data_1YPO
# 
_entry.id   1YPO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1YPO         
RCSB  RCSB031786   
WWPDB D_1000031786 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1YPQ . unspecified 
PDB 1YPU . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YPO 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Park, H.'        1 
'Adsit, F.G.'     2 
'Boyington, J.C.' 3 
# 
_citation.id                        primary 
_citation.title                     
'The 1.4 angstrom crystal structure of the human oxidized low density lipoprotein receptor lox-1.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            280 
_citation.page_first                13593 
_citation.page_last                 13599 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15695803 
_citation.pdbx_database_id_DOI      10.1074/jbc.M500768200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Park, H.'        1 
primary 'Adsit, F.G.'     2 
primary 'Boyington, J.C.' 3 
# 
_cell.entry_id           1YPO 
_cell.length_a           97.7 
_cell.length_b           97.7 
_cell.length_c           215.1 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        120 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              48 
# 
_symmetry.entry_id                         1YPO 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                152 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'oxidised low density lipoprotein (lectin-like) receptor 1' 
_entity.formula_weight             15040.122 
_entity.pdbx_number_of_molecules   8 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'C-type lectin-like domain (Residues 142-273)' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDG
SPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDG
SPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRA
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   PRO n 
1 4   CYS n 
1 5   PRO n 
1 6   GLN n 
1 7   ASP n 
1 8   TRP n 
1 9   ILE n 
1 10  TRP n 
1 11  HIS n 
1 12  GLY n 
1 13  GLU n 
1 14  ASN n 
1 15  CYS n 
1 16  TYR n 
1 17  LEU n 
1 18  PHE n 
1 19  SER n 
1 20  SER n 
1 21  GLY n 
1 22  SER n 
1 23  PHE n 
1 24  ASN n 
1 25  TRP n 
1 26  GLU n 
1 27  LYS n 
1 28  SER n 
1 29  GLN n 
1 30  GLU n 
1 31  LYS n 
1 32  CYS n 
1 33  LEU n 
1 34  SER n 
1 35  LEU n 
1 36  ASP n 
1 37  ALA n 
1 38  LYS n 
1 39  LEU n 
1 40  LEU n 
1 41  LYS n 
1 42  ILE n 
1 43  ASN n 
1 44  SER n 
1 45  THR n 
1 46  ALA n 
1 47  ASP n 
1 48  LEU n 
1 49  ASP n 
1 50  PHE n 
1 51  ILE n 
1 52  GLN n 
1 53  GLN n 
1 54  ALA n 
1 55  ILE n 
1 56  SER n 
1 57  TYR n 
1 58  SER n 
1 59  SER n 
1 60  PHE n 
1 61  PRO n 
1 62  PHE n 
1 63  TRP n 
1 64  MET n 
1 65  GLY n 
1 66  LEU n 
1 67  SER n 
1 68  ARG n 
1 69  ARG n 
1 70  ASN n 
1 71  PRO n 
1 72  SER n 
1 73  TYR n 
1 74  PRO n 
1 75  TRP n 
1 76  LEU n 
1 77  TRP n 
1 78  GLU n 
1 79  ASP n 
1 80  GLY n 
1 81  SER n 
1 82  PRO n 
1 83  LEU n 
1 84  MET n 
1 85  PRO n 
1 86  HIS n 
1 87  LEU n 
1 88  PHE n 
1 89  ARG n 
1 90  VAL n 
1 91  ARG n 
1 92  GLY n 
1 93  ALA n 
1 94  VAL n 
1 95  SER n 
1 96  GLN n 
1 97  THR n 
1 98  TYR n 
1 99  PRO n 
1 100 SER n 
1 101 GLY n 
1 102 THR n 
1 103 CYS n 
1 104 ALA n 
1 105 TYR n 
1 106 ILE n 
1 107 GLN n 
1 108 ARG n 
1 109 GLY n 
1 110 ALA n 
1 111 VAL n 
1 112 TYR n 
1 113 ALA n 
1 114 GLU n 
1 115 ASN n 
1 116 CYS n 
1 117 ILE n 
1 118 LEU n 
1 119 ALA n 
1 120 ALA n 
1 121 PHE n 
1 122 SER n 
1 123 ILE n 
1 124 CYS n 
1 125 GLN n 
1 126 LYS n 
1 127 LYS n 
1 128 ALA n 
1 129 ASN n 
1 130 LEU n 
1 131 ARG n 
1 132 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Origami B (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P78380_HUMAN 
_struct_ref.pdbx_db_accession          P78380 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;APCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGS
PLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRA
;
_struct_ref.pdbx_align_begin           142 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1YPO A 2 ? 132 ? P78380 142 ? 272 ? 142 272 
2 1 1YPO B 2 ? 132 ? P78380 142 ? 272 ? 142 272 
3 1 1YPO C 2 ? 132 ? P78380 142 ? 272 ? 142 272 
4 1 1YPO D 2 ? 132 ? P78380 142 ? 272 ? 142 272 
5 1 1YPO E 2 ? 132 ? P78380 142 ? 272 ? 142 272 
6 1 1YPO F 2 ? 132 ? P78380 142 ? 272 ? 142 272 
7 1 1YPO G 2 ? 132 ? P78380 142 ? 272 ? 142 272 
8 1 1YPO H 2 ? 132 ? P78380 142 ? 272 ? 142 272 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1YPO MET A 1 ? UNP P78380 ? ? 'INITIATING METHIONINE' 141 1 
2 1YPO MET B 1 ? UNP P78380 ? ? 'INITIATING METHIONINE' 141 2 
3 1YPO MET C 1 ? UNP P78380 ? ? 'INITIATING METHIONINE' 141 3 
4 1YPO MET D 1 ? UNP P78380 ? ? 'INITIATING METHIONINE' 141 4 
5 1YPO MET E 1 ? UNP P78380 ? ? 'INITIATING METHIONINE' 141 5 
6 1YPO MET F 1 ? UNP P78380 ? ? 'INITIATING METHIONINE' 141 6 
7 1YPO MET G 1 ? UNP P78380 ? ? 'INITIATING METHIONINE' 141 7 
8 1YPO MET H 1 ? UNP P78380 ? ? 'INITIATING METHIONINE' 141 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1YPO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   46.6 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'ammonium acetate, Bis-Tris, PEG 10K, HEPES, NaCl, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2004-09-01 
_diffrn_detector.details                'OSMIC MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.54 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1YPO 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   24056 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.101 
_reflns.pdbx_netI_over_sigmaI        22.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.300 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   96.7 
_reflns_shell.Rmerge_I_obs           0.496 
_reflns_shell.pdbx_Rsym_value        0.532 
_reflns_shell.meanI_over_sigI_obs    4.200 
_reflns_shell.pdbx_redundancy        2.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1YPO 
_refine.ls_number_reflns_obs                     22145 
_refine.ls_number_reflns_all                     23784 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               153980.69 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    93.1 
_refine.ls_R_factor_obs                          0.228 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.228 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1064 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               46.90 
_refine.aniso_B[1][1]                            0 
_refine.aniso_B[2][2]                            0 
_refine.aniso_B[3][3]                            0 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.385831 
_refine.solvent_model_param_bsol                 26.6771 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1YPQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1YPO 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.47 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.50 
_refine_analyze.Luzzati_sigma_a_free            0.58 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8363 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8363 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.20  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.20 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.80  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.18 
_refine_ls_shell.number_reflns_R_work             3272 
_refine_ls_shell.R_factor_R_work                  0.313 
_refine_ls_shell.percent_reflns_obs               87.3 
_refine_ls_shell.R_factor_R_free                  0.351 
_refine_ls_shell.R_factor_R_free_error            0.030 
_refine_ls_shell.percent_reflns_R_free            4.1 
_refine_ls_shell.number_reflns_R_free             139 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1YPO 
_struct.title                     'Human Oxidized Low Density Lipoprotein Receptor LOX-1 P3 1 21 Space Group' 
_struct.pdbx_descriptor           'oxidised low density lipoprotein (lectin-like) receptor 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YPO 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
'Oxidized Low Density Lipoprotein receptor, Lox-1, CTLD, C-type lectin like domain, NK Cell receptor, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The biological assembly is a dimer (chain A and B)' ? 
2 ?                                                    ? 
3 ?                                                    ? 
4 ?                                                    ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 24 ? SER A 34 ? ASN A 164 SER A 174 1 ? 11 
HELX_P HELX_P2  2  SER A 44 ? ILE A 55 ? SER A 184 ILE A 195 1 ? 12 
HELX_P HELX_P3  3  ASN B 24 ? LEU B 35 ? ASN B 164 LEU B 175 1 ? 12 
HELX_P HELX_P4  4  SER B 44 ? SER B 56 ? SER B 184 SER B 196 1 ? 13 
HELX_P HELX_P5  5  ASN C 24 ? SER C 34 ? ASN C 164 SER C 174 1 ? 11 
HELX_P HELX_P6  6  SER C 44 ? ILE C 55 ? SER C 184 ILE C 195 1 ? 12 
HELX_P HELX_P7  7  ASN D 24 ? SER D 34 ? ASN D 164 SER D 174 1 ? 11 
HELX_P HELX_P8  8  SER D 44 ? ALA D 54 ? SER D 184 ALA D 194 1 ? 11 
HELX_P HELX_P9  9  TRP E 25 ? LEU E 35 ? TRP E 165 LEU E 175 1 ? 11 
HELX_P HELX_P10 10 SER E 44 ? ALA E 54 ? SER E 184 ALA E 194 1 ? 11 
HELX_P HELX_P11 11 ASN F 24 ? LEU F 35 ? ASN F 164 LEU F 175 1 ? 12 
HELX_P HELX_P12 12 SER F 44 ? SER F 56 ? SER F 184 SER F 196 1 ? 13 
HELX_P HELX_P13 13 ASN G 24 ? LEU G 35 ? ASN G 164 LEU G 175 1 ? 12 
HELX_P HELX_P14 14 SER G 44 ? SER G 56 ? SER G 184 SER G 196 1 ? 13 
HELX_P HELX_P15 15 ASN H 24 ? LEU H 35 ? ASN H 164 LEU H 175 1 ? 12 
HELX_P HELX_P16 16 SER H 44 ? ILE H 55 ? SER H 184 ILE H 195 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 4   SG ? ? ? 1_555 A CYS 15  SG ? ? A CYS 144 A CYS 155 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf2  disulf ? ? A CYS 32  SG ? ? ? 1_555 A CYS 124 SG ? ? A CYS 172 A CYS 264 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf3  disulf ? ? A CYS 103 SG ? ? ? 1_555 A CYS 116 SG ? ? A CYS 243 A CYS 256 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf4  disulf ? ? B CYS 4   SG ? ? ? 1_555 B CYS 15  SG ? ? B CYS 144 B CYS 155 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf5  disulf ? ? B CYS 32  SG ? ? ? 1_555 B CYS 124 SG ? ? B CYS 172 B CYS 264 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf6  disulf ? ? B CYS 103 SG ? ? ? 1_555 B CYS 116 SG ? ? B CYS 243 B CYS 256 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf7  disulf ? ? C CYS 4   SG ? ? ? 1_555 C CYS 15  SG ? ? C CYS 144 C CYS 155 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf8  disulf ? ? C CYS 32  SG ? ? ? 1_555 C CYS 124 SG ? ? C CYS 172 C CYS 264 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf9  disulf ? ? C CYS 103 SG ? ? ? 1_555 C CYS 116 SG ? ? C CYS 243 C CYS 256 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf10 disulf ? ? D CYS 4   SG ? ? ? 1_555 D CYS 15  SG ? ? D CYS 144 D CYS 155 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf11 disulf ? ? D CYS 32  SG ? ? ? 1_555 D CYS 124 SG ? ? D CYS 172 D CYS 264 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf12 disulf ? ? D CYS 103 SG ? ? ? 1_555 D CYS 116 SG ? ? D CYS 243 D CYS 256 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf13 disulf ? ? E CYS 4   SG ? ? ? 1_555 E CYS 15  SG ? ? E CYS 144 E CYS 155 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf14 disulf ? ? E CYS 32  SG ? ? ? 1_555 E CYS 124 SG ? ? E CYS 172 E CYS 264 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf15 disulf ? ? E CYS 103 SG ? ? ? 1_555 E CYS 116 SG ? ? E CYS 243 E CYS 256 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf16 disulf ? ? F CYS 4   SG ? ? ? 1_555 F CYS 15  SG ? ? F CYS 144 F CYS 155 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf17 disulf ? ? F CYS 32  SG ? ? ? 1_555 F CYS 124 SG ? ? F CYS 172 F CYS 264 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf18 disulf ? ? F CYS 103 SG ? ? ? 1_555 F CYS 116 SG ? ? F CYS 243 F CYS 256 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf19 disulf ? ? G CYS 4   SG ? ? ? 1_555 G CYS 15  SG ? ? G CYS 144 G CYS 155 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf20 disulf ? ? G CYS 32  SG ? ? ? 1_555 G CYS 124 SG ? ? G CYS 172 G CYS 264 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf21 disulf ? ? G CYS 103 SG ? ? ? 1_555 G CYS 116 SG ? ? G CYS 243 G CYS 256 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf22 disulf ? ? H CYS 4   SG ? ? ? 1_555 H CYS 15  SG ? ? H CYS 144 H CYS 155 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf23 disulf ? ? H CYS 32  SG ? ? ? 1_555 H CYS 124 SG ? ? H CYS 172 H CYS 264 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf24 disulf ? ? H CYS 103 SG ? ? ? 1_555 H CYS 116 SG ? ? H CYS 243 H CYS 256 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5  ? 
B ? 6  ? 
C ? 5  ? 
D ? 6  ? 
E ? 4  ? 
F ? 7  ? 
G ? 4  ? 
H ? 7  ? 
I ? 13 ? 
J ? 4  ? 
K ? 7  ? 
L ? 4  ? 
M ? 7  ? 
N ? 4  ? 
O ? 7  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? parallel      
A 4  5  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? parallel      
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? parallel      
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? parallel      
C 4  5  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? parallel      
F 4  5  ? anti-parallel 
F 5  6  ? anti-parallel 
F 6  7  ? parallel      
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? parallel      
H 4  5  ? anti-parallel 
H 5  6  ? anti-parallel 
H 6  7  ? parallel      
I 1  2  ? anti-parallel 
I 2  3  ? anti-parallel 
I 3  4  ? anti-parallel 
I 4  5  ? anti-parallel 
I 5  6  ? anti-parallel 
I 6  7  ? anti-parallel 
I 7  8  ? parallel      
I 8  9  ? anti-parallel 
I 9  10 ? anti-parallel 
I 10 11 ? anti-parallel 
I 11 12 ? anti-parallel 
I 12 13 ? parallel      
J 1  2  ? anti-parallel 
J 2  3  ? anti-parallel 
J 3  4  ? anti-parallel 
K 1  2  ? anti-parallel 
K 2  3  ? anti-parallel 
K 3  4  ? parallel      
K 4  5  ? anti-parallel 
K 5  6  ? anti-parallel 
K 6  7  ? parallel      
L 1  2  ? anti-parallel 
L 2  3  ? anti-parallel 
L 3  4  ? anti-parallel 
M 1  2  ? anti-parallel 
M 2  3  ? anti-parallel 
M 3  4  ? parallel      
M 4  5  ? anti-parallel 
M 5  6  ? anti-parallel 
M 6  7  ? parallel      
N 1  2  ? anti-parallel 
N 2  3  ? anti-parallel 
N 3  4  ? anti-parallel 
O 1  2  ? anti-parallel 
O 2  3  ? anti-parallel 
O 3  4  ? parallel      
O 4  5  ? anti-parallel 
O 5  6  ? anti-parallel 
O 6  7  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ILE A 9   ? HIS A 11  ? ILE A 149 HIS A 151 
A 2  ASN A 14  ? PHE A 18  ? ASN A 154 PHE A 158 
A 3  PHE A 121 ? LYS A 127 ? PHE A 261 LYS A 267 
A 4  PHE A 62  ? ARG A 68  ? PHE A 202 ARG A 208 
A 5  LEU A 76  ? TRP A 77  ? LEU A 216 TRP A 217 
B 1  LYS A 38  ? LEU A 39  ? LYS A 178 LEU A 179 
B 2  PHE A 121 ? LYS A 127 ? PHE A 261 LYS A 267 
B 3  PHE A 62  ? ARG A 68  ? PHE A 202 ARG A 208 
B 4  THR A 102 ? GLN A 107 ? THR A 242 GLN A 247 
B 5  ALA A 110 ? ASN A 115 ? ALA A 250 ASN A 255 
B 6  ARG A 91  ? GLY A 92  ? ARG A 231 GLY A 232 
C 1  ILE B 9   ? HIS B 11  ? ILE B 149 HIS B 151 
C 2  ASN B 14  ? PHE B 18  ? ASN B 154 PHE B 158 
C 3  PHE B 121 ? LYS B 127 ? PHE B 261 LYS B 267 
C 4  PRO B 61  ? ARG B 68  ? PRO B 201 ARG B 208 
C 5  LEU B 76  ? TRP B 77  ? LEU B 216 TRP B 217 
D 1  LYS B 38  ? LEU B 39  ? LYS B 178 LEU B 179 
D 2  PHE B 121 ? LYS B 127 ? PHE B 261 LYS B 267 
D 3  PRO B 61  ? ARG B 68  ? PRO B 201 ARG B 208 
D 4  THR B 102 ? GLN B 107 ? THR B 242 GLN B 247 
D 5  ALA B 110 ? ASN B 115 ? ALA B 250 ASN B 255 
D 6  ARG B 91  ? GLY B 92  ? ARG B 231 GLY B 232 
E 1  ILE C 9   ? HIS C 11  ? ILE C 149 HIS C 151 
E 2  ASN C 14  ? PHE C 18  ? ASN C 154 PHE C 158 
E 3  PHE C 121 ? LYS C 127 ? PHE C 261 LYS C 267 
E 4  LYS C 38  ? LEU C 39  ? LYS C 178 LEU C 179 
F 1  ILE C 9   ? HIS C 11  ? ILE C 149 HIS C 151 
F 2  ASN C 14  ? PHE C 18  ? ASN C 154 PHE C 158 
F 3  PHE C 121 ? LYS C 127 ? PHE C 261 LYS C 267 
F 4  PHE C 62  ? ARG C 68  ? PHE C 202 ARG C 208 
F 5  THR C 102 ? GLN C 107 ? THR C 242 GLN C 247 
F 6  ALA C 110 ? ASN C 115 ? ALA C 250 ASN C 255 
F 7  ARG C 91  ? GLY C 92  ? ARG C 231 GLY C 232 
G 1  ILE D 9   ? HIS D 11  ? ILE D 149 HIS D 151 
G 2  ASN D 14  ? PHE D 18  ? ASN D 154 PHE D 158 
G 3  PHE D 121 ? LYS D 127 ? PHE D 261 LYS D 267 
G 4  LYS D 38  ? LEU D 39  ? LYS D 178 LEU D 179 
H 1  ILE D 9   ? HIS D 11  ? ILE D 149 HIS D 151 
H 2  ASN D 14  ? PHE D 18  ? ASN D 154 PHE D 158 
H 3  PHE D 121 ? LYS D 127 ? PHE D 261 LYS D 267 
H 4  PHE D 62  ? ARG D 68  ? PHE D 202 ARG D 208 
H 5  THR D 102 ? GLN D 107 ? THR D 242 GLN D 247 
H 6  ALA D 110 ? ASN D 115 ? ALA D 250 ASN D 255 
H 7  VAL D 90  ? GLY D 92  ? VAL D 230 GLY D 232 
I 1  ILE E 9   ? HIS E 11  ? ILE E 149 HIS E 151 
I 2  ASN E 14  ? PHE E 18  ? ASN E 154 PHE E 158 
I 3  ALA E 119 ? LYS E 127 ? ALA E 259 LYS E 267 
I 4  PHE E 23  ? ASN E 24  ? PHE E 163 ASN E 164 
I 5  ALA E 119 ? LYS E 127 ? ALA E 259 LYS E 267 
I 6  LYS E 38  ? LEU E 39  ? LYS E 178 LEU E 179 
I 7  ALA E 119 ? LYS E 127 ? ALA E 259 LYS E 267 
I 8  PHE E 62  ? ARG E 68  ? PHE E 202 ARG E 208 
I 9  LEU E 76  ? TRP E 77  ? LEU E 216 TRP E 217 
I 10 PHE E 62  ? ARG E 68  ? PHE E 202 ARG E 208 
I 11 THR E 102 ? GLN E 107 ? THR E 242 GLN E 247 
I 12 ALA E 110 ? ASN E 115 ? ALA E 250 ASN E 255 
I 13 VAL E 90  ? GLY E 92  ? VAL E 230 GLY E 232 
J 1  ILE F 9   ? HIS F 11  ? ILE F 149 HIS F 151 
J 2  ASN F 14  ? PHE F 18  ? ASN F 154 PHE F 158 
J 3  PHE F 121 ? LYS F 127 ? PHE F 261 LYS F 267 
J 4  LYS F 38  ? LEU F 39  ? LYS F 178 LEU F 179 
K 1  ILE F 9   ? HIS F 11  ? ILE F 149 HIS F 151 
K 2  ASN F 14  ? PHE F 18  ? ASN F 154 PHE F 158 
K 3  PHE F 121 ? LYS F 127 ? PHE F 261 LYS F 267 
K 4  PHE F 62  ? ARG F 68  ? PHE F 202 ARG F 208 
K 5  THR F 102 ? GLN F 107 ? THR F 242 GLN F 247 
K 6  ALA F 110 ? ASN F 115 ? ALA F 250 ASN F 255 
K 7  ARG F 91  ? GLY F 92  ? ARG F 231 GLY F 232 
L 1  ILE G 9   ? HIS G 11  ? ILE G 149 HIS G 151 
L 2  ASN G 14  ? PHE G 18  ? ASN G 154 PHE G 158 
L 3  PHE G 121 ? LYS G 127 ? PHE G 261 LYS G 267 
L 4  LYS G 38  ? LEU G 39  ? LYS G 178 LEU G 179 
M 1  ILE G 9   ? HIS G 11  ? ILE G 149 HIS G 151 
M 2  ASN G 14  ? PHE G 18  ? ASN G 154 PHE G 158 
M 3  PHE G 121 ? LYS G 127 ? PHE G 261 LYS G 267 
M 4  PHE G 62  ? ARG G 68  ? PHE G 202 ARG G 208 
M 5  THR G 102 ? GLN G 107 ? THR G 242 GLN G 247 
M 6  ALA G 110 ? ALA G 113 ? ALA G 250 ALA G 253 
M 7  ARG G 91  ? GLY G 92  ? ARG G 231 GLY G 232 
N 1  ILE H 9   ? HIS H 11  ? ILE H 149 HIS H 151 
N 2  ASN H 14  ? PHE H 18  ? ASN H 154 PHE H 158 
N 3  PHE H 121 ? LYS H 127 ? PHE H 261 LYS H 267 
N 4  LYS H 38  ? LEU H 39  ? LYS H 178 LEU H 179 
O 1  ILE H 9   ? HIS H 11  ? ILE H 149 HIS H 151 
O 2  ASN H 14  ? PHE H 18  ? ASN H 154 PHE H 158 
O 3  PHE H 121 ? LYS H 127 ? PHE H 261 LYS H 267 
O 4  PHE H 62  ? ARG H 68  ? PHE H 202 ARG H 208 
O 5  THR H 102 ? GLN H 107 ? THR H 242 GLN H 247 
O 6  ALA H 110 ? ASN H 115 ? ALA H 250 ASN H 255 
O 7  VAL H 90  ? GLY H 92  ? VAL H 230 GLY H 232 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N HIS A 11  ? N HIS A 151 O ASN A 14  ? O ASN A 154 
A 2  3  N LEU A 17  ? N LEU A 157 O CYS A 124 ? O CYS A 264 
A 3  4  O PHE A 121 ? O PHE A 261 N TRP A 63  ? N TRP A 203 
A 4  5  N SER A 67  ? N SER A 207 O LEU A 76  ? O LEU A 216 
B 1  2  N LYS A 38  ? N LYS A 178 O GLN A 125 ? O GLN A 265 
B 2  3  O PHE A 121 ? O PHE A 261 N TRP A 63  ? N TRP A 203 
B 3  4  N ARG A 68  ? N ARG A 208 O THR A 102 ? O THR A 242 
B 4  5  N GLN A 107 ? N GLN A 247 O ALA A 110 ? O ALA A 250 
B 5  6  O VAL A 111 ? O VAL A 251 N ARG A 91  ? N ARG A 231 
C 1  2  N ILE B 9   ? N ILE B 149 O TYR B 16  ? O TYR B 156 
C 2  3  N LEU B 17  ? N LEU B 157 O CYS B 124 ? O CYS B 264 
C 3  4  O PHE B 121 ? O PHE B 261 N TRP B 63  ? N TRP B 203 
C 4  5  N SER B 67  ? N SER B 207 O LEU B 76  ? O LEU B 216 
D 1  2  N LYS B 38  ? N LYS B 178 O GLN B 125 ? O GLN B 265 
D 2  3  O PHE B 121 ? O PHE B 261 N TRP B 63  ? N TRP B 203 
D 3  4  N ARG B 68  ? N ARG B 208 O THR B 102 ? O THR B 242 
D 4  5  N TYR B 105 ? N TYR B 245 O TYR B 112 ? O TYR B 252 
D 5  6  O ALA B 113 ? O ALA B 253 N ARG B 91  ? N ARG B 231 
E 1  2  N ILE C 9   ? N ILE C 149 O TYR C 16  ? O TYR C 156 
E 2  3  N LEU C 17  ? N LEU C 157 O CYS C 124 ? O CYS C 264 
E 3  4  O GLN C 125 ? O GLN C 265 N LYS C 38  ? N LYS C 178 
F 1  2  N ILE C 9   ? N ILE C 149 O TYR C 16  ? O TYR C 156 
F 2  3  N LEU C 17  ? N LEU C 157 O CYS C 124 ? O CYS C 264 
F 3  4  O PHE C 121 ? O PHE C 261 N TRP C 63  ? N TRP C 203 
F 4  5  N ARG C 68  ? N ARG C 208 O THR C 102 ? O THR C 242 
F 5  6  N CYS C 103 ? N CYS C 243 O GLU C 114 ? O GLU C 254 
F 6  7  O VAL C 111 ? O VAL C 251 N ARG C 91  ? N ARG C 231 
G 1  2  N ILE D 9   ? N ILE D 149 O TYR D 16  ? O TYR D 156 
G 2  3  N LEU D 17  ? N LEU D 157 O CYS D 124 ? O CYS D 264 
G 3  4  O GLN D 125 ? O GLN D 265 N LYS D 38  ? N LYS D 178 
H 1  2  N ILE D 9   ? N ILE D 149 O TYR D 16  ? O TYR D 156 
H 2  3  N LEU D 17  ? N LEU D 157 O CYS D 124 ? O CYS D 264 
H 3  4  O PHE D 121 ? O PHE D 261 N TRP D 63  ? N TRP D 203 
H 4  5  N ARG D 68  ? N ARG D 208 O THR D 102 ? O THR D 242 
H 5  6  N GLN D 107 ? N GLN D 247 O ALA D 110 ? O ALA D 250 
H 6  7  O ALA D 113 ? O ALA D 253 N ARG D 91  ? N ARG D 231 
I 1  2  N ILE E 9   ? N ILE E 149 O TYR E 16  ? O TYR E 156 
I 2  3  N LEU E 17  ? N LEU E 157 O CYS E 124 ? O CYS E 264 
I 3  4  O ALA E 120 ? O ALA E 260 N PHE E 23  ? N PHE E 163 
I 4  5  N PHE E 23  ? N PHE E 163 O ALA E 120 ? O ALA E 260 
I 5  6  O GLN E 125 ? O GLN E 265 N LYS E 38  ? N LYS E 178 
I 6  7  N LYS E 38  ? N LYS E 178 O GLN E 125 ? O GLN E 265 
I 7  8  O PHE E 121 ? O PHE E 261 N TRP E 63  ? N TRP E 203 
I 8  9  N SER E 67  ? N SER E 207 O LEU E 76  ? O LEU E 216 
I 9  10 O LEU E 76  ? O LEU E 216 N SER E 67  ? N SER E 207 
I 10 11 N PHE E 62  ? N PHE E 202 O ILE E 106 ? O ILE E 246 
I 11 12 N TYR E 105 ? N TYR E 245 O TYR E 112 ? O TYR E 252 
I 12 13 O ALA E 113 ? O ALA E 253 N ARG E 91  ? N ARG E 231 
J 1  2  N ILE F 9   ? N ILE F 149 O TYR F 16  ? O TYR F 156 
J 2  3  N CYS F 15  ? N CYS F 155 O LYS F 126 ? O LYS F 266 
J 3  4  O GLN F 125 ? O GLN F 265 N LYS F 38  ? N LYS F 178 
K 1  2  N ILE F 9   ? N ILE F 149 O TYR F 16  ? O TYR F 156 
K 2  3  N CYS F 15  ? N CYS F 155 O LYS F 126 ? O LYS F 266 
K 3  4  O PHE F 121 ? O PHE F 261 N TRP F 63  ? N TRP F 203 
K 4  5  N PHE F 62  ? N PHE F 202 O ILE F 106 ? O ILE F 246 
K 5  6  N GLN F 107 ? N GLN F 247 O ALA F 110 ? O ALA F 250 
K 6  7  O ALA F 113 ? O ALA F 253 N ARG F 91  ? N ARG F 231 
L 1  2  N ILE G 9   ? N ILE G 149 O TYR G 16  ? O TYR G 156 
L 2  3  N LEU G 17  ? N LEU G 157 O CYS G 124 ? O CYS G 264 
L 3  4  O GLN G 125 ? O GLN G 265 N LYS G 38  ? N LYS G 178 
M 1  2  N ILE G 9   ? N ILE G 149 O TYR G 16  ? O TYR G 156 
M 2  3  N LEU G 17  ? N LEU G 157 O CYS G 124 ? O CYS G 264 
M 3  4  O PHE G 121 ? O PHE G 261 N TRP G 63  ? N TRP G 203 
M 4  5  N PHE G 62  ? N PHE G 202 O ILE G 106 ? O ILE G 246 
M 5  6  N TYR G 105 ? N TYR G 245 O TYR G 112 ? O TYR G 252 
M 6  7  N VAL G 111 ? N VAL G 251 O ARG G 91  ? O ARG G 231 
N 1  2  N ILE H 9   ? N ILE H 149 O TYR H 16  ? O TYR H 156 
N 2  3  N CYS H 15  ? N CYS H 155 O LYS H 126 ? O LYS H 266 
N 3  4  O GLN H 125 ? O GLN H 265 N LYS H 38  ? N LYS H 178 
O 1  2  N ILE H 9   ? N ILE H 149 O TYR H 16  ? O TYR H 156 
O 2  3  N CYS H 15  ? N CYS H 155 O LYS H 126 ? O LYS H 266 
O 3  4  O PHE H 121 ? O PHE H 261 N TRP H 63  ? N TRP H 203 
O 4  5  N PHE H 62  ? N PHE H 202 O ILE H 106 ? O ILE H 246 
O 5  6  N CYS H 103 ? N CYS H 243 O GLU H 114 ? O GLU H 254 
O 6  7  O ALA H 113 ? O ALA H 253 N ARG H 91  ? N ARG H 231 
# 
_atom_sites.entry_id                    1YPO 
_atom_sites.fract_transf_matrix[1][1]   0.010235 
_atom_sites.fract_transf_matrix[1][2]   0.005909 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011819 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004649 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ALA A 1 2   ? 29.218  41.101  17.063  1.00 42.98 ? 142 ALA A N   1 
ATOM 2    C CA  . ALA A 1 2   ? 27.727  41.114  17.117  1.00 43.02 ? 142 ALA A CA  1 
ATOM 3    C C   . ALA A 1 2   ? 27.217  40.248  18.265  1.00 42.75 ? 142 ALA A C   1 
ATOM 4    O O   . ALA A 1 2   ? 27.532  39.062  18.352  1.00 42.46 ? 142 ALA A O   1 
ATOM 5    C CB  . ALA A 1 2   ? 27.150  40.614  15.796  1.00 41.89 ? 142 ALA A CB  1 
ATOM 6    N N   . PRO A 1 3   ? 26.423  40.840  19.168  1.00 41.75 ? 143 PRO A N   1 
ATOM 7    C CA  . PRO A 1 3   ? 25.875  40.106  20.309  1.00 40.81 ? 143 PRO A CA  1 
ATOM 8    C C   . PRO A 1 3   ? 24.885  39.043  19.853  1.00 40.96 ? 143 PRO A C   1 
ATOM 9    O O   . PRO A 1 3   ? 25.039  37.858  20.148  1.00 40.72 ? 143 PRO A O   1 
ATOM 10   C CB  . PRO A 1 3   ? 25.189  41.200  21.131  1.00 40.90 ? 143 PRO A CB  1 
ATOM 11   C CG  . PRO A 1 3   ? 25.952  42.436  20.775  1.00 41.49 ? 143 PRO A CG  1 
ATOM 12   C CD  . PRO A 1 3   ? 26.131  42.278  19.289  1.00 42.47 ? 143 PRO A CD  1 
ATOM 13   N N   . CYS A 1 4   ? 23.876  39.485  19.113  1.00 40.85 ? 144 CYS A N   1 
ATOM 14   C CA  . CYS A 1 4   ? 22.827  38.601  18.635  1.00 39.85 ? 144 CYS A CA  1 
ATOM 15   C C   . CYS A 1 4   ? 22.747  38.552  17.118  1.00 38.88 ? 144 CYS A C   1 
ATOM 16   O O   . CYS A 1 4   ? 23.404  39.327  16.427  1.00 41.06 ? 144 CYS A O   1 
ATOM 17   C CB  . CYS A 1 4   ? 21.485  39.083  19.179  1.00 40.77 ? 144 CYS A CB  1 
ATOM 18   S SG  . CYS A 1 4   ? 21.402  39.241  20.986  1.00 42.71 ? 144 CYS A SG  1 
ATOM 19   N N   . PRO A 1 5   ? 21.938  37.626  16.581  1.00 37.46 ? 145 PRO A N   1 
ATOM 20   C CA  . PRO A 1 5   ? 21.764  37.487  15.133  1.00 37.04 ? 145 PRO A CA  1 
ATOM 21   C C   . PRO A 1 5   ? 20.880  38.628  14.627  1.00 36.94 ? 145 PRO A C   1 
ATOM 22   O O   . PRO A 1 5   ? 20.430  39.470  15.408  1.00 36.72 ? 145 PRO A O   1 
ATOM 23   C CB  . PRO A 1 5   ? 21.065  36.138  14.996  1.00 35.71 ? 145 PRO A CB  1 
ATOM 24   C CG  . PRO A 1 5   ? 21.506  35.396  16.205  1.00 36.88 ? 145 PRO A CG  1 
ATOM 25   C CD  . PRO A 1 5   ? 21.405  36.443  17.274  1.00 37.31 ? 145 PRO A CD  1 
ATOM 26   N N   . GLN A 1 6   ? 20.634  38.659  13.323  1.00 36.61 ? 146 GLN A N   1 
ATOM 27   C CA  . GLN A 1 6   ? 19.784  39.692  12.756  1.00 36.43 ? 146 GLN A CA  1 
ATOM 28   C C   . GLN A 1 6   ? 18.337  39.256  12.920  1.00 35.64 ? 146 GLN A C   1 
ATOM 29   O O   . GLN A 1 6   ? 18.030  38.074  12.798  1.00 36.11 ? 146 GLN A O   1 
ATOM 30   C CB  . GLN A 1 6   ? 20.105  39.899  11.276  1.00 38.58 ? 146 GLN A CB  1 
ATOM 31   C CG  . GLN A 1 6   ? 21.494  40.461  11.020  1.00 42.63 ? 146 GLN A CG  1 
ATOM 32   C CD  . GLN A 1 6   ? 21.738  40.777  9.560   1.00 44.44 ? 146 GLN A CD  1 
ATOM 33   O OE1 . GLN A 1 6   ? 20.957  41.495  8.930   1.00 44.68 ? 146 GLN A OE1 1 
ATOM 34   N NE2 . GLN A 1 6   ? 22.831  40.251  9.014   1.00 44.07 ? 146 GLN A NE2 1 
ATOM 35   N N   . ASP A 1 7   ? 17.462  40.215  13.206  1.00 35.00 ? 147 ASP A N   1 
ATOM 36   C CA  . ASP A 1 7   ? 16.031  39.970  13.404  1.00 35.10 ? 147 ASP A CA  1 
ATOM 37   C C   . ASP A 1 7   ? 15.674  39.661  14.850  1.00 34.38 ? 147 ASP A C   1 
ATOM 38   O O   . ASP A 1 7   ? 14.503  39.645  15.217  1.00 33.90 ? 147 ASP A O   1 
ATOM 39   C CB  . ASP A 1 7   ? 15.526  38.842  12.499  1.00 34.05 ? 147 ASP A CB  1 
ATOM 40   C CG  . ASP A 1 7   ? 15.681  39.169  11.037  1.00 32.24 ? 147 ASP A CG  1 
ATOM 41   O OD1 . ASP A 1 7   ? 15.357  40.311  10.654  1.00 32.03 ? 147 ASP A OD1 1 
ATOM 42   O OD2 . ASP A 1 7   ? 16.115  38.287  10.270  1.00 31.82 ? 147 ASP A OD2 1 
ATOM 43   N N   . TRP A 1 8   ? 16.683  39.404  15.669  1.00 34.31 ? 148 TRP A N   1 
ATOM 44   C CA  . TRP A 1 8   ? 16.451  39.137  17.078  1.00 34.82 ? 148 TRP A CA  1 
ATOM 45   C C   . TRP A 1 8   ? 16.497  40.481  17.792  1.00 35.57 ? 148 TRP A C   1 
ATOM 46   O O   . TRP A 1 8   ? 16.667  41.524  17.162  1.00 36.94 ? 148 TRP A O   1 
ATOM 47   C CB  . TRP A 1 8   ? 17.538  38.210  17.632  1.00 32.62 ? 148 TRP A CB  1 
ATOM 48   C CG  . TRP A 1 8   ? 17.478  36.829  17.066  1.00 32.21 ? 148 TRP A CG  1 
ATOM 49   C CD1 . TRP A 1 8   ? 17.612  36.471  15.755  1.00 30.88 ? 148 TRP A CD1 1 
ATOM 50   C CD2 . TRP A 1 8   ? 17.245  35.614  17.791  1.00 33.71 ? 148 TRP A CD2 1 
ATOM 51   N NE1 . TRP A 1 8   ? 17.478  35.109  15.616  1.00 30.54 ? 148 TRP A NE1 1 
ATOM 52   C CE2 . TRP A 1 8   ? 17.251  34.557  16.851  1.00 31.96 ? 148 TRP A CE2 1 
ATOM 53   C CE3 . TRP A 1 8   ? 17.030  35.311  19.147  1.00 33.78 ? 148 TRP A CE3 1 
ATOM 54   C CZ2 . TRP A 1 8   ? 17.051  33.218  17.221  1.00 30.35 ? 148 TRP A CZ2 1 
ATOM 55   C CZ3 . TRP A 1 8   ? 16.830  33.977  19.514  1.00 32.04 ? 148 TRP A CZ3 1 
ATOM 56   C CH2 . TRP A 1 8   ? 16.843  32.950  18.550  1.00 29.97 ? 148 TRP A CH2 1 
ATOM 57   N N   . ILE A 1 9   ? 16.325  40.456  19.104  1.00 35.69 ? 149 ILE A N   1 
ATOM 58   C CA  . ILE A 1 9   ? 16.384  41.667  19.904  1.00 35.94 ? 149 ILE A CA  1 
ATOM 59   C C   . ILE A 1 9   ? 17.416  41.382  20.981  1.00 38.21 ? 149 ILE A C   1 
ATOM 60   O O   . ILE A 1 9   ? 17.275  40.427  21.749  1.00 39.09 ? 149 ILE A O   1 
ATOM 61   C CB  . ILE A 1 9   ? 15.051  41.960  20.584  1.00 34.26 ? 149 ILE A CB  1 
ATOM 62   C CG1 . ILE A 1 9   ? 13.940  42.048  19.543  1.00 32.68 ? 149 ILE A CG1 1 
ATOM 63   C CG2 . ILE A 1 9   ? 15.160  43.247  21.374  1.00 33.35 ? 149 ILE A CG2 1 
ATOM 64   C CD1 . ILE A 1 9   ? 12.556  42.015  20.152  1.00 30.74 ? 149 ILE A CD1 1 
ATOM 65   N N   . TRP A 1 10  ? 18.469  42.185  21.027  1.00 38.86 ? 150 TRP A N   1 
ATOM 66   C CA  . TRP A 1 10  ? 19.498  41.974  22.028  1.00 39.69 ? 150 TRP A CA  1 
ATOM 67   C C   . TRP A 1 10  ? 19.149  42.706  23.314  1.00 39.65 ? 150 TRP A C   1 
ATOM 68   O O   . TRP A 1 10  ? 19.118  43.935  23.357  1.00 40.36 ? 150 TRP A O   1 
ATOM 69   C CB  . TRP A 1 10  ? 20.860  42.436  21.503  1.00 39.80 ? 150 TRP A CB  1 
ATOM 70   C CG  . TRP A 1 10  ? 21.879  42.580  22.577  1.00 39.92 ? 150 TRP A CG  1 
ATOM 71   C CD1 . TRP A 1 10  ? 22.186  41.672  23.550  1.00 40.48 ? 150 TRP A CD1 1 
ATOM 72   C CD2 . TRP A 1 10  ? 22.707  43.718  22.813  1.00 40.47 ? 150 TRP A CD2 1 
ATOM 73   N NE1 . TRP A 1 10  ? 23.153  42.180  24.384  1.00 39.30 ? 150 TRP A NE1 1 
ATOM 74   C CE2 . TRP A 1 10  ? 23.492  43.435  23.952  1.00 40.87 ? 150 TRP A CE2 1 
ATOM 75   C CE3 . TRP A 1 10  ? 22.864  44.952  22.171  1.00 40.14 ? 150 TRP A CE3 1 
ATOM 76   C CZ2 . TRP A 1 10  ? 24.419  44.345  24.464  1.00 41.13 ? 150 TRP A CZ2 1 
ATOM 77   C CZ3 . TRP A 1 10  ? 23.786  45.856  22.680  1.00 39.51 ? 150 TRP A CZ3 1 
ATOM 78   C CH2 . TRP A 1 10  ? 24.552  45.546  23.814  1.00 39.73 ? 150 TRP A CH2 1 
ATOM 79   N N   . HIS A 1 11  ? 18.876  41.934  24.359  1.00 39.99 ? 151 HIS A N   1 
ATOM 80   C CA  . HIS A 1 11  ? 18.532  42.491  25.659  1.00 39.99 ? 151 HIS A CA  1 
ATOM 81   C C   . HIS A 1 11  ? 19.410  41.869  26.738  1.00 40.35 ? 151 HIS A C   1 
ATOM 82   O O   . HIS A 1 11  ? 19.624  40.654  26.755  1.00 39.24 ? 151 HIS A O   1 
ATOM 83   C CB  . HIS A 1 11  ? 17.066  42.222  25.979  1.00 39.52 ? 151 HIS A CB  1 
ATOM 84   C CG  . HIS A 1 11  ? 16.577  42.936  27.199  1.00 39.77 ? 151 HIS A CG  1 
ATOM 85   N ND1 . HIS A 1 11  ? 16.602  44.309  27.316  1.00 39.56 ? 151 HIS A ND1 1 
ATOM 86   C CD2 . HIS A 1 11  ? 16.030  42.470  28.345  1.00 39.37 ? 151 HIS A CD2 1 
ATOM 87   C CE1 . HIS A 1 11  ? 16.088  44.658  28.481  1.00 39.14 ? 151 HIS A CE1 1 
ATOM 88   N NE2 . HIS A 1 11  ? 15.732  43.561  29.126  1.00 39.39 ? 151 HIS A NE2 1 
ATOM 89   N N   . GLY A 1 12  ? 19.916  42.711  27.632  1.00 39.78 ? 152 GLY A N   1 
ATOM 90   C CA  . GLY A 1 12  ? 20.768  42.232  28.698  1.00 40.34 ? 152 GLY A CA  1 
ATOM 91   C C   . GLY A 1 12  ? 21.811  41.254  28.207  1.00 41.83 ? 152 GLY A C   1 
ATOM 92   O O   . GLY A 1 12  ? 22.615  41.567  27.334  1.00 42.78 ? 152 GLY A O   1 
ATOM 93   N N   . GLU A 1 13  ? 21.777  40.050  28.761  1.00 44.19 ? 153 GLU A N   1 
ATOM 94   C CA  . GLU A 1 13  ? 22.733  39.015  28.403  1.00 46.26 ? 153 GLU A CA  1 
ATOM 95   C C   . GLU A 1 13  ? 22.123  37.984  27.468  1.00 45.55 ? 153 GLU A C   1 
ATOM 96   O O   . GLU A 1 13  ? 22.766  37.000  27.114  1.00 46.08 ? 153 GLU A O   1 
ATOM 97   C CB  . GLU A 1 13  ? 23.229  38.328  29.675  1.00 49.60 ? 153 GLU A CB  1 
ATOM 98   C CG  . GLU A 1 13  ? 23.638  39.310  30.764  1.00 53.93 ? 153 GLU A CG  1 
ATOM 99   C CD  . GLU A 1 13  ? 24.142  38.624  32.014  1.00 55.79 ? 153 GLU A CD  1 
ATOM 100  O OE1 . GLU A 1 13  ? 24.452  39.338  32.994  1.00 57.12 ? 153 GLU A OE1 1 
ATOM 101  O OE2 . GLU A 1 13  ? 24.229  37.376  32.015  1.00 55.59 ? 153 GLU A OE2 1 
ATOM 102  N N   . ASN A 1 14  ? 20.880  38.215  27.067  1.00 45.14 ? 154 ASN A N   1 
ATOM 103  C CA  . ASN A 1 14  ? 20.192  37.289  26.180  1.00 44.69 ? 154 ASN A CA  1 
ATOM 104  C C   . ASN A 1 14  ? 19.778  37.921  24.864  1.00 44.16 ? 154 ASN A C   1 
ATOM 105  O O   . ASN A 1 14  ? 19.882  39.134  24.677  1.00 43.45 ? 154 ASN A O   1 
ATOM 106  C CB  . ASN A 1 14  ? 18.952  36.722  26.872  1.00 45.09 ? 154 ASN A CB  1 
ATOM 107  C CG  . ASN A 1 14  ? 19.298  35.823  28.032  1.00 44.31 ? 154 ASN A CG  1 
ATOM 108  O OD1 . ASN A 1 14  ? 19.846  34.739  27.845  1.00 45.20 ? 154 ASN A OD1 1 
ATOM 109  N ND2 . ASN A 1 14  ? 18.987  36.270  29.242  1.00 44.83 ? 154 ASN A ND2 1 
ATOM 110  N N   . CYS A 1 15  ? 19.313  37.069  23.957  1.00 43.46 ? 155 CYS A N   1 
ATOM 111  C CA  . CYS A 1 15  ? 18.842  37.483  22.643  1.00 42.67 ? 155 CYS A CA  1 
ATOM 112  C C   . CYS A 1 15  ? 17.411  36.993  22.546  1.00 42.15 ? 155 CYS A C   1 
ATOM 113  O O   . CYS A 1 15  ? 17.102  35.898  23.011  1.00 43.11 ? 155 CYS A O   1 
ATOM 114  C CB  . CYS A 1 15  ? 19.679  36.832  21.549  1.00 41.61 ? 155 CYS A CB  1 
ATOM 115  S SG  . CYS A 1 15  ? 21.429  37.306  21.598  1.00 42.86 ? 155 CYS A SG  1 
ATOM 116  N N   . TYR A 1 16  ? 16.537  37.787  21.943  1.00 40.69 ? 156 TYR A N   1 
ATOM 117  C CA  . TYR A 1 16  ? 15.147  37.378  21.840  1.00 39.65 ? 156 TYR A CA  1 
ATOM 118  C C   . TYR A 1 16  ? 14.553  37.404  20.442  1.00 40.62 ? 156 TYR A C   1 
ATOM 119  O O   . TYR A 1 16  ? 14.687  38.383  19.711  1.00 42.47 ? 156 TYR A O   1 
ATOM 120  C CB  . TYR A 1 16  ? 14.286  38.234  22.769  1.00 37.00 ? 156 TYR A CB  1 
ATOM 121  C CG  . TYR A 1 16  ? 14.625  38.070  24.233  1.00 35.44 ? 156 TYR A CG  1 
ATOM 122  C CD1 . TYR A 1 16  ? 15.672  38.784  24.815  1.00 34.72 ? 156 TYR A CD1 1 
ATOM 123  C CD2 . TYR A 1 16  ? 13.916  37.176  25.030  1.00 32.93 ? 156 TYR A CD2 1 
ATOM 124  C CE1 . TYR A 1 16  ? 16.001  38.610  26.153  1.00 32.45 ? 156 TYR A CE1 1 
ATOM 125  C CE2 . TYR A 1 16  ? 14.237  36.996  26.361  1.00 33.05 ? 156 TYR A CE2 1 
ATOM 126  C CZ  . TYR A 1 16  ? 15.278  37.714  26.918  1.00 32.72 ? 156 TYR A CZ  1 
ATOM 127  O OH  . TYR A 1 16  ? 15.585  37.531  28.245  1.00 35.07 ? 156 TYR A OH  1 
ATOM 128  N N   . LEU A 1 17  ? 13.893  36.310  20.079  1.00 40.51 ? 157 LEU A N   1 
ATOM 129  C CA  . LEU A 1 17  ? 13.240  36.208  18.787  1.00 40.61 ? 157 LEU A CA  1 
ATOM 130  C C   . LEU A 1 17  ? 11.753  35.993  19.008  1.00 41.87 ? 157 LEU A C   1 
ATOM 131  O O   . LEU A 1 17  ? 11.341  35.438  20.023  1.00 40.77 ? 157 LEU A O   1 
ATOM 132  C CB  . LEU A 1 17  ? 13.795  35.039  17.978  1.00 40.35 ? 157 LEU A CB  1 
ATOM 133  C CG  . LEU A 1 17  ? 13.089  34.845  16.633  1.00 40.19 ? 157 LEU A CG  1 
ATOM 134  C CD1 . LEU A 1 17  ? 13.286  36.079  15.765  1.00 39.88 ? 157 LEU A CD1 1 
ATOM 135  C CD2 . LEU A 1 17  ? 13.633  33.619  15.938  1.00 39.63 ? 157 LEU A CD2 1 
ATOM 136  N N   . PHE A 1 18  ? 10.952  36.442  18.051  1.00 44.84 ? 158 PHE A N   1 
ATOM 137  C CA  . PHE A 1 18  ? 9.508   36.293  18.131  1.00 47.51 ? 158 PHE A CA  1 
ATOM 138  C C   . PHE A 1 18  ? 9.027   35.280  17.115  1.00 48.77 ? 158 PHE A C   1 
ATOM 139  O O   . PHE A 1 18  ? 9.143   35.484  15.909  1.00 50.99 ? 158 PHE A O   1 
ATOM 140  C CB  . PHE A 1 18  ? 8.831   37.641  17.910  1.00 48.09 ? 158 PHE A CB  1 
ATOM 141  C CG  . PHE A 1 18  ? 8.914   38.548  19.098  1.00 50.47 ? 158 PHE A CG  1 
ATOM 142  C CD1 . PHE A 1 18  ? 10.112  38.695  19.795  1.00 52.04 ? 158 PHE A CD1 1 
ATOM 143  C CD2 . PHE A 1 18  ? 7.798   39.242  19.535  1.00 51.01 ? 158 PHE A CD2 1 
ATOM 144  C CE1 . PHE A 1 18  ? 10.199  39.521  20.915  1.00 52.25 ? 158 PHE A CE1 1 
ATOM 145  C CE2 . PHE A 1 18  ? 7.873   40.070  20.650  1.00 54.02 ? 158 PHE A CE2 1 
ATOM 146  C CZ  . PHE A 1 18  ? 9.080   40.208  21.345  1.00 53.57 ? 158 PHE A CZ  1 
ATOM 147  N N   . SER A 1 19  ? 8.494   34.176  17.622  1.00 49.88 ? 159 SER A N   1 
ATOM 148  C CA  . SER A 1 19  ? 7.999   33.097  16.784  1.00 50.10 ? 159 SER A CA  1 
ATOM 149  C C   . SER A 1 19  ? 7.287   33.629  15.547  1.00 50.13 ? 159 SER A C   1 
ATOM 150  O O   . SER A 1 19  ? 6.716   34.724  15.556  1.00 50.43 ? 159 SER A O   1 
ATOM 151  C CB  . SER A 1 19  ? 7.048   32.207  17.586  1.00 50.34 ? 159 SER A CB  1 
ATOM 152  O OG  . SER A 1 19  ? 6.904   30.939  16.971  1.00 55.14 ? 159 SER A OG  1 
ATOM 153  N N   . SER A 1 20  ? 7.347   32.846  14.476  1.00 50.09 ? 160 SER A N   1 
ATOM 154  C CA  . SER A 1 20  ? 6.712   33.201  13.217  1.00 48.77 ? 160 SER A CA  1 
ATOM 155  C C   . SER A 1 20  ? 5.404   32.430  13.159  1.00 47.86 ? 160 SER A C   1 
ATOM 156  O O   . SER A 1 20  ? 4.335   33.003  12.960  1.00 45.66 ? 160 SER A O   1 
ATOM 157  C CB  . SER A 1 20  ? 7.605   32.788  12.047  1.00 47.59 ? 160 SER A CB  1 
ATOM 158  O OG  . SER A 1 20  ? 8.947   33.175  12.283  1.00 46.55 ? 160 SER A OG  1 
ATOM 159  N N   . GLY A 1 21  ? 5.509   31.120  13.351  1.00 48.44 ? 161 GLY A N   1 
ATOM 160  C CA  . GLY A 1 21  ? 4.340   30.266  13.318  1.00 50.26 ? 161 GLY A CA  1 
ATOM 161  C C   . GLY A 1 21  ? 3.627   30.188  14.654  1.00 50.75 ? 161 GLY A C   1 
ATOM 162  O O   . GLY A 1 21  ? 4.163   30.583  15.695  1.00 50.90 ? 161 GLY A O   1 
ATOM 163  N N   . SER A 1 22  ? 2.403   29.675  14.620  1.00 49.45 ? 162 SER A N   1 
ATOM 164  C CA  . SER A 1 22  ? 1.599   29.535  15.820  1.00 47.48 ? 162 SER A CA  1 
ATOM 165  C C   . SER A 1 22  ? 1.187   28.087  15.987  1.00 46.69 ? 162 SER A C   1 
ATOM 166  O O   . SER A 1 22  ? 0.226   27.632  15.370  1.00 46.25 ? 162 SER A O   1 
ATOM 167  C CB  . SER A 1 22  ? 0.354   30.415  15.728  1.00 46.95 ? 162 SER A CB  1 
ATOM 168  O OG  . SER A 1 22  ? -0.500  30.197  16.837  1.00 45.67 ? 162 SER A OG  1 
ATOM 169  N N   . PHE A 1 23  ? 1.925   27.361  16.817  1.00 46.75 ? 163 PHE A N   1 
ATOM 170  C CA  . PHE A 1 23  ? 1.618   25.961  17.070  1.00 47.36 ? 163 PHE A CA  1 
ATOM 171  C C   . PHE A 1 23  ? 1.561   25.738  18.573  1.00 45.11 ? 163 PHE A C   1 
ATOM 172  O O   . PHE A 1 23  ? 1.662   26.689  19.347  1.00 44.94 ? 163 PHE A O   1 
