392 1.00 44.80  ? 179 ASN C CA  1 
ATOM   5092 C  C   . ASN C 1 180 ? 0.889   19.013  -35.629 1.00 43.94  ? 179 ASN C C   1 
ATOM   5093 O  O   . ASN C 1 180 ? 1.483   18.148  -34.964 1.00 35.40  ? 179 ASN C O   1 
ATOM   5094 C  CB  . ASN C 1 180 ? -0.056  18.105  -37.775 1.00 42.62  ? 179 ASN C CB  1 
ATOM   5095 C  CG  . ASN C 1 180 ? 0.666   19.108  -38.647 1.00 45.20  ? 179 ASN C CG  1 
ATOM   5096 O  OD1 . ASN C 1 180 ? 1.402   18.723  -39.552 1.00 38.96  ? 179 ASN C OD1 1 
ATOM   5097 N  ND2 . ASN C 1 180 ? 0.450   20.398  -38.394 1.00 45.64  ? 179 ASN C ND2 1 
ATOM   5098 N  N   . LEU C 1 181 ? 1.325   20.266  -35.755 1.00 46.20  ? 180 LEU C N   1 
ATOM   5099 C  CA  . LEU C 1 181 ? 2.520   20.747  -35.065 1.00 43.66  ? 180 LEU C CA  1 
ATOM   5100 C  C   . LEU C 1 181 ? 2.220   20.908  -33.584 1.00 45.81  ? 180 LEU C C   1 
ATOM   5101 O  O   . LEU C 1 181 ? 3.109   20.751  -32.744 1.00 45.95  ? 180 LEU C O   1 
ATOM   5102 C  CB  . LEU C 1 181 ? 2.979   22.099  -35.621 1.00 36.32  ? 180 LEU C CB  1 
ATOM   5103 C  CG  . LEU C 1 181 ? 3.474   22.175  -37.062 1.00 31.21  ? 180 LEU C CG  1 
ATOM   5104 C  CD1 . LEU C 1 181 ? 4.085   23.551  -37.298 1.00 24.54  ? 180 LEU C CD1 1 
ATOM   5105 C  CD2 . LEU C 1 181 ? 4.492   21.079  -37.339 1.00 25.79  ? 180 LEU C CD2 1 
ATOM   5106 N  N   . LYS C 1 182 ? 0.998   21.331  -33.277 1.00 45.52  ? 181 LYS C N   1 
ATOM   5107 C  CA  . LYS C 1 182 ? 0.588   21.498  -31.898 1.00 47.66  ? 181 LYS C CA  1 
ATOM   5108 C  C   . LYS C 1 182 ? 0.539   20.124  -31.247 1.00 47.74  ? 181 LYS C C   1 
ATOM   5109 O  O   . LYS C 1 182 ? 0.968   19.954  -30.110 1.00 48.66  ? 181 LYS C O   1 
ATOM   5110 C  CB  . LYS C 1 182 ? -0.774  22.182  -31.817 1.00 49.76  ? 181 LYS C CB  1 
ATOM   5111 C  CG  . LYS C 1 182 ? -0.721  23.698  -31.795 1.00 54.34  ? 181 LYS C CG  1 
ATOM   5112 C  CD  . LYS C 1 182 ? -2.126  24.270  -31.677 1.00 62.51  ? 181 LYS C CD  1 
ATOM   5113 C  CE  . LYS C 1 182 ? -2.120  25.771  -31.464 1.00 68.56  ? 181 LYS C CE  1 
ATOM   5114 N  NZ  . LYS C 1 182 ? -3.498  26.334  -31.568 1.00 71.47  ? 181 LYS C NZ  1 
ATOM   5115 N  N   . ASP C 1 183 ? 0.022   19.142  -31.977 1.00 47.35  ? 182 ASP C N   1 
ATOM   5116 C  CA  . ASP C 1 183 ? -0.062  17.784  -31.451 1.00 50.73  ? 182 ASP C CA  1 
ATOM   5117 C  C   . ASP C 1 183 ? 1.336   17.251  -31.206 1.00 49.33  ? 182 ASP C C   1 
ATOM   5118 O  O   . ASP C 1 183 ? 1.538   16.369  -30.370 1.00 49.99  ? 182 ASP C O   1 
ATOM   5119 C  CB  . ASP C 1 183 ? -0.805  16.855  -32.420 1.00 57.99  ? 182 ASP C CB  1 
ATOM   5120 C  CG  . ASP C 1 183 ? -2.281  17.219  -32.582 1.00 62.05  ? 182 ASP C CG  1 
ATOM   5121 O  OD1 . ASP C 1 183 ? -2.844  17.917  -31.710 1.00 59.11  ? 182 ASP C OD1 1 
ATOM   5122 O  OD2 . ASP C 1 183 ? -2.886  16.797  -33.590 1.00 63.27  ? 182 ASP C OD2 1 
ATOM   5123 N  N   . PHE C 1 184 ? 2.283   17.724  -32.011 1.00 48.53  ? 183 PHE C N   1 
ATOM   5124 C  CA  . PHE C 1 184 ? 3.679   17.331  -31.876 1.00 42.68  ? 183 PHE C CA  1 
ATOM   5125 C  C   . PHE C 1 184 ? 4.150   17.818  -30.510 1.00 40.51  ? 183 PHE C C   1 
ATOM   5126 O  O   . PHE C 1 184 ? 4.640   17.035  -29.699 1.00 42.48  ? 183 PHE C O   1 
ATOM   5127 C  CB  . PHE C 1 184 ? 4.520   17.969  -32.988 1.00 37.24  ? 183 PHE C CB  1 
ATOM   5128 C  CG  . PHE C 1 184 ? 5.997   17.840  -32.778 1.00 39.92  ? 183 PHE C CG  1 
ATOM   5129 C  CD1 . PHE C 1 184 ? 6.632   16.611  -32.938 1.00 40.74  ? 183 PHE C CD1 1 
ATOM   5130 C  CD2 . PHE C 1 184 ? 6.753   18.939  -32.377 1.00 39.95  ? 183 PHE C CD2 1 
ATOM   5131 C  CE1 . PHE C 1 184 ? 7.998   16.476  -32.693 1.00 38.46  ? 183 PHE C CE1 1 
ATOM   5132 C  CE2 . PHE C 1 184 ? 8.118   18.813  -32.131 1.00 35.53  ? 183 PHE C CE2 1 
ATOM   5133 C  CZ  . PHE C 1 184 ? 8.742   17.580  -32.289 1.00 36.09  ? 183 PHE C CZ  1 
ATOM   5134 N  N   . ILE C 1 185 ? 3.985   19.115  -30.265 1.00 36.02  ? 184 ILE C N   1 
ATOM   5135 C  CA  . ILE C 1 185 ? 4.379   19.725  -29.005 1.00 33.58  ? 184 ILE C CA  1 
ATOM   5136 C  C   . ILE C 1 185 ? 3.748   19.030  -27.803 1.00 37.62  ? 184 ILE C C   1 
ATOM   5137 O  O   . ILE C 1 185 ? 4.407   18.841  -26.774 1.00 35.57  ? 184 ILE C O   1 
ATOM   5138 C  CB  . ILE C 1 185 ? 4.030   21.214  -28.984 1.00 25.50  ? 184 ILE C CB  1 
ATOM   5139 C  CG1 . ILE C 1 185 ? 4.823   21.946  -30.063 1.00 24.34  ? 184 ILE C CG1 1 
ATOM   5140 C  CG2 . ILE C 1 185 ? 4.345   21.816  -27.632 1.00 23.17  ? 184 ILE C CG2 1 
ATOM   5141 C  CD1 . ILE C 1 185 ? 4.645   23.445  -30.040 1.00 30.29  ? 184 ILE C CD1 1 
ATOM   5142 N  N   . SER C 1 186 ? 2.468   18.686  -27.919 1.00 40.91  ? 185 SER C N   1 
ATOM   5143 C  CA  . SER C 1 186 ? 1.761   18.004  -26.843 1.00 43.99  ? 185 SER C CA  1 
ATOM   5144 C  C   . SER C 1 186 ? 2.385   16.642  -26.654 1.00 44.20  ? 185 SER C C   1 
ATOM   5145 O  O   . SER C 1 186 ? 2.767   16.271  -25.546 1.00 48.31  ? 185 SER C O   1 
ATOM   5146 C  CB  . SER C 1 186 ? 0.280   17.846  -27.178 1.00 44.49  ? 185 SER C CB  1 
ATOM   5147 O  OG  . SER C 1 186 ? -0.343  19.119  -27.276 1.00 60.07  ? 185 SER C OG  1 
ATOM   5148 N  N   . ARG C 1 187 ? 2.537   15.924  -27.760 1.00 43.34  ? 186 ARG C N   1 
ATOM   5149 C  CA  . ARG C 1 187 ? 3.114   14.588  -27.757 1.00 45.14  ? 186 ARG C CA  1 
ATOM   5150 C  C   . ARG C 1 187 ? 4.533   14.589  -27.183 1.00 43.22  ? 186 ARG C C   1 
ATOM   5151 O  O   . ARG C 1 187 ? 4.905   13.675  -26.444 1.00 41.54  ? 186 ARG C O   1 
ATOM   5152 C  CB  . ARG C 1 187 ? 3.086   14.024  -29.182 1.00 45.82  ? 186 ARG C CB  1 
ATOM   5153 C  CG  . ARG C 1 187 ? 3.459   12.555  -29.314 1.00 51.94  ? 186 ARG C CG  1 
ATOM   5154 C  CD  . ARG C 1 187 ? 2.934   11.961  -30.622 1.00 60.64  ? 186 ARG C CD  1 
ATOM   5155 N  NE  . ARG C 1 187 ? 3.162   12.840  -31.768 1.00 70.52  ? 186 ARG C NE  1 
ATOM   5156 C  CZ  . ARG C 1 187 ? 2.197   13.467  -32.439 1.00 76.43  ? 186 ARG C CZ  1 
ATOM   5157 N  NH1 . ARG C 1 187 ? 0.927   13.314  -32.084 1.00 77.37  ? 186 ARG C NH1 1 
ATOM   5158 N  NH2 . ARG C 1 187 ? 2.503   14.261  -33.457 1.00 78.35  ? 186 ARG C NH2 1 
ATOM   5159 N  N   . PHE C 1 188 ? 5.310   15.620  -27.512 1.00 39.81  ? 187 PHE C N   1 
ATOM   5160 C  CA  . PHE C 1 188 ? 6.681   15.744  -27.029 1.00 37.68  ? 187 PHE C CA  1 
ATOM   5161 C  C   . PHE C 1 188 ? 6.733   16.080  -25.535 1.00 37.41  ? 187 PHE C C   1 
ATOM   5162 O  O   . PHE C 1 188 ? 7.391   15.382  -24.756 1.00 34.86  ? 187 PHE C O   1 
ATOM   5163 C  CB  . PHE C 1 188 ? 7.439   16.807  -27.831 1.00 40.46  ? 187 PHE C CB  1 
ATOM   5164 C  CG  . PHE C 1 188 ? 8.900   16.916  -27.468 1.00 40.85  ? 187 PHE C CG  1 
ATOM   5165 C  CD1 . PHE C 1 188 ? 9.833   16.023  -28.000 1.00 41.09  ? 187 PHE C CD1 1 
ATOM   5166 C  CD2 . PHE C 1 188 ? 9.342   17.899  -26.583 1.00 40.67  ? 187 PHE C CD2 1 
ATOM   5167 C  CE1 . PHE C 1 188 ? 11.181  16.107  -27.654 1.00 37.59  ? 187 PHE C CE1 1 
ATOM   5168 C  CE2 . PHE C 1 188 ? 10.687  17.992  -26.230 1.00 38.62  ? 187 PHE C CE2 1 
ATOM   5169 C  CZ  . PHE C 1 188 ? 11.607  17.097  -26.766 1.00 41.35  ? 187 PHE C CZ  1 
ATOM   5170 N  N   . GLU C 1 189 ? 6.104   17.189  -25.150 1.00 36.99  ? 188 GLU C N   1 
ATOM   5171 C  CA  . GLU C 1 189 ? 6.076   17.598  -23.758 1.00 34.42  ? 188 GLU C CA  1 
ATOM   5172 C  C   . GLU C 1 189 ? 5.320   16.555  -22.936 1.00 37.66  ? 188 GLU C C   1 
ATOM   5173 O  O   . GLU C 1 189 ? 5.322   16.593  -21.707 1.00 36.01  ? 188 GLU C O   1 
ATOM   5174 C  CB  . GLU C 1 189 ? 5.413   18.968  -23.618 1.00 30.76  ? 188 GLU C CB  1 
ATOM   5175 C  CG  . GLU C 1 189 ? 6.155   20.098  -24.312 1.00 33.59  ? 188 GLU C CG  1 
ATOM   5176 C  CD  . GLU C 1 189 ? 5.473   21.454  -24.143 1.00 39.30  ? 188 GLU C CD  1 
ATOM   5177 O  OE1 . GLU C 1 189 ? 4.228   21.499  -24.075 1.00 42.96  ? 188 GLU C OE1 1 
ATOM   5178 O  OE2 . GLU C 1 189 ? 6.181   22.486  -24.089 1.00 40.77  ? 188 GLU C OE2 1 
ATOM   5179 N  N   . GLY C 1 190 ? 4.660   15.634  -23.629 1.00 42.01  ? 189 GLY C N   1 
ATOM   5180 C  CA  . GLY C 1 190 ? 3.906   14.590  -22.963 1.00 41.99  ? 189 GLY C CA  1 
ATOM   5181 C  C   . GLY C 1 190 ? 4.739   13.373  -22.627 1.00 42.33  ? 189 GLY C C   1 
ATOM   5182 O  O   . GLY C 1 190 ? 4.278   12.466  -21.931 1.00 43.98  ? 189 GLY C O   1 
ATOM   5183 N  N   . LEU C 1 191 ? 5.950   13.313  -23.165 1.00 42.80  ? 190 LEU C N   1 
ATOM   5184 C  CA  . LEU C 1 191 ? 6.830   12.189  -22.882 1.00 46.18  ? 190 LEU C CA  1 
ATOM   5185 C  C   . LEU C 1 191 ? 7.156   12.224  -21.396 1.00 48.01  ? 190 LEU C C   1 
ATOM   5186 O  O   . LEU C 1 191 ? 7.433   13.291  -20.838 1.00 45.30  ? 190 LEU C O   1 
ATOM   5187 C  CB  . LEU C 1 191 ? 8.091   12.288  -23.731 1.00 44.45  ? 190 LEU C CB  1 
ATOM   5188 C  CG  . LEU C 1 191 ? 7.797   12.199  -25.232 1.00 43.93  ? 190 LEU C CG  1 
ATOM   5189 C  CD1 . LEU C 1 191 ? 9.058   12.455  -26.040 1.00 38.81  ? 190 LEU C CD1 1 
ATOM   5190 C  CD2 . LEU C 1 191 ? 7.201   10.832  -25.557 1.00 40.42  ? 190 LEU C CD2 1 
ATOM   5191 N  N   . GLU C 1 192 ? 7.128   11.055  -20.763 1.00 50.46  ? 191 GLU C N   1 
ATOM   5192 C  CA  . GLU C 1 192 ? 7.364   10.945  -19.325 1.00 52.69  ? 191 GLU C CA  1 
ATOM   5193 C  C   . GLU C 1 192 ? 8.526   11.774  -18.790 1.00 52.63  ? 191 GLU C C   1 
ATOM   5194 O  O   . GLU C 1 192 ? 8.323   12.730  -18.036 1.00 49.15  ? 191 GLU C O   1 
ATOM   5195 C  CB  . GLU C 1 192 ? 7.533   9.479   -18.903 1.00 51.15  ? 191 GLU C CB  1 
ATOM   5196 C  CG  . GLU C 1 192 ? 6.888   9.324   -17.545 1.00 53.79  ? 191 GLU C CG  1 
ATOM   5197 C  CD  . GLU C 1 192 ? 7.421   8.132   -16.764 1.00 55.78  ? 191 GLU C CD  1 
ATOM   5198 O  OE1 . GLU C 1 192 ? 7.807   8.314   -15.589 1.00 55.10  ? 191 GLU C OE1 1 
ATOM   5199 O  OE2 . GLU C 1 192 ? 7.452   7.011   -17.307 1.00 57.79  ? 191 GLU C OE2 1 
ATOM   5200 N  N   . LYS C 1 193 ? 9.742   11.402  -19.176 1.00 54.28  ? 192 LYS C N   1 
ATOM   5201 C  CA  . LYS C 1 193 ? 10.937  12.100  -18.709 1.00 53.87  ? 192 LYS C CA  1 