ATOM 173  C CB  . PHE A 1 23  ? 2.686   25.060  16.448  1.00 49.17 ? 163 PHE A CB  1 
ATOM 174  C CG  . PHE A 1 23  ? 3.175   25.538  15.113  1.00 49.92 ? 163 PHE A CG  1 
ATOM 175  C CD1 . PHE A 1 23  ? 4.267   26.397  15.027  1.00 49.59 ? 163 PHE A CD1 1 
ATOM 176  C CD2 . PHE A 1 23  ? 2.529   25.149  13.944  1.00 50.07 ? 163 PHE A CD2 1 
ATOM 177  C CE1 . PHE A 1 23  ? 4.713   26.864  13.793  1.00 50.00 ? 163 PHE A CE1 1 
ATOM 178  C CE2 . PHE A 1 23  ? 2.963   25.608  12.707  1.00 51.47 ? 163 PHE A CE2 1 
ATOM 179  C CZ  . PHE A 1 23  ? 4.061   26.470  12.631  1.00 51.49 ? 163 PHE A CZ  1 
ATOM 180  N N   . ASN A 1 24  ? 1.399   24.485  18.984  1.00 42.34 ? 164 ASN A N   1 
ATOM 181  C CA  . ASN A 1 24  ? 1.344   24.166  20.403  1.00 40.90 ? 164 ASN A CA  1 
ATOM 182  C C   . ASN A 1 24  ? 2.726   24.204  21.054  1.00 39.76 ? 164 ASN A C   1 
ATOM 183  O O   . ASN A 1 24  ? 3.750   24.240  20.373  1.00 38.61 ? 164 ASN A O   1 
ATOM 184  C CB  . ASN A 1 24  ? 0.685   22.801  20.619  1.00 40.05 ? 164 ASN A CB  1 
ATOM 185  C CG  . ASN A 1 24  ? 1.171   21.759  19.644  1.00 37.07 ? 164 ASN A CG  1 
ATOM 186  O OD1 . ASN A 1 24  ? 2.362   21.456  19.585  1.00 34.74 ? 164 ASN A OD1 1 
ATOM 187  N ND2 . ASN A 1 24  ? 0.247   21.201  18.871  1.00 35.23 ? 164 ASN A ND2 1 
ATOM 188  N N   . TRP A 1 25  ? 2.728   24.193  22.383  1.00 39.19 ? 165 TRP A N   1 
ATOM 189  C CA  . TRP A 1 25  ? 3.940   24.262  23.192  1.00 39.38 ? 165 TRP A CA  1 
ATOM 190  C C   . TRP A 1 25  ? 5.087   23.347  22.774  1.00 41.78 ? 165 TRP A C   1 
ATOM 191  O O   . TRP A 1 25  ? 6.227   23.798  22.652  1.00 41.76 ? 165 TRP A O   1 
ATOM 192  C CB  . TRP A 1 25  ? 3.597   23.974  24.651  1.00 35.62 ? 165 TRP A CB  1 
ATOM 193  C CG  . TRP A 1 25  ? 4.568   24.562  25.603  1.00 30.60 ? 165 TRP A CG  1 
ATOM 194  C CD1 . TRP A 1 25  ? 4.593   25.849  26.054  1.00 31.25 ? 165 TRP A CD1 1 
ATOM 195  C CD2 . TRP A 1 25  ? 5.679   23.902  26.204  1.00 27.96 ? 165 TRP A CD2 1 
ATOM 196  N NE1 . TRP A 1 25  ? 5.655   26.033  26.903  1.00 29.91 ? 165 TRP A NE1 1 
ATOM 197  C CE2 . TRP A 1 25  ? 6.342   24.853  27.011  1.00 28.56 ? 165 TRP A CE2 1 
ATOM 198  C CE3 . TRP A 1 25  ? 6.186   22.601  26.136  1.00 27.74 ? 165 TRP A CE3 1 
ATOM 199  C CZ2 . TRP A 1 25  ? 7.487   24.543  27.750  1.00 27.86 ? 165 TRP A CZ2 1 
ATOM 200  C CZ3 . TRP A 1 25  ? 7.324   22.291  26.868  1.00 29.27 ? 165 TRP A CZ3 1 
ATOM 201  C CH2 . TRP A 1 25  ? 7.964   23.261  27.665  1.00 28.59 ? 165 TRP A CH2 1 
ATOM 202  N N   . GLU A 1 26  ? 4.791   22.064  22.573  1.00 43.34 ? 166 GLU A N   1 
ATOM 203  C CA  . GLU A 1 26  ? 5.818   21.097  22.197  1.00 44.36 ? 166 GLU A CA  1 
ATOM 204  C C   . GLU A 1 26  ? 6.517   21.494  20.905  1.00 44.71 ? 166 GLU A C   1 
ATOM 205  O O   . GLU A 1 26  ? 7.743   21.628  20.866  1.00 43.67 ? 166 GLU A O   1 
ATOM 206  C CB  . GLU A 1 26  ? 5.207   19.707  22.045  1.00 45.87 ? 166 GLU A CB  1 
ATOM 207  C CG  . GLU A 1 26  ? 6.230   18.582  22.067  1.00 48.23 ? 166 GLU A CG  1 
ATOM 208  C CD  . GLU A 1 26  ? 5.593   17.224  21.881  1.00 49.90 ? 166 GLU A CD  1 
ATOM 209  O OE1 . GLU A 1 26  ? 5.049   16.980  20.783  1.00 51.09 ? 166 GLU A OE1 1 
ATOM 210  O OE2 . GLU A 1 26  ? 5.631   16.407  22.829  1.00 49.51 ? 166 GLU A OE2 1 
ATOM 211  N N   . LYS A 1 27  ? 5.733   21.678  19.850  1.00 44.95 ? 167 LYS A N   1 
ATOM 212  C CA  . LYS A 1 27  ? 6.278   22.075  18.562  1.00 44.99 ? 167 LYS A CA  1 
ATOM 213  C C   . LYS A 1 27  ? 6.956   23.437  18.704  1.00 44.64 ? 167 LYS A C   1 
ATOM 214  O O   . LYS A 1 27  ? 8.044   23.659  18.169  1.00 44.09 ? 167 LYS A O   1 
ATOM 215  C CB  . LYS A 1 27  ? 5.157   22.147  17.527  1.00 45.50 ? 167 LYS A CB  1 
ATOM 216  C CG  . LYS A 1 27  ? 4.377   20.843  17.352  1.00 48.49 ? 167 LYS A CG  1 
ATOM 217  C CD  . LYS A 1 27  ? 5.124   19.829  16.482  1.00 49.75 ? 167 LYS A CD  1 
ATOM 218  C CE  . LYS A 1 27  ? 6.261   19.114  17.209  1.00 47.84 ? 167 LYS A CE  1 
ATOM 219  N NZ  . LYS A 1 27  ? 5.778   17.905  17.928  1.00 46.42 ? 167 LYS A NZ  1 
ATOM 220  N N   . SER A 1 28  ? 6.312   24.341  19.437  1.00 44.60 ? 168 SER A N   1 
ATOM 221  C CA  . SER A 1 28  ? 6.849   25.680  19.663  1.00 45.55 ? 168 SER A CA  1 
ATOM 222  C C   . SER A 1 28  ? 8.191   25.591  20.376  1.00 46.54 ? 168 SER A C   1 
ATOM 223  O O   . SER A 1 28  ? 9.082   26.411  20.162  1.00 45.28 ? 168 SER A O   1 
ATOM 224  C CB  . SER A 1 28  ? 5.879   26.498  20.516  1.00 45.80 ? 168 SER A CB  1 
ATOM 225  O OG  . SER A 1 28  ? 4.596   26.558  19.918  1.00 47.44 ? 168 SER A OG  1 
ATOM 226  N N   . GLN A 1 29  ? 8.316   24.578  21.227  1.00 49.19 ? 169 GLN A N   1 
ATOM 227  C CA  . GLN A 1 29  ? 9.526   24.338  22.004  1.00 50.26 ? 169 GLN A CA  1 
ATOM 228  C C   . GLN A 1 29  ? 10.668  23.838  21.135  1.00 51.23 ? 169 GLN A C   1 
ATOM 229  O O   . GLN A 1 29  ? 11.838  24.104  21.417  1.00 50.91 ? 169 GLN A O   1 
ATOM 230  C CB  . GLN A 1 29  ? 9.237   23.311  23.102  1.00 50.20 ? 169 GLN A CB  1 
ATOM 231  C CG  . GLN A 1 29  ? 10.460  22.854  23.875  1.00 49.37 ? 169 GLN A CG  1 
ATOM 232  C CD  . GLN A 1 29  ? 10.141  21.744  24.856  1.00 47.92 ? 169 GLN A CD  1 
ATOM 233  O OE1 . GLN A 1 29  ? 9.689   20.668  24.467  1.00 47.69 ? 169 GLN A OE1 1 
ATOM 234  N NE2 . GLN A 1 29  ? 10.375  22.000  26.137  1.00 47.52 ? 169 GLN A NE2 1 
ATOM 235  N N   . GLU A 1 30  ? 10.322  23.106  20.081  1.00 52.56 ? 170 GLU A N   1 
ATOM 236  C CA  . GLU A 1 30  ? 11.319  22.554  19.178  1.00 52.80 ? 170 GLU A CA  1 
ATOM 237  C C   . GLU A 1 30  ? 11.842  23.607  18.217  1.00 51.82 ? 170 GLU A C   1 
ATOM 238  O O   . GLU A 1 30  ? 12.999  23.554  17.802  1.00 52.63 ? 170 GLU A O   1 
ATOM 239  C CB  . GLU A 1 30  ? 10.729  21.374  18.401  1.00 54.37 ? 170 GLU A CB  1 
ATOM 240  C CG  . GLU A 1 30  ? 10.273  20.227  19.297  1.00 56.93 ? 170 GLU A CG  1 
ATOM 241  C CD  . GLU A 1 30  ? 9.802   19.019  18.512  1.00 58.54 ? 170 GLU A CD  1 
ATOM 242  O OE1 . GLU A 1 30  ? 10.596  18.508  17.697  1.00 59.66 ? 170 GLU A OE1 1 
ATOM 243  O OE2 . GLU A 1 30  ? 8.647   18.579  18.712  1.00 58.30 ? 170 GLU A OE2 1 
ATOM 244  N N   . LYS A 1 31  ? 10.992  24.567  17.869  1.00 50.58 ? 171 LYS A N   1 
ATOM 245  C CA  . LYS A 1 31  ? 11.400  25.627  16.959  1.00 49.12 ? 171 LYS A CA  1 
ATOM 246  C C   . LYS A 1 31  ? 12.474  26.489  17.607  1.00 48.50 ? 171 LYS A C   1 
ATOM 247  O O   . LYS A 1 31  ? 13.336  27.037  16.921  1.00 47.81 ? 171 LYS A O   1 
ATOM 248  C CB  . LYS A 1 31  ? 10.191  26.470  16.557  1.00 48.84 ? 171 LYS A CB  1 
ATOM 249  C CG  . LYS A 1 31  ? 9.173   25.678  15.760  1.00 49.55 ? 171 LYS A CG  1 
ATOM 250  C CD  . LYS A 1 31  ? 8.887   26.327  14.418  1.00 50.54 ? 171 LYS A CD  1 
ATOM 251  C CE  . LYS A 1 31  ? 8.364   25.307  13.415  1.00 49.27 ? 171 LYS A CE  1 
ATOM 252  N NZ  . LYS A 1 31  ? 9.381   24.252  13.122  1.00 46.75 ? 171 LYS A NZ  1 
ATOM 253  N N   . CYS A 1 32  ? 12.422  26.607  18.931  1.00 47.55 ? 172 CYS A N   1 
ATOM 254  C CA  . CYS A 1 32  ? 13.424  27.378  19.656  1.00 47.57 ? 172 CYS A CA  1 
ATOM 255  C C   . CYS A 1 32  ? 14.694  26.540  19.744  1.00 48.21 ? 172 CYS A C   1 
ATOM 256  O O   . CYS A 1 32  ? 15.794  27.073  19.911  1.00 48.39 ? 172 CYS A O   1 
ATOM 257  C CB  . CYS A 1 32  ? 12.951  27.718  21.071  1.00 45.73 ? 172 CYS A CB  1 
ATOM 258  S SG  . CYS A 1 32  ? 11.676  29.013  21.219  1.00 46.13 ? 172 CYS A SG  1 
ATOM 259  N N   . LEU A 1 33  ? 14.532  25.223  19.641  1.00 48.28 ? 173 LEU A N   1 
ATOM 260  C CA  . LEU A 1 33  ? 15.664  24.308  19.693  1.00 48.86 ? 173 LEU A CA  1 
ATOM 261  C C   . LEU A 1 33  ? 16.397  24.320  18.366  1.00 48.34 ? 173 LEU A C   1 
ATOM 262  O O   . LEU A 1 33  ? 17.625  24.319  18.328  1.00 48.27 ? 173 LEU A O   1 
ATOM 263  C CB  . LEU A 1 33  ? 15.201  22.883  20.004  1.00 50.87 ? 173 LEU A CB  1 
ATOM 264  C CG  . LEU A 1 33  ? 15.009  22.520  21.478  1.00 52.08 ? 173 LEU A CG  1 
ATOM 265  C CD1 . LEU A 1 33  ? 14.339  21.151  21.590  1.00 49.64 ? 173 LEU A CD1 1 
ATOM 266  C CD2 . LEU A 1 33  ? 16.362  22.534  22.187  1.00 49.56 ? 173 LEU A CD2 1 
ATOM 267  N N   . SER A 1 34  ? 15.641  24.334  17.276  1.00 47.65 ? 174 SER A N   1 
ATOM 268  C CA  . SER A 1 34  ? 16.246  24.352  15.955  1.00 48.50 ? 174 SER A CA  1 
ATOM 269  C C   . SER A 1 34  ? 17.045  25.636  15.754  1.00 48.74 ? 174 SER A C   1 
ATOM 270  O O   . SER A 1 34  ? 17.787  25.765  14.782  1.00 49.55 ? 174 SER A O   1 
ATOM 271  C CB  . SER A 1 34  ? 15.171  24.235  14.873  1.00 48.19 ? 174 SER A CB  1 
ATOM 272  O OG  . SER A 1 34  ? 14.293  25.344  14.904  1.00 48.48 ? 174 SER A OG  1 
ATOM 273  N N   . LEU A 1 35  ? 16.891  26.583  16.675  1.00 48.36 ? 175 LEU A N   1 
ATOM 274  C CA  . LEU A 1 35  ? 17.606  27.850  16.590  1.00 47.84 ? 175 LEU A CA  1 
ATOM 275  C C   . LEU A 1 35  ? 18.633  28.025  17.702  1.00 48.63 ? 175 LEU A C   1 
ATOM 276  O O   . LEU A 1 35  ? 18.967  29.153  18.059  1.00 50.35 ? 175 LEU A O   1 
ATOM 277  C CB  . LEU A 1 35  ? 16.634  29.031  16.636  1.00 46.58 ? 175 LEU A CB  1 
ATOM 278  C CG  . LEU A 1 35  ? 15.561  29.192  15.560  1.00 45.55 ? 175 LEU A CG  1 
ATOM 279  C CD1 . LEU A 1 35  ? 14.981  30.592  15.661  1.00 42.44 ? 175 LEU A CD1 1 
ATOM 280  C CD2 . LEU A 1 35  ? 16.154  28.971  14.183  1.00 45.30 ? 175 LEU A CD2 1 
ATOM 281  N N   . ASP A 1 36  ? 19.130  26.920  18.251  1.00 48.33 ? 176 ASP A N   1 
ATOM 282  C CA  . ASP A 1 36  ? 20.130  26.987  19.318  1.00 48.19 ? 176 ASP A CA  1 
ATOM 283  C C   . ASP A 1 36  ? 19.633  27.766  20.533  1.00 46.46 ? 176 ASP A C   1 
ATOM 284  O O   . ASP A 1 36  ? 20.430  28.371  21.252  1.00 44.16 ? 176 ASP A O   1 
ATOM 285  C CB  . ASP A 1 36  ? 21.415  27.655  18.807  1.00 51.26 ? 176 ASP A CB  1 
ATOM 286  C CG  . ASP A 1 36  ? 22.140  26.822  17.767  1.00 55.77 ? 176 ASP A CG  1 
ATOM 287  O OD1 . ASP A 1 36  ? 21.542  26.536  16.707  1.00 57.28 ? 176 ASP A OD1 1 
ATOM 288  O OD2 . ASP A 1 36  ? 23.312  26.456  18.011  1.00 57.71 ? 176 ASP A OD2 1 
ATOM 289  N N   . ALA A 1 37  ? 18.324  27.746  20.771  1.00 45.30 ? 177 ALA A N   1 
ATOM 290  C CA  . ALA A 1 37  ? 17.764  28.481  21.901  1.00 43.89 ? 177 ALA A CA  1 
ATOM 291  C C   . ALA A 1 37  ? 16.815  27.672  22.785  1.00 40.66 ? 177 ALA A C   1 
ATOM 292  O O   . ALA A 1 37  ? 16.857  26.444  22.812  1.00 40.04 ? 177 ALA A O   1 
ATOM 293  C CB  . ALA A 1 37  ? 17.058  29.745  21.393  1.00 45.30 ? 177 ALA A CB  1 
ATOM 294  N N   . LYS A 1 38  ? 15.968  28.390  23.518  1.00 38.03 ? 178 LYS A N   1 
ATOM 295  C CA  . LYS A 1 38  ? 14.988  27.788  24.414  1.00 35.17 ? 178 LYS A CA  1 
ATOM 296  C C   . LYS A 1 38  ? 13.852  28.778  24.563  1.00 35.70 ? 178 LYS A C   1 
ATOM 297  O O   . LYS A 1 38  ? 14.014  29.956  24.246  1.00 37.00 ? 178 LYS A O   1 
ATOM 298  C CB  . LYS A 1 38  ? 15.603  27.532  25.788  1.00 32.60 ? 178 LYS A CB  1 
ATOM 299  C CG  . LYS A 1 38  ? 15.834  28.787  26.622  1.00 29.34 ? 178 LYS A CG  1 
ATOM 300  C CD  . LYS A 1 38  ? 16.585  28.447  27.896  1.00 30.49 ? 178 LYS A CD  1 
ATOM 301  C CE  . LYS A 1 38  ? 16.795  29.659  28.787  1.00 31.96 ? 178 LYS A CE  1 
ATOM 302  N NZ  . LYS A 1 38  ? 17.568  29.296  30.017  1.00 34.05 ? 178 LYS A NZ  1 
ATOM 303  N N   . LEU A 1 39  ? 12.708  28.308  25.051  1.00 35.16 ? 179 LEU A N   1 
ATOM 304  C CA  . LEU A 1 39  ? 11.561  29.186  25.240  1.00 32.48 ? 179 LEU A CA  1 
ATOM 305  C C   . LEU A 1 39  ? 11.845  30.204  26.331  1.00 31.76 ? 179 LEU A C   1 
ATOM 306  O O   . LEU A 1 39  ? 12.593  29.933  27.272  1.00 31.22 ? 179 LEU A O   1 
ATOM 307  C CB  . LEU A 1 39  ? 10.311  28.374  25.580  1.00 31.77 ? 179 LEU A CB  1 
ATOM 308  C CG  . LEU A 1 39  ? 9.683   27.689  24.362  1.00 32.62 ? 179 LEU A CG  1 
ATOM 309  C CD1 . LEU A 1 39  ? 8.604   26.729  24.802  1.00 31.18 ? 179 LEU A CD1 1 
ATOM 310  C CD2 . LEU A 1 39  ? 9.110   28.739  23.424  1.00 32.87 ? 179 LEU A CD2 1 
ATOM 311  N N   . LEU A 1 40  ? 11.251  31.383  26.184  1.00 31.10 ? 180 LEU A N   1 
ATOM 312  C CA  . LEU A 1 40  ? 11.430  32.474  27.133  1.00 30.25 ? 180 LEU A CA  1 
ATOM 313  C C   . LEU A 1 40  ? 11.451  32.056  28.598  1.00 29.88 ? 180 LEU A C   1 
ATOM 314  O O   . LEU A 1 40  ? 10.537  31.383  29.078  1.00 30.29 ? 180 LEU A O   1 
ATOM 315  C CB  . LEU A 1 40  ? 10.323  33.510  26.948  1.00 29.21 ? 180 LEU A CB  1 
ATOM 316  C CG  . LEU A 1 40  ? 10.267  34.603  28.017  1.00 28.64 ? 180 LEU A CG  1 
ATOM 317  C CD1 . LEU A 1 40  ? 11.404  35.592  27.810  1.00 26.09 ? 180 LEU A CD1 1 
ATOM 318  C CD2 . LEU A 1 40  ? 8.918   35.305  27.950  1.00 29.17 ? 180 LEU A CD2 1 
ATOM 319  N N   . LYS A 1 41  ? 12.497  32.462  29.306  1.00 28.44 ? 181 LYS A N   1 
ATOM 320  C CA  . LYS A 1 41  ? 12.603  32.170  30.724  1.00 29.72 ? 181 LYS A CA  1 
ATOM 321  C C   . LYS A 1 41  ? 12.743  33.497  31.442  1.00 30.77 ? 181 LYS A C   1 
ATOM 322  O O   . LYS A 1 41  ? 13.682  34.251  31.198  1.00 32.63 ? 181 LYS A O   1 
ATOM 323  C CB  . LYS A 1 41  ? 13.815  31.294  31.034  1.00 30.76 ? 181 LYS A CB  1 
ATOM 324  C CG  . LYS A 1 41  ? 13.931  30.948  32.519  1.00 30.27 ? 181 LYS A CG  1 
ATOM 325  C CD  . LYS A 1 41  ? 15.165  30.114  32.830  1.00 31.32 ? 181 LYS A CD  1 
ATOM 326  C CE  . LYS A 1 41  ? 15.253  29.818  34.319  1.00 29.14 ? 181 LYS A CE  1 
ATOM 327  N NZ  . LYS A 1 41  ? 16.464  29.029  34.660  1.00 29.82 ? 181 LYS A NZ  1 
ATOM 328  N N   . ILE A 1 42  ? 11.798  33.780  32.327  1.00 31.97 ? 182 ILE A N   1 
ATOM 329  C CA  . ILE A 1 42  ? 11.802  35.021  33.079  1.00 33.75 ? 182 ILE A CA  1 
ATOM 330  C C   . ILE A 1 42  ? 12.438  34.798  34.447  1.00 34.70 ? 182 ILE A C   1 
ATOM 331  O O   . ILE A 1 42  ? 11.958  33.989  35.241  1.00 34.57 ? 182 ILE A O   1 
ATOM 332  C CB  . ILE A 1 42  ? 10.365  35.541  33.237  1.00 34.09 ? 182 ILE A CB  1 
ATOM 333  C CG1 . ILE A 1 42  ? 9.695   35.582  31.861  1.00 35.24 ? 182 ILE A CG1 1 
ATOM 334  C CG2 . ILE A 1 42  ? 10.371  36.929  33.847  1.00 34.71 ? 182 ILE A CG2 1 
ATOM 335  C CD1 . ILE A 1 42  ? 8.237   35.961  31.896  1.00 37.79 ? 182 ILE A CD1 1 
ATOM 336  N N   . ASN A 1 43  ? 13.523  35.519  34.710  1.00 35.44 ? 183 ASN A N   1 
ATOM 337  C CA  . ASN A 1 43  ? 14.243  35.401  35.972  1.00 37.22 ? 183 ASN A CA  1 
ATOM 338  C C   . ASN A 1 43  ? 13.976  36.550  36.932  1.00 38.87 ? 183 ASN A C   1 
ATOM 339  O O   . ASN A 1 43  ? 14.341  36.480  38.105  1.00 40.46 ? 183 ASN A O   1 
ATOM 340  C CB  . ASN A 1 43  ? 15.745  35.308  35.703  1.00 37.39 ? 183 ASN A CB  1 
ATOM 341  C CG  . ASN A 1 43  ? 16.176  33.922  35.269  1.00 38.39 ? 183 ASN A CG  1 
ATOM 342  O OD1 . ASN A 1 43  ? 17.189  33.758  34.586  1.00 35.74 ? 183 ASN A OD1 1 
ATOM 343  N ND2 . ASN A 1 43  ? 15.415  32.912  35.680  1.00 38.98 ? 183 ASN A ND2 1 
ATOM 344  N N   . SER A 1 44  ? 13.337  37.604  36.437  1.00 39.75 ? 184 SER A N   1 
ATOM 345  C CA  . SER A 1 44  ? 13.034  38.769  37.261  1.00 39.98 ? 184 SER A CA  1 
ATOM 346  C C   . SER A 1 44  ? 11.866  39.525  36.663  1.00 40.39 ? 184 SER A C   1 
ATOM 347  O O   . SER A 1 44  ? 11.327  39.129  35.632  1.00 42.08 ? 184 SER A O   1 
ATOM 348  C CB  . SER A 1 44  ? 14.240  39.704  37.318  1.00 40.27 ? 184 SER A CB  1 
ATOM 349  O OG  . SER A 1 44  ? 14.461  40.311  36.056  1.00 37.92 ? 184 SER A OG  1 
ATOM 350  N N   . THR A 1 45  ? 11.473  40.620  37.303  1.00 40.13 ? 185 THR A N   1 
ATOM 351  C CA  . THR A 1 45  ? 10.374  41.418  36.777  1.00 40.13 ? 185 THR A CA  1 
ATOM 352  C C   . THR A 1 45  ? 10.916  42.268  35.629  1.00 40.15 ? 185 THR A C   1 
ATOM 353  O O   . THR A 1 45  ? 10.194  42.596  34.690  1.00 41.09 ? 185 THR A O   1 
ATOM 354  C CB  . THR A 1 45  ? 9.774   42.337  37.854  1.00 39.48 ? 185 THR A CB  1 
ATOM 355  O OG1 . THR A 1 45  ? 10.711  43.368  38.188  1.00 41.66 ? 185 THR A OG1 1 
ATOM 356  C CG2 . THR A 1 45  ? 9.452   41.540  39.099  1.00 38.04 ? 185 THR A CG2 1 
ATOM 357  N N   . ALA A 1 46  ? 12.197  42.614  35.710  1.00 39.93 ? 186 ALA A N   1 
ATOM 358  C CA  . ALA A 1 46  ? 12.840  43.410  34.673  1.00 37.88 ? 186 ALA A CA  1 
ATOM 359  C C   . ALA A 1 46  ? 12.657  42.678  33.359  1.00 37.15 ? 186 ALA A C   1 
ATOM 360  O O   . ALA A 1 46  ? 12.411  43.297  32.326  1.00 37.63 ? 186 ALA A O   1 
ATOM 361  C CB  . ALA A 1 46  ? 14.317  43.581  34.978  1.00 36.00 ? 186 ALA A CB  1 
ATOM 362  N N   . ASP A 1 47  ? 12.776  41.353  33.409  1.00 36.12 ? 187 ASP A N   1 
ATOM 363  C CA  . ASP A 1 47  ? 12.596  40.522  32.221  1.00 36.06 ? 187 ASP A CA  1 
ATOM 364  C C   . ASP A 1 47  ? 11.145  40.614  31.758  1.00 35.75 ? 187 ASP A C   1 
ATOM 365  O O   . ASP A 1 47  ? 10.860  40.855  30.585  1.00 34.33 ? 187 ASP A O   1 
ATOM 366  C CB  . ASP A 1 47  ? 12.929  39.064  32.536  1.00 35.18 ? 187 ASP A CB  1 
ATOM 367  C CG  . ASP A 1 47  ? 14.397  38.850  32.833  1.00 35.80 ? 187 ASP A CG  1 
ATOM 368  O OD1 . ASP A 1 47  ? 15.174  39.829  32.757  1.00 34.70 ? 187 ASP A OD1 1 
ATOM 369  O OD2 . ASP A 1 47  ? 14.772  37.696  33.135  1.00 34.90 ? 187 ASP A OD2 1 
ATOM 370  N N   . LEU A 1 48  ? 10.232  40.419  32.702  1.00 36.04 ? 188 LEU A N   1 
ATOM 371  C CA  . LEU A 1 48  ? 8.808   40.477  32.417  1.00 35.71 ? 188 LEU A CA  1 
ATOM 372  C C   . LEU A 1 48  ? 8.452   41.825  31.799  1.00 34.39 ? 188 LEU A C   1 
ATOM 373  O O   . LEU A 1 48  ? 7.820   41.878  30.748  1.00 33.95 ? 188 LEU A O   1 
ATOM 374  C CB  . LEU A 1 48  ? 8.007   40.260  33.705  1.00 36.37 ? 188 LEU A CB  1 
ATOM 375  C CG  . LEU A 1 48  ? 6.517   39.945  33.558  1.00 35.86 ? 188 LEU A CG  1 
ATOM 376  C CD1 . LEU A 1 48  ? 6.340   38.636  32.805  1.00 34.13 ? 188 LEU A CD1 1 
ATOM 377  C CD2 . LEU A 1 48  ? 5.886   39.849  34.935  1.00 35.37 ? 188 LEU A CD2 1 
ATOM 378  N N   . ASP A 1 49  ? 8.862   42.909  32.450  1.00 33.86 ? 189 ASP A N   1 
ATOM 379  C CA  . ASP A 1 49  ? 8.581   44.246  31.941  1.00 34.17 ? 189 ASP A CA  1 
ATOM 380  C C   . ASP A 1 49  ? 9.166   44.401  30.551  1.00 34.11 ? 189 ASP A C   1 
ATOM 381  O O   . ASP A 1 49  ? 8.580   45.057  29.690  1.00 34.03 ? 189 ASP A O   1 
ATOM 382  C CB  . ASP A 1 49  ? 9.156   45.320  32.866  1.00 34.52 ? 189 ASP A CB  1 
ATOM 383  C CG  . ASP A 1 49  ? 8.472   45.351  34.213  1.00 35.07 ? 189 ASP A CG  1 
ATOM 384  O OD1 . ASP A 1 49  ? 7.233   45.196  34.255  1.00 33.71 ? 189 ASP A OD1 1 
ATOM 385  O OD2 . ASP A 1 49  ? 9.171   45.539  35.229  1.00 35.45 ? 189 ASP A OD2 1 
ATOM 386  N N   . PHE A 1 50  ? 10.329  43.800  30.329  1.00 33.19 ? 190 PHE A N   1 
ATOM 387  C CA  . PHE A 1 50  ? 10.936  43.870  29.016  1.00 32.88 ? 190 PHE A CA  1 
ATOM 388  C C   . PHE A 1 50  ? 9.952   43.250  28.034  1.00 34.23 ? 190 PHE A C   1 
ATOM 389  O O   . PHE A 1 50  ? 9.306   43.955  27.261  1.00 33.74 ? 190 PHE A O   1 
ATOM 390  C CB  . PHE A 1 50  ? 12.255  43.098  28.982  1.00 32.73 ? 190 PHE A CB  1 
ATOM 391  C CG  . PHE A 1 50  ? 12.759  42.827  27.590  1.00 32.88 ? 190 PHE A CG  1 
ATOM 392  C CD1 . PHE A 1 50  ? 12.910  43.865  26.673  1.00 33.52 ? 190 PHE A CD1 1 
ATOM 393  C CD2 . PHE A 1 50  ? 13.062  41.529  27.188  1.00 33.23 ? 190 PHE A CD2 1 
ATOM 394  C CE1 . PHE A 1 50  ? 13.353  43.615  25.377  1.00 32.95 ? 190 PHE A CE1 1 
ATOM 395  C CE2 . PHE A 1 50  ? 13.508  41.267  25.896  1.00 33.29 ? 190 PHE A CE2 1 
ATOM 396  C CZ  . PHE A 1 50  ? 13.652  42.312  24.987  1.00 34.62 ? 190 PHE A CZ  1 
ATOM 397  N N   . ILE A 1 51  ? 9.826   41.928  28.094  1.00 35.58 ? 191 ILE A N   1 
ATOM 398  C CA  . ILE A 1 51  ? 8.930   41.186  27.214  1.00 37.25 ? 191 ILE A CA  1 
ATOM 399  C C   . ILE A 1 51  ? 7.540   41.801  27.055  1.00 38.88 ? 191 ILE A C   1 
ATOM 400  O O   . ILE A 1 51  ? 6.936   41.693  25.986  1.00 38.73 ? 191 ILE A O   1 
ATOM 401  C CB  . ILE A 1 51  ? 8.782   39.725  27.689  1.00 37.49 ? 191 ILE A CB  1 
ATOM 402  C CG1 . ILE A 1 51  ? 10.102  38.982  27.476  1.00 38.85 ? 191 ILE A CG1 1 
ATOM 403  C CG2 . ILE A 1 51  ? 7.671   39.023  26.914  1.00 36.71 ? 191 ILE A CG2 1 
ATOM 404  C CD1 . ILE A 1 51  ? 10.499  38.850  26.009  1.00 41.67 ? 191 ILE A CD1 1 
ATOM 405  N N   . GLN A 1 52  ? 7.027   42.436  28.106  1.00 40.80 ? 192 GLN A N   1 
ATOM 406  C CA  . GLN A 1 52  ? 5.709   43.063  28.032  1.00 41.31 ? 192 GLN A CA  1 
ATOM 407  C C   . GLN A 1 52  ? 5.716   44.189  27.006  1.00 40.70 ? 192 GLN A C   1 
ATOM 408  O O   . GLN A 1 52  ? 4.860   44.242  26.123  1.00 40.54 ? 192 GLN A O   1 
ATOM 409  C CB  . GLN A 1 52  ? 5.294   43.612  29.395  1.00 43.43 ? 192 GLN A CB  1 
ATOM 410  C CG  . GLN A 1 52  ? 4.233   44.725  29.347  1.00 47.18 ? 192 GLN A CG  1 
ATOM 411  C CD  . GLN A 1 52  ? 3.007   44.372  28.509  1.00 49.19 ? 192 GLN A CD  1 
ATOM 412  O OE1 . GLN A 1 52  ? 2.590   43.214  28.451  1.00 51.92 ? 192 GLN A OE1 1 
ATOM 413  N NE2 . GLN A 1 52  ? 2.415   45.380  27.872  1.00 46.41 ? 192 GLN A NE2 1 
ATOM 414  N N   . GLN A 1 53  ? 6.685   45.090  27.125  1.00 38.58 ? 193 GLN A N   1 
ATOM 415  C CA  . GLN A 1 53  ? 6.789   46.202  26.193  1.00 37.43 ? 193 GLN A CA  1 
ATOM 416  C C   . GLN A 1 53  ? 7.019   45.675  24.776  1.00 35.13 ? 193 GLN A C   1 
ATOM 417  O O   . GLN A 1 53  ? 6.436   46.172  23.815  1.00 33.24 ? 193 GLN A O   1 
ATOM 418  C CB  . GLN A 1 53  ? 7.940   47.119  26.608  1.00 39.07 ? 193 GLN A CB  1 
ATOM 419  C CG  . GLN A 1 53  ? 7.705   48.600  26.320  1.00 42.06 ? 193 GLN A CG  1 
ATOM 420  C CD  . GLN A 1 53  ? 7.707   48.935  24.839  1.00 45.35 ? 193 GLN A CD  1 
ATOM 421  O OE1 . GLN A 1 53  ? 8.684   48.675  24.133  1.00 49.30 ? 193 GLN A OE1 1 
ATOM 422  N NE2 . GLN A 1 53  ? 6.615   49.524  24.363  1.00 44.59 ? 193 GLN A NE2 1 
ATOM 423  N N   . ALA A 1 54  ? 7.861   44.655  24.661  1.00 34.21 ? 194 ALA A N   1 
ATOM 424  C CA  . ALA A 1 54  ? 8.192   44.055  23.376  1.00 34.49 ? 194 ALA A CA  1 
ATOM 425  C C   . ALA A 1 54  ? 6.987   43.483  22.638  1.00 36.85 ? 194 ALA A C   1 
ATOM 426  O O   . ALA A 1 54  ? 7.017   43.341  21.415  1.00 37.84 ? 194 ALA A O   1 
ATOM 427  C CB  . ALA A 1 54  ? 9.231   42.974  23.572  1.00 33.92 ? 194 ALA A CB  1 
ATOM 428  N N   . ILE A 1 55  ? 5.930   43.150  23.373  1.00 38.17 ? 195 ILE A N   1 
ATOM 429  C CA  . ILE A 1 55  ? 4.726   42.596  22.755  1.00 38.82 ? 195 ILE A CA  1 
ATOM 430  C C   . ILE A 1 55  ? 3.477   43.433  23.051  1.00 39.42 ? 195 ILE A C   1 
ATOM 431  O O   . ILE A 1 55  ? 2.354   42.940  22.966  1.00 38.98 ? 195 ILE A O   1 
ATOM 432  C CB  . ILE A 1 55  ? 4.482   41.143  23.227  1.00 37.75 ? 195 ILE A CB  1 
ATOM 433  C CG1 . ILE A 1 55  ? 4.126   41.115  24.715  1.00 36.83 ? 195 ILE A CG1 1 
ATOM 434  C CG2 . ILE A 1 55  ? 5.736   40.323  23.017  1.00 36.57 ? 195 ILE A CG2 1 
ATOM 435  C CD1 . ILE A 1 55  ? 3.808   39.728  25.241  1.00 36.51 ? 195 ILE A CD1 1 
ATOM 436  N N   . SER A 1 56  ? 3.686   44.702  23.387  1.00 41.35 ? 196 SER A N   1 
ATOM 437  C CA  . SER A 1 56  ? 2.592   45.614  23.707  1.00 42.45 ? 196 SER A CA  1 
ATOM 438  C C   . SER A 1 56  ? 1.723   45.868  22.492  1.00 43.61 ? 196 SER A C   1 
ATOM 439  O O   . SER A 1 56  ? 0.517   46.056  22.616  1.00 43.90 ? 196 SER A O   1 
ATOM 440  C CB  . SER A 1 56  ? 3.138   46.957  24.200  1.00 42.09 ? 196 SER A CB  1 
ATOM 441  O OG  . SER A 1 56  ? 4.138   46.782  25.182  1.00 44.81 ? 196 SER A OG  1 
ATOM 442  N N   . TYR A 1 57  ? 2.345   45.869  21.318  1.00 45.34 ? 197 TYR A N   1 
ATOM 443  C CA  . TYR A 1 57  ? 1.643   46.130  20.068  1.00 46.50 ? 197 TYR A CA  1 
ATOM 444  C C   . TYR A 1 57  ? 0.819   44.948  19.572  1.00 47.56 ? 197 TYR A C   1 
ATOM 445  O O   . TYR A 1 57  ? 0.163   45.033  18.536  1.00 50.27 ? 197 TYR A O   1 
ATOM 446  C CB  . TYR A 1 57  ? 2.651   46.535  18.996  1.00 47.29 ? 197 TYR A CB  1 
ATOM 447  C CG  . TYR A 1 57  ? 3.846   47.280  19.545  1.00 50.02 ? 197 TYR A CG  1 
ATOM 448  C CD1 . TYR A 1 57  ? 5.045   46.616  19.804  1.00 51.05 ? 197 TYR A CD1 1 
ATOM 449  C CD2 . TYR A 1 57  ? 3.779   48.648  19.817  1.00 51.12 ? 197 TYR A CD2 1 
ATOM 450  C CE1 . TYR A 1 57  ? 6.153   47.295  20.321  1.00 52.26 ? 197 TYR A CE1 1 
ATOM 451  C CE2 . TYR A 1 57  ? 4.881   49.338  20.337  1.00 52.16 ? 197 TYR A CE2 1 
ATOM 452  C CZ  . TYR A 1 57  ? 6.065   48.655  20.584  1.00 52.89 ? 197 TYR A CZ  1 
ATOM 453  O OH  . TYR A 1 57  ? 7.154   49.331  21.091  1.00 52.40 ? 197 TYR A OH  1 
ATOM 454  N N   . SER A 1 58  ? 0.847   43.849  20.315  1.00 47.70 ? 198 SER A N   1 
ATOM 455  C CA  . SER A 1 58  ? 0.110   42.656  19.929  1.00 46.77 ? 198 SER A CA  1 
ATOM 456  C C   . SER A 1 58  ? -0.896  42.235  20.982  1.00 45.94 ? 198 SER A C   1 
ATOM 457  O O   . SER A 1 58  ? -0.799  42.634  22.139  1.00 46.24 ? 198 SER A O   1 
ATOM 458  C CB  . SER A 1 58  ? 1.075   41.501  19.676  1.00 48.01 ? 198 SER A CB  1 
ATOM 459  O OG  . SER A 1 58  ? 0.366   40.336  19.293  1.00 50.34 ? 198 SER A OG  1 
ATOM 460  N N   . SER A 1 59  ? -1.856  41.414  20.568  1.00 44.97 ? 199 SER A N   1 
ATOM 461  C CA  . SER A 1 59  ? -2.891  40.918  21.464  1.00 45.80 ? 199 SER A CA  1 
ATOM 462  C C   . SER A 1 59  ? -2.900  39.393  21.477  1.00 45.86 ? 199 SER A C   1 
ATOM 463  O O   . SER A 1 59  ? -3.699  38.776  22.185  1.00 45.44 ? 199 SER A O   1 
ATOM 464  C CB  . SER A 1 59  ? -4.264  41.448  21.032  1.00 46.37 ? 199 SER A CB  1 
ATOM 465  O OG  . SER A 1 59  ? -4.532  41.130  19.678  1.00 47.68 ? 199 SER A OG  1 
ATOM 466  N N   . PHE A 1 60  ? -2.009  38.792  20.691  1.00 44.71 ? 200 PHE A N   1 
ATOM 467  C CA  . PHE A 1 60  ? -1.905  37.338  20.620  1.00 43.94 ? 200 PHE A CA  1 
ATOM 468  C C   . PHE A 1 60  ? -1.274  36.756  21.880  1.00 43.29 ? 200 PHE A C   1 
ATOM 469  O O   . PHE A 1 60  ? -0.714  37.478  22.702  1.00 43.25 ? 200 PHE A O   1 
ATOM 470  C CB  . PHE A 1 60  ? -1.038  36.906  19.435  1.00 44.80 ? 200 PHE A CB  1 
ATOM 471  C CG  . PHE A 1 60  ? -1.661  37.134  18.096  1.00 46.78 ? 200 PHE A CG  1 
ATOM 472  C CD1 . PHE A 1 60  ? -1.691  38.407  17.532  1.00 48.40 ? 200 PHE A CD1 1 
ATOM 473  C CD2 . PHE A 1 60  ? -2.212  36.072  17.388  1.00 47.09 ? 200 PHE A CD2 1 
ATOM 474  C CE1 . PHE A 1 60  ? -2.254  38.621  16.274  1.00 47.91 ? 200 PHE A CE1 1 
ATOM 475  C CE2 . PHE A 1 60  ? -2.777  36.274  16.130  1.00 48.94 ? 200 PHE A CE2 1 
ATOM 476  C CZ  . PHE A 1 60  ? -2.800  37.555  15.573  1.00 47.64 ? 200 PHE A CZ  1 
ATOM 477  N N   . PRO A 1 61  ? -1.375  35.430  22.053  1.00 42.41 ? 201 PRO A N   1 
ATOM 478  C CA  . PRO A 1 61  ? -0.793  34.762  23.217  1.00 41.51 ? 201 PRO A CA  1 
ATOM 479  C C   . PRO A 1 61  ? 0.599   34.262  22.820  1.00 40.68 ? 201 PRO A C   1 
ATOM 480  O O   . PRO A 1 61  ? 0.778   33.747  21.718  1.00 39.34 ? 201 PRO A O   1 
ATOM 481  C CB  . PRO A 1 61  ? -1.766  33.624  23.467  1.00 41.48 ? 201 PRO A CB  1 
ATOM 482  C CG  . PRO A 1 61  ? -2.130  33.223  22.079  1.00 42.84 ? 201 PRO A CG  1 
ATOM 483  C CD  . PRO A 1 61  ? -2.357  34.552  21.391  1.00 42.74 ? 201 PRO A CD  1 
ATOM 484  N N   . PHE A 1 62  ? 1.582   34.431  23.700  1.00 40.67 ? 202 PHE A N   1 
ATOM 485  C CA  . PHE A 1 62  ? 2.944   33.984  23.418  1.00 39.93 ? 202 PHE A CA  1 
ATOM 486  C C   . PHE A 1 62  ? 3.441   33.019  24.483  1.00 39.58 ? 202 PHE A C   1 
ATOM 487  O O   . PHE A 1 62  ? 3.447   33.345  25.664  1.00 40.60 ? 202 PHE A O   1 
ATOM 488  C CB  . PHE A 1 62  ? 3.909   35.167  23.346  1.00 40.24 ? 202 PHE A CB  1 
ATOM 489  C CG  . PHE A 1 62  ? 3.611   36.137  22.241  1.00 40.08 ? 202 PHE A CG  1 
ATOM 490  C CD1 . PHE A 1 62  ? 2.583   37.063  22.367  1.00 39.69 ? 202 PHE A CD1 1 
ATOM 491  C CD2 . PHE A 1 62  ? 4.384   36.146  21.087  1.00 39.51 ? 202 PHE A CD2 1 
ATOM 492  C CE1 . PHE A 1 62  ? 2.332   37.990  21.361  1.00 40.38 ? 202 PHE A CE1 1 
ATOM 493  C CE2 . PHE A 1 62  ? 4.142   37.068  20.073  1.00 40.19 ? 202 PHE A CE2 1 
ATOM 494  C CZ  . PHE A 1 62  ? 3.113   37.994  20.212  1.00 40.67 ? 202 PHE A CZ  1 
ATOM 495  N N   . TRP A 1 63  ? 3.870   31.835  24.059  1.00 39.15 ? 203 TRP A N   1 
ATOM 496  C CA  . TRP A 1 63  ? 4.372   30.819  24.980  1.00 38.32 ? 203 TRP A CA  1 
ATOM 497  C C   . TRP A 1 63  ? 5.700   31.200  25.626  1.00 38.40 ? 203 TRP A C   1 
ATOM 498  O O   . TRP A 1 63  ? 6.458   32.001  25.088  1.00 38.07 ? 203 TRP A O   1 
ATOM 499  C CB  . TRP A 1 63  ? 4.576   29.485  24.253  1.00 37.62 ? 203 TRP A CB  1 
ATOM 500  C CG  . TRP A 1 63  ? 3.329   28.783  23.821  1.00 36.31 ? 203 TRP A CG  1 
ATOM 501  C CD1 . TRP A 1 63  ? 3.005   28.411  22.553  1.00 35.37 ? 203 TRP A CD1 1 
ATOM 502  C CD2 . TRP A 1 63  ? 2.260   28.326  24.660  1.00 36.66 ? 203 TRP A CD2 1 
ATOM 503  N NE1 . TRP A 1 63  ? 1.804   27.749  22.545  1.00 34.53 ? 203 TRP A NE1 1 
ATOM 504  C CE2 . TRP A 1 63  ? 1.325   27.682  23.823  1.00 35.43 ? 203 TRP A CE2 1 
ATOM 505  C CE3 . TRP A 1 63  ? 2.003   28.398  26.036  1.00 37.11 ? 203 TRP A CE3 1 
ATOM 506  C CZ2 . TRP A 1 63  ? 0.145   27.112  24.317  1.00 35.99 ? 203 TRP A CZ2 1 
ATOM 507  C CZ3 . TRP A 1 63  ? 0.827   27.830  26.526  1.00 36.92 ? 203 TRP A CZ3 1 
ATOM 508  C CH2 . TRP A 1 63  ? -0.086  27.195  25.665  1.00 35.35 ? 203 TRP A CH2 1 
ATOM 509  N N   . MET A 1 64  ? 5.958   30.611  26.792  1.00 39.47 ? 204 MET A N   1 
ATOM 510  C CA  . MET A 1 64  ? 7.203   30.799  27.533  1.00 37.71 ? 204 MET A CA  1 
ATOM 511  C C   . MET A 1 64  ? 7.551   29.388  27.999  1.00 35.64 ? 204 MET A C   1 
ATOM 512  O O   . MET A 1 64  ? 6.731   28.480  27.865  1.00 33.42 ? 204 MET A O   1 
ATOM 513  C CB  . MET A 1 64  ? 7.024   31.756  28.724  1.00 38.08 ? 204 MET A CB  1 
ATOM 514  C CG  . MET A 1 64  ? 5.992   31.339  29.762  1.00 39.93 ? 204 MET A CG  1 
ATOM 515  S SD  . MET A 1 64  ? 5.871   32.540  31.119  1.00 40.75 ? 204 MET A SD  1 
ATOM 516  C CE  . MET A 1 64  ? 5.085   33.911  30.259  1.00 38.74 ? 204 MET A CE  1 
ATOM 517  N N   . GLY A 1 65  ? 8.747   29.196  28.541  1.00 34.81 ? 205 GLY A N   1 
ATOM 518  C CA  . GLY A 1 65  ? 9.154   27.862  28.958  1.00 33.97 ? 205 GLY A CA  1 
ATOM 519  C C   . GLY A 1 65  ? 8.632   27.289  30.262  1.00 32.40 ? 205 GLY A C   1 
ATOM 520  O O   . GLY A 1 65  ? 9.306   26.469  30.878  1.00 32.56 ? 205 GLY A O   1 
ATOM 521  N N   . LEU A 1 66  ? 7.437   27.689  30.679  1.00 31.60 ? 206 LEU A N   1 
ATOM 522  C CA  . LEU A 1 66  ? 6.863   27.193  31.926  1.00 30.28 ? 206 LEU A CA  1 
ATOM 523  C C   . LEU A 1 66  ? 5.757   26.180  31.638  1.00 30.70 ? 206 LEU A C   1 
ATOM 524  O O   . LEU A 1 66  ? 4.977   26.355  30.708  1.00 29.18 ? 206 LEU A O   1 
ATOM 525  C CB  . LEU A 1 66  ? 6.295   28.364  32.730  1.00 29.66 ? 206 LEU A CB  1 
ATOM 526  C CG  . LEU A 1 66  ? 6.010   28.165  34.220  1.00 28.78 ? 206 LEU A CG  1 
ATOM 527  C CD1 . LEU A 1 66  ? 7.320   28.076  34.986  1.00 27.69 ? 206 LEU A CD1 1 
ATOM 528  C CD2 . LEU A 1 66  ? 5.187   29.333  34.734  1.00 27.52 ? 206 LEU A CD2 1 
ATOM 529  N N   . SER A 1 67  ? 5.688   25.120  32.438  1.00 31.82 ? 207 SER A N   1 
ATOM 530  C CA  . SER A 1 67  ? 4.666   24.096  32.241  1.00 31.81 ? 207 SER A CA  1 
ATOM 531  C C   . SER A 1 67  ? 4.549   23.138  33.425  1.00 32.89 ? 207 SER A C   1 
ATOM 532  O O   . SER A 1 67  ? 5.319   23.228  34.385  1.00 30.50 ? 207 SER A O   1 
ATOM 533  C CB  . SER A 1 67  ? 4.964   23.306  30.966  1.00 30.22 ? 207 SER A CB  1 
ATOM 534  O OG  . SER A 1 67  ? 6.295   22.823  30.976  1.00 27.00 ? 207 SER A OG  1 
ATOM 535  N N   . ARG A 1 68  ? 3.578   22.225  33.346  1.00 33.96 ? 208 ARG A N   1 
ATOM 536  C CA  . ARG A 1 68  ? 3.335   21.237  34.401  1.00 34.18 ? 208 ARG A CA  1 
ATOM 537  C C   . ARG A 1 68  ? 2.255   20.240  33.966  1.00 34.19 ? 208 ARG A C   1 
ATOM 538  O O   . ARG A 1 68  ? 1.363   20.597  33.193  1.00 32.21 ? 208 ARG A O   1 
ATOM 539  C CB  . ARG A 1 68  ? 2.879   21.943  35.682  1.00 34.14 ? 208 ARG A CB  1 
ATOM 540  C CG  . ARG A 1 68  ? 1.518   22.617  35.557  1.00 32.75 ? 208 ARG A CG  1 
ATOM 541  C CD  . ARG A 1 68  ? 1.056   23.221  36.872  1.00 33.89 ? 208 ARG A CD  1 
ATOM 542  N NE  . ARG A 1 68  ? -0.326  23.688  36.794  1.00 34.95 ? 208 ARG A NE  1 
ATOM 543  C CZ  . ARG A 1 68  ? -1.005  24.200  37.816  1.00 36.26 ? 208 ARG A CZ  1 
ATOM 544  N NH1 . ARG A 1 68  ? -0.430  24.320  39.007  1.00 37.69 ? 208 ARG A NH1 1 
ATOM 545  N NH2 . ARG A 1 68  ? -2.267  24.574  37.651  1.00 35.35 ? 208 ARG A NH2 1 
ATOM 546  N N   . ARG A 1 69  ? 2.332   19.003  34.461  1.00 33.77 ? 209 ARG A N   1 
ATOM 547  C CA  . ARG A 1 69  ? 1.336   17.985  34.119  1.00 34.89 ? 209 ARG A CA  1 
ATOM 548  C C   . ARG A 1 69  ? -0.015  18.343  34.732  1.00 35.27 ? 209 ARG A C   1 
ATOM 549  O O   . ARG A 1 69  ? -0.983  18.584  34.016  1.00 36.63 ? 209 ARG A O   1 
ATOM 550  C CB  . ARG A 1 69  ? 1.763   16.607  34.621  1.00 35.54 ? 209 ARG A CB  1 
ATOM 551  C CG  . ARG A 1 69  ? 2.903   15.966  33.856  1.00 37.31 ? 209 ARG A CG  1 
ATOM 552  C CD  . ARG A 1 69  ? 3.231   14.608  34.457  1.00 38.91 ? 209 ARG A CD  1 
ATOM 553  N NE  . ARG A 1 69  ? 2.089   13.696  34.410  1.00 38.62 ? 209 ARG A NE  1 
ATOM 554  C CZ  . ARG A 1 69  ? 1.821   12.879  33.395  1.00 39.89 ? 209 ARG A CZ  1 
ATOM 555  N NH1 . ARG A 1 69  ? 2.616   12.850  32.332  1.00 38.81 ? 209 ARG A NH1 1 
ATOM 556  N NH2 . ARG A 1 69  ? 0.754   12.091  33.440  1.00 40.22 ? 209 ARG A NH2 1 
ATOM 557  N N   . ASN A 1 70  ? -0.074  18.372  36.059  1.00 35.80 ? 210 ASN A N   1 
ATOM 558  C CA  . ASN A 1 70  ? -1.300  18.719  36.772  1.00 37.17 ? 210 ASN A CA  1 
ATOM 559  C C   . ASN A 1 70  ? -0.945  19.598  37.963  1.00 37.11 ? 210 ASN A C   1 
ATOM 560  O O   . ASN A 1 70  ? 0.225   19.718  38.316  1.00 38.07 ? 210 ASN A O   1 
ATOM 561  C CB  . ASN A 1 70  ? -2.042  17.450  37.226  1.00 38.55 ? 210 ASN A CB  1 
ATOM 562  C CG  . ASN A 1 70  ? -1.114  16.393  37.811  1.00 38.20 ? 210 ASN A CG  1 
ATOM 563  O OD1 . ASN A 1 70  ? -0.516  16.584  38.867  1.00 38.55 ? 210 ASN A OD1 1 
ATOM 564  N ND2 . ASN A 1 70  ? -0.997  15.268  37.119  1.00 36.82 ? 210 ASN A ND2 1 
ATOM 565  N N   . PRO A 1 71  ? -1.947  20.235  38.592  1.00 37.18 ? 211 PRO A N   1 
ATOM 566  C CA  . PRO A 1 71  ? -1.702  21.108  39.745  1.00 36.49 ? 211 PRO A CA  1 
ATOM 567  C C   . PRO A 1 71  ? -0.834  20.482  40.830  1.00 36.03 ? 211 PRO A C   1 
ATOM 568  O O   . PRO A 1 71  ? -0.232  21.185  41.640  1.00 35.68 ? 211 PRO A O   1 
ATOM 569  C CB  . PRO A 1 71  ? -3.111  21.429  40.231  1.00 36.62 ? 211 PRO A CB  1 
ATOM 570  C CG  . PRO A 1 71  ? -3.888  21.469  38.956  1.00 35.97 ? 211 PRO A CG  1 
ATOM 571  C CD  . PRO A 1 71  ? -3.381  20.226  38.251  1.00 37.58 ? 211 PRO A CD  1 
ATOM 572  N N   . SER A 1 72  ? -0.773  19.157  40.842  1.00 35.85 ? 212 SER A N   1 
ATOM 573  C CA  . SER A 1 72  ? 0.031   18.447  41.822  1.00 35.69 ? 212 SER A CA  1 
ATOM 574  C C   . SER A 1 72  ? 1.506   18.771  41.618  1.00 36.11 ? 212 SER A C   1 
ATOM 575  O O   . SER A 1 72  ? 2.320   18.604  42.527  1.00 36.55 ? 212 SER A O   1 
ATOM 576  C CB  . SER A 1 72  ? -0.192  16.942  41.685  1.00 35.85 ? 212 SER A CB  1 
ATOM 577  O OG  . SER A 1 72  ? 0.729   16.217  42.477  1.00 38.60 ? 212 SER A OG  1 
ATOM 578  N N   . TYR A 1 73  ? 1.841   19.232  40.416  1.00 34.89 ? 213 TYR A N   1 
ATOM 579  C CA  . TYR A 1 73  ? 3.216   19.578  40.082  1.00 33.42 ? 213 TYR A CA  1 
ATOM 580  C C   . TYR A 1 73  ? 3.394   21.084  40.069  1.00 33.28 ? 213 TYR A C   1 
ATOM 581  O O   . TYR A 1 73  ? 2.488   21.824  39.673  1.00 33.22 ? 213 TYR A O   1 
ATOM 582  C CB  . TYR A 1 73  ? 3.601   19.067  38.688  1.00 33.78 ? 213 TYR A CB  1 
ATOM 583  C CG  . TYR A 1 73  ? 3.538   17.575  38.471  1.00 31.03 ? 213 TYR A CG  1 
ATOM 584  C CD1 . TYR A 1 73  ? 2.327   16.895  38.524  1.00 30.72 ? 213 TYR A CD1 1 
ATOM 585  C CD2 . TYR A 1 73  ? 4.690   16.850  38.162  1.00 29.94 ? 213 TYR A CD2 1 
ATOM 586  C CE1 . TYR A 1 73  ? 2.259   15.531  38.272  1.00 31.25 ? 213 TYR A CE1 1 
ATOM 587  C CE2 . TYR A 1 73  ? 4.636   15.489  37.908  1.00 28.84 ? 213 TYR A CE2 1 
ATOM 588  C CZ  . TYR A 1 73  ? 3.416   14.836  37.965  1.00 30.31 ? 213 TYR A CZ  1 
ATOM 589  O OH  . TYR A 1 73  ? 3.345   13.490  37.716  1.00 29.76 ? 213 TYR A OH  1 
ATOM 590  N N   . PRO A 1 74  ? 4.570   21.562  40.503  1.00 32.37 ? 214 PRO A N   1 
ATOM 591  C CA  . PRO A 1 74  ? 4.818   23.004  40.505  1.00 31.63 ? 214 PRO A CA  1 
ATOM 592  C C   . PRO A 1 74  ? 5.219   23.434  39.092  1.00 30.50 ? 214 PRO A C   1 
ATOM 593  O O   . PRO A 1 74  ? 5.584   22.599  38.266  1.00 29.18 ? 214 PRO A O   1 
ATOM 594  C CB  . PRO A 1 74  ? 5.961   23.148  41.504  1.00 30.27 ? 214 PRO A CB  1 
ATOM 595  C CG  . PRO A 1 74  ? 6.738   21.902  41.287  1.00 30.55 ? 214 PRO A CG  1 
ATOM 596  C CD  . PRO A 1 74  ? 5.643   20.851  41.219  1.00 31.13 ? 214 PRO A CD  1 
ATOM 597  N N   . TRP A 1 75  ? 5.135   24.729  38.810  1.00 30.36 ? 215 TRP A N   1 
ATOM 598  C CA  . TRP A 1 75  ? 5.518   25.230  37.501  1.00 30.04 ? 215 TRP A CA  1 
ATOM 599  C C   . TRP A 1 75  ? 7.025   25.114  37.367  1.00 31.24 ? 215 TRP A C   1 
ATOM 600  O O   . TRP A 1 75  ? 7.760   25.450  38.290  1.00 34.11 ? 215 TRP A O   1 
ATOM 601  C CB  . TRP A 1 75  ? 5.115   26.695  37.341  1.00 28.79 ? 215 TRP A CB  1 
ATOM 602  C CG  . TRP A 1 75  ? 3.651   26.925  37.404  1.00 28.65 ? 215 TRP A CG  1 
ATOM 603  C CD1 . TRP A 1 75  ? 2.934   27.356  38.483  1.00 29.04 ? 215 TRP A CD1 1 
ATOM 604  C CD2 . TRP A 1 75  ? 2.705   26.711  36.351  1.00 29.15 ? 215 TRP A CD2 1 
ATOM 605  N NE1 . TRP A 1 75  ? 1.597   27.422  38.168  1.00 30.03 ? 215 TRP A NE1 1 
ATOM 606  C CE2 . TRP A 1 75  ? 1.428   27.030  36.866  1.00 30.32 ? 215 TRP A CE2 1 
ATOM 607  C CE3 . TRP A 1 75  ? 2.810   26.278  35.023  1.00 28.80 ? 215 TRP A CE3 1 
ATOM 608  C CZ2 . TRP A 1 75  ? 0.264   26.932  36.098  1.00 29.80 ? 215 TRP A CZ2 1 
ATOM 609  C CZ3 . TRP A 1 75  ? 1.653   26.182  34.258  1.00 29.92 ? 215 TRP A CZ3 1 
ATOM 610  C CH2 . TRP A 1 75  ? 0.397   26.506  34.800  1.00 30.76 ? 215 TRP A CH2 1 
ATOM 611  N N   . LEU A 1 76  ? 7.486   24.643  36.217  1.00 32.18 ? 216 LEU A N   1 
ATOM 612  C CA  . LEU A 1 76  ? 8.913   24.496  35.988  1.00 33.71 ? 216 LEU A CA  1 
ATOM 613  C C   . LEU A 1 76  ? 9.344   25.009  34.628  1.00 34.20 ? 216 LEU A C   1 
ATOM 614  O O   . LEU A 1 76  ? 8.630   24.866  33.634  1.00 34.40 ? 216 LEU A O   1 
ATOM 615  C CB  . LEU A 1 76  ? 9.334   23.031  36.130  1.00 34.43 ? 216 LEU A CB  1 
ATOM 616  C CG  . LEU A 1 76  ? 9.395   22.463  37.551  1.00 37.38 ? 216 LEU A CG  1 
ATOM 617  C CD1 . LEU A 1 76  ? 9.845   21.008  37.494  1.00 39.07 ? 216 LEU A CD1 1 
ATOM 618  C CD2 . LEU A 1 76  ? 10.362  23.278  38.403  1.00 35.31 ? 216 LEU A CD2 1 
ATOM 619  N N   . TRP A 1 77  ? 10.518  25.622  34.599  1.00 34.82 ? 217 TRP A N   1 
ATOM 620  C CA  . TRP A 1 77  ? 11.066  26.140  33.361  1.00 37.26 ? 217 TRP A CA  1 
ATOM 621  C C   . TRP A 1 77  ? 11.652  24.942  32.628  1.00 38.36 ? 217 TRP A C   1 
ATOM 622  O O   . TRP A 1 77  ? 11.896  23.904  33.240  1.00 38.60 ? 217 TRP A O   1 