ATOM   5202 C  C   . LYS C 1 193 ? 11.019  13.559  -19.120 1.00 53.05  ? 192 LYS C C   1 
ATOM   5203 O  O   . LYS C 1 193 ? 11.693  14.350  -18.461 1.00 55.47  ? 192 LYS C O   1 
ATOM   5204 C  CB  . LYS C 1 193 ? 12.195  11.342  -19.121 1.00 54.43  ? 192 LYS C CB  1 
ATOM   5205 C  CG  . LYS C 1 193 ? 12.230  9.944   -18.541 1.00 62.94  ? 192 LYS C CG  1 
ATOM   5206 C  CD  . LYS C 1 193 ? 13.478  9.182   -18.931 1.00 70.86  ? 192 LYS C CD  1 
ATOM   5207 C  CE  . LYS C 1 193 ? 13.346  7.714   -18.552 1.00 74.41  ? 192 LYS C CE  1 
ATOM   5208 N  NZ  . LYS C 1 193 ? 12.206  7.066   -19.273 1.00 72.59  ? 192 LYS C NZ  1 
ATOM   5209 N  N   . ILE C 1 194 ? 10.372  13.911  -20.224 1.00 50.95  ? 193 ILE C N   1 
ATOM   5210 C  CA  . ILE C 1 194 ? 10.377  15.293  -20.677 1.00 49.26  ? 193 ILE C CA  1 
ATOM   5211 C  C   . ILE C 1 194 ? 9.463   16.102  -19.778 1.00 49.12  ? 193 ILE C C   1 
ATOM   5212 O  O   . ILE C 1 194 ? 9.773   17.242  -19.431 1.00 42.83  ? 193 ILE C O   1 
ATOM   5213 C  CB  . ILE C 1 194 ? 9.885   15.426  -22.132 1.00 52.20  ? 193 ILE C CB  1 
ATOM   5214 C  CG1 . ILE C 1 194 ? 10.892  14.787  -23.088 1.00 52.26  ? 193 ILE C CG1 1 
ATOM   5215 C  CG2 . ILE C 1 194 ? 9.669   16.896  -22.495 1.00 51.73  ? 193 ILE C CG2 1 
ATOM   5216 C  CD1 . ILE C 1 194 ? 12.232  15.482  -23.103 1.00 53.08  ? 193 ILE C CD1 1 
ATOM   5217 N  N   . SER C 1 195 ? 8.321   15.521  -19.432 1.00 50.90  ? 194 SER C N   1 
ATOM   5218 C  CA  . SER C 1 195 ? 7.363   16.197  -18.572 1.00 50.74  ? 194 SER C CA  1 
ATOM   5219 C  C   . SER C 1 195 ? 8.013   16.377  -17.205 1.00 49.78  ? 194 SER C C   1 
ATOM   5220 O  O   . SER C 1 195 ? 8.102   17.499  -16.691 1.00 47.65  ? 194 SER C O   1 
ATOM   5221 C  CB  . SER C 1 195 ? 6.076   15.369  -18.455 1.00 53.58  ? 194 SER C CB  1 
ATOM   5222 O  OG  . SER C 1 195 ? 5.028   16.094  -17.820 1.00 55.65  ? 194 SER C OG  1 
ATOM   5223 N  N   . ALA C 1 196 ? 8.505   15.272  -16.646 1.00 48.08  ? 195 ALA C N   1 
ATOM   5224 C  CA  . ALA C 1 196 ? 9.156   15.284  -15.337 1.00 45.77  ? 195 ALA C CA  1 
ATOM   5225 C  C   . ALA C 1 196 ? 10.201  16.382  -15.250 1.00 45.90  ? 195 ALA C C   1 
ATOM   5226 O  O   . ALA C 1 196 ? 10.174  17.205  -14.338 1.00 44.48  ? 195 ALA C O   1 
ATOM   5227 C  CB  . ALA C 1 196 ? 9.798   13.936  -15.056 1.00 42.28  ? 195 ALA C CB  1 
ATOM   5228 N  N   . TYR C 1 197 ? 11.124  16.374  -16.203 1.00 48.81  ? 196 TYR C N   1 
ATOM   5229 C  CA  . TYR C 1 197 ? 12.193  17.356  -16.263 1.00 48.68  ? 196 TYR C CA  1 
ATOM   5230 C  C   . TYR C 1 197 ? 11.690  18.795  -16.394 1.00 49.83  ? 196 TYR C C   1 
ATOM   5231 O  O   . TYR C 1 197 ? 12.331  19.730  -15.920 1.00 47.58  ? 196 TYR C O   1 
ATOM   5232 C  CB  . TYR C 1 197 ? 13.125  17.023  -17.422 1.00 47.59  ? 196 TYR C CB  1 
ATOM   5233 C  CG  . TYR C 1 197 ? 14.119  18.118  -17.733 1.00 50.71  ? 196 TYR C CG  1 
ATOM   5234 C  CD1 . TYR C 1 197 ? 15.207  18.361  -16.894 1.00 51.81  ? 196 TYR C CD1 1 
ATOM   5235 C  CD2 . TYR C 1 197 ? 13.965  18.917  -18.865 1.00 50.83  ? 196 TYR C CD2 1 
ATOM   5236 C  CE1 . TYR C 1 197 ? 16.118  19.375  -17.176 1.00 49.70  ? 196 TYR C CE1 1 
ATOM   5237 C  CE2 . TYR C 1 197 ? 14.865  19.929  -19.156 1.00 47.02  ? 196 TYR C CE2 1 
ATOM   5238 C  CZ  . TYR C 1 197 ? 15.938  20.156  -18.309 1.00 46.42  ? 196 TYR C CZ  1 
ATOM   5239 O  OH  . TYR C 1 197 ? 16.808  21.179  -18.605 1.00 38.35  ? 196 TYR C OH  1 
ATOM   5240 N  N   . MET C 1 198 ? 10.593  18.984  -17.113 1.00 54.18  ? 197 MET C N   1 
ATOM   5241 C  CA  . MET C 1 198 ? 10.048  20.325  -17.276 1.00 57.19  ? 197 MET C CA  1 
ATOM   5242 C  C   . MET C 1 198 ? 9.528   20.856  -15.946 1.00 60.48  ? 197 MET C C   1 
ATOM   5243 O  O   . MET C 1 198 ? 9.436   22.072  -15.738 1.00 59.06  ? 197 MET C O   1 
ATOM   5244 C  CB  . MET C 1 198 ? 8.941   20.331  -18.329 1.00 55.00  ? 197 MET C CB  1 
ATOM   5245 C  CG  . MET C 1 198 ? 9.457   20.173  -19.751 1.00 49.70  ? 197 MET C CG  1 
ATOM   5246 S  SD  . MET C 1 198 ? 8.187   20.351  -21.013 1.00 48.34  ? 197 MET C SD  1 
ATOM   5247 C  CE  . MET C 1 198 ? 8.169   22.133  -21.260 1.00 40.25  ? 197 MET C CE  1 
ATOM   5248 N  N   . LYS C 1 199 ? 9.186   19.933  -15.054 1.00 63.89  ? 198 LYS C N   1 
ATOM   5249 C  CA  . LYS C 1 199 ? 8.672   20.282  -13.737 1.00 66.79  ? 198 LYS C CA  1 
ATOM   5250 C  C   . LYS C 1 199 ? 9.761   20.315  -12.662 1.00 67.03  ? 198 LYS C C   1 
ATOM   5251 O  O   . LYS C 1 199 ? 9.515   20.762  -11.538 1.00 66.36  ? 198 LYS C O   1 
ATOM   5252 C  CB  . LYS C 1 199 ? 7.534   19.325  -13.340 1.00 68.53  ? 198 LYS C CB  1 
ATOM   5253 C  CG  . LYS C 1 199 ? 6.270   19.490  -14.188 1.00 71.83  ? 198 LYS C CG  1 
ATOM   5254 C  CD  . LYS C 1 199 ? 5.213   18.431  -13.888 1.00 71.61  ? 198 LYS C CD  1 
ATOM   5255 C  CE  . LYS C 1 199 ? 5.646   17.049  -14.355 1.00 73.69  ? 198 LYS C CE  1 
ATOM   5256 N  NZ  . LYS C 1 199 ? 4.555   16.039  -14.214 1.00 75.90  ? 198 LYS C NZ  1 
ATOM   5257 N  N   . SER C 1 200 ? 10.957  19.840  -12.996 1.00 68.72  ? 199 SER C N   1 
ATOM   5258 C  CA  . SER C 1 200 ? 12.052  19.838  -12.033 1.00 70.75  ? 199 SER C CA  1 
ATOM   5259 C  C   . SER C 1 200 ? 12.727  21.207  -11.902 1.00 70.42  ? 199 SER C C   1 
ATOM   5260 O  O   . SER C 1 200 ? 12.339  22.174  -12.569 1.00 69.39  ? 199 SER C O   1 
ATOM   5261 C  CB  . SER C 1 200 ? 13.084  18.745  -12.362 1.00 73.28  ? 199 SER C CB  1 
ATOM   5262 O  OG  . SER C 1 200 ? 13.767  18.974  -13.585 1.00 76.45  ? 199 SER C OG  1 
ATOM   5263 N  N   . SER C 1 201 ? 13.677  21.296  -10.973 1.00 70.91  ? 200 SER C N   1 
ATOM   5264 C  CA  . SER C 1 201 ? 14.419  22.531  -10.721 1.00 68.78  ? 200 SER C CA  1 
ATOM   5265 C  C   . SER C 1 201 ? 15.483  22.783  -11.792 1.00 66.30  ? 200 SER C C   1 
ATOM   5266 O  O   . SER C 1 201 ? 15.959  23.912  -11.956 1.00 63.49  ? 200 SER C O   1 
ATOM   5267 C  CB  . SER C 1 201 ? 15.070  22.477  -9.328  1.00 73.22  ? 200 SER C CB  1 
ATOM   5268 O  OG  . SER C 1 201 ? 15.860  21.305  -9.147  1.00 71.14  ? 200 SER C OG  1 
ATOM   5269 N  N   . ARG C 1 202 ? 15.850  21.720  -12.506 1.00 63.88  ? 201 ARG C N   1 
ATOM   5270 C  CA  . ARG C 1 202 ? 16.861  21.775  -13.557 1.00 62.64  ? 201 ARG C CA  1 
ATOM   5271 C  C   . ARG C 1 202 ? 16.423  22.516  -14.820 1.00 63.30  ? 201 ARG C C   1 
ATOM   5272 O  O   . ARG C 1 202 ? 17.250  23.138  -15.488 1.00 62.25  ? 201 ARG C O   1 
ATOM   5273 C  CB  . ARG C 1 202 ? 17.300  20.358  -13.929 1.00 60.71  ? 201 ARG C CB  1 
ATOM   5274 C  CG  . ARG C 1 202 ? 17.811  19.529  -12.763 1.00 63.99  ? 201 ARG C CG  1 
ATOM   5275 C  CD  . ARG C 1 202 ? 18.364  18.189  -13.231 1.00 60.12  ? 201 ARG C CD  1 
ATOM   5276 N  NE  . ARG C 1 202 ? 17.349  17.379  -13.895 1.00 60.32  ? 201 ARG C NE  1 
ATOM   5277 C  CZ  . ARG C 1 202 ? 16.338  16.783  -13.271 1.00 62.49  ? 201 ARG C CZ  1 
ATOM   5278 N  NH1 . ARG C 1 202 ? 16.199  16.899  -11.957 1.00 66.09  ? 201 ARG C NH1 1 
ATOM   5279 N  NH2 . ARG C 1 202 ? 15.464  16.067  -13.963 1.00 62.72  ? 201 ARG C NH2 1 
ATOM   5280 N  N   . PHE C 1 203 ? 15.130  22.452  -15.134 1.00 63.93  ? 202 PHE C N   1 
ATOM   5281 C  CA  . PHE C 1 203 ? 14.554  23.086  -16.324 1.00 63.72  ? 202 PHE C CA  1 
ATOM   5282 C  C   . PHE C 1 203 ? 14.888  24.571  -16.488 1.00 62.85  ? 202 PHE C C   1 
ATOM   5283 O  O   . PHE C 1 203 ? 14.443  25.407  -15.699 1.00 62.57  ? 202 PHE C O   1 
ATOM   5284 C  CB  . PHE C 1 203 ? 13.038  22.893  -16.325 1.00 64.58  ? 202 PHE C CB  1 
ATOM   5285 C  CG  . PHE C 1 203 ? 12.369  23.393  -17.565 1.00 66.98  ? 202 PHE C CG  1 
ATOM   5286 C  CD1 . PHE C 1 203 ? 12.839  23.020  -18.819 1.00 69.19  ? 202 PHE C CD1 1 
ATOM   5287 C  CD2 . PHE C 1 203 ? 11.269  24.236  -17.486 1.00 69.80  ? 202 PHE C CD2 1 
ATOM   5288 C  CE1 . PHE C 1 203 ? 12.226  23.477  -19.976 1.00 67.69  ? 202 PHE C CE1 1 
ATOM   5289 C  CE2 . PHE C 1 203 ? 10.646  24.698  -18.638 1.00 68.00  ? 202 PHE C CE2 1 
ATOM   5290 C  CZ  . PHE C 1 203 ? 11.128  24.317  -19.887 1.00 66.80  ? 202 PHE C CZ  1 
ATOM   5291 N  N   . LEU C 1 204 ? 15.592  24.904  -17.569 1.00 61.36  ? 203 LEU C N   1 
ATOM   5292 C  CA  . LEU C 1 204 ? 16.009  26.285  -17.842 1.00 58.45  ? 203 LEU C CA  1 
ATOM   5293 C  C   . LEU C 1 204 ? 15.537  26.773  -19.216 1.00 60.18  ? 203 LEU C C   1 
ATOM   5294 O  O   . LEU C 1 204 ? 16.312  26.844  -20.164 1.00 59.65  ? 203 LEU C O   1 
ATOM   5295 C  CB  . LEU C 1 204 ? 17.540  26.390  -17.740 1.00 56.44  ? 203 LEU C CB  1 
ATOM   5296 C  CG  . LEU C 1 204 ? 18.301  27.701  -18.002 1.00 46.80  ? 203 LEU C CG  1 
ATOM   5297 C  CD1 . LEU C 1 204 ? 17.906  28.764  -17.004 1.00 50.04  ? 203 LEU C CD1 1 
ATOM   5298 C  CD2 . LEU C 1 204 ? 19.799  27.439  -17.909 1.00 44.44  ? 203 LEU C CD2 1 
ATOM   5299 N  N   . PRO C 1 205 ? 14.253  27.152  -19.325 1.00 62.41  ? 204 PRO C N   1 
ATOM   5300 C  CA  . PRO C 1 205 ? 13.691  27.632  -20.590 1.00 63.51  ? 204 PRO C CA  1 
ATOM   5301 C  C   . PRO C 1 205 ? 14.143  29.031  -20.991 1.00 62.86  ? 204 PRO C C   1 
ATOM   5302 O  O   . PRO C 1 205 ? 14.038  29.405  -22.160 1.00 63.23  ? 204 PRO C O   1 
ATOM   5303 C  CB  . PRO C 1 205 ? 12.188  27.599  -20.321 1.00 64.71  ? 204 PRO C CB  1 
ATOM   5304 C  CG  . PRO C 1 205 ? 12.119  27.999  -18.876 1.00 66.62  ? 204 PRO C CG  1 
ATOM   5305 C  CD  . PRO C 1 205 ? 13.227  27.154  -18.263 1.00 64.80  ? 204 PRO C CD  1 
ATOM   5306 N  N   . ARG C 1 206 ? 14.585  29.818  -20.013 1.00 63.10  ? 205 ARG C N   1 
ATOM   5307 C  CA  . ARG C 1 206 ? 15.039  31.194  -20.252 1.00 64.74  ? 205 ARG C CA  1 
ATOM   5308 C  C   . ARG C 1 206 ? 16.235  31.527  -19.356 1.00 61.90  ? 205 ARG C C   1 
ATOM   5309 O  O   . ARG C 1 206 ? 16.407  30.911  -18.304 1.00 62.01  ? 205 ARG C O   1 
ATOM   5310 C  CB  . ARG C 1 206 ? 13.896  32.185  -19.984 1.00 69.59  ? 205 ARG C CB  1 
ATOM   5311 C  CG  . ARG C 1 206 ? 12.711  32.018  -20.919 1.00 79.58  ? 205 ARG C CG  1 
ATOM   5312 C  CD  . ARG C 1 206 ? 11.439  32.620  -20.360 1.00 86.62  ? 205 ARG C CD  1 
ATOM   5313 N  NE  . ARG C 1 206 ? 10.279  31.846  -20.796 1.00 94.35  ? 205 ARG C NE  1 
ATOM   5314 C  CZ  . ARG C 1 206 ? 9.282   32.330  -21.526 1.00 97.40  ? 205 ARG C CZ  1 
ATOM   5315 N  NH1 . ARG C 1 206 ? 9.288   33.601  -21.912 1.00 98.36  ? 205 ARG C NH1 1 
ATOM   5316 N  NH2 . ARG C 1 206 ? 8.285   31.532  -21.887 1.00 100.00 ? 205 ARG C NH2 1 
ATOM   5317 N  N   . PRO C 1 207 ? 17.060  32.513  -19.748 1.00 60.74  ? 206 PRO C N   1 
ATOM   5318 C  CA  . PRO C 1 207 ? 16.999  33.352  -20.956 1.00 60.77  ? 206 PRO C CA  1 
ATOM   5319 C  C   . PRO C 1 207 ? 17.176  32.549  -22.237 1.00 61.07  ? 206 PRO C C   1 
ATOM   5320 O  O   . PRO C 1 207 ? 17.938  31.578  -22.278 1.00 58.46  ? 206 PRO C O   1 
ATOM   5321 C  CB  . PRO C 1 207 ? 18.164  34.319  -20.768 1.00 60.86  ? 206 PRO C CB  1 
ATOM   5322 C  CG  . PRO C 1 207 ? 18.302  34.401  -19.282 1.00 62.74  ? 206 PRO C CG  1 
ATOM   5323 C  CD  . PRO C 1 207 ? 18.154  32.966  -18.870 1.00 60.92  ? 206 PRO C CD  1 
ATOM   5324 N  N   . VAL C 1 208 ? 16.443  32.946  -23.271 1.00 62.80  ? 207 VAL C N   1 
ATOM   5325 C  CA  . VAL C 1 208 ? 16.511  32.272  -24.560 1.00 63.50  ? 207 VAL C CA  1 
ATOM   5326 C  C   . VAL C 1 208 ? 17.894  32.481  -25.162 1.00 63.84  ? 207 VAL C C   1 
ATOM   5327 O  O   . VAL C 1 208 ? 18.525  31.545  -25.657 1.00 60.89  ? 207 VAL C O   1 
ATOM   5328 C  CB  . VAL C 1 208 ? 15.440  32.828  -25.530 1.00 63.40  ? 207 VAL C CB  1 
ATOM   5329 C  CG1 . VAL C 1 208 ? 15.590  32.190  -26.902 1.00 63.29  ? 207 VAL C CG1 1 
ATOM   5330 C  CG2 . VAL C 1 208 ? 14.045  32.577  -24.976 1.00 64.61  ? 207 VAL C CG2 1 
ATOM   5331 N  N   . PHE C 1 209 ? 18.350  33.725  -25.118 1.00 66.99  ? 208 PHE C N   1 
ATOM   5332 C  CA  . PHE C 1 209 ? 19.649  34.075  -25.659 1.00 72.82  ? 208 PHE C CA  1 
ATOM   5333 C  C   . PHE C 1 209 ? 20.567  34.650  -24.594 1.00 76.87  ? 208 PHE C C   1 
ATOM   5334 O  O   . PHE C 1 209 ? 20.282  34.558  -23.398 1.00 79.37  ? 208 PHE C O   1 
ATOM   5335 C  CB  . PHE C 1 209 ? 19.478  35.069  -26.808 1.00 74.84  ? 208 PHE C CB  1 
ATOM   5336 C  CG  . PHE C 1 209 ? 18.766  34.495  -28.003 1.00 75.38  ? 208 PHE C CG  1 
ATOM   5337 C  CD1 . PHE C 1 209 ? 19.240  33.339  -28.625 1.00 73.83  ? 208 PHE C CD1 1 
ATOM   5338 C  CD2 . PHE C 1 209 ? 17.620  35.102  -28.507 1.00 74.57  ? 208 PHE C CD2 1 
ATOM   5339 C  CE1 . PHE C 1 209 ? 18.582  32.792  -29.732 1.00 73.67  ? 208 PHE C CE1 1 
ATOM   5340 C  CE2 . PHE C 1 209 ? 16.953  34.563  -29.614 1.00 74.46  ? 208 PHE C CE2 1 
ATOM   5341 C  CZ  . PHE C 1 209 ? 17.437  33.405  -30.228 1.00 72.00  ? 208 PHE C CZ  1 
ATOM   5342 N  N   . SER C 1 210 ? 21.696  35.195  -25.031 1.00 78.91  ? 209 SER C N   1 
ATOM   5343 C  CA  . SER C 1 210 ? 22.662  35.785  -24.115 1.00 81.91  ? 209 SER C CA  1 
ATOM   5344 C  C   . SER C 1 210 ? 22.252  37.215  -23.779 1.00 82.41  ? 209 SER C C   1 
ATOM   5345 O  O   . SER C 1 210 ? 21.235  37.711  -24.269 1.00 79.74  ? 209 SER C O   1 
ATOM   5346 C  CB  . SER C 1 210 ? 24.082  35.752  -24.710 1.00 82.63  ? 209 SER C CB  1 
ATOM   5347 O  OG  . SER C 1 210 ? 24.386  36.903  -25.487 1.00 86.67  ? 209 SER C OG  1 
ATOM   5348 N  N   . LYS C 1 211 ? 23.033  37.854  -22.910 1.00 86.29  ? 210 LYS C N   1 
ATOM   5349 C  CA  . LYS C 1 211 ? 22.775  39.229  -22.490 1.00 88.33  ? 210 LYS C CA  1 
ATOM   5350 C  C   . LYS C 1 211 ? 22.948  40.233  -23.637 1.00 87.41  ? 210 LYS C C   1 
ATOM   5351 O  O   . LYS C 1 211 ? 22.383  41.326  -23.595 1.00 87.70  ? 210 LYS C O   1 
ATOM   5352 C  CB  . LYS C 1 211 ? 23.685  39.599  -21.307 1.00 90.59  ? 210 LYS C CB  1 
ATOM   5353 C  CG  . LYS C 1 211 ? 23.460  38.741  -20.054 1.00 91.91  ? 210 LYS C CG  1 
ATOM   5354 C  CD  . LYS C 1 211 ? 24.358  39.157  -18.894 1.00 93.79  ? 210 LYS C CD  1 
ATOM   5355 C  CE  . LYS C 1 211 ? 24.084  38.313  -17.658 1.00 93.37  ? 210 LYS C CE  1 
ATOM   5356 N  NZ  . LYS C 1 211 ? 24.960  38.707  -16.524 1.00 93.09  ? 210 LYS C NZ  1 
ATOM   5357 N  N   . MET C 1 212 ? 23.727  39.854  -24.652 1.00 86.07  ? 211 MET C N   1 
ATOM   5358 C  CA  . MET C 1 212 ? 23.982  40.713  -25.814 1.00 84.90  ? 211 MET C CA  1 
ATOM   5359 C  C   . MET C 1 212 ? 22.747  40.895  -26.694 1.00 84.92  ? 211 MET C C   1 
ATOM   5360 O  O   . MET C 1 212 ? 22.728  41.758  -27.578 1.00 83.56  ? 211 MET C O   1 
ATOM   5361 C  CB  . MET C 1 212 ? 25.097  40.124  -26.684 1.00 84.89  ? 211 MET C CB  1 
ATOM   5362 C  CG  . MET C 1 212 ? 26.405  39.839  -25.974 1.00 85.71  ? 211 MET C CG  1 
ATOM   5363 S  SD  . MET C 1 212 ? 27.657  39.227  -27.127 1.00 88.10  ? 211 MET C SD  1 
ATOM   5364 C  CE  . MET C 1 212 ? 28.603  40.723  -27.397 1.00 87.96  ? 211 MET C CE  1 
ATOM   5365 N  N   . ALA C 1 213 ? 21.744  40.048  -26.481 1.00 85.53  ? 212 ALA C N   1 
ATOM   5366 C  CA  . ALA C 1 213 ? 20.511  40.083  -27.260 1.00 85.37  ? 212 ALA C CA  1 
ATOM   5367 C  C   . ALA C 1 213 ? 19.574  41.261  -26.983 1.00 85.77  ? 212 ALA C C   1 
ATOM   5368 O  O   . ALA C 1 213 ? 19.576  41.844  -25.894 1.00 86.59  ? 212 ALA C O   1 
ATOM   5369 C  CB  . ALA C 1 213 ? 19.762  38.763  -27.104 1.00 83.78  ? 212 ALA C CB  1 
ATOM   5370 N  N   . VAL C 1 214 ? 18.793  41.617  -28.001 1.00 85.15  ? 213 VAL C N   1 
ATOM   5371 C  CA  . VAL C 1 214 ? 17.819  42.699  -27.899 1.00 84.83  ? 213 VAL C CA  1 
ATOM   5372 C  C   . VAL C 1 214 ? 16.490  42.085  -27.449 1.00 84.22  ? 213 VAL C C   1 
ATOM   5373 O  O   . VAL C 1 214 ? 15.657  42.760  -26.837 1.00 85.00  ? 213 VAL C O   1 
ATOM   5374 C  CB  . VAL C 1 214 ? 17.631  43.428  -29.251 1.00 85.26  ? 213 VAL C CB  1 
ATOM   5375 C  CG1 . VAL C 1 214 ? 16.708  44.626  -29.085 1.00 85.94  ? 213 VAL C CG1 1 
ATOM   5376 C  CG2 . VAL C 1 214 ? 18.978  43.873  -29.795 1.00 83.99  ? 213 VAL C CG2 1 
ATOM   5377 N  N   . TRP C 1 215 ? 16.299  40.806  -27.776 1.00 82.01  ? 214 TRP C N   1 
ATOM   5378 C  CA  . TRP C 1 215 ? 15.096  40.068  -27.398 1.00 79.97  ? 214 TRP C CA  1 
ATOM   5379 C  C   . TRP C 1 215 ? 15.455  38.730  -26.734 1.00 81.85  ? 214 TRP C C   1 
ATOM   5380 O  O   . TRP C 1 215 ? 16.379  38.039  -27.172 1.00 82.23  ? 214 TRP C O   1 
ATOM   5381 C  CB  . TRP C 1 215 ? 14.205  39.819  -28.617 1.00 72.99  ? 214 TRP C CB  1 
ATOM   5382 C  CG  . TRP C 1 215 ? 12.890  39.191  -28.257 1.00 65.82  ? 214 TRP C CG  1 
ATOM   5383 C  CD1 . TRP C 1 215 ? 11.717  39.839  -27.996 1.00 63.96  ? 214 TRP C CD1 1 
ATOM   5384 C  CD2 . TRP C 1 215 ? 12.625  37.792  -28.071 1.00 62.16  ? 214 TRP C CD2 1 
ATOM   5385 N  NE1 . TRP C 1 215 ? 10.740  38.935  -27.654 1.00 62.98  ? 214 TRP C NE1 1 
ATOM   5386 C  CE2 . TRP C 1 215 ? 11.270  37.671  -27.692 1.00 61.28  ? 214 TRP C CE2 1 
ATOM   5387 C  CE3 . TRP C 1 215 ? 13.403  36.630  -28.187 1.00 61.55  ? 214 TRP C CE3 1 
ATOM   5388 C  CZ2 . TRP C 1 215 ? 10.673  36.433  -27.423 1.00 57.59  ? 214 TRP C CZ2 1 
ATOM   5389 C  CZ3 . TRP C 1 215 ? 12.810  35.399  -27.920 1.00 61.30  ? 214 TRP C CZ3 1 
ATOM   5390 C  CH2 . TRP C 1 215 ? 11.457  35.312  -27.543 1.00 59.31  ? 214 TRP C CH2 1 
ATOM   5391 N  N   . GLY C 1 216 ? 14.692  38.355  -25.707 1.00 83.66  ? 215 GLY C N   1 
ATOM   5392 C  CA  . GLY C 1 216 ? 14.926  37.105  -24.998 1.00 84.61  ? 215 GLY C CA  1 
ATOM   5393 C  C   . GLY C 1 216 ? 16.270  37.074  -24.300 1.00 85.91  ? 215 GLY C C   1 
ATOM   5394 O  O   . GLY C 1 216 ? 16.826  36.006  -24.032 1.00 84.96  ? 215 GLY C O   1 
ATOM   5395 N  N   . ASN C 1 217 ? 16.792  38.266  -24.034 1.00 88.70  ? 216 ASN C N   1 
ATOM   5396 C  CA  . ASN C 1 217 ? 18.074  38.430  -23.367 1.00 91.04  ? 216 ASN C CA  1 
ATOM   5397 C  C   . ASN C 1 217 ? 17.950  38.127  -21.882 1.00 91.47  ? 216 ASN C C   1 
ATOM   5398 O  O   . ASN C 1 217 ? 18.950  37.869  -21.213 1.00 91.44  ? 216 ASN C O   1 
ATOM   5399 C  CB  . ASN C 1 217 ? 18.588  39.860  -23.552 1.00 92.94  ? 216 ASN C CB  1 
ATOM   5400 C  CG  . ASN C 1 217 ? 17.751  40.887  -22.807 1.00 96.65  ? 216 ASN C CG  1 
ATOM   5401 O  OD1 . ASN C 1 217 ? 18.235  41.531  -21.878 1.00 100.00 ? 216 ASN C OD1 1 
ATOM   5402 N  ND2 . ASN C 1 217 ? 16.491  41.043  -23.207 1.00 95.69  ? 216 ASN C ND2 1 
ATOM   5403 N  N   . LYS C 1 218 ? 16.721  38.168  -21.374 1.00 92.35  ? 217 LYS C N   1 
ATOM   5404 C  CA  . LYS C 1 218 ? 16.459  37.911  -19.965 1.00 93.89  ? 217 LYS C CA  1 
ATOM   5405 C  C   . LYS C 1 218 ? 15.341  36.880  -19.797 1.00 94.65  ? 217 LYS C C   1 
ATOM   5406 O  O   . LYS C 1 218 ? 14.374  36.909  -20.591 1.00 95.84  ? 217 LYS C O   1 
ATOM   5407 C  CB  . LYS C 1 218 ? 16.077  39.219  -19.261 1.00 96.25  ? 217 LYS C CB  1 
ATOM   5408 C  CG  . LYS C 1 218 ? 17.161  39.632  -18.291 1.00 97.94  ? 217 LYS C CG  1 
ATOM   5409 C  CD  . LYS C 1 218 ? 17.779  40.968  -18.723 1.00 100.00 ? 217 LYS C CD  1 
ATOM   5410 C  CE  . LYS C 1 218 ? 16.784  42.124  -18.671 1.00 100.00 ? 217 LYS C CE  1 
ATOM   5411 N  NZ  . LYS C 1 218 ? 15.586  41.893  -19.539 1.00 100.00 ? 217 LYS C NZ  1 
ATOM   5412 O  OXT . LYS C 1 218 ? 15.443  36.050  -18.869 1.00 95.24  ? 217 LYS C OXT 1 
HETATM 5413 ZN ZN  . ZN  D 2 .   ? 33.073  3.922   13.052  1.00 26.75  ? 219 ZN  A ZN  1 
HETATM 5414 N  N1  . GSH E 3 .   ? 24.030  4.547   12.468  1.00 38.35  ? 218 GSH A N1  1 
HETATM 5415 C  CA1 . GSH E 3 .   ? 24.917  5.665   12.222  1.00 35.97  ? 218 GSH A CA1 1 
HETATM 5416 C  C1  . GSH E 3 .   ? 25.223  5.626   10.710  1.00 38.12  ? 218 GSH A C1  1 
HETATM 5417 O  O11 . GSH E 3 .   ? 25.120  4.604   10.044  1.00 41.53  ? 218 GSH A O11 1 
HETATM 5418 O  O12 . GSH E 3 .   ? 25.554  6.788   10.346  1.00 39.60  ? 218 GSH A O12 1 
HETATM 5419 C  CB1 . GSH E 3 .   ? 26.151  5.515   13.104  1.00 35.75  ? 218 GSH A CB1 1 
HETATM 5420 C  CG1 . GSH E 3 .   ? 27.112  6.671   12.780  1.00 32.10  ? 218 GSH A CG1 1 
HETATM 5421 C  CD1 . GSH E 3 .   ? 28.278  6.747   13.736  1.00 35.76  ? 218 GSH A CD1 1 
HETATM 5422 O  OE1 . GSH E 3 .   ? 28.236  6.393   14.924  1.00 37.90  ? 218 GSH A OE1 1 
HETATM 5423 N  N2  . GSH E 3 .   ? 29.357  7.262   13.130  1.00 34.05  ? 218 GSH A N2  1 