ATOM 623  C CB  . TRP A 1 77  ? 12.160  27.169  33.657  1.00 36.04 ? 217 TRP A CB  1 
ATOM 624  C CG  . TRP A 1 77  ? 11.650  28.456  34.249  1.00 36.41 ? 217 TRP A CG  1 
ATOM 625  C CD1 . TRP A 1 77  ? 11.964  28.981  35.475  1.00 36.75 ? 217 TRP A CD1 1 
ATOM 626  C CD2 . TRP A 1 77  ? 10.770  29.399  33.623  1.00 34.74 ? 217 TRP A CD2 1 
ATOM 627  N NE1 . TRP A 1 77  ? 11.335  30.196  35.646  1.00 35.03 ? 217 TRP A NE1 1 
ATOM 628  C CE2 . TRP A 1 77  ? 10.596  30.474  34.526  1.00 34.83 ? 217 TRP A CE2 1 
ATOM 629  C CE3 . TRP A 1 77  ? 10.111  29.441  32.388  1.00 33.26 ? 217 TRP A CE3 1 
ATOM 630  C CZ2 . TRP A 1 77  ? 9.793   31.580  34.228  1.00 34.86 ? 217 TRP A CZ2 1 
ATOM 631  C CZ3 . TRP A 1 77  ? 9.313   30.542  32.093  1.00 34.07 ? 217 TRP A CZ3 1 
ATOM 632  C CH2 . TRP A 1 77  ? 9.161   31.595  33.011  1.00 33.72 ? 217 TRP A CH2 1 
ATOM 633  N N   . GLU A 1 78  ? 11.870  25.071  31.325  1.00 39.33 ? 218 GLU A N   1 
ATOM 634  C CA  . GLU A 1 78  ? 12.438  23.967  30.566  1.00 40.09 ? 218 GLU A CA  1 
ATOM 635  C C   . GLU A 1 78  ? 13.642  23.371  31.289  1.00 39.50 ? 218 GLU A C   1 
ATOM 636  O O   . GLU A 1 78  ? 13.645  22.188  31.622  1.00 40.39 ? 218 GLU A O   1 
ATOM 637  C CB  . GLU A 1 78  ? 12.861  24.429  29.170  1.00 41.80 ? 218 GLU A CB  1 
ATOM 638  C CG  . GLU A 1 78  ? 11.709  24.683  28.216  1.00 44.37 ? 218 GLU A CG  1 
ATOM 639  C CD  . GLU A 1 78  ? 12.176  25.060  26.821  1.00 45.22 ? 218 GLU A CD  1 
ATOM 640  O OE1 . GLU A 1 78  ? 12.846  26.102  26.675  1.00 45.40 ? 218 GLU A OE1 1 
ATOM 641  O OE2 . GLU A 1 78  ? 11.875  24.315  25.866  1.00 45.94 ? 218 GLU A OE2 1 
ATOM 642  N N   . ASP A 1 79  ? 14.653  24.197  31.543  1.00 39.09 ? 219 ASP A N   1 
ATOM 643  C CA  . ASP A 1 79  ? 15.872  23.747  32.214  1.00 39.31 ? 219 ASP A CA  1 
ATOM 644  C C   . ASP A 1 79  ? 15.589  22.926  33.475  1.00 38.78 ? 219 ASP A C   1 
ATOM 645  O O   . ASP A 1 79  ? 16.484  22.284  34.027  1.00 37.23 ? 219 ASP A O   1 
ATOM 646  C CB  . ASP A 1 79  ? 16.763  24.955  32.544  1.00 39.20 ? 219 ASP A CB  1 
ATOM 647  C CG  . ASP A 1 79  ? 16.176  25.843  33.625  1.00 39.92 ? 219 ASP A CG  1 
ATOM 648  O OD1 . ASP A 1 79  ? 14.935  25.899  33.749  1.00 41.30 ? 219 ASP A OD1 1 
ATOM 649  O OD2 . ASP A 1 79  ? 16.960  26.496  34.344  1.00 39.35 ? 219 ASP A OD2 1 
ATOM 650  N N   . GLY A 1 80  ? 14.340  22.950  33.927  1.00 38.35 ? 220 GLY A N   1 
ATOM 651  C CA  . GLY A 1 80  ? 13.972  22.182  35.101  1.00 37.90 ? 220 GLY A CA  1 
ATOM 652  C C   . GLY A 1 80  ? 13.943  22.958  36.400  1.00 36.62 ? 220 GLY A C   1 
ATOM 653  O O   . GLY A 1 80  ? 13.538  22.421  37.426  1.00 36.41 ? 220 GLY A O   1 
ATOM 654  N N   . SER A 1 81  ? 14.371  24.216  36.365  1.00 35.97 ? 221 SER A N   1 
ATOM 655  C CA  . SER A 1 81  ? 14.380  25.045  37.563  1.00 35.06 ? 221 SER A CA  1 
ATOM 656  C C   . SER A 1 81  ? 12.971  25.522  37.891  1.00 35.99 ? 221 SER A C   1 
ATOM 657  O O   . SER A 1 81  ? 12.134  25.673  37.003  1.00 37.69 ? 221 SER A O   1 
ATOM 658  C CB  . SER A 1 81  ? 15.311  26.242  37.367  1.00 33.27 ? 221 SER A CB  1 
ATOM 659  O OG  . SER A 1 81  ? 14.966  26.964  36.202  1.00 32.44 ? 221 SER A OG  1 
ATOM 660  N N   . PRO A 1 82  ? 12.691  25.765  39.180  1.00 36.65 ? 222 PRO A N   1 
ATOM 661  C CA  . PRO A 1 82  ? 11.388  26.226  39.670  1.00 37.26 ? 222 PRO A CA  1 
ATOM 662  C C   . PRO A 1 82  ? 11.133  27.695  39.368  1.00 37.81 ? 222 PRO A C   1 
ATOM 663  O O   . PRO A 1 82  ? 12.069  28.445  39.097  1.00 37.61 ? 222 PRO A O   1 
ATOM 664  C CB  . PRO A 1 82  ? 11.491  25.974  41.163  1.00 37.21 ? 222 PRO A CB  1 
ATOM 665  C CG  . PRO A 1 82  ? 12.915  26.335  41.426  1.00 36.94 ? 222 PRO A CG  1 
ATOM 666  C CD  . PRO A 1 82  ? 13.640  25.628  40.298  1.00 36.67 ? 222 PRO A CD  1 
ATOM 667  N N   . LEU A 1 83  ? 9.867   28.100  39.422  1.00 38.08 ? 223 LEU A N   1 
ATOM 668  C CA  . LEU A 1 83  ? 9.498   29.490  39.172  1.00 39.84 ? 223 LEU A CA  1 
ATOM 669  C C   . LEU A 1 83  ? 9.750   30.346  40.405  1.00 41.72 ? 223 LEU A C   1 
ATOM 670  O O   . LEU A 1 83  ? 9.159   30.117  41.459  1.00 43.32 ? 223 LEU A O   1 
ATOM 671  C CB  . LEU A 1 83  ? 8.022   29.582  38.781  1.00 39.54 ? 223 LEU A CB  1 
ATOM 672  C CG  . LEU A 1 83  ? 7.309   30.918  39.026  1.00 38.99 ? 223 LEU A CG  1 
ATOM 673  C CD1 . LEU A 1 83  ? 8.067   32.054  38.363  1.00 39.12 ? 223 LEU A CD1 1 
ATOM 674  C CD2 . LEU A 1 83  ? 5.886   30.840  38.495  1.00 37.67 ? 223 LEU A CD2 1 
ATOM 675  N N   . MET A 1 84  ? 10.626  31.335  40.268  1.00 44.06 ? 224 MET A N   1 
ATOM 676  C CA  . MET A 1 84  ? 10.951  32.222  41.377  1.00 47.05 ? 224 MET A CA  1 
ATOM 677  C C   . MET A 1 84  ? 9.698   32.950  41.868  1.00 47.50 ? 224 MET A C   1 
ATOM 678  O O   . MET A 1 84  ? 8.877   33.414  41.070  1.00 47.44 ? 224 MET A O   1 
ATOM 679  C CB  . MET A 1 84  ? 11.995  33.247  40.932  1.00 51.63 ? 224 MET A CB  1 
ATOM 680  C CG  . MET A 1 84  ? 12.521  34.155  42.043  1.00 57.90 ? 224 MET A CG  1 
ATOM 681  S SD  . MET A 1 84  ? 13.655  35.425  41.421  1.00 61.59 ? 224 MET A SD  1 
ATOM 682  C CE  . MET A 1 84  ? 15.068  34.386  40.986  1.00 59.97 ? 224 MET A CE  1 
ATOM 683  N N   . PRO A 1 85  ? 9.535   33.057  43.194  1.00 47.15 ? 225 PRO A N   1 
ATOM 684  C CA  . PRO A 1 85  ? 8.379   33.733  43.789  1.00 47.14 ? 225 PRO A CA  1 
ATOM 685  C C   . PRO A 1 85  ? 8.455   35.250  43.615  1.00 47.72 ? 225 PRO A C   1 
ATOM 686  O O   . PRO A 1 85  ? 9.546   35.826  43.576  1.00 48.40 ? 225 PRO A O   1 
ATOM 687  C CB  . PRO A 1 85  ? 8.463   33.318  45.250  1.00 46.00 ? 225 PRO A CB  1 
ATOM 688  C CG  . PRO A 1 85  ? 9.946   33.260  45.477  1.00 46.23 ? 225 PRO A CG  1 
ATOM 689  C CD  . PRO A 1 85  ? 10.426  32.527  44.242  1.00 46.92 ? 225 PRO A CD  1 
ATOM 690  N N   . HIS A 1 86  ? 7.292   35.886  43.502  1.00 47.02 ? 226 HIS A N   1 
ATOM 691  C CA  . HIS A 1 86  ? 7.205   37.335  43.350  1.00 46.95 ? 226 HIS A CA  1 
ATOM 692  C C   . HIS A 1 86  ? 7.698   37.837  41.996  1.00 47.05 ? 226 HIS A C   1 
ATOM 693  O O   . HIS A 1 86  ? 8.418   38.833  41.925  1.00 48.47 ? 226 HIS A O   1 
ATOM 694  C CB  . HIS A 1 86  ? 7.995   38.030  44.467  1.00 48.04 ? 226 HIS A CB  1 
ATOM 695  C CG  . HIS A 1 86  ? 7.632   37.564  45.844  1.00 50.47 ? 226 HIS A CG  1 
ATOM 696  N ND1 . HIS A 1 86  ? 6.386   37.768  46.397  1.00 52.49 ? 226 HIS A ND1 1 
ATOM 697  C CD2 . HIS A 1 86  ? 8.344   36.874  46.766  1.00 50.42 ? 226 HIS A CD2 1 
ATOM 698  C CE1 . HIS A 1 86  ? 6.344   37.221  47.599  1.00 51.73 ? 226 HIS A CE1 1 
ATOM 699  N NE2 . HIS A 1 86  ? 7.519   36.672  47.848  1.00 51.12 ? 226 HIS A NE2 1 
ATOM 700  N N   . LEU A 1 87  ? 7.323   37.145  40.925  1.00 46.05 ? 227 LEU A N   1 
ATOM 701  C CA  . LEU A 1 87  ? 7.717   37.554  39.579  1.00 44.61 ? 227 LEU A CA  1 
ATOM 702  C C   . LEU A 1 87  ? 6.464   37.908  38.808  1.00 44.00 ? 227 LEU A C   1 
ATOM 703  O O   . LEU A 1 87  ? 6.421   38.901  38.087  1.00 44.79 ? 227 LEU A O   1 
ATOM 704  C CB  . LEU A 1 87  ? 8.451   36.430  38.846  1.00 44.75 ? 227 LEU A CB  1 
ATOM 705  C CG  . LEU A 1 87  ? 9.874   36.094  39.282  1.00 46.08 ? 227 LEU A CG  1 
ATOM 706  C CD1 . LEU A 1 87  ? 10.507  35.188  38.239  1.00 46.84 ? 227 LEU A CD1 1 
ATOM 707  C CD2 . LEU A 1 87  ? 10.692  37.370  39.427  1.00 47.66 ? 227 LEU A CD2 1 
ATOM 708  N N   . PHE A 1 88  ? 5.445   37.077  38.978  1.00 42.59 ? 228 PHE A N   1 
ATOM 709  C CA  . PHE A 1 88  ? 4.159   37.253  38.325  1.00 42.09 ? 228 PHE A CA  1 
ATOM 710  C C   . PHE A 1 88  ? 3.330   36.088  38.811  1.00 43.36 ? 228 PHE A C   1 
ATOM 711  O O   . PHE A 1 88  ? 3.887   35.072  39.217  1.00 43.44 ? 228 PHE A O   1 
ATOM 712  C CB  . PHE A 1 88  ? 4.315   37.187  36.799  1.00 41.06 ? 228 PHE A CB  1 
ATOM 713  C CG  . PHE A 1 88  ? 4.876   35.879  36.290  1.00 38.31 ? 228 PHE A CG  1 
ATOM 714  C CD1 . PHE A 1 88  ? 4.083   34.735  36.234  1.00 37.45 ? 228 PHE A CD1 1 
ATOM 715  C CD2 . PHE A 1 88  ? 6.199   35.794  35.862  1.00 36.92 ? 228 PHE A CD2 1 
ATOM 716  C CE1 . PHE A 1 88  ? 4.593   33.531  35.757  1.00 36.09 ? 228 PHE A CE1 1 
ATOM 717  C CE2 . PHE A 1 88  ? 6.719   34.593  35.383  1.00 35.95 ? 228 PHE A CE2 1 
ATOM 718  C CZ  . PHE A 1 88  ? 5.915   33.460  35.332  1.00 36.31 ? 228 PHE A CZ  1 
ATOM 719  N N   . ARG A 1 89  ? 2.011   36.224  38.797  1.00 45.45 ? 229 ARG A N   1 
ATOM 720  C CA  . ARG A 1 89  ? 1.173   35.118  39.228  1.00 46.73 ? 229 ARG A CA  1 
ATOM 721  C C   . ARG A 1 89  ? 0.401   34.617  38.015  1.00 46.50 ? 229 ARG A C   1 
ATOM 722  O O   . ARG A 1 89  ? -0.120  35.403  37.221  1.00 45.53 ? 229 ARG A O   1 
ATOM 723  C CB  . ARG A 1 89  ? 0.233   35.542  40.359  1.00 47.17 ? 229 ARG A CB  1 
ATOM 724  C CG  . ARG A 1 89  ? -1.161  35.929  39.945  1.00 49.85 ? 229 ARG A CG  1 
ATOM 725  C CD  . ARG A 1 89  ? -2.126  35.528  41.044  1.00 53.29 ? 229 ARG A CD  1 
ATOM 726  N NE  . ARG A 1 89  ? -3.492  35.972  40.794  1.00 56.82 ? 229 ARG A NE  1 
ATOM 727  C CZ  . ARG A 1 89  ? -3.859  37.246  40.718  1.00 58.20 ? 229 ARG A CZ  1 
ATOM 728  N NH1 . ARG A 1 89  ? -5.127  37.557  40.491  1.00 60.21 ? 229 ARG A NH1 1 
ATOM 729  N NH2 . ARG A 1 89  ? -2.960  38.210  40.866  1.00 58.12 ? 229 ARG A NH2 1 
ATOM 730  N N   . VAL A 1 90  ? 0.343   33.299  37.875  1.00 46.33 ? 230 VAL A N   1 
ATOM 731  C CA  . VAL A 1 90  ? -0.313  32.679  36.739  1.00 46.23 ? 230 VAL A CA  1 
ATOM 732  C C   . VAL A 1 90  ? -1.835  32.667  36.756  1.00 46.82 ? 230 VAL A C   1 
ATOM 733  O O   . VAL A 1 90  ? -2.450  31.889  37.485  1.00 47.33 ? 230 VAL A O   1 
ATOM 734  C CB  . VAL A 1 90  ? 0.194   31.236  36.558  1.00 45.00 ? 230 VAL A CB  1 
ATOM 735  C CG1 . VAL A 1 90  ? -0.471  30.596  35.355  1.00 44.32 ? 230 VAL A CG1 1 
ATOM 736  C CG2 . VAL A 1 90  ? 1.704   31.242  36.388  1.00 43.32 ? 230 VAL A CG2 1 
ATOM 737  N N   . ARG A 1 91  ? -2.433  33.530  35.938  1.00 46.82 ? 231 ARG A N   1 
ATOM 738  C CA  . ARG A 1 91  ? -3.884  33.608  35.820  1.00 47.50 ? 231 ARG A CA  1 
ATOM 739  C C   . ARG A 1 91  ? -4.318  32.365  35.034  1.00 48.28 ? 231 ARG A C   1 
ATOM 740  O O   . ARG A 1 91  ? -3.511  31.473  34.783  1.00 48.22 ? 231 ARG A O   1 
ATOM 741  C CB  . ARG A 1 91  ? -4.285  34.851  35.020  1.00 47.41 ? 231 ARG A CB  1 
ATOM 742  C CG  . ARG A 1 91  ? -3.642  36.166  35.445  1.00 48.86 ? 231 ARG A CG  1 
ATOM 743  C CD  . ARG A 1 91  ? -4.176  36.663  36.781  1.00 52.59 ? 231 ARG A CD  1 
ATOM 744  N NE  . ARG A 1 91  ? -4.400  38.112  36.801  1.00 53.34 ? 231 ARG A NE  1 
ATOM 745  C CZ  . ARG A 1 91  ? -3.452  39.034  36.656  1.00 51.87 ? 231 ARG A CZ  1 
ATOM 746  N NH1 . ARG A 1 91  ? -2.189  38.675  36.478  1.00 52.50 ? 231 ARG A NH1 1 
ATOM 747  N NH2 . ARG A 1 91  ? -3.769  40.322  36.692  1.00 50.89 ? 231 ARG A NH2 1 
ATOM 748  N N   . GLY A 1 92  ? -5.591  32.302  34.658  1.00 49.46 ? 232 GLY A N   1 
ATOM 749  C CA  . GLY A 1 92  ? -6.063  31.187  33.851  1.00 51.81 ? 232 GLY A CA  1 
ATOM 750  C C   . GLY A 1 92  ? -6.612  29.909  34.461  1.00 53.58 ? 232 GLY A C   1 
ATOM 751  O O   . GLY A 1 92  ? -6.825  29.797  35.670  1.00 53.13 ? 232 GLY A O   1 
ATOM 752  N N   . ALA A 1 93  ? -6.841  28.937  33.577  1.00 54.85 ? 233 ALA A N   1 
ATOM 753  C CA  . ALA A 1 93  ? -7.373  27.625  33.933  1.00 55.79 ? 233 ALA A CA  1 
ATOM 754  C C   . ALA A 1 93  ? -6.352  26.785  34.692  1.00 55.50 ? 233 ALA A C   1 
ATOM 755  O O   . ALA A 1 93  ? -5.666  25.940  34.109  1.00 54.90 ? 233 ALA A O   1 
ATOM 756  C CB  . ALA A 1 93  ? -7.811  26.890  32.673  1.00 55.60 ? 233 ALA A CB  1 
ATOM 757  N N   . VAL A 1 94  ? -6.269  27.014  35.996  1.00 54.56 ? 234 VAL A N   1 
ATOM 758  C CA  . VAL A 1 94  ? -5.332  26.292  36.842  1.00 52.85 ? 234 VAL A CA  1 
ATOM 759  C C   . VAL A 1 94  ? -6.000  25.127  37.565  1.00 52.94 ? 234 VAL A C   1 
ATOM 760  O O   . VAL A 1 94  ? -5.339  24.367  38.273  1.00 52.32 ? 234 VAL A O   1 
ATOM 761  C CB  . VAL A 1 94  ? -4.710  27.233  37.884  1.00 50.99 ? 234 VAL A CB  1 
ATOM 762  C CG1 . VAL A 1 94  ? -3.986  28.366  37.182  1.00 48.29 ? 234 VAL A CG1 1 
ATOM 763  C CG2 . VAL A 1 94  ? -5.792  27.785  38.791  1.00 49.97 ? 234 VAL A CG2 1 
ATOM 764  N N   . SER A 1 95  ? -7.310  24.993  37.387  1.00 53.46 ? 235 SER A N   1 
ATOM 765  C CA  . SER A 1 95  ? -8.059  23.917  38.026  1.00 54.64 ? 235 SER A CA  1 
ATOM 766  C C   . SER A 1 95  ? -8.019  22.693  37.133  1.00 54.18 ? 235 SER A C   1 
ATOM 767  O O   . SER A 1 95  ? -7.739  21.584  37.578  1.00 53.96 ? 235 SER A O   1 
ATOM 768  C CB  . SER A 1 95  ? -9.518  24.334  38.246  1.00 56.05 ? 235 SER A CB  1 
ATOM 769  O OG  . SER A 1 95  ? -9.610  25.516  39.024  1.00 59.41 ? 235 SER A OG  1 
ATOM 770  N N   . GLN A 1 96  ? -8.296  22.911  35.857  1.00 54.66 ? 236 GLN A N   1 
ATOM 771  C CA  . GLN A 1 96  ? -8.312  21.834  34.886  1.00 55.29 ? 236 GLN A CA  1 
ATOM 772  C C   . GLN A 1 96  ? -6.941  21.181  34.760  1.00 54.12 ? 236 GLN A C   1 
ATOM 773  O O   . GLN A 1 96  ? -5.935  21.741  35.193  1.00 53.60 ? 236 GLN A O   1 
ATOM 774  C CB  . GLN A 1 96  ? -8.756  22.388  33.531  1.00 57.61 ? 236 GLN A CB  1 
ATOM 775  C CG  . GLN A 1 96  ? -9.944  23.334  33.640  1.00 62.41 ? 236 GLN A CG  1 
ATOM 776  C CD  . GLN A 1 96  ? -10.682 23.528  32.325  1.00 66.18 ? 236 GLN A CD  1 
ATOM 777  O OE1 . GLN A 1 96  ? -11.689 24.237  32.268  1.00 68.22 ? 236 GLN A OE1 1 
ATOM 778  N NE2 . GLN A 1 96  ? -10.191 22.895  31.265  1.00 66.32 ? 236 GLN A NE2 1 
ATOM 779  N N   . THR A 1 97  ? -6.916  19.981  34.188  1.00 52.27 ? 237 THR A N   1 
ATOM 780  C CA  . THR A 1 97  ? -5.675  19.250  33.954  1.00 50.75 ? 237 THR A CA  1 
ATOM 781  C C   . THR A 1 97  ? -5.839  18.621  32.582  1.00 49.15 ? 237 THR A C   1 
ATOM 782  O O   . THR A 1 97  ? -6.647  17.715  32.401  1.00 47.44 ? 237 THR A O   1 
ATOM 783  C CB  . THR A 1 97  ? -5.445  18.126  34.977  1.00 49.94 ? 237 THR A CB  1 
ATOM 784  O OG1 . THR A 1 97  ? -6.546  17.218  34.936  1.00 52.74 ? 237 THR A OG1 1 
ATOM 785  C CG2 . THR A 1 97  ? -5.318  18.684  36.368  1.00 50.00 ? 237 THR A CG2 1 
ATOM 786  N N   . TYR A 1 98  ? -5.078  19.118  31.616  1.00 48.71 ? 238 TYR A N   1 
ATOM 787  C CA  . TYR A 1 98  ? -5.153  18.623  30.250  1.00 47.66 ? 238 TYR A CA  1 
ATOM 788  C C   . TYR A 1 98  ? -4.185  17.472  30.010  1.00 46.86 ? 238 TYR A C   1 
ATOM 789  O O   . TYR A 1 98  ? -3.080  17.449  30.554  1.00 47.65 ? 238 TYR A O   1 
ATOM 790  C CB  . TYR A 1 98  ? -4.878  19.775  29.289  1.00 48.22 ? 238 TYR A CB  1 
ATOM 791  C CG  . TYR A 1 98  ? -5.750  20.974  29.572  1.00 49.84 ? 238 TYR A CG  1 
ATOM 792  C CD1 . TYR A 1 98  ? -7.100  20.980  29.219  1.00 51.00 ? 238 TYR A CD1 1 
ATOM 793  C CD2 . TYR A 1 98  ? -5.238  22.089  30.233  1.00 51.39 ? 238 TYR A CD2 1 
ATOM 794  C CE1 . TYR A 1 98  ? -7.918  22.070  29.518  1.00 52.65 ? 238 TYR A CE1 1 
ATOM 795  C CE2 . TYR A 1 98  ? -6.046  23.183  30.537  1.00 53.05 ? 238 TYR A CE2 1 
ATOM 796  C CZ  . TYR A 1 98  ? -7.383  23.168  30.179  1.00 52.95 ? 238 TYR A CZ  1 
ATOM 797  O OH  . TYR A 1 98  ? -8.179  24.247  30.492  1.00 53.60 ? 238 TYR A OH  1 
ATOM 798  N N   . PRO A 1 99  ? -4.595  16.500  29.184  1.00 45.73 ? 239 PRO A N   1 
ATOM 799  C CA  . PRO A 1 99  ? -3.828  15.303  28.823  1.00 43.87 ? 239 PRO A CA  1 
ATOM 800  C C   . PRO A 1 99  ? -2.418  15.529  28.291  1.00 41.64 ? 239 PRO A C   1 
ATOM 801  O O   . PRO A 1 99  ? -1.543  14.690  28.484  1.00 40.59 ? 239 PRO A O   1 
ATOM 802  C CB  . PRO A 1 99  ? -4.726  14.616  27.796  1.00 44.68 ? 239 PRO A CB  1 
ATOM 803  C CG  . PRO A 1 99  ? -5.473  15.763  27.181  1.00 45.86 ? 239 PRO A CG  1 
ATOM 804  C CD  . PRO A 1 99  ? -5.834  16.574  28.393  1.00 45.04 ? 239 PRO A CD  1 
ATOM 805  N N   . SER A 1 100 ? -2.196  16.650  27.615  1.00 40.34 ? 240 SER A N   1 
ATOM 806  C CA  . SER A 1 100 ? -0.875  16.944  27.065  1.00 40.06 ? 240 SER A CA  1 
ATOM 807  C C   . SER A 1 100 ? -0.101  17.968  27.890  1.00 39.74 ? 240 SER A C   1 
ATOM 808  O O   . SER A 1 100 ? 0.815   18.620  27.391  1.00 39.23 ? 240 SER A O   1 
ATOM 809  C CB  . SER A 1 100 ? -1.005  17.433  25.621  1.00 39.34 ? 240 SER A CB  1 
ATOM 810  O OG  . SER A 1 100 ? -1.936  18.494  25.536  1.00 41.84 ? 240 SER A OG  1 
ATOM 811  N N   . GLY A 1 101 ? -0.473  18.100  29.158  1.00 39.89 ? 241 GLY A N   1 
ATOM 812  C CA  . GLY A 1 101 ? 0.202   19.037  30.035  1.00 38.13 ? 241 GLY A CA  1 
ATOM 813  C C   . GLY A 1 101 ? -0.452  20.400  30.077  1.00 38.36 ? 241 GLY A C   1 
ATOM 814  O O   . GLY A 1 101 ? -1.343  20.702  29.283  1.00 36.41 ? 241 GLY A O   1 
ATOM 815  N N   . THR A 1 102 ? -0.001  21.223  31.017  1.00 39.98 ? 242 THR A N   1 
ATOM 816  C CA  . THR A 1 102 ? -0.513  22.579  31.187  1.00 40.88 ? 242 THR A CA  1 
ATOM 817  C C   . THR A 1 102 ? 0.642   23.553  30.968  1.00 39.94 ? 242 THR A C   1 
ATOM 818  O O   . THR A 1 102 ? 1.644   23.513  31.683  1.00 40.63 ? 242 THR A O   1 
ATOM 819  C CB  . THR A 1 102 ? -1.088  22.780  32.604  1.00 41.89 ? 242 THR A CB  1 
ATOM 820  O OG1 . THR A 1 102 ? -2.145  21.834  32.825  1.00 44.03 ? 242 THR A OG1 1 
ATOM 821  C CG2 . THR A 1 102 ? -1.620  24.204  32.773  1.00 40.28 ? 242 THR A CG2 1 
ATOM 822  N N   . CYS A 1 103 ? 0.499   24.425  29.977  1.00 38.13 ? 243 CYS A N   1 
ATOM 823  C CA  . CYS A 1 103 ? 1.552   25.376  29.656  1.00 36.37 ? 243 CYS A CA  1 
ATOM 824  C C   . CYS A 1 103 ? 1.149   26.830  29.884  1.00 34.66 ? 243 CYS A C   1 
ATOM 825  O O   . CYS A 1 103 ? -0.028  27.176  29.822  1.00 34.28 ? 243 CYS A O   1 
ATOM 826  C CB  . CYS A 1 103 ? 2.000   25.137  28.215  1.00 36.21 ? 243 CYS A CB  1 
ATOM 827  S SG  . CYS A 1 103 ? 2.749   23.484  28.010  1.00 37.00 ? 243 CYS A SG  1 
ATOM 828  N N   . ALA A 1 104 ? 2.139   27.675  30.156  1.00 33.75 ? 244 ALA A N   1 
ATOM 829  C CA  . ALA A 1 104 ? 1.895   29.088  30.422  1.00 33.04 ? 244 ALA A CA  1 
ATOM 830  C C   . ALA A 1 104 ? 2.327   30.031  29.307  1.00 34.52 ? 244 ALA A C   1 
ATOM 831  O O   . ALA A 1 104 ? 3.458   29.963  28.815  1.00 34.45 ? 244 ALA A O   1 
ATOM 832  C CB  . ALA A 1 104 ? 2.586   29.489  31.715  1.00 32.39 ? 244 ALA A CB  1 
ATOM 833  N N   . TYR A 1 105 ? 1.414   30.917  28.919  1.00 35.08 ? 245 TYR A N   1 
ATOM 834  C CA  . TYR A 1 105 ? 1.694   31.906  27.890  1.00 34.77 ? 245 TYR A CA  1 
ATOM 835  C C   . TYR A 1 105 ? 1.478   33.295  28.474  1.00 35.13 ? 245 TYR A C   1 
ATOM 836  O O   . TYR A 1 105 ? 0.836   33.452  29.515  1.00 33.26 ? 245 TYR A O   1 
ATOM 837  C CB  . TYR A 1 105 ? 0.782   31.705  26.671  1.00 35.37 ? 245 TYR A CB  1 
ATOM 838  C CG  . TYR A 1 105 ? -0.694  31.997  26.897  1.00 37.91 ? 245 TYR A CG  1 
ATOM 839  C CD1 . TYR A 1 105 ? -1.143  33.291  27.175  1.00 38.04 ? 245 TYR A CD1 1 
ATOM 840  C CD2 . TYR A 1 105 ? -1.648  30.983  26.788  1.00 39.32 ? 245 TYR A CD2 1 
ATOM 841  C CE1 . TYR A 1 105 ? -2.500  33.570  27.335  1.00 39.18 ? 245 TYR A CE1 1 
ATOM 842  C CE2 . TYR A 1 105 ? -3.013  31.251  26.945  1.00 40.33 ? 245 TYR A CE2 1 
ATOM 843  C CZ  . TYR A 1 105 ? -3.433  32.546  27.216  1.00 41.17 ? 245 TYR A CZ  1 
ATOM 844  O OH  . TYR A 1 105 ? -4.781  32.814  27.355  1.00 39.85 ? 245 TYR A OH  1 
ATOM 845  N N   . ILE A 1 106 ? 2.026   34.301  27.806  1.00 35.99 ? 246 ILE A N   1 
ATOM 846  C CA  . ILE A 1 106 ? 1.867   35.675  28.244  1.00 37.63 ? 246 ILE A CA  1 
ATOM 847  C C   . ILE A 1 106 ? 1.046   36.405  27.188  1.00 38.33 ? 246 ILE A C   1 
ATOM 848  O O   . ILE A 1 106 ? 1.303   36.282  25.992  1.00 38.40 ? 246 ILE A O   1 
ATOM 849  C CB  . ILE A 1 106 ? 3.227   36.370  28.422  1.00 38.12 ? 246 ILE A CB  1 
ATOM 850  C CG1 . ILE A 1 106 ? 3.017   37.758  29.027  1.00 40.56 ? 246 ILE A CG1 1 
ATOM 851  C CG2 . ILE A 1 106 ? 3.941   36.468  27.088  1.00 38.88 ? 246 ILE A CG2 1 
ATOM 852  C CD1 . ILE A 1 106 ? 4.300   38.476  29.379  1.00 43.14 ? 246 ILE A CD1 1 
ATOM 853  N N   . GLN A 1 107 ? 0.042   37.147  27.637  1.00 40.27 ? 247 GLN A N   1 
ATOM 854  C CA  . GLN A 1 107 ? -0.830  37.884  26.734  1.00 41.74 ? 247 GLN A CA  1 
ATOM 855  C C   . GLN A 1 107 ? -1.267  39.196  27.367  1.00 42.67 ? 247 GLN A C   1 
ATOM 856  O O   . GLN A 1 107 ? -1.629  39.243  28.546  1.00 43.44 ? 247 GLN A O   1 
ATOM 857  C CB  . GLN A 1 107 ? -2.050  37.034  26.378  1.00 41.16 ? 247 GLN A CB  1 
ATOM 858  C CG  . GLN A 1 107 ? -3.062  37.727  25.489  1.00 42.31 ? 247 GLN A CG  1 
ATOM 859  C CD  . GLN A 1 107 ? -4.083  36.765  24.922  1.00 42.97 ? 247 GLN A CD  1 
ATOM 860  O OE1 . GLN A 1 107 ? -4.829  36.123  25.659  1.00 42.86 ? 247 GLN A OE1 1 
ATOM 861  N NE2 . GLN A 1 107 ? -4.116  36.654  23.602  1.00 44.99 ? 247 GLN A NE2 1 
ATOM 862  N N   . ARG A 1 108 ? -1.228  40.257  26.568  1.00 43.04 ? 248 ARG A N   1 
ATOM 863  C CA  . ARG A 1 108 ? -1.589  41.592  27.023  1.00 44.37 ? 248 ARG A CA  1 
ATOM 864  C C   . ARG A 1 108 ? -1.181  41.836  28.474  1.00 44.12 ? 248 ARG A C   1 
ATOM 865  O O   . ARG A 1 108 ? -2.013  42.173  29.323  1.00 42.40 ? 248 ARG A O   1 
ATOM 866  C CB  . ARG A 1 108 ? -3.092  41.844  26.849  1.00 46.18 ? 248 ARG A CB  1 
ATOM 867  C CG  . ARG A 1 108 ? -3.558  41.831  25.394  1.00 51.03 ? 248 ARG A CG  1 
ATOM 868  C CD  . ARG A 1 108 ? -4.739  42.776  25.161  1.00 52.91 ? 248 ARG A CD  1 
ATOM 869  N NE  . ARG A 1 108 ? -4.330  44.180  25.179  1.00 54.89 ? 248 ARG A NE  1 
ATOM 870  C CZ  . ARG A 1 108 ? -5.163  45.205  25.023  1.00 56.24 ? 248 ARG A CZ  1 
ATOM 871  N NH1 . ARG A 1 108 ? -6.458  44.985  24.837  1.00 57.76 ? 248 ARG A NH1 1 
ATOM 872  N NH2 . ARG A 1 108 ? -4.705  46.451  25.051  1.00 56.49 ? 248 ARG A NH2 1 
ATOM 873  N N   . GLY A 1 109 ? 0.110   41.648  28.742  1.00 43.25 ? 249 GLY A N   1 
ATOM 874  C CA  . GLY A 1 109 ? 0.643   41.877  30.070  1.00 43.41 ? 249 GLY A CA  1 
ATOM 875  C C   . GLY A 1 109 ? 0.554   40.745  31.075  1.00 43.99 ? 249 GLY A C   1 
ATOM 876  O O   . GLY A 1 109 ? 1.495   40.532  31.841  1.00 44.29 ? 249 GLY A O   1 
ATOM 877  N N   . ALA A 1 110 ? -0.558  40.015  31.076  1.00 42.13 ? 250 ALA A N   1 
ATOM 878  C CA  . ALA A 1 110 ? -0.745  38.932  32.034  1.00 40.46 ? 250 ALA A CA  1 
ATOM 879  C C   . ALA A 1 110 ? -0.307  37.553  31.551  1.00 38.61 ? 250 ALA A C   1 
ATOM 880  O O   . ALA A 1 110 ? -0.300  37.278  30.355  1.00 38.52 ? 250 ALA A O   1 
ATOM 881  C CB  . ALA A 1 110 ? -2.206  38.888  32.477  1.00 40.37 ? 250 ALA A CB  1 
ATOM 882  N N   . VAL A 1 111 ? 0.055   36.698  32.507  1.00 36.23 ? 251 VAL A N   1 
ATOM 883  C CA  . VAL A 1 111 ? 0.495   35.328  32.240  1.00 33.74 ? 251 VAL A CA  1 
ATOM 884  C C   . VAL A 1 111 ? -0.653  34.354  32.527  1.00 33.71 ? 251 VAL A C   1 
ATOM 885  O O   . VAL A 1 111 ? -1.175  34.317  33.640  1.00 33.09 ? 251 VAL A O   1 
ATOM 886  C CB  . VAL A 1 111 ? 1.707   34.960  33.135  1.00 32.55 ? 251 VAL A CB  1 
ATOM 887  C CG1 . VAL A 1 111 ? 2.079   33.500  32.949  1.00 32.10 ? 251 VAL A CG1 1 
ATOM 888  C CG2 . VAL A 1 111 ? 2.890   35.853  32.799  1.00 29.61 ? 251 VAL A CG2 1 
ATOM 889  N N   . TYR A 1 112 ? -1.032  33.561  31.525  1.00 33.36 ? 252 TYR A N   1 
ATOM 890  C CA  . TYR A 1 112 ? -2.134  32.609  31.671  1.00 31.51 ? 252 TYR A CA  1 
ATOM 891  C C   . TYR A 1 112 ? -1.734  31.156  31.439  1.00 32.18 ? 252 TYR A C   1 
ATOM 892  O O   . TYR A 1 112 ? -0.822  30.869  30.661  1.00 31.91 ? 252 TYR A O   1 
ATOM 893  C CB  . TYR A 1 112 ? -3.265  32.943  30.695  1.00 28.22 ? 252 TYR A CB  1 
ATOM 894  C CG  . TYR A 1 112 ? -3.729  34.384  30.703  1.00 29.89 ? 252 TYR A CG  1 
ATOM 895  C CD1 . TYR A 1 112 ? -2.923  35.404  30.193  1.00 31.33 ? 252 TYR A CD1 1 
ATOM 896  C CD2 . TYR A 1 112 ? -4.990  34.725  31.190  1.00 28.02 ? 252 TYR A CD2 1 
ATOM 897  C CE1 . TYR A 1 112 ? -3.366  36.721  30.165  1.00 30.48 ? 252 TYR A CE1 1 
ATOM 898  C CE2 . TYR A 1 112 ? -5.441  36.035  31.166  1.00 26.44 ? 252 TYR A CE2 1 
ATOM 899  C CZ  . TYR A 1 112 ? -4.627  37.029  30.652  1.00 30.33 ? 252 TYR A CZ  1 
ATOM 900  O OH  . TYR A 1 112 ? -5.074  38.333  30.625  1.00 31.62 ? 252 TYR A OH  1 
ATOM 901  N N   . ALA A 1 113 ? -2.433  30.248  32.119  1.00 33.29 ? 253 ALA A N   1 
ATOM 902  C CA  . ALA A 1 113 ? -2.207  28.814  31.979  1.00 34.07 ? 253 ALA A CA  1 
ATOM 903  C C   . ALA A 1 113 ? -3.190  28.334  30.911  1.00 37.47 ? 253 ALA A C   1 
ATOM 904  O O   . ALA A 1 113 ? -4.296  28.881  30.784  1.00 38.62 ? 253 ALA A O   1 
ATOM 905  C CB  . ALA A 1 113 ? -2.476  28.115  33.286  1.00 31.21 ? 253 ALA A CB  1 
ATOM 906  N N   . GLU A 1 114 ? -2.804  27.315  30.148  1.00 37.95 ? 254 GLU A N   1 
ATOM 907  C CA  . GLU A 1 114 ? -3.669  26.823  29.083  1.00 38.19 ? 254 GLU A CA  1 
ATOM 908  C C   . GLU A 1 114 ? -3.278  25.420  28.636  1.00 38.47 ? 254 GLU A C   1 
ATOM 909  O O   . GLU A 1 114 ? -2.171  24.955  28.916  1.00 38.46 ? 254 GLU A O   1 
ATOM 910  C CB  . GLU A 1 114 ? -3.588  27.791  27.894  1.00 38.55 ? 254 GLU A CB  1 
ATOM 911  C CG  . GLU A 1 114 ? -4.531  27.509  26.741  1.00 39.20 ? 254 GLU A CG  1 
ATOM 912  C CD  . GLU A 1 114 ? -5.983  27.562  27.155  1.00 41.37 ? 254 GLU A CD  1 
ATOM 913  O OE1 . GLU A 1 114 ? -6.434  26.624  27.847  1.00 44.09 ? 254 GLU A OE1 1 
ATOM 914  O OE2 . GLU A 1 114 ? -6.672  28.542  26.797  1.00 40.52 ? 254 GLU A OE2 1 
ATOM 915  N N   . ASN A 1 115 ? -4.199  24.747  27.952  1.00 38.18 ? 255 ASN A N   1 
ATOM 916  C CA  . ASN A 1 115 ? -3.939  23.411  27.433  1.00 40.18 ? 255 ASN A CA  1 
ATOM 917  C C   . ASN A 1 115 ? -2.699  23.541  26.547  1.00 42.13 ? 255 ASN A C   1 
ATOM 918  O O   . ASN A 1 115 ? -2.673  24.371  25.634  1.00 44.41 ? 255 ASN A O   1 
ATOM 919  C CB  . ASN A 1 115 ? -5.125  22.941  26.591  1.00 41.20 ? 255 ASN A CB  1 
ATOM 920  C CG  . ASN A 1 115 ? -5.028  21.474  26.206  1.00 41.75 ? 255 ASN A CG  1 
ATOM 921  O OD1 . ASN A 1 115 ? -3.932  20.929  26.047  1.00 41.95 ? 255 ASN A OD1 1 
ATOM 922  N ND2 . ASN A 1 115 ? -6.178  20.831  26.036  1.00 39.08 ? 255 ASN A ND2 1 
ATOM 923  N N   . CYS A 1 116 ? -1.677  22.729  26.799  1.00 42.19 ? 256 CYS A N   1 
ATOM 924  C CA  . CYS A 1 116 ? -0.449  22.820  26.015  1.00 42.29 ? 256 CYS A CA  1 
ATOM 925  C C   . CYS A 1 116 ? -0.618  22.614  24.506  1.00 43.71 ? 256 CYS A C   1 
ATOM 926  O O   . CYS A 1 116 ? 0.159   23.163  23.721  1.00 44.61 ? 256 CYS A O   1 
ATOM 927  C CB  . CYS A 1 116 ? 0.605   21.847  26.549  1.00 40.07 ? 256 CYS A CB  1 
ATOM 928  S SG  . CYS A 1 116 ? 1.217   22.176  28.241  1.00 38.73 ? 256 CYS A SG  1 
ATOM 929  N N   . ILE A 1 117 ? -1.619  21.840  24.089  1.00 43.41 ? 257 ILE A N   1 
ATOM 930  C CA  . ILE A 1 117 ? -1.822  21.615  22.659  1.00 43.43 ? 257 ILE A CA  1 
ATOM 931  C C   . ILE A 1 117 ? -2.672  22.679  21.984  1.00 43.20 ? 257 ILE A C   1 
ATOM 932  O O   . ILE A 1 117 ? -3.594  22.369  21.235  1.00 43.16 ? 257 ILE A O   1 
ATOM 933  C CB  . ILE A 1 117 ? -2.444  20.225  22.360  1.00 42.91 ? 257 ILE A CB  1 
ATOM 934  C CG1 . ILE A 1 117 ? -3.602  19.933  23.313  1.00 43.43 ? 257 ILE A CG1 1 
ATOM 935  C CG2 . ILE A 1 117 ? -1.370  19.156  22.448  1.00 42.56 ? 257 ILE A CG2 1 
ATOM 936  C CD1 . ILE A 1 117 ? -4.830  20.779  23.090  1.00 44.79 ? 257 ILE A CD1 1 
ATOM 937  N N   . LEU A 1 118 ? -2.357  23.938  22.256  1.00 43.27 ? 258 LEU A N   1 
ATOM 938  C CA  . LEU A 1 118 ? -3.075  25.041  21.645  1.00 43.03 ? 258 LEU A CA  1 
ATOM 939  C C   . LEU A 1 118 ? -2.077  25.943  20.944  1.00 42.53 ? 258 LEU A C   1 
ATOM 940  O O   . LEU A 1 118 ? -1.027  26.272  21.492  1.00 41.60 ? 258 LEU A O   1 
ATOM 941  C CB  . LEU A 1 118 ? -3.866  25.826  22.694  1.00 43.08 ? 258 LEU A CB  1 
ATOM 942  C CG  . LEU A 1 118 ? -5.043  25.041  23.283  1.00 42.93 ? 258 LEU A CG  1 
ATOM 943  C CD1 . LEU A 1 118 ? -5.891  25.954  24.143  1.00 41.04 ? 258 LEU A CD1 1 
ATOM 944  C CD2 . LEU A 1 118 ? -5.888  24.461  22.158  1.00 42.97 ? 258 LEU A CD2 1 
ATOM 945  N N   . ALA A 1 119 ? -2.407  26.325  19.717  1.00 42.67 ? 259 ALA A N   1 
ATOM 946  C CA  . ALA A 1 119 ? -1.540  27.178  18.922  1.00 40.24 ? 259 ALA A CA  1 
ATOM 947  C C   . ALA A 1 119 ? -1.400  28.570  19.518  1.00 39.16 ? 259 ALA A C   1 
ATOM 948  O O   . ALA A 1 119 ? -2.372  29.174  19.973  1.00 38.43 ? 259 ALA A O   1 
ATOM 949  C CB  . ALA A 1 119 ? -2.068  27.272  17.504  1.00 39.59 ? 259 ALA A CB  1 
ATOM 950  N N   . ALA A 1 120 ? -0.169  29.064  19.504  1.00 37.13 ? 260 ALA A N   1 
ATOM 951  C CA  . ALA A 1 120 ? 0.155   30.381  20.017  1.00 36.23 ? 260 ALA A CA  1 
ATOM 952  C C   . ALA A 1 120 ? 1.594   30.653  19.633  1.00 35.95 ? 260 ALA A C   1 
ATOM 953  O O   . ALA A 1 120 ? 2.372   29.722  19.447  1.00 36.51 ? 260 ALA A O   1 
ATOM 954  C CB  . ALA A 1 120 ? 0.006   30.409  21.521  1.00 36.23 ? 260 ALA A CB  1 
ATOM 955  N N   . PHE A 1 121 ? 1.949   31.924  19.499  1.00 36.87 ? 261 PHE A N   1 
ATOM 956  C CA  . PHE A 1 121 ? 3.318   32.270  19.148  1.00 38.90 ? 261 PHE A CA  1 
ATOM 957  C C   . PHE A 1 121 ? 4.198   32.072  20.371  1.00 37.51 ? 261 PHE A C   1 
ATOM 958  O O   . PHE A 1 121 ? 3.708   32.034  21.494  1.00 37.61 ? 261 PHE A O   1 
ATOM 959  C CB  . PHE A 1 121 ? 3.405   33.720  18.667  1.00 41.97 ? 261 PHE A CB  1 
ATOM 960  C CG  . PHE A 1 121 ? 2.647   33.977  17.405  1.00 45.47 ? 261 PHE A CG  1 
ATOM 961  C CD1 . PHE A 1 121 ? 1.257   34.023  17.411  1.00 45.59 ? 261 PHE A CD1 1 
ATOM 962  C CD2 . PHE A 1 121 ? 3.321   34.138  16.197  1.00 47.36 ? 261 PHE A CD2 1 
ATOM 963  C CE1 . PHE A 1 121 ? 0.547   34.224  16.233  1.00 46.08 ? 261 PHE A CE1 1 
ATOM 964  C CE2 . PHE A 1 121 ? 2.619   34.339  15.011  1.00 47.34 ? 261 PHE A CE2 1 
ATOM 965  C CZ  . PHE A 1 121 ? 1.230   34.382  15.031  1.00 46.61 ? 261 PHE A CZ  1 
ATOM 966  N N   . SER A 1 122 ? 5.497   31.933  20.151  1.00 36.47 ? 262 SER A N   1 
ATOM 967  C CA  . SER A 1 122 ? 6.422   31.735  21.252  1.00 36.22 ? 262 SER A CA  1 
ATOM 968  C C   . SER A 1 122 ? 7.549   32.746  21.203  1.00 35.60 ? 262 SER A C   1 
ATOM 969  O O   . SER A 1 122 ? 7.722   33.463  20.224  1.00 36.18 ? 262 SER A O   1 
ATOM 970  C CB  . SER A 1 122 ? 6.994   30.315  21.219  1.00 37.38 ? 262 SER A CB  1 
ATOM 971  O OG  . SER A 1 122 ? 7.605   30.029  19.973  1.00 40.63 ? 262 SER A OG  1 
ATOM 972  N N   . ILE A 1 123 ? 8.312   32.801  22.278  1.00 35.11 ? 263 ILE A N   1 
ATOM 973  C CA  . ILE A 1 123 ? 9.431   33.714  22.367  1.00 36.32 ? 263 ILE A CA  1 
ATOM 974  C C   . ILE A 1 123 ? 10.649  32.864  22.681  1.00 36.65 ? 263 ILE A C   1 
ATOM 975  O O   . ILE A 1 123 ? 10.650  32.120  23.659  1.00 36.98 ? 263 ILE A O   1 
ATOM 976  C CB  . ILE A 1 123 ? 9.202   34.749  23.492  1.00 36.80 ? 263 ILE A CB  1 
ATOM 977  C CG1 . ILE A 1 123 ? 7.896   35.503  23.234  1.00 36.51 ? 263 ILE A CG1 1 
ATOM 978  C CG2 . ILE A 1 123 ? 10.377  35.713  23.574  1.00 35.09 ? 263 ILE A CG2 1 
ATOM 979  C CD1 . ILE A 1 123 ? 7.553   36.519  24.299  1.00 39.01 ? 263 ILE A CD1 1 
ATOM 980  N N   . CYS A 1 124 ? 11.670  32.950  21.836  1.00 37.31 ? 264 CYS A N   1 
ATOM 981  C CA  . CYS A 1 124 ? 12.890  32.183  22.046  1.00 38.40 ? 264 CYS A CA  1 
ATOM 982  C C   . CYS A 1 124 ? 14.003  33.078  22.579  1.00 38.58 ? 264 CYS A C   1 
ATOM 983  O O   . CYS A 1 124 ? 13.985  34.291  22.376  1.00 37.47 ? 264 CYS A O   1 
ATOM 984  C CB  . CYS A 1 124 ? 13.366  31.542  20.742  1.00 38.51 ? 264 CYS A CB  1 
ATOM 985  S SG  . CYS A 1 124 ? 12.193  30.452  19.873  1.00 42.60 ? 264 CYS A SG  1 
ATOM 986  N N   . GLN A 1 125 ? 14.970  32.473  23.262  1.00 39.56 ? 265 GLN A N   1 
ATOM 987  C CA  . GLN A 1 125 ? 16.099  33.219  23.805  1.00 40.62 ? 265 GLN A CA  1 
ATOM 988  C C   . GLN A 1 125 ? 17.340  32.351  23.911  1.00 41.72 ? 265 GLN A C   1 
ATOM 989  O O   . GLN A 1 125 ? 17.251  31.147  24.148  1.00 40.74 ? 265 GLN A O   1 
ATOM 990  C CB  . GLN A 1 125 ? 15.769  33.787  25.190  1.00 40.16 ? 265 GLN A CB  1 
ATOM 991  C CG  . GLN A 1 125 ? 15.732  32.762  26.307  1.00 40.26 ? 265 GLN A CG  1 
ATOM 992  C CD  . GLN A 1 125 ? 15.501  33.396  27.665  1.00 40.60 ? 265 GLN A CD  1 
ATOM 993  O OE1 . GLN A 1 125 ? 14.480  34.043  27.894  1.00 42.69 ? 265 GLN A OE1 1 
ATOM 994  N NE2 . GLN A 1 125 ? 16.452  33.214  28.573  1.00 39.01 ? 265 GLN A NE2 1 
ATOM 995  N N   . LYS A 1 126 ? 18.497  32.976  23.724  1.00 43.68 ? 266 LYS A N   1 
ATOM 996  C CA  . LYS A 1 126 ? 19.771  32.283  23.821  1.00 45.23 ? 266 LYS A CA  1 
ATOM 997  C C   . LYS A 1 126 ? 20.839  33.291  24.199  1.00 45.90 ? 266 LYS A C   1 
ATOM 998  O O   . LYS A 1 126 ? 20.804  34.434  23.755  1.00 46.36 ? 266 LYS A O   1 
ATOM 999  C CB  . LYS A 1 126 ? 20.128  31.589  22.498  1.00 45.44 ? 266 LYS A CB  1 
ATOM 1000 C CG  . LYS A 1 126 ? 20.674  32.482  21.394  1.00 44.99 ? 266 LYS A CG  1 
ATOM 1001 C CD  . LYS A 1 126 ? 20.819  31.686  20.093  1.00 44.69 ? 266 LYS A CD  1 
ATOM 1002 C CE  . LYS A 1 126 ? 21.413  32.522  18.971  1.00 43.33 ? 266 LYS A CE  1 
ATOM 1003 N NZ  . LYS A 1 126 ? 21.041  31.983  17.634  1.00 41.95 ? 266 LYS A NZ  1 
ATOM 1004 N N   . LYS A 1 127 ? 21.779  32.854  25.035  1.00 48.54 ? 267 LYS A N   1 
ATOM 1005 C CA  . LYS A 1 127 ? 22.870  33.702  25.508  1.00 50.68 ? 267 LYS A CA  1 
ATOM 1006 C C   . LYS A 1 127 ? 23.321  34.629  24.403  1.00 50.94 ? 267 LYS A C   1 
ATOM 1007 O O   . LYS A 1 127 ? 23.477  34.227  23.262  1.00 50.00 ? 267 LYS A O   1 
ATOM 1008 C CB  . LYS A 1 127 ? 24.056  32.861  25.968  1.00 52.38 ? 267 LYS A CB  1 
ATOM 1009 C CG  . LYS A 1 127 ? 25.248  33.685  26.439  1.00 54.27 ? 267 LYS A CG  1 
ATOM 1010 C CD  . LYS A 1 127 ? 26.553  32.907  26.291  1.00 55.53 ? 267 LYS A CD  1 
ATOM 1011 C CE  . LYS A 1 127 ? 26.635  31.718  27.242  1.00 56.17 ? 267 LYS A CE  1 
ATOM 1012 N NZ  . LYS A 1 127 ? 27.014  32.125  28.627  1.00 55.77 ? 267 LYS A NZ  1 
ATOM 1013 N N   . ALA A 1 128 ? 23.553  35.879  24.762  1.00 52.26 ? 268 ALA A N   1 
ATOM 1014 C CA  . ALA A 1 128 ? 23.947  36.887  23.787  1.00 54.10 ? 268 ALA A CA  1 
ATOM 1015 C C   . ALA A 1 128 ? 25.248  36.586  23.057  1.00 56.35 ? 268 ALA A C   1 
ATOM 1016 O O   . ALA A 1 128 ? 25.312  35.751  22.143  1.00 58.52 ? 268 ALA A O   1 
ATOM 1017 C CB  . ALA A 1 128 ? 24.074  38.217  24.460  1.00 52.86 ? 268 ALA A CB  1 
ATOM 1018 N N   . ASN A 1 129 ? 26.266  37.329  23.471  1.00 56.74 ? 269 ASN A N   1 
ATOM 1019 C CA  . ASN A 1 129 ? 27.594  37.250  22.932  1.00 56.97 ? 269 ASN A CA  1 
ATOM 1020 C C   . ASN A 1 129 ? 28.153  38.588  23.380  1.00 59.71 ? 269 ASN A C   1 
ATOM 1021 O O   . ASN A 1 129 ? 27.531  39.633  23.184  1.00 61.00 ? 269 ASN A O   1 
ATOM 1022 C CB  . ASN A 1 129 ? 27.532  37.109  21.401  1.00 53.19 ? 269 ASN A CB  1 
ATOM 1023 C CG  . ASN A 1 129 ? 28.554  36.128  20.877  1.00 49.39 ? 269 ASN A CG  1 
ATOM 1024 O OD1 . ASN A 1 129 ? 29.752  36.357  21.006  1.00 46.97 ? 269 ASN A OD1 1 
ATOM 1025 N ND2 . ASN A 1 129 ? 28.092  35.005  20.344  1.00 47.45 ? 269 ASN A ND2 1 
ATOM 1026 N N   . LEU A 1 130 ? 29.279  38.531  24.083  1.00 61.96 ? 270 LEU A N   1 
ATOM 1027 C CA  . LEU A 1 130 ? 29.916  39.755  24.611  1.00 65.24 ? 270 LEU A CA  1 
ATOM 1028 C C   . LEU A 1 130 ? 30.677  39.140  25.751  1.00 67.38 ? 270 LEU A C   1 
ATOM 1029 O O   . LEU A 1 130 ? 30.195  39.019  26.863  1.00 68.77 ? 270 LEU A O   1 
ATOM 1030 C CB  . LEU A 1 130 ? 28.837  40.804  25.066  1.00 64.14 ? 270 LEU A CB  1 
ATOM 1031 C CG  . LEU A 1 130 ? 27.681  40.685  26.136  1.00 61.57 ? 270 LEU A CG  1 
ATOM 1032 C CD1 . LEU A 1 130 ? 27.807  41.946  26.969  1.00 62.07 ? 270 LEU A CD1 1 
ATOM 1033 C CD2 . LEU A 1 130 ? 26.235  40.554  25.567  1.00 62.05 ? 270 LEU A CD2 1 
ATOM 1034 N N   . ARG A 1 131 ? 31.864  38.667  25.417  1.00 69.89 ? 271 ARG A N   1 
ATOM 1035 C CA  . ARG A 1 131 ? 32.760  38.038  26.383  1.00 71.90 ? 271 ARG A CA  1 
ATOM 1036 C C   . ARG A 1 131 ? 33.427  39.075  27.308  1.00 71.62 ? 271 ARG A C   1 
ATOM 1037 O O   . ARG A 1 131 ? 33.839  38.731  28.440  1.00 71.34 ? 271 ARG A O   1 
ATOM 1038 C CB  . ARG A 1 131 ? 33.850  37.206  25.649  1.00 73.82 ? 271 ARG A CB  1 
ATOM 1039 C CG  . ARG A 1 131 ? 33.457  35.742  25.363  1.00 77.01 ? 271 ARG A CG  1 
ATOM 1040 C CD  . ARG A 1 131 ? 32.122  35.551  24.623  1.00 79.59 ? 271 ARG A CD  1 
ATOM 1041 N NE  . ARG A 1 131 ? 31.720  34.141  24.631  1.00 82.09 ? 271 ARG A NE  1 
ATOM 1042 C CZ  . ARG A 1 131 ? 32.460  33.148  24.139  1.00 83.76 ? 271 ARG A CZ  1 
ATOM 1043 N NH1 . ARG A 1 131 ? 33.639  33.407  23.586  1.00 84.58 ? 271 ARG A NH1 1 
ATOM 1044 N NH2 . ARG A 1 131 ? 32.040  31.893  24.226  1.00 83.51 ? 271 ARG A NH2 1 
ATOM 1045 N N   . MET B 1 1   ? 30.364  42.970  18.361  1.00 67.13 ? 141 MET B N   1 
ATOM 1046 C CA  . MET B 1 1   ? 30.836  44.321  18.776  1.00 66.65 ? 141 MET B CA  1 
ATOM 1047 C C   . MET B 1 1   ? 29.683  45.315  18.874  1.00 64.94 ? 141 MET B C   1 
ATOM 1048 O O   . MET B 1 1   ? 29.894  46.529  18.856  1.00 65.21 ? 141 MET B O   1 
ATOM 1049 C CB  . MET B 1 1   ? 31.892  44.842  17.795  1.00 68.27 ? 141 MET B CB  1 
ATOM 1050 C CG  . MET B 1 1   ? 33.244  44.145  17.903  1.00 69.52 ? 141 MET B CG  1 
ATOM 1051 S SD  . MET B 1 1   ? 33.156  42.362  17.670  1.00 72.66 ? 141 MET B SD  1 
ATOM 1052 C CE  . MET B 1 1   ? 33.371  42.247  15.901  1.00 68.99 ? 141 MET B CE  1 
ATOM 1053 N N   . ALA B 1 2   ? 28.468  44.781  18.966  1.00 62.01 ? 142 ALA B N   1 
ATOM 1054 C CA  . ALA B 1 2   ? 27.256  45.583  19.100  1.00 59.39 ? 142 ALA B CA  1 
ATOM 1055 C C   . ALA B 1 2   ? 26.902  46.447  17.897  1.00 57.30 ? 142 ALA B C   1 
ATOM 1056 O O   . ALA B 1 2   ? 27.220  47.635  17.859  1.00 56.94 ? 142 ALA B O   1 
ATOM 1057 C CB  . ALA B 1 2   ? 27.346  46.462  20.357  1.00 58.62 ? 142 ALA B CB  1 
ATOM 1058 N N   . PRO B 1 3   ? 26.244  45.858  16.888  1.00 55.11 ? 143 PRO B N   1 
ATOM 1059 C CA  . PRO B 1 3   ? 25.896  46.692  15.742  1.00 52.57 ? 143 PRO B CA  1 
ATOM 1060 C C   . PRO B 1 3   ? 24.815  47.666  16.179  1.00 51.06 ? 143 PRO B C   1 
ATOM 1061 O O   . PRO B 1 3   ? 24.642  48.715  15.570  1.00 51.43 ? 143 PRO B O   1 
ATOM 1062 C CB  . PRO B 1 3   ? 25.385  45.684  14.719  1.00 52.28 ? 143 PRO B CB  1 
ATOM 1063 C CG  . PRO B 1 3   ? 26.138  44.444  15.067  1.00 53.70 ? 143 PRO B CG  1 
ATOM 1064 C CD  . PRO B 1 3   ? 26.049  44.435  16.571  1.00 54.41 ? 143 PRO B CD  1 
ATOM 1065 N N   . CYS B 1 4   ? 24.101  47.326  17.250  1.00 49.40 ? 144 CYS B N   1 
ATOM 1066 C CA  . CYS B 1 4   ? 23.037  48.201  17.725  1.00 48.53 ? 144 CYS B CA  1 
ATOM 1067 C C   . CYS B 1 4   ? 22.587  48.135  19.176  1.00 46.55 ? 144 CYS B C   1 
ATOM 1068 O O   . CYS B 1 4   ? 22.788  47.138  19.871  1.00 47.56 ? 144 CYS B O   1 
ATOM 1069 C CB  . CYS B 1 4   ? 21.814  48.053  16.829  1.00 49.07 ? 144 CYS B CB  1 
ATOM 1070 S SG  . CYS B 1 4   ? 21.978  49.081  15.345  1.00 54.33 ? 144 CYS B SG  1 
ATOM 1071 N N   . PRO B 1 5   ? 21.948  49.221  19.645  1.00 43.97 ? 145 PRO B N   1 
ATOM 1072 C CA  . PRO B 1 5   ? 21.428  49.386  21.001  1.00 42.58 ? 145 PRO B CA  1 
ATOM 1073 C C   . PRO B 1 5   ? 20.578  48.208  21.446  1.00 41.57 ? 145 PRO B C   1 
ATOM 1074 O O   . PRO B 1 5   ? 20.008  47.492  20.621  1.00 41.66 ? 145 PRO B O   1 
ATOM 1075 C CB  . PRO B 1 5   ? 20.602  50.664  20.895  1.00 42.05 ? 145 PRO B CB  1 
ATOM 1076 C CG  . PRO B 1 5   ? 21.318  51.441  19.857  1.00 40.10 ? 145 PRO B CG  1 
ATOM 1077 C CD  . PRO B 1 5   ? 21.613  50.399  18.824  1.00 42.13 ? 145 PRO B CD  1 
ATOM 1078 N N   . GLN B 1 6   ? 20.503  48.002  22.755  1.00 39.85 ? 146 GLN B N   1 
ATOM 1079 C CA  . GLN B 1 6   ? 19.684  46.929  23.285  1.00 38.10 ? 146 GLN B CA  1 
ATOM 1080 C C   . GLN B 1 6   ? 18.239  47.293  22.967  1.00 37.76 ? 146 GLN B C   1 
ATOM 1081 O O   . GLN B 1 6   ? 17.916  48.471  22.799  1.00 39.64 ? 146 GLN B O   1 
ATOM 1082 C CB  . GLN B 1 6   ? 19.872  46.799  24.797  1.00 37.13 ? 146 GLN B CB  1 
ATOM 1083 C CG  . GLN B 1 6   ? 21.086  45.986  25.218  1.00 37.44 ? 146 GLN B CG  1 
ATOM 1084 C CD  . GLN B 1 6   ? 21.166  45.791  26.724  1.00 38.29 ? 146 GLN B CD  1 
ATOM 1085 O OE1 . GLN B 1 6   ? 20.209  45.343  27.359  1.00 38.01 ? 146 GLN B OE1 1 
ATOM 1086 N NE2 . GLN B 1 6   ? 22.314  46.123  27.302  1.00 39.35 ? 146 GLN B NE2 1 
ATOM 1087 N N   . ASP B 1 7   ? 17.379  46.285  22.876  1.00 36.63 ? 147 ASP B N   1 
ATOM 1088 C CA  . ASP B 1 7   ? 15.964  46.487  22.577  1.00 35.09 ? 147 ASP B CA  1 
ATOM 1089 C C   . ASP B 1 7   ? 15.672  46.837  21.121  1.00 34.37 ? 147 ASP B C   1 
ATOM 1090 O O   . ASP B 1 7   ? 14.517  47.040  20.753  1.00 34.61 ? 147 ASP B O   1 
ATOM 1091 C CB  . ASP B 1 7   ? 15.375  47.559  23.496  1.00 33.55 ? 147 ASP B CB  1 
ATOM 1092 C CG  . ASP B 1 7   ? 15.441  47.163  24.951  1.00 34.86 ? 147 ASP B CG  1 
ATOM 1093 O OD1 . ASP B 1 7   ? 15.129  45.994  25.253  1.00 36.16 ? 147 ASP B OD1 1 
ATOM 1094 O OD2 . ASP B 1 7   ? 15.795  48.012  25.792  1.00 35.35 ? 147 ASP B OD2 1 
ATOM 1095 N N   . TRP B 1 8   ? 16.709  46.910  20.296  1.00 32.91 ? 148 TRP B N   1 
ATOM 1096 C CA  . TRP B 1 8   ? 16.515  47.219  18.887  1.00 32.68 ? 148 TRP B CA  1 
ATOM 1097 C C   . TRP B 1 8   ? 16.660  45.936  18.091  1.00 32.67 ? 148 TRP B C   1 
ATOM 1098 O O   . TRP B 1 8   ? 17.330  45.005  18.524  1.00 34.03 ? 148 TRP B O   1 
ATOM 1099 C CB  . TRP B 1 8   ? 17.552  48.240  18.398  1.00 32.90 ? 148 TRP B CB  1 
ATOM 1100 C CG  . TRP B 1 8   ? 17.338  49.634  18.912  1.00 33.93 ? 148 TRP B CG  1 
ATOM 1101 C CD1 . TRP B 1 8   ? 17.292  50.029  20.219  1.00 33.50 ? 148 TRP B CD1 1 
ATOM 1102 C CD2 . TRP B 1 8   ? 17.129  50.816  18.130  1.00 33.60 ? 148 TRP B CD2 1 
ATOM 1103 N NE1 . TRP B 1 8   ? 17.067  51.381  20.300  1.00 33.51 ? 148 TRP B NE1 1 
ATOM 1104 C CE2 . TRP B 1 8   ? 16.963  51.891  19.031  1.00 33.76 ? 148 TRP B CE2 1 
ATOM 1105 C CE3 . TRP B 1 8   ? 17.066  51.074  16.753  1.00 32.89 ? 148 TRP B CE3 1 
ATOM 1106 C CZ2 . TRP B 1 8   ? 16.733  53.202  18.604  1.00 32.31 ? 148 TRP B CZ2 1 
ATOM 1107 C CZ3 . TRP B 1 8   ? 16.837  52.377  16.327  1.00 31.25 ? 148 TRP B CZ3 1 
ATOM 1108 C CH2 . TRP B 1 8   ? 16.673  53.424  17.251  1.00 31.90 ? 148 TRP B CH2 1 
ATOM 1109 N N   . ILE B 1 9   ? 16.011  45.884  16.936  1.00 32.94 ? 149 ILE B N   1 
ATOM 1110 C CA  . ILE B 1 9   ? 16.098  44.725  16.062  1.00 32.51 ? 149 ILE B CA  1 
ATOM 1111 C C   . ILE B 1 9   ? 17.126  45.098  15.007  1.00 33.88 ? 149 ILE B C   1 
ATOM 1112 O O   . ILE B 1 9   ? 17.090  46.197  14.458  1.00 33.31 ? 149 ILE B O   1 
ATOM 1113 C CB  . ILE B 1 9   ? 14.763  44.428  15.336  1.00 31.29 ? 149 ILE B CB  1 
ATOM 1114 C CG1 . ILE B 1 9   ? 13.641  44.207  16.349  1.00 31.44 ? 149 ILE B CG1 1 
ATOM 1115 C CG2 . ILE B 1 9   ? 14.917  43.196  14.464  1.00 28.12 ? 149 ILE B CG2 1 
ATOM 1116 C CD1 . ILE B 1 9   ? 12.275  44.062  15.711  1.00 28.84 ? 149 ILE B CD1 1 
ATOM 1117 N N   . TRP B 1 10  ? 18.045  44.187  14.729  1.00 36.22 ? 150 TRP B N   1 
ATOM 1118 C CA  . TRP B 1 10  ? 19.072  44.440  13.734  1.00 38.10 ? 150 TRP B CA  1 
ATOM 1119 C C   . TRP B 1 10  ? 18.708  43.747  12.421  1.00 38.83 ? 150 TRP B C   1 
ATOM 1120 O O   . TRP B 1 10  ? 18.349  42.570  12.403  1.00 38.51 ? 150 TRP B O   1 
ATOM 1121 C CB  . TRP B 1 10  ? 20.426  43.961  14.272  1.00 38.68 ? 150 TRP B CB  1 
ATOM 1122 C CG  . TRP B 1 10  ? 21.530  43.922  13.269  1.00 41.28 ? 150 TRP B CG  1 
ATOM 1123 C CD1 . TRP B 1 10  ? 21.807  44.852  12.311  1.00 42.57 ? 150 TRP B CD1 1 
ATOM 1124 C CD2 . TRP B 1 10  ? 22.524  42.899  13.137  1.00 42.67 ? 150 TRP B CD2 1 
ATOM 1125 N NE1 . TRP B 1 10  ? 22.911  44.469  11.584  1.00 43.67 ? 150 TRP B NE1 1 
ATOM 1126 C CE2 . TRP B 1 10  ? 23.370  43.273  12.071  1.00 42.34 ? 150 TRP B CE2 1 
ATOM 1127 C CE3 . TRP B 1 10  ? 22.781  41.699  13.816  1.00 43.66 ? 150 TRP B CE3 1 
ATOM 1128 C CZ2 . TRP B 1 10  ? 24.455  42.493  11.668  1.00 42.01 ? 150 TRP B CZ2 1 
ATOM 1129 C CZ3 . TRP B 1 10  ? 23.861  40.922  13.415  1.00 42.01 ? 150 TRP B CZ3 1 
ATOM 1130 C CH2 . TRP B 1 10  ? 24.683  41.323  12.349  1.00 42.96 ? 150 TRP B CH2 1 
ATOM 1131 N N   . HIS B 1 11  ? 18.776  44.500  11.328  1.00 39.88 ? 151 HIS B N   1 
ATOM 1132 C CA  . HIS B 1 11  ? 18.452  43.973  10.009  1.00 40.24 ? 151 HIS B CA  1 
ATOM 1133 C C   . HIS B 1 11  ? 19.338  44.633  8.959   1.00 40.88 ? 151 HIS B C   1 
ATOM 1134 O O   . HIS B 1 11  ? 19.515  45.848  8.971   1.00 40.80 ? 151 HIS B O   1 
ATOM 1135 C CB  . HIS B 1 11  ? 16.985  44.253  9.681   1.00 38.41 ? 151 HIS B CB  1 
ATOM 1136 C CG  . HIS B 1 11  ? 16.498  43.558  8.448   1.00 36.02 ? 151 HIS B CG  1 
ATOM 1137 N ND1 . HIS B 1 11  ? 16.250  42.202  8.407   1.00 34.23 ? 151 HIS B ND1 1 
ATOM 1138 C CD2 . HIS B 1 11  ? 16.216  44.030  7.213   1.00 34.69 ? 151 HIS B CD2 1 
ATOM 1139 C CE1 . HIS B 1 11  ? 15.833  41.869  7.200   1.00 32.82 ? 151 HIS B CE1 1 
ATOM 1140 N NE2 . HIS B 1 11  ? 15.803  42.960  6.455   1.00 35.33 ? 151 HIS B NE2 1 
ATOM 1141 N N   . GLY B 1 12  ? 19.889  43.830  8.055   1.00 41.90 ? 152 GLY B N   1 
ATOM 1142 C CA  . GLY B 1 12  ? 20.749  44.367  7.016   1.00 44.81 ? 152 GLY B CA  1 
ATOM 1143 C C   . GLY B 1 12  ? 21.762  45.371  7.536   1.00 47.32 ? 152 GLY B C   1 
ATOM 1144 O O   . GLY B 1 12  ? 22.689  45.011  8.265   1.00 48.27 ? 152 GLY B O   1 
ATOM 1145 N N   . GLU B 1 13  ? 21.586  46.636  7.169   1.00 48.74 ? 153 GLU B N   1 
ATOM 1146 C CA  . GLU B 1 13  ? 22.503  47.684  7.604   1.00 48.90 ? 153 GLU B CA  1 
ATOM 1147 C C   . GLU B 1 13  ? 21.810  48.701  8.480   1.00 47.62 ? 153 GLU B C   1 
ATOM 1148 O O   . GLU B 1 13  ? 22.351  49.768  8.752   1.00 48.46 ? 153 GLU B O   1 
ATOM 1149 C CB  . GLU B 1 13  ? 23.107  48.401  6.401   1.00 51.54 ? 153 GLU B CB  1 
ATOM 1150 C CG  . GLU B 1 13  ? 23.807  47.473  5.425   1.00 57.14 ? 153 GLU B CG  1 
ATOM 1151 C CD  . GLU B 1 13  ? 24.963  48.148  4.713   1.00 60.68 ? 153 GLU B CD  1 
ATOM 1152 O OE1 . GLU B 1 13  ? 24.729  49.184  4.053   1.00 63.09 ? 153 GLU B OE1 1 
ATOM 1153 O OE2 . GLU B 1 13  ? 26.104  47.643  4.817   1.00 60.79 ? 153 GLU B OE2 1 
ATOM 1154 N N   . ASN B 1 14  ? 20.608  48.368  8.920   1.00 46.68 ? 154 ASN B N   1 
ATOM 1155 C CA  . ASN B 1 14  ? 19.855  49.274  9.758   1.00 45.97 ? 154 ASN B CA  1 
ATOM 1156 C C   . ASN B 1 14  ? 19.324  48.611  10.997  1.00 46.12 ? 154 ASN B C   1 
ATOM 1157 O O   . ASN B 1 14  ? 19.350  47.387  11.140  1.00 46.13 ? 154 ASN B O   1 
ATOM 1158 C CB  . ASN B 1 14  ? 18.674  49.849  8.996   1.00 46.11 ? 154 ASN B CB  1 
ATOM 1159 C CG  . ASN B 1 14  ? 19.096  50.667  7.820   1.00 45.92 ? 154 ASN B CG  1 
ATOM 1160 O OD1 . ASN B 1 14  ? 19.645  51.759  7.970   1.00 44.48 ? 154 ASN B OD1 1 
ATOM 1161 N ND2 . ASN B 1 14  ? 18.856  50.143  6.629   1.00 47.68 ? 154 ASN B ND2 1 
ATOM 1162 N N   . CYS B 1 15  ? 18.820  49.439  11.897  1.00 45.28 ? 155 CYS B N   1 
ATOM 1163 C CA  . CYS B 1 15  ? 18.259  48.920  13.112  1.00 44.50 ? 155 CYS B CA  1 
ATOM 1164 C C   . CYS B 1 15  ? 16.950  49.537  13.426  1.00 42.50 ? 155 CYS B C   1 
ATOM 1165 O O   . CYS B 1 15  ? 16.753  50.749  13.252  1.00 41.97 ? 155 CYS B O   1 
ATOM 1166 C CB  . CYS B 1 15  ? 19.201  49.119  14.267  1.00 47.61 ? 155 CYS B CB  1 
ATOM 1167 S SG  . CYS B 1 15  ? 20.741  48.193  14.025  1.00 52.15 ? 155 CYS B SG  1 
ATOM 1168 N N   . TYR B 1 16  ? 16.047  48.706  13.925  1.00 41.38 ? 156 TYR B N   1 
ATOM 1169 C CA  . TYR B 1 16  ? 14.720  49.217  14.223  1.00 40.99 ? 156 TYR B CA  1 
ATOM 1170 C C   . TYR B 1 16  ? 14.310  49.045  15.679  1.00 41.69 ? 156 TYR B C   1 
ATOM 1171 O O   . TYR B 1 16  ? 14.719  48.077  16.351  1.00 42.66 ? 156 TYR B O   1 
ATOM 1172 C CB  . TYR B 1 16  ? 13.711  48.547  13.287  1.00 38.21 ? 156 TYR B CB  1 
ATOM 1173 C CG  . TYR B 1 16  ? 14.221  48.463  11.872  1.00 36.38 ? 156 TYR B CG  1 
ATOM 1174 C CD1 . TYR B 1 16  ? 15.203  47.534  11.534  1.00 35.66 ? 156 TYR B CD1 1 
ATOM 1175 C CD2 . TYR B 1 16  ? 13.795  49.367  10.882  1.00 35.86 ? 156 TYR B CD2 1 
ATOM 1176 C CE1 . TYR B 1 16  ? 15.755  47.507  10.264  1.00 35.55 ? 156 TYR B CE1 1 
ATOM 1177 C CE2 . TYR B 1 16  ? 14.351  49.336  9.602   1.00 35.52 ? 156 TYR B CE2 1 
ATOM 1178 C CZ  . TYR B 1 16  ? 15.327  48.402  9.309   1.00 35.82 ? 156 TYR B CZ  1 
ATOM 1179 O OH  . TYR B 1 16  ? 15.880  48.334  8.053   1.00 35.38 ? 156 TYR B OH  1 
ATOM 1180 N N   . LEU B 1 17  ? 13.523  50.031  16.117  1.00 41.52 ? 157 LEU B N   1 
ATOM 1181 C CA  . LEU B 1 17  ? 12.976  50.133  17.459  1.00 41.00 ? 157 LEU B CA  1 
ATOM 1182 C C   . LEU B 1 17  ? 11.500  50.471  17.290  1.00 41.90 ? 157 LEU B C   1 
ATOM 1183 O O   . LEU B 1 17  ? 11.119  51.163  16.341  1.00 41.47 ? 157 LEU B O   1 
ATOM 1184 C CB  . LEU B 1 17  ? 13.639  51.264  18.266  1.00 38.64 ? 157 LEU B CB  1 
ATOM 1185 C CG  . LEU B 1 17  ? 13.068  51.707  19.608  1.00 37.69 ? 157 LEU B CG  1 
ATOM 1186 C CD1 . LEU B 1 17  ? 13.461  50.786  20.771  1.00 39.77 ? 157 LEU B CD1 1 
ATOM 1187 C CD2 . LEU B 1 17  ? 13.598  53.088  19.869  1.00 37.75 ? 157 LEU B CD2 1 
ATOM 1188 N N   . PHE B 1 18  ? 10.662  49.954  18.183  1.00 43.50 ? 158 PHE B N   1 
ATOM 1189 C CA  . PHE B 1 18  ? 9.228   50.203  18.090  1.00 44.89 ? 158 PHE B CA  1 
ATOM 1190 C C   . PHE B 1 18  ? 8.708   51.237  19.073  1.00 47.39 ? 158 PHE B C   1 
ATOM 1191 O O   . PHE B 1 18  ? 8.797   51.093  20.295  1.00 48.33 ? 158 PHE B O   1 
ATOM 1192 C CB  . PHE B 1 18  ? 8.482   48.885  18.216  1.00 42.36 ? 158 PHE B CB  1 
ATOM 1193 C CG  . PHE B 1 18  ? 8.632   48.011  17.005  1.00 40.70 ? 158 PHE B CG  1 
ATOM 1194 C CD1 . PHE B 1 18  ? 7.526   47.668  16.249  1.00 39.79 ? 158 PHE B CD1 1 
ATOM 1195 C CD2 . PHE B 1 18  ? 9.885   47.542  16.611  1.00 40.65 ? 158 PHE B CD2 1 
ATOM 1196 C CE1 . PHE B 1 18  ? 7.656   46.872  15.117  1.00 41.61 ? 158 PHE B CE1 1 
ATOM 1197 C CE2 . PHE B 1 18  ? 10.033  46.741  15.476  1.00 41.44 ? 158 PHE B CE2 1 
ATOM 1198 C CZ  . PHE B 1 18  ? 8.913   46.402  14.726  1.00 42.61 ? 158 PHE B CZ  1 
ATOM 1199 N N   . SER B 1 19  ? 8.173   52.300  18.490  1.00 49.81 ? 159 SER B N   1 
ATOM 1200 C CA  . SER B 1 19  ? 7.611   53.420  19.215  1.00 51.99 ? 159 SER B CA  1 
ATOM 1201 C C   . SER B 1 19  ? 6.811   52.996  20.435  1.00 53.13 ? 159 SER B C   1 
ATOM 1202 O O   . SER B 1 19  ? 5.801   52.298  20.325  1.00 52.47 ? 159 SER B O   1 
ATOM 1203 C CB  . SER B 1 19  ? 6.723   54.237  18.276  1.00 53.95 ? 159 SER B CB  1 
ATOM 1204 O OG  . SER B 1 19  ? 6.205   55.382  18.923  1.00 59.23 ? 159 SER B OG  1 
ATOM 1205 N N   . SER B 1 20  ? 7.276   53.424  21.602  1.00 54.75 ? 160 SER B N   1 
ATOM 1206 C CA  . SER B 1 20  ? 6.608   53.108  22.854  1.00 56.04 ? 160 SER B CA  1 
ATOM 1207 C C   . SER B 1 20  ? 5.245   53.798  22.922  1.00 56.51 ? 160 SER B C   1 
ATOM 1208 O O   . SER B 1 20  ? 4.215   53.144  23.082  1.00 56.99 ? 160 SER B O   1 
ATOM 1209 C CB  . SER B 1 20  ? 7.471   53.564  24.029  1.00 55.80 ? 160 SER B CB  1 
ATOM 1210 O OG  . SER B 1 20  ? 8.751   52.962  23.976  1.00 56.92 ? 160 SER B OG  1 
ATOM 1211 N N   . GLY B 1 21  ? 5.249   55.121  22.794  1.00 56.39 ? 161 GLY B N   1 
ATOM 1212 C CA  . GLY B 1 21  ? 4.012   55.877  22.857  1.00 56.68 ? 161 GLY B CA  1 
ATOM 1213 C C   . GLY B 1 21  ? 3.272   55.966  21.539  1.00 56.51 ? 161 GLY B C   1 
ATOM 1214 O O   . GLY B 1 21  ? 3.725   55.439  20.523  1.00 56.46 ? 161 GLY B O   1 
ATOM 1215 N N   . SER B 1 22  ? 2.127   56.641  21.564  1.00 55.92 ? 162 SER B N   1 
ATOM 1216 C CA  . SER B 1 22  ? 1.304   56.812  20.376  1.00 56.36 ? 162 SER B CA  1 
ATOM 1217 C C   . SER B 1 22  ? 0.996   58.291  20.169  1.00 57.47 ? 162 SER B C   1 
ATOM 1218 O O   . SER B 1 22  ? 0.033   58.817  20.729  1.00 58.64 ? 162 SER B O   1 
ATOM 1219 C CB  . SER B 1 22  ? 0.001   56.030  20.530  1.00 55.00 ? 162 SER B CB  1 
ATOM 1220 O OG  . SER B 1 22  ? -0.839  56.214  19.405  1.00 54.05 ? 162 SER B OG  1 
ATOM 1221 N N   . PHE B 1 23  ? 1.813   58.962  19.363  1.00 58.15 ? 163 PHE B N   1 
ATOM 1222 C CA  . PHE B 1 23  ? 1.616   60.383  19.110  1.00 58.51 ? 163 PHE B CA  1 
ATOM 1223 C C   . PHE B 1 23  ? 1.463   60.715  17.631  1.00 58.16 ? 163 PHE B C   1 
ATOM 1224 O O   . PHE B 1 23  ? 1.564   59.845  16.764  1.00 57.66 ? 163 PHE B O   1 
ATOM 1225 C CB  . PHE B 1 23  ? 2.790   61.186  19.669  1.00 60.56 ? 163 PHE B CB  1 
ATOM 1226 C CG  . PHE B 1 23  ? 3.125   60.865  21.094  1.00 62.13 ? 163 PHE B CG  1 
ATOM 1227 C CD1 . PHE B 1 23  ? 3.790   59.687  21.417  1.00 61.34 ? 163 PHE B CD1 1 
ATOM 1228 C CD2 . PHE B 1 23  ? 2.779   61.747  22.117  1.00 62.78 ? 163 PHE B CD2 1 
ATOM 1229 C CE1 . PHE B 1 23  ? 4.105   59.390  22.735  1.00 62.84 ? 163 PHE B CE1 1 
ATOM 1230 C CE2 . PHE B 1 23  ? 3.088   61.462  23.441  1.00 62.58 ? 163 PHE B CE2 1 
ATOM 1231 C CZ  . PHE B 1 23  ? 3.754   60.281  23.752  1.00 63.75 ? 163 PHE B CZ  1 
ATOM 1232 N N   . ASN B 1 24  ? 1.215   61.992  17.357  1.00 57.48 ? 164 ASN B N   1 
ATOM 1233 C CA  . ASN B 1 24  ? 1.066   62.469  15.992  1.00 56.20 ? 164 ASN B CA  1 
ATOM 1234 C C   . ASN B 1 24  ? 2.391   62.267  15.267  1.00 55.30 ? 164 ASN B C   1 
ATOM 1235 O O   . ASN B 1 24  ? 3.430   62.080  15.899  1.00 55.90 ? 164 ASN B O   1 
ATOM 1236 C CB  . ASN B 1 24  ? 0.678   63.949  15.992  1.00 56.37 ? 164 ASN B CB  1 
ATOM 1237 C CG  . ASN B 1 24  ? 1.624   64.800  16.815  1.00 56.70 ? 164 ASN B CG  1 
ATOM 1238 O OD1 . ASN B 1 24  ? 2.801   64.941  16.484  1.00 57.08 ? 164 ASN B OD1 1 
ATOM 1239 N ND2 . ASN B 1 24  ? 1.114   65.369  17.900  1.00 56.96 ? 164 ASN B ND2 1 
ATOM 1240 N N   . TRP B 1 25  ? 2.348   62.309  13.941  1.00 54.07 ? 165 TRP B N   1 
ATOM 1241 C CA  . TRP B 1 25  ? 3.534   62.111  13.115  1.00 53.11 ? 165 TRP B CA  1 
ATOM 1242 C C   . TRP B 1 25  ? 4.735   62.967  13.526  1.00 53.55 ? 165 TRP B C   1 
ATOM 1243 O O   . TRP B 1 25  ? 5.881   62.533  13.415  1.00 53.79 ? 165 TRP B O   1 
ATOM 1244 C CB  . TRP B 1 25  ? 3.196   62.400  11.653  1.00 50.50 ? 165 TRP B CB  1 
ATOM 1245 C CG  . TRP B 1 25  ? 4.187   61.834  10.687  1.00 48.13 ? 165 TRP B CG  1 
ATOM 1246 C CD1 . TRP B 1 25  ? 4.254   60.546  10.245  1.00 46.89 ? 165 TRP B CD1 1 
ATOM 1247 C CD2 . TRP B 1 25  ? 5.265   62.534  10.052  1.00 46.89 ? 165 TRP B CD2 1 
ATOM 1248 N NE1 . TRP B 1 25  ? 5.304   60.397  9.374   1.00 46.27 ? 165 TRP B NE1 1 
ATOM 1249 C CE2 . TRP B 1 25  ? 5.940   61.600  9.236   1.00 46.59 ? 165 TRP B CE2 1 
ATOM 1250 C CE3 . TRP B 1 25  ? 5.722   63.856  10.093  1.00 46.10 ? 165 TRP B CE3 1 
ATOM 1251 C CZ2 . TRP B 1 25  ? 7.054   61.949  8.465   1.00 46.75 ? 165 TRP B CZ2 1 
ATOM 1252 C CZ3 . TRP B 1 25  ? 6.830   64.203  9.326   1.00 46.77 ? 165 TRP B CZ3 1 
ATOM 1253 C CH2 . TRP B 1 25  ? 7.482   63.251  8.522   1.00 47.27 ? 165 TRP B CH2 1 
ATOM 1254 N N   . GLU B 1 26  ? 4.469   64.181  14.001  1.00 54.05 ? 166 GLU B N   1 
ATOM 1255 C CA  . GLU B 1 26  ? 5.528   65.103  14.400  1.00 54.39 ? 166 GLU B CA  1 
ATOM 1256 C C   . GLU B 1 26  ? 6.281   64.653  15.644  1.00 54.46 ? 166 GLU B C   1 
ATOM 1257 O O   . GLU B 1 26  ? 7.511   64.617  15.647  1.00 54.42 ? 166 GLU B O   1 
ATOM 1258 C CB  . GLU B 1 26  ? 4.942   66.495  14.618  1.00 55.41 ? 166 GLU B CB  1 
ATOM 1259 C CG  . GLU B 1 26  ? 5.971   67.602  14.740  1.00 57.20 ? 166 GLU B CG  1 
ATOM 1260 C CD  . GLU B 1 26  ? 5.350   68.968  14.537  1.00 58.55 ? 166 GLU B CD  1 
ATOM 1261 O OE1 . GLU B 1 26  ? 4.313   69.246  15.177  1.00 59.57 ? 166 GLU B OE1 1 
ATOM 1262 O OE2 . GLU B 1 26  ? 5.893   69.762  13.740  1.00 59.17 ? 166 GLU B OE2 1 
ATOM 1263 N N   . LYS B 1 27  ? 5.548   64.321  16.703  1.00 54.63 ? 167 LYS B N   1 
ATOM 1264 C CA  . LYS B 1 27  ? 6.177   63.856  17.933  1.00 55.10 ? 167 LYS B CA  1 
ATOM 1265 C C   . LYS B 1 27  ? 6.906   62.545  17.671  1.00 54.11 ? 167 LYS B C   1 
ATOM 1266 O O   . LYS B 1 27  ? 7.943   62.266  18.273  1.00 53.85 ? 167 LYS B O   1 
ATOM 1267 C CB  . LYS B 1 27  ? 5.132   63.656  19.034  1.00 57.67 ? 167 LYS B CB  1 
ATOM 1268 C CG  . LYS B 1 27  ? 4.781   64.927  19.794  1.00 61.78 ? 167 LYS B CG  1 
ATOM 1269 C CD  . LYS B 1 27  ? 6.007   65.490  20.513  1.00 64.38 ? 167 LYS B CD  1 
ATOM 1270 C CE  . LYS B 1 27  ? 5.687   66.799  21.221  1.00 65.02 ? 167 LYS B CE  1 
ATOM 1271 N NZ  . LYS B 1 27  ? 6.907   67.438  21.790  1.00 63.19 ? 167 LYS B NZ  1 
ATOM 1272 N N   . SER B 1 28  ? 6.357   61.744  16.765  1.00 53.13 ? 168 SER B N   1 
ATOM 1273 C CA  . SER B 1 28  ? 6.964   60.469  16.419  1.00 51.50 ? 168 SER B CA  1 
ATOM 1274 C C   . SER B 1 28  ? 8.273   60.728  15.697  1.00 51.71 ? 168 SER B C   1 
ATOM 1275 O O   . SER B 1 28  ? 9.252   60.010  15.893  1.00 52.17 ? 168 SER B O   1 
ATOM 1276 C CB  . SER B 1 28  ? 6.028   59.655  15.524  1.00 51.51 ? 168 SER B CB  1 
ATOM 1277 O OG  . SER B 1 28  ? 4.878   59.234  16.236  1.00 50.54 ? 168 SER B OG  1 
ATOM 1278 N N   . GLN B 1 29  ? 8.288   61.764  14.866  1.00 51.70 ? 169 GLN B N   1 
ATOM 1279 C CA  . GLN B 1 29  ? 9.486   62.118  14.119  1.00 51.81 ? 169 GLN B CA  1 
ATOM 1280 C C   . GLN B 1 29  ? 10.529  62.728  15.046  1.00 51.66 ? 169 GLN B C   1 
ATOM 1281 O O   . GLN B 1 29  ? 11.729  62.624  14.793  1.00 51.52 ? 169 GLN B O   1 
ATOM 1282 C CB  . GLN B 1 29  ? 9.152   63.114  13.009  1.00 52.39 ? 169 GLN B CB  1 
ATOM 1283 C CG  . GLN B 1 29  ? 10.335  63.443  12.115  1.00 53.19 ? 169 GLN B CG  1 
ATOM 1284 C CD  . GLN B 1 29  ? 10.043  64.570  11.147  1.00 54.46 ? 169 GLN B CD  1 
ATOM 1285 O OE1 . GLN B 1 29  ? 9.721   65.685  11.557  1.00 54.42 ? 169 GLN B OE1 1 
ATOM 1286 N NE2 . GLN B 1 29  ? 10.160  64.288  9.854   1.00 53.79 ? 169 GLN B NE2 1 
ATOM 1287 N N   . GLU B 1 30  ? 10.070  63.374  16.113  1.00 51.34 ? 170 GLU B N   1 
ATOM 1288 C CA  . GLU B 1 30  ? 10.982  63.981  17.074  1.00 51.83 ? 170 GLU B CA  1 
ATOM 1289 C C   . GLU B 1 30  ? 11.672  62.880  17.864  1.00 51.75 ? 170 GLU B C   1 
ATOM 1290 O O   . GLU B 1 30  ? 12.901  62.812  17.924  1.00 52.04 ? 170 GLU B O   1 
ATOM 1291 C CB  . GLU B 1 30  ? 10.226  64.888  18.049  1.00 52.63 ? 170 GLU B CB  1 
ATOM 1292 C CG  . GLU B 1 30  ? 9.617   66.133  17.430  1.00 57.84 ? 170 GLU B CG  1 
ATOM 1293 C CD  . GLU B 1 30  ? 9.082   67.096  18.481  1.00 60.91 ? 170 GLU B CD  1 
ATOM 1294 O OE1 . GLU B 1 30  ? 9.876   67.519  19.349  1.00 63.30 ? 170 GLU B OE1 1 
ATOM 1295 O OE2 . GLU B 1 30  ? 7.876   67.432  18.443  1.00 61.16 ? 170 GLU B OE2 1 
ATOM 1296 N N   . LYS B 1 31  ? 10.859  62.019  18.467  1.00 50.80 ? 171 LYS B N   1 
ATOM 1297 C CA  . LYS B 1 31  ? 11.346  60.913  19.278  1.00 49.24 ? 171 LYS B CA  1 
ATOM 1298 C C   . LYS B 1 31  ? 12.381  60.039  18.581  1.00 47.63 ? 171 LYS B C   1 
ATOM 1299 O O   . LYS B 1 31  ? 13.312  59.555  19.219  1.00 47.54 ? 171 LYS B O   1 
ATOM 1300 C CB  . LYS B 1 31  ? 10.164  60.064  19.740  1.00 50.36 ? 171 LYS B CB  1 
ATOM 1301 C CG  . LYS B 1 31  ? 9.195   60.825  20.623  1.00 51.26 ? 171 LYS B CG  1 
ATOM 1302 C CD  . LYS B 1 31  ? 8.011   59.969  21.024  1.00 52.11 ? 171 LYS B CD  1 
ATOM 1303 C CE  . LYS B 1 31  ? 7.181   60.664  22.087  1.00 52.26 ? 171 LYS B CE  1 
ATOM 1304 N NZ  . LYS B 1 31  ? 7.975   60.881  23.325  1.00 51.92 ? 171 LYS B NZ  1 
ATOM 1305 N N   . CYS B 1 32  ? 12.219  59.820  17.281  1.00 46.08 ? 172 CYS B N   1 
ATOM 1306 C CA  . CYS B 1 32  ? 13.190  59.011  16.560  1.00 45.54 ? 172 CYS B CA  1 
ATOM 1307 C C   . CYS B 1 32  ? 14.526  59.740  16.593  1.00 45.81 ? 172 CYS B C   1 
ATOM 1308 O O   . CYS B 1 32  ? 15.573  59.112  16.744  1.00 46.85 ? 172 CYS B O   1 
ATOM 1309 C CB  . CYS B 1 32  ? 12.778  58.795  15.103  1.00 43.85 ? 172 CYS B CB  1 
ATOM 1310 S SG  . CYS B 1 32  ? 11.451  57.584  14.783  1.00 43.52 ? 172 CYS B SG  1 
ATOM 1311 N N   . LEU B 1 33  ? 14.486  61.066  16.450  1.00 45.01 ? 173 LEU B N   1 
ATOM 1312 C CA  . LEU B 1 33  ? 15.707  61.866  16.481  1.00 43.68 ? 173 LEU B CA  1 
ATOM 1313 C C   . LEU B 1 33  ? 16.358  61.846  17.855  1.00 42.17 ? 173 LEU B C   1 
ATOM 1314 O O   . LEU B 1 33  ? 17.553  61.590  17.972  1.00 41.25 ? 173 LEU B O   1 
ATOM 1315 C CB  . LEU B 1 33  ? 15.432  63.320  16.098  1.00 45.13 ? 173 LEU B CB  1 
ATOM 1316 C CG  . LEU B 1 33  ? 15.306  63.685  14.619  1.00 47.71 ? 173 LEU B CG  1 
ATOM 1317 C CD1 . LEU B 1 33  ? 15.405  65.196  14.499  1.00 46.16 ? 173 LEU B CD1 1 
ATOM 1318 C CD2 . LEU B 1 33  ? 16.411  63.031  13.792  1.00 49.88 ? 173 LEU B CD2 1 
ATOM 1319 N N   . SER B 1 34  ? 15.571  62.123  18.893  1.00 40.24 ? 174 SER B N   1 
ATOM 1320 C CA  . SER B 1 34  ? 16.088  62.141  20.256  1.00 37.95 ? 174 SER B CA  1 
ATOM 1321 C C   . SER B 1 34  ? 16.853  60.858  20.513  1.00 37.30 ? 174 SER B C   1 
ATOM 1322 O O   . SER B 1 34  ? 17.718  60.803  21.384  1.00 38.26 ? 174 SER B O   1 
ATOM 1323 C CB  . SER B 1 34  ? 14.953  62.243  21.264  1.00 38.26 ? 174 SER B CB  1 
ATOM 1324 O OG  . SER B 1 34  ? 14.445  60.956  21.559  1.00 39.73 ? 174 SER B OG  1 
ATOM 1325 N N   . LEU B 1 35  ? 16.514  59.822  19.755  1.00 35.62 ? 175 LEU B N   1 
ATOM 1326 C CA  . LEU B 1 35  ? 17.176  58.533  19.879  1.00 34.42 ? 175 LEU B CA  1 
ATOM 1327 C C   . LEU B 1 35  ? 18.216  58.377  18.775  1.00 34.20 ? 175 LEU B C   1 
ATOM 1328 O O   . LEU B 1 35  ? 18.621  57.267  18.433  1.00 33.77 ? 175 LEU B O   1 
ATOM 1329 C CB  . LEU B 1 35  ? 16.149  57.404  19.807  1.00 34.09 ? 175 LEU B CB  1 
ATOM 1330 C CG  . LEU B 1 35  ? 15.201  57.334  21.003  1.00 33.25 ? 175 LEU B CG  1 
ATOM 1331 C CD1 . LEU B 1 35  ? 14.130  56.292  20.763  1.00 33.47 ? 175 LEU B CD1 1 
ATOM 1332 C CD2 . LEU B 1 35  ? 16.000  57.004  22.245  1.00 35.51 ? 175 LEU B CD2 1 
ATOM 1333 N N   . ASP B 1 36  ? 18.639  59.506  18.217  1.00 34.30 ? 176 ASP B N   1 
ATOM 1334 C CA  . ASP B 1 36  ? 19.651  59.516  17.170  1.00 36.28 ? 176 ASP B CA  1 
ATOM 1335 C C   . ASP B 1 36  ? 19.234  58.724  15.926  1.00 34.72 ? 176 ASP B C   1 
ATOM 1336 O O   . ASP B 1 36  ? 20.066  58.125  15.251  1.00 31.88 ? 176 ASP B O   1 
ATOM 1337 C CB  . ASP B 1 36  ? 20.965  58.978  17.752  1.00 40.29 ? 176 ASP B CB  1 
ATOM 1338 C CG  . ASP B 1 36  ? 22.069  58.884  16.724  1.00 46.22 ? 176 ASP B CG  1 
ATOM 1339 O OD1 . ASP B 1 36  ? 22.272  59.868  15.983  1.00 47.97 ? 176 ASP B OD1 1 
ATOM 1340 O OD2 . ASP B 1 36  ? 22.735  57.826  16.661  1.00 50.20 ? 176 ASP B OD2 1 
ATOM 1341 N N   . ALA B 1 37  ? 17.940  58.747  15.615  1.00 34.89 ? 177 ALA B N   1 
ATOM 1342 C CA  . ALA B 1 37  ? 17.421  58.021  14.459  1.00 34.33 ? 177 ALA B CA  1 
ATOM 1343 C C   . ALA B 1 37  ? 16.359  58.790  13.655  1.00 33.62 ? 177 ALA B C   1 
ATOM 1344 O O   . ALA B 1 37  ? 16.116  59.976  13.889  1.00 31.68 ? 177 ALA B O   1 
ATOM 1345 C CB  . ALA B 1 37  ? 16.860  56.669  14.915  1.00 32.70 ? 177 ALA B CB  1 
ATOM 1346 N N   . LYS B 1 38  ? 15.742  58.096  12.700  1.00 33.57 ? 178 LYS B N   1 
ATOM 1347 C CA  . LYS B 1 38  ? 14.705  58.670  11.845  1.00 31.37 ? 178 LYS B CA  1 
ATOM 1348 C C   . LYS B 1 38  ? 13.567  57.670  11.662  1.00 32.22 ? 178 LYS B C   1 
ATOM 1349 O O   . LYS B 1 38  ? 13.750  56.468  11.865  1.00 33.06 ? 178 LYS B O   1 
ATOM 1350 C CB  . LYS B 1 38  ? 15.282  59.010  10.474  1.00 28.63 ? 178 LYS B CB  1 
ATOM 1351 C CG  . LYS B 1 38  ? 15.611  57.792  9.625   1.00 25.01 ? 178 LYS B CG  1 
ATOM 1352 C CD  . LYS B 1 38  ? 16.292  58.193  8.326   1.00 24.42 ? 178 LYS B CD  1 
ATOM 1353 C CE  . LYS B 1 38  ? 16.693  56.973  7.511   1.00 24.66 ? 178 LYS B CE  1 
ATOM 1354 N NZ  . LYS B 1 38  ? 17.482  57.315  6.292   1.00 23.18 ? 178 LYS B NZ  1 
ATOM 1355 N N   . LEU B 1 39  ? 12.394  58.169  11.278  1.00 32.19 ? 179 LEU B N   1 
ATOM 1356 C CA  . LEU B 1 39  ? 11.237  57.305  11.051  1.00 31.37 ? 179 LEU B CA  1 
ATOM 1357 C C   . LEU B 1 39  ? 11.544  56.288  9.952   1.00 32.17 ? 179 LEU B C   1 
ATOM 1358 O O   . LEU B 1 39  ? 12.403  56.519  9.098   1.00 33.98 ? 179 LEU B O   1 
ATOM 1359 C CB  . LEU B 1 39  ? 10.009  58.141  10.666  1.00 29.32 ? 179 LEU B CB  1 
ATOM 1360 C CG  . LEU B 1 39  ? 9.218   58.836  11.783  1.00 28.22 ? 179 LEU B CG  1 
ATOM 1361 C CD1 . LEU B 1 39  ? 8.218   59.804  11.181  1.00 27.83 ? 179 LEU B CD1 1 
ATOM 1362 C CD2 . LEU B 1 39  ? 8.501   57.799  12.634  1.00 27.41 ? 179 LEU B CD2 1 
ATOM 1363 N N   . LEU B 1 40  ? 10.839  55.162  9.981   1.00 32.35 ? 180 LEU B N   1 
ATOM 1364 C CA  . LEU B 1 40  ? 11.033  54.098  9.004   1.00 32.42 ? 180 LEU B CA  1 
ATOM 1365 C C   . LEU B 1 40  ? 11.000  54.551  7.549   1.00 33.22 ? 180 LEU B C   1 
ATOM 1366 O O   . LEU B 1 40  ? 10.081  55.253  7.120   1.00 32.03 ? 180 LEU B O   1 
ATOM 1367 C CB  . LEU B 1 40  ? 9.980   53.009  9.200   1.00 32.14 ? 180 LEU B CB  1 
ATOM 1368 C CG  . LEU B 1 40  ? 9.902   51.980  8.068   1.00 32.47 ? 180 LEU B CG  1 
ATOM 1369 C CD1 . LEU B 1 40  ? 11.239  51.261  7.919   1.00 32.76 ? 180 LEU B CD1 1 
ATOM 1370 C CD2 . LEU B 1 40  ? 8.781   50.997  8.355   1.00 33.24 ? 180 LEU B CD2 1 
ATOM 1371 N N   . LYS B 1 41  ? 12.014  54.136  6.797   1.00 34.05 ? 181 LYS B N   1 
ATOM 1372 C CA  . LYS B 1 41  ? 12.105  54.452  5.377   1.00 35.78 ? 181 LYS B CA  1 
ATOM 1373 C C   . LYS B 1 41  ? 12.256  53.146  4.609   1.00 37.39 ? 181 LYS B C   1 
ATOM 1374 O O   . LYS B 1 41  ? 13.263  52.452  4.754   1.00 38.73 ? 181 LYS B O   1 
ATOM 1375 C CB  . LYS B 1 41  ? 13.311  55.343  5.074   1.00 34.88 ? 181 LYS B CB  1 
ATOM 1376 C CG  . LYS B 1 41  ? 13.524  55.528  3.576   1.00 34.77 ? 181 LYS B CG  1 
ATOM 1377 C CD  . LYS B 1 41  ? 14.754  56.353  3.237   1.00 37.13 ? 181 LYS B CD  1 
ATOM 1378 C CE  . LYS B 1 41  ? 14.890  56.529  1.720   1.00 37.29 ? 181 LYS B CE  1 
ATOM 1379 N NZ  . LYS B 1 41  ? 16.120  57.268  1.300   1.00 38.78 ? 181 LYS B NZ  1 
ATOM 1380 N N   . ILE B 1 42  ? 11.260  52.812  3.796   1.00 38.18 ? 182 ILE B N   1 
ATOM 1381 C CA  . ILE B 1 42  ? 11.305  51.578  3.025   1.00 38.95 ? 182 ILE B CA  1 
ATOM 1382 C C   . ILE B 1 42  ? 11.931  51.844  1.665   1.00 39.41 ? 182 ILE B C   1 
ATOM 1383 O O   . ILE B 1 42  ? 11.432  52.666  0.901   1.00 39.85 ? 182 ILE B O   1 
ATOM 1384 C CB  . ILE B 1 42  ? 9.891   50.988  2.820   1.00 39.28 ? 182 ILE B CB  1 
ATOM 1385 C CG1 . ILE B 1 42  ? 9.104   51.047  4.132   1.00 38.92 ? 182 ILE B CG1 1 
ATOM 1386 C CG2 . ILE B 1 42  ? 10.003  49.539  2.367   1.00 38.40 ? 182 ILE B CG2 1 
ATOM 1387 C CD1 . ILE B 1 42  ? 7.678   50.556  4.022   1.00 40.71 ? 182 ILE B CD1 1 
ATOM 1388 N N   . ASN B 1 43  ? 13.026  51.143  1.374   1.00 39.98 ? 183 ASN B N   1 
ATOM 1389 C CA  . ASN B 1 43  ? 13.745  51.294  0.109   1.00 40.43 ? 183 ASN B CA  1 
ATOM 1390 C C   . ASN B 1 43  ? 13.477  50.160  -0.865  1.00 40.83 ? 183 ASN B C   1 
ATOM 1391 O O   . ASN B 1 43  ? 13.427  50.370  -2.076  1.00 42.24 ? 183 ASN B O   1 
ATOM 1392 C CB  . ASN B 1 43  ? 15.252  51.378  0.362   1.00 40.42 ? 183 ASN B CB  1 
ATOM 1393 C CG  . ASN B 1 43  ? 15.742  52.801  0.490   1.00 40.90 ? 183 ASN B CG  1 
ATOM 1394 O OD1 . ASN B 1 43  ? 16.842  53.049  0.987   1.00 41.95 ? 183 ASN B OD1 1 
ATOM 1395 N ND2 . ASN B 1 43  ? 14.934  53.747  0.027   1.00 39.89 ? 183 ASN B ND2 1 
ATOM 1396 N N   . SER B 1 44  ? 13.310  48.955  -0.334  1.00 39.93 ? 184 SER B N   1 
ATOM 1397 C CA  . SER B 1 44  ? 13.060  47.794  -1.168  1.00 39.31 ? 184 SER B CA  1 
ATOM 1398 C C   . SER B 1 44  ? 11.836  47.042  -0.695  1.00 39.32 ? 184 SER B C   1 
ATOM 1399 O O   . SER B 1 44  ? 11.153  47.462  0.234   1.00 39.58 ? 184 SER B O   1 
ATOM 1400 C CB  . SER B 1 44  ? 14.260  46.857  -1.121  1.00 38.86 ? 184 SER B CB  1 
ATOM 1401 O OG  . SER B 1 44  ? 14.479  46.418  0.206   1.00 38.40 ? 184 SER B OG  1 
ATOM 1402 N N   . THR B 1 45  ? 11.563  45.922  -1.348  1.00 39.38 ? 185 THR B N   1 
ATOM 1403 C CA  . THR B 1 45  ? 10.440  45.087  -0.972  1.00 39.44 ? 185 THR B CA  1 
ATOM 1404 C C   . THR B 1 45  ? 10.880  44.321  0.266   1.00 39.45 ? 185 THR B C   1 
ATOM 1405 O O   . THR B 1 45  ? 10.148  44.233  1.251   1.00 40.09 ? 185 THR B O   1 
ATOM 1406 C CB  . THR B 1 45  ? 10.106  44.096  -2.079  1.00 39.54 ? 185 THR B CB  1 
ATOM 1407 O OG1 . THR B 1 45  ? 11.279  43.336  -2.398  1.00 43.96 ? 185 THR B OG1 1 
ATOM 1408 C CG2 . THR B 1 45  ? 9.627   44.832  -3.315  1.00 37.87 ? 185 THR B CG2 1 
ATOM 1409 N N   . ALA B 1 46  ? 12.091  43.775  0.211   1.00 39.91 ? 186 ALA B N   1 
ATOM 1410 C CA  . ALA B 1 46  ? 12.644  43.029  1.335   1.00 39.67 ? 186 ALA B CA  1 
ATOM 1411 C C   . ALA B 1 46  ? 12.472  43.860  2.605   1.00 38.81 ? 186 ALA B C   1 
ATOM 1412 O O   . ALA B 1 46  ? 12.230  43.323  3.685   1.00 39.62 ? 186 ALA B O   1 
ATOM 1413 C CB  . ALA B 1 46  ? 14.114  42.734  1.091   1.00 38.70 ? 186 ALA B CB  1 
ATOM 1414 N N   . ASP B 1 47  ? 12.603  45.174  2.462   1.00 36.50 ? 187 ASP B N   1 
ATOM 1415 C CA  . ASP B 1 47  ? 12.439  46.088  3.581   1.00 33.99 ? 187 ASP B CA  1 
ATOM 1416 C C   . ASP B 1 47  ? 11.004  46.004  4.067   1.00 33.95 ? 187 ASP B C   1 
ATOM 1417 O O   . ASP B 1 47  ? 10.744  45.906  5.266   1.00 33.64 ? 187 ASP B O   1 
ATOM 1418 C CB  . ASP B 1 47  ? 12.749  47.514  3.134   1.00 33.84 ? 187 ASP B CB  1 
ATOM 1419 C CG  . ASP B 1 47  ? 14.220  47.829  3.196   1.00 34.05 ? 187 ASP B CG  1 
ATOM 1420 O OD1 . ASP B 1 47  ? 15.028  46.911  2.947   1.00 36.61 ? 187 ASP B OD1 1 
ATOM 1421 O OD2 . ASP B 1 47  ? 14.567  48.993  3.486   1.00 31.94 ? 187 ASP B OD2 1 
ATOM 1422 N N   . LEU B 1 48  ? 10.075  46.045  3.119   1.00 32.92 ? 188 LEU B N   1 
ATOM 1423 C CA  . LEU B 1 48  ? 8.660   45.971  3.432   1.00 32.39 ? 188 LEU B CA  1 
ATOM 1424 C C   . LEU B 1 48  ? 8.358   44.623  4.071   1.00 33.59 ? 188 LEU B C   1 
ATOM 1425 O O   . LEU B 1 48  ? 7.648   44.554  5.076   1.00 35.31 ? 188 LEU B O   1 
ATOM 1426 C CB  . LEU B 1 48  ? 7.825   46.149  2.161   1.00 30.90 ? 188 LEU B CB  1 
ATOM 1427 C CG  . LEU B 1 48  ? 6.312   46.224  2.366   1.00 30.11 ? 188 LEU B CG  1 
ATOM 1428 C CD1 . LEU B 1 48  ? 5.981   47.370  3.310   1.00 31.39 ? 188 LEU B CD1 1 
ATOM 1429 C CD2 . LEU B 1 48  ? 5.622   46.422  1.034   1.00 28.95 ? 188 LEU B CD2 1 
ATOM 1430 N N   . ASP B 1 49  ? 8.905   43.554  3.493   1.00 33.58 ? 189 ASP B N   1 
ATOM 1431 C CA  . ASP B 1 49  ? 8.684   42.214  4.023   1.00 33.77 ? 189 ASP B CA  1 
ATOM 1432 C C   . ASP B 1 49  ? 9.268   42.058  5.422   1.00 33.85 ? 189 ASP B C   1 
ATOM 1433 O O   . ASP B 1 49  ? 8.715   41.337  6.245   1.00 35.43 ? 189 ASP B O   1 
ATOM 1434 C CB  . ASP B 1 49  ? 9.275   41.152  3.094   1.00 33.73 ? 189 ASP B CB  1 
ATOM 1435 C CG  . ASP B 1 49  ? 8.574   41.096  1.752   1.00 35.30 ? 189 ASP B CG  1 
ATOM 1436 O OD1 . ASP B 1 49  ? 7.398   41.507  1.678   1.00 35.13 ? 189 ASP B OD1 1 
ATOM 1437 O OD2 . ASP B 1 49  ? 9.193   40.626  0.775   1.00 35.97 ? 189 ASP B OD2 1 
ATOM 1438 N N   . PHE B 1 50  ? 10.384  42.728  5.695   1.00 33.40 ? 190 PHE B N   1 
ATOM 1439 C CA  . PHE B 1 50  ? 11.000  42.660  7.019   1.00 32.64 ? 190 PHE B CA  1 
ATOM 1440 C C   . PHE B 1 50  ? 10.102  43.321  8.061   1.00 32.42 ? 190 PHE B C   1 
ATOM 1441 O O   . PHE B 1 50  ? 9.879   42.780  9.144   1.00 32.21 ? 190 PHE B O   1 
ATOM 1442 C CB  . PHE B 1 50  ? 12.355  43.367  7.025   1.00 31.01 ? 190 PHE B CB  1 
ATOM 1443 C CG  . PHE B 1 50  ? 12.854  43.697  8.404   1.00 29.67 ? 190 PHE B CG  1 
ATOM 1444 C CD1 . PHE B 1 50  ? 13.275  42.694  9.270   1.00 27.79 ? 190 PHE B CD1 1 
ATOM 1445 C CD2 . PHE B 1 50  ? 12.868  45.013  8.850   1.00 30.22 ? 190 PHE B CD2 1 
ATOM 1446 C CE1 . PHE B 1 50  ? 13.703  42.997  10.558  1.00 26.00 ? 190 PHE B CE1 1 
ATOM 1447 C CE2 . PHE B 1 50  ? 13.291  45.323  10.131  1.00 29.47 ? 190 PHE B CE2 1 
ATOM 1448 C CZ  . PHE B 1 50  ? 13.710  44.312  10.988  1.00 27.32 ? 190 PHE B CZ  1 
ATOM 1449 N N   . ILE B 1 51  ? 9.601   44.503  7.723   1.00 32.49 ? 191 ILE B N   1 
ATOM 1450 C CA  . ILE B 1 51  ? 8.733   45.254  8.612   1.00 32.61 ? 191 ILE B CA  1 
ATOM 1451 C C   . ILE B 1 51  ? 7.412   44.535  8.835   1.00 34.64 ? 191 ILE B C   1 
ATOM 1452 O O   . ILE B 1 51  ? 7.051   44.244  9.977   1.00 35.38 ? 191 ILE B O   1 
ATOM 1453 C CB  . ILE B 1 51  ? 8.467   46.663  8.051   1.00 30.63 ? 191 ILE B CB  1 
ATOM 1454 C CG1 . ILE B 1 51  ? 9.740   47.505  8.159   1.00 29.92 ? 191 ILE B CG1 1 
ATOM 1455 C CG2 . ILE B 1 51  ? 7.313   47.318  8.784   1.00 31.58 ? 191 ILE B CG2 1 
ATOM 1456 C CD1 . ILE B 1 51  ? 10.270  47.654  9.564   1.00 26.00 ? 191 ILE B CD1 1 
ATOM 1457 N N   . GLN B 1 52  ? 6.697   44.247  7.748   1.00 35.60 ? 192 GLN B N   1 
ATOM 1458 C CA  . GLN B 1 52  ? 5.413   43.558  7.835   1.00 35.29 ? 192 GLN B CA  1 
ATOM 1459 C C   . GLN B 1 52  ? 5.525   42.324  8.715   1.00 35.02 ? 192 GLN B C   1 
ATOM 1460 O O   . GLN B 1 52  ? 4.649   42.040  9.524   1.00 34.44 ? 192 GLN B O   1 
ATOM 1461 C CB  . GLN B 1 52  ? 4.931   43.155  6.443   1.00 37.23 ? 192 GLN B CB  1 
ATOM 1462 C CG  . GLN B 1 52  ? 3.704   42.265  6.460   1.00 40.80 ? 192 GLN B CG  1 
ATOM 1463 C CD  . GLN B 1 52  ? 2.657   42.741  7.450   1.00 43.55 ? 192 GLN B CD  1 
ATOM 1464 O OE1 . GLN B 1 52  ? 2.292   43.916  7.469   1.00 45.93 ? 192 GLN B OE1 1 
ATOM 1465 N NE2 . GLN B 1 52  ? 2.167   41.827  8.277   1.00 43.42 ? 192 GLN B NE2 1 
ATOM 1466 N N   . GLN B 1 53  ? 6.616   41.591  8.548   1.00 35.05 ? 193 GLN B N   1 
ATOM 1467 C CA  . GLN B 1 53  ? 6.860   40.397  9.335   1.00 35.44 ? 193 GLN B CA  1 
ATOM 1468 C C   . GLN B 1 53  ? 7.045   40.759  10.799  1.00 36.57 ? 193 GLN B C   1 
ATOM 1469 O O   . GLN B 1 53  ? 6.618   40.029  11.688  1.00 37.50 ? 193 GLN B O   1 
ATOM 1470 C CB  . GLN B 1 53  ? 8.117   39.693  8.831   1.00 37.16 ? 193 GLN B CB  1 
ATOM 1471 C CG  . GLN B 1 53  ? 8.540   38.511  9.679   1.00 39.96 ? 193 GLN B CG  1 
ATOM 1472 C CD  . GLN B 1 53  ? 7.376   37.605  10.031  1.00 40.96 ? 193 GLN B CD  1 
ATOM 1473 O OE1 . GLN B 1 53  ? 6.608   37.191  9.160   1.00 42.95 ? 193 GLN B OE1 1 
ATOM 1474 N NE2 . GLN B 1 53  ? 7.241   37.288  11.312  1.00 40.93 ? 193 GLN B NE2 1 
ATOM 1475 N N   . ALA B 1 54  ? 7.689   41.894  11.038  1.00 37.10 ? 194 ALA B N   1 
ATOM 1476 C CA  . ALA B 1 54  ? 7.958   42.357  12.391  1.00 36.93 ? 194 ALA B CA  1 
ATOM 1477 C C   . ALA B 1 54  ? 6.743   42.960  13.087  1.00 37.35 ? 194 ALA B C   1 
ATOM 1478 O O   . ALA B 1 54  ? 6.799   43.276  14.271  1.00 37.95 ? 194 ALA B O   1 
ATOM 1479 C CB  . ALA B 1 54  ? 9.097   43.364  12.366  1.00 36.63 ? 194 ALA B CB  1 
ATOM 1480 N N   . ILE B 1 55  ? 5.649   43.133  12.356  1.00 37.42 ? 195 ILE B N   1 
ATOM 1481 C CA  . ILE B 1 55  ? 4.440   43.695  12.947  1.00 38.84 ? 195 ILE B CA  1 
ATOM 1482 C C   . ILE B 1 55  ? 3.212   42.911  12.516  1.00 40.14 ? 195 ILE B C   1 
ATOM 1483 O O   . ILE B 1 55  ? 2.078   43.336  12.751  1.00 39.24 ? 195 ILE B O   1 
ATOM 1484 C CB  . ILE B 1 55  ? 4.225   45.173  12.545  1.00 36.75 ? 195 ILE B CB  1 
ATOM 1485 C CG1 . ILE B 1 55  ? 4.058   45.284  11.030  1.00 34.98 ? 195 ILE B CG1 1 
ATOM 1486 C CG2 . ILE B 1 55  ? 5.387   46.010  13.013  1.00 37.14 ? 195 ILE B CG2 1 
ATOM 1487 C CD1 . ILE B 1 55  ? 3.527   46.608  10.573  1.00 35.11 ? 195 ILE B CD1 1 
ATOM 1488 N N   . SER B 1 56  ? 3.442   41.767  11.882  1.00 41.05 ? 196 SER B N   1 
ATOM 1489 C CA  . SER B 1 56  ? 2.349   40.927  11.419  1.00 42.11 ? 196 SER B CA  1 
ATOM 1490 C C   . SER B 1 56  ? 1.492   40.459  12.588  1.00 44.35 ? 196 SER B C   1 
ATOM 1491 O O   . SER B 1 56  ? 0.270   40.351  12.464  1.00 45.61 ? 196 SER B O   1 
ATOM 1492 C CB  . SER B 1 56  ? 2.898   39.721  10.663  1.00 39.35 ? 196 SER B CB  1 
ATOM 1493 O OG  . SER B 1 56  ? 3.806   38.994  11.465  1.00 37.86 ? 196 SER B OG  1 
ATOM 1494 N N   . TYR B 1 57  ? 2.127   40.183  13.723  1.00 45.57 ? 197 TYR B N   1 
ATOM 1495 C CA  . TYR B 1 57  ? 1.387   39.740  14.894  1.00 47.54 ? 197 TYR B CA  1 
ATOM 1496 C C   . TYR B 1 57  ? 0.847   40.926  15.678  1.00 47.77 ? 197 TYR B C   1 
ATOM 1497 O O   . TYR B 1 57  ? 0.816   40.920  16.904  1.00 47.61 ? 197 TYR B O   1 
ATOM 1498 C CB  . TYR B 1 57  ? 2.256   38.845  15.786  1.00 49.78 ? 197 TYR B CB  1 
ATOM 1499 C CG  . TYR B 1 57  ? 3.627   39.387  16.115  1.00 52.13 ? 197 TYR B CG  1 
ATOM 1500 C CD1 . TYR B 1 57  ? 3.782   40.545  16.876  1.00 54.31 ? 197 TYR B CD1 1 
ATOM 1501 C CD2 . TYR B 1 57  ? 4.775   38.716  15.694  1.00 53.76 ? 197 TYR B CD2 1 
ATOM 1502 C CE1 . TYR B 1 57  ? 5.055   41.024  17.217  1.00 57.71 ? 197 TYR B CE1 1 
ATOM 1503 C CE2 . TYR B 1 57  ? 6.049   39.182  16.026  1.00 57.23 ? 197 TYR B CE2 1 
ATOM 1504 C CZ  . TYR B 1 57  ? 6.185   40.338  16.789  1.00 58.80 ? 197 TYR B CZ  1 
ATOM 1505 O OH  . TYR B 1 57  ? 7.442   40.813  17.118  1.00 59.60 ? 197 TYR B OH  1 
ATOM 1506 N N   . SER B 1 58  ? 0.417   41.943  14.941  1.00 48.94 ? 198 SER B N   1 
ATOM 1507 C CA  . SER B 1 58  ? -0.156  43.160  15.510  1.00 49.93 ? 198 SER B CA  1 
ATOM 1508 C C   . SER B 1 58  ? -1.180  43.703  14.522  1.00 50.72 ? 198 SER B C   1 
ATOM 1509 O O   . SER B 1 58  ? -1.286  43.206  13.400  1.00 52.07 ? 198 SER B O   1 
ATOM 1510 C CB  . SER B 1 58  ? 0.928   44.215  15.744  1.00 49.33 ? 198 SER B CB  1 
ATOM 1511 O OG  . SER B 1 58  ? 0.355   45.465  16.097  1.00 46.17 ? 198 SER B OG  1 
ATOM 1512 N N   . SER B 1 59  ? -1.936  44.715  14.936  1.00 50.46 ? 199 SER B N   1 
ATOM 1513 C CA  . SER B 1 59  ? -2.936  45.311  14.056  1.00 51.48 ? 199 SER B CA  1 
ATOM 1514 C C   . SER B 1 59  ? -3.084  46.794  14.354  1.00 51.12 ? 199 SER B C   1 
ATOM 1515 O O   . SER B 1 59  ? -4.080  47.424  13.996  1.00 50.04 ? 199 SER B O   1 
ATOM 1516 C CB  . SER B 1 59  ? -4.283  44.603  14.208  1.00 52.08 ? 199 SER B CB  1 
ATOM 1517 O OG  . SER B 1 59  ? -4.760  44.690  15.537  1.00 56.06 ? 199 SER B OG  1 
ATOM 1518 N N   . PHE B 1 60  ? -2.079  47.339  15.028  1.00 51.18 ? 200 PHE B N   1 
ATOM 1519 C CA  . PHE B 1 60  ? -2.047  48.754  15.359  1.00 50.42 ? 200 PHE B CA  1 
ATOM 1520 C C   . PHE B 1 60  ? -1.381  49.461  14.184  1.00 49.41 ? 200 PHE B C   1 
ATOM 1521 O O   . PHE B 1 60  ? -0.715  48.826  13.365  1.00 49.76 ? 200 PHE B O   1 