HETATM 5424 C  CA2 . GSH E 3 .   ? 30.621  7.451   13.809  1.00 36.22  ? 218 GSH A CA2 1 
HETATM 5425 C  C2  . GSH E 3 .   ? 31.101  8.877   14.044  1.00 33.21  ? 218 GSH A C2  1 
HETATM 5426 O  O2  . GSH E 3 .   ? 32.307  9.146   14.230  1.00 33.41  ? 218 GSH A O2  1 
HETATM 5427 C  CB2 . GSH E 3 .   ? 31.629  6.948   12.786  1.00 33.82  ? 218 GSH A CB2 1 
HETATM 5428 S  SG2 . GSH E 3 .   ? 31.419  5.202   12.363  1.00 40.22  ? 218 GSH A SG2 1 
HETATM 5429 N  N3  . GSH E 3 .   ? 30.194  9.851   14.127  1.00 29.20  ? 218 GSH A N3  1 
HETATM 5430 C  CA3 . GSH E 3 .   ? 30.544  11.225  14.429  1.00 29.29  ? 218 GSH A CA3 1 
HETATM 5431 C  C3  . GSH E 3 .   ? 30.162  11.739  15.814  1.00 36.13  ? 218 GSH A C3  1 
HETATM 5432 O  O31 . GSH E 3 .   ? 30.110  12.994  15.936  1.00 38.92  ? 218 GSH A O31 1 
HETATM 5433 O  O32 . GSH E 3 .   ? 29.844  10.857  16.680  1.00 43.73  ? 218 GSH A O32 1 
HETATM 5434 ZN ZN  . ZN  F 2 .   ? 18.155  -6.423  23.161  1.00 42.76  ? 219 ZN  B ZN  1 
HETATM 5435 N  N1  . GSH G 3 .   ? 19.447  -5.133  14.733  1.00 48.49  ? 218 GSH B N1  1 
HETATM 5436 C  CA1 . GSH G 3 .   ? 18.631  -6.235  15.235  1.00 44.21  ? 218 GSH B CA1 1 
HETATM 5437 C  C1  . GSH G 3 .   ? 17.099  -6.016  15.120  1.00 43.47  ? 218 GSH B C1  1 
HETATM 5438 O  O11 . GSH G 3 .   ? 16.582  -4.910  15.186  1.00 38.60  ? 218 GSH B O11 1 
HETATM 5439 O  O12 . GSH G 3 .   ? 16.554  -7.129  14.914  1.00 43.65  ? 218 GSH B O12 1 
HETATM 5440 C  CB1 . GSH G 3 .   ? 19.060  -6.550  16.688  1.00 45.53  ? 218 GSH B CB1 1 
HETATM 5441 C  CG1 . GSH G 3 .   ? 18.751  -7.985  16.918  1.00 45.01  ? 218 GSH B CG1 1 
HETATM 5442 C  CD1 . GSH G 3 .   ? 19.249  -8.483  18.275  1.00 44.91  ? 218 GSH B CD1 1 
HETATM 5443 O  OE1 . GSH G 3 .   ? 20.500  -8.505  18.573  1.00 46.82  ? 218 GSH B OE1 1 
HETATM 5444 N  N2  . GSH G 3 .   ? 18.257  -8.855  19.090  1.00 43.98  ? 218 GSH B N2  1 
HETATM 5445 C  CA2 . GSH G 3 .   ? 18.412  -9.459  20.429  1.00 47.61  ? 218 GSH B CA2 1 
HETATM 5446 C  C2  . GSH G 3 .   ? 18.427  -10.947 20.417  1.00 47.08  ? 218 GSH B C2  1 
HETATM 5447 O  O2  . GSH G 3 .   ? 18.120  -11.464 21.470  1.00 47.56  ? 218 GSH B O2  1 
HETATM 5448 C  CB2 . GSH G 3 .   ? 17.430  -8.811  21.456  1.00 47.51  ? 218 GSH B CB2 1 
HETATM 5449 S  SG2 . GSH G 3 .   ? 17.561  -7.047  21.405  1.00 65.20  ? 218 GSH B SG2 1 
HETATM 5450 N  N3  . GSH G 3 .   ? 18.819  -11.574 19.301  1.00 46.06  ? 218 GSH B N3  1 
HETATM 5451 C  CA3 . GSH G 3 .   ? 18.868  -13.059 19.230  1.00 51.20  ? 218 GSH B CA3 1 
HETATM 5452 C  C3  . GSH G 3 .   ? 20.227  -13.698 18.882  1.00 58.64  ? 218 GSH B C3  1 
HETATM 5453 O  O31 . GSH G 3 .   ? 20.382  -14.910 19.205  1.00 57.26  ? 218 GSH B O31 1 
HETATM 5454 O  O32 . GSH G 3 .   ? 21.029  -12.978 18.175  1.00 62.56  ? 218 GSH B O32 1 
HETATM 5455 ZN ZN  . ZN  H 2 .   ? 24.681  31.624  -29.689 1.00 34.18  ? 219 ZN  C ZN  1 
HETATM 5456 N  N1  . GSH I 3 .   ? 27.516  25.697  -34.881 1.00 47.32  ? 218 GSH C N1  1 
HETATM 5457 C  CA1 . GSH I 3 .   ? 28.090  25.861  -33.535 1.00 48.78  ? 218 GSH C CA1 1 
HETATM 5458 C  C1  . GSH I 3 .   ? 27.518  24.896  -32.437 1.00 47.01  ? 218 GSH C C1  1 
HETATM 5459 O  O11 . GSH I 3 .   ? 26.341  24.611  -32.382 1.00 40.14  ? 218 GSH C O11 1 
HETATM 5460 O  O12 . GSH I 3 .   ? 28.455  24.465  -31.713 1.00 53.99  ? 218 GSH C O12 1 
HETATM 5461 C  CB1 . GSH I 3 .   ? 28.143  27.344  -33.065 1.00 43.46  ? 218 GSH C CB1 1 
HETATM 5462 C  CG1 . GSH I 3 .   ? 28.637  27.566  -31.651 1.00 42.76  ? 218 GSH C CG1 1 
HETATM 5463 C  CD1 . GSH I 3 .   ? 28.516  28.986  -31.195 1.00 46.06  ? 218 GSH C CD1 1 
HETATM 5464 O  OE1 . GSH I 3 .   ? 28.672  29.989  -31.959 1.00 46.54  ? 218 GSH C OE1 1 
HETATM 5465 N  N2  . GSH I 3 .   ? 28.274  29.063  -29.877 1.00 47.79  ? 218 GSH C N2  1 
HETATM 5466 C  CA2 . GSH I 3 .   ? 28.074  30.304  -29.151 1.00 50.30  ? 218 GSH C CA2 1 
HETATM 5467 C  C2  . GSH I 3 .   ? 29.309  30.952  -28.527 1.00 50.77  ? 218 GSH C C2  1 
HETATM 5468 O  O2  . GSH I 3 .   ? 29.252  32.116  -28.170 1.00 51.94  ? 218 GSH C O2  1 
HETATM 5469 C  CB2 . GSH I 3 .   ? 26.809  30.317  -28.253 1.00 49.88  ? 218 GSH C CB2 1 
HETATM 5470 S  SG2 . GSH I 3 .   ? 25.455  29.814  -29.325 1.00 52.45  ? 218 GSH C SG2 1 
HETATM 5471 N  N3  . GSH I 3 .   ? 30.471  30.214  -28.452 1.00 46.24  ? 218 GSH C N3  1 
HETATM 5472 C  CA3 . GSH I 3 .   ? 31.663  30.826  -27.862 1.00 46.04  ? 218 GSH C CA3 1 
HETATM 5473 C  C3  . GSH I 3 .   ? 33.013  30.608  -28.556 1.00 48.65  ? 218 GSH C C3  1 
HETATM 5474 O  O31 . GSH I 3 .   ? 34.034  30.600  -27.806 1.00 48.99  ? 218 GSH C O31 1 
HETATM 5475 O  O32 . GSH I 3 .   ? 32.971  30.351  -29.801 1.00 49.86  ? 218 GSH C O32 1 
HETATM 5476 O  O   . HOH J 4 .   ? 35.647  4.145   0.824   1.00 58.62  ? 220 HOH A O   1 
HETATM 5477 O  O   . HOH J 4 .   ? 43.912  2.961   -6.376  1.00 53.52  ? 221 HOH A O   1 
HETATM 5478 O  O   . HOH J 4 .   ? 45.059  -7.203  21.713  1.00 41.51  ? 222 HOH A O   1 
HETATM 5479 O  O   . HOH J 4 .   ? 28.735  -18.276 -10.742 1.00 54.53  ? 223 HOH A O   1 
HETATM 5480 O  O   . HOH J 4 .   ? 34.676  12.848  -6.783  1.00 42.76  ? 224 HOH A O   1 
HETATM 5481 O  O   . HOH J 4 .   ? 25.387  22.408  -6.651  1.00 27.77  ? 225 HOH A O   1 
HETATM 5482 O  O   . HOH J 4 .   ? 20.279  14.933  9.850   1.00 35.09  ? 226 HOH A O   1 
HETATM 5483 O  O   . HOH J 4 .   ? 17.219  18.298  5.669   1.00 39.00  ? 227 HOH A O   1 
HETATM 5484 O  O   . HOH J 4 .   ? 25.569  9.548   10.100  1.00 24.47  ? 228 HOH A O   1 
HETATM 5485 O  O   . HOH J 4 .   ? 14.194  -9.980  -8.616  1.00 49.33  ? 229 HOH A O   1 
HETATM 5486 O  O   . HOH J 4 .   ? 15.452  15.550  6.932   1.00 31.83  ? 230 HOH A O   1 
HETATM 5487 O  O   . HOH J 4 .   ? 27.970  -16.933 14.138  1.00 47.92  ? 231 HOH A O   1 
HETATM 5488 O  O   . HOH J 4 .   ? 36.416  15.260  -3.630  1.00 31.61  ? 232 HOH A O   1 
HETATM 5489 O  O   . HOH J 4 .   ? 22.142  -25.783 2.592   1.00 49.78  ? 233 HOH A O   1 
HETATM 5490 O  O   . HOH J 4 .   ? 45.897  -3.127  11.352  1.00 34.85  ? 234 HOH A O   1 
HETATM 5491 O  O   . HOH J 4 .   ? 31.683  -9.822  18.470  1.00 45.65  ? 235 HOH A O   1 
HETATM 5492 O  O   . HOH J 4 .   ? 31.606  -13.676 16.116  1.00 53.61  ? 236 HOH A O   1 
HETATM 5493 O  O   . HOH J 4 .   ? 46.282  17.401  25.876  1.00 38.92  ? 237 HOH A O   1 
HETATM 5494 O  O   . HOH J 4 .   ? 31.206  22.492  -5.717  1.00 31.25  ? 238 HOH A O   1 
HETATM 5495 O  O   . HOH J 4 .   ? 21.783  -0.474  -12.118 1.00 30.72  ? 239 HOH A O   1 
HETATM 5496 O  O   . HOH J 4 .   ? 22.726  -23.071 9.007   1.00 41.99  ? 240 HOH A O   1 
HETATM 5497 O  O   . HOH J 4 .   ? 16.413  19.391  13.230  1.00 46.53  ? 241 HOH A O   1 
HETATM 5498 O  O   . HOH J 4 .   ? 43.299  6.119   10.623  1.00 40.28  ? 242 HOH A O   1 
HETATM 5499 O  O   . HOH J 4 .   ? 29.787  0.727   4.679   1.00 32.23  ? 243 HOH A O   1 
HETATM 5500 O  O   . HOH J 4 .   ? 24.761  20.605  11.900  1.00 47.29  ? 244 HOH A O   1 
HETATM 5501 O  O   . HOH J 4 .   ? 18.115  21.452  10.295  1.00 52.31  ? 245 HOH A O   1 
HETATM 5502 O  O   . HOH J 4 .   ? 23.447  13.938  16.669  1.00 42.72  ? 246 HOH A O   1 
HETATM 5503 O  O   . HOH J 4 .   ? 24.001  9.534   16.993  1.00 50.11  ? 247 HOH A O   1 
HETATM 5504 O  O   . HOH J 4 .   ? 27.428  2.211   4.816   1.00 35.59  ? 248 HOH A O   1 
HETATM 5505 O  O   . HOH J 4 .   ? 13.996  2.581   -5.857  1.00 43.19  ? 249 HOH A O   1 
HETATM 5506 O  O   . HOH J 4 .   ? 12.904  -14.660 -2.266  1.00 48.82  ? 250 HOH A O   1 
HETATM 5507 O  O   . HOH J 4 .   ? 16.252  -16.958 0.423   1.00 38.54  ? 251 HOH A O   1 
HETATM 5508 O  O   . HOH J 4 .   ? 23.683  -16.595 -11.289 1.00 50.23  ? 252 HOH A O   1 
HETATM 5509 O  O   . HOH J 4 .   ? 25.503  -16.221 -6.834  1.00 57.23  ? 253 HOH A O   1 
HETATM 5510 O  O   . HOH J 4 .   ? 40.970  -13.902 0.314   1.00 61.22  ? 254 HOH A O   1 
HETATM 5511 O  O   . HOH J 4 .   ? 40.815  -7.314  -0.557  1.00 46.51  ? 255 HOH A O   1 
HETATM 5512 O  O   . HOH J 4 .   ? 36.112  -0.196  -15.912 1.00 67.44  ? 256 HOH A O   1 
HETATM 5513 O  O   . HOH J 4 .   ? 32.891  2.386   12.006  1.00 26.90  ? 257 HOH A O   1 
HETATM 5514 O  O   . HOH J 4 .   ? 34.615  5.041   12.710  1.00 20.36  ? 258 HOH A O   1 
HETATM 5515 O  O   . HOH J 4 .   ? 32.812  3.691   14.881  1.00 41.21  ? 259 HOH A O   1 
HETATM 5516 O  O   . HOH K 4 .   ? 6.035   -4.544  24.559  1.00 39.11  ? 220 HOH B O   1 
HETATM 5517 O  O   . HOH K 4 .   ? 11.320  -0.830  23.780  1.00 49.47  ? 221 HOH B O   1 
HETATM 5518 O  O   . HOH K 4 .   ? 21.564  11.723  19.212  1.00 27.76  ? 222 HOH B O   1 
HETATM 5519 O  O   . HOH K 4 .   ? 11.454  -16.126 3.733   1.00 41.98  ? 223 HOH B O   1 
HETATM 5520 O  O   . HOH K 4 .   ? 4.904   -20.459 8.175   1.00 44.15  ? 224 HOH B O   1 
HETATM 5521 O  O   . HOH K 4 .   ? 25.460  7.517   24.588  1.00 23.88  ? 225 HOH B O   1 
HETATM 5522 O  O   . HOH K 4 .   ? 11.955  22.234  9.486   1.00 49.11  ? 226 HOH B O   1 
HETATM 5523 O  O   . HOH K 4 .   ? 4.502   19.248  17.717  1.00 34.82  ? 227 HOH B O   1 
HETATM 5524 O  O   . HOH K 4 .   ? 23.711  -16.119 15.833  1.00 48.66  ? 228 HOH B O   1 
HETATM 5525 O  O   . HOH K 4 .   ? 15.712  -13.562 7.964   1.00 55.09  ? 229 HOH B O   1 
HETATM 5526 O  O   . HOH K 4 .   ? 5.526   4.863   31.236  1.00 56.15  ? 230 HOH B O   1 
HETATM 5527 O  O   . HOH K 4 .   ? 18.361  12.035  38.277  1.00 35.79  ? 231 HOH B O   1 
HETATM 5528 O  O   . HOH K 4 .   ? 16.761  -3.448  12.694  1.00 30.40  ? 232 HOH B O   1 
HETATM 5529 O  O   . HOH K 4 .   ? 18.386  -18.393 3.706   1.00 42.73  ? 233 HOH B O   1 
HETATM 5530 O  O   . HOH K 4 .   ? 21.784  -20.486 36.585  1.00 58.78  ? 234 HOH B O   1 
HETATM 5531 O  O   . HOH K 4 .   ? 25.587  -20.590 29.620  1.00 49.59  ? 235 HOH B O   1 
HETATM 5532 O  O   . HOH K 4 .   ? 19.575  14.984  32.039  1.00 56.00  ? 236 HOH B O   1 
HETATM 5533 O  O   . HOH K 4 .   ? -4.542  -8.952  19.456  1.00 33.72  ? 237 HOH B O   1 
HETATM 5534 O  O   . HOH K 4 .   ? 22.512  -7.241  24.704  1.00 51.61  ? 238 HOH B O   1 
HETATM 5535 O  O   . HOH K 4 .   ? 22.076  1.348   10.739  1.00 30.42  ? 239 HOH B O   1 
HETATM 5536 O  O   . HOH K 4 .   ? 9.631   -23.548 8.408   1.00 49.89  ? 240 HOH B O   1 
HETATM 5537 O  O   . HOH K 4 .   ? 16.046  17.367  29.021  1.00 52.16  ? 241 HOH B O   1 
HETATM 5538 O  O   . HOH K 4 .   ? 12.936  2.585   4.121   1.00 67.57  ? 242 HOH B O   1 
HETATM 5539 O  O   . HOH K 4 .   ? 23.107  -8.418  18.174  1.00 52.24  ? 243 HOH B O   1 
HETATM 5540 O  O   . HOH K 4 .   ? 12.870  -12.882 3.206   1.00 36.78  ? 244 HOH B O   1 
HETATM 5541 O  O   . HOH K 4 .   ? 7.241   23.261  12.355  1.00 48.78  ? 245 HOH B O   1 
HETATM 5542 O  O   . HOH K 4 .   ? 26.606  -3.622  26.768  1.00 50.02  ? 246 HOH B O   1 
HETATM 5543 O  O   . HOH K 4 .   ? 13.119  -1.180  16.661  1.00 52.22  ? 247 HOH B O   1 
HETATM 5544 O  O   . HOH K 4 .   ? 13.306  2.354   19.098  1.00 61.12  ? 248 HOH B O   1 
HETATM 5545 O  O   . HOH K 4 .   ? 11.006  -1.251  19.889  1.00 58.12  ? 249 HOH B O   1 
HETATM 5546 O  O   . HOH K 4 .   ? 1.798   -18.174 10.292  1.00 48.64  ? 250 HOH B O   1 
HETATM 5547 O  O   . HOH K 4 .   ? 17.616  -4.558  23.543  1.00 40.41  ? 251 HOH B O   1 
HETATM 5548 O  O   . HOH K 4 .   ? 17.448  -7.245  24.757  1.00 31.28  ? 252 HOH B O   1 
HETATM 5549 O  O   . HOH K 4 .   ? 19.982  -6.540  23.126  1.00 50.70  ? 253 HOH B O   1 
HETATM 5550 O  O   . HOH L 4 .   ? 17.813  24.856  -21.436 1.00 20.91  ? 220 HOH C O   1 
HETATM 5551 O  O   . HOH L 4 .   ? 21.372  16.484  -14.038 1.00 33.72  ? 221 HOH C O   1 
HETATM 5552 O  O   . HOH L 4 .   ? 43.010  19.458  -32.079 1.00 38.66  ? 222 HOH C O   1 
HETATM 5553 O  O   . HOH L 4 .   ? 14.022  11.872  -50.054 1.00 31.10  ? 223 HOH C O   1 
HETATM 5554 O  O   . HOH L 4 .   ? 22.562  28.586  -39.596 1.00 48.42  ? 224 HOH C O   1 
HETATM 5555 O  O   . HOH L 4 .   ? 28.943  25.019  -12.676 1.00 35.04  ? 225 HOH C O   1 
HETATM 5556 O  O   . HOH L 4 .   ? 33.378  12.388  -17.984 1.00 35.05  ? 226 HOH C O   1 
HETATM 5557 O  O   . HOH L 4 .   ? 26.259  21.919  -34.691 1.00 25.92  ? 227 HOH C O   1 
HETATM 5558 O  O   . HOH L 4 .   ? 2.504   3.055   -37.543 1.00 40.85  ? 228 HOH C O   1 
HETATM 5559 O  O   . HOH L 4 .   ? -1.168  30.624  -37.095 1.00 31.67  ? 229 HOH C O   1 
HETATM 5560 O  O   . HOH L 4 .   ? 5.355   29.984  -50.721 1.00 43.82  ? 230 HOH C O   1 
HETATM 5561 O  O   . HOH L 4 .   ? 32.134  16.468  -9.567  1.00 39.27  ? 231 HOH C O   1 
HETATM 5562 O  O   . HOH L 4 .   ? 14.429  4.105   -48.008 1.00 55.25  ? 232 HOH C O   1 
HETATM 5563 O  O   . HOH L 4 .   ? 5.887   40.374  -50.007 1.00 39.22  ? 233 HOH C O   1 
HETATM 5564 O  O   . HOH L 4 .   ? 10.314  44.448  -41.336 1.00 50.68  ? 234 HOH C O   1 
HETATM 5565 O  O   . HOH L 4 .   ? 8.953   8.613   -22.045 1.00 47.43  ? 235 HOH C O   1 
HETATM 5566 O  O   . HOH L 4 .   ? 16.918  7.008   -23.563 1.00 45.81  ? 236 HOH C O   1 
HETATM 5567 O  O   . HOH L 4 .   ? 7.937   11.117  -13.773 1.00 31.25  ? 237 HOH C O   1 
HETATM 5568 O  O   . HOH L 4 .   ? 31.153  33.191  -30.712 1.00 31.68  ? 238 HOH C O   1 
HETATM 5569 O  O   . HOH L 4 .   ? -2.057  21.211  -40.184 1.00 35.51  ? 239 HOH C O   1 
HETATM 5570 O  O   . HOH L 4 .   ? 21.616  43.775  -24.872 1.00 62.34  ? 240 HOH C O   1 
HETATM 5571 O  O   . HOH L 4 .   ? 18.795  23.877  -29.093 1.00 55.43  ? 241 HOH C O   1 
HETATM 5572 O  O   . HOH L 4 .   ? 10.256  32.243  -45.155 1.00 45.11  ? 242 HOH C O   1 
HETATM 5573 O  O   . HOH L 4 .   ? 17.578  24.606  -32.785 1.00 62.16  ? 243 HOH C O   1 
HETATM 5574 O  O   . HOH L 4 .   ? 22.538  1.489   -28.573 1.00 43.89  ? 244 HOH C O   1 
HETATM 5575 O  O   . HOH L 4 .   ? 40.286  23.201  -25.124 1.00 37.18  ? 245 HOH C O   1 
HETATM 5576 O  O   . HOH L 4 .   ? 22.212  19.193  -14.687 1.00 50.37  ? 246 HOH C O   1 
HETATM 5577 O  O   . HOH L 4 .   ? 28.754  12.579  -32.147 1.00 92.74  ? 247 HOH C O   1 
HETATM 5578 O  O   . HOH L 4 .   ? 36.638  19.015  -29.808 1.00 54.55  ? 248 HOH C O   1 
HETATM 5579 O  O   . HOH L 4 .   ? 22.899  31.414  -30.224 1.00 42.76  ? 249 HOH C O   1 
HETATM 5580 O  O   . HOH L 4 .   ? 24.482  32.329  -27.907 1.00 49.76  ? 250 HOH C O   1 
HETATM 5581 O  O   . HOH L 4 .   ? 25.934  32.751  -30.510 1.00 40.28  ? 251 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   PRO 2   1   1   PRO PRO A . n 
A 1 3   MET 3   2   2   MET MET A . n 
A 1 4   ILE 4   3   3   ILE ILE A . n 
A 1 5   LEU 5   4   4   LEU LEU A . n 
A 1 6   GLY 6   5   5   GLY GLY A . n 
A 1 7   TYR 7   6   6   TYR TYR A . n 
A 1 8   TRP 8   7   7   TRP TRP A . n 
A 1 9   ASP 9   8   8   ASP ASP A . n 
A 1 10  ILE 10  9   9   ILE ILE A . n 
A 1 11  ARG 11  10  10  ARG ARG A . n 
A 1 12  GLY 12  11  11  GLY GLY A . n 
A 1 13  LEU 13  12  12  LEU LEU A . n 
A 1 14  ALA 14  13  13  ALA ALA A . n 
A 1 15  HIS 15  14  14  HIS HIS A . n 
A 1 16  ALA 16  15  15  ALA ALA A . n 
A 1 17  ILE 17  16  16  ILE ILE A . n 
A 1 18  ARG 18  17  17  ARG ARG A . n 
A 1 19  LEU 19  18  18  LEU LEU A . n 
A 1 20  LEU 20  19  19  LEU LEU A . n 
A 1 21  LEU 21  20  20  LEU LEU A . n 
A 1 22  GLU 22  21  21  GLU GLU A . n 
A 1 23  TYR 23  22  22  TYR TYR A . n 
A 1 24  THR 24  23  23  THR THR A . n 
A 1 25  ASP 25  24  24  ASP ASP A . n 
A 1 26  SER 26  25  25  SER SER A . n 
A 1 27  SER 27  26  26  SER SER A . n 
A 1 28  TYR 28  27  27  TYR TYR A . n 
A 1 29  GLU 29  28  28  GLU GLU A . n 
A 1 30  GLU 30  29  29  GLU GLU A . n 
A 1 31  LYS 31  30  30  LYS LYS A . n 
A 1 32  LYS 32  31  31  LYS LYS A . n 
A 1 33  TYR 33  32  32  TYR TYR A . n 
A 1 34  THR 34  33  33  THR THR A . n 
A 1 35  MET 35  34  34  MET MET A . n 
A 1 36  GLY 36  35  35  GLY GLY A . n 
A 1 37  ASP 37  36  36  ASP ASP A . n 
A 1 38  ALA 38  37  37  ALA ALA A . n 
A 1 39  PRO 39  38  38  PRO PRO A . n 
A 1 40  ASP 40  39  39  ASP ASP A . n 
A 1 41  TYR 41  40  40  TYR TYR A . n 
A 1 42  ASP 42  41  41  ASP ASP A . n 
A 1 43  ARG 43  42  42  ARG ARG A . n 
A 1 44  SER 44  43  43  SER SER A . n 
A 1 45  GLN 45  44  44  GLN GLN A . n 
A 1 46  TRP 46  45  45  TRP TRP A . n 
A 1 47  LEU 47  46  46  LEU LEU A . n 
A 1 48  ASN 48  47  47  ASN ASN A . n 
A 1 49  GLU 49  48  48  GLU GLU A . n 
A 1 50  LYS 50  49  49  LYS LYS A . n 
A 1 51  PHE 51  50  50  PHE PHE A . n 
A 1 52  LYS 52  51  51  LYS LYS A . n 
A 1 53  LEU 53  52  52  LEU LEU A . n 
A 1 54  GLY 54  53  53  GLY GLY A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  ASP 56  55  55  ASP ASP A . n 
A 1 57  PHE 57  56  56  PHE PHE A . n 
A 1 58  PRO 58  57  57  PRO PRO A . n 
A 1 59  ASN 59  58  58  ASN ASN A . n 
A 1 60  LEU 60  59  59  LEU LEU A . n 
A 1 61  PRO 61  60  60  PRO PRO A . n 
A 1 62  TYR 62  61  61  TYR TYR A . n 
A 1 63  LEU 63  62  62  LEU LEU A . n 
A 1 64  ILE 64  63  63  ILE ILE A . n 
A 1 65  ASP 65  64  64  ASP ASP A . n 
A 1 66  GLY 66  65  65  GLY GLY A . n 
A 1 67  ALA 67  66  66  ALA ALA A . n 
A 1 68  HIS 68  67  67  HIS HIS A . n 
A 1 69  LYS 69  68  68  LYS LYS A . n 
A 1 70  ILE 70  69  69  ILE ILE A . n 
A 1 71  THR 71  70  70  THR THR A . n 
A 1 72  GLN 72  71  71  GLN GLN A . n 
A 1 73  SER 73  72  72  SER SER A . n 
A 1 74  ASN 74  73  73  ASN ASN A . n 
A 1 75  ALA 75  74  74  ALA ALA A . n 
A 1 76  ILE 76  75  75  ILE ILE A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  CYS 78  77  77  CYS CYS A . n 
A 1 79  TYR 79  78  78  TYR TYR A . n 
A 1 80  ILE 80  79  79  ILE ILE A . n 
A 1 81  ALA 81  80  80  ALA ALA A . n 
A 1 82  ARG 82  81  81  ARG ARG A . n 
A 1 83  LYS 83  82  82  LYS LYS A . n 
A 1 84  HIS 84  83  83  HIS HIS A . n 
A 1 85  ASN 85  84  84  ASN ASN A . n 
A 1 86  LEU 86  85  85  LEU LEU A . n 
A 1 87  CYS 87  86  86  CYS CYS A . n 
A 1 88  GLY 88  87  87  GLY GLY A . n 
A 1 89  GLU 89  88  88  GLU GLU A . n 
A 1 90  THR 90  89  89  THR THR A . n 
A 1 91  GLU 91  90  90  GLU GLU A . n 
A 1 92  GLU 92  91  91  GLU GLU A . n 
A 1 93  GLU 93  92  92  GLU GLU A . n 
A 1 94  LYS 94  93  93  LYS LYS A . n 
A 1 95  ILE 95  94  94  ILE ILE A . n 
A 1 96  ARG 96  95  95  ARG ARG A . n 
A 1 97  VAL 97  96  96  VAL VAL A . n 
A 1 98  ASP 98  97  97  ASP ASP A . n 
A 1 99  ILE 99  98  98  ILE ILE A . n 
A 1 100 LEU 100 99  99  LEU LEU A . n 
A 1 101 GLU 101 100 100 GLU GLU A . n 
A 1 102 ASN 102 101 101 ASN ASN A . n 
A 1 103 GLN 103 102 102 GLN GLN A . n 
A 1 104 THR 104 103 103 THR THR A . n 
A 1 105 MET 105 104 104 MET MET A . n 
A 1 106 ASP 106 105 105 ASP ASP A . n 
A 1 107 ASN 107 106 106 ASN ASN A . n 
A 1 108 HIS 108 107 107 HIS HIS A . n 
A 1 109 MET 109 108 108 MET MET A . n 
A 1 110 GLN 110 109 109 GLN GLN A . n 
A 1 111 LEU 111 110 110 LEU LEU A . n 
A 1 112 GLY 112 111 111 GLY GLY A . n 
A 1 113 MET 113 112 112 MET MET A . n 
A 1 114 ILE 114 113 113 ILE ILE A . n 
A 1 115 CYS 115 114 114 CYS CYS A . n 
A 1 116 TYR 116 115 115 TYR TYR A . n 
A 1 117 ASN 117 116 116 ASN ASN A . n 
A 1 118 PRO 118 117 117 PRO PRO A . n 
A 1 119 GLU 119 118 118 GLU GLU A . n 
A 1 120 PHE 120 119 119 PHE PHE A . n 
A 1 121 GLU 121 120 120 GLU GLU A . n 
A 1 122 LYS 122 121 121 LYS LYS A . n 
A 1 123 LEU 123 122 122 LEU LEU A . n 
A 1 124 LYS 124 123 123 LYS LYS A . n 
A 1 125 PRO 125 124 124 PRO PRO A . n 
A 1 126 LYS 126 125 125 LYS LYS A . n 
A 1 127 TYR 127 126 126 TYR TYR A . n 
A 1 128 LEU 128 127 127 LEU LEU A . n 
A 1 129 GLU 129 128 128 GLU GLU A . n 
A 1 130 GLU 130 129 129 GLU GLU A . n 
A 1 131 LEU 131 130 130 LEU LEU A . n 
A 1 132 PRO 132 131 131 PRO PRO A . n 
A 1 133 GLU 133 132 132 GLU GLU A . n 
A 1 134 LYS 134 133 133 LYS LYS A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 LYS 136 135 135 LYS LYS A . n 
A 1 137 LEU 137 136 136 LEU LEU A . n 
A 1 138 TYR 138 137 137 TYR TYR A . n 
A 1 139 SER 139 138 138 SER SER A . n 
A 1 140 GLU 140 139 139 GLU GLU A . n 
A 1 141 PHE 141 140 140 PHE PHE A . n 
A 1 142 LEU 142 141 141 LEU LEU A . n 
A 1 143 GLY 143 142 142 GLY GLY A . n 
A 1 144 LYS 144 143 143 LYS LYS A . n 
A 1 145 ARG 145 144 144 ARG ARG A . n 