ATOM 1522 C CB  . PHE B 1 60  ? -1.205  48.993  16.617  1.00 51.89 ? 200 PHE B CB  1 
ATOM 1523 C CG  . PHE B 1 60  ? -1.949  48.796  17.910  1.00 53.19 ? 200 PHE B CG  1 
ATOM 1524 C CD1 . PHE B 1 60  ? -1.287  48.292  19.028  1.00 53.66 ? 200 PHE B CD1 1 
ATOM 1525 C CD2 . PHE B 1 60  ? -3.286  49.158  18.030  1.00 53.56 ? 200 PHE B CD2 1 
ATOM 1526 C CE1 . PHE B 1 60  ? -1.945  48.146  20.245  1.00 54.94 ? 200 PHE B CE1 1 
ATOM 1527 C CE2 . PHE B 1 60  ? -3.955  49.017  19.244  1.00 55.17 ? 200 PHE B CE2 1 
ATOM 1528 C CZ  . PHE B 1 60  ? -3.281  48.512  20.356  1.00 55.65 ? 200 PHE B CZ  1 
ATOM 1529 N N   . PRO B 1 61  ? -1.568  50.783  14.074  1.00 47.72 ? 201 PRO B N   1 
ATOM 1530 C CA  . PRO B 1 61  ? -0.957  51.542  12.983  1.00 44.44 ? 201 PRO B CA  1 
ATOM 1531 C C   . PRO B 1 61  ? 0.436   52.055  13.374  1.00 41.52 ? 201 PRO B C   1 
ATOM 1532 O O   . PRO B 1 61  ? 0.657   52.494  14.502  1.00 38.56 ? 201 PRO B O   1 
ATOM 1533 C CB  . PRO B 1 61  ? -1.955  52.671  12.766  1.00 46.61 ? 201 PRO B CB  1 
ATOM 1534 C CG  . PRO B 1 61  ? -2.404  52.961  14.167  1.00 46.94 ? 201 PRO B CG  1 
ATOM 1535 C CD  . PRO B 1 61  ? -2.628  51.572  14.731  1.00 47.19 ? 201 PRO B CD  1 
ATOM 1536 N N   . PHE B 1 62  ? 1.372   51.989  12.436  1.00 40.38 ? 202 PHE B N   1 
ATOM 1537 C CA  . PHE B 1 62  ? 2.733   52.448  12.680  1.00 38.01 ? 202 PHE B CA  1 
ATOM 1538 C C   . PHE B 1 62  ? 3.129   53.496  11.646  1.00 36.32 ? 202 PHE B C   1 
ATOM 1539 O O   . PHE B 1 62  ? 3.022   53.266  10.447  1.00 35.59 ? 202 PHE B O   1 
ATOM 1540 C CB  . PHE B 1 62  ? 3.711   51.270  12.626  1.00 38.76 ? 202 PHE B CB  1 
ATOM 1541 C CG  . PHE B 1 62  ? 3.522   50.267  13.737  1.00 38.96 ? 202 PHE B CG  1 
ATOM 1542 C CD1 . PHE B 1 62  ? 2.388   49.471  13.791  1.00 39.07 ? 202 PHE B CD1 1 
ATOM 1543 C CD2 . PHE B 1 62  ? 4.483   50.120  14.728  1.00 38.94 ? 202 PHE B CD2 1 
ATOM 1544 C CE1 . PHE B 1 62  ? 2.216   48.543  14.816  1.00 39.92 ? 202 PHE B CE1 1 
ATOM 1545 C CE2 . PHE B 1 62  ? 4.319   49.197  15.752  1.00 38.84 ? 202 PHE B CE2 1 
ATOM 1546 C CZ  . PHE B 1 62  ? 3.182   48.407  15.797  1.00 38.70 ? 202 PHE B CZ  1 
ATOM 1547 N N   . TRP B 1 63  ? 3.580   54.649  12.130  1.00 36.26 ? 203 TRP B N   1 
ATOM 1548 C CA  . TRP B 1 63  ? 4.001   55.766  11.284  1.00 34.47 ? 203 TRP B CA  1 
ATOM 1549 C C   . TRP B 1 63  ? 5.318   55.492  10.575  1.00 34.15 ? 203 TRP B C   1 
ATOM 1550 O O   . TRP B 1 63  ? 6.180   54.792  11.098  1.00 34.55 ? 203 TRP B O   1 
ATOM 1551 C CB  . TRP B 1 63  ? 4.221   57.024  12.127  1.00 35.28 ? 203 TRP B CB  1 
ATOM 1552 C CG  . TRP B 1 63  ? 3.016   57.795  12.532  1.00 35.46 ? 203 TRP B CG  1 
ATOM 1553 C CD1 . TRP B 1 63  ? 2.753   58.291  13.778  1.00 36.30 ? 203 TRP B CD1 1 
ATOM 1554 C CD2 . TRP B 1 63  ? 1.963   58.265  11.684  1.00 35.26 ? 203 TRP B CD2 1 
ATOM 1555 N NE1 . TRP B 1 63  ? 1.607   59.045  13.757  1.00 37.85 ? 203 TRP B NE1 1 
ATOM 1556 C CE2 . TRP B 1 63  ? 1.100   59.046  12.485  1.00 35.59 ? 203 TRP B CE2 1 
ATOM 1557 C CE3 . TRP B 1 63  ? 1.662   58.104  10.326  1.00 35.24 ? 203 TRP B CE3 1 
ATOM 1558 C CZ2 . TRP B 1 63  ? -0.042  59.666  11.973  1.00 33.66 ? 203 TRP B CZ2 1 
ATOM 1559 C CZ3 . TRP B 1 63  ? 0.523   58.720  9.817   1.00 34.52 ? 203 TRP B CZ3 1 
ATOM 1560 C CH2 . TRP B 1 63  ? -0.314  59.490  10.642  1.00 34.50 ? 203 TRP B CH2 1 
ATOM 1561 N N   . MET B 1 64  ? 5.473   56.064  9.388   1.00 33.32 ? 204 MET B N   1 
ATOM 1562 C CA  . MET B 1 64  ? 6.716   55.944  8.645   1.00 33.60 ? 204 MET B CA  1 
ATOM 1563 C C   . MET B 1 64  ? 7.088   57.352  8.195   1.00 34.06 ? 204 MET B C   1 
ATOM 1564 O O   . MET B 1 64  ? 6.267   58.265  8.271   1.00 34.39 ? 204 MET B O   1 
ATOM 1565 C CB  . MET B 1 64  ? 6.582   54.993  7.449   1.00 33.12 ? 204 MET B CB  1 
ATOM 1566 C CG  . MET B 1 64  ? 5.552   55.345  6.412   1.00 30.80 ? 204 MET B CG  1 
ATOM 1567 S SD  . MET B 1 64  ? 5.789   54.252  5.001   1.00 33.98 ? 204 MET B SD  1 
ATOM 1568 C CE  . MET B 1 64  ? 5.078   52.724  5.595   1.00 31.57 ? 204 MET B CE  1 
ATOM 1569 N N   . GLY B 1 65  ? 8.324   57.534  7.746   1.00 33.99 ? 205 GLY B N   1 
ATOM 1570 C CA  . GLY B 1 65  ? 8.764   58.853  7.333   1.00 31.95 ? 205 GLY B CA  1 
ATOM 1571 C C   . GLY B 1 65  ? 8.239   59.340  6.003   1.00 31.11 ? 205 GLY B C   1 
ATOM 1572 O O   . GLY B 1 65  ? 8.899   60.135  5.344   1.00 32.12 ? 205 GLY B O   1 
ATOM 1573 N N   . LEU B 1 66  ? 7.059   58.879  5.598   1.00 31.27 ? 206 LEU B N   1 
ATOM 1574 C CA  . LEU B 1 66  ? 6.484   59.308  4.323   1.00 30.66 ? 206 LEU B CA  1 
ATOM 1575 C C   . LEU B 1 66  ? 5.340   60.292  4.555   1.00 30.94 ? 206 LEU B C   1 
ATOM 1576 O O   . LEU B 1 66  ? 4.464   60.041  5.379   1.00 31.84 ? 206 LEU B O   1 
ATOM 1577 C CB  . LEU B 1 66  ? 5.963   58.104  3.542   1.00 28.25 ? 206 LEU B CB  1 
ATOM 1578 C CG  . LEU B 1 66  ? 5.614   58.383  2.078   1.00 28.09 ? 206 LEU B CG  1 
ATOM 1579 C CD1 . LEU B 1 66  ? 6.899   58.500  1.271   1.00 29.04 ? 206 LEU B CD1 1 
ATOM 1580 C CD2 . LEU B 1 66  ? 4.754   57.261  1.528   1.00 27.60 ? 206 LEU B CD2 1 
ATOM 1581 N N   . SER B 1 67  ? 5.342   61.409  3.833   1.00 31.18 ? 207 SER B N   1 
ATOM 1582 C CA  . SER B 1 67  ? 4.280   62.397  3.998   1.00 30.47 ? 207 SER B CA  1 
ATOM 1583 C C   . SER B 1 67  ? 4.212   63.427  2.869   1.00 31.32 ? 207 SER B C   1 
ATOM 1584 O O   . SER B 1 67  ? 4.924   63.324  1.864   1.00 28.69 ? 207 SER B O   1 
ATOM 1585 C CB  . SER B 1 67  ? 4.440   63.120  5.343   1.00 28.33 ? 207 SER B CB  1 
ATOM 1586 O OG  . SER B 1 67  ? 5.648   63.861  5.394   1.00 24.04 ? 207 SER B OG  1 
ATOM 1587 N N   . ARG B 1 68  ? 3.340   64.416  3.051   1.00 33.01 ? 208 ARG B N   1 
ATOM 1588 C CA  . ARG B 1 68  ? 3.151   65.481  2.074   1.00 34.11 ? 208 ARG B CA  1 
ATOM 1589 C C   . ARG B 1 68  ? 2.133   66.507  2.581   1.00 35.07 ? 208 ARG B C   1 
ATOM 1590 O O   . ARG B 1 68  ? 1.363   66.221  3.499   1.00 33.19 ? 208 ARG B O   1 
ATOM 1591 C CB  . ARG B 1 68  ? 2.669   64.882  0.757   1.00 33.82 ? 208 ARG B CB  1 
ATOM 1592 C CG  . ARG B 1 68  ? 1.349   64.142  0.866   1.00 36.21 ? 208 ARG B CG  1 
ATOM 1593 C CD  . ARG B 1 68  ? 0.938   63.607  -0.492  1.00 39.63 ? 208 ARG B CD  1 
ATOM 1594 N NE  . ARG B 1 68  ? -0.408  63.043  -0.512  1.00 39.48 ? 208 ARG B NE  1 
ATOM 1595 C CZ  . ARG B 1 68  ? -1.003  62.592  -1.613  1.00 39.10 ? 208 ARG B CZ  1 
ATOM 1596 N NH1 . ARG B 1 68  ? -0.367  62.641  -2.778  1.00 37.70 ? 208 ARG B NH1 1 
ATOM 1597 N NH2 . ARG B 1 68  ? -2.233  62.096  -1.554  1.00 37.11 ? 208 ARG B NH2 1 
ATOM 1598 N N   . ARG B 1 69  ? 2.138   67.702  1.995   1.00 37.52 ? 209 ARG B N   1 
ATOM 1599 C CA  . ARG B 1 69  ? 1.192   68.749  2.387   1.00 41.32 ? 209 ARG B CA  1 
ATOM 1600 C C   . ARG B 1 69  ? -0.199  68.433  1.847   1.00 44.39 ? 209 ARG B C   1 
ATOM 1601 O O   . ARG B 1 69  ? -1.197  68.461  2.580   1.00 45.48 ? 209 ARG B O   1 
ATOM 1602 C CB  . ARG B 1 69  ? 1.625   70.103  1.831   1.00 41.89 ? 209 ARG B CB  1 
ATOM 1603 C CG  . ARG B 1 69  ? 2.666   70.839  2.645   1.00 43.82 ? 209 ARG B CG  1 
ATOM 1604 C CD  . ARG B 1 69  ? 2.959   72.191  2.008   1.00 46.08 ? 209 ARG B CD  1 
ATOM 1605 N NE  . ARG B 1 69  ? 1.775   73.048  1.938   1.00 45.44 ? 209 ARG B NE  1 
ATOM 1606 C CZ  . ARG B 1 69  ? 1.365   73.842  2.923   1.00 46.30 ? 209 ARG B CZ  1 
ATOM 1607 N NH1 . ARG B 1 69  ? 2.046   73.896  4.056   1.00 47.16 ? 209 ARG B NH1 1 
ATOM 1608 N NH2 . ARG B 1 69  ? 0.268   74.575  2.780   1.00 47.32 ? 209 ARG B NH2 1 
ATOM 1609 N N   . ASN B 1 70  ? -0.251  68.140  0.551   1.00 45.46 ? 210 ASN B N   1 
ATOM 1610 C CA  . ASN B 1 70  ? -1.499  67.819  -0.123  1.00 46.93 ? 210 ASN B CA  1 
ATOM 1611 C C   . ASN B 1 70  ? -1.175  67.107  -1.431  1.00 47.86 ? 210 ASN B C   1 
ATOM 1612 O O   . ASN B 1 70  ? -0.019  67.079  -1.857  1.00 47.42 ? 210 ASN B O   1 
ATOM 1613 C CB  . ASN B 1 70  ? -2.279  69.100  -0.412  1.00 47.54 ? 210 ASN B CB  1 
ATOM 1614 C CG  . ASN B 1 70  ? -1.565  69.999  -1.399  1.00 49.56 ? 210 ASN B CG  1 
ATOM 1615 O OD1 . ASN B 1 70  ? -1.378  69.641  -2.563  1.00 49.09 ? 210 ASN B OD1 1 
ATOM 1616 N ND2 . ASN B 1 70  ? -1.156  71.174  -0.936  1.00 50.61 ? 210 ASN B ND2 1 
ATOM 1617 N N   . PRO B 1 71  ? -2.198  66.533  -2.089  1.00 48.45 ? 211 PRO B N   1 
ATOM 1618 C CA  . PRO B 1 71  ? -2.062  65.809  -3.356  1.00 49.53 ? 211 PRO B CA  1 
ATOM 1619 C C   . PRO B 1 71  ? -1.276  66.509  -4.473  1.00 51.03 ? 211 PRO B C   1 
ATOM 1620 O O   . PRO B 1 71  ? -0.807  65.846  -5.404  1.00 52.08 ? 211 PRO B O   1 
ATOM 1621 C CB  . PRO B 1 71  ? -3.512  65.533  -3.739  1.00 48.46 ? 211 PRO B CB  1 
ATOM 1622 C CG  . PRO B 1 71  ? -4.143  65.298  -2.410  1.00 48.21 ? 211 PRO B CG  1 
ATOM 1623 C CD  . PRO B 1 71  ? -3.586  66.448  -1.600  1.00 47.69 ? 211 PRO B CD  1 
ATOM 1624 N N   . SER B 1 72  ? -1.137  67.832  -4.404  1.00 50.88 ? 212 SER B N   1 
ATOM 1625 C CA  . SER B 1 72  ? -0.376  68.535  -5.432  1.00 51.53 ? 212 SER B CA  1 
ATOM 1626 C C   . SER B 1 72  ? 1.105   68.329  -5.156  1.00 51.40 ? 212 SER B C   1 
ATOM 1627 O O   . SER B 1 72  ? 1.958   68.651  -5.989  1.00 51.92 ? 212 SER B O   1 
ATOM 1628 C CB  . SER B 1 72  ? -0.710  70.031  -5.452  1.00 53.27 ? 212 SER B CB  1 
ATOM 1629 O OG  . SER B 1 72  ? -1.715  70.313  -6.415  1.00 54.83 ? 212 SER B OG  1 
ATOM 1630 N N   . TYR B 1 73  ? 1.395   67.789  -3.974  1.00 49.01 ? 213 TYR B N   1 
ATOM 1631 C CA  . TYR B 1 73  ? 2.761   67.499  -3.562  1.00 46.31 ? 213 TYR B CA  1 
ATOM 1632 C C   . TYR B 1 73  ? 2.920   65.985  -3.597  1.00 44.62 ? 213 TYR B C   1 
ATOM 1633 O O   . TYR B 1 73  ? 1.979   65.258  -3.293  1.00 46.07 ? 213 TYR B O   1 
ATOM 1634 C CB  . TYR B 1 73  ? 3.015   67.980  -2.131  1.00 45.92 ? 213 TYR B CB  1 
ATOM 1635 C CG  . TYR B 1 73  ? 3.023   69.481  -1.921  1.00 46.92 ? 213 TYR B CG  1 
ATOM 1636 C CD1 . TYR B 1 73  ? 1.834   70.211  -1.860  1.00 46.78 ? 213 TYR B CD1 1 
ATOM 1637 C CD2 . TYR B 1 73  ? 4.226   70.168  -1.735  1.00 47.47 ? 213 TYR B CD2 1 
ATOM 1638 C CE1 . TYR B 1 73  ? 1.845   71.589  -1.610  1.00 45.70 ? 213 TYR B CE1 1 
ATOM 1639 C CE2 . TYR B 1 73  ? 4.248   71.542  -1.487  1.00 46.55 ? 213 TYR B CE2 1 
ATOM 1640 C CZ  . TYR B 1 73  ? 3.057   72.245  -1.424  1.00 46.88 ? 213 TYR B CZ  1 
ATOM 1641 O OH  . TYR B 1 73  ? 3.087   73.597  -1.163  1.00 46.06 ? 213 TYR B OH  1 
ATOM 1642 N N   . PRO B 1 74  ? 4.107   65.488  -3.976  1.00 42.62 ? 214 PRO B N   1 
ATOM 1643 C CA  . PRO B 1 74  ? 4.341   64.041  -4.029  1.00 41.79 ? 214 PRO B CA  1 
ATOM 1644 C C   . PRO B 1 74  ? 4.633   63.472  -2.638  1.00 41.81 ? 214 PRO B C   1 
ATOM 1645 O O   . PRO B 1 74  ? 4.735   64.221  -1.668  1.00 42.85 ? 214 PRO B O   1 
ATOM 1646 C CB  . PRO B 1 74  ? 5.542   63.932  -4.954  1.00 40.76 ? 214 PRO B CB  1 
ATOM 1647 C CG  . PRO B 1 74  ? 6.313   65.140  -4.610  1.00 40.75 ? 214 PRO B CG  1 
ATOM 1648 C CD  . PRO B 1 74  ? 5.248   66.215  -4.554  1.00 41.42 ? 214 PRO B CD  1 
ATOM 1649 N N   . TRP B 1 75  ? 4.748   62.150  -2.537  1.00 41.41 ? 215 TRP B N   1 
ATOM 1650 C CA  . TRP B 1 75  ? 5.052   61.513  -1.258  1.00 40.45 ? 215 TRP B CA  1 
ATOM 1651 C C   . TRP B 1 75  ? 6.563   61.537  -1.087  1.00 41.48 ? 215 TRP B C   1 
ATOM 1652 O O   . TRP B 1 75  ? 7.295   61.010  -1.930  1.00 41.28 ? 215 TRP B O   1 
ATOM 1653 C CB  . TRP B 1 75  ? 4.574   60.060  -1.232  1.00 38.57 ? 215 TRP B CB  1 
ATOM 1654 C CG  . TRP B 1 75  ? 3.092   59.881  -1.083  1.00 37.43 ? 215 TRP B CG  1 
ATOM 1655 C CD1 . TRP B 1 75  ? 2.236   59.335  -1.996  1.00 36.18 ? 215 TRP B CD1 1 
ATOM 1656 C CD2 . TRP B 1 75  ? 2.300   60.198  0.068   1.00 36.93 ? 215 TRP B CD2 1 
ATOM 1657 N NE1 . TRP B 1 75  ? 0.962   59.288  -1.485  1.00 35.07 ? 215 TRP B NE1 1 
ATOM 1658 C CE2 . TRP B 1 75  ? 0.972   59.810  -0.219  1.00 35.84 ? 215 TRP B CE2 1 
ATOM 1659 C CE3 . TRP B 1 75  ? 2.584   60.767  1.318   1.00 37.37 ? 215 TRP B CE3 1 
ATOM 1660 C CZ2 . TRP B 1 75  ? -0.073  59.974  0.696   1.00 36.16 ? 215 TRP B CZ2 1 
ATOM 1661 C CZ3 . TRP B 1 75  ? 1.543   60.930  2.231   1.00 37.57 ? 215 TRP B CZ3 1 
ATOM 1662 C CH2 . TRP B 1 75  ? 0.232   60.533  1.912   1.00 37.33 ? 215 TRP B CH2 1 
ATOM 1663 N N   . LEU B 1 76  ? 7.033   62.145  -0.002  1.00 41.70 ? 216 LEU B N   1 
ATOM 1664 C CA  . LEU B 1 76  ? 8.470   62.225  0.242   1.00 42.77 ? 216 LEU B CA  1 
ATOM 1665 C C   . LEU B 1 76  ? 8.918   61.699  1.601   1.00 42.59 ? 216 LEU B C   1 
ATOM 1666 O O   . LEU B 1 76  ? 8.288   61.967  2.629   1.00 42.24 ? 216 LEU B O   1 
ATOM 1667 C CB  . LEU B 1 76  ? 8.952   63.670  0.099   1.00 43.17 ? 216 LEU B CB  1 
ATOM 1668 C CG  . LEU B 1 76  ? 8.936   64.303  -1.291  1.00 43.64 ? 216 LEU B CG  1 
ATOM 1669 C CD1 . LEU B 1 76  ? 9.338   65.763  -1.178  1.00 42.75 ? 216 LEU B CD1 1 
ATOM 1670 C CD2 . LEU B 1 76  ? 9.884   63.549  -2.212  1.00 43.73 ? 216 LEU B CD2 1 
ATOM 1671 N N   . TRP B 1 77  ? 10.012  60.944  1.599   1.00 41.72 ? 217 TRP B N   1 
ATOM 1672 C CA  . TRP B 1 77  ? 10.559  60.428  2.838   1.00 41.69 ? 217 TRP B CA  1 
ATOM 1673 C C   . TRP B 1 77  ? 11.181  61.632  3.539   1.00 42.75 ? 217 TRP B C   1 
ATOM 1674 O O   . TRP B 1 77  ? 11.490  62.636  2.899   1.00 42.94 ? 217 TRP B O   1 
ATOM 1675 C CB  . TRP B 1 77  ? 11.628  59.372  2.558   1.00 41.43 ? 217 TRP B CB  1 
ATOM 1676 C CG  . TRP B 1 77  ? 11.103  58.120  1.907   1.00 41.96 ? 217 TRP B CG  1 
ATOM 1677 C CD1 . TRP B 1 77  ? 11.360  57.681  0.637   1.00 40.40 ? 217 TRP B CD1 1 
ATOM 1678 C CD2 . TRP B 1 77  ? 10.236  57.143  2.499   1.00 41.54 ? 217 TRP B CD2 1 
ATOM 1679 N NE1 . TRP B 1 77  ? 10.708  56.494  0.403   1.00 37.92 ? 217 TRP B NE1 1 
ATOM 1680 C CE2 . TRP B 1 77  ? 10.011  56.141  1.527   1.00 39.90 ? 217 TRP B CE2 1 
ATOM 1681 C CE3 . TRP B 1 77  ? 9.628   57.018  3.755   1.00 41.92 ? 217 TRP B CE3 1 
ATOM 1682 C CZ2 . TRP B 1 77  ? 9.204   55.027  1.774   1.00 40.66 ? 217 TRP B CZ2 1 
ATOM 1683 C CZ3 . TRP B 1 77  ? 8.825   55.908  4.000   1.00 42.68 ? 217 TRP B CZ3 1 
ATOM 1684 C CH2 . TRP B 1 77  ? 8.621   54.928  3.011   1.00 42.11 ? 217 TRP B CH2 1 
ATOM 1685 N N   . GLU B 1 78  ? 11.359  61.539  4.850   1.00 43.96 ? 218 GLU B N   1 
ATOM 1686 C CA  . GLU B 1 78  ? 11.937  62.632  5.624   1.00 43.41 ? 218 GLU B CA  1 
ATOM 1687 C C   . GLU B 1 78  ? 13.121  63.309  4.939   1.00 43.03 ? 218 GLU B C   1 
ATOM 1688 O O   . GLU B 1 78  ? 13.116  64.521  4.726   1.00 41.95 ? 218 GLU B O   1 
ATOM 1689 C CB  . GLU B 1 78  ? 12.361  62.120  6.999   1.00 43.77 ? 218 GLU B CB  1 
ATOM 1690 C CG  . GLU B 1 78  ? 11.206  61.906  7.951   1.00 44.41 ? 218 GLU B CG  1 
ATOM 1691 C CD  . GLU B 1 78  ? 11.568  60.986  9.092   1.00 47.46 ? 218 GLU B CD  1 
ATOM 1692 O OE1 . GLU B 1 78  ? 11.835  59.796  8.823   1.00 48.71 ? 218 GLU B OE1 1 
ATOM 1693 O OE2 . GLU B 1 78  ? 11.592  61.447  10.253  1.00 48.79 ? 218 GLU B OE2 1 
ATOM 1694 N N   . ASP B 1 79  ? 14.133  62.520  4.599   1.00 43.11 ? 219 ASP B N   1 
ATOM 1695 C CA  . ASP B 1 79  ? 15.326  63.045  3.949   1.00 44.63 ? 219 ASP B CA  1 
ATOM 1696 C C   . ASP B 1 79  ? 15.059  63.724  2.609   1.00 44.96 ? 219 ASP B C   1 
ATOM 1697 O O   . ASP B 1 79  ? 15.968  64.298  2.012   1.00 46.59 ? 219 ASP B O   1 
ATOM 1698 C CB  . ASP B 1 79  ? 16.347  61.926  3.763   1.00 46.89 ? 219 ASP B CB  1 
ATOM 1699 C CG  . ASP B 1 79  ? 15.743  60.688  3.143   1.00 49.27 ? 219 ASP B CG  1 
ATOM 1700 O OD1 . ASP B 1 79  ? 14.818  60.108  3.754   1.00 52.91 ? 219 ASP B OD1 1 
ATOM 1701 O OD2 . ASP B 1 79  ? 16.194  60.294  2.048   1.00 49.59 ? 219 ASP B OD2 1 
ATOM 1702 N N   . GLY B 1 80  ? 13.822  63.661  2.132   1.00 44.00 ? 220 GLY B N   1 
ATOM 1703 C CA  . GLY B 1 80  ? 13.496  64.306  0.874   1.00 42.12 ? 220 GLY B CA  1 
ATOM 1704 C C   . GLY B 1 80  ? 13.468  63.383  -0.325  1.00 42.27 ? 220 GLY B C   1 
ATOM 1705 O O   . GLY B 1 80  ? 13.061  63.796  -1.407  1.00 42.32 ? 220 GLY B O   1 
ATOM 1706 N N   . SER B 1 81  ? 13.901  62.138  -0.145  1.00 42.01 ? 221 SER B N   1 
ATOM 1707 C CA  . SER B 1 81  ? 13.903  61.172  -1.241  1.00 41.63 ? 221 SER B CA  1 
ATOM 1708 C C   . SER B 1 81  ? 12.469  60.772  -1.594  1.00 41.36 ? 221 SER B C   1 
ATOM 1709 O O   . SER B 1 81  ? 11.611  60.652  -0.719  1.00 41.32 ? 221 SER B O   1 
ATOM 1710 C CB  . SER B 1 81  ? 14.725  59.933  -0.860  1.00 41.85 ? 221 SER B CB  1 
ATOM 1711 O OG  . SER B 1 81  ? 14.282  59.371  0.363   1.00 42.74 ? 221 SER B OG  1 
ATOM 1712 N N   . PRO B 1 82  ? 12.190  60.564  -2.889  1.00 41.07 ? 222 PRO B N   1 
ATOM 1713 C CA  . PRO B 1 82  ? 10.850  60.183  -3.341  1.00 41.29 ? 222 PRO B CA  1 
ATOM 1714 C C   . PRO B 1 82  ? 10.519  58.742  -3.000  1.00 41.21 ? 222 PRO B C   1 
ATOM 1715 O O   . PRO B 1 82  ? 11.393  57.980  -2.599  1.00 41.39 ? 222 PRO B O   1 
ATOM 1716 C CB  . PRO B 1 82  ? 10.933  60.399  -4.842  1.00 40.07 ? 222 PRO B CB  1 
ATOM 1717 C CG  . PRO B 1 82  ? 12.322  59.951  -5.130  1.00 39.82 ? 222 PRO B CG  1 
ATOM 1718 C CD  . PRO B 1 82  ? 13.121  60.622  -4.029  1.00 40.19 ? 222 PRO B CD  1 
ATOM 1719 N N   . LEU B 1 83  ? 9.255   58.372  -3.170  1.00 41.48 ? 223 LEU B N   1 
ATOM 1720 C CA  . LEU B 1 83  ? 8.818   57.010  -2.895  1.00 42.90 ? 223 LEU B CA  1 
ATOM 1721 C C   . LEU B 1 83  ? 9.064   56.141  -4.117  1.00 45.00 ? 223 LEU B C   1 
ATOM 1722 O O   . LEU B 1 83  ? 8.247   56.110  -5.038  1.00 46.88 ? 223 LEU B O   1 
ATOM 1723 C CB  . LEU B 1 83  ? 7.326   56.986  -2.538  1.00 41.37 ? 223 LEU B CB  1 
ATOM 1724 C CG  . LEU B 1 83  ? 6.618   55.623  -2.541  1.00 37.96 ? 223 LEU B CG  1 
ATOM 1725 C CD1 . LEU B 1 83  ? 7.273   54.668  -1.555  1.00 35.79 ? 223 LEU B CD1 1 
ATOM 1726 C CD2 . LEU B 1 83  ? 5.157   55.826  -2.194  1.00 37.88 ? 223 LEU B CD2 1 
ATOM 1727 N N   . MET B 1 84  ? 10.196  55.445  -4.126  1.00 46.65 ? 224 MET B N   1 
ATOM 1728 C CA  . MET B 1 84  ? 10.541  54.571  -5.237  1.00 48.86 ? 224 MET B CA  1 
ATOM 1729 C C   . MET B 1 84  ? 9.276   53.812  -5.627  1.00 49.24 ? 224 MET B C   1 
ATOM 1730 O O   . MET B 1 84  ? 8.589   53.263  -4.767  1.00 48.96 ? 224 MET B O   1 
ATOM 1731 C CB  . MET B 1 84  ? 11.637  53.600  -4.803  1.00 52.16 ? 224 MET B CB  1 
ATOM 1732 C CG  . MET B 1 84  ? 12.243  52.771  -5.920  1.00 57.04 ? 224 MET B CG  1 
ATOM 1733 S SD  . MET B 1 84  ? 13.543  51.670  -5.304  1.00 62.56 ? 224 MET B SD  1 
ATOM 1734 C CE  . MET B 1 84  ? 12.662  50.130  -5.187  1.00 60.91 ? 224 MET B CE  1 
ATOM 1735 N N   . PRO B 1 85  ? 8.942   53.786  -6.927  1.00 49.98 ? 225 PRO B N   1 
ATOM 1736 C CA  . PRO B 1 85  ? 7.744   53.089  -7.403  1.00 50.40 ? 225 PRO B CA  1 
ATOM 1737 C C   . PRO B 1 85  ? 7.800   51.571  -7.255  1.00 51.16 ? 225 PRO B C   1 
ATOM 1738 O O   . PRO B 1 85  ? 8.880   50.974  -7.177  1.00 50.36 ? 225 PRO B O   1 
ATOM 1739 C CB  . PRO B 1 85  ? 7.661   53.520  -8.863  1.00 48.91 ? 225 PRO B CB  1 
ATOM 1740 C CG  . PRO B 1 85  ? 9.098   53.600  -9.245  1.00 48.71 ? 225 PRO B CG  1 
ATOM 1741 C CD  . PRO B 1 85  ? 9.705   54.335  -8.062  1.00 49.78 ? 225 PRO B CD  1 
ATOM 1742 N N   . HIS B 1 86  ? 6.620   50.959  -7.220  1.00 51.47 ? 226 HIS B N   1 
ATOM 1743 C CA  . HIS B 1 86  ? 6.486   49.512  -7.104  1.00 52.80 ? 226 HIS B CA  1 
ATOM 1744 C C   . HIS B 1 86  ? 6.954   48.945  -5.768  1.00 52.06 ? 226 HIS B C   1 
ATOM 1745 O O   . HIS B 1 86  ? 7.633   47.920  -5.734  1.00 52.78 ? 226 HIS B O   1 
ATOM 1746 C CB  . HIS B 1 86  ? 7.256   48.816  -8.235  1.00 56.47 ? 226 HIS B CB  1 
ATOM 1747 C CG  . HIS B 1 86  ? 6.921   49.321  -9.605  1.00 58.84 ? 226 HIS B CG  1 
ATOM 1748 N ND1 . HIS B 1 86  ? 5.628   49.383  -10.083 1.00 59.92 ? 226 HIS B ND1 1 
ATOM 1749 C CD2 . HIS B 1 86  ? 7.713   49.778  -10.602 1.00 59.54 ? 226 HIS B CD2 1 
ATOM 1750 C CE1 . HIS B 1 86  ? 5.640   49.859  -11.316 1.00 60.62 ? 226 HIS B CE1 1 
ATOM 1751 N NE2 . HIS B 1 86  ? 6.893   50.107  -11.655 1.00 61.07 ? 226 HIS B NE2 1 
ATOM 1752 N N   . LEU B 1 87  ? 6.595   49.601  -4.671  1.00 50.85 ? 227 LEU B N   1 
ATOM 1753 C CA  . LEU B 1 87  ? 6.982   49.116  -3.349  1.00 49.83 ? 227 LEU B CA  1 
ATOM 1754 C C   . LEU B 1 87  ? 5.724   48.769  -2.568  1.00 49.67 ? 227 LEU B C   1 
ATOM 1755 O O   . LEU B 1 87  ? 5.692   47.808  -1.799  1.00 49.32 ? 227 LEU B O   1 
ATOM 1756 C CB  . LEU B 1 87  ? 7.793   50.178  -2.607  1.00 49.43 ? 227 LEU B CB  1 
ATOM 1757 C CG  . LEU B 1 87  ? 9.117   50.569  -3.268  1.00 49.08 ? 227 LEU B CG  1 
ATOM 1758 C CD1 . LEU B 1 87  ? 9.836   51.595  -2.410  1.00 47.67 ? 227 LEU B CD1 1 
ATOM 1759 C CD2 . LEU B 1 87  ? 9.979   49.330  -3.458  1.00 49.02 ? 227 LEU B CD2 1 
ATOM 1760 N N   . PHE B 1 88  ? 4.688   49.569  -2.787  1.00 48.86 ? 228 PHE B N   1 
ATOM 1761 C CA  . PHE B 1 88  ? 3.386   49.396  -2.156  1.00 48.89 ? 228 PHE B CA  1 
ATOM 1762 C C   . PHE B 1 88  ? 2.480   50.509  -2.668  1.00 49.74 ? 228 PHE B C   1 
ATOM 1763 O O   . PHE B 1 88  ? 2.960   51.474  -3.255  1.00 50.07 ? 228 PHE B O   1 
ATOM 1764 C CB  . PHE B 1 88  ? 3.506   49.449  -0.626  1.00 47.92 ? 228 PHE B CB  1 
ATOM 1765 C CG  . PHE B 1 88  ? 4.101   50.723  -0.094  1.00 47.54 ? 228 PHE B CG  1 
ATOM 1766 C CD1 . PHE B 1 88  ? 3.389   51.920  -0.127  1.00 48.06 ? 228 PHE B CD1 1 
ATOM 1767 C CD2 . PHE B 1 88  ? 5.374   50.720  0.460   1.00 47.69 ? 228 PHE B CD2 1 
ATOM 1768 C CE1 . PHE B 1 88  ? 3.939   53.092  0.387   1.00 48.95 ? 228 PHE B CE1 1 
ATOM 1769 C CE2 . PHE B 1 88  ? 5.931   51.881  0.975   1.00 48.71 ? 228 PHE B CE2 1 
ATOM 1770 C CZ  . PHE B 1 88  ? 5.212   53.072  0.940   1.00 48.93 ? 228 PHE B CZ  1 
ATOM 1771 N N   . ARG B 1 89  ? 1.175   50.374  -2.460  1.00 50.37 ? 229 ARG B N   1 
ATOM 1772 C CA  . ARG B 1 89  ? 0.234   51.386  -2.924  1.00 51.48 ? 229 ARG B CA  1 
ATOM 1773 C C   . ARG B 1 89  ? -0.381  52.128  -1.743  1.00 51.32 ? 229 ARG B C   1 
ATOM 1774 O O   . ARG B 1 89  ? -0.981  51.516  -0.865  1.00 51.79 ? 229 ARG B O   1 
ATOM 1775 C CB  . ARG B 1 89  ? -0.867  50.728  -3.758  1.00 53.86 ? 229 ARG B CB  1 
ATOM 1776 C CG  . ARG B 1 89  ? -1.833  51.712  -4.398  1.00 57.04 ? 229 ARG B CG  1 
ATOM 1777 C CD  . ARG B 1 89  ? -1.169  52.514  -5.508  1.00 58.48 ? 229 ARG B CD  1 
ATOM 1778 N NE  . ARG B 1 89  ? -1.916  53.735  -5.801  1.00 60.79 ? 229 ARG B NE  1 
ATOM 1779 C CZ  . ARG B 1 89  ? -1.618  54.589  -6.776  1.00 60.19 ? 229 ARG B CZ  1 
ATOM 1780 N NH1 . ARG B 1 89  ? -2.359  55.674  -6.955  1.00 58.73 ? 229 ARG B NH1 1 
ATOM 1781 N NH2 . ARG B 1 89  ? -0.587  54.354  -7.578  1.00 59.93 ? 229 ARG B NH2 1 
ATOM 1782 N N   . VAL B 1 90  ? -0.232  53.450  -1.727  1.00 51.61 ? 230 VAL B N   1 
ATOM 1783 C CA  . VAL B 1 90  ? -0.774  54.258  -0.639  1.00 51.09 ? 230 VAL B CA  1 
ATOM 1784 C C   . VAL B 1 90  ? -2.285  54.379  -0.762  1.00 51.42 ? 230 VAL B C   1 
ATOM 1785 O O   . VAL B 1 90  ? -2.803  54.799  -1.796  1.00 52.81 ? 230 VAL B O   1 
ATOM 1786 C CB  . VAL B 1 90  ? -0.163  55.671  -0.627  1.00 49.60 ? 230 VAL B CB  1 
ATOM 1787 C CG1 . VAL B 1 90  ? -0.538  56.386  0.660   1.00 48.89 ? 230 VAL B CG1 1 
ATOM 1788 C CG2 . VAL B 1 90  ? 1.343   55.584  -0.768  1.00 49.43 ? 230 VAL B CG2 1 
ATOM 1789 N N   . ARG B 1 91  ? -2.986  54.017  0.305   1.00 51.74 ? 231 ARG B N   1 
ATOM 1790 C CA  . ARG B 1 91  ? -4.439  54.062  0.312   1.00 52.77 ? 231 ARG B CA  1 
ATOM 1791 C C   . ARG B 1 91  ? -4.963  55.083  1.321   1.00 52.18 ? 231 ARG B C   1 
ATOM 1792 O O   . ARG B 1 91  ? -4.304  56.081  1.594   1.00 53.13 ? 231 ARG B O   1 
ATOM 1793 C CB  . ARG B 1 91  ? -4.972  52.660  0.620   1.00 55.56 ? 231 ARG B CB  1 
ATOM 1794 C CG  . ARG B 1 91  ? -4.335  51.581  -0.260  1.00 58.29 ? 231 ARG B CG  1 
ATOM 1795 C CD  . ARG B 1 91  ? -4.896  50.187  0.011   1.00 61.16 ? 231 ARG B CD  1 
ATOM 1796 N NE  . ARG B 1 91  ? -4.229  49.158  -0.790  1.00 63.37 ? 231 ARG B NE  1 
ATOM 1797 C CZ  . ARG B 1 91  ? -4.172  49.156  -2.120  1.00 62.97 ? 231 ARG B CZ  1 
ATOM 1798 N NH1 . ARG B 1 91  ? -4.744  50.130  -2.816  1.00 62.26 ? 231 ARG B NH1 1 
ATOM 1799 N NH2 . ARG B 1 91  ? -3.536  48.181  -2.756  1.00 61.13 ? 231 ARG B NH2 1 
ATOM 1800 N N   . GLY B 1 92  ? -6.150  54.840  1.866   1.00 51.67 ? 232 GLY B N   1 
ATOM 1801 C CA  . GLY B 1 92  ? -6.718  55.764  2.832   1.00 51.94 ? 232 GLY B CA  1 
ATOM 1802 C C   . GLY B 1 92  ? -7.143  57.104  2.250   1.00 52.83 ? 232 GLY B C   1 
ATOM 1803 O O   . GLY B 1 92  ? -7.540  57.189  1.088   1.00 52.32 ? 232 GLY B O   1 
ATOM 1804 N N   . ALA B 1 93  ? -7.057  58.153  3.067   1.00 53.89 ? 233 ALA B N   1 
ATOM 1805 C CA  . ALA B 1 93  ? -7.435  59.506  2.657   1.00 54.31 ? 233 ALA B CA  1 
ATOM 1806 C C   . ALA B 1 93  ? -6.403  60.121  1.722   1.00 54.22 ? 233 ALA B C   1 
ATOM 1807 O O   . ALA B 1 93  ? -5.658  61.014  2.115   1.00 55.10 ? 233 ALA B O   1 
ATOM 1808 C CB  . ALA B 1 93  ? -7.608  60.396  3.890   1.00 52.72 ? 233 ALA B CB  1 
ATOM 1809 N N   . VAL B 1 94  ? -6.373  59.648  0.482   1.00 54.73 ? 234 VAL B N   1 
ATOM 1810 C CA  . VAL B 1 94  ? -5.422  60.142  -0.508  1.00 56.34 ? 234 VAL B CA  1 
ATOM 1811 C C   . VAL B 1 94  ? -5.862  61.421  -1.223  1.00 57.41 ? 234 VAL B C   1 
ATOM 1812 O O   . VAL B 1 94  ? -5.061  62.060  -1.908  1.00 58.12 ? 234 VAL B O   1 
ATOM 1813 C CB  . VAL B 1 94  ? -5.148  59.076  -1.587  1.00 56.70 ? 234 VAL B CB  1 
ATOM 1814 C CG1 . VAL B 1 94  ? -4.733  57.772  -0.928  1.00 55.62 ? 234 VAL B CG1 1 
ATOM 1815 C CG2 . VAL B 1 94  ? -6.386  58.882  -2.458  1.00 55.48 ? 234 VAL B CG2 1 
ATOM 1816 N N   . SER B 1 95  ? -7.127  61.794  -1.068  1.00 57.14 ? 235 SER B N   1 
ATOM 1817 C CA  . SER B 1 95  ? -7.646  62.984  -1.729  1.00 56.35 ? 235 SER B CA  1 
ATOM 1818 C C   . SER B 1 95  ? -8.099  64.061  -0.756  1.00 56.76 ? 235 SER B C   1 
ATOM 1819 O O   . SER B 1 95  ? -9.271  64.427  -0.739  1.00 57.50 ? 235 SER B O   1 
ATOM 1820 C CB  . SER B 1 95  ? -8.816  62.600  -2.635  1.00 55.78 ? 235 SER B CB  1 
ATOM 1821 O OG  . SER B 1 95  ? -9.822  61.928  -1.897  1.00 54.21 ? 235 SER B OG  1 
ATOM 1822 N N   . GLN B 1 96  ? -7.178  64.563  0.060   1.00 57.41 ? 236 GLN B N   1 
ATOM 1823 C CA  . GLN B 1 96  ? -7.516  65.611  1.021   1.00 57.10 ? 236 GLN B CA  1 
ATOM 1824 C C   . GLN B 1 96  ? -6.365  66.558  1.340   1.00 55.31 ? 236 GLN B C   1 
ATOM 1825 O O   . GLN B 1 96  ? -5.252  66.408  0.832   1.00 53.92 ? 236 GLN B O   1 
ATOM 1826 C CB  . GLN B 1 96  ? -8.026  65.007  2.335   1.00 58.38 ? 236 GLN B CB  1 
ATOM 1827 C CG  . GLN B 1 96  ? -9.407  64.383  2.257   1.00 60.03 ? 236 GLN B CG  1 
ATOM 1828 C CD  . GLN B 1 96  ? -9.360  62.879  2.095   1.00 62.52 ? 236 GLN B CD  1 
ATOM 1829 O OE1 . GLN B 1 96  ? -8.877  62.361  1.087   1.00 62.49 ? 236 GLN B OE1 1 
ATOM 1830 N NE2 . GLN B 1 96  ? -9.863  62.167  3.096   1.00 63.53 ? 236 GLN B NE2 1 
ATOM 1831 N N   . THR B 1 97  ? -6.661  67.538  2.188   1.00 53.46 ? 237 THR B N   1 
ATOM 1832 C CA  . THR B 1 97  ? -5.688  68.529  2.621   1.00 52.04 ? 237 THR B CA  1 
ATOM 1833 C C   . THR B 1 97  ? -5.955  68.896  4.076   1.00 51.30 ? 237 THR B C   1 
ATOM 1834 O O   . THR B 1 97  ? -7.033  69.381  4.413   1.00 52.02 ? 237 THR B O   1 
ATOM 1835 C CB  . THR B 1 97  ? -5.769  69.808  1.769   1.00 50.58 ? 237 THR B CB  1 
ATOM 1836 O OG1 . THR B 1 97  ? -5.312  69.530  0.440   1.00 50.41 ? 237 THR B OG1 1 
ATOM 1837 C CG2 . THR B 1 97  ? -4.912  70.906  2.380   1.00 51.40 ? 237 THR B CG2 1 
ATOM 1838 N N   . TYR B 1 98  ? -4.973  68.655  4.938   1.00 50.44 ? 238 TYR B N   1 
ATOM 1839 C CA  . TYR B 1 98  ? -5.116  68.974  6.351   1.00 49.90 ? 238 TYR B CA  1 
ATOM 1840 C C   . TYR B 1 98  ? -4.064  69.997  6.759   1.00 49.73 ? 238 TYR B C   1 
ATOM 1841 O O   . TYR B 1 98  ? -3.009  70.101  6.129   1.00 49.18 ? 238 TYR B O   1 
ATOM 1842 C CB  . TYR B 1 98  ? -4.943  67.723  7.215   1.00 51.16 ? 238 TYR B CB  1 
ATOM 1843 C CG  . TYR B 1 98  ? -5.817  66.550  6.833   1.00 52.63 ? 238 TYR B CG  1 
ATOM 1844 C CD1 . TYR B 1 98  ? -5.337  65.538  5.998   1.00 53.27 ? 238 TYR B CD1 1 
ATOM 1845 C CD2 . TYR B 1 98  ? -7.115  66.437  7.326   1.00 52.64 ? 238 TYR B CD2 1 
ATOM 1846 C CE1 . TYR B 1 98  ? -6.131  64.440  5.668   1.00 53.35 ? 238 TYR B CE1 1 
ATOM 1847 C CE2 . TYR B 1 98  ? -7.917  65.344  7.003   1.00 53.04 ? 238 TYR B CE2 1 
ATOM 1848 C CZ  . TYR B 1 98  ? -7.419  64.350  6.176   1.00 53.79 ? 238 TYR B CZ  1 
ATOM 1849 O OH  . TYR B 1 98  ? -8.204  63.263  5.872   1.00 54.23 ? 238 TYR B OH  1 
ATOM 1850 N N   . PRO B 1 99  ? -4.341  70.766  7.823   1.00 49.36 ? 239 PRO B N   1 
ATOM 1851 C CA  . PRO B 1 99  ? -3.408  71.783  8.314   1.00 48.57 ? 239 PRO B CA  1 
ATOM 1852 C C   . PRO B 1 99  ? -2.030  71.197  8.607   1.00 47.71 ? 239 PRO B C   1 
ATOM 1853 O O   . PRO B 1 99  ? -1.009  71.798  8.282   1.00 48.37 ? 239 PRO B O   1 
ATOM 1854 C CB  . PRO B 1 99  ? -4.098  72.297  9.575   1.00 49.28 ? 239 PRO B CB  1 
ATOM 1855 C CG  . PRO B 1 99  ? -5.538  72.185  9.219   1.00 50.24 ? 239 PRO B CG  1 
ATOM 1856 C CD  . PRO B 1 99  ? -5.603  70.814  8.581   1.00 49.63 ? 239 PRO B CD  1 
ATOM 1857 N N   . SER B 1 100 ? -2.010  70.019  9.225   1.00 46.52 ? 240 SER B N   1 
ATOM 1858 C CA  . SER B 1 100 ? -0.760  69.349  9.561   1.00 45.70 ? 240 SER B CA  1 
ATOM 1859 C C   . SER B 1 100 ? -0.230  68.506  8.402   1.00 46.12 ? 240 SER B C   1 
ATOM 1860 O O   . SER B 1 100 ? 0.871   67.956  8.477   1.00 46.32 ? 240 SER B O   1 
ATOM 1861 C CB  . SER B 1 100 ? -0.953  68.465  10.790  1.00 46.39 ? 240 SER B CB  1 
ATOM 1862 O OG  . SER B 1 100 ? -1.244  69.247  11.933  1.00 48.21 ? 240 SER B OG  1 
ATOM 1863 N N   . GLY B 1 101 ? -1.015  68.403  7.334   1.00 45.87 ? 241 GLY B N   1 
ATOM 1864 C CA  . GLY B 1 101 ? -0.589  67.638  6.176   1.00 44.78 ? 241 GLY B CA  1 
ATOM 1865 C C   . GLY B 1 101 ? -1.003  66.183  6.220   1.00 44.44 ? 241 GLY B C   1 
ATOM 1866 O O   . GLY B 1 101 ? -1.746  65.768  7.109   1.00 42.87 ? 241 GLY B O   1 
ATOM 1867 N N   . THR B 1 102 ? -0.519  65.408  5.252   1.00 44.67 ? 242 THR B N   1 
ATOM 1868 C CA  . THR B 1 102 ? -0.840  63.990  5.178   1.00 45.42 ? 242 THR B CA  1 
ATOM 1869 C C   . THR B 1 102 ? 0.397   63.140  5.459   1.00 45.04 ? 242 THR B C   1 
ATOM 1870 O O   . THR B 1 102 ? 1.495   63.454  4.998   1.00 44.99 ? 242 THR B O   1 
ATOM 1871 C CB  . THR B 1 102 ? -1.394  63.622  3.797   1.00 46.76 ? 242 THR B CB  1 
ATOM 1872 O OG1 . THR B 1 102 ? -2.508  64.466  3.490   1.00 48.98 ? 242 THR B OG1 1 
ATOM 1873 C CG2 . THR B 1 102 ? -1.858  62.176  3.788   1.00 48.97 ? 242 THR B CG2 1 
ATOM 1874 N N   . CYS B 1 103 ? 0.209   62.061  6.215   1.00 44.01 ? 243 CYS B N   1 
ATOM 1875 C CA  . CYS B 1 103 ? 1.310   61.179  6.574   1.00 42.19 ? 243 CYS B CA  1 
ATOM 1876 C C   . CYS B 1 103 ? 0.925   59.711  6.441   1.00 40.84 ? 243 CYS B C   1 
ATOM 1877 O O   . CYS B 1 103 ? -0.149  59.300  6.867   1.00 39.95 ? 243 CYS B O   1 
ATOM 1878 C CB  . CYS B 1 103 ? 1.756   61.492  8.002   1.00 42.94 ? 243 CYS B CB  1 
ATOM 1879 S SG  . CYS B 1 103 ? 2.329   63.213  8.179   1.00 43.41 ? 243 CYS B SG  1 
ATOM 1880 N N   . ALA B 1 104 ? 1.818   58.922  5.853   1.00 40.16 ? 244 ALA B N   1 
ATOM 1881 C CA  . ALA B 1 104 ? 1.568   57.503  5.631   1.00 39.21 ? 244 ALA B CA  1 
ATOM 1882 C C   . ALA B 1 104 ? 2.024   56.615  6.774   1.00 39.07 ? 244 ALA B C   1 
ATOM 1883 O O   . ALA B 1 104 ? 3.084   56.828  7.354   1.00 38.95 ? 244 ALA B O   1 
ATOM 1884 C CB  . ALA B 1 104 ? 2.242   57.059  4.339   1.00 39.95 ? 244 ALA B CB  1 
ATOM 1885 N N   . TYR B 1 105 ? 1.212   55.609  7.082   1.00 39.07 ? 245 TYR B N   1 
ATOM 1886 C CA  . TYR B 1 105 ? 1.519   54.659  8.147   1.00 39.64 ? 245 TYR B CA  1 
ATOM 1887 C C   . TYR B 1 105 ? 1.179   53.255  7.673   1.00 37.84 ? 245 TYR B C   1 
ATOM 1888 O O   . TYR B 1 105 ? 0.308   53.087  6.825   1.00 38.23 ? 245 TYR B O   1 
ATOM 1889 C CB  . TYR B 1 105 ? 0.712   54.989  9.412   1.00 41.86 ? 245 TYR B CB  1 
ATOM 1890 C CG  . TYR B 1 105 ? -0.779  54.719  9.320   1.00 43.28 ? 245 TYR B CG  1 
ATOM 1891 C CD1 . TYR B 1 105 ? -1.283  53.422  9.421   1.00 45.03 ? 245 TYR B CD1 1 
ATOM 1892 C CD2 . TYR B 1 105 ? -1.685  55.763  9.149   1.00 43.87 ? 245 TYR B CD2 1 
ATOM 1893 C CE1 . TYR B 1 105 ? -2.656  53.174  9.355   1.00 46.56 ? 245 TYR B CE1 1 
ATOM 1894 C CE2 . TYR B 1 105 ? -3.055  55.527  9.083   1.00 46.06 ? 245 TYR B CE2 1 
ATOM 1895 C CZ  . TYR B 1 105 ? -3.534  54.231  9.188   1.00 46.14 ? 245 TYR B CZ  1 
ATOM 1896 O OH  . TYR B 1 105 ? -4.887  53.994  9.131   1.00 45.70 ? 245 TYR B OH  1 
ATOM 1897 N N   . ILE B 1 106 ? 1.861   52.248  8.207   1.00 35.94 ? 246 ILE B N   1 
ATOM 1898 C CA  . ILE B 1 106 ? 1.576   50.877  7.804   1.00 35.94 ? 246 ILE B CA  1 
ATOM 1899 C C   . ILE B 1 106 ? 0.776   50.168  8.876   1.00 35.78 ? 246 ILE B C   1 
ATOM 1900 O O   . ILE B 1 106 ? 1.062   50.285  10.062  1.00 35.11 ? 246 ILE B O   1 
ATOM 1901 C CB  . ILE B 1 106 ? 2.860   50.058  7.526   1.00 35.36 ? 246 ILE B CB  1 
ATOM 1902 C CG1 . ILE B 1 106 ? 2.484   48.743  6.840   1.00 32.34 ? 246 ILE B CG1 1 
ATOM 1903 C CG2 . ILE B 1 106 ? 3.594   49.754  8.828   1.00 36.64 ? 246 ILE B CG2 1 
ATOM 1904 C CD1 . ILE B 1 106 ? 3.663   47.940  6.374   1.00 30.70 ? 246 ILE B CD1 1 
ATOM 1905 N N   . GLN B 1 107 ? -0.233  49.425  8.445   1.00 37.73 ? 247 GLN B N   1 
ATOM 1906 C CA  . GLN B 1 107 ? -1.081  48.701  9.371   1.00 39.60 ? 247 GLN B CA  1 
ATOM 1907 C C   . GLN B 1 107 ? -1.518  47.373  8.781   1.00 39.97 ? 247 GLN B C   1 
ATOM 1908 O O   . GLN B 1 107 ? -1.799  47.280  7.586   1.00 38.41 ? 247 GLN B O   1 
ATOM 1909 C CB  . GLN B 1 107 ? -2.319  49.536  9.710   1.00 40.05 ? 247 GLN B CB  1 
ATOM 1910 C CG  . GLN B 1 107 ? -3.214  48.924  10.774  1.00 43.29 ? 247 GLN B CG  1 
ATOM 1911 C CD  . GLN B 1 107 ? -4.480  49.727  11.007  1.00 45.62 ? 247 GLN B CD  1 
ATOM 1912 O OE1 . GLN B 1 107 ? -4.436  50.886  11.422  1.00 47.36 ? 247 GLN B OE1 1 
ATOM 1913 N NE2 . GLN B 1 107 ? -5.622  49.110  10.735  1.00 49.52 ? 247 GLN B NE2 1 
ATOM 1914 N N   . ARG B 1 108 ? -1.551  46.349  9.628   1.00 40.78 ? 248 ARG B N   1 
ATOM 1915 C CA  . ARG B 1 108 ? -1.993  45.018  9.232   1.00 41.48 ? 248 ARG B CA  1 
ATOM 1916 C C   . ARG B 1 108 ? -1.576  44.651  7.803   1.00 40.99 ? 248 ARG B C   1 
ATOM 1917 O O   . ARG B 1 108 ? -2.299  43.934  7.108   1.00 40.09 ? 248 ARG B O   1 
ATOM 1918 C CB  . ARG B 1 108 ? -3.517  44.964  9.373   1.00 43.40 ? 248 ARG B CB  1 
ATOM 1919 C CG  . ARG B 1 108 ? -4.144  43.642  9.800   1.00 47.15 ? 248 ARG B CG  1 
ATOM 1920 C CD  . ARG B 1 108 ? -5.534  43.960  10.350  1.00 50.86 ? 248 ARG B CD  1 
ATOM 1921 N NE  . ARG B 1 108 ? -6.491  42.855  10.333  1.00 52.27 ? 248 ARG B NE  1 
ATOM 1922 C CZ  . ARG B 1 108 ? -7.772  42.987  10.682  1.00 52.81 ? 248 ARG B CZ  1 
ATOM 1923 N NH1 . ARG B 1 108 ? -8.236  44.171  11.071  1.00 50.72 ? 248 ARG B NH1 1 
ATOM 1924 N NH2 . ARG B 1 108 ? -8.593  41.942  10.645  1.00 50.74 ? 248 ARG B NH2 1 
ATOM 1925 N N   . GLY B 1 109 ? -0.426  45.153  7.359   1.00 39.82 ? 249 GLY B N   1 
ATOM 1926 C CA  . GLY B 1 109 ? 0.044   44.817  6.025   1.00 40.57 ? 249 GLY B CA  1 
ATOM 1927 C C   . GLY B 1 109 ? 0.098   45.891  4.951   1.00 41.67 ? 249 GLY B C   1 
ATOM 1928 O O   . GLY B 1 109 ? 1.045   45.923  4.168   1.00 41.93 ? 249 GLY B O   1 
ATOM 1929 N N   . ALA B 1 110 ? -0.901  46.766  4.900   1.00 41.86 ? 250 ALA B N   1 
ATOM 1930 C CA  . ALA B 1 110 ? -0.944  47.812  3.880   1.00 41.50 ? 250 ALA B CA  1 
ATOM 1931 C C   . ALA B 1 110 ? -0.579  49.192  4.409   1.00 42.00 ? 250 ALA B C   1 
ATOM 1932 O O   . ALA B 1 110 ? -0.610  49.429  5.612   1.00 42.87 ? 250 ALA B O   1 
ATOM 1933 C CB  . ALA B 1 110 ? -2.328  47.853  3.251   1.00 42.02 ? 250 ALA B CB  1 
ATOM 1934 N N   . VAL B 1 111 ? -0.238  50.099  3.496   1.00 42.35 ? 251 VAL B N   1 
ATOM 1935 C CA  . VAL B 1 111 ? 0.125   51.473  3.845   1.00 42.99 ? 251 VAL B CA  1 
ATOM 1936 C C   . VAL B 1 111 ? -1.072  52.406  3.628   1.00 43.01 ? 251 VAL B C   1 
ATOM 1937 O O   . VAL B 1 111 ? -1.776  52.296  2.623   1.00 42.53 ? 251 VAL B O   1 
ATOM 1938 C CB  . VAL B 1 111 ? 1.293   51.977  2.979   1.00 44.08 ? 251 VAL B CB  1 
ATOM 1939 C CG1 . VAL B 1 111 ? 1.676   53.385  3.396   1.00 44.96 ? 251 VAL B CG1 1 
ATOM 1940 C CG2 . VAL B 1 111 ? 2.480   51.036  3.105   1.00 45.32 ? 251 VAL B CG2 1 
ATOM 1941 N N   . TYR B 1 112 ? -1.296  53.327  4.563   1.00 42.74 ? 252 TYR B N   1 
ATOM 1942 C CA  . TYR B 1 112 ? -2.426  54.245  4.464   1.00 43.41 ? 252 TYR B CA  1 
ATOM 1943 C C   . TYR B 1 112 ? -2.066  55.697  4.754   1.00 44.38 ? 252 TYR B C   1 
ATOM 1944 O O   . TYR B 1 112 ? -1.267  55.987  5.644   1.00 44.00 ? 252 TYR B O   1 
ATOM 1945 C CB  . TYR B 1 112 ? -3.538  53.838  5.438   1.00 44.16 ? 252 TYR B CB  1 
ATOM 1946 C CG  . TYR B 1 112 ? -3.946  52.378  5.402   1.00 46.45 ? 252 TYR B CG  1 
ATOM 1947 C CD1 . TYR B 1 112 ? -3.123  51.386  5.937   1.00 45.92 ? 252 TYR B CD1 1 
ATOM 1948 C CD2 . TYR B 1 112 ? -5.169  51.989  4.849   1.00 46.90 ? 252 TYR B CD2 1 
ATOM 1949 C CE1 . TYR B 1 112 ? -3.507  50.049  5.923   1.00 45.67 ? 252 TYR B CE1 1 
ATOM 1950 C CE2 . TYR B 1 112 ? -5.561  50.655  4.834   1.00 45.69 ? 252 TYR B CE2 1 
ATOM 1951 C CZ  . TYR B 1 112 ? -4.727  49.694  5.372   1.00 46.48 ? 252 TYR B CZ  1 
ATOM 1952 O OH  . TYR B 1 112 ? -5.124  48.380  5.370   1.00 48.08 ? 252 TYR B OH  1 
ATOM 1953 N N   . ALA B 1 113 ? -2.678  56.608  4.003   1.00 45.33 ? 253 ALA B N   1 
ATOM 1954 C CA  . ALA B 1 113 ? -2.462  58.037  4.196   1.00 46.73 ? 253 ALA B CA  1 
ATOM 1955 C C   . ALA B 1 113 ? -3.415  58.468  5.315   1.00 48.07 ? 253 ALA B C   1 
ATOM 1956 O O   . ALA B 1 113 ? -4.447  57.831  5.529   1.00 49.43 ? 253 ALA B O   1 
ATOM 1957 C CB  . ALA B 1 113 ? -2.768  58.795  2.909   1.00 44.75 ? 253 ALA B CB  1 
ATOM 1958 N N   . GLU B 1 114 ? -3.081  59.540  6.026   1.00 48.19 ? 254 GLU B N   1 
ATOM 1959 C CA  . GLU B 1 114 ? -3.926  59.986  7.126   1.00 47.95 ? 254 GLU B CA  1 
ATOM 1960 C C   . GLU B 1 114 ? -3.531  61.369  7.631   1.00 49.22 ? 254 GLU B C   1 
ATOM 1961 O O   . GLU B 1 114 ? -2.466  61.881  7.290   1.00 48.99 ? 254 GLU B O   1 
ATOM 1962 C CB  . GLU B 1 114 ? -3.829  58.963  8.265   1.00 47.09 ? 254 GLU B CB  1 
ATOM 1963 C CG  . GLU B 1 114 ? -4.568  59.316  9.545   1.00 45.23 ? 254 GLU B CG  1 
ATOM 1964 C CD  . GLU B 1 114 ? -6.064  59.375  9.364   1.00 44.21 ? 254 GLU B CD  1 
ATOM 1965 O OE1 . GLU B 1 114 ? -6.555  60.332  8.729   1.00 43.33 ? 254 GLU B OE1 1 
ATOM 1966 O OE2 . GLU B 1 114 ? -6.748  58.456  9.856   1.00 44.42 ? 254 GLU B OE2 1 
ATOM 1967 N N   . ASN B 1 115 ? -4.405  61.971  8.434   1.00 50.91 ? 255 ASN B N   1 
ATOM 1968 C CA  . ASN B 1 115 ? -4.138  63.283  9.014   1.00 52.41 ? 255 ASN B CA  1 
ATOM 1969 C C   . ASN B 1 115 ? -3.039  63.070  10.048  1.00 52.72 ? 255 ASN B C   1 
ATOM 1970 O O   . ASN B 1 115 ? -3.205  62.293  10.991  1.00 53.27 ? 255 ASN B O   1 
ATOM 1971 C CB  . ASN B 1 115 ? -5.389  63.837  9.699   1.00 54.33 ? 255 ASN B CB  1 