A 1 146 PRO 146 145 145 PRO PRO A . n 
A 1 147 TRP 147 146 146 TRP TRP A . n 
A 1 148 PHE 148 147 147 PHE PHE A . n 
A 1 149 ALA 149 148 148 ALA ALA A . n 
A 1 150 GLY 150 149 149 GLY GLY A . n 
A 1 151 ASN 151 150 150 ASN ASN A . n 
A 1 152 LYS 152 151 151 LYS LYS A . n 
A 1 153 ILE 153 152 152 ILE ILE A . n 
A 1 154 THR 154 153 153 THR THR A . n 
A 1 155 PHE 155 154 154 PHE PHE A . n 
A 1 156 VAL 156 155 155 VAL VAL A . n 
A 1 157 ASP 157 156 156 ASP ASP A . n 
A 1 158 PHE 158 157 157 PHE PHE A . n 
A 1 159 LEU 159 158 158 LEU LEU A . n 
A 1 160 VAL 160 159 159 VAL VAL A . n 
A 1 161 TYR 161 160 160 TYR TYR A . n 
A 1 162 ASP 162 161 161 ASP ASP A . n 
A 1 163 VAL 163 162 162 VAL VAL A . n 
A 1 164 LEU 164 163 163 LEU LEU A . n 
A 1 165 ASP 165 164 164 ASP ASP A . n 
A 1 166 LEU 166 165 165 LEU LEU A . n 
A 1 167 HIS 167 166 166 HIS HIS A . n 
A 1 168 ARG 168 167 167 ARG ARG A . n 
A 1 169 ILE 169 168 168 ILE ILE A . n 
A 1 170 PHE 170 169 169 PHE PHE A . n 
A 1 171 GLU 171 170 170 GLU GLU A . n 
A 1 172 PRO 172 171 171 PRO PRO A . n 
A 1 173 LYS 173 172 172 LYS LYS A . n 
A 1 174 CYS 174 173 173 CYS CYS A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 ASP 176 175 175 ASP ASP A . n 
A 1 177 ALA 177 176 176 ALA ALA A . n 
A 1 178 PHE 178 177 177 PHE PHE A . n 
A 1 179 PRO 179 178 178 PRO PRO A . n 
A 1 180 ASN 180 179 179 ASN ASN A . n 
A 1 181 LEU 181 180 180 LEU LEU A . n 
A 1 182 LYS 182 181 181 LYS LYS A . n 
A 1 183 ASP 183 182 182 ASP ASP A . n 
A 1 184 PHE 184 183 183 PHE PHE A . n 
A 1 185 ILE 185 184 184 ILE ILE A . n 
A 1 186 SER 186 185 185 SER SER A . n 
A 1 187 ARG 187 186 186 ARG ARG A . n 
A 1 188 PHE 188 187 187 PHE PHE A . n 
A 1 189 GLU 189 188 188 GLU GLU A . n 
A 1 190 GLY 190 189 189 GLY GLY A . n 
A 1 191 LEU 191 190 190 LEU LEU A . n 
A 1 192 GLU 192 191 191 GLU GLU A . n 
A 1 193 LYS 193 192 192 LYS LYS A . n 
A 1 194 ILE 194 193 193 ILE ILE A . n 
A 1 195 SER 195 194 194 SER SER A . n 
A 1 196 ALA 196 195 195 ALA ALA A . n 
A 1 197 TYR 197 196 196 TYR TYR A . n 
A 1 198 MET 198 197 197 MET MET A . n 
A 1 199 LYS 199 198 198 LYS LYS A . n 
A 1 200 SER 200 199 199 SER SER A . n 
A 1 201 SER 201 200 200 SER SER A . n 
A 1 202 ARG 202 201 201 ARG ARG A . n 
A 1 203 PHE 203 202 202 PHE PHE A . n 
A 1 204 LEU 204 203 203 LEU LEU A . n 
A 1 205 PRO 205 204 204 PRO PRO A . n 
A 1 206 ARG 206 205 205 ARG ARG A . n 
A 1 207 PRO 207 206 206 PRO PRO A . n 
A 1 208 VAL 208 207 207 VAL VAL A . n 
A 1 209 PHE 209 208 208 PHE PHE A . n 
A 1 210 SER 210 209 209 SER SER A . n 
A 1 211 LYS 211 210 210 LYS LYS A . n 
A 1 212 MET 212 211 211 MET MET A . n 
A 1 213 ALA 213 212 212 ALA ALA A . n 
A 1 214 VAL 214 213 213 VAL VAL A . n 
A 1 215 TRP 215 214 214 TRP TRP A . n 
A 1 216 GLY 216 215 215 GLY GLY A . n 
A 1 217 ASN 217 216 216 ASN ASN A . n 
A 1 218 LYS 218 217 217 LYS LYS A . n 
B 1 1   MET 1   0   ?   ?   ?   B . n 
B 1 2   PRO 2   1   1   PRO PRO B . n 
B 1 3   MET 3   2   2   MET MET B . n 
B 1 4   ILE 4   3   3   ILE ILE B . n 
B 1 5   LEU 5   4   4   LEU LEU B . n 
B 1 6   GLY 6   5   5   GLY GLY B . n 
B 1 7   TYR 7   6   6   TYR TYR B . n 
B 1 8   TRP 8   7   7   TRP TRP B . n 
B 1 9   ASP 9   8   8   ASP ASP B . n 
B 1 10  ILE 10  9   9   ILE ILE B . n 
B 1 11  ARG 11  10  10  ARG ARG B . n 
B 1 12  GLY 12  11  11  GLY GLY B . n 
B 1 13  LEU 13  12  12  LEU LEU B . n 
B 1 14  ALA 14  13  13  ALA ALA B . n 
B 1 15  HIS 15  14  14  HIS HIS B . n 
B 1 16  ALA 16  15  15  ALA ALA B . n 
B 1 17  ILE 17  16  16  ILE ILE B . n 
B 1 18  ARG 18  17  17  ARG ARG B . n 
B 1 19  LEU 19  18  18  LEU LEU B . n 
B 1 20  LEU 20  19  19  LEU LEU B . n 
B 1 21  LEU 21  20  20  LEU LEU B . n 
B 1 22  GLU 22  21  21  GLU GLU B . n 
B 1 23  TYR 23  22  22  TYR TYR B . n 
B 1 24  THR 24  23  23  THR THR B . n 
B 1 25  ASP 25  24  24  ASP ASP B . n 
B 1 26  SER 26  25  25  SER SER B . n 
B 1 27  SER 27  26  26  SER SER B . n 
B 1 28  TYR 28  27  27  TYR TYR B . n 
B 1 29  GLU 29  28  28  GLU GLU B . n 
B 1 30  GLU 30  29  29  GLU GLU B . n 
B 1 31  LYS 31  30  30  LYS LYS B . n 
B 1 32  LYS 32  31  31  LYS LYS B . n 
B 1 33  TYR 33  32  32  TYR TYR B . n 
B 1 34  THR 34  33  33  THR THR B . n 
B 1 35  MET 35  34  34  MET MET B . n 
B 1 36  GLY 36  35  35  GLY GLY B . n 
B 1 37  ASP 37  36  36  ASP ASP B . n 
B 1 38  ALA 38  37  37  ALA ALA B . n 
B 1 39  PRO 39  38  38  PRO PRO B . n 
B 1 40  ASP 40  39  39  ASP ASP B . n 
B 1 41  TYR 41  40  40  TYR TYR B . n 
B 1 42  ASP 42  41  41  ASP ASP B . n 
B 1 43  ARG 43  42  42  ARG ARG B . n 
B 1 44  SER 44  43  43  SER SER B . n 
B 1 45  GLN 45  44  44  GLN GLN B . n 
B 1 46  TRP 46  45  45  TRP TRP B . n 
B 1 47  LEU 47  46  46  LEU LEU B . n 
B 1 48  ASN 48  47  47  ASN ASN B . n 
B 1 49  GLU 49  48  48  GLU GLU B . n 
B 1 50  LYS 50  49  49  LYS LYS B . n 
B 1 51  PHE 51  50  50  PHE PHE B . n 
B 1 52  LYS 52  51  51  LYS LYS B . n 
B 1 53  LEU 53  52  52  LEU LEU B . n 
B 1 54  GLY 54  53  53  GLY GLY B . n 
B 1 55  LEU 55  54  54  LEU LEU B . n 
B 1 56  ASP 56  55  55  ASP ASP B . n 
B 1 57  PHE 57  56  56  PHE PHE B . n 
B 1 58  PRO 58  57  57  PRO PRO B . n 
B 1 59  ASN 59  58  58  ASN ASN B . n 
B 1 60  LEU 60  59  59  LEU LEU B . n 
B 1 61  PRO 61  60  60  PRO PRO B . n 
B 1 62  TYR 62  61  61  TYR TYR B . n 
B 1 63  LEU 63  62  62  LEU LEU B . n 
B 1 64  ILE 64  63  63  ILE ILE B . n 
B 1 65  ASP 65  64  64  ASP ASP B . n 
B 1 66  GLY 66  65  65  GLY GLY B . n 
B 1 67  ALA 67  66  66  ALA ALA B . n 
B 1 68  HIS 68  67  67  HIS HIS B . n 
B 1 69  LYS 69  68  68  LYS LYS B . n 
B 1 70  ILE 70  69  69  ILE ILE B . n 
B 1 71  THR 71  70  70  THR THR B . n 
B 1 72  GLN 72  71  71  GLN GLN B . n 
B 1 73  SER 73  72  72  SER SER B . n 
B 1 74  ASN 74  73  73  ASN ASN B . n 
B 1 75  ALA 75  74  74  ALA ALA B . n 
B 1 76  ILE 76  75  75  ILE ILE B . n 
B 1 77  LEU 77  76  76  LEU LEU B . n 
B 1 78  CYS 78  77  77  CYS CYS B . n 
B 1 79  TYR 79  78  78  TYR TYR B . n 
B 1 80  ILE 80  79  79  ILE ILE B . n 
B 1 81  ALA 81  80  80  ALA ALA B . n 
B 1 82  ARG 82  81  81  ARG ARG B . n 
B 1 83  LYS 83  82  82  LYS LYS B . n 
B 1 84  HIS 84  83  83  HIS HIS B . n 
B 1 85  ASN 85  84  84  ASN ASN B . n 
B 1 86  LEU 86  85  85  LEU LEU B . n 
B 1 87  CYS 87  86  86  CYS CYS B . n 
B 1 88  GLY 88  87  87  GLY GLY B . n 
B 1 89  GLU 89  88  88  GLU GLU B . n 
B 1 90  THR 90  89  89  THR THR B . n 
B 1 91  GLU 91  90  90  GLU GLU B . n 
B 1 92  GLU 92  91  91  GLU GLU B . n 
B 1 93  GLU 93  92  92  GLU GLU B . n 
B 1 94  LYS 94  93  93  LYS LYS B . n 
B 1 95  ILE 95  94  94  ILE ILE B . n 
B 1 96  ARG 96  95  95  ARG ARG B . n 
B 1 97  VAL 97  96  96  VAL VAL B . n 
B 1 98  ASP 98  97  97  ASP ASP B . n 
B 1 99  ILE 99  98  98  ILE ILE B . n 
B 1 100 LEU 100 99  99  LEU LEU B . n 
B 1 101 GLU 101 100 100 GLU GLU B . n 
B 1 102 ASN 102 101 101 ASN ASN B . n 
B 1 103 GLN 103 102 102 GLN GLN B . n 
B 1 104 THR 104 103 103 THR THR B . n 
B 1 105 MET 105 104 104 MET MET B . n 
B 1 106 ASP 106 105 105 ASP ASP B . n 
B 1 107 ASN 107 106 106 ASN ASN B . n 
B 1 108 HIS 108 107 107 HIS HIS B . n 
B 1 109 MET 109 108 108 MET MET B . n 
B 1 110 GLN 110 109 109 GLN GLN B . n 
B 1 111 LEU 111 110 110 LEU LEU B . n 
B 1 112 GLY 112 111 111 GLY GLY B . n 
B 1 113 MET 113 112 112 MET MET B . n 
B 1 114 ILE 114 113 113 ILE ILE B . n 
B 1 115 CYS 115 114 114 CYS CYS B . n 
B 1 116 TYR 116 115 115 TYR TYR B . n 
B 1 117 ASN 117 116 116 ASN ASN B . n 
B 1 118 PRO 118 117 117 PRO PRO B . n 
B 1 119 GLU 119 118 118 GLU GLU B . n 
B 1 120 PHE 120 119 119 PHE PHE B . n 
B 1 121 GLU 121 120 120 GLU GLU B . n 
B 1 122 LYS 122 121 121 LYS LYS B . n 
B 1 123 LEU 123 122 122 LEU LEU B . n 
B 1 124 LYS 124 123 123 LYS LYS B . n 
B 1 125 PRO 125 124 124 PRO PRO B . n 
B 1 126 LYS 126 125 125 LYS LYS B . n 
B 1 127 TYR 127 126 126 TYR TYR B . n 
B 1 128 LEU 128 127 127 LEU LEU B . n 
B 1 129 GLU 129 128 128 GLU GLU B . n 
B 1 130 GLU 130 129 129 GLU GLU B . n 
B 1 131 LEU 131 130 130 LEU LEU B . n 
B 1 132 PRO 132 131 131 PRO PRO B . n 
B 1 133 GLU 133 132 132 GLU GLU B . n 
B 1 134 LYS 134 133 133 LYS LYS B . n 
B 1 135 LEU 135 134 134 LEU LEU B . n 
B 1 136 LYS 136 135 135 LYS LYS B . n 
B 1 137 LEU 137 136 136 LEU LEU B . n 
B 1 138 TYR 138 137 137 TYR TYR B . n 
B 1 139 SER 139 138 138 SER SER B . n 
B 1 140 GLU 140 139 139 GLU GLU B . n 
B 1 141 PHE 141 140 140 PHE PHE B . n 
B 1 142 LEU 142 141 141 LEU LEU B . n 
B 1 143 GLY 143 142 142 GLY GLY B . n 
B 1 144 LYS 144 143 143 LYS LYS B . n 
B 1 145 ARG 145 144 144 ARG ARG B . n 
B 1 146 PRO 146 145 145 PRO PRO B . n 
B 1 147 TRP 147 146 146 TRP TRP B . n 
B 1 148 PHE 148 147 147 PHE PHE B . n 
B 1 149 ALA 149 148 148 ALA ALA B . n 
B 1 150 GLY 150 149 149 GLY GLY B . n 
B 1 151 ASN 151 150 150 ASN ASN B . n 
B 1 152 LYS 152 151 151 LYS LYS B . n 
B 1 153 ILE 153 152 152 ILE ILE B . n 
B 1 154 THR 154 153 153 THR THR B . n 
B 1 155 PHE 155 154 154 PHE PHE B . n 
B 1 156 VAL 156 155 155 VAL VAL B . n 
B 1 157 ASP 157 156 156 ASP ASP B . n 
B 1 158 PHE 158 157 157 PHE PHE B . n 
B 1 159 LEU 159 158 158 LEU LEU B . n 
B 1 160 VAL 160 159 159 VAL VAL B . n 
B 1 161 TYR 161 160 160 TYR TYR B . n 
B 1 162 ASP 162 161 161 ASP ASP B . n 
B 1 163 VAL 163 162 162 VAL VAL B . n 
B 1 164 LEU 164 163 163 LEU LEU B . n 
B 1 165 ASP 165 164 164 ASP ASP B . n 
B 1 166 LEU 166 165 165 LEU LEU B . n 
B 1 167 HIS 167 166 166 HIS HIS B . n 
B 1 168 ARG 168 167 167 ARG ARG B . n 
B 1 169 ILE 169 168 168 ILE ILE B . n 
B 1 170 PHE 170 169 169 PHE PHE B . n 
B 1 171 GLU 171 170 170 GLU GLU B . n 
B 1 172 PRO 172 171 171 PRO PRO B . n 
B 1 173 LYS 173 172 172 LYS LYS B . n 
B 1 174 CYS 174 173 173 CYS CYS B . n 
B 1 175 LEU 175 174 174 LEU LEU B . n 
B 1 176 ASP 176 175 175 ASP ASP B . n 
B 1 177 ALA 177 176 176 ALA ALA B . n 
B 1 178 PHE 178 177 177 PHE PHE B . n 
B 1 179 PRO 179 178 178 PRO PRO B . n 
B 1 180 ASN 180 179 179 ASN ASN B . n 
B 1 181 LEU 181 180 180 LEU LEU B . n 
B 1 182 LYS 182 181 181 LYS LYS B . n 
B 1 183 ASP 183 182 182 ASP ASP B . n 