ATOM 1972 C CG  . ASN B 1 115 ? -5.223  65.285  10.132  1.00 55.88 ? 255 ASN B CG  1 
ATOM 1973 O OD1 . ASN B 1 115 ? -4.102  65.773  10.300  1.00 56.03 ? 255 ASN B OD1 1 
ATOM 1974 N ND2 . ASN B 1 115 ? -6.342  65.976  10.328  1.00 55.54 ? 255 ASN B ND2 1 
ATOM 1975 N N   . CYS B 1 116 ? -1.923  63.768  9.872   1.00 52.50 ? 256 CYS B N   1 
ATOM 1976 C CA  . CYS B 1 116 ? -0.779  63.631  10.760  1.00 52.37 ? 256 CYS B CA  1 
ATOM 1977 C C   . CYS B 1 116 ? -1.020  63.996  12.221  1.00 53.52 ? 256 CYS B C   1 
ATOM 1978 O O   . CYS B 1 116 ? -0.216  63.640  13.076  1.00 55.42 ? 256 CYS B O   1 
ATOM 1979 C CB  . CYS B 1 116 ? 0.389   64.450  10.225  1.00 49.74 ? 256 CYS B CB  1 
ATOM 1980 S SG  . CYS B 1 116 ? 0.628   64.296  8.426   1.00 48.04 ? 256 CYS B SG  1 
ATOM 1981 N N   . ILE B 1 117 ? -2.107  64.698  12.525  1.00 54.34 ? 257 ILE B N   1 
ATOM 1982 C CA  . ILE B 1 117 ? -2.369  65.056  13.918  1.00 55.59 ? 257 ILE B CA  1 
ATOM 1983 C C   . ILE B 1 117 ? -2.853  63.843  14.705  1.00 56.03 ? 257 ILE B C   1 
ATOM 1984 O O   . ILE B 1 117 ? -2.776  63.816  15.935  1.00 56.73 ? 257 ILE B O   1 
ATOM 1985 C CB  . ILE B 1 117 ? -3.438  66.179  14.051  1.00 55.77 ? 257 ILE B CB  1 
ATOM 1986 C CG1 . ILE B 1 117 ? -4.739  65.761  13.360  1.00 55.40 ? 257 ILE B CG1 1 
ATOM 1987 C CG2 . ILE B 1 117 ? -2.902  67.484  13.483  1.00 54.85 ? 257 ILE B CG2 1 
ATOM 1988 C CD1 . ILE B 1 117 ? -5.867  66.772  13.518  1.00 54.99 ? 257 ILE B CD1 1 
ATOM 1989 N N   . LEU B 1 118 ? -3.342  62.834  13.990  1.00 56.10 ? 258 LEU B N   1 
ATOM 1990 C CA  . LEU B 1 118 ? -3.856  61.634  14.635  1.00 56.39 ? 258 LEU B CA  1 
ATOM 1991 C C   . LEU B 1 118 ? -2.759  60.733  15.182  1.00 56.05 ? 258 LEU B C   1 
ATOM 1992 O O   . LEU B 1 118 ? -1.854  60.325  14.458  1.00 57.07 ? 258 LEU B O   1 
ATOM 1993 C CB  . LEU B 1 118 ? -4.764  60.870  13.666  1.00 56.10 ? 258 LEU B CB  1 
ATOM 1994 C CG  . LEU B 1 118 ? -6.034  61.667  13.318  1.00 57.06 ? 258 LEU B CG  1 
ATOM 1995 C CD1 . LEU B 1 118 ? -6.938  60.853  12.398  1.00 56.56 ? 258 LEU B CD1 1 
ATOM 1996 C CD2 . LEU B 1 118 ? -6.779  62.048  14.606  1.00 54.72 ? 258 LEU B CD2 1 
ATOM 1997 N N   . ALA B 1 119 ? -2.863  60.434  16.474  1.00 55.09 ? 259 ALA B N   1 
ATOM 1998 C CA  . ALA B 1 119 ? -1.898  59.605  17.191  1.00 53.64 ? 259 ALA B CA  1 
ATOM 1999 C C   . ALA B 1 119 ? -1.828  58.141  16.767  1.00 52.77 ? 259 ALA B C   1 
ATOM 2000 O O   . ALA B 1 119 ? -2.840  57.514  16.464  1.00 52.18 ? 259 ALA B O   1 
ATOM 2001 C CB  . ALA B 1 119 ? -2.177  59.684  18.681  1.00 54.47 ? 259 ALA B CB  1 
ATOM 2002 N N   . ALA B 1 120 ? -0.613  57.606  16.775  1.00 52.46 ? 260 ALA B N   1 
ATOM 2003 C CA  . ALA B 1 120 ? -0.358  56.218  16.412  1.00 52.44 ? 260 ALA B CA  1 
ATOM 2004 C C   . ALA B 1 120 ? 1.089   55.894  16.748  1.00 51.99 ? 260 ALA B C   1 
ATOM 2005 O O   . ALA B 1 120 ? 1.883   56.791  17.025  1.00 51.80 ? 260 ALA B O   1 
ATOM 2006 C CB  . ALA B 1 120 ? -0.604  56.005  14.920  1.00 52.10 ? 260 ALA B CB  1 
ATOM 2007 N N   . PHE B 1 121 ? 1.428   54.611  16.737  1.00 51.77 ? 261 PHE B N   1 
ATOM 2008 C CA  . PHE B 1 121 ? 2.797   54.209  17.017  1.00 52.15 ? 261 PHE B CA  1 
ATOM 2009 C C   . PHE B 1 121 ? 3.636   54.486  15.782  1.00 50.47 ? 261 PHE B C   1 
ATOM 2010 O O   . PHE B 1 121 ? 3.164   55.098  14.822  1.00 50.36 ? 261 PHE B O   1 
ATOM 2011 C CB  . PHE B 1 121 ? 2.871   52.723  17.361  1.00 54.39 ? 261 PHE B CB  1 
ATOM 2012 C CG  . PHE B 1 121 ? 2.140   52.360  18.613  1.00 56.76 ? 261 PHE B CG  1 
ATOM 2013 C CD1 . PHE B 1 121 ? 2.521   52.903  19.834  1.00 58.55 ? 261 PHE B CD1 1 
ATOM 2014 C CD2 . PHE B 1 121 ? 1.062   51.486  18.572  1.00 58.57 ? 261 PHE B CD2 1 
ATOM 2015 C CE1 . PHE B 1 121 ? 1.836   52.584  20.999  1.00 59.31 ? 261 PHE B CE1 1 
ATOM 2016 C CE2 . PHE B 1 121 ? 0.370   51.158  19.729  1.00 59.78 ? 261 PHE B CE2 1 
ATOM 2017 C CZ  . PHE B 1 121 ? 0.757   51.709  20.946  1.00 59.94 ? 261 PHE B CZ  1 
ATOM 2018 N N   . SER B 1 122 ? 4.881   54.030  15.807  1.00 47.76 ? 262 SER B N   1 
ATOM 2019 C CA  . SER B 1 122 ? 5.771   54.244  14.683  1.00 45.63 ? 262 SER B CA  1 
ATOM 2020 C C   . SER B 1 122 ? 7.006   53.384  14.812  1.00 43.84 ? 262 SER B C   1 
ATOM 2021 O O   . SER B 1 122 ? 7.205   52.694  15.810  1.00 43.51 ? 262 SER B O   1 
ATOM 2022 C CB  . SER B 1 122 ? 6.190   55.710  14.610  1.00 47.06 ? 262 SER B CB  1 
ATOM 2023 O OG  . SER B 1 122 ? 6.914   56.091  15.768  1.00 47.81 ? 262 SER B OG  1 
ATOM 2024 N N   . ILE B 1 123 ? 7.837   53.436  13.785  1.00 41.27 ? 263 ILE B N   1 
ATOM 2025 C CA  . ILE B 1 123 ? 9.064   52.672  13.767  1.00 39.95 ? 263 ILE B CA  1 
ATOM 2026 C C   . ILE B 1 123 ? 10.190  53.645  13.470  1.00 40.14 ? 263 ILE B C   1 
ATOM 2027 O O   . ILE B 1 123 ? 10.030  54.552  12.654  1.00 41.81 ? 263 ILE B O   1 
ATOM 2028 C CB  . ILE B 1 123 ? 9.021   51.585  12.674  1.00 39.05 ? 263 ILE B CB  1 
ATOM 2029 C CG1 . ILE B 1 123 ? 7.853   50.631  12.938  1.00 37.22 ? 263 ILE B CG1 1 
ATOM 2030 C CG2 . ILE B 1 123 ? 10.333  50.815  12.649  1.00 39.61 ? 263 ILE B CG2 1 
ATOM 2031 C CD1 . ILE B 1 123 ? 7.679   49.569  11.878  1.00 38.16 ? 263 ILE B CD1 1 
ATOM 2032 N N   . CYS B 1 124 ? 11.317  53.468  14.153  1.00 38.85 ? 264 CYS B N   1 
ATOM 2033 C CA  . CYS B 1 124 ? 12.482  54.320  13.952  1.00 37.12 ? 264 CYS B CA  1 
ATOM 2034 C C   . CYS B 1 124 ? 13.628  53.466  13.440  1.00 36.92 ? 264 CYS B C   1 
ATOM 2035 O O   . CYS B 1 124 ? 13.650  52.253  13.662  1.00 35.83 ? 264 CYS B O   1 
ATOM 2036 C CB  . CYS B 1 124 ? 12.930  54.963  15.260  1.00 37.19 ? 264 CYS B CB  1 
ATOM 2037 S SG  . CYS B 1 124 ? 11.748  56.060  16.094  1.00 39.08 ? 264 CYS B SG  1 
ATOM 2038 N N   . GLN B 1 125 ? 14.582  54.103  12.764  1.00 36.12 ? 265 GLN B N   1 
ATOM 2039 C CA  . GLN B 1 125 ? 15.740  53.392  12.248  1.00 36.27 ? 265 GLN B CA  1 
ATOM 2040 C C   . GLN B 1 125 ? 16.990  54.262  12.165  1.00 38.18 ? 265 GLN B C   1 
ATOM 2041 O O   . GLN B 1 125 ? 16.911  55.489  12.165  1.00 38.11 ? 265 GLN B O   1 
ATOM 2042 C CB  . GLN B 1 125 ? 15.433  52.788  10.870  1.00 34.48 ? 265 GLN B CB  1 
ATOM 2043 C CG  . GLN B 1 125 ? 15.365  53.761  9.701   1.00 31.42 ? 265 GLN B CG  1 
ATOM 2044 C CD  . GLN B 1 125 ? 15.119  53.044  8.378   1.00 31.33 ? 265 GLN B CD  1 
ATOM 2045 O OE1 . GLN B 1 125 ? 13.999  52.629  8.079   1.00 31.31 ? 265 GLN B OE1 1 
ATOM 2046 N NE2 . GLN B 1 125 ? 16.173  52.880  7.589   1.00 30.83 ? 265 GLN B NE2 1 
ATOM 2047 N N   . LYS B 1 126 ? 18.142  53.602  12.116  1.00 40.12 ? 266 LYS B N   1 
ATOM 2048 C CA  . LYS B 1 126 ? 19.438  54.262  12.004  1.00 42.90 ? 266 LYS B CA  1 
ATOM 2049 C C   . LYS B 1 126 ? 20.461  53.218  11.569  1.00 45.14 ? 266 LYS B C   1 
ATOM 2050 O O   . LYS B 1 126 ? 20.430  52.083  12.041  1.00 46.71 ? 266 LYS B O   1 
ATOM 2051 C CB  . LYS B 1 126 ? 19.846  54.897  13.338  1.00 42.17 ? 266 LYS B CB  1 
ATOM 2052 C CG  . LYS B 1 126 ? 19.950  53.946  14.517  1.00 42.64 ? 266 LYS B CG  1 
ATOM 2053 C CD  . LYS B 1 126 ? 20.306  54.725  15.778  1.00 44.28 ? 266 LYS B CD  1 
ATOM 2054 C CE  . LYS B 1 126 ? 20.416  53.841  17.010  1.00 44.85 ? 266 LYS B CE  1 
ATOM 2055 N NZ  . LYS B 1 126 ? 20.641  54.653  18.244  1.00 44.64 ? 266 LYS B NZ  1 
ATOM 2056 N N   . LYS B 1 127 ? 21.351  53.596  10.655  1.00 47.84 ? 267 LYS B N   1 
ATOM 2057 C CA  . LYS B 1 127 ? 22.364  52.674  10.152  1.00 50.11 ? 267 LYS B CA  1 
ATOM 2058 C C   . LYS B 1 127 ? 22.987  51.859  11.273  1.00 51.37 ? 267 LYS B C   1 
ATOM 2059 O O   . LYS B 1 127 ? 23.174  52.351  12.385  1.00 51.86 ? 267 LYS B O   1 
ATOM 2060 C CB  . LYS B 1 127 ? 23.458  53.432  9.395   1.00 50.73 ? 267 LYS B CB  1 
ATOM 2061 C CG  . LYS B 1 127 ? 22.984  54.081  8.101   1.00 53.31 ? 267 LYS B CG  1 
ATOM 2062 C CD  . LYS B 1 127 ? 24.139  54.719  7.341   1.00 55.34 ? 267 LYS B CD  1 
ATOM 2063 C CE  . LYS B 1 127 ? 24.804  55.827  8.150   1.00 56.23 ? 267 LYS B CE  1 
ATOM 2064 N NZ  . LYS B 1 127 ? 23.851  56.922  8.476   1.00 55.70 ? 267 LYS B NZ  1 
ATOM 2065 N N   . ALA B 1 128 ? 23.296  50.605  10.972  1.00 52.75 ? 268 ALA B N   1 
ATOM 2066 C CA  . ALA B 1 128 ? 23.895  49.712  11.947  1.00 54.95 ? 268 ALA B CA  1 
ATOM 2067 C C   . ALA B 1 128 ? 25.386  49.979  12.083  1.00 57.10 ? 268 ALA B C   1 
ATOM 2068 O O   . ALA B 1 128 ? 26.096  50.128  11.087  1.00 57.06 ? 268 ALA B O   1 
ATOM 2069 C CB  . ALA B 1 128 ? 23.662  48.270  11.536  1.00 55.34 ? 268 ALA B CB  1 
ATOM 2070 N N   . ASN B 1 129 ? 25.850  50.041  13.325  1.00 59.25 ? 269 ASN B N   1 
ATOM 2071 C CA  . ASN B 1 129 ? 27.257  50.271  13.613  1.00 60.95 ? 269 ASN B CA  1 
ATOM 2072 C C   . ASN B 1 129 ? 28.015  48.982  13.309  1.00 61.81 ? 269 ASN B C   1 
ATOM 2073 O O   . ASN B 1 129 ? 27.881  47.993  14.024  1.00 62.00 ? 269 ASN B O   1 
ATOM 2074 C CB  . ASN B 1 129 ? 27.430  50.640  15.085  1.00 61.93 ? 269 ASN B CB  1 
ATOM 2075 C CG  . ASN B 1 129 ? 28.844  51.045  15.420  1.00 63.59 ? 269 ASN B CG  1 
ATOM 2076 O OD1 . ASN B 1 129 ? 29.801  50.357  15.065  1.00 64.71 ? 269 ASN B OD1 1 
ATOM 2077 N ND2 . ASN B 1 129 ? 28.988  52.166  16.116  1.00 64.13 ? 269 ASN B ND2 1 
ATOM 2078 N N   . LEU B 1 130 ? 28.809  48.995  12.246  1.00 63.66 ? 270 LEU B N   1 
ATOM 2079 C CA  . LEU B 1 130 ? 29.561  47.810  11.857  1.00 65.76 ? 270 LEU B CA  1 
ATOM 2080 C C   . LEU B 1 130 ? 31.063  47.973  12.086  1.00 67.62 ? 270 LEU B C   1 
ATOM 2081 O O   . LEU B 1 130 ? 31.878  47.320  11.430  1.00 66.88 ? 270 LEU B O   1 
ATOM 2082 C CB  . LEU B 1 130 ? 29.274  47.480  10.389  1.00 65.39 ? 270 LEU B CB  1 
ATOM 2083 C CG  . LEU B 1 130 ? 27.795  47.228  10.068  1.00 65.04 ? 270 LEU B CG  1 
ATOM 2084 C CD1 . LEU B 1 130 ? 27.584  47.172  8.565   1.00 64.99 ? 270 LEU B CD1 1 
ATOM 2085 C CD2 . LEU B 1 130 ? 27.344  45.935  10.725  1.00 64.33 ? 270 LEU B CD2 1 
ATOM 2086 N N   . ARG B 1 131 ? 31.423  48.847  13.022  1.00 69.56 ? 271 ARG B N   1 
ATOM 2087 C CA  . ARG B 1 131 ? 32.824  49.078  13.351  1.00 71.18 ? 271 ARG B CA  1 
ATOM 2088 C C   . ARG B 1 131 ? 33.161  48.405  14.680  1.00 71.20 ? 271 ARG B C   1 
ATOM 2089 O O   . ARG B 1 131 ? 32.644  48.789  15.730  1.00 71.95 ? 271 ARG B O   1 
ATOM 2090 C CB  . ARG B 1 131 ? 33.117  50.580  13.432  1.00 72.44 ? 271 ARG B CB  1 
ATOM 2091 C CG  . ARG B 1 131 ? 34.544  50.904  13.856  1.00 74.13 ? 271 ARG B CG  1 
ATOM 2092 C CD  . ARG B 1 131 ? 34.874  52.381  13.688  1.00 75.81 ? 271 ARG B CD  1 
ATOM 2093 N NE  . ARG B 1 131 ? 34.929  52.782  12.284  1.00 76.30 ? 271 ARG B NE  1 
ATOM 2094 C CZ  . ARG B 1 131 ? 35.358  53.968  11.861  1.00 76.31 ? 271 ARG B CZ  1 
ATOM 2095 N NH1 . ARG B 1 131 ? 35.773  54.876  12.735  1.00 76.76 ? 271 ARG B NH1 1 
ATOM 2096 N NH2 . ARG B 1 131 ? 35.375  54.246  10.566  1.00 75.35 ? 271 ARG B NH2 1 
ATOM 2097 N N   . ALA B 1 132 ? 34.023  47.393  14.622  1.00 70.87 ? 272 ALA B N   1 
ATOM 2098 C CA  . ALA B 1 132 ? 34.433  46.653  15.811  1.00 70.20 ? 272 ALA B CA  1 
ATOM 2099 C C   . ALA B 1 132 ? 35.099  47.572  16.833  1.00 70.28 ? 272 ALA B C   1 
ATOM 2100 O O   . ALA B 1 132 ? 34.522  47.745  17.928  1.00 70.42 ? 272 ALA B O   1 
ATOM 2101 C CB  . ALA B 1 132 ? 35.384  45.527  15.417  1.00 68.68 ? 272 ALA B CB  1 
ATOM 2102 O OXT . ALA B 1 132 ? 36.186  48.109  16.527  1.00 69.74 ? 272 ALA B OXT 1 
ATOM 2103 N N   . MET C 1 1   ? -10.278 -6.746  54.047  1.00 59.21 ? 141 MET C N   1 
ATOM 2104 C CA  . MET C 1 1   ? -10.249 -5.931  55.297  1.00 58.96 ? 141 MET C CA  1 
ATOM 2105 C C   . MET C 1 1   ? -8.841  -5.440  55.600  1.00 57.30 ? 141 MET C C   1 
ATOM 2106 O O   . MET C 1 1   ? -8.186  -5.931  56.520  1.00 57.03 ? 141 MET C O   1 
ATOM 2107 C CB  . MET C 1 1   ? -10.759 -6.756  56.483  1.00 61.81 ? 141 MET C CB  1 
ATOM 2108 C CG  . MET C 1 1   ? -12.259 -6.997  56.485  1.00 65.87 ? 141 MET C CG  1 
ATOM 2109 S SD  . MET C 1 1   ? -13.208 -5.518  56.894  1.00 71.20 ? 141 MET C SD  1 
ATOM 2110 C CE  . MET C 1 1   ? -13.616 -5.852  58.612  1.00 68.12 ? 141 MET C CE  1 
ATOM 2111 N N   . ALA C 1 2   ? -8.375  -4.469  54.822  1.00 55.43 ? 142 ALA C N   1 
ATOM 2112 C CA  . ALA C 1 2   ? -7.044  -3.914  55.026  1.00 52.11 ? 142 ALA C CA  1 
ATOM 2113 C C   . ALA C 1 2   ? -7.087  -2.927  56.185  1.00 49.74 ? 142 ALA C C   1 
ATOM 2114 O O   . ALA C 1 2   ? -8.130  -2.343  56.483  1.00 46.67 ? 142 ALA C O   1 
ATOM 2115 C CB  . ALA C 1 2   ? -6.560  -3.219  53.758  1.00 51.76 ? 142 ALA C CB  1 
ATOM 2116 N N   . PRO C 1 3   ? -5.951  -2.740  56.865  1.00 49.26 ? 143 PRO C N   1 
ATOM 2117 C CA  . PRO C 1 3   ? -5.884  -1.813  57.997  1.00 49.58 ? 143 PRO C CA  1 
ATOM 2118 C C   . PRO C 1 3   ? -6.320  -0.412  57.588  1.00 49.57 ? 143 PRO C C   1 
ATOM 2119 O O   . PRO C 1 3   ? -7.131  0.224   58.264  1.00 50.15 ? 143 PRO C O   1 
ATOM 2120 C CB  . PRO C 1 3   ? -4.412  -1.866  58.395  1.00 49.20 ? 143 PRO C CB  1 
ATOM 2121 C CG  . PRO C 1 3   ? -4.027  -3.263  58.037  1.00 49.63 ? 143 PRO C CG  1 
ATOM 2122 C CD  . PRO C 1 3   ? -4.668  -3.441  56.685  1.00 48.86 ? 143 PRO C CD  1 
ATOM 2123 N N   . CYS C 1 4   ? -5.784  0.057   56.466  1.00 48.30 ? 144 CYS C N   1 
ATOM 2124 C CA  . CYS C 1 4   ? -6.107  1.384   55.972  1.00 45.65 ? 144 CYS C CA  1 
ATOM 2125 C C   . CYS C 1 4   ? -6.330  1.378   54.477  1.00 45.27 ? 144 CYS C C   1 
ATOM 2126 O O   . CYS C 1 4   ? -5.886  0.465   53.780  1.00 44.54 ? 144 CYS C O   1 
ATOM 2127 C CB  . CYS C 1 4   ? -4.966  2.347   56.278  1.00 44.99 ? 144 CYS C CB  1 
ATOM 2128 S SG  . CYS C 1 4   ? -4.485  2.417   58.025  1.00 42.32 ? 144 CYS C SG  1 
ATOM 2129 N N   . PRO C 1 5   ? -7.033  2.400   53.963  1.00 45.63 ? 145 PRO C N   1 
ATOM 2130 C CA  . PRO C 1 5   ? -7.290  2.488   52.526  1.00 44.97 ? 145 PRO C CA  1 
ATOM 2131 C C   . PRO C 1 5   ? -5.944  2.721   51.851  1.00 44.51 ? 145 PRO C C   1 
ATOM 2132 O O   . PRO C 1 5   ? -4.915  2.806   52.524  1.00 45.06 ? 145 PRO C O   1 
ATOM 2133 C CB  . PRO C 1 5   ? -8.209  3.704   52.413  1.00 43.84 ? 145 PRO C CB  1 
ATOM 2134 C CG  . PRO C 1 5   ? -8.929  3.715   53.730  1.00 43.02 ? 145 PRO C CG  1 
ATOM 2135 C CD  . PRO C 1 5   ? -7.804  3.424   54.692  1.00 45.47 ? 145 PRO C CD  1 
ATOM 2136 N N   . GLN C 1 6   ? -5.944  2.816   50.530  1.00 44.41 ? 146 GLN C N   1 
ATOM 2137 C CA  . GLN C 1 6   ? -4.708  3.054   49.801  1.00 43.15 ? 146 GLN C CA  1 
ATOM 2138 C C   . GLN C 1 6   ? -4.388  4.536   49.909  1.00 42.28 ? 146 GLN C C   1 
ATOM 2139 O O   . GLN C 1 6   ? -5.264  5.332   50.234  1.00 41.61 ? 146 GLN C O   1 
ATOM 2140 C CB  . GLN C 1 6   ? -4.878  2.631   48.345  1.00 44.04 ? 146 GLN C CB  1 
ATOM 2141 C CG  . GLN C 1 6   ? -5.077  1.132   48.190  1.00 45.13 ? 146 GLN C CG  1 
ATOM 2142 C CD  . GLN C 1 6   ? -5.588  0.739   46.827  1.00 45.08 ? 146 GLN C CD  1 
ATOM 2143 O OE1 . GLN C 1 6   ? -5.000  1.089   45.802  1.00 45.28 ? 146 GLN C OE1 1 
ATOM 2144 N NE2 . GLN C 1 6   ? -6.690  -0.003  46.806  1.00 44.61 ? 146 GLN C NE2 1 
ATOM 2145 N N   . ASP C 1 7   ? -3.135  4.901   49.656  1.00 42.90 ? 147 ASP C N   1 
ATOM 2146 C CA  . ASP C 1 7   ? -2.701  6.294   49.751  1.00 44.45 ? 147 ASP C CA  1 
ATOM 2147 C C   . ASP C 1 7   ? -2.441  6.727   51.194  1.00 44.29 ? 147 ASP C C   1 
ATOM 2148 O O   . ASP C 1 7   ? -1.558  7.548   51.446  1.00 43.82 ? 147 ASP C O   1 
ATOM 2149 C CB  . ASP C 1 7   ? -3.740  7.221   49.122  1.00 45.12 ? 147 ASP C CB  1 
ATOM 2150 C CG  . ASP C 1 7   ? -3.602  7.317   47.620  1.00 46.07 ? 147 ASP C CG  1 
ATOM 2151 O OD1 . ASP C 1 7   ? -3.209  6.312   46.983  1.00 42.94 ? 147 ASP C OD1 1 
ATOM 2152 O OD2 . ASP C 1 7   ? -3.902  8.405   47.083  1.00 47.11 ? 147 ASP C OD2 1 
ATOM 2153 N N   . TRP C 1 8   ? -3.211  6.181   52.134  1.00 43.83 ? 148 TRP C N   1 
ATOM 2154 C CA  . TRP C 1 8   ? -3.048  6.509   53.550  1.00 43.46 ? 148 TRP C CA  1 
ATOM 2155 C C   . TRP C 1 8   ? -1.820  5.811   54.126  1.00 43.46 ? 148 TRP C C   1 
ATOM 2156 O O   . TRP C 1 8   ? -1.066  5.159   53.405  1.00 43.72 ? 148 TRP C O   1 
ATOM 2157 C CB  . TRP C 1 8   ? -4.284  6.081   54.355  1.00 42.70 ? 148 TRP C CB  1 
ATOM 2158 C CG  . TRP C 1 8   ? -5.554  6.798   53.987  1.00 41.64 ? 148 TRP C CG  1 
ATOM 2159 C CD1 . TRP C 1 8   ? -6.201  6.758   52.786  1.00 41.85 ? 148 TRP C CD1 1 
ATOM 2160 C CD2 . TRP C 1 8   ? -6.338  7.643   54.837  1.00 39.30 ? 148 TRP C CD2 1 
ATOM 2161 N NE1 . TRP C 1 8   ? -7.340  7.523   52.836  1.00 40.86 ? 148 TRP C NE1 1 
ATOM 2162 C CE2 . TRP C 1 8   ? -7.449  8.078   54.081  1.00 38.95 ? 148 TRP C CE2 1 
ATOM 2163 C CE3 . TRP C 1 8   ? -6.211  8.075   56.163  1.00 39.16 ? 148 TRP C CE3 1 
ATOM 2164 C CZ2 . TRP C 1 8   ? -8.426  8.923   54.608  1.00 37.75 ? 148 TRP C CZ2 1 
ATOM 2165 C CZ3 . TRP C 1 8   ? -7.183  8.914   56.686  1.00 37.63 ? 148 TRP C CZ3 1 
ATOM 2166 C CH2 . TRP C 1 8   ? -8.277  9.329   55.907  1.00 37.40 ? 148 TRP C CH2 1 
ATOM 2167 N N   . ILE C 1 9   ? -1.623  5.965   55.431  1.00 44.19 ? 149 ILE C N   1 
ATOM 2168 C CA  . ILE C 1 9   ? -0.508  5.334   56.130  1.00 44.33 ? 149 ILE C CA  1 
ATOM 2169 C C   . ILE C 1 9   ? -1.050  4.608   57.356  1.00 45.85 ? 149 ILE C C   1 
ATOM 2170 O O   . ILE C 1 9   ? -1.858  5.160   58.108  1.00 46.76 ? 149 ILE C O   1 
ATOM 2171 C CB  . ILE C 1 9   ? 0.538   6.360   56.605  1.00 42.78 ? 149 ILE C CB  1 
ATOM 2172 C CG1 . ILE C 1 9   ? 1.195   7.035   55.403  1.00 43.75 ? 149 ILE C CG1 1 
ATOM 2173 C CG2 . ILE C 1 9   ? 1.594   5.665   57.444  1.00 40.89 ? 149 ILE C CG2 1 
ATOM 2174 C CD1 . ILE C 1 9   ? 2.254   8.056   55.777  1.00 44.89 ? 149 ILE C CD1 1 
ATOM 2175 N N   . TRP C 1 10  ? -0.615  3.367   57.549  1.00 46.26 ? 150 TRP C N   1 
ATOM 2176 C CA  . TRP C 1 10  ? -1.059  2.582   58.693  1.00 46.41 ? 150 TRP C CA  1 
ATOM 2177 C C   . TRP C 1 10  ? 0.002   2.572   59.784  1.00 46.26 ? 150 TRP C C   1 
ATOM 2178 O O   . TRP C 1 10  ? 1.116   2.083   59.585  1.00 46.38 ? 150 TRP C O   1 
ATOM 2179 C CB  . TRP C 1 10  ? -1.387  1.149   58.266  1.00 47.13 ? 150 TRP C CB  1 
ATOM 2180 C CG  . TRP C 1 10  ? -1.669  0.225   59.419  1.00 47.61 ? 150 TRP C CG  1 
ATOM 2181 C CD1 . TRP C 1 10  ? -2.511  0.454   60.471  1.00 48.04 ? 150 TRP C CD1 1 
ATOM 2182 C CD2 . TRP C 1 10  ? -1.106  -1.072  59.631  1.00 47.59 ? 150 TRP C CD2 1 
ATOM 2183 N NE1 . TRP C 1 10  ? -2.505  -0.623  61.325  1.00 47.34 ? 150 TRP C NE1 1 
ATOM 2184 C CE2 . TRP C 1 10  ? -1.652  -1.574  60.832  1.00 48.02 ? 150 TRP C CE2 1 
ATOM 2185 C CE3 . TRP C 1 10  ? -0.194  -1.863  58.919  1.00 47.59 ? 150 TRP C CE3 1 
ATOM 2186 C CZ2 . TRP C 1 10  ? -1.311  -2.829  61.341  1.00 48.47 ? 150 TRP C CZ2 1 
ATOM 2187 C CZ3 . TRP C 1 10  ? 0.144   -3.108  59.425  1.00 47.58 ? 150 TRP C CZ3 1 
ATOM 2188 C CH2 . TRP C 1 10  ? -0.415  -3.580  60.624  1.00 48.19 ? 150 TRP C CH2 1 
ATOM 2189 N N   . HIS C 1 11  ? -0.350  3.123   60.938  1.00 45.79 ? 151 HIS C N   1 
ATOM 2190 C CA  . HIS C 1 11  ? 0.572   3.188   62.061  1.00 46.13 ? 151 HIS C CA  1 
ATOM 2191 C C   . HIS C 1 11  ? -0.190  2.977   63.363  1.00 46.25 ? 151 HIS C C   1 
ATOM 2192 O O   . HIS C 1 11  ? -1.098  3.748   63.692  1.00 46.25 ? 151 HIS C O   1 
ATOM 2193 C CB  . HIS C 1 11  ? 1.268   4.546   62.082  1.00 45.59 ? 151 HIS C CB  1 
ATOM 2194 C CG  . HIS C 1 11  ? 2.245   4.703   63.202  1.00 43.03 ? 151 HIS C CG  1 
ATOM 2195 N ND1 . HIS C 1 11  ? 3.516   4.175   63.161  1.00 41.23 ? 151 HIS C ND1 1 
ATOM 2196 C CD2 . HIS C 1 11  ? 2.127   5.311   64.406  1.00 41.51 ? 151 HIS C CD2 1 
ATOM 2197 C CE1 . HIS C 1 11  ? 4.141   4.451   64.291  1.00 41.42 ? 151 HIS C CE1 1 
ATOM 2198 N NE2 . HIS C 1 11  ? 3.319   5.139   65.063  1.00 42.34 ? 151 HIS C NE2 1 
ATOM 2199 N N   . GLY C 1 12  ? 0.186   1.935   64.100  1.00 45.20 ? 152 GLY C N   1 
ATOM 2200 C CA  . GLY C 1 12  ? -0.494  1.636   65.346  1.00 44.26 ? 152 GLY C CA  1 
ATOM 2201 C C   . GLY C 1 12  ? -1.914  1.181   65.069  1.00 43.65 ? 152 GLY C C   1 
ATOM 2202 O O   . GLY C 1 12  ? -2.143  0.283   64.258  1.00 43.91 ? 152 GLY C O   1 
ATOM 2203 N N   . GLU C 1 13  ? -2.875  1.805   65.736  1.00 42.82 ? 153 GLU C N   1 
ATOM 2204 C CA  . GLU C 1 13  ? -4.271  1.454   65.547  1.00 44.01 ? 153 GLU C CA  1 
ATOM 2205 C C   . GLU C 1 13  ? -4.955  2.498   64.682  1.00 43.73 ? 153 GLU C C   1 
ATOM 2206 O O   . GLU C 1 13  ? -6.181  2.527   64.580  1.00 44.35 ? 153 GLU C O   1 
ATOM 2207 C CB  . GLU C 1 13  ? -4.967  1.362   66.902  1.00 46.09 ? 153 GLU C CB  1 
ATOM 2208 C CG  . GLU C 1 13  ? -4.556  0.146   67.706  1.00 48.78 ? 153 GLU C CG  1 
ATOM 2209 C CD  . GLU C 1 13  ? -4.929  0.261   69.164  1.00 51.14 ? 153 GLU C CD  1 
ATOM 2210 O OE1 . GLU C 1 13  ? -6.093  0.608   69.461  1.00 51.79 ? 153 GLU C OE1 1 
ATOM 2211 O OE2 . GLU C 1 13  ? -4.053  -0.001  70.013  1.00 52.86 ? 153 GLU C OE2 1 
ATOM 2212 N N   . ASN C 1 14  ? -4.156  3.347   64.045  1.00 43.30 ? 154 ASN C N   1 
ATOM 2213 C CA  . ASN C 1 14  ? -4.707  4.402   63.209  1.00 41.98 ? 154 ASN C CA  1 
ATOM 2214 C C   . ASN C 1 14  ? -4.249  4.418   61.760  1.00 41.12 ? 154 ASN C C   1 
ATOM 2215 O O   . ASN C 1 14  ? -3.420  3.609   61.332  1.00 40.14 ? 154 ASN C O   1 
ATOM 2216 C CB  . ASN C 1 14  ? -4.413  5.764   63.836  1.00 41.98 ? 154 ASN C CB  1 
ATOM 2217 C CG  . ASN C 1 14  ? -5.248  6.026   65.068  1.00 42.04 ? 154 ASN C CG  1 
ATOM 2218 O OD1 . ASN C 1 14  ? -6.478  6.029   65.009  1.00 40.11 ? 154 ASN C OD1 1 
ATOM 2219 N ND2 . ASN C 1 14  ? -4.585  6.249   66.195  1.00 41.16 ? 154 ASN C ND2 1 
ATOM 2220 N N   . CYS C 1 15  ? -4.820  5.360   61.017  1.00 40.47 ? 155 CYS C N   1 
ATOM 2221 C CA  . CYS C 1 15  ? -4.516  5.562   59.610  1.00 40.02 ? 155 CYS C CA  1 
ATOM 2222 C C   . CYS C 1 15  ? -4.338  7.056   59.412  1.00 39.34 ? 155 CYS C C   1 
ATOM 2223 O O   . CYS C 1 15  ? -5.175  7.848   59.857  1.00 39.63 ? 155 CYS C O   1 
ATOM 2224 C CB  . CYS C 1 15  ? -5.674  5.084   58.736  1.00 41.41 ? 155 CYS C CB  1 
ATOM 2225 S SG  . CYS C 1 15  ? -6.081  3.321   58.889  1.00 42.76 ? 155 CYS C SG  1 
ATOM 2226 N N   . TYR C 1 16  ? -3.255  7.445   58.751  1.00 37.58 ? 156 TYR C N   1 
ATOM 2227 C CA  . TYR C 1 16  ? -3.005  8.856   58.510  1.00 35.72 ? 156 TYR C CA  1 
ATOM 2228 C C   . TYR C 1 16  ? -2.897  9.171   57.028  1.00 34.79 ? 156 TYR C C   1 
ATOM 2229 O O   . TYR C 1 16  ? -2.419  8.361   56.235  1.00 33.43 ? 156 TYR C O   1 
ATOM 2230 C CB  . TYR C 1 16  ? -1.731  9.304   59.225  1.00 35.10 ? 156 TYR C CB  1 
ATOM 2231 C CG  . TYR C 1 16  ? -1.737  8.967   60.692  1.00 36.95 ? 156 TYR C CG  1 
ATOM 2232 C CD1 . TYR C 1 16  ? -1.312  7.719   61.141  1.00 36.91 ? 156 TYR C CD1 1 
ATOM 2233 C CD2 . TYR C 1 16  ? -2.236  9.869   61.628  1.00 38.10 ? 156 TYR C CD2 1 
ATOM 2234 C CE1 . TYR C 1 16  ? -1.389  7.378   62.484  1.00 38.12 ? 156 TYR C CE1 1 
ATOM 2235 C CE2 . TYR C 1 16  ? -2.319  9.537   62.971  1.00 36.83 ? 156 TYR C CE2 1 
ATOM 2236 C CZ  . TYR C 1 16  ? -1.897  8.290   63.392  1.00 37.76 ? 156 TYR C CZ  1 
ATOM 2237 O OH  . TYR C 1 16  ? -1.999  7.955   64.720  1.00 39.21 ? 156 TYR C OH  1 
ATOM 2238 N N   . LEU C 1 17  ? -3.368  10.356  56.666  1.00 33.54 ? 157 LEU C N   1 
ATOM 2239 C CA  . LEU C 1 17  ? -3.317  10.822  55.294  1.00 31.66 ? 157 LEU C CA  1 
ATOM 2240 C C   . LEU C 1 17  ? -2.797  12.246  55.305  1.00 33.30 ? 157 LEU C C   1 
ATOM 2241 O O   . LEU C 1 17  ? -3.275  13.079  56.066  1.00 32.18 ? 157 LEU C O   1 
ATOM 2242 C CB  . LEU C 1 17  ? -4.706  10.803  54.662  1.00 28.06 ? 157 LEU C CB  1 
ATOM 2243 C CG  . LEU C 1 17  ? -4.763  11.273  53.205  1.00 26.26 ? 157 LEU C CG  1 
ATOM 2244 C CD1 . LEU C 1 17  ? -4.005  10.279  52.328  1.00 23.91 ? 157 LEU C CD1 1 
ATOM 2245 C CD2 . LEU C 1 17  ? -6.214  11.401  52.750  1.00 22.38 ? 157 LEU C CD2 1 
ATOM 2246 N N   . PHE C 1 18  ? -1.804  12.519  54.470  1.00 36.45 ? 158 PHE C N   1 
ATOM 2247 C CA  . PHE C 1 18  ? -1.248  13.857  54.383  1.00 38.72 ? 158 PHE C CA  1 
ATOM 2248 C C   . PHE C 1 18  ? -1.923  14.607  53.248  1.00 39.08 ? 158 PHE C C   1 
ATOM 2249 O O   . PHE C 1 18  ? -1.590  14.412  52.081  1.00 39.74 ? 158 PHE C O   1 
ATOM 2250 C CB  . PHE C 1 18  ? 0.261   13.785  54.165  1.00 40.99 ? 158 PHE C CB  1 
ATOM 2251 C CG  . PHE C 1 18  ? 0.992   13.178  55.317  1.00 44.18 ? 158 PHE C CG  1 
ATOM 2252 C CD1 . PHE C 1 18  ? 1.420   11.859  55.274  1.00 45.87 ? 158 PHE C CD1 1 
ATOM 2253 C CD2 . PHE C 1 18  ? 1.196   13.909  56.480  1.00 47.35 ? 158 PHE C CD2 1 
ATOM 2254 C CE1 . PHE C 1 18  ? 2.036   11.275  56.377  1.00 48.44 ? 158 PHE C CE1 1 
ATOM 2255 C CE2 . PHE C 1 18  ? 1.810   13.333  57.589  1.00 48.87 ? 158 PHE C CE2 1 
ATOM 2256 C CZ  . PHE C 1 18  ? 2.233   12.012  57.538  1.00 48.71 ? 158 PHE C CZ  1 
ATOM 2257 N N   . SER C 1 19  ? -2.883  15.457  53.607  1.00 39.37 ? 159 SER C N   1 
ATOM 2258 C CA  . SER C 1 19  ? -3.646  16.247  52.644  1.00 40.42 ? 159 SER C CA  1 
ATOM 2259 C C   . SER C 1 19  ? -2.817  16.642  51.435  1.00 41.35 ? 159 SER C C   1 
ATOM 2260 O O   . SER C 1 19  ? -1.683  17.101  51.563  1.00 41.63 ? 159 SER C O   1 
ATOM 2261 C CB  . SER C 1 19  ? -4.177  17.522  53.292  1.00 40.44 ? 159 SER C CB  1 
ATOM 2262 O OG  . SER C 1 19  ? -3.181  18.530  53.287  1.00 40.55 ? 159 SER C OG  1 
ATOM 2263 N N   . SER C 1 20  ? -3.399  16.467  50.258  1.00 42.17 ? 160 SER C N   1 
ATOM 2264 C CA  . SER C 1 20  ? -2.726  16.811  49.017  1.00 42.94 ? 160 SER C CA  1 
ATOM 2265 C C   . SER C 1 20  ? -2.708  18.326  48.799  1.00 42.80 ? 160 SER C C   1 
ATOM 2266 O O   . SER C 1 20  ? -1.892  18.839  48.031  1.00 42.81 ? 160 SER C O   1 
ATOM 2267 C CB  . SER C 1 20  ? -3.430  16.117  47.848  1.00 42.98 ? 160 SER C CB  1 
ATOM 2268 O OG  . SER C 1 20  ? -4.836  16.290  47.928  1.00 42.19 ? 160 SER C OG  1 
ATOM 2269 N N   . GLY C 1 21  ? -3.596  19.038  49.491  1.00 42.18 ? 161 GLY C N   1 
ATOM 2270 C CA  . GLY C 1 21  ? -3.668  20.480  49.329  1.00 41.74 ? 161 GLY C CA  1 
ATOM 2271 C C   . GLY C 1 21  ? -3.408  21.331  50.557  1.00 41.39 ? 161 GLY C C   1 
ATOM 2272 O O   . GLY C 1 21  ? -3.224  20.817  51.655  1.00 41.33 ? 161 GLY C O   1 
ATOM 2273 N N   . SER C 1 22  ? -3.405  22.646  50.360  1.00 41.49 ? 162 SER C N   1 
ATOM 2274 C CA  . SER C 1 22  ? -3.157  23.603  51.433  1.00 41.95 ? 162 SER C CA  1 
ATOM 2275 C C   . SER C 1 22  ? -4.371  24.507  51.630  1.00 41.90 ? 162 SER C C   1 
ATOM 2276 O O   . SER C 1 22  ? -4.722  25.282  50.746  1.00 42.01 ? 162 SER C O   1 
ATOM 2277 C CB  . SER C 1 22  ? -1.934  24.458  51.090  1.00 43.14 ? 162 SER C CB  1 
ATOM 2278 O OG  . SER C 1 22  ? -1.447  25.148  52.229  1.00 47.33 ? 162 SER C OG  1 
ATOM 2279 N N   . PHE C 1 23  ? -5.010  24.402  52.793  1.00 42.78 ? 163 PHE C N   1 
ATOM 2280 C CA  . PHE C 1 23  ? -6.198  25.200  53.101  1.00 41.43 ? 163 PHE C CA  1 
ATOM 2281 C C   . PHE C 1 23  ? -6.208  25.599  54.577  1.00 41.25 ? 163 PHE C C   1 
ATOM 2282 O O   . PHE C 1 23  ? -5.351  25.159  55.343  1.00 40.97 ? 163 PHE C O   1 
ATOM 2283 C CB  . PHE C 1 23  ? -7.461  24.399  52.769  1.00 39.58 ? 163 PHE C CB  1 
ATOM 2284 C CG  . PHE C 1 23  ? -7.367  23.632  51.481  1.00 40.34 ? 163 PHE C CG  1 
ATOM 2285 C CD1 . PHE C 1 23  ? -6.622  22.456  51.407  1.00 39.94 ? 163 PHE C CD1 1 
ATOM 2286 C CD2 . PHE C 1 23  ? -7.987  24.100  50.330  1.00 40.45 ? 163 PHE C CD2 1 
ATOM 2287 C CE1 . PHE C 1 23  ? -6.496  21.766  50.211  1.00 37.32 ? 163 PHE C CE1 1 
ATOM 2288 C CE2 . PHE C 1 23  ? -7.864  23.413  49.129  1.00 37.50 ? 163 PHE C CE2 1 
ATOM 2289 C CZ  . PHE C 1 23  ? -7.117  22.245  49.072  1.00 36.95 ? 163 PHE C CZ  1 
ATOM 2290 N N   . ASN C 1 24  ? -7.171  26.431  54.973  1.00 40.41 ? 164 ASN C N   1 
ATOM 2291 C CA  . ASN C 1 24  ? -7.260  26.868  56.364  1.00 38.20 ? 164 ASN C CA  1 
ATOM 2292 C C   . ASN C 1 24  ? -7.784  25.763  57.279  1.00 38.29 ? 164 ASN C C   1 
ATOM 2293 O O   . ASN C 1 24  ? -8.398  24.795  56.828  1.00 38.40 ? 164 ASN C O   1 
ATOM 2294 C CB  . ASN C 1 24  ? -8.125  28.128  56.494  1.00 36.09 ? 164 ASN C CB  1 
ATOM 2295 C CG  . ASN C 1 24  ? -9.536  27.923  56.005  1.00 36.56 ? 164 ASN C CG  1 
ATOM 2296 O OD1 . ASN C 1 24  ? -10.266 27.079  56.518  1.00 34.29 ? 164 ASN C OD1 1 
ATOM 2297 N ND2 . ASN C 1 24  ? -9.934  28.704  55.009  1.00 38.62 ? 164 ASN C ND2 1 
ATOM 2298 N N   . TRP C 1 25  ? -7.533  25.927  58.572  1.00 37.68 ? 165 TRP C N   1 
ATOM 2299 C CA  . TRP C 1 25  ? -7.910  24.945  59.577  1.00 37.85 ? 165 TRP C CA  1 
ATOM 2300 C C   . TRP C 1 25  ? -9.352  24.430  59.554  1.00 38.42 ? 165 TRP C C   1 
ATOM 2301 O O   . TRP C 1 25  ? -9.587  23.241  59.782  1.00 40.27 ? 165 TRP C O   1 
ATOM 2302 C CB  . TRP C 1 25  ? -7.595  25.494  60.967  1.00 37.58 ? 165 TRP C CB  1 
ATOM 2303 C CG  . TRP C 1 25  ? -7.505  24.426  61.994  1.00 35.35 ? 165 TRP C CG  1 
ATOM 2304 C CD1 . TRP C 1 25  ? -6.411  23.669  62.289  1.00 36.69 ? 165 TRP C CD1 1 
ATOM 2305 C CD2 . TRP C 1 25  ? -8.569  23.938  62.821  1.00 35.19 ? 165 TRP C CD2 1 
ATOM 2306 N NE1 . TRP C 1 25  ? -6.725  22.736  63.246  1.00 35.91 ? 165 TRP C NE1 1 
ATOM 2307 C CE2 . TRP C 1 25  ? -8.041  22.877  63.589  1.00 35.98 ? 165 TRP C CE2 1 
ATOM 2308 C CE3 . TRP C 1 25  ? -9.915  24.290  62.982  1.00 34.71 ? 165 TRP C CE3 1 
ATOM 2309 C CZ2 . TRP C 1 25  ? -8.817  22.163  64.512  1.00 36.60 ? 165 TRP C CZ2 1 
ATOM 2310 C CZ3 . TRP C 1 25  ? -10.687 23.577  63.900  1.00 36.03 ? 165 TRP C CZ3 1 
ATOM 2311 C CH2 . TRP C 1 25  ? -10.133 22.525  64.652  1.00 35.78 ? 165 TRP C CH2 1 
ATOM 2312 N N   . GLU C 1 26  ? -10.314 25.312  59.301  1.00 38.10 ? 166 GLU C N   1 
ATOM 2313 C CA  . GLU C 1 26  ? -11.722 24.911  59.264  1.00 36.85 ? 166 GLU C CA  1 
ATOM 2314 C C   . GLU C 1 26  ? -11.955 24.044  58.029  1.00 36.86 ? 166 GLU C C   1 
ATOM 2315 O O   . GLU C 1 26  ? -12.506 22.946  58.112  1.00 33.79 ? 166 GLU C O   1 
ATOM 2316 C CB  . GLU C 1 26  ? -12.606 26.151  59.216  1.00 35.36 ? 166 GLU C CB  1 
ATOM 2317 C CG  . GLU C 1 26  ? -14.074 25.905  59.479  1.00 38.46 ? 166 GLU C CG  1 
ATOM 2318 C CD  . GLU C 1 26  ? -14.849 27.205  59.603  1.00 41.40 ? 166 GLU C CD  1 
ATOM 2319 O OE1 . GLU C 1 26  ? -14.793 28.017  58.658  1.00 45.03 ? 166 GLU C OE1 1 
ATOM 2320 O OE2 . GLU C 1 26  ? -15.509 27.421  60.641  1.00 42.44 ? 166 GLU C OE2 1 
ATOM 2321 N N   . LYS C 1 27  ? -11.515 24.556  56.883  1.00 37.96 ? 167 LYS C N   1 
ATOM 2322 C CA  . LYS C 1 27  ? -11.624 23.858  55.610  1.00 37.01 ? 167 LYS C CA  1 
ATOM 2323 C C   . LYS C 1 27  ? -10.922 22.506  55.723  1.00 36.35 ? 167 LYS C C   1 
ATOM 2324 O O   . LYS C 1 27  ? -11.386 21.514  55.157  1.00 36.53 ? 167 LYS C O   1 
ATOM 2325 C CB  . LYS C 1 27  ? -10.976 24.695  54.501  1.00 39.83 ? 167 LYS C CB  1 
ATOM 2326 C CG  . LYS C 1 27  ? -11.933 25.158  53.407  1.00 42.61 ? 167 LYS C CG  1 
ATOM 2327 C CD  . LYS C 1 27  ? -13.091 25.975  53.967  1.00 45.88 ? 167 LYS C CD  1 
ATOM 2328 C CE  . LYS C 1 27  ? -12.630 27.286  54.584  1.00 47.70 ? 167 LYS C CE  1 
ATOM 2329 N NZ  . LYS C 1 27  ? -13.759 27.961  55.289  1.00 48.62 ? 167 LYS C NZ  1 
ATOM 2330 N N   . SER C 1 28  ? -9.800  22.473  56.447  1.00 34.25 ? 168 SER C N   1 
ATOM 2331 C CA  . SER C 1 28  ? -9.045  21.237  56.651  1.00 34.16 ? 168 SER C CA  1 
ATOM 2332 C C   . SER C 1 28  ? -9.863  20.277  57.505  1.00 35.25 ? 168 SER C C   1 
ATOM 2333 O O   . SER C 1 28  ? -9.838  19.061  57.303  1.00 34.63 ? 168 SER C O   1 
ATOM 2334 C CB  . SER C 1 28  ? -7.713  21.522  57.348  1.00 33.68 ? 168 SER C CB  1 
ATOM 2335 O OG  . SER C 1 28  ? -6.793  22.141  56.468  1.00 35.27 ? 168 SER C OG  1 
ATOM 2336 N N   . GLN C 1 29  ? -10.587 20.838  58.468  1.00 35.92 ? 169 GLN C N   1 
ATOM 2337 C CA  . GLN C 1 29  ? -11.432 20.054  59.356  1.00 35.51 ? 169 GLN C CA  1 
ATOM 2338 C C   . GLN C 1 29  ? -12.493 19.347  58.511  1.00 35.40 ? 169 GLN C C   1 
ATOM 2339 O O   . GLN C 1 29  ? -12.741 18.153  58.666  1.00 33.85 ? 169 GLN C O   1 
ATOM 2340 C CB  . GLN C 1 29  ? -12.081 20.986  60.383  1.00 36.03 ? 169 GLN C CB  1 
ATOM 2341 C CG  . GLN C 1 29  ? -12.986 20.315  61.400  1.00 37.71 ? 169 GLN C CG  1 
ATOM 2342 C CD  . GLN C 1 29  ? -13.329 21.236  62.562  1.00 40.28 ? 169 GLN C CD  1 
ATOM 2343 O OE1 . GLN C 1 29  ? -13.849 22.336  62.371  1.00 42.45 ? 169 GLN C OE1 1 
ATOM 2344 N NE2 . GLN C 1 29  ? -13.036 20.788  63.776  1.00 41.78 ? 169 GLN C NE2 1 
ATOM 2345 N N   . GLU C 1 30  ? -13.103 20.098  57.603  1.00 35.63 ? 170 GLU C N   1 
ATOM 2346 C CA  . GLU C 1 30  ? -14.128 19.558  56.725  1.00 37.45 ? 170 GLU C CA  1 
ATOM 2347 C C   . GLU C 1 30  ? -13.588 18.428  55.858  1.00 38.41 ? 170 GLU C C   1 
ATOM 2348 O O   . GLU C 1 30  ? -14.212 17.369  55.742  1.00 39.05 ? 170 GLU C O   1 
ATOM 2349 C CB  . GLU C 1 30  ? -14.677 20.660  55.821  1.00 39.87 ? 170 GLU C CB  1 
ATOM 2350 C CG  . GLU C 1 30  ? -15.379 21.786  56.548  1.00 43.00 ? 170 GLU C CG  1 
ATOM 2351 C CD  . GLU C 1 30  ? -15.973 22.795  55.584  1.00 46.43 ? 170 GLU C CD  1 
ATOM 2352 O OE1 . GLU C 1 30  ? -16.788 22.383  54.732  1.00 48.11 ? 170 GLU C OE1 1 
ATOM 2353 O OE2 . GLU C 1 30  ? -15.628 23.994  55.672  1.00 49.01 ? 170 GLU C OE2 1 
ATOM 2354 N N   . LYS C 1 31  ? -12.437 18.664  55.233  1.00 37.59 ? 171 LYS C N   1 
ATOM 2355 C CA  . LYS C 1 31  ? -11.825 17.659  54.373  1.00 38.12 ? 171 LYS C CA  1 
ATOM 2356 C C   . LYS C 1 31  ? -11.590 16.328  55.079  1.00 39.05 ? 171 LYS C C   1 
ATOM 2357 O O   . LYS C 1 31  ? -11.697 15.273  54.460  1.00 40.33 ? 171 LYS C O   1 
ATOM 2358 C CB  . LYS C 1 31  ? -10.499 18.165  53.802  1.00 38.35 ? 171 LYS C CB  1 
ATOM 2359 C CG  . LYS C 1 31  ? -10.601 18.779  52.414  1.00 39.82 ? 171 LYS C CG  1 
ATOM 2360 C CD  . LYS C 1 31  ? -11.250 20.158  52.430  1.00 39.31 ? 171 LYS C CD  1 
ATOM 2361 C CE  . LYS C 1 31  ? -11.400 20.701  51.015  1.00 37.45 ? 171 LYS C CE  1 
ATOM 2362 N NZ  . LYS C 1 31  ? -10.108 20.678  50.272  1.00 36.87 ? 171 LYS C NZ  1 
ATOM 2363 N N   . CYS C 1 32  ? -11.264 16.369  56.369  1.00 39.36 ? 172 CYS C N   1 
ATOM 2364 C CA  . CYS C 1 32  ? -11.026 15.135  57.112  1.00 39.53 ? 172 CYS C CA  1 
ATOM 2365 C C   . CYS C 1 32  ? -12.309 14.350  57.375  1.00 40.31 ? 172 CYS C C   1 
ATOM 2366 O O   . CYS C 1 32  ? -12.324 13.124  57.225  1.00 41.33 ? 172 CYS C O   1 
ATOM 2367 C CB  . CYS C 1 32  ? -10.332 15.420  58.443  1.00 37.97 ? 172 CYS C CB  1 
ATOM 2368 S SG  . CYS C 1 32  ? -8.568  15.868  58.348  1.00 35.68 ? 172 CYS C SG  1 
ATOM 2369 N N   . LEU C 1 33  ? -13.375 15.046  57.777  1.00 38.43 ? 173 LEU C N   1 
ATOM 2370 C CA  . LEU C 1 33  ? -14.651 14.385  58.039  1.00 37.72 ? 173 LEU C CA  1 
ATOM 2371 C C   . LEU C 1 33  ? -15.115 13.674  56.777  1.00 37.21 ? 173 LEU C C   1 
ATOM 2372 O O   . LEU C 1 33  ? -15.542 12.523  56.819  1.00 35.29 ? 173 LEU C O   1 
ATOM 2373 C CB  . LEU C 1 33  ? -15.728 15.390  58.447  1.00 38.45 ? 173 LEU C CB  1 
ATOM 2374 C CG  . LEU C 1 33  ? -15.547 16.261  59.687  1.00 40.92 ? 173 LEU C CG  1 
ATOM 2375 C CD1 . LEU C 1 33  ? -16.858 16.993  59.962  1.00 39.79 ? 173 LEU C CD1 1 
ATOM 2376 C CD2 . LEU C 1 33  ? -15.149 15.405  60.885  1.00 42.14 ? 173 LEU C CD2 1 
ATOM 2377 N N   . SER C 1 34  ? -15.028 14.377  55.652  1.00 37.16 ? 174 SER C N   1 
ATOM 2378 C CA  . SER C 1 34  ? -15.441 13.832  54.366  1.00 37.62 ? 174 SER C CA  1 
ATOM 2379 C C   . SER C 1 34  ? -14.771 12.488  54.109  1.00 37.99 ? 174 SER C C   1 
ATOM 2380 O O   . SER C 1 34  ? -15.276 11.661  53.354  1.00 37.65 ? 174 SER C O   1 
ATOM 2381 C CB  . SER C 1 34  ? -15.069 14.797  53.250  1.00 36.79 ? 174 SER C CB  1 
ATOM 2382 O OG  . SER C 1 34  ? -13.673 14.761  53.030  1.00 38.66 ? 174 SER C OG  1 
ATOM 2383 N N   . LEU C 1 35  ? -13.620 12.280  54.732  1.00 39.46 ? 175 LEU C N   1 
ATOM 2384 C CA  . LEU C 1 35  ? -12.894 11.031  54.571  1.00 40.44 ? 175 LEU C CA  1 
ATOM 2385 C C   . LEU C 1 35  ? -13.143 10.114  55.764  1.00 40.50 ? 175 LEU C C   1 
ATOM 2386 O O   . LEU C 1 35  ? -12.374 9.182   56.003  1.00 40.77 ? 175 LEU C O   1 
ATOM 2387 C CB  . LEU C 1 35  ? -11.394 11.300  54.450  1.00 41.33 ? 175 LEU C CB  1 
ATOM 2388 C CG  . LEU C 1 35  ? -10.902 12.173  53.298  1.00 40.87 ? 175 LEU C CG  1 
ATOM 2389 C CD1 . LEU C 1 35  ? -9.394  12.039  53.190  1.00 41.63 ? 175 LEU C CD1 1 
ATOM 2390 C CD2 . LEU C 1 35  ? -11.549 11.735  52.004  1.00 40.58 ? 175 LEU C CD2 1 
ATOM 2391 N N   . ASP C 1 36  ? -14.224 10.373  56.498  1.00 39.51 ? 176 ASP C N   1 
ATOM 2392 C CA  . ASP C 1 36  ? -14.565 9.583   57.677  1.00 38.74 ? 176 ASP C CA  1 
ATOM 2393 C C   . ASP C 1 36  ? -13.367 9.531   58.615  1.00 38.09 ? 176 ASP C C   1 
ATOM 2394 O O   . ASP C 1 36  ? -12.967 8.464   59.097  1.00 37.65 ? 176 ASP C O   1 
ATOM 2395 C CB  . ASP C 1 36  ? -15.001 8.171   57.276  1.00 40.25 ? 176 ASP C CB  1 
ATOM 2396 C CG  . ASP C 1 36  ? -16.395 8.149   56.685  1.00 45.98 ? 176 ASP C CG  1 
ATOM 2397 O OD1 . ASP C 1 36  ? -17.289 8.768   57.297  1.00 49.43 ? 176 ASP C OD1 1 
ATOM 2398 O OD2 . ASP C 1 36  ? -16.603 7.526   55.621  1.00 48.90 ? 176 ASP C OD2 1 
ATOM 2399 N N   . ALA C 1 37  ? -12.800 10.709  58.857  1.00 35.17 ? 177 ALA C N   1 
ATOM 2400 C CA  . ALA C 1 37  ? -11.651 10.863  59.727  1.00 32.69 ? 177 ALA C CA  1 
ATOM 2401 C C   . ALA C 1 37  ? -11.706 12.237  60.387  1.00 31.34 ? 177 ALA C C   1 
ATOM 2402 O O   . ALA C 1 37  ? -12.657 12.995  60.191  1.00 29.55 ? 177 ALA C O   1 
ATOM 2403 C CB  . ALA C 1 37  ? -10.365 10.715  58.925  1.00 33.81 ? 177 ALA C CB  1 
ATOM 2404 N N   . LYS C 1 38  ? -10.676 12.547  61.166  1.00 30.01 ? 178 LYS C N   1 
ATOM 2405 C CA  . LYS C 1 38  ? -10.582 13.816  61.875  1.00 28.19 ? 178 LYS C CA  1 
ATOM 2406 C C   . LYS C 1 38  ? -9.152  14.327  61.748  1.00 26.64 ? 178 LYS C C   1 
ATOM 2407 O O   . LYS C 1 38  ? -8.256  13.578  61.356  1.00 26.11 ? 178 LYS C O   1 
ATOM 2408 C CB  . LYS C 1 38  ? -10.903 13.596  63.353  1.00 28.21 ? 178 LYS C CB  1 
ATOM 2409 C CG  . LYS C 1 38  ? -9.887  12.690  64.030  1.00 29.50 ? 178 LYS C CG  1 
ATOM 2410 C CD  . LYS C 1 38  ? -10.250 12.345  65.465  1.00 30.81 ? 178 LYS C CD  1 
ATOM 2411 C CE  . LYS C 1 38  ? -9.160  11.479  66.091  1.00 29.40 ? 178 LYS C CE  1 
ATOM 2412 N NZ  . LYS C 1 38  ? -9.541  10.951  67.427  1.00 29.54 ? 178 LYS C NZ  1 
ATOM 2413 N N   . LEU C 1 39  ? -8.936  15.596  62.077  1.00 24.66 ? 179 LEU C N   1 
ATOM 2414 C CA  . LEU C 1 39  ? -7.592  16.155  62.020  1.00 23.35 ? 179 LEU C CA  1 
ATOM 2415 C C   . LEU C 1 39  ? -6.721  15.478  63.075  1.00 22.82 ? 179 LEU C C   1 
ATOM 2416 O O   . LEU C 1 39  ? -7.209  15.076  64.135  1.00 21.33 ? 179 LEU C O   1 
ATOM 2417 C CB  . LEU C 1 39  ? -7.617  17.663  62.268  1.00 22.12 ? 179 LEU C CB  1 
ATOM 2418 C CG  . LEU C 1 39  ? -7.937  18.568  61.080  1.00 20.50 ? 179 LEU C CG  1 
ATOM 2419 C CD1 . LEU C 1 39  ? -8.018  20.009  61.551  1.00 19.74 ? 179 LEU C CD1 1 
ATOM 2420 C CD2 . LEU C 1 39  ? -6.861  18.415  60.015  1.00 19.58 ? 179 LEU C CD2 1 