B 1 184 PHE 184 183 183 PHE PHE B . n 
B 1 185 ILE 185 184 184 ILE ILE B . n 
B 1 186 SER 186 185 185 SER SER B . n 
B 1 187 ARG 187 186 186 ARG ARG B . n 
B 1 188 PHE 188 187 187 PHE PHE B . n 
B 1 189 GLU 189 188 188 GLU GLU B . n 
B 1 190 GLY 190 189 189 GLY GLY B . n 
B 1 191 LEU 191 190 190 LEU LEU B . n 
B 1 192 GLU 192 191 191 GLU GLU B . n 
B 1 193 LYS 193 192 192 LYS LYS B . n 
B 1 194 ILE 194 193 193 ILE ILE B . n 
B 1 195 SER 195 194 194 SER SER B . n 
B 1 196 ALA 196 195 195 ALA ALA B . n 
B 1 197 TYR 197 196 196 TYR TYR B . n 
B 1 198 MET 198 197 197 MET MET B . n 
B 1 199 LYS 199 198 198 LYS LYS B . n 
B 1 200 SER 200 199 199 SER SER B . n 
B 1 201 SER 201 200 200 SER SER B . n 
B 1 202 ARG 202 201 201 ARG ARG B . n 
B 1 203 PHE 203 202 202 PHE PHE B . n 
B 1 204 LEU 204 203 203 LEU LEU B . n 
B 1 205 PRO 205 204 204 PRO PRO B . n 
B 1 206 ARG 206 205 205 ARG ARG B . n 
B 1 207 PRO 207 206 206 PRO PRO B . n 
B 1 208 VAL 208 207 207 VAL VAL B . n 
B 1 209 PHE 209 208 208 PHE PHE B . n 
B 1 210 SER 210 209 209 SER SER B . n 
B 1 211 LYS 211 210 210 LYS LYS B . n 
B 1 212 MET 212 211 211 MET MET B . n 
B 1 213 ALA 213 212 212 ALA ALA B . n 
B 1 214 VAL 214 213 213 VAL VAL B . n 
B 1 215 TRP 215 214 214 TRP TRP B . n 
B 1 216 GLY 216 215 215 GLY GLY B . n 
B 1 217 ASN 217 216 216 ASN ASN B . n 
B 1 218 LYS 218 217 217 LYS LYS B . n 
C 1 1   MET 1   0   ?   ?   ?   C . n 
C 1 2   PRO 2   1   1   PRO PRO C . n 
C 1 3   MET 3   2   2   MET MET C . n 
C 1 4   ILE 4   3   3   ILE ILE C . n 
C 1 5   LEU 5   4   4   LEU LEU C . n 
C 1 6   GLY 6   5   5   GLY GLY C . n 
C 1 7   TYR 7   6   6   TYR TYR C . n 
C 1 8   TRP 8   7   7   TRP TRP C . n 
C 1 9   ASP 9   8   8   ASP ASP C . n 
C 1 10  ILE 10  9   9   ILE ILE C . n 
C 1 11  ARG 11  10  10  ARG ARG C . n 
C 1 12  GLY 12  11  11  GLY GLY C . n 
C 1 13  LEU 13  12  12  LEU LEU C . n 
C 1 14  ALA 14  13  13  ALA ALA C . n 
C 1 15  HIS 15  14  14  HIS HIS C . n 
C 1 16  ALA 16  15  15  ALA ALA C . n 
C 1 17  ILE 17  16  16  ILE ILE C . n 
C 1 18  ARG 18  17  17  ARG ARG C . n 
C 1 19  LEU 19  18  18  LEU LEU C . n 
C 1 20  LEU 20  19  19  LEU LEU C . n 
C 1 21  LEU 21  20  20  LEU LEU C . n 
C 1 22  GLU 22  21  21  GLU GLU C . n 
C 1 23  TYR 23  22  22  TYR TYR C . n 
C 1 24  THR 24  23  23  THR THR C . n 
C 1 25  ASP 25  24  24  ASP ASP C . n 
C 1 26  SER 26  25  25  SER SER C . n 
C 1 27  SER 27  26  26  SER SER C . n 
C 1 28  TYR 28  27  27  TYR TYR C . n 
C 1 29  GLU 29  28  28  GLU GLU C . n 
C 1 30  GLU 30  29  29  GLU GLU C . n 
C 1 31  LYS 31  30  30  LYS LYS C . n 
C 1 32  LYS 32  31  31  LYS LYS C . n 
C 1 33  TYR 33  32  32  TYR TYR C . n 
C 1 34  THR 34  33  33  THR THR C . n 
C 1 35  MET 35  34  34  MET MET C . n 
C 1 36  GLY 36  35  35  GLY GLY C . n 
C 1 37  ASP 37  36  36  ASP ASP C . n 
C 1 38  ALA 38  37  37  ALA ALA C . n 
C 1 39  PRO 39  38  38  PRO PRO C . n 
C 1 40  ASP 40  39  39  ASP ASP C . n 
C 1 41  TYR 41  40  40  TYR TYR C . n 
C 1 42  ASP 42  41  41  ASP ASP C . n 
C 1 43  ARG 43  42  42  ARG ARG C . n 
C 1 44  SER 44  43  43  SER SER C . n 
C 1 45  GLN 45  44  44  GLN GLN C . n 
C 1 46  TRP 46  45  45  TRP TRP C . n 
C 1 47  LEU 47  46  46  LEU LEU C . n 
C 1 48  ASN 48  47  47  ASN ASN C . n 
C 1 49  GLU 49  48  48  GLU GLU C . n 
C 1 50  LYS 50  49  49  LYS LYS C . n 
C 1 51  PHE 51  50  50  PHE PHE C . n 
C 1 52  LYS 52  51  51  LYS LYS C . n 
C 1 53  LEU 53  52  52  LEU LEU C . n 
C 1 54  GLY 54  53  53  GLY GLY C . n 
C 1 55  LEU 55  54  54  LEU LEU C . n 
C 1 56  ASP 56  55  55  ASP ASP C . n 
C 1 57  PHE 57  56  56  PHE PHE C . n 
C 1 58  PRO 58  57  57  PRO PRO C . n 
C 1 59  ASN 59  58  58  ASN ASN C . n 
C 1 60  LEU 60  59  59  LEU LEU C . n 
C 1 61  PRO 61  60  60  PRO PRO C . n 
C 1 62  TYR 62  61  61  TYR TYR C . n 
C 1 63  LEU 63  62  62  LEU LEU C . n 
C 1 64  ILE 64  63  63  ILE ILE C . n 
C 1 65  ASP 65  64  64  ASP ASP C . n 
C 1 66  GLY 66  65  65  GLY GLY C . n 
C 1 67  ALA 67  66  66  ALA ALA C . n 
C 1 68  HIS 68  67  67  HIS HIS C . n 
C 1 69  LYS 69  68  68  LYS LYS C . n 
C 1 70  ILE 70  69  69  ILE ILE C . n 
C 1 71  THR 71  70  70  THR THR C . n 
C 1 72  GLN 72  71  71  GLN GLN C . n 
C 1 73  SER 73  72  72  SER SER C . n 
C 1 74  ASN 74  73  73  ASN ASN C . n 
C 1 75  ALA 75  74  74  ALA ALA C . n 
C 1 76  ILE 76  75  75  ILE ILE C . n 
C 1 77  LEU 77  76  76  LEU LEU C . n 
C 1 78  CYS 78  77  77  CYS CYS C . n 
C 1 79  TYR 79  78  78  TYR TYR C . n 
C 1 80  ILE 80  79  79  ILE ILE C . n 
C 1 81  ALA 81  80  80  ALA ALA C . n 
C 1 82  ARG 82  81  81  ARG ARG C . n 
C 1 83  LYS 83  82  82  LYS LYS C . n 
C 1 84  HIS 84  83  83  HIS HIS C . n 
C 1 85  ASN 85  84  84  ASN ASN C . n 
C 1 86  LEU 86  85  85  LEU LEU C . n 
C 1 87  CYS 87  86  86  CYS CYS C . n 
C 1 88  GLY 88  87  87  GLY GLY C . n 
C 1 89  GLU 89  88  88  GLU GLU C . n 
C 1 90  THR 90  89  89  THR THR C . n 
C 1 91  GLU 91  90  90  GLU GLU C . n 
C 1 92  GLU 92  91  91  GLU GLU C . n 
C 1 93  GLU 93  92  92  GLU GLU C . n 
C 1 94  LYS 94  93  93  LYS LYS C . n 
C 1 95  ILE 95  94  94  ILE ILE C . n 
C 1 96  ARG 96  95  95  ARG ARG C . n 
C 1 97  VAL 97  96  96  VAL VAL C . n 
C 1 98  ASP 98  97  97  ASP ASP C . n 
C 1 99  ILE 99  98  98  ILE ILE C . n 
C 1 100 LEU 100 99  99  LEU LEU C . n 
C 1 101 GLU 101 100 100 GLU GLU C . n 
C 1 102 ASN 102 101 101 ASN ASN C . n 
C 1 103 GLN 103 102 102 GLN GLN C . n 
C 1 104 THR 104 103 103 THR THR C . n 
C 1 105 MET 105 104 104 MET MET C . n 
C 1 106 ASP 106 105 105 ASP ASP C . n 
C 1 107 ASN 107 106 106 ASN ASN C . n 
C 1 108 HIS 108 107 107 HIS HIS C . n 
C 1 109 MET 109 108 108 MET MET C . n 
C 1 110 GLN 110 109 109 GLN GLN C . n 
C 1 111 LEU 111 110 110 LEU LEU C . n 
C 1 112 GLY 112 111 111 GLY GLY C . n 
C 1 113 MET 113 112 112 MET MET C . n 
C 1 114 ILE 114 113 113 ILE ILE C . n 
C 1 115 CYS 115 114 114 CYS CYS C . n 
C 1 116 TYR 116 115 115 TYR TYR C . n 
C 1 117 ASN 117 116 116 ASN ASN C . n 
C 1 118 PRO 118 117 117 PRO PRO C . n 
C 1 119 GLU 119 118 118 GLU GLU C . n 
C 1 120 PHE 120 119 119 PHE PHE C . n 
C 1 121 GLU 121 120 120 GLU GLU C . n 
C 1 122 LYS 122 121 121 LYS LYS C . n 
C 1 123 LEU 123 122 122 LEU LEU C . n 
C 1 124 LYS 124 123 123 LYS LYS C . n 
C 1 125 PRO 125 124 124 PRO PRO C . n 
C 1 126 LYS 126 125 125 LYS LYS C . n 
C 1 127 TYR 127 126 126 TYR TYR C . n 
C 1 128 LEU 128 127 127 LEU LEU C . n 
C 1 129 GLU 129 128 128 GLU GLU C . n 
C 1 130 GLU 130 129 129 GLU GLU C . n 
C 1 131 LEU 131 130 130 LEU LEU C . n 
C 1 132 PRO 132 131 131 PRO PRO C . n 
C 1 133 GLU 133 132 132 GLU GLU C . n 
C 1 134 LYS 134 133 133 LYS LYS C . n 
C 1 135 LEU 135 134 134 LEU LEU C . n 
C 1 136 LYS 136 135 135 LYS LYS C . n 
C 1 137 LEU 137 136 136 LEU LEU C . n 
C 1 138 TYR 138 137 137 TYR TYR C . n 
C 1 139 SER 139 138 138 SER SER C . n 
C 1 140 GLU 140 139 139 GLU GLU C . n 
C 1 141 PHE 141 140 140 PHE PHE C . n 
C 1 142 LEU 142 141 141 LEU LEU C . n 
C 1 143 GLY 143 142 142 GLY GLY C . n 
C 1 144 LYS 144 143 143 LYS LYS C . n 
C 1 145 ARG 145 144 144 ARG ARG C . n 
C 1 146 PRO 146 145 145 PRO PRO C . n 
C 1 147 TRP 147 146 146 TRP TRP C . n 
C 1 148 PHE 148 147 147 PHE PHE C . n 
C 1 149 ALA 149 148 148 ALA ALA C . n 
C 1 150 GLY 150 149 149 GLY GLY C . n 
C 1 151 ASN 151 150 150 ASN ASN C . n 
C 1 152 LYS 152 151 151 LYS LYS C . n 
C 1 153 ILE 153 152 152 ILE ILE C . n 
C 1 154 THR 154 153 153 THR THR C . n 
C 1 155 PHE 155 154 154 PHE PHE C . n 
C 1 156 VAL 156 155 155 VAL VAL C . n 
C 1 157 ASP 157 156 156 ASP ASP C . n 
C 1 158 PHE 158 157 157 PHE PHE C . n 
C 1 159 LEU 159 158 158 LEU LEU C . n 
C 1 160 VAL 160 159 159 VAL VAL C . n 
C 1 161 TYR 161 160 160 TYR TYR C . n 
C 1 162 ASP 162 161 161 ASP ASP C . n 
C 1 163 VAL 163 162 162 VAL VAL C . n 
C 1 164 LEU 164 163 163 LEU LEU C . n 
C 1 165 ASP 165 164 164 ASP ASP C . n 
C 1 166 LEU 166 165 165 LEU LEU C . n 
C 1 167 HIS 167 166 166 HIS HIS C . n 
C 1 168 ARG 168 167 167 ARG ARG C . n 
C 1 169 ILE 169 168 168 ILE ILE C . n 
C 1 170 PHE 170 169 169 PHE PHE C . n 
C 1 171 GLU 171 170 170 GLU GLU C . n 
C 1 172 PRO 172 171 171 PRO PRO C . n 
C 1 173 LYS 173 172 172 LYS LYS C . n 
C 1 174 CYS 174 173 173 CYS CYS C . n 
C 1 175 LEU 175 174 174 LEU LEU C . n 
C 1 176 ASP 176 175 175 ASP ASP C . n 
C 1 177 ALA 177 176 176 ALA ALA C . n 
C 1 178 PHE 178 177 177 PHE PHE C . n 
C 1 179 PRO 179 178 178 PRO PRO C . n 
C 1 180 ASN 180 179 179 ASN ASN C . n 
C 1 181 LEU 181 180 180 LEU LEU C . n 
C 1 182 LYS 182 181 181 LYS LYS C . n 
C 1 183 ASP 183 182 182 ASP ASP C . n 
C 1 184 PHE 184 183 183 PHE PHE C . n 
C 1 185 ILE 185 184 184 ILE ILE C . n 
C 1 186 SER 186 185 185 SER SER C . n 
C 1 187 ARG 187 186 186 ARG ARG C . n 
C 1 188 PHE 188 187 187 PHE PHE C . n 
C 1 189 GLU 189 188 188 GLU GLU C . n 
C 1 190 GLY 190 189 189 GLY GLY C . n 
C 1 191 LEU 191 190 190 LEU LEU C . n 
C 1 192 GLU 192 191 191 GLU GLU C . n 
C 1 193 LYS 193 192 192 LYS LYS C . n 
C 1 194 ILE 194 193 193 ILE ILE C . n 
C 1 195 SER 195 194 194 SER SER C . n 
C 1 196 ALA 196 195 195 ALA ALA C . n 
C 1 197 TYR 197 196 196 TYR TYR C . n 
C 1 198 MET 198 197 197 MET MET C . n 
C 1 199 LYS 199 198 198 LYS LYS C . n 
C 1 200 SER 200 199 199 SER SER C . n 
C 1 201 SER 201 200 200 SER SER C . n 
C 1 202 ARG 202 201 201 ARG ARG C . n 
C 1 203 PHE 203 202 202 PHE PHE C . n 
C 1 204 LEU 204 203 203 LEU LEU C . n 
C 1 205 PRO 205 204 204 PRO PRO C . n 
C 1 206 ARG 206 205 205 ARG ARG C . n 
C 1 207 PRO 207 206 206 PRO PRO C . n 
C 1 208 VAL 208 207 207 VAL VAL C . n 
C 1 209 PHE 209 208 208 PHE PHE C . n 
C 1 210 SER 210 209 209 SER SER C . n 
C 1 211 LYS 211 210 210 LYS LYS C . n 
C 1 212 MET 212 211 211 MET MET C . n 
C 1 213 ALA 213 212 212 ALA ALA C . n 
C 1 214 VAL 214 213 213 VAL VAL C . n 
C 1 215 TRP 215 214 214 TRP TRP C . n 
C 1 216 GLY 216 215 215 GLY GLY C . n 
C 1 217 ASN 217 216 216 ASN ASN C . n 
C 1 218 LYS 218 217 217 LYS LYS C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 ZN  1  219 219 ZN  ZH3 A . 