ATOM 2421 N N   . LEU C 1 40  ? -5.431  15.366  62.780  1.00 21.92 ? 180 LEU C N   1 
ATOM 2422 C CA  . LEU C 1 40  ? -4.478  14.726  63.679  1.00 24.67 ? 180 LEU C CA  1 
ATOM 2423 C C   . LEU C 1 40  ? -4.640  15.051  65.163  1.00 27.31 ? 180 LEU C C   1 
ATOM 2424 O O   . LEU C 1 40  ? -4.920  16.190  65.544  1.00 28.41 ? 180 LEU C O   1 
ATOM 2425 C CB  . LEU C 1 40  ? -3.047  15.076  63.262  1.00 22.21 ? 180 LEU C CB  1 
ATOM 2426 C CG  . LEU C 1 40  ? -1.960  14.546  64.196  1.00 20.48 ? 180 LEU C CG  1 
ATOM 2427 C CD1 . LEU C 1 40  ? -1.855  13.039  64.048  1.00 21.04 ? 180 LEU C CD1 1 
ATOM 2428 C CD2 . LEU C 1 40  ? -0.633  15.204  63.875  1.00 20.94 ? 180 LEU C CD2 1 
ATOM 2429 N N   . LYS C 1 41  ? -4.451  14.030  65.993  1.00 28.68 ? 181 LYS C N   1 
ATOM 2430 C CA  . LYS C 1 41  ? -4.525  14.172  67.440  1.00 30.07 ? 181 LYS C CA  1 
ATOM 2431 C C   . LYS C 1 41  ? -3.391  13.356  68.025  1.00 33.03 ? 181 LYS C C   1 
ATOM 2432 O O   . LYS C 1 41  ? -3.251  12.175  67.702  1.00 34.04 ? 181 LYS C O   1 
ATOM 2433 C CB  . LYS C 1 41  ? -5.846  13.645  68.000  1.00 28.63 ? 181 LYS C CB  1 
ATOM 2434 C CG  . LYS C 1 41  ? -5.870  13.655  69.526  1.00 27.50 ? 181 LYS C CG  1 
ATOM 2435 C CD  . LYS C 1 41  ? -7.219  13.269  70.110  1.00 29.49 ? 181 LYS C CD  1 
ATOM 2436 C CE  . LYS C 1 41  ? -7.167  13.255  71.636  1.00 29.93 ? 181 LYS C CE  1 
ATOM 2437 N NZ  . LYS C 1 41  ? -8.495  12.997  72.257  1.00 29.90 ? 181 LYS C NZ  1 
ATOM 2438 N N   . ILE C 1 42  ? -2.584  13.984  68.880  1.00 35.41 ? 182 ILE C N   1 
ATOM 2439 C CA  . ILE C 1 42  ? -1.463  13.295  69.504  1.00 35.55 ? 182 ILE C CA  1 
ATOM 2440 C C   . ILE C 1 42  ? -1.783  12.929  70.950  1.00 36.03 ? 182 ILE C C   1 
ATOM 2441 O O   . ILE C 1 42  ? -1.957  13.811  71.797  1.00 36.01 ? 182 ILE C O   1 
ATOM 2442 C CB  . ILE C 1 42  ? -0.188  14.156  69.487  1.00 34.58 ? 182 ILE C CB  1 
ATOM 2443 C CG1 . ILE C 1 42  ? 0.193   14.514  68.048  1.00 33.19 ? 182 ILE C CG1 1 
ATOM 2444 C CG2 . ILE C 1 42  ? 0.947   13.394  70.139  1.00 35.28 ? 182 ILE C CG2 1 
ATOM 2445 C CD1 . ILE C 1 42  ? -0.665  15.593  67.429  1.00 36.16 ? 182 ILE C CD1 1 
ATOM 2446 N N   . ASN C 1 43  ? -1.872  11.628  71.226  1.00 36.07 ? 183 ASN C N   1 
ATOM 2447 C CA  . ASN C 1 43  ? -2.172  11.161  72.577  1.00 35.98 ? 183 ASN C CA  1 
ATOM 2448 C C   . ASN C 1 43  ? -0.907  10.726  73.274  1.00 34.95 ? 183 ASN C C   1 
ATOM 2449 O O   . ASN C 1 43  ? -0.950  10.246  74.401  1.00 35.98 ? 183 ASN C O   1 
ATOM 2450 C CB  . ASN C 1 43  ? -3.153  9.981   72.569  1.00 37.03 ? 183 ASN C CB  1 
ATOM 2451 C CG  . ASN C 1 43  ? -4.577  10.401  72.245  1.00 40.77 ? 183 ASN C CG  1 
ATOM 2452 O OD1 . ASN C 1 43  ? -4.985  10.390  71.087  1.00 43.23 ? 183 ASN C OD1 1 
ATOM 2453 N ND2 . ASN C 1 43  ? -5.338  10.783  73.270  1.00 40.72 ? 183 ASN C ND2 1 
ATOM 2454 N N   . SER C 1 44  ? 0.222   10.898  72.601  1.00 33.47 ? 184 SER C N   1 
ATOM 2455 C CA  . SER C 1 44  ? 1.496   10.494  73.166  1.00 32.66 ? 184 SER C CA  1 
ATOM 2456 C C   . SER C 1 44  ? 2.662   10.937  72.300  1.00 32.76 ? 184 SER C C   1 
ATOM 2457 O O   . SER C 1 44  ? 2.558   10.956  71.077  1.00 33.55 ? 184 SER C O   1 
ATOM 2458 C CB  . SER C 1 44  ? 1.540   8.980   73.294  1.00 33.37 ? 184 SER C CB  1 
ATOM 2459 O OG  . SER C 1 44  ? 1.583   8.378   72.009  1.00 33.23 ? 184 SER C OG  1 
ATOM 2460 N N   . THR C 1 45  ? 3.778   11.270  72.940  1.00 32.90 ? 185 THR C N   1 
ATOM 2461 C CA  . THR C 1 45  ? 4.973   11.699  72.228  1.00 33.70 ? 185 THR C CA  1 
ATOM 2462 C C   . THR C 1 45  ? 5.343   10.653  71.184  1.00 35.18 ? 185 THR C C   1 
ATOM 2463 O O   . THR C 1 45  ? 5.915   10.972  70.143  1.00 36.85 ? 185 THR C O   1 
ATOM 2464 C CB  . THR C 1 45  ? 6.153   11.892  73.191  1.00 32.83 ? 185 THR C CB  1 
ATOM 2465 O OG1 . THR C 1 45  ? 6.485   10.638  73.796  1.00 33.56 ? 185 THR C OG1 1 
ATOM 2466 C CG2 . THR C 1 45  ? 5.791   12.891  74.278  1.00 32.02 ? 185 THR C CG2 1 
ATOM 2467 N N   . ALA C 1 46  ? 5.011   9.400   71.464  1.00 36.35 ? 186 ALA C N   1 
ATOM 2468 C CA  . ALA C 1 46  ? 5.285   8.326   70.520  1.00 38.80 ? 186 ALA C CA  1 
ATOM 2469 C C   . ALA C 1 46  ? 4.633   8.680   69.180  1.00 39.21 ? 186 ALA C C   1 
ATOM 2470 O O   . ALA C 1 46  ? 5.277   8.650   68.129  1.00 38.19 ? 186 ALA C O   1 
ATOM 2471 C CB  . ALA C 1 46  ? 4.716   7.013   71.049  1.00 40.37 ? 186 ALA C CB  1 
ATOM 2472 N N   . ASP C 1 47  ? 3.348   9.015   69.231  1.00 38.95 ? 187 ASP C N   1 
ATOM 2473 C CA  . ASP C 1 47  ? 2.612   9.381   68.032  1.00 39.72 ? 187 ASP C CA  1 
ATOM 2474 C C   . ASP C 1 47  ? 3.176   10.638  67.385  1.00 39.83 ? 187 ASP C C   1 
ATOM 2475 O O   . ASP C 1 47  ? 3.298   10.710  66.163  1.00 40.49 ? 187 ASP C O   1 
ATOM 2476 C CB  . ASP C 1 47  ? 1.134   9.607   68.353  1.00 41.14 ? 187 ASP C CB  1 
ATOM 2477 C CG  . ASP C 1 47  ? 0.432   8.342   68.784  1.00 42.07 ? 187 ASP C CG  1 
ATOM 2478 O OD1 . ASP C 1 47  ? 0.861   7.249   68.353  1.00 43.00 ? 187 ASP C OD1 1 
ATOM 2479 O OD2 . ASP C 1 47  ? -0.557  8.446   69.539  1.00 42.89 ? 187 ASP C OD2 1 
ATOM 2480 N N   . LEU C 1 48  ? 3.517   11.632  68.202  1.00 38.81 ? 188 LEU C N   1 
ATOM 2481 C CA  . LEU C 1 48  ? 4.061   12.876  67.674  1.00 36.94 ? 188 LEU C CA  1 
ATOM 2482 C C   . LEU C 1 48  ? 5.419   12.667  67.034  1.00 37.31 ? 188 LEU C C   1 
ATOM 2483 O O   . LEU C 1 48  ? 5.809   13.427  66.150  1.00 39.01 ? 188 LEU C O   1 
ATOM 2484 C CB  . LEU C 1 48  ? 4.189   13.934  68.765  1.00 34.23 ? 188 LEU C CB  1 
ATOM 2485 C CG  . LEU C 1 48  ? 4.672   15.278  68.214  1.00 32.79 ? 188 LEU C CG  1 
ATOM 2486 C CD1 . LEU C 1 48  ? 3.616   15.849  67.281  1.00 30.32 ? 188 LEU C CD1 1 
ATOM 2487 C CD2 . LEU C 1 48  ? 4.951   16.235  69.354  1.00 31.57 ? 188 LEU C CD2 1 
ATOM 2488 N N   . ASP C 1 49  ? 6.150   11.652  67.484  1.00 37.30 ? 189 ASP C N   1 
ATOM 2489 C CA  . ASP C 1 49  ? 7.455   11.387  66.901  1.00 38.41 ? 189 ASP C CA  1 
ATOM 2490 C C   . ASP C 1 49  ? 7.340   10.605  65.603  1.00 39.12 ? 189 ASP C C   1 
ATOM 2491 O O   . ASP C 1 49  ? 8.232   10.663  64.756  1.00 39.82 ? 189 ASP C O   1 
ATOM 2492 C CB  . ASP C 1 49  ? 8.362   10.663  67.889  1.00 38.05 ? 189 ASP C CB  1 
ATOM 2493 C CG  . ASP C 1 49  ? 9.044   11.619  68.841  1.00 40.64 ? 189 ASP C CG  1 
ATOM 2494 O OD1 . ASP C 1 49  ? 9.428   12.720  68.389  1.00 41.77 ? 189 ASP C OD1 1 
ATOM 2495 O OD2 . ASP C 1 49  ? 9.207   11.274  70.030  1.00 42.97 ? 189 ASP C OD2 1 
ATOM 2496 N N   . PHE C 1 50  ? 6.240   9.875   65.447  1.00 38.75 ? 190 PHE C N   1 
ATOM 2497 C CA  . PHE C 1 50  ? 6.006   9.134   64.214  1.00 38.56 ? 190 PHE C CA  1 
ATOM 2498 C C   . PHE C 1 50  ? 5.795   10.188  63.130  1.00 38.79 ? 190 PHE C C   1 
ATOM 2499 O O   . PHE C 1 50  ? 6.511   10.229  62.131  1.00 39.36 ? 190 PHE C O   1 
ATOM 2500 C CB  . PHE C 1 50  ? 4.751   8.264   64.326  1.00 37.28 ? 190 PHE C CB  1 
ATOM 2501 C CG  . PHE C 1 50  ? 4.212   7.815   62.997  1.00 38.11 ? 190 PHE C CG  1 
ATOM 2502 C CD1 . PHE C 1 50  ? 5.009   7.078   62.123  1.00 38.58 ? 190 PHE C CD1 1 
ATOM 2503 C CD2 . PHE C 1 50  ? 2.919   8.154   62.602  1.00 37.99 ? 190 PHE C CD2 1 
ATOM 2504 C CE1 . PHE C 1 50  ? 4.527   6.682   60.872  1.00 37.74 ? 190 PHE C CE1 1 
ATOM 2505 C CE2 . PHE C 1 50  ? 2.428   7.762   61.351  1.00 37.58 ? 190 PHE C CE2 1 
ATOM 2506 C CZ  . PHE C 1 50  ? 3.237   7.025   60.486  1.00 37.17 ? 190 PHE C CZ  1 
ATOM 2507 N N   . ILE C 1 51  ? 4.802   11.042  63.352  1.00 38.71 ? 191 ILE C N   1 
ATOM 2508 C CA  . ILE C 1 51  ? 4.471   12.117  62.431  1.00 38.31 ? 191 ILE C CA  1 
ATOM 2509 C C   . ILE C 1 51  ? 5.721   12.888  62.028  1.00 39.44 ? 191 ILE C C   1 
ATOM 2510 O O   . ILE C 1 51  ? 6.069   12.956  60.850  1.00 40.22 ? 191 ILE C O   1 
ATOM 2511 C CB  . ILE C 1 51  ? 3.477   13.097  63.077  1.00 37.46 ? 191 ILE C CB  1 
ATOM 2512 C CG1 . ILE C 1 51  ? 2.155   12.380  63.356  1.00 36.97 ? 191 ILE C CG1 1 
ATOM 2513 C CG2 . ILE C 1 51  ? 3.265   14.298  62.181  1.00 35.83 ? 191 ILE C CG2 1 
ATOM 2514 C CD1 . ILE C 1 51  ? 1.493   11.813  62.123  1.00 36.43 ? 191 ILE C CD1 1 
ATOM 2515 N N   . GLN C 1 52  ? 6.392   13.469  63.016  1.00 40.00 ? 192 GLN C N   1 
ATOM 2516 C CA  . GLN C 1 52  ? 7.604   14.241  62.771  1.00 40.76 ? 192 GLN C CA  1 
ATOM 2517 C C   . GLN C 1 52  ? 8.547   13.545  61.787  1.00 41.40 ? 192 GLN C C   1 
ATOM 2518 O O   . GLN C 1 52  ? 9.076   14.168  60.870  1.00 39.82 ? 192 GLN C O   1 
ATOM 2519 C CB  . GLN C 1 52  ? 8.330   14.493  64.090  1.00 41.13 ? 192 GLN C CB  1 
ATOM 2520 C CG  . GLN C 1 52  ? 7.598   15.423  65.044  1.00 40.14 ? 192 GLN C CG  1 
ATOM 2521 C CD  . GLN C 1 52  ? 7.679   16.874  64.618  1.00 39.36 ? 192 GLN C CD  1 
ATOM 2522 O OE1 . GLN C 1 52  ? 7.205   17.246  63.548  1.00 37.78 ? 192 GLN C OE1 1 
ATOM 2523 N NE2 . GLN C 1 52  ? 8.290   17.702  65.457  1.00 39.06 ? 192 GLN C NE2 1 
ATOM 2524 N N   . GLN C 1 53  ? 8.759   12.250  61.986  1.00 42.19 ? 193 GLN C N   1 
ATOM 2525 C CA  . GLN C 1 53  ? 9.631   11.478  61.109  1.00 42.78 ? 193 GLN C CA  1 
ATOM 2526 C C   . GLN C 1 53  ? 9.016   11.375  59.715  1.00 42.42 ? 193 GLN C C   1 
ATOM 2527 O O   . GLN C 1 53  ? 9.708   11.489  58.703  1.00 42.00 ? 193 GLN C O   1 
ATOM 2528 C CB  . GLN C 1 53  ? 9.823   10.072  61.674  1.00 44.18 ? 193 GLN C CB  1 
ATOM 2529 C CG  . GLN C 1 53  ? 10.803  9.207   60.902  1.00 47.14 ? 193 GLN C CG  1 
ATOM 2530 C CD  . GLN C 1 53  ? 10.567  7.727   61.140  1.00 50.16 ? 193 GLN C CD  1 
ATOM 2531 O OE1 . GLN C 1 53  ? 11.473  6.904   60.980  1.00 50.75 ? 193 GLN C OE1 1 
ATOM 2532 N NE2 . GLN C 1 53  ? 9.337   7.379   61.510  1.00 49.62 ? 193 GLN C NE2 1 
ATOM 2533 N N   . ALA C 1 54  ? 7.706   11.155  59.677  1.00 41.47 ? 194 ALA C N   1 
ATOM 2534 C CA  . ALA C 1 54  ? 6.972   11.019  58.426  1.00 40.06 ? 194 ALA C CA  1 
ATOM 2535 C C   . ALA C 1 54  ? 7.051   12.257  57.539  1.00 40.65 ? 194 ALA C C   1 
ATOM 2536 O O   . ALA C 1 54  ? 7.284   12.146  56.335  1.00 42.14 ? 194 ALA C O   1 
ATOM 2537 C CB  . ALA C 1 54  ? 5.513   10.688  58.719  1.00 38.57 ? 194 ALA C CB  1 
ATOM 2538 N N   . ILE C 1 55  ? 6.870   13.433  58.134  1.00 38.63 ? 195 ILE C N   1 
ATOM 2539 C CA  . ILE C 1 55  ? 6.890   14.684  57.378  1.00 35.50 ? 195 ILE C CA  1 
ATOM 2540 C C   . ILE C 1 55  ? 8.197   15.467  57.438  1.00 34.46 ? 195 ILE C C   1 
ATOM 2541 O O   . ILE C 1 55  ? 8.241   16.642  57.071  1.00 31.28 ? 195 ILE C O   1 
ATOM 2542 C CB  . ILE C 1 55  ? 5.765   15.623  57.851  1.00 35.57 ? 195 ILE C CB  1 
ATOM 2543 C CG1 . ILE C 1 55  ? 5.908   15.910  59.348  1.00 32.15 ? 195 ILE C CG1 1 
ATOM 2544 C CG2 . ILE C 1 55  ? 4.422   15.003  57.558  1.00 35.29 ? 195 ILE C CG2 1 
ATOM 2545 C CD1 . ILE C 1 55  ? 4.852   16.854  59.870  1.00 27.48 ? 195 ILE C CD1 1 
ATOM 2546 N N   . SER C 1 56  ? 9.261   14.814  57.887  1.00 34.10 ? 196 SER C N   1 
ATOM 2547 C CA  . SER C 1 56  ? 10.554  15.469  58.014  1.00 34.54 ? 196 SER C CA  1 
ATOM 2548 C C   . SER C 1 56  ? 11.072  16.058  56.708  1.00 34.85 ? 196 SER C C   1 
ATOM 2549 O O   . SER C 1 56  ? 11.916  16.954  56.716  1.00 34.46 ? 196 SER C O   1 
ATOM 2550 C CB  . SER C 1 56  ? 11.576  14.487  58.573  1.00 34.75 ? 196 SER C CB  1 
ATOM 2551 O OG  . SER C 1 56  ? 11.775  13.418  57.671  1.00 36.37 ? 196 SER C OG  1 
ATOM 2552 N N   . TYR C 1 57  ? 10.565  15.561  55.586  1.00 35.06 ? 197 TYR C N   1 
ATOM 2553 C CA  . TYR C 1 57  ? 10.997  16.048  54.284  1.00 34.22 ? 197 TYR C CA  1 
ATOM 2554 C C   . TYR C 1 57  ? 10.016  17.045  53.690  1.00 34.18 ? 197 TYR C C   1 
ATOM 2555 O O   . TYR C 1 57  ? 10.062  17.345  52.499  1.00 35.68 ? 197 TYR C O   1 
ATOM 2556 C CB  . TYR C 1 57  ? 11.195  14.871  53.333  1.00 36.36 ? 197 TYR C CB  1 
ATOM 2557 C CG  . TYR C 1 57  ? 10.052  13.884  53.320  1.00 37.55 ? 197 TYR C CG  1 
ATOM 2558 C CD1 . TYR C 1 57  ? 8.788   14.254  52.861  1.00 37.46 ? 197 TYR C CD1 1 
ATOM 2559 C CD2 . TYR C 1 57  ? 10.235  12.574  53.764  1.00 38.01 ? 197 TYR C CD2 1 
ATOM 2560 C CE1 . TYR C 1 57  ? 7.731   13.342  52.841  1.00 40.94 ? 197 TYR C CE1 1 
ATOM 2561 C CE2 . TYR C 1 57  ? 9.184   11.653  53.750  1.00 41.22 ? 197 TYR C CE2 1 
ATOM 2562 C CZ  . TYR C 1 57  ? 7.933   12.043  53.288  1.00 42.55 ? 197 TYR C CZ  1 
ATOM 2563 O OH  . TYR C 1 57  ? 6.883   11.143  53.276  1.00 43.19 ? 197 TYR C OH  1 
ATOM 2564 N N   . SER C 1 58  ? 9.133   17.564  54.536  1.00 33.39 ? 198 SER C N   1 
ATOM 2565 C CA  . SER C 1 58  ? 8.135   18.537  54.116  1.00 30.48 ? 198 SER C CA  1 
ATOM 2566 C C   . SER C 1 58  ? 8.693   19.951  54.027  1.00 29.03 ? 198 SER C C   1 
ATOM 2567 O O   . SER C 1 58  ? 9.619   20.321  54.748  1.00 26.39 ? 198 SER C O   1 
ATOM 2568 C CB  . SER C 1 58  ? 6.949   18.528  55.080  1.00 30.78 ? 198 SER C CB  1 
ATOM 2569 O OG  . SER C 1 58  ? 6.034   19.562  54.757  1.00 28.02 ? 198 SER C OG  1 
ATOM 2570 N N   . SER C 1 59  ? 8.109   20.735  53.130  1.00 30.54 ? 199 SER C N   1 
ATOM 2571 C CA  . SER C 1 59  ? 8.513   22.119  52.917  1.00 31.98 ? 199 SER C CA  1 
ATOM 2572 C C   . SER C 1 59  ? 7.364   23.040  53.308  1.00 31.65 ? 199 SER C C   1 
ATOM 2573 O O   . SER C 1 59  ? 7.381   24.234  53.015  1.00 32.46 ? 199 SER C O   1 
ATOM 2574 C CB  . SER C 1 59  ? 8.877   22.345  51.446  1.00 31.27 ? 199 SER C CB  1 
ATOM 2575 O OG  . SER C 1 59  ? 9.968   21.527  51.059  1.00 32.46 ? 199 SER C OG  1 
ATOM 2576 N N   . PHE C 1 60  ? 6.365   22.472  53.972  1.00 30.34 ? 200 PHE C N   1 
ATOM 2577 C CA  . PHE C 1 60  ? 5.201   23.234  54.392  1.00 31.08 ? 200 PHE C CA  1 
ATOM 2578 C C   . PHE C 1 60  ? 4.702   22.782  55.755  1.00 31.12 ? 200 PHE C C   1 
ATOM 2579 O O   . PHE C 1 60  ? 5.005   21.679  56.210  1.00 32.63 ? 200 PHE C O   1 
ATOM 2580 C CB  . PHE C 1 60  ? 4.074   23.073  53.370  1.00 31.97 ? 200 PHE C CB  1 
ATOM 2581 C CG  . PHE C 1 60  ? 4.369   23.694  52.042  1.00 34.67 ? 200 PHE C CG  1 
ATOM 2582 C CD1 . PHE C 1 60  ? 4.432   25.077  51.909  1.00 35.89 ? 200 PHE C CD1 1 
ATOM 2583 C CD2 . PHE C 1 60  ? 4.593   22.900  50.921  1.00 35.90 ? 200 PHE C CD2 1 
ATOM 2584 C CE1 . PHE C 1 60  ? 4.714   25.667  50.679  1.00 36.93 ? 200 PHE C CE1 1 
ATOM 2585 C CE2 . PHE C 1 60  ? 4.878   23.477  49.683  1.00 37.01 ? 200 PHE C CE2 1 
ATOM 2586 C CZ  . PHE C 1 60  ? 4.937   24.866  49.563  1.00 36.79 ? 200 PHE C CZ  1 
ATOM 2587 N N   . PRO C 1 61  ? 3.932   23.640  56.433  1.00 29.57 ? 201 PRO C N   1 
ATOM 2588 C CA  . PRO C 1 61  ? 3.399   23.293  57.746  1.00 29.21 ? 201 PRO C CA  1 
ATOM 2589 C C   . PRO C 1 61  ? 2.180   22.381  57.622  1.00 30.40 ? 201 PRO C C   1 
ATOM 2590 O O   . PRO C 1 61  ? 1.489   22.385  56.603  1.00 29.43 ? 201 PRO C O   1 
ATOM 2591 C CB  . PRO C 1 61  ? 3.047   24.652  58.329  1.00 29.88 ? 201 PRO C CB  1 
ATOM 2592 C CG  . PRO C 1 61  ? 2.602   25.408  57.127  1.00 27.25 ? 201 PRO C CG  1 
ATOM 2593 C CD  . PRO C 1 61  ? 3.660   25.053  56.116  1.00 27.26 ? 201 PRO C CD  1 
ATOM 2594 N N   . PHE C 1 62  ? 1.936   21.590  58.661  1.00 31.38 ? 202 PHE C N   1 
ATOM 2595 C CA  . PHE C 1 62  ? 0.797   20.683  58.697  1.00 32.02 ? 202 PHE C CA  1 
ATOM 2596 C C   . PHE C 1 62  ? -0.097  21.028  59.885  1.00 33.15 ? 202 PHE C C   1 
ATOM 2597 O O   . PHE C 1 62  ? 0.374   21.132  61.014  1.00 34.82 ? 202 PHE C O   1 
ATOM 2598 C CB  . PHE C 1 62  ? 1.256   19.226  58.828  1.00 30.95 ? 202 PHE C CB  1 
ATOM 2599 C CG  . PHE C 1 62  ? 1.561   18.552  57.515  1.00 32.65 ? 202 PHE C CG  1 
ATOM 2600 C CD1 . PHE C 1 62  ? 2.857   18.516  57.012  1.00 32.67 ? 202 PHE C CD1 1 
ATOM 2601 C CD2 . PHE C 1 62  ? 0.549   17.920  56.797  1.00 33.41 ? 202 PHE C CD2 1 
ATOM 2602 C CE1 . PHE C 1 62  ? 3.140   17.855  55.816  1.00 31.63 ? 202 PHE C CE1 1 
ATOM 2603 C CE2 . PHE C 1 62  ? 0.823   17.259  55.603  1.00 31.98 ? 202 PHE C CE2 1 
ATOM 2604 C CZ  . PHE C 1 62  ? 2.120   17.226  55.113  1.00 31.65 ? 202 PHE C CZ  1 
ATOM 2605 N N   . TRP C 1 63  ? -1.384  21.218  59.621  1.00 33.69 ? 203 TRP C N   1 
ATOM 2606 C CA  . TRP C 1 63  ? -2.353  21.526  60.669  1.00 33.86 ? 203 TRP C CA  1 
ATOM 2607 C C   . TRP C 1 63  ? -2.627  20.271  61.506  1.00 32.79 ? 203 TRP C C   1 
ATOM 2608 O O   . TRP C 1 63  ? -2.289  19.155  61.111  1.00 31.20 ? 203 TRP C O   1 
ATOM 2609 C CB  . TRP C 1 63  ? -3.688  21.977  60.054  1.00 34.89 ? 203 TRP C CB  1 
ATOM 2610 C CG  . TRP C 1 63  ? -3.817  23.425  59.651  1.00 34.35 ? 203 TRP C CG  1 
ATOM 2611 C CD1 . TRP C 1 63  ? -4.380  23.897  58.501  1.00 34.97 ? 203 TRP C CD1 1 
ATOM 2612 C CD2 . TRP C 1 63  ? -3.480  24.581  60.434  1.00 34.11 ? 203 TRP C CD2 1 
ATOM 2613 N NE1 . TRP C 1 63  ? -4.418  25.270  58.516  1.00 35.25 ? 203 TRP C NE1 1 
ATOM 2614 C CE2 . TRP C 1 63  ? -3.873  25.716  59.689  1.00 34.90 ? 203 TRP C CE2 1 
ATOM 2615 C CE3 . TRP C 1 63  ? -2.886  24.768  61.687  1.00 33.39 ? 203 TRP C CE3 1 
ATOM 2616 C CZ2 . TRP C 1 63  ? -3.694  27.020  60.161  1.00 33.80 ? 203 TRP C CZ2 1 
ATOM 2617 C CZ3 . TRP C 1 63  ? -2.708  26.065  62.155  1.00 32.44 ? 203 TRP C CZ3 1 
ATOM 2618 C CH2 . TRP C 1 63  ? -3.110  27.174  61.391  1.00 33.16 ? 203 TRP C CH2 1 
ATOM 2619 N N   . MET C 1 64  ? -3.240  20.473  62.665  1.00 32.38 ? 204 MET C N   1 
ATOM 2620 C CA  . MET C 1 64  ? -3.630  19.383  63.548  1.00 31.63 ? 204 MET C CA  1 
ATOM 2621 C C   . MET C 1 64  ? -4.912  19.830  64.247  1.00 31.53 ? 204 MET C C   1 
ATOM 2622 O O   . MET C 1 64  ? -5.244  21.018  64.239  1.00 32.28 ? 204 MET C O   1 
ATOM 2623 C CB  . MET C 1 64  ? -2.529  19.055  64.564  1.00 30.50 ? 204 MET C CB  1 
ATOM 2624 C CG  . MET C 1 64  ? -2.115  20.175  65.488  1.00 29.91 ? 204 MET C CG  1 
ATOM 2625 S SD  . MET C 1 64  ? -1.122  19.515  66.853  1.00 30.77 ? 204 MET C SD  1 
ATOM 2626 C CE  . MET C 1 64  ? 0.518   19.446  66.137  1.00 30.26 ? 204 MET C CE  1 
ATOM 2627 N N   . GLY C 1 65  ? -5.639  18.887  64.835  1.00 29.55 ? 205 GLY C N   1 
ATOM 2628 C CA  . GLY C 1 65  ? -6.892  19.224  65.491  1.00 29.62 ? 205 GLY C CA  1 
ATOM 2629 C C   . GLY C 1 65  ? -6.859  20.160  66.688  1.00 29.44 ? 205 GLY C C   1 
ATOM 2630 O O   . GLY C 1 65  ? -7.911  20.506  67.224  1.00 29.66 ? 205 GLY C O   1 
ATOM 2631 N N   . LEU C 1 66  ? -5.675  20.586  67.113  1.00 29.57 ? 206 LEU C N   1 
ATOM 2632 C CA  . LEU C 1 66  ? -5.577  21.459  68.277  1.00 29.06 ? 206 LEU C CA  1 
ATOM 2633 C C   . LEU C 1 66  ? -5.930  22.889  67.934  1.00 30.19 ? 206 LEU C C   1 
ATOM 2634 O O   . LEU C 1 66  ? -5.611  23.364  66.848  1.00 31.25 ? 206 LEU C O   1 
ATOM 2635 C CB  . LEU C 1 66  ? -4.173  21.409  68.873  1.00 28.06 ? 206 LEU C CB  1 
ATOM 2636 C CG  . LEU C 1 66  ? -4.090  21.990  70.285  1.00 28.63 ? 206 LEU C CG  1 
ATOM 2637 C CD1 . LEU C 1 66  ? -5.038  21.229  71.197  1.00 28.43 ? 206 LEU C CD1 1 
ATOM 2638 C CD2 . LEU C 1 66  ? -2.668  21.899  70.805  1.00 28.74 ? 206 LEU C CD2 1 
ATOM 2639 N N   . SER C 1 67  ? -6.592  23.573  68.865  1.00 31.01 ? 207 SER C N   1 
ATOM 2640 C CA  . SER C 1 67  ? -6.992  24.956  68.645  1.00 31.71 ? 207 SER C CA  1 
ATOM 2641 C C   . SER C 1 67  ? -7.649  25.572  69.869  1.00 32.79 ? 207 SER C C   1 
ATOM 2642 O O   . SER C 1 67  ? -8.116  24.867  70.758  1.00 33.10 ? 207 SER C O   1 
ATOM 2643 C CB  . SER C 1 67  ? -7.966  25.034  67.473  1.00 31.58 ? 207 SER C CB  1 
ATOM 2644 O OG  . SER C 1 67  ? -9.135  24.293  67.759  1.00 32.68 ? 207 SER C OG  1 
ATOM 2645 N N   . ARG C 1 68  ? -7.690  26.900  69.892  1.00 33.88 ? 208 ARG C N   1 
ATOM 2646 C CA  . ARG C 1 68  ? -8.290  27.650  70.989  1.00 35.26 ? 208 ARG C CA  1 
ATOM 2647 C C   . ARG C 1 68  ? -8.669  29.024  70.460  1.00 35.49 ? 208 ARG C C   1 
ATOM 2648 O O   . ARG C 1 68  ? -8.042  29.523  69.528  1.00 36.16 ? 208 ARG C O   1 
ATOM 2649 C CB  . ARG C 1 68  ? -7.288  27.808  72.132  1.00 37.63 ? 208 ARG C CB  1 
ATOM 2650 C CG  . ARG C 1 68  ? -6.023  28.526  71.711  1.00 39.84 ? 208 ARG C CG  1 
ATOM 2651 C CD  . ARG C 1 68  ? -5.126  28.918  72.870  1.00 41.34 ? 208 ARG C CD  1 
ATOM 2652 N NE  . ARG C 1 68  ? -4.054  29.790  72.392  1.00 44.62 ? 208 ARG C NE  1 
ATOM 2653 C CZ  . ARG C 1 68  ? -3.095  30.308  73.154  1.00 44.69 ? 208 ARG C CZ  1 
ATOM 2654 N NH1 . ARG C 1 68  ? -3.057  30.048  74.456  1.00 45.33 ? 208 ARG C NH1 1 
ATOM 2655 N NH2 . ARG C 1 68  ? -2.171  31.089  72.609  1.00 41.95 ? 208 ARG C NH2 1 
ATOM 2656 N N   . ARG C 1 69  ? -9.686  29.636  71.058  1.00 36.15 ? 209 ARG C N   1 
ATOM 2657 C CA  . ARG C 1 69  ? -10.137 30.955  70.630  1.00 37.02 ? 209 ARG C CA  1 
ATOM 2658 C C   . ARG C 1 69  ? -9.009  31.972  70.771  1.00 36.97 ? 209 ARG C C   1 
ATOM 2659 O O   . ARG C 1 69  ? -8.497  32.491  69.774  1.00 37.80 ? 209 ARG C O   1 
ATOM 2660 C CB  . ARG C 1 69  ? -11.353 31.387  71.456  1.00 39.30 ? 209 ARG C CB  1 
ATOM 2661 C CG  . ARG C 1 69  ? -11.932 32.742  71.058  1.00 43.67 ? 209 ARG C CG  1 
ATOM 2662 C CD  . ARG C 1 69  ? -13.237 33.052  71.792  1.00 45.92 ? 209 ARG C CD  1 
ATOM 2663 N NE  . ARG C 1 69  ? -14.418 32.824  70.959  1.00 51.56 ? 209 ARG C NE  1 
ATOM 2664 C CZ  . ARG C 1 69  ? -14.853 31.630  70.564  1.00 53.57 ? 209 ARG C CZ  1 
ATOM 2665 N NH1 . ARG C 1 69  ? -14.209 30.527  70.923  1.00 54.64 ? 209 ARG C NH1 1 
ATOM 2666 N NH2 . ARG C 1 69  ? -15.939 31.537  69.803  1.00 52.98 ? 209 ARG C NH2 1 
ATOM 2667 N N   . ASN C 1 70  ? -8.625  32.246  72.013  1.00 36.72 ? 210 ASN C N   1 
ATOM 2668 C CA  . ASN C 1 70  ? -7.547  33.183  72.306  1.00 36.45 ? 210 ASN C CA  1 
ATOM 2669 C C   . ASN C 1 70  ? -6.647  32.595  73.398  1.00 36.71 ? 210 ASN C C   1 
ATOM 2670 O O   . ASN C 1 70  ? -6.869  31.469  73.850  1.00 36.47 ? 210 ASN C O   1 
ATOM 2671 C CB  . ASN C 1 70  ? -8.128  34.526  72.746  1.00 35.47 ? 210 ASN C CB  1 
ATOM 2672 C CG  . ASN C 1 70  ? -9.205  34.373  73.788  1.00 34.82 ? 210 ASN C CG  1 
ATOM 2673 O OD1 . ASN C 1 70  ? -9.002  33.726  74.813  1.00 34.26 ? 210 ASN C OD1 1 
ATOM 2674 N ND2 . ASN C 1 70  ? -10.362 34.971  73.535  1.00 32.63 ? 210 ASN C ND2 1 
ATOM 2675 N N   . PRO C 1 71  ? -5.613  33.343  73.829  1.00 36.47 ? 211 PRO C N   1 
ATOM 2676 C CA  . PRO C 1 71  ? -4.713  32.834  74.869  1.00 36.74 ? 211 PRO C CA  1 
ATOM 2677 C C   . PRO C 1 71  ? -5.312  32.596  76.256  1.00 37.06 ? 211 PRO C C   1 
ATOM 2678 O O   . PRO C 1 71  ? -4.583  32.247  77.184  1.00 38.19 ? 211 PRO C O   1 
ATOM 2679 C CB  . PRO C 1 71  ? -3.592  33.875  74.901  1.00 35.75 ? 211 PRO C CB  1 
ATOM 2680 C CG  . PRO C 1 71  ? -3.553  34.368  73.501  1.00 35.53 ? 211 PRO C CG  1 
ATOM 2681 C CD  . PRO C 1 71  ? -5.024  34.531  73.184  1.00 36.55 ? 211 PRO C CD  1 
ATOM 2682 N N   . SER C 1 72  ? -6.620  32.779  76.413  1.00 35.88 ? 212 SER C N   1 
ATOM 2683 C CA  . SER C 1 72  ? -7.235  32.548  77.716  1.00 36.61 ? 212 SER C CA  1 
ATOM 2684 C C   . SER C 1 72  ? -7.997  31.226  77.778  1.00 37.94 ? 212 SER C C   1 
ATOM 2685 O O   . SER C 1 72  ? -8.449  30.808  78.846  1.00 38.86 ? 212 SER C O   1 
ATOM 2686 C CB  . SER C 1 72  ? -8.160  33.707  78.081  1.00 35.61 ? 212 SER C CB  1 
ATOM 2687 O OG  . SER C 1 72  ? -7.401  34.870  78.358  1.00 36.08 ? 212 SER C OG  1 
ATOM 2688 N N   . TYR C 1 73  ? -8.131  30.573  76.626  1.00 38.43 ? 213 TYR C N   1 
ATOM 2689 C CA  . TYR C 1 73  ? -8.823  29.291  76.527  1.00 37.18 ? 213 TYR C CA  1 
ATOM 2690 C C   . TYR C 1 73  ? -7.795  28.175  76.465  1.00 36.53 ? 213 TYR C C   1 
ATOM 2691 O O   . TYR C 1 73  ? -6.773  28.301  75.791  1.00 37.06 ? 213 TYR C O   1 
ATOM 2692 C CB  . TYR C 1 73  ? -9.662  29.223  75.251  1.00 38.11 ? 213 TYR C CB  1 
ATOM 2693 C CG  . TYR C 1 73  ? -10.957 29.997  75.269  1.00 38.45 ? 213 TYR C CG  1 
ATOM 2694 C CD1 . TYR C 1 73  ? -10.963 31.385  75.285  1.00 39.00 ? 213 TYR C CD1 1 
ATOM 2695 C CD2 . TYR C 1 73  ? -12.183 29.332  75.230  1.00 39.54 ? 213 TYR C CD2 1 
ATOM 2696 C CE1 . TYR C 1 73  ? -12.163 32.097  75.257  1.00 41.72 ? 213 TYR C CE1 1 
ATOM 2697 C CE2 . TYR C 1 73  ? -13.383 30.030  75.201  1.00 39.78 ? 213 TYR C CE2 1 
ATOM 2698 C CZ  . TYR C 1 73  ? -13.368 31.411  75.214  1.00 41.89 ? 213 TYR C CZ  1 
ATOM 2699 O OH  . TYR C 1 73  ? -14.557 32.105  75.174  1.00 43.71 ? 213 TYR C OH  1 
ATOM 2700 N N   . PRO C 1 74  ? -8.046  27.062  77.162  1.00 35.85 ? 214 PRO C N   1 
ATOM 2701 C CA  . PRO C 1 74  ? -7.065  25.979  77.103  1.00 35.73 ? 214 PRO C CA  1 
ATOM 2702 C C   . PRO C 1 74  ? -7.061  25.345  75.714  1.00 36.82 ? 214 PRO C C   1 
ATOM 2703 O O   . PRO C 1 74  ? -8.059  25.419  74.993  1.00 37.27 ? 214 PRO C O   1 
ATOM 2704 C CB  . PRO C 1 74  ? -7.556  25.018  78.181  1.00 34.35 ? 214 PRO C CB  1 
ATOM 2705 C CG  . PRO C 1 74  ? -9.020  25.210  78.151  1.00 34.62 ? 214 PRO C CG  1 
ATOM 2706 C CD  . PRO C 1 74  ? -9.159  26.712  78.059  1.00 35.69 ? 214 PRO C CD  1 
ATOM 2707 N N   . TRP C 1 75  ? -5.938  24.744  75.328  1.00 36.78 ? 215 TRP C N   1 
ATOM 2708 C CA  . TRP C 1 75  ? -5.854  24.093  74.028  1.00 35.33 ? 215 TRP C CA  1 
ATOM 2709 C C   . TRP C 1 75  ? -6.756  22.867  74.032  1.00 35.68 ? 215 TRP C C   1 
ATOM 2710 O O   . TRP C 1 75  ? -6.727  22.072  74.970  1.00 35.96 ? 215 TRP C O   1 
ATOM 2711 C CB  . TRP C 1 75  ? -4.424  23.648  73.727  1.00 34.21 ? 215 TRP C CB  1 
ATOM 2712 C CG  . TRP C 1 75  ? -3.466  24.754  73.450  1.00 34.62 ? 215 TRP C CG  1 
ATOM 2713 C CD1 . TRP C 1 75  ? -2.466  25.197  74.266  1.00 34.03 ? 215 TRP C CD1 1 
ATOM 2714 C CD2 . TRP C 1 75  ? -3.373  25.524  72.247  1.00 35.53 ? 215 TRP C CD2 1 
ATOM 2715 N NE1 . TRP C 1 75  ? -1.751  26.192  73.644  1.00 34.70 ? 215 TRP C NE1 1 
ATOM 2716 C CE2 . TRP C 1 75  ? -2.288  26.413  72.401  1.00 35.39 ? 215 TRP C CE2 1 
ATOM 2717 C CE3 . TRP C 1 75  ? -4.102  25.548  71.049  1.00 35.18 ? 215 TRP C CE3 1 
ATOM 2718 C CZ2 . TRP C 1 75  ? -1.910  27.318  71.403  1.00 36.01 ? 215 TRP C CZ2 1 
ATOM 2719 C CZ3 . TRP C 1 75  ? -3.727  26.446  70.056  1.00 36.00 ? 215 TRP C CZ3 1 
ATOM 2720 C CH2 . TRP C 1 75  ? -2.639  27.319  70.241  1.00 35.60 ? 215 TRP C CH2 1 
ATOM 2721 N N   . LEU C 1 76  ? -7.557  22.713  72.985  1.00 36.17 ? 216 LEU C N   1 
ATOM 2722 C CA  . LEU C 1 76  ? -8.453  21.570  72.884  1.00 36.98 ? 216 LEU C CA  1 
ATOM 2723 C C   . LEU C 1 76  ? -8.350  20.913  71.522  1.00 37.44 ? 216 LEU C C   1 
ATOM 2724 O O   . LEU C 1 76  ? -8.073  21.576  70.524  1.00 38.34 ? 216 LEU C O   1 
ATOM 2725 C CB  . LEU C 1 76  ? -9.903  22.002  73.123  1.00 37.35 ? 216 LEU C CB  1 
ATOM 2726 C CG  . LEU C 1 76  ? -10.241 22.528  74.521  1.00 38.92 ? 216 LEU C CG  1 
ATOM 2727 C CD1 . LEU C 1 76  ? -11.708 22.933  74.578  1.00 37.61 ? 216 LEU C CD1 1 
ATOM 2728 C CD2 . LEU C 1 76  ? -9.941  21.455  75.563  1.00 38.37 ? 216 LEU C CD2 1 
ATOM 2729 N N   . TRP C 1 77  ? -8.555  19.601  71.487  1.00 38.50 ? 217 TRP C N   1 
ATOM 2730 C CA  . TRP C 1 77  ? -8.526  18.870  70.234  1.00 39.61 ? 217 TRP C CA  1 
ATOM 2731 C C   . TRP C 1 77  ? -9.923  19.008  69.655  1.00 40.82 ? 217 TRP C C   1 
ATOM 2732 O O   . TRP C 1 77  ? -10.824 19.513  70.321  1.00 42.74 ? 217 TRP C O   1 
ATOM 2733 C CB  . TRP C 1 77  ? -8.196  17.396  70.467  1.00 39.19 ? 217 TRP C CB  1 
ATOM 2734 C CG  . TRP C 1 77  ? -6.839  17.180  71.055  1.00 40.97 ? 217 TRP C CG  1 
ATOM 2735 C CD1 . TRP C 1 77  ? -6.543  16.916  72.361  1.00 41.82 ? 217 TRP C CD1 1 
ATOM 2736 C CD2 . TRP C 1 77  ? -5.585  17.241  70.363  1.00 41.86 ? 217 TRP C CD2 1 
ATOM 2737 N NE1 . TRP C 1 77  ? -5.182  16.807  72.526  1.00 42.64 ? 217 TRP C NE1 1 
ATOM 2738 C CE2 . TRP C 1 77  ? -4.570  17.000  71.315  1.00 42.20 ? 217 TRP C CE2 1 
ATOM 2739 C CE3 . TRP C 1 77  ? -5.220  17.473  69.029  1.00 41.42 ? 217 TRP C CE3 1 
ATOM 2740 C CZ2 . TRP C 1 77  ? -3.211  16.988  70.979  1.00 41.75 ? 217 TRP C CZ2 1 
ATOM 2741 C CZ3 . TRP C 1 77  ? -3.869  17.462  68.695  1.00 41.63 ? 217 TRP C CZ3 1 
ATOM 2742 C CH2 . TRP C 1 77  ? -2.882  17.218  69.669  1.00 41.98 ? 217 TRP C CH2 1 
ATOM 2743 N N   . GLU C 1 78  ? -10.114 18.573  68.419  1.00 41.59 ? 218 GLU C N   1 
ATOM 2744 C CA  . GLU C 1 78  ? -11.426 18.686  67.810  1.00 41.92 ? 218 GLU C CA  1 
ATOM 2745 C C   . GLU C 1 78  ? -12.516 18.095  68.696  1.00 40.77 ? 218 GLU C C   1 
ATOM 2746 O O   . GLU C 1 78  ? -13.517 18.758  68.967  1.00 40.47 ? 218 GLU C O   1 
ATOM 2747 C CB  . GLU C 1 78  ? -11.433 18.015  66.435  1.00 43.65 ? 218 GLU C CB  1 
ATOM 2748 C CG  . GLU C 1 78  ? -10.750 18.829  65.353  1.00 45.83 ? 218 GLU C CG  1 
ATOM 2749 C CD  . GLU C 1 78  ? -10.654 18.084  64.035  1.00 48.56 ? 218 GLU C CD  1 
ATOM 2750 O OE1 . GLU C 1 78  ? -10.014 17.013  64.002  1.00 51.44 ? 218 GLU C OE1 1 
ATOM 2751 O OE2 . GLU C 1 78  ? -11.214 18.565  63.030  1.00 49.22 ? 218 GLU C OE2 1 
ATOM 2752 N N   . ASP C 1 79  ? -12.321 16.864  69.164  1.00 39.22 ? 219 ASP C N   1 
ATOM 2753 C CA  . ASP C 1 79  ? -13.328 16.219  70.004  1.00 38.58 ? 219 ASP C CA  1 
ATOM 2754 C C   . ASP C 1 79  ? -13.635 16.970  71.298  1.00 38.09 ? 219 ASP C C   1 
ATOM 2755 O O   . ASP C 1 79  ? -14.547 16.600  72.036  1.00 38.24 ? 219 ASP C O   1 
ATOM 2756 C CB  . ASP C 1 79  ? -12.924 14.779  70.339  1.00 37.67 ? 219 ASP C CB  1 
ATOM 2757 C CG  . ASP C 1 79  ? -11.597 14.693  71.054  1.00 37.66 ? 219 ASP C CG  1 
ATOM 2758 O OD1 . ASP C 1 79  ? -11.268 15.620  71.822  1.00 40.20 ? 219 ASP C OD1 1 
ATOM 2759 O OD2 . ASP C 1 79  ? -10.887 13.686  70.862  1.00 36.17 ? 219 ASP C OD2 1 
ATOM 2760 N N   . GLY C 1 80  ? -12.871 18.019  71.576  1.00 37.64 ? 220 GLY C N   1 
ATOM 2761 C CA  . GLY C 1 80  ? -13.110 18.791  72.779  1.00 36.86 ? 220 GLY C CA  1 
ATOM 2762 C C   . GLY C 1 80  ? -12.282 18.365  73.970  1.00 37.51 ? 220 GLY C C   1 
ATOM 2763 O O   . GLY C 1 80  ? -12.278 19.054  74.991  1.00 38.13 ? 220 GLY C O   1 
ATOM 2764 N N   . SER C 1 81  ? -11.593 17.232  73.857  1.00 36.58 ? 221 SER C N   1 
ATOM 2765 C CA  . SER C 1 81  ? -10.756 16.758  74.951  1.00 36.57 ? 221 SER C CA  1 
ATOM 2766 C C   . SER C 1 81  ? -9.559  17.699  75.036  1.00 36.23 ? 221 SER C C   1 
ATOM 2767 O O   . SER C 1 81  ? -9.173  18.317  74.046  1.00 37.59 ? 221 SER C O   1 
ATOM 2768 C CB  . SER C 1 81  ? -10.287 15.325  74.694  1.00 37.54 ? 221 SER C CB  1 
ATOM 2769 O OG  . SER C 1 81  ? -9.305  15.279  73.675  1.00 40.26 ? 221 SER C OG  1 
ATOM 2770 N N   . PRO C 1 82  ? -8.952  17.815  76.220  1.00 35.31 ? 222 PRO C N   1 
ATOM 2771 C CA  . PRO C 1 82  ? -7.800  18.691  76.439  1.00 35.02 ? 222 PRO C CA  1 
ATOM 2772 C C   . PRO C 1 82  ? -6.449  18.136  76.001  1.00 35.51 ? 222 PRO C C   1 
ATOM 2773 O O   . PRO C 1 82  ? -6.284  16.932  75.799  1.00 35.65 ? 222 PRO C O   1 
ATOM 2774 C CB  . PRO C 1 82  ? -7.845  18.912  77.938  1.00 34.56 ? 222 PRO C CB  1 
ATOM 2775 C CG  . PRO C 1 82  ? -8.228  17.542  78.420  1.00 34.74 ? 222 PRO C CG  1 
ATOM 2776 C CD  . PRO C 1 82  ? -9.356  17.163  77.477  1.00 34.23 ? 222 PRO C CD  1 
ATOM 2777 N N   . LEU C 1 83  ? -5.486  19.039  75.860  1.00 35.49 ? 223 LEU C N   1 
ATOM 2778 C CA  . LEU C 1 83  ? -4.130  18.670  75.494  1.00 35.58 ? 223 LEU C CA  1 
ATOM 2779 C C   . LEU C 1 83  ? -3.517  18.125  76.771  1.00 37.47 ? 223 LEU C C   1 
ATOM 2780 O O   . LEU C 1 83  ? -3.642  18.738  77.826  1.00 40.55 ? 223 LEU C O   1 
ATOM 2781 C CB  . LEU C 1 83  ? -3.345  19.905  75.037  1.00 32.86 ? 223 LEU C CB  1 
ATOM 2782 C CG  . LEU C 1 83  ? -1.828  19.746  74.871  1.00 33.20 ? 223 LEU C CG  1 
ATOM 2783 C CD1 . LEU C 1 83  ? -1.526  18.710  73.802  1.00 32.67 ? 223 LEU C CD1 1 
ATOM 2784 C CD2 . LEU C 1 83  ? -1.205  21.076  74.493  1.00 32.31 ? 223 LEU C CD2 1 
ATOM 2785 N N   . MET C 1 84  ? -2.876  16.968  76.695  1.00 38.26 ? 224 MET C N   1 
ATOM 2786 C CA  . MET C 1 84  ? -2.255  16.406  77.882  1.00 38.36 ? 224 MET C CA  1 
ATOM 2787 C C   . MET C 1 84  ? -0.848  16.959  78.014  1.00 37.77 ? 224 MET C C   1 
ATOM 2788 O O   . MET C 1 84  ? -0.189  17.253  77.018  1.00 37.51 ? 224 MET C O   1 
ATOM 2789 C CB  . MET C 1 84  ? -2.228  14.880  77.806  1.00 41.64 ? 224 MET C CB  1 
ATOM 2790 C CG  . MET C 1 84  ? -3.601  14.244  77.967  1.00 46.72 ? 224 MET C CG  1 
ATOM 2791 S SD  . MET C 1 84  ? -4.393  14.677  79.541  1.00 50.38 ? 224 MET C SD  1 
ATOM 2792 C CE  . MET C 1 84  ? -3.965  13.252  80.541  1.00 49.16 ? 224 MET C CE  1 
ATOM 2793 N N   . PRO C 1 85  ? -0.372  17.121  79.256  1.00 37.37 ? 225 PRO C N   1 
ATOM 2794 C CA  . PRO C 1 85  ? 0.962   17.645  79.552  1.00 36.73 ? 225 PRO C CA  1 
ATOM 2795 C C   . PRO C 1 85  ? 2.116   16.731  79.155  1.00 37.25 ? 225 PRO C C   1 
ATOM 2796 O O   . PRO C 1 85  ? 1.955   15.519  79.019  1.00 36.28 ? 225 PRO C O   1 
ATOM 2797 C CB  . PRO C 1 85  ? 0.904   17.878  81.057  1.00 35.22 ? 225 PRO C CB  1 
ATOM 2798 C CG  . PRO C 1 85  ? 0.028   16.775  81.509  1.00 36.74 ? 225 PRO C CG  1 
ATOM 2799 C CD  . PRO C 1 85  ? -1.093  16.817  80.502  1.00 36.85 ? 225 PRO C CD  1 
ATOM 2800 N N   . HIS C 1 86  ? 3.281   17.340  78.964  1.00 38.47 ? 226 HIS C N   1 
ATOM 2801 C CA  . HIS C 1 86  ? 4.495   16.620  78.611  1.00 40.43 ? 226 HIS C CA  1 
ATOM 2802 C C   . HIS C 1 86  ? 4.491   15.979  77.227  1.00 40.83 ? 226 HIS C C   1 
ATOM 2803 O O   . HIS C 1 86  ? 5.321   15.111  76.946  1.00 42.82 ? 226 HIS C O   1 
ATOM 2804 C CB  . HIS C 1 86  ? 4.788   15.555  79.669  1.00 42.30 ? 226 HIS C CB  1 
ATOM 2805 C CG  . HIS C 1 86  ? 4.783   16.084  81.068  1.00 44.76 ? 226 HIS C CG  1 
ATOM 2806 N ND1 . HIS C 1 86  ? 5.619   17.099  81.484  1.00 44.86 ? 226 HIS C ND1 1 
ATOM 2807 C CD2 . HIS C 1 86  ? 4.029   15.754  82.144  1.00 45.02 ? 226 HIS C CD2 1 
ATOM 2808 C CE1 . HIS C 1 86  ? 5.378   17.371  82.754  1.00 46.25 ? 226 HIS C CE1 1 
ATOM 2809 N NE2 . HIS C 1 86  ? 4.417   16.569  83.178  1.00 46.92 ? 226 HIS C NE2 1 
ATOM 2810 N N   . LEU C 1 87  ? 3.569   16.394  76.362  1.00 38.98 ? 227 LEU C N   1 
ATOM 2811 C CA  . LEU C 1 87  ? 3.518   15.847  75.012  1.00 36.83 ? 227 LEU C CA  1 
ATOM 2812 C C   . LEU C 1 87  ? 4.381   16.703  74.104  1.00 35.75 ? 227 LEU C C   1 
ATOM 2813 O O   . LEU C 1 87  ? 5.263   16.201  73.403  1.00 35.19 ? 227 LEU C O   1 
ATOM 2814 C CB  . LEU C 1 87  ? 2.082   15.818  74.497  1.00 37.22 ? 227 LEU C CB  1 
ATOM 2815 C CG  . LEU C 1 87  ? 1.245   14.686  75.092  1.00 37.91 ? 227 LEU C CG  1 
ATOM 2816 C CD1 . LEU C 1 87  ? -0.134  14.669  74.457  1.00 39.30 ? 227 LEU C CD1 1 
ATOM 2817 C CD2 . LEU C 1 87  ? 1.952   13.362  74.850  1.00 37.12 ? 227 LEU C CD2 1 
ATOM 2818 N N   . PHE C 1 88  ? 4.113   18.003  74.128  1.00 33.88 ? 228 PHE C N   1 
ATOM 2819 C CA  . PHE C 1 88  ? 4.859   18.971  73.336  1.00 33.17 ? 228 PHE C CA  1 
ATOM 2820 C C   . PHE C 1 88  ? 4.464   20.358  73.815  1.00 33.77 ? 228 PHE C C   1 
ATOM 2821 O O   . PHE C 1 88  ? 3.400   20.533  74.411  1.00 34.51 ? 228 PHE C O   1 
ATOM 2822 C CB  . PHE C 1 88  ? 4.570   18.793  71.833  1.00 31.62 ? 228 PHE C CB  1 
ATOM 2823 C CG  . PHE C 1 88  ? 3.115   18.901  71.460  1.00 29.65 ? 228 PHE C CG  1 
ATOM 2824 C CD1 . PHE C 1 88  ? 2.540   20.136  71.181  1.00 30.67 ? 228 PHE C CD1 1 
ATOM 2825 C CD2 . PHE C 1 88  ? 2.318   17.765  71.380  1.00 28.28 ? 228 PHE C CD2 1 
ATOM 2826 C CE1 . PHE C 1 88  ? 1.197   20.236  70.826  1.00 28.19 ? 228 PHE C CE1 1 
ATOM 2827 C CE2 . PHE C 1 88  ? 0.980   17.859  71.028  1.00 26.90 ? 228 PHE C CE2 1 
ATOM 2828 C CZ  . PHE C 1 88  ? 0.419   19.097  70.751  1.00 27.34 ? 228 PHE C CZ  1 
ATOM 2829 N N   . ARG C 1 89  ? 5.334   21.336  73.587  1.00 34.86 ? 229 ARG C N   1 
ATOM 2830 C CA  . ARG C 1 89  ? 5.062   22.707  74.003  1.00 36.38 ? 229 ARG C CA  1 
ATOM 2831 C C   . ARG C 1 89  ? 4.834   23.578  72.775  1.00 36.07 ? 229 ARG C C   1 
ATOM 2832 O O   . ARG C 1 89  ? 5.744   23.781  71.972  1.00 37.30 ? 229 ARG C O   1 
ATOM 2833 C CB  . ARG C 1 89  ? 6.233   23.246  74.828  1.00 38.18 ? 229 ARG C CB  1 
ATOM 2834 C CG  . ARG C 1 89  ? 6.073   24.686  75.298  1.00 44.25 ? 229 ARG C CG  1 
ATOM 2835 C CD  . ARG C 1 89  ? 7.184   25.065  76.272  1.00 48.17 ? 229 ARG C CD  1 
ATOM 2836 N NE  . ARG C 1 89  ? 6.988   24.477  77.598  1.00 52.84 ? 229 ARG C NE  1 
ATOM 2837 C CZ  . ARG C 1 89  ? 6.190   24.984  78.536  1.00 53.37 ? 229 ARG C CZ  1 
ATOM 2838 N NH1 . ARG C 1 89  ? 5.507   26.096  78.299  1.00 53.38 ? 229 ARG C NH1 1 
ATOM 2839 N NH2 . ARG C 1 89  ? 6.077   24.383  79.714  1.00 53.17 ? 229 ARG C NH2 1 
ATOM 2840 N N   . VAL C 1 90  ? 3.615   24.086  72.631  1.00 34.31 ? 230 VAL C N   1 
ATOM 2841 C CA  . VAL C 1 90  ? 3.275   24.919  71.489  1.00 32.71 ? 230 VAL C CA  1 
ATOM 2842 C C   . VAL C 1 90  ? 4.071   26.216  71.461  1.00 32.05 ? 230 VAL C C   1 
ATOM 2843 O O   . VAL C 1 90  ? 4.086   26.960  72.437  1.00 31.54 ? 230 VAL C O   1 
ATOM 2844 C CB  . VAL C 1 90  ? 1.780   25.270  71.482  1.00 32.51 ? 230 VAL C CB  1 
ATOM 2845 C CG1 . VAL C 1 90  ? 1.449   26.084  70.240  1.00 31.25 ? 230 VAL C CG1 1 
ATOM 2846 C CG2 . VAL C 1 90  ? 0.949   24.000  71.529  1.00 31.20 ? 230 VAL C CG2 1 
ATOM 2847 N N   . ARG C 1 91  ? 4.726   26.476  70.333  1.00 31.91 ? 231 ARG C N   1 
ATOM 2848 C CA  . ARG C 1 91  ? 5.528   27.682  70.152  1.00 32.76 ? 231 ARG C CA  1 
ATOM 2849 C C   . ARG C 1 91  ? 4.798   28.754  69.349  1.00 33.95 ? 231 ARG C C   1 
ATOM 2850 O O   . ARG C 1 91  ? 3.574   28.838  69.360  1.00 36.73 ? 231 ARG C O   1 
ATOM 2851 C CB  . ARG C 1 91  ? 6.827   27.354  69.417  1.00 31.88 ? 231 ARG C CB  1 
ATOM 2852 C CG  . ARG C 1 91  ? 7.922   26.762  70.258  1.00 32.22 ? 231 ARG C CG  1 
ATOM 2853 C CD  . ARG C 1 91  ? 7.840   25.260  70.320  1.00 33.89 ? 231 ARG C CD  1 
ATOM 2854 N NE  . ARG C 1 91  ? 9.165   24.690  70.545  1.00 35.01 ? 231 ARG C NE  1 
ATOM 2855 C CZ  . ARG C 1 91  ? 9.457   23.400  70.439  1.00 34.22 ? 231 ARG C CZ  1 
ATOM 2856 N NH1 . ARG C 1 91  ? 8.512   22.529  70.110  1.00 34.49 ? 231 ARG C NH1 1 
ATOM 2857 N NH2 . ARG C 1 91  ? 10.700  22.987  70.651  1.00 33.77 ? 231 ARG C NH2 1 
ATOM 2858 N N   . GLY C 1 92  ? 5.579   29.574  68.655  1.00 34.43 ? 232 GLY C N   1 
ATOM 2859 C CA  . GLY C 1 92  ? 5.029   30.622  67.821  1.00 36.92 ? 232 GLY C CA  1 
ATOM 2860 C C   . GLY C 1 92  ? 4.296   31.737  68.534  1.00 38.37 ? 232 GLY C C   1 
ATOM 2861 O O   . GLY C 1 92  ? 4.555   32.025  69.701  1.00 38.13 ? 232 GLY C O   1 
ATOM 2862 N N   . ALA C 1 93  ? 3.375   32.364  67.805  1.00 39.34 ? 233 ALA C N   1 
ATOM 2863 C CA  . ALA C 1 93  ? 2.573   33.467  68.314  1.00 39.54 ? 233 ALA C CA  1 
ATOM 2864 C C   . ALA C 1 93  ? 1.504   32.967  69.272  1.00 40.23 ? 233 ALA C C   1 
ATOM 2865 O O   . ALA C 1 93  ? 0.322   32.911  68.927  1.00 40.16 ? 233 ALA C O   1 
ATOM 2866 C CB  . ALA C 1 93  ? 1.925   34.206  67.157  1.00 40.19 ? 233 ALA C CB  1 
ATOM 2867 N N   . VAL C 1 94  ? 1.933   32.611  70.479  1.00 40.24 ? 234 VAL C N   1 
ATOM 2868 C CA  . VAL C 1 94  ? 1.035   32.108  71.512  1.00 39.53 ? 234 VAL C CA  1 
ATOM 2869 C C   . VAL C 1 94  ? 0.431   33.223  72.355  1.00 40.47 ? 234 VAL C C   1 
ATOM 2870 O O   . VAL C 1 94  ? -0.139  32.964  73.414  1.00 41.55 ? 234 VAL C O   1 