E 3 GSH 1  218 218 GSH GSH A . 
F 2 ZN  1  219 219 ZN  ZH3 B . 
G 3 GSH 1  218 218 GSH GSH B . 
H 2 ZN  1  219 219 ZN  ZH3 C . 
I 3 GSH 1  218 218 GSH GSH C . 
J 4 HOH 1  220 1   HOH HOH A . 
J 4 HOH 2  221 5   HOH HOH A . 
J 4 HOH 3  222 8   HOH HOH A . 
J 4 HOH 4  223 10  HOH HOH A . 
J 4 HOH 5  224 11  HOH HOH A . 
J 4 HOH 6  225 13  HOH HOH A . 
J 4 HOH 7  226 14  HOH HOH A . 
J 4 HOH 8  227 15  HOH HOH A . 
J 4 HOH 9  228 18  HOH HOH A . 
J 4 HOH 10 229 22  HOH HOH A . 
J 4 HOH 11 230 25  HOH HOH A . 
J 4 HOH 12 231 32  HOH HOH A . 
J 4 HOH 13 232 38  HOH HOH A . 
J 4 HOH 14 233 39  HOH HOH A . 
J 4 HOH 15 234 40  HOH HOH A . 
J 4 HOH 16 235 47  HOH HOH A . 
J 4 HOH 17 236 50  HOH HOH A . 
J 4 HOH 18 237 51  HOH HOH A . 
J 4 HOH 19 238 53  HOH HOH A . 
J 4 HOH 20 239 55  HOH HOH A . 
J 4 HOH 21 240 60  HOH HOH A . 
J 4 HOH 22 241 64  HOH HOH A . 
J 4 HOH 23 242 65  HOH HOH A . 
J 4 HOH 24 243 66  HOH HOH A . 
J 4 HOH 25 244 67  HOH HOH A . 
J 4 HOH 26 245 68  HOH HOH A . 
J 4 HOH 27 246 69  HOH HOH A . 
J 4 HOH 28 247 70  HOH HOH A . 
J 4 HOH 29 248 71  HOH HOH A . 
J 4 HOH 30 249 73  HOH HOH A . 
J 4 HOH 31 250 75  HOH HOH A . 
J 4 HOH 32 251 77  HOH HOH A . 
J 4 HOH 33 252 78  HOH HOH A . 
J 4 HOH 34 253 79  HOH HOH A . 
J 4 HOH 35 254 80  HOH HOH A . 
J 4 HOH 36 255 81  HOH HOH A . 
J 4 HOH 37 256 82  HOH HOH A . 
J 4 HOH 38 257 219 HOH ZH3 A . 
J 4 HOH 39 258 219 HOH ZH3 A . 
J 4 HOH 40 259 219 HOH ZH3 A . 
K 4 HOH 1  220 3   HOH HOH B . 
K 4 HOH 2  221 4   HOH HOH B . 
K 4 HOH 3  222 16  HOH HOH B . 
K 4 HOH 4  223 17  HOH HOH B . 
K 4 HOH 5  224 21  HOH HOH B . 
K 4 HOH 6  225 24  HOH HOH B . 
K 4 HOH 7  226 27  HOH HOH B . 
K 4 HOH 8  227 29  HOH HOH B . 
K 4 HOH 9  228 30  HOH HOH B . 
K 4 HOH 10 229 33  HOH HOH B . 
K 4 HOH 11 230 34  HOH HOH B . 
K 4 HOH 12 231 36  HOH HOH B . 
K 4 HOH 13 232 37  HOH HOH B . 
K 4 HOH 14 233 44  HOH HOH B . 
K 4 HOH 15 234 46  HOH HOH B . 
K 4 HOH 16 235 49  HOH HOH B . 
K 4 HOH 17 236 54  HOH HOH B . 
K 4 HOH 18 237 56  HOH HOH B . 
K 4 HOH 19 238 58  HOH HOH B . 
K 4 HOH 20 239 59  HOH HOH B . 
K 4 HOH 21 240 62  HOH HOH B . 
K 4 HOH 22 241 63  HOH HOH B . 
K 4 HOH 23 242 72  HOH HOH B . 
K 4 HOH 24 243 74  HOH HOH B . 
K 4 HOH 25 244 76  HOH HOH B . 
K 4 HOH 26 245 92  HOH HOH B . 
K 4 HOH 27 246 93  HOH HOH B . 
K 4 HOH 28 247 94  HOH HOH B . 
K 4 HOH 29 248 95  HOH HOH B . 
K 4 HOH 30 249 96  HOH HOH B . 
K 4 HOH 31 250 97  HOH HOH B . 
K 4 HOH 32 251 219 HOH ZH3 B . 
K 4 HOH 33 252 219 HOH ZH3 B . 
K 4 HOH 34 253 219 HOH ZH3 B . 
L 4 HOH 1  220 2   HOH HOH C . 
L 4 HOH 2  221 6   HOH HOH C . 
L 4 HOH 3  222 7   HOH HOH C . 
L 4 HOH 4  223 9   HOH HOH C . 
L 4 HOH 5  224 12  HOH HOH C . 
L 4 HOH 6  225 19  HOH HOH C . 
L 4 HOH 7  226 20  HOH HOH C . 
L 4 HOH 8  227 23  HOH HOH C . 
L 4 HOH 9  228 26  HOH HOH C . 
L 4 HOH 10 229 28  HOH HOH C . 
L 4 HOH 11 230 31  HOH HOH C . 
L 4 HOH 12 231 35  HOH HOH C . 
L 4 HOH 13 232 41  HOH HOH C . 
L 4 HOH 14 233 42  HOH HOH C . 
L 4 HOH 15 234 43  HOH HOH C . 
L 4 HOH 16 235 45  HOH HOH C . 
L 4 HOH 17 236 48  HOH HOH C . 
L 4 HOH 18 237 52  HOH HOH C . 
L 4 HOH 19 238 57  HOH HOH C . 
L 4 HOH 20 239 61  HOH HOH C . 
L 4 HOH 21 240 83  HOH HOH C . 
L 4 HOH 22 241 84  HOH HOH C . 
L 4 HOH 23 242 85  HOH HOH C . 
L 4 HOH 24 243 86  HOH HOH C . 
L 4 HOH 25 244 87  HOH HOH C . 
L 4 HOH 26 245 88  HOH HOH C . 
L 4 HOH 27 246 89  HOH HOH C . 
L 4 HOH 28 247 90  HOH HOH C . 
L 4 HOH 29 248 91  HOH HOH C . 
L 4 HOH 30 249 219 HOH ZH3 C . 
L 4 HOH 31 250 219 HOH ZH3 C . 
L 4 HOH 32 251 219 HOH ZH3 C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_defined_assembly              ?    dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,D,E,F,G,J,K 
2 1,2 C,H,I,L         
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4160  ? 
1 MORE         -96   ? 
1 'SSA (A^2)'  18670 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 2_554 -x,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 50.3680115543 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -79.1533689243 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? J HOH . ? A HOH 257 ? 1_555 ZN ? D ZN . ? A ZN 219 ? 1_555 O   ? J HOH . ? A HOH 258 ? 1_555 117.0 ? 
2  O ? J HOH . ? A HOH 257 ? 1_555 ZN ? D ZN . ? A ZN 219 ? 1_555 O   ? J HOH . ? A HOH 259 ? 1_555 115.8 ? 
3  O ? J HOH . ? A HOH 258 ? 1_555 ZN ? D ZN . ? A ZN 219 ? 1_555 O   ? J HOH . ? A HOH 259 ? 1_555 110.9 ? 
4  O ? J HOH . ? A HOH 257 ? 1_555 ZN ? D ZN . ? A ZN 219 ? 1_555 SG2 ? E GSH . ? A GSH 218 ? 1_555 103.3 ? 
5  O ? J HOH . ? A HOH 258 ? 1_555 ZN ? D ZN . ? A ZN 219 ? 1_555 SG2 ? E GSH . ? A GSH 218 ? 1_555 101.9 ? 
6  O ? J HOH . ? A HOH 259 ? 1_555 ZN ? D ZN . ? A ZN 219 ? 1_555 SG2 ? E GSH . ? A GSH 218 ? 1_555 105.9 ? 
7  O ? K HOH . ? B HOH 253 ? 1_555 ZN ? F ZN . ? B ZN 219 ? 1_555 O   ? K HOH . ? B HOH 251 ? 1_555 109.6 ? 
8  O ? K HOH . ? B HOH 253 ? 1_555 ZN ? F ZN . ? B ZN 219 ? 1_555 O   ? K HOH . ? B HOH 252 ? 1_555 110.7 ? 
9  O ? K HOH . ? B HOH 251 ? 1_555 ZN ? F ZN . ? B ZN 219 ? 1_555 O   ? K HOH . ? B HOH 252 ? 1_555 98.2  ? 
10 O ? K HOH . ? B HOH 253 ? 1_555 ZN ? F ZN . ? B ZN 219 ? 1_555 SG2 ? G GSH . ? B GSH 218 ? 1_555 105.4 ? 
11 O ? K HOH . ? B HOH 251 ? 1_555 ZN ? F ZN . ? B ZN 219 ? 1_555 SG2 ? G GSH . ? B GSH 218 ? 1_555 113.0 ? 
12 O ? K HOH . ? B HOH 252 ? 1_555 ZN ? F ZN . ? B ZN 219 ? 1_555 SG2 ? G GSH . ? B GSH 218 ? 1_555 119.7 ? 
13 O ? L HOH . ? C HOH 249 ? 1_555 ZN ? H ZN . ? C ZN 219 ? 1_555 O   ? L HOH . ? C HOH 251 ? 1_555 125.3 ? 
14 O ? L HOH . ? C HOH 249 ? 1_555 ZN ? H ZN . ? C ZN 219 ? 1_555 O   ? L HOH . ? C HOH 250 ? 1_555 101.9 ? 
15 O ? L HOH . ? C HOH 251 ? 1_555 ZN ? H ZN . ? C ZN 219 ? 1_555 O   ? L HOH . ? C HOH 250 ? 1_555 104.7 ? 
16 O ? L HOH . ? C HOH 249 ? 1_555 ZN ? H ZN . ? C ZN 219 ? 1_555 SG2 ? I GSH . ? C GSH 218 ? 1_555 108.6 ? 
17 O ? L HOH . ? C HOH 251 ? 1_555 ZN ? H ZN . ? C ZN 219 ? 1_555 SG2 ? I GSH . ? C GSH 218 ? 1_555 111.4 ? 
18 O ? L HOH . ? C HOH 250 ? 1_555 ZN ? H ZN . ? C ZN 219 ? 1_555 SG2 ? I GSH . ? C GSH 218 ? 1_555 101.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-02-01 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SCALEPACK 'data scaling' .          ? 1 
MOLREP    phasing        '(CCP4)'   ? 2 
CNS       refinement     1.0        ? 3 
CCP4      phasing        '(MOLREP)' ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 10  ? ? -69.33  -76.55  
2  1 GLU A 48  ? ? -157.67 -9.85   
3  1 PRO A 57  ? ? -39.23  120.03  
4  1 GLN A 71  ? ? 79.06   108.59  
5  1 GLU A 88  ? ? -129.20 -58.80  
6  1 ARG B 10  ? ? -70.47  -74.81  
7  1 GLU B 48  ? ? -157.06 -7.64   
8  1 PRO B 57  ? ? -39.49  116.64  
9  1 GLN B 71  ? ? 80.14   105.07  
10 1 GLU B 88  ? ? -126.67 -60.10  
11 1 GLU B 118 ? ? -94.15  30.78   
12 1 ARG C 10  ? ? -72.28  -70.30  
13 1 GLU C 48  ? ? -155.48 -7.55   
14 1 PRO C 57  ? ? -39.68  115.95  
15 1 GLN C 71  ? ? 77.35   103.22  
16 1 GLU C 88  ? ? -129.75 -57.07  
17 1 GLU C 118 ? ? -92.45  33.93   
18 1 PHE C 208 ? ? -119.71 -169.65 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 0 ? A MET 1 
2 1 Y 1 B MET 0 ? B MET 1 
3 1 Y 1 C MET 0 ? C MET 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'  ZN  
3 GLUTATHIONE GSH 
4 water       HOH 
#