ATOM 2871 C CB  . VAL C 1 94  ? 1.769   31.140  72.463  1.00 37.70 ? 234 VAL C CB  1 
ATOM 2872 C CG1 . VAL C 1 94  ? 1.904   29.777  71.816  1.00 36.71 ? 234 VAL C CG1 1 
ATOM 2873 C CG2 . VAL C 1 94  ? 3.138   31.695  72.804  1.00 34.45 ? 234 VAL C CG2 1 
ATOM 2874 N N   . SER C 1 95  ? 0.540   34.460  71.884  1.00 40.86 ? 235 SER C N   1 
ATOM 2875 C CA  . SER C 1 95  ? 0.016   35.591  72.638  1.00 42.35 ? 235 SER C CA  1 
ATOM 2876 C C   . SER C 1 95  ? -1.046  36.408  71.913  1.00 42.65 ? 235 SER C C   1 
ATOM 2877 O O   . SER C 1 95  ? -1.857  37.079  72.552  1.00 43.12 ? 235 SER C O   1 
ATOM 2878 C CB  . SER C 1 95  ? 1.166   36.509  73.048  1.00 43.62 ? 235 SER C CB  1 
ATOM 2879 O OG  . SER C 1 95  ? 1.878   36.965  71.909  1.00 46.80 ? 235 SER C OG  1 
ATOM 2880 N N   . GLN C 1 96  ? -1.047  36.361  70.585  1.00 42.54 ? 236 GLN C N   1 
ATOM 2881 C CA  . GLN C 1 96  ? -2.027  37.122  69.822  1.00 42.45 ? 236 GLN C CA  1 
ATOM 2882 C C   . GLN C 1 96  ? -3.420  36.515  69.853  1.00 42.76 ? 236 GLN C C   1 
ATOM 2883 O O   . GLN C 1 96  ? -3.663  35.478  70.473  1.00 41.99 ? 236 GLN C O   1 
ATOM 2884 C CB  . GLN C 1 96  ? -1.592  37.271  68.362  1.00 42.44 ? 236 GLN C CB  1 
ATOM 2885 C CG  . GLN C 1 96  ? -0.355  38.111  68.168  1.00 45.25 ? 236 GLN C CG  1 
ATOM 2886 C CD  . GLN C 1 96  ? 0.915   37.291  68.207  1.00 48.85 ? 236 GLN C CD  1 
ATOM 2887 O OE1 . GLN C 1 96  ? 1.097   36.439  69.078  1.00 51.33 ? 236 GLN C OE1 1 
ATOM 2888 N NE2 . GLN C 1 96  ? 1.811   37.552  67.263  1.00 50.08 ? 236 GLN C NE2 1 
ATOM 2889 N N   . THR C 1 97  ? -4.334  37.202  69.181  1.00 42.80 ? 237 THR C N   1 
ATOM 2890 C CA  . THR C 1 97  ? -5.715  36.770  69.055  1.00 43.02 ? 237 THR C CA  1 
ATOM 2891 C C   . THR C 1 97  ? -6.026  36.880  67.573  1.00 43.82 ? 237 THR C C   1 
ATOM 2892 O O   . THR C 1 97  ? -5.412  37.678  66.866  1.00 45.92 ? 237 THR C O   1 
ATOM 2893 C CB  . THR C 1 97  ? -6.678  37.687  69.819  1.00 41.29 ? 237 THR C CB  1 
ATOM 2894 O OG1 . THR C 1 97  ? -6.413  37.600  71.224  1.00 43.12 ? 237 THR C OG1 1 
ATOM 2895 C CG2 . THR C 1 97  ? -8.113  37.279  69.552  1.00 40.62 ? 237 THR C CG2 1 
ATOM 2896 N N   . TYR C 1 98  ? -6.955  36.069  67.091  1.00 43.01 ? 238 TYR C N   1 
ATOM 2897 C CA  . TYR C 1 98  ? -7.315  36.126  65.688  1.00 42.35 ? 238 TYR C CA  1 
ATOM 2898 C C   . TYR C 1 98  ? -8.809  35.891  65.547  1.00 41.69 ? 238 TYR C C   1 
ATOM 2899 O O   . TYR C 1 98  ? -9.384  35.040  66.224  1.00 41.03 ? 238 TYR C O   1 
ATOM 2900 C CB  . TYR C 1 98  ? -6.519  35.094  64.887  1.00 43.62 ? 238 TYR C CB  1 
ATOM 2901 C CG  . TYR C 1 98  ? -5.014  35.247  65.007  1.00 44.95 ? 238 TYR C CG  1 
ATOM 2902 C CD1 . TYR C 1 98  ? -4.305  34.627  66.040  1.00 45.94 ? 238 TYR C CD1 1 
ATOM 2903 C CD2 . TYR C 1 98  ? -4.297  36.012  64.089  1.00 44.34 ? 238 TYR C CD2 1 
ATOM 2904 C CE1 . TYR C 1 98  ? -2.916  34.767  66.149  1.00 45.71 ? 238 TYR C CE1 1 
ATOM 2905 C CE2 . TYR C 1 98  ? -2.915  36.158  64.188  1.00 45.33 ? 238 TYR C CE2 1 
ATOM 2906 C CZ  . TYR C 1 98  ? -2.230  35.533  65.219  1.00 45.38 ? 238 TYR C CZ  1 
ATOM 2907 O OH  . TYR C 1 98  ? -0.865  35.674  65.315  1.00 43.98 ? 238 TYR C OH  1 
ATOM 2908 N N   . PRO C 1 99  ? -9.459  36.658  64.664  1.00 41.54 ? 239 PRO C N   1 
ATOM 2909 C CA  . PRO C 1 99  ? -10.901 36.570  64.406  1.00 41.23 ? 239 PRO C CA  1 
ATOM 2910 C C   . PRO C 1 99  ? -11.377 35.132  64.267  1.00 40.76 ? 239 PRO C C   1 
ATOM 2911 O O   . PRO C 1 99  ? -12.393 34.739  64.832  1.00 40.92 ? 239 PRO C O   1 
ATOM 2912 C CB  . PRO C 1 99  ? -11.063 37.353  63.109  1.00 41.68 ? 239 PRO C CB  1 
ATOM 2913 C CG  . PRO C 1 99  ? -9.966  38.378  63.201  1.00 41.43 ? 239 PRO C CG  1 
ATOM 2914 C CD  . PRO C 1 99  ? -8.807  37.563  63.702  1.00 40.69 ? 239 PRO C CD  1 
ATOM 2915 N N   . SER C 1 100 ? -10.624 34.352  63.505  1.00 41.06 ? 240 SER C N   1 
ATOM 2916 C CA  . SER C 1 100 ? -10.952 32.956  63.270  1.00 40.67 ? 240 SER C CA  1 
ATOM 2917 C C   . SER C 1 100 ? -10.464 32.042  64.390  1.00 39.31 ? 240 SER C C   1 
ATOM 2918 O O   . SER C 1 100 ? -10.805 30.859  64.426  1.00 37.66 ? 240 SER C O   1 
ATOM 2919 C CB  . SER C 1 100 ? -10.352 32.512  61.937  1.00 42.67 ? 240 SER C CB  1 
ATOM 2920 O OG  . SER C 1 100 ? -9.010  32.953  61.817  1.00 46.15 ? 240 SER C OG  1 
ATOM 2921 N N   . GLY C 1 101 ? -9.671  32.593  65.304  1.00 38.61 ? 241 GLY C N   1 
ATOM 2922 C CA  . GLY C 1 101 ? -9.156  31.806  66.410  1.00 37.92 ? 241 GLY C CA  1 
ATOM 2923 C C   . GLY C 1 101 ? -7.728  31.361  66.171  1.00 37.38 ? 241 GLY C C   1 
ATOM 2924 O O   . GLY C 1 101 ? -7.187  31.546  65.075  1.00 36.89 ? 241 GLY C O   1 
ATOM 2925 N N   . THR C 1 102 ? -7.113  30.773  67.194  1.00 35.10 ? 242 THR C N   1 
ATOM 2926 C CA  . THR C 1 102 ? -5.738  30.305  67.081  1.00 32.33 ? 242 THR C CA  1 
ATOM 2927 C C   . THR C 1 102 ? -5.668  28.787  66.974  1.00 29.51 ? 242 THR C C   1 
ATOM 2928 O O   . THR C 1 102 ? -6.176  28.062  67.827  1.00 28.78 ? 242 THR C O   1 
ATOM 2929 C CB  . THR C 1 102 ? -4.899  30.770  68.278  1.00 33.53 ? 242 THR C CB  1 
ATOM 2930 O OG1 . THR C 1 102 ? -5.015  32.194  68.409  1.00 35.73 ? 242 THR C OG1 1 
ATOM 2931 C CG2 . THR C 1 102 ? -3.429  30.403  68.076  1.00 32.62 ? 242 THR C CG2 1 
ATOM 2932 N N   . CYS C 1 103 ? -5.029  28.321  65.909  1.00 27.03 ? 243 CYS C N   1 
ATOM 2933 C CA  . CYS C 1 103 ? -4.883  26.900  65.645  1.00 26.09 ? 243 CYS C CA  1 
ATOM 2934 C C   . CYS C 1 103 ? -3.423  26.497  65.744  1.00 25.03 ? 243 CYS C C   1 
ATOM 2935 O O   . CYS C 1 103 ? -2.539  27.350  65.743  1.00 24.50 ? 243 CYS C O   1 
ATOM 2936 C CB  . CYS C 1 103 ? -5.441  26.582  64.253  1.00 28.16 ? 243 CYS C CB  1 
ATOM 2937 S SG  . CYS C 1 103 ? -7.251  26.755  64.207  1.00 28.71 ? 243 CYS C SG  1 
ATOM 2938 N N   . ALA C 1 104 ? -3.169  25.198  65.833  1.00 24.10 ? 244 ALA C N   1 
ATOM 2939 C CA  . ALA C 1 104 ? -1.801  24.702  65.944  1.00 24.86 ? 244 ALA C CA  1 
ATOM 2940 C C   . ALA C 1 104 ? -1.409  23.797  64.781  1.00 25.04 ? 244 ALA C C   1 
ATOM 2941 O O   . ALA C 1 104 ? -2.150  22.887  64.407  1.00 23.72 ? 244 ALA C O   1 
ATOM 2942 C CB  . ALA C 1 104 ? -1.625  23.960  67.260  1.00 24.41 ? 244 ALA C CB  1 
ATOM 2943 N N   . TYR C 1 105 ? -0.241  24.062  64.205  1.00 26.11 ? 245 TYR C N   1 
ATOM 2944 C CA  . TYR C 1 105 ? 0.262   23.268  63.092  1.00 27.37 ? 245 TYR C CA  1 
ATOM 2945 C C   . TYR C 1 105 ? 1.608   22.686  63.486  1.00 28.61 ? 245 TYR C C   1 
ATOM 2946 O O   . TYR C 1 105 ? 2.091   22.929  64.590  1.00 30.04 ? 245 TYR C O   1 
ATOM 2947 C CB  . TYR C 1 105 ? 0.386   24.123  61.822  1.00 26.49 ? 245 TYR C CB  1 
ATOM 2948 C CG  . TYR C 1 105 ? 1.399   25.248  61.877  1.00 26.85 ? 245 TYR C CG  1 
ATOM 2949 C CD1 . TYR C 1 105 ? 2.759   25.007  61.664  1.00 27.46 ? 245 TYR C CD1 1 
ATOM 2950 C CD2 . TYR C 1 105 ? 0.993   26.562  62.104  1.00 27.79 ? 245 TYR C CD2 1 
ATOM 2951 C CE1 . TYR C 1 105 ? 3.689   26.053  61.670  1.00 27.42 ? 245 TYR C CE1 1 
ATOM 2952 C CE2 . TYR C 1 105 ? 1.908   27.610  62.113  1.00 28.45 ? 245 TYR C CE2 1 
ATOM 2953 C CZ  . TYR C 1 105 ? 3.253   27.351  61.895  1.00 28.85 ? 245 TYR C CZ  1 
ATOM 2954 O OH  . TYR C 1 105 ? 4.153   28.394  61.904  1.00 29.12 ? 245 TYR C OH  1 
ATOM 2955 N N   . ILE C 1 106 ? 2.216   21.920  62.591  1.00 28.94 ? 246 ILE C N   1 
ATOM 2956 C CA  . ILE C 1 106 ? 3.495   21.295  62.893  1.00 30.62 ? 246 ILE C CA  1 
ATOM 2957 C C   . ILE C 1 106 ? 4.497   21.425  61.752  1.00 30.46 ? 246 ILE C C   1 
ATOM 2958 O O   . ILE C 1 106 ? 4.222   21.036  60.618  1.00 28.49 ? 246 ILE C O   1 
ATOM 2959 C CB  . ILE C 1 106 ? 3.280   19.799  63.288  1.00 31.85 ? 246 ILE C CB  1 
ATOM 2960 C CG1 . ILE C 1 106 ? 4.467   18.946  62.847  1.00 31.82 ? 246 ILE C CG1 1 
ATOM 2961 C CG2 . ILE C 1 106 ? 1.970   19.288  62.712  1.00 31.84 ? 246 ILE C CG2 1 
ATOM 2962 C CD1 . ILE C 1 106 ? 4.290   17.489  63.162  1.00 35.77 ? 246 ILE C CD1 1 
ATOM 2963 N N   . GLN C 1 107 ? 5.664   21.978  62.078  1.00 31.81 ? 247 GLN C N   1 
ATOM 2964 C CA  . GLN C 1 107 ? 6.731   22.202  61.108  1.00 32.51 ? 247 GLN C CA  1 
ATOM 2965 C C   . GLN C 1 107 ? 8.066   22.431  61.815  1.00 33.00 ? 247 GLN C C   1 
ATOM 2966 O O   . GLN C 1 107 ? 8.107   22.697  63.013  1.00 33.29 ? 247 GLN C O   1 
ATOM 2967 C CB  . GLN C 1 107 ? 6.373   23.416  60.238  1.00 32.96 ? 247 GLN C CB  1 
ATOM 2968 C CG  . GLN C 1 107 ? 7.445   23.858  59.256  1.00 34.98 ? 247 GLN C CG  1 
ATOM 2969 C CD  . GLN C 1 107 ? 6.937   24.894  58.265  1.00 36.32 ? 247 GLN C CD  1 
ATOM 2970 O OE1 . GLN C 1 107 ? 6.394   25.929  58.654  1.00 38.26 ? 247 GLN C OE1 1 
ATOM 2971 N NE2 . GLN C 1 107 ? 7.118   24.620  56.976  1.00 35.73 ? 247 GLN C NE2 1 
ATOM 2972 N N   . ARG C 1 108 ? 9.157   22.320  61.065  1.00 34.33 ? 248 ARG C N   1 
ATOM 2973 C CA  . ARG C 1 108 ? 10.503  22.515  61.603  1.00 34.07 ? 248 ARG C CA  1 
ATOM 2974 C C   . ARG C 1 108 ? 10.824  21.717  62.865  1.00 33.99 ? 248 ARG C C   1 
ATOM 2975 O O   . ARG C 1 108 ? 11.761  22.053  63.591  1.00 34.50 ? 248 ARG C O   1 
ATOM 2976 C CB  . ARG C 1 108 ? 10.758  24.000  61.869  1.00 33.78 ? 248 ARG C CB  1 
ATOM 2977 C CG  . ARG C 1 108 ? 11.231  24.784  60.657  1.00 33.68 ? 248 ARG C CG  1 
ATOM 2978 C CD  . ARG C 1 108 ? 10.938  26.253  60.848  1.00 35.50 ? 248 ARG C CD  1 
ATOM 2979 N NE  . ARG C 1 108 ? 9.596   26.403  61.399  1.00 40.12 ? 248 ARG C NE  1 
ATOM 2980 C CZ  . ARG C 1 108 ? 8.714   27.321  61.021  1.00 41.51 ? 248 ARG C CZ  1 
ATOM 2981 N NH1 . ARG C 1 108 ? 9.022   28.197  60.073  1.00 42.54 ? 248 ARG C NH1 1 
ATOM 2982 N NH2 . ARG C 1 108 ? 7.514   27.353  61.587  1.00 41.54 ? 248 ARG C NH2 1 
ATOM 2983 N N   . GLY C 1 109 ? 10.059  20.658  63.119  1.00 34.23 ? 249 GLY C N   1 
ATOM 2984 C CA  . GLY C 1 109 ? 10.302  19.835  64.290  1.00 32.96 ? 249 GLY C CA  1 
ATOM 2985 C C   . GLY C 1 109 ? 9.614   20.336  65.544  1.00 33.06 ? 249 GLY C C   1 
ATOM 2986 O O   . GLY C 1 109 ? 9.954   19.919  66.646  1.00 34.70 ? 249 GLY C O   1 
ATOM 2987 N N   . ALA C 1 110 ? 8.651   21.236  65.384  1.00 32.22 ? 250 ALA C N   1 
ATOM 2988 C CA  . ALA C 1 110 ? 7.917   21.773  66.524  1.00 33.06 ? 250 ALA C CA  1 
ATOM 2989 C C   . ALA C 1 110 ? 6.488   22.112  66.125  1.00 34.16 ? 250 ALA C C   1 
ATOM 2990 O O   . ALA C 1 110 ? 6.140   22.092  64.947  1.00 35.84 ? 250 ALA C O   1 
ATOM 2991 C CB  . ALA C 1 110 ? 8.615   23.014  67.061  1.00 32.09 ? 250 ALA C CB  1 
ATOM 2992 N N   . VAL C 1 111 ? 5.658   22.415  67.114  1.00 33.33 ? 251 VAL C N   1 
ATOM 2993 C CA  . VAL C 1 111 ? 4.269   22.765  66.859  1.00 32.37 ? 251 VAL C CA  1 
ATOM 2994 C C   . VAL C 1 111 ? 4.107   24.258  67.127  1.00 32.17 ? 251 VAL C C   1 
ATOM 2995 O O   . VAL C 1 111 ? 4.544   24.748  68.166  1.00 33.47 ? 251 VAL C O   1 
ATOM 2996 C CB  . VAL C 1 111 ? 3.330   21.979  67.789  1.00 33.21 ? 251 VAL C CB  1 
ATOM 2997 C CG1 . VAL C 1 111 ? 1.888   22.343  67.497  1.00 35.37 ? 251 VAL C CG1 1 
ATOM 2998 C CG2 . VAL C 1 111 ? 3.556   20.487  67.616  1.00 30.55 ? 251 VAL C CG2 1 
ATOM 2999 N N   . TYR C 1 112 ? 3.484   24.978  66.195  1.00 30.76 ? 252 TYR C N   1 
ATOM 3000 C CA  . TYR C 1 112 ? 3.292   26.422  66.346  1.00 28.33 ? 252 TYR C CA  1 
ATOM 3001 C C   . TYR C 1 112 ? 1.836   26.888  66.336  1.00 29.06 ? 252 TYR C C   1 
ATOM 3002 O O   . TYR C 1 112 ? 0.968   26.264  65.724  1.00 28.75 ? 252 TYR C O   1 
ATOM 3003 C CB  . TYR C 1 112 ? 4.005   27.180  65.234  1.00 25.62 ? 252 TYR C CB  1 
ATOM 3004 C CG  . TYR C 1 112 ? 5.500   27.016  65.156  1.00 25.52 ? 252 TYR C CG  1 
ATOM 3005 C CD1 . TYR C 1 112 ? 6.077   25.793  64.817  1.00 25.02 ? 252 TYR C CD1 1 
ATOM 3006 C CD2 . TYR C 1 112 ? 6.339   28.116  65.324  1.00 24.79 ? 252 TYR C CD2 1 
ATOM 3007 C CE1 . TYR C 1 112 ? 7.457   25.676  64.634  1.00 25.64 ? 252 TYR C CE1 1 
ATOM 3008 C CE2 . TYR C 1 112 ? 7.715   28.011  65.145  1.00 24.32 ? 252 TYR C CE2 1 
ATOM 3009 C CZ  . TYR C 1 112 ? 8.268   26.793  64.795  1.00 25.38 ? 252 TYR C CZ  1 
ATOM 3010 O OH  . TYR C 1 112 ? 9.625   26.702  64.581  1.00 25.84 ? 252 TYR C OH  1 
ATOM 3011 N N   . ALA C 1 113 ? 1.591   28.012  67.003  1.00 29.05 ? 253 ALA C N   1 
ATOM 3012 C CA  . ALA C 1 113 ? 0.265   28.612  67.063  1.00 29.02 ? 253 ALA C CA  1 
ATOM 3013 C C   . ALA C 1 113 ? 0.212   29.611  65.916  1.00 29.60 ? 253 ALA C C   1 
ATOM 3014 O O   . ALA C 1 113 ? 1.155   30.375  65.710  1.00 28.88 ? 253 ALA C O   1 
ATOM 3015 C CB  . ALA C 1 113 ? 0.069   29.319  68.396  1.00 30.48 ? 253 ALA C CB  1 
ATOM 3016 N N   . GLU C 1 114 ? -0.888  29.606  65.172  1.00 30.72 ? 254 GLU C N   1 
ATOM 3017 C CA  . GLU C 1 114 ? -1.032  30.493  64.024  1.00 31.93 ? 254 GLU C CA  1 
ATOM 3018 C C   . GLU C 1 114 ? -2.487  30.901  63.829  1.00 32.28 ? 254 GLU C C   1 
ATOM 3019 O O   . GLU C 1 114 ? -3.378  30.381  64.493  1.00 32.00 ? 254 GLU C O   1 
ATOM 3020 C CB  . GLU C 1 114 ? -0.520  29.765  62.774  1.00 33.21 ? 254 GLU C CB  1 
ATOM 3021 C CG  . GLU C 1 114 ? -0.454  30.584  61.493  1.00 38.19 ? 254 GLU C CG  1 
ATOM 3022 C CD  . GLU C 1 114 ? 0.559   31.716  61.555  1.00 40.50 ? 254 GLU C CD  1 
ATOM 3023 O OE1 . GLU C 1 114 ? 0.213   32.807  62.067  1.00 39.23 ? 254 GLU C OE1 1 
ATOM 3024 O OE2 . GLU C 1 114 ? 1.705   31.508  61.091  1.00 41.77 ? 254 GLU C OE2 1 
ATOM 3025 N N   . ASN C 1 115 ? -2.723  31.839  62.920  1.00 35.01 ? 255 ASN C N   1 
ATOM 3026 C CA  . ASN C 1 115 ? -4.079  32.288  62.627  1.00 37.54 ? 255 ASN C CA  1 
ATOM 3027 C C   . ASN C 1 115 ? -4.798  31.191  61.831  1.00 38.38 ? 255 ASN C C   1 
ATOM 3028 O O   . ASN C 1 115 ? -4.329  30.780  60.760  1.00 38.63 ? 255 ASN C O   1 
ATOM 3029 C CB  . ASN C 1 115 ? -4.049  33.569  61.798  1.00 38.92 ? 255 ASN C CB  1 
ATOM 3030 C CG  . ASN C 1 115 ? -5.423  34.178  61.633  1.00 40.32 ? 255 ASN C CG  1 
ATOM 3031 O OD1 . ASN C 1 115 ? -6.410  33.468  61.456  1.00 42.75 ? 255 ASN C OD1 1 
ATOM 3032 N ND2 . ASN C 1 115 ? -5.495  35.497  61.680  1.00 41.64 ? 255 ASN C ND2 1 
ATOM 3033 N N   . CYS C 1 116 ? -5.942  30.737  62.343  1.00 37.30 ? 256 CYS C N   1 
ATOM 3034 C CA  . CYS C 1 116 ? -6.702  29.671  61.696  1.00 35.68 ? 256 CYS C CA  1 
ATOM 3035 C C   . CYS C 1 116 ? -7.200  29.937  60.273  1.00 35.58 ? 256 CYS C C   1 
ATOM 3036 O O   . CYS C 1 116 ? -7.852  29.067  59.696  1.00 36.18 ? 256 CYS C O   1 
ATOM 3037 C CB  . CYS C 1 116 ? -7.902  29.266  62.547  1.00 34.36 ? 256 CYS C CB  1 
ATOM 3038 S SG  . CYS C 1 116 ? -7.581  28.758  64.267  1.00 33.91 ? 256 CYS C SG  1 
ATOM 3039 N N   . ILE C 1 117 ? -6.928  31.114  59.708  1.00 33.74 ? 257 ILE C N   1 
ATOM 3040 C CA  . ILE C 1 117 ? -7.358  31.385  58.333  1.00 32.04 ? 257 ILE C CA  1 
ATOM 3041 C C   . ILE C 1 117 ? -6.206  31.200  57.359  1.00 33.17 ? 257 ILE C C   1 
ATOM 3042 O O   . ILE C 1 117 ? -6.395  31.235  56.138  1.00 35.87 ? 257 ILE C O   1 
ATOM 3043 C CB  . ILE C 1 117 ? -7.910  32.812  58.142  1.00 29.46 ? 257 ILE C CB  1 
ATOM 3044 C CG1 . ILE C 1 117 ? -6.991  33.838  58.804  1.00 30.97 ? 257 ILE C CG1 1 
ATOM 3045 C CG2 . ILE C 1 117 ? -9.308  32.894  58.688  1.00 28.53 ? 257 ILE C CG2 1 
ATOM 3046 C CD1 . ILE C 1 117 ? -5.585  33.910  58.246  1.00 28.48 ? 257 ILE C CD1 1 
ATOM 3047 N N   . LEU C 1 118 ? -5.007  31.020  57.898  1.00 31.71 ? 258 LEU C N   1 
ATOM 3048 C CA  . LEU C 1 118 ? -3.852  30.827  57.047  1.00 32.05 ? 258 LEU C CA  1 
ATOM 3049 C C   . LEU C 1 118 ? -3.887  29.431  56.464  1.00 31.08 ? 258 LEU C C   1 
ATOM 3050 O O   . LEU C 1 118 ? -4.411  28.504  57.076  1.00 30.91 ? 258 LEU C O   1 
ATOM 3051 C CB  . LEU C 1 118 ? -2.559  31.064  57.830  1.00 33.83 ? 258 LEU C CB  1 
ATOM 3052 C CG  . LEU C 1 118 ? -2.357  32.522  58.281  1.00 35.64 ? 258 LEU C CG  1 
ATOM 3053 C CD1 . LEU C 1 118 ? -0.978  32.669  58.895  1.00 34.06 ? 258 LEU C CD1 1 
ATOM 3054 C CD2 . LEU C 1 118 ? -2.509  33.484  57.097  1.00 31.60 ? 258 LEU C CD2 1 
ATOM 3055 N N   . ALA C 1 119 ? -3.339  29.295  55.263  1.00 31.87 ? 259 ALA C N   1 
ATOM 3056 C CA  . ALA C 1 119 ? -3.316  28.020  54.568  1.00 31.89 ? 259 ALA C CA  1 
ATOM 3057 C C   . ALA C 1 119 ? -2.124  27.163  54.959  1.00 31.97 ? 259 ALA C C   1 
ATOM 3058 O O   . ALA C 1 119 ? -0.992  27.640  55.065  1.00 32.05 ? 259 ALA C O   1 
ATOM 3059 C CB  . ALA C 1 119 ? -3.317  28.249  53.064  1.00 32.02 ? 259 ALA C CB  1 
ATOM 3060 N N   . ALA C 1 120 ? -2.395  25.885  55.173  1.00 31.26 ? 260 ALA C N   1 
ATOM 3061 C CA  . ALA C 1 120 ? -1.361  24.941  55.538  1.00 31.88 ? 260 ALA C CA  1 
ATOM 3062 C C   . ALA C 1 120 ? -1.873  23.566  55.186  1.00 32.24 ? 260 ALA C C   1 
ATOM 3063 O O   . ALA C 1 120 ? -3.082  23.357  55.091  1.00 30.87 ? 260 ALA C O   1 
ATOM 3064 C CB  . ALA C 1 120 ? -1.085  25.019  57.019  1.00 32.15 ? 260 ALA C CB  1 
ATOM 3065 N N   . PHE C 1 121 ? -0.962  22.630  54.958  1.00 33.26 ? 261 PHE C N   1 
ATOM 3066 C CA  . PHE C 1 121 ? -1.396  21.277  54.670  1.00 34.82 ? 261 PHE C CA  1 
ATOM 3067 C C   . PHE C 1 121 ? -1.911  20.770  56.004  1.00 33.28 ? 261 PHE C C   1 
ATOM 3068 O O   . PHE C 1 121 ? -1.874  21.488  57.001  1.00 32.22 ? 261 PHE C O   1 
ATOM 3069 C CB  . PHE C 1 121 ? -0.237  20.400  54.191  1.00 37.46 ? 261 PHE C CB  1 
ATOM 3070 C CG  . PHE C 1 121 ? 0.129   20.608  52.754  1.00 39.33 ? 261 PHE C CG  1 
ATOM 3071 C CD1 . PHE C 1 121 ? 0.818   21.749  52.350  1.00 40.88 ? 261 PHE C CD1 1 
ATOM 3072 C CD2 . PHE C 1 121 ? -0.222  19.663  51.800  1.00 39.90 ? 261 PHE C CD2 1 
ATOM 3073 C CE1 . PHE C 1 121 ? 1.156   21.940  51.012  1.00 41.93 ? 261 PHE C CE1 1 
ATOM 3074 C CE2 . PHE C 1 121 ? 0.109   19.844  50.459  1.00 40.70 ? 261 PHE C CE2 1 
ATOM 3075 C CZ  . PHE C 1 121 ? 0.798   20.985  50.065  1.00 41.13 ? 261 PHE C CZ  1 
ATOM 3076 N N   . SER C 1 122 ? -2.390  19.539  56.028  1.00 31.88 ? 262 SER C N   1 
ATOM 3077 C CA  . SER C 1 122 ? -2.907  18.975  57.255  1.00 31.47 ? 262 SER C CA  1 
ATOM 3078 C C   . SER C 1 122 ? -2.789  17.472  57.190  1.00 30.44 ? 262 SER C C   1 
ATOM 3079 O O   . SER C 1 122 ? -2.287  16.926  56.221  1.00 29.39 ? 262 SER C O   1 
ATOM 3080 C CB  . SER C 1 122 ? -4.370  19.387  57.448  1.00 32.75 ? 262 SER C CB  1 
ATOM 3081 O OG  . SER C 1 122 ? -5.159  19.048  56.322  1.00 34.14 ? 262 SER C OG  1 
ATOM 3082 N N   . ILE C 1 123 ? -3.254  16.807  58.235  1.00 31.84 ? 263 ILE C N   1 
ATOM 3083 C CA  . ILE C 1 123 ? -3.202  15.360  58.298  1.00 33.12 ? 263 ILE C CA  1 
ATOM 3084 C C   . ILE C 1 123 ? -4.508  14.890  58.904  1.00 33.59 ? 263 ILE C C   1 
ATOM 3085 O O   . ILE C 1 123 ? -5.020  15.507  59.837  1.00 33.05 ? 263 ILE C O   1 
ATOM 3086 C CB  . ILE C 1 123 ? -2.052  14.882  59.205  1.00 33.86 ? 263 ILE C CB  1 
ATOM 3087 C CG1 . ILE C 1 123 ? -0.826  15.774  59.005  1.00 32.74 ? 263 ILE C CG1 1 
ATOM 3088 C CG2 . ILE C 1 123 ? -1.698  13.440  58.878  1.00 35.40 ? 263 ILE C CG2 1 
ATOM 3089 C CD1 . ILE C 1 123 ? 0.210   15.625  60.089  1.00 31.16 ? 263 ILE C CD1 1 
ATOM 3090 N N   . CYS C 1 124 ? -5.057  13.812  58.359  1.00 35.20 ? 264 CYS C N   1 
ATOM 3091 C CA  . CYS C 1 124 ? -6.292  13.253  58.883  1.00 36.10 ? 264 CYS C CA  1 
ATOM 3092 C C   . CYS C 1 124 ? -5.982  11.882  59.456  1.00 36.20 ? 264 CYS C C   1 
ATOM 3093 O O   . CYS C 1 124 ? -5.048  11.209  59.012  1.00 34.72 ? 264 CYS C O   1 
ATOM 3094 C CB  . CYS C 1 124 ? -7.337  13.110  57.785  1.00 35.41 ? 264 CYS C CB  1 
ATOM 3095 S SG  . CYS C 1 124 ? -7.772  14.653  56.926  1.00 38.94 ? 264 CYS C SG  1 
ATOM 3096 N N   . GLN C 1 125 ? -6.757  11.469  60.450  1.00 37.36 ? 265 GLN C N   1 
ATOM 3097 C CA  . GLN C 1 125 ? -6.541  10.163  61.051  1.00 39.67 ? 265 GLN C CA  1 
ATOM 3098 C C   . GLN C 1 125 ? -7.847  9.480   61.406  1.00 39.91 ? 265 GLN C C   1 
ATOM 3099 O O   . GLN C 1 125 ? -8.845  10.132  61.724  1.00 39.92 ? 265 GLN C O   1 
ATOM 3100 C CB  . GLN C 1 125 ? -5.686  10.278  62.318  1.00 41.01 ? 265 GLN C CB  1 
ATOM 3101 C CG  . GLN C 1 125 ? -6.418  10.868  63.515  1.00 42.27 ? 265 GLN C CG  1 
ATOM 3102 C CD  . GLN C 1 125 ? -5.755  10.514  64.829  1.00 41.86 ? 265 GLN C CD  1 
ATOM 3103 O OE1 . GLN C 1 125 ? -4.614  10.894  65.086  1.00 45.44 ? 265 GLN C OE1 1 
ATOM 3104 N NE2 . GLN C 1 125 ? -6.467  9.774   65.667  1.00 40.51 ? 265 GLN C NE2 1 
ATOM 3105 N N   . LYS C 1 126 ? -7.828  8.155   61.343  1.00 39.99 ? 266 LYS C N   1 
ATOM 3106 C CA  . LYS C 1 126 ? -8.984  7.346   61.688  1.00 40.82 ? 266 LYS C CA  1 
ATOM 3107 C C   . LYS C 1 126 ? -8.460  5.970   62.063  1.00 41.61 ? 266 LYS C C   1 
ATOM 3108 O O   . LYS C 1 126 ? -7.387  5.567   61.618  1.00 42.44 ? 266 LYS C O   1 
ATOM 3109 C CB  . LYS C 1 126 ? -9.967  7.262   60.513  1.00 40.44 ? 266 LYS C CB  1 
ATOM 3110 C CG  . LYS C 1 126 ? -9.413  6.662   59.232  1.00 41.99 ? 266 LYS C CG  1 
ATOM 3111 C CD  . LYS C 1 126 ? -10.449 6.772   58.115  1.00 42.17 ? 266 LYS C CD  1 
ATOM 3112 C CE  . LYS C 1 126 ? -9.971  6.157   56.804  1.00 42.58 ? 266 LYS C CE  1 
ATOM 3113 N NZ  . LYS C 1 126 ? -10.982 6.341   55.719  1.00 41.28 ? 266 LYS C NZ  1 
ATOM 3114 N N   . LYS C 1 127 ? -9.203  5.262   62.901  1.00 41.59 ? 267 LYS C N   1 
ATOM 3115 C CA  . LYS C 1 127 ? -8.799  3.936   63.346  1.00 40.94 ? 267 LYS C CA  1 
ATOM 3116 C C   . LYS C 1 127 ? -8.812  2.950   62.195  1.00 41.04 ? 267 LYS C C   1 
ATOM 3117 O O   . LYS C 1 127 ? -9.613  3.074   61.275  1.00 41.02 ? 267 LYS C O   1 
ATOM 3118 C CB  . LYS C 1 127 ? -9.732  3.463   64.460  1.00 41.66 ? 267 LYS C CB  1 
ATOM 3119 C CG  . LYS C 1 127 ? -11.041 4.233   64.504  1.00 44.94 ? 267 LYS C CG  1 
ATOM 3120 C CD  . LYS C 1 127 ? -11.819 4.081   63.203  1.00 46.17 ? 267 LYS C CD  1 
ATOM 3121 C CE  . LYS C 1 127 ? -12.706 5.288   62.948  1.00 46.39 ? 267 LYS C CE  1 
ATOM 3122 N NZ  . LYS C 1 127 ? -11.902 6.523   62.719  1.00 44.94 ? 267 LYS C NZ  1 
ATOM 3123 N N   . ALA C 1 128 ? -7.917  1.973   62.248  1.00 42.49 ? 268 ALA C N   1 
ATOM 3124 C CA  . ALA C 1 128 ? -7.827  0.967   61.201  1.00 44.95 ? 268 ALA C CA  1 
ATOM 3125 C C   . ALA C 1 128 ? -8.723  -0.226  61.506  1.00 46.98 ? 268 ALA C C   1 
ATOM 3126 O O   . ALA C 1 128 ? -9.445  -0.237  62.504  1.00 47.42 ? 268 ALA C O   1 
ATOM 3127 C CB  . ALA C 1 128 ? -6.382  0.505   61.055  1.00 44.43 ? 268 ALA C CB  1 
ATOM 3128 N N   . ASN C 1 129 ? -8.679  -1.223  60.628  1.00 49.02 ? 269 ASN C N   1 
ATOM 3129 C CA  . ASN C 1 129 ? -9.452  -2.440  60.818  1.00 51.14 ? 269 ASN C CA  1 
ATOM 3130 C C   . ASN C 1 129 ? -8.566  -3.448  61.531  1.00 53.47 ? 269 ASN C C   1 
ATOM 3131 O O   . ASN C 1 129 ? -7.457  -3.729  61.083  1.00 54.02 ? 269 ASN C O   1 
ATOM 3132 C CB  . ASN C 1 129 ? -9.891  -3.023  59.479  1.00 52.17 ? 269 ASN C CB  1 
ATOM 3133 C CG  . ASN C 1 129 ? -10.948 -2.190  58.800  1.00 53.22 ? 269 ASN C CG  1 
ATOM 3134 O OD1 . ASN C 1 129 ? -11.942 -1.805  59.417  1.00 53.46 ? 269 ASN C OD1 1 
ATOM 3135 N ND2 . ASN C 1 129 ? -10.751 -1.919  57.515  1.00 53.21 ? 269 ASN C ND2 1 
ATOM 3136 N N   . LEU C 1 130 ? -9.064  -3.979  62.644  1.00 55.72 ? 270 LEU C N   1 
ATOM 3137 C CA  . LEU C 1 130 ? -8.353  -4.965  63.456  1.00 58.03 ? 270 LEU C CA  1 
ATOM 3138 C C   . LEU C 1 130 ? -9.407  -5.507  64.427  1.00 59.77 ? 270 LEU C C   1 
ATOM 3139 O O   . LEU C 1 130 ? -10.494 -4.937  64.518  1.00 60.29 ? 270 LEU C O   1 
ATOM 3140 C CB  . LEU C 1 130 ? -7.207  -4.288  64.224  1.00 58.81 ? 270 LEU C CB  1 
ATOM 3141 C CG  . LEU C 1 130 ? -6.083  -3.583  63.445  1.00 58.03 ? 270 LEU C CG  1 
ATOM 3142 C CD1 . LEU C 1 130 ? -5.266  -2.718  64.391  1.00 56.82 ? 270 LEU C CD1 1 
ATOM 3143 C CD2 . LEU C 1 130 ? -5.196  -4.609  62.746  1.00 59.01 ? 270 LEU C CD2 1 
ATOM 3144 N N   . ARG C 1 131 ? -9.116  -6.587  65.149  1.00 61.23 ? 271 ARG C N   1 
ATOM 3145 C CA  . ARG C 1 131 ? -10.118 -7.121  66.073  1.00 63.67 ? 271 ARG C CA  1 
ATOM 3146 C C   . ARG C 1 131 ? -9.636  -7.616  67.433  1.00 63.64 ? 271 ARG C C   1 
ATOM 3147 O O   . ARG C 1 131 ? -10.399 -8.248  68.162  1.00 64.45 ? 271 ARG C O   1 
ATOM 3148 C CB  . ARG C 1 131 ? -10.922 -8.235  65.396  1.00 67.03 ? 271 ARG C CB  1 
ATOM 3149 C CG  . ARG C 1 131 ? -11.819 -7.744  64.267  1.00 72.45 ? 271 ARG C CG  1 
ATOM 3150 C CD  . ARG C 1 131 ? -12.734 -8.845  63.729  1.00 75.44 ? 271 ARG C CD  1 
ATOM 3151 N NE  . ARG C 1 131 ? -13.411 -8.435  62.497  1.00 77.35 ? 271 ARG C NE  1 
ATOM 3152 C CZ  . ARG C 1 131 ? -14.310 -9.170  61.846  1.00 77.54 ? 271 ARG C CZ  1 
ATOM 3153 N NH1 . ARG C 1 131 ? -14.659 -10.367 62.302  1.00 77.13 ? 271 ARG C NH1 1 
ATOM 3154 N NH2 . ARG C 1 131 ? -14.860 -8.706  60.731  1.00 77.70 ? 271 ARG C NH2 1 
ATOM 3155 N N   . ALA C 1 132 ? -8.383  -7.326  67.772  1.00 63.05 ? 272 ALA C N   1 
ATOM 3156 C CA  . ALA C 1 132 ? -7.790  -7.727  69.053  1.00 60.79 ? 272 ALA C CA  1 
ATOM 3157 C C   . ALA C 1 132 ? -8.381  -8.999  69.668  1.00 59.65 ? 272 ALA C C   1 
ATOM 3158 O O   . ALA C 1 132 ? -8.541  -9.025  70.908  1.00 57.59 ? 272 ALA C O   1 
ATOM 3159 C CB  . ALA C 1 132 ? -7.906  -6.576  70.048  1.00 59.18 ? 272 ALA C CB  1 
ATOM 3160 O OXT . ALA C 1 132 ? -8.656  -9.959  68.916  1.00 58.88 ? 272 ALA C OXT 1 
ATOM 3161 N N   . ALA D 1 2   ? -3.657  -7.110  55.700  1.00 39.91 ? 142 ALA D N   1 
ATOM 3162 C CA  . ALA D 1 2   ? -2.353  -6.385  55.820  1.00 41.16 ? 142 ALA D CA  1 
ATOM 3163 C C   . ALA D 1 2   ? -1.638  -6.269  54.465  1.00 40.21 ? 142 ALA D C   1 
ATOM 3164 O O   . ALA D 1 2   ? -0.614  -6.917  54.220  1.00 37.58 ? 142 ALA D O   1 
ATOM 3165 C CB  . ALA D 1 2   ? -1.454  -7.094  56.837  1.00 41.03 ? 142 ALA D CB  1 
ATOM 3166 N N   . PRO D 1 3   ? -2.182  -5.435  53.563  1.00 39.73 ? 143 PRO D N   1 
ATOM 3167 C CA  . PRO D 1 3   ? -1.567  -5.262  52.248  1.00 40.07 ? 143 PRO D CA  1 
ATOM 3168 C C   . PRO D 1 3   ? -0.113  -4.840  52.370  1.00 40.67 ? 143 PRO D C   1 
ATOM 3169 O O   . PRO D 1 3   ? 0.753   -5.374  51.687  1.00 41.30 ? 143 PRO D O   1 
ATOM 3170 C CB  . PRO D 1 3   ? -2.428  -4.178  51.604  1.00 39.67 ? 143 PRO D CB  1 
ATOM 3171 C CG  . PRO D 1 3   ? -3.781  -4.442  52.189  1.00 38.50 ? 143 PRO D CG  1 
ATOM 3172 C CD  . PRO D 1 3   ? -3.453  -4.692  53.647  1.00 39.45 ? 143 PRO D CD  1 
ATOM 3173 N N   . CYS D 1 4   ? 0.146   -3.887  53.257  1.00 41.76 ? 144 CYS D N   1 
ATOM 3174 C CA  . CYS D 1 4   ? 1.494   -3.376  53.461  1.00 42.53 ? 144 CYS D CA  1 
ATOM 3175 C C   . CYS D 1 4   ? 1.837   -3.241  54.946  1.00 41.85 ? 144 CYS D C   1 
ATOM 3176 O O   . CYS D 1 4   ? 0.965   -3.342  55.810  1.00 42.33 ? 144 CYS D O   1 
ATOM 3177 C CB  . CYS D 1 4   ? 1.638   -2.010  52.781  1.00 44.67 ? 144 CYS D CB  1 
ATOM 3178 S SG  . CYS D 1 4   ? 1.344   -1.968  50.980  1.00 47.60 ? 144 CYS D SG  1 
ATOM 3179 N N   . PRO D 1 5   ? 3.122   -3.012  55.257  1.00 40.67 ? 145 PRO D N   1 
ATOM 3180 C CA  . PRO D 1 5   ? 3.637   -2.853  56.620  1.00 40.66 ? 145 PRO D CA  1 
ATOM 3181 C C   . PRO D 1 5   ? 3.230   -1.521  57.251  1.00 42.36 ? 145 PRO D C   1 
ATOM 3182 O O   . PRO D 1 5   ? 2.806   -0.599  56.553  1.00 42.82 ? 145 PRO D O   1 
ATOM 3183 C CB  . PRO D 1 5   ? 5.149   -2.928  56.423  1.00 39.79 ? 145 PRO D CB  1 
ATOM 3184 C CG  . PRO D 1 5   ? 5.304   -3.710  55.179  1.00 39.08 ? 145 PRO D CG  1 
ATOM 3185 C CD  . PRO D 1 5   ? 4.239   -3.133  54.310  1.00 40.02 ? 145 PRO D CD  1 
ATOM 3186 N N   . GLN D 1 6   ? 3.358   -1.422  58.571  1.00 43.81 ? 146 GLN D N   1 
ATOM 3187 C CA  . GLN D 1 6   ? 3.035   -0.177  59.258  1.00 44.47 ? 146 GLN D CA  1 
ATOM 3188 C C   . GLN D 1 6   ? 4.060   0.871   58.821  1.00 45.20 ? 146 GLN D C   1 
ATOM 3189 O O   . GLN D 1 6   ? 5.255   0.573   58.734  1.00 46.43 ? 146 GLN D O   1 
ATOM 3190 C CB  . GLN D 1 6   ? 3.096   -0.358  60.779  1.00 43.37 ? 146 GLN D CB  1 
ATOM 3191 C CG  . GLN D 1 6   ? 1.860   -1.011  61.384  1.00 44.03 ? 146 GLN D CG  1 
ATOM 3192 C CD  . GLN D 1 6   ? 1.847   -0.971  62.906  1.00 43.88 ? 146 GLN D CD  1 
ATOM 3193 O OE1 . GLN D 1 6   ? 2.105   0.066   63.514  1.00 43.91 ? 146 GLN D OE1 1 
ATOM 3194 N NE2 . GLN D 1 6   ? 1.528   -2.100  63.525  1.00 44.53 ? 146 GLN D NE2 1 
ATOM 3195 N N   . ASP D 1 7   ? 3.585   2.083   58.536  1.00 43.88 ? 147 ASP D N   1 
ATOM 3196 C CA  . ASP D 1 7   ? 4.433   3.197   58.100  1.00 42.72 ? 147 ASP D CA  1 
ATOM 3197 C C   . ASP D 1 7   ? 4.644   3.287   56.588  1.00 42.85 ? 147 ASP D C   1 
ATOM 3198 O O   . ASP D 1 7   ? 5.159   4.287   56.085  1.00 44.30 ? 147 ASP D O   1 
ATOM 3199 C CB  . ASP D 1 7   ? 5.791   3.155   58.804  1.00 41.02 ? 147 ASP D CB  1 
ATOM 3200 C CG  . ASP D 1 7   ? 5.680   3.410   60.288  1.00 40.97 ? 147 ASP D CG  1 
ATOM 3201 O OD1 . ASP D 1 7   ? 4.563   3.704   60.765  1.00 42.08 ? 147 ASP D OD1 1 
ATOM 3202 O OD2 . ASP D 1 7   ? 6.712   3.322   60.977  1.00 41.07 ? 147 ASP D OD2 1 
ATOM 3203 N N   . TRP D 1 8   ? 4.258   2.243   55.862  1.00 41.45 ? 148 TRP D N   1 
ATOM 3204 C CA  . TRP D 1 8   ? 4.385   2.254   54.412  1.00 40.11 ? 148 TRP D CA  1 
ATOM 3205 C C   . TRP D 1 8   ? 3.085   2.785   53.814  1.00 39.79 ? 148 TRP D C   1 
ATOM 3206 O O   . TRP D 1 8   ? 2.056   2.829   54.490  1.00 39.76 ? 148 TRP D O   1 
ATOM 3207 C CB  . TRP D 1 8   ? 4.649   0.841   53.885  1.00 39.22 ? 148 TRP D CB  1 
ATOM 3208 C CG  . TRP D 1 8   ? 6.037   0.351   54.138  1.00 40.04 ? 148 TRP D CG  1 
ATOM 3209 C CD1 . TRP D 1 8   ? 6.652   0.217   55.348  1.00 40.46 ? 148 TRP D CD1 1 
ATOM 3210 C CD2 . TRP D 1 8   ? 6.990   -0.068  53.154  1.00 39.85 ? 148 TRP D CD2 1 
ATOM 3211 N NE1 . TRP D 1 8   ? 7.930   -0.261  55.180  1.00 40.19 ? 148 TRP D NE1 1 
ATOM 3212 C CE2 . TRP D 1 8   ? 8.164   -0.445  53.842  1.00 39.39 ? 148 TRP D CE2 1 
ATOM 3213 C CE3 . TRP D 1 8   ? 6.965   -0.165  51.756  1.00 40.84 ? 148 TRP D CE3 1 
ATOM 3214 C CZ2 . TRP D 1 8   ? 9.308   -0.908  53.180  1.00 38.95 ? 148 TRP D CZ2 1 
ATOM 3215 C CZ3 . TRP D 1 8   ? 8.104   -0.628  51.095  1.00 39.51 ? 148 TRP D CZ3 1 
ATOM 3216 C CH2 . TRP D 1 8   ? 9.258   -0.993  51.810  1.00 38.67 ? 148 TRP D CH2 1 
ATOM 3217 N N   . ILE D 1 9   ? 3.137   3.215   52.557  1.00 39.89 ? 149 ILE D N   1 
ATOM 3218 C CA  . ILE D 1 9   ? 1.939   3.697   51.882  1.00 40.30 ? 149 ILE D CA  1 
ATOM 3219 C C   . ILE D 1 9   ? 1.562   2.622   50.877  1.00 41.02 ? 149 ILE D C   1 
ATOM 3220 O O   . ILE D 1 9   ? 2.387   2.213   50.058  1.00 39.95 ? 149 ILE D O   1 
ATOM 3221 C CB  . ILE D 1 9   ? 2.177   5.022   51.124  1.00 40.74 ? 149 ILE D CB  1 
ATOM 3222 C CG1 . ILE D 1 9   ? 2.555   6.130   52.110  1.00 38.70 ? 149 ILE D CG1 1 
ATOM 3223 C CG2 . ILE D 1 9   ? 0.910   5.415   50.363  1.00 39.63 ? 149 ILE D CG2 1 
ATOM 3224 C CD1 . ILE D 1 9   ? 2.792   7.466   51.454  1.00 37.73 ? 149 ILE D CD1 1 
ATOM 3225 N N   . TRP D 1 10  ? 0.320   2.157   50.954  1.00 41.95 ? 150 TRP D N   1 
ATOM 3226 C CA  . TRP D 1 10  ? -0.161  1.116   50.058  1.00 43.19 ? 150 TRP D CA  1 
ATOM 3227 C C   . TRP D 1 10  ? -0.883  1.702   48.849  1.00 42.98 ? 150 TRP D C   1 
ATOM 3228 O O   . TRP D 1 10  ? -1.837  2.467   48.987  1.00 40.88 ? 150 TRP D O   1 
ATOM 3229 C CB  . TRP D 1 10  ? -1.081  0.164   50.829  1.00 45.47 ? 150 TRP D CB  1 
ATOM 3230 C CG  . TRP D 1 10  ? -1.846  -0.791  49.973  1.00 46.60 ? 150 TRP D CG  1 
ATOM 3231 C CD1 . TRP D 1 10  ? -1.364  -1.542  48.941  1.00 47.29 ? 150 TRP D CD1 1 
ATOM 3232 C CD2 . TRP D 1 10  ? -3.235  -1.111  50.090  1.00 46.70 ? 150 TRP D CD2 1 
ATOM 3233 N NE1 . TRP D 1 10  ? -2.369  -2.312  48.406  1.00 46.54 ? 150 TRP D NE1 1 
ATOM 3234 C CE2 . TRP D 1 10  ? -3.528  -2.069  49.095  1.00 47.57 ? 150 TRP D CE2 1 
ATOM 3235 C CE3 . TRP D 1 10  ? -4.260  -0.687  50.943  1.00 45.97 ? 150 TRP D CE3 1 
ATOM 3236 C CZ2 . TRP D 1 10  ? -4.809  -2.605  48.925  1.00 46.91 ? 150 TRP D CZ2 1 
ATOM 3237 C CZ3 . TRP D 1 10  ? -5.533  -1.220  50.776  1.00 46.10 ? 150 TRP D CZ3 1 
ATOM 3238 C CH2 . TRP D 1 10  ? -5.795  -2.171  49.775  1.00 45.90 ? 150 TRP D CH2 1 
ATOM 3239 N N   . HIS D 1 11  ? -0.411  1.332   47.664  1.00 44.32 ? 151 HIS D N   1 
ATOM 3240 C CA  . HIS D 1 11  ? -0.985  1.813   46.416  1.00 45.15 ? 151 HIS D CA  1 
ATOM 3241 C C   . HIS D 1 11  ? -1.084  0.657   45.422  1.00 45.76 ? 151 HIS D C   1 
ATOM 3242 O O   . HIS D 1 11  ? -0.068  0.150   44.948  1.00 44.67 ? 151 HIS D O   1 
ATOM 3243 C CB  . HIS D 1 11  ? -0.103  2.921   45.848  1.00 44.97 ? 151 HIS D CB  1 
ATOM 3244 C CG  . HIS D 1 11  ? -0.759  3.722   44.771  1.00 46.63 ? 151 HIS D CG  1 
ATOM 3245 N ND1 . HIS D 1 11  ? -1.949  4.389   44.962  1.00 47.63 ? 151 HIS D ND1 1 
ATOM 3246 C CD2 . HIS D 1 11  ? -0.379  3.979   43.498  1.00 46.07 ? 151 HIS D CD2 1 
ATOM 3247 C CE1 . HIS D 1 11  ? -2.276  5.025   43.850  1.00 49.12 ? 151 HIS D CE1 1 
ATOM 3248 N NE2 . HIS D 1 11  ? -1.340  4.793   42.947  1.00 48.22 ? 151 HIS D NE2 1 
ATOM 3249 N N   . GLY D 1 12  ? -2.309  0.236   45.122  1.00 46.34 ? 152 GLY D N   1 
ATOM 3250 C CA  . GLY D 1 12  ? -2.506  -0.862  44.190  1.00 48.56 ? 152 GLY D CA  1 
ATOM 3251 C C   . GLY D 1 12  ? -1.771  -2.158  44.519  1.00 50.48 ? 152 GLY D C   1 
ATOM 3252 O O   . GLY D 1 12  ? -2.081  -2.830  45.506  1.00 50.31 ? 152 GLY D O   1 
ATOM 3253 N N   . GLU D 1 13  ? -0.794  -2.515  43.688  1.00 51.09 ? 153 GLU D N   1 
ATOM 3254 C CA  . GLU D 1 13  ? -0.031  -3.746  43.888  1.00 52.83 ? 153 GLU D CA  1 
ATOM 3255 C C   . GLU D 1 13  ? 1.310   -3.533  44.581  1.00 52.26 ? 153 GLU D C   1 
ATOM 3256 O O   . GLU D 1 13  ? 2.065   -4.485  44.776  1.00 53.17 ? 153 GLU D O   1 
ATOM 3257 C CB  . GLU D 1 13  ? 0.234   -4.442  42.549  1.00 55.26 ? 153 GLU D CB  1 
ATOM 3258 C CG  . GLU D 1 13  ? -0.995  -4.806  41.733  1.00 58.60 ? 153 GLU D CG  1 
ATOM 3259 C CD  . GLU D 1 13  ? -0.627  -5.568  40.469  1.00 59.48 ? 153 GLU D CD  1 
ATOM 3260 O OE1 . GLU D 1 13  ? 0.335   -5.152  39.789  1.00 60.28 ? 153 GLU D OE1 1 
ATOM 3261 O OE2 . GLU D 1 13  ? -1.295  -6.574  40.153  1.00 59.43 ? 153 GLU D OE2 1 
ATOM 3262 N N   . ASN D 1 14  ? 1.613   -2.295  44.950  1.00 50.91 ? 154 ASN D N   1 
ATOM 3263 C CA  . ASN D 1 14  ? 2.885   -2.016  45.600  1.00 50.77 ? 154 ASN D CA  1 
ATOM 3264 C C   . ASN D 1 14  ? 2.781   -1.222  46.891  1.00 50.75 ? 154 ASN D C   1 
ATOM 3265 O O   . ASN D 1 14  ? 1.747   -0.625  47.198  1.00 50.97 ? 154 ASN D O   1 
ATOM 3266 C CB  . ASN D 1 14  ? 3.817   -1.272  44.641  1.00 51.22 ? 154 ASN D CB  1 
ATOM 3267 C CG  . ASN D 1 14  ? 4.271   -2.133  43.483  1.00 51.54 ? 154 ASN D CG  1 
ATOM 3268 O OD1 . ASN D 1 14  ? 4.826   -3.212  43.678  1.00 52.52 ? 154 ASN D OD1 1 
ATOM 3269 N ND2 . ASN D 1 14  ? 4.047   -1.653  42.268  1.00 53.82 ? 154 ASN D ND2 1 
ATOM 3270 N N   . CYS D 1 15  ? 3.879   -1.227  47.640  1.00 49.69 ? 155 CYS D N   1 
ATOM 3271 C CA  . CYS D 1 15  ? 3.977   -0.506  48.900  1.00 49.21 ? 155 CYS D CA  1 
ATOM 3272 C C   . CYS D 1 15  ? 5.183   0.412   48.768  1.00 48.86 ? 155 CYS D C   1 
ATOM 3273 O O   . CYS D 1 15  ? 6.237   -0.014  48.289  1.00 49.30 ? 155 CYS D O   1 
ATOM 3274 C CB  . CYS D 1 15  ? 4.211   -1.475  50.057  1.00 49.59 ? 155 CYS D CB  1 
ATOM 3275 S SG  . CYS D 1 15  ? 3.010   -2.836  50.206  1.00 49.45 ? 155 CYS D SG  1 
ATOM 3276 N N   . TYR D 1 16  ? 5.037   1.666   49.185  1.00 47.16 ? 156 TYR D N   1 
ATOM 3277 C CA  . TYR D 1 16  ? 6.140   2.611   49.082  1.00 44.92 ? 156 TYR D CA  1 
ATOM 3278 C C   . TYR D 1 16  ? 6.538   3.182   50.428  1.00 44.09 ? 156 TYR D C   1 
ATOM 3279 O O   . TYR D 1 16  ? 5.691   3.466   51.275  1.00 42.87 ? 156 TYR D O   1 
ATOM 3280 C CB  . TYR D 1 16  ? 5.778   3.756   48.135  1.00 42.97 ? 156 TYR D CB  1 
ATOM 3281 C CG  . TYR D 1 16  ? 5.410   3.301   46.746  1.00 39.56 ? 156 TYR D CG  1 
ATOM 3282 C CD1 . TYR D 1 16  ? 4.157   2.752   46.477  1.00 37.34 ? 156 TYR D CD1 1 
ATOM 3283 C CD2 . TYR D 1 16  ? 6.321   3.404   45.703  1.00 39.69 ? 156 TYR D CD2 1 
ATOM 3284 C CE1 . TYR D 1 16  ? 3.825   2.320   45.209  1.00 36.76 ? 156 TYR D CE1 1 
ATOM 3285 C CE2 . TYR D 1 16  ? 5.998   2.974   44.427  1.00 39.29 ? 156 TYR D CE2 1 
ATOM 3286 C CZ  . TYR D 1 16  ? 4.750   2.433   44.187  1.00 38.79 ? 156 TYR D CZ  1 
ATOM 3287 O OH  . TYR D 1 16  ? 4.438   1.999   42.922  1.00 41.01 ? 156 TYR D OH  1 
ATOM 3288 N N   . LEU D 1 17  ? 7.840   3.349   50.617  1.00 43.79 ? 157 LEU D N   1 
ATOM 3289 C CA  . LEU D 1 17  ? 8.357   3.896   51.855  1.00 45.78 ? 157 LEU D CA  1 
ATOM 3290 C C   . LEU D 1 17  ? 9.131   5.151   51.519  1.00 49.07 ? 157 LEU D C   1 
ATOM 3291 O O   . LEU D 1 17  ? 9.979   5.139   50.628  1.00 49.91 ? 157 LEU D O   1 
ATOM 3292 C CB  . LEU D 1 17  ? 9.289   2.894   52.535  1.00 43.00 ? 157 LEU D CB  1 
ATOM 3293 C CG  . LEU D 1 17  ? 9.748   3.270   53.943  1.00 40.31 ? 157 LEU D CG  1 
ATOM 3294 C CD1 . LEU D 1 17  ? 8.549   3.337   54.871  1.00 40.33 ? 157 LEU D CD1 1 
ATOM 3295 C CD2 . LEU D 1 17  ? 10.735  2.242   54.448  1.00 40.13 ? 157 LEU D CD2 1 
ATOM 3296 N N   . PHE D 1 18  ? 8.826   6.239   52.216  1.00 52.09 ? 158 PHE D N   1 
ATOM 3297 C CA  . PHE D 1 18  ? 9.523   7.492   51.985  1.00 55.20 ? 158 PHE D CA  1 
ATOM 3298 C C   . PHE D 1 18  ? 10.541  7.666   53.092  1.00 57.31 ? 158 PHE D C   1 
ATOM 3299 O O   . PHE D 1 18  ? 10.240  8.183   54.166  1.00 58.63 ? 158 PHE D O   1 
ATOM 3300 C CB  . PHE D 1 18  ? 8.539   8.659   51.961  1.00 55.70 ? 158 PHE D CB  1 
ATOM 3301 C CG  . PHE D 1 18  ? 7.600   8.628   50.789  1.00 57.99 ? 158 PHE D CG  1 
ATOM 3302 C CD1 . PHE D 1 18  ? 6.579   7.680   50.717  1.00 58.80 ? 158 PHE D CD1 1 
ATOM 3303 C CD2 . PHE D 1 18  ? 7.756   9.522   49.736  1.00 58.82 ? 158 PHE D CD2 1 
ATOM 3304 C CE1 . PHE D 1 18  ? 5.723   7.621   49.608  1.00 57.87 ? 158 PHE D CE1 1 
ATOM 3305 C CE2 . PHE D 1 18  ? 6.909   9.472   48.626  1.00 59.13 ? 158 PHE D CE2 1 
ATOM 3306 C CZ  . PHE D 1 18  ? 5.890   8.517   48.563  1.00 58.65 ? 158 PHE D CZ  1 
ATOM 3307 N N   . SER D 1 19  ? 11.754  7.206   52.811  1.00 59.59 ? 159 SER D N   1 
ATOM 3308 C CA  . SER D 1 19  ? 12.856  7.262   53.754  1.00 62.27 ? 159 SER D CA  1 
ATOM 3309 C C   . SER D 1 19  ? 12.909  8.541   54.569  1.00 63.58 ? 159 SER D C   1 
ATOM 3310 O O   . SER D 1 19  ? 12.527  9.615   54.104  1.00 64.11 ? 159 SER D O   1 
ATOM 3311 C CB  . SER D 1 19  ? 14.182  7.076   53.017  1.00 63.00 ? 159 SER D CB  1 
ATOM 3312 O OG  . SER D 1 19  ? 14.339  8.054   52.004  1.00 65.80 ? 159 SER D OG  1 
ATOM 3313 N N   . SER D 1 20  ? 13.394  8.407   55.795  1.00 65.45 ? 160 SER D N   1 
ATOM 3314 C CA  . SER D 1 20  ? 13.521  9.529   56.709  1.00 66.84 ? 160 SER D CA  1 
ATOM 3315 C C   . SER D 1 20  ? 14.883  10.193  56.532  1.00 66.97 ? 160 SER D C   1 
ATOM 3316 O O   . SER D 1 20  ? 15.007  11.416  56.636  1.00 66.47 ? 160 SER D O   1 
ATOM 3317 C CB  . SER D 1 20  ? 13.375  9.036   58.148  1.00 68.02 ? 160 SER D CB  1 
ATOM 3318 O OG  . SER D 1 20  ? 14.268  7.960   58.398  1.00 69.75 ? 160 SER D OG  1 
ATOM 3319 N N   . GLY D 1 21  ? 15.898  9.376   56.254  1.00 66.44 ? 161 GLY D N   1 
ATOM 3320 C CA  . GLY D 1 21  ? 17.247  9.885   56.085  1.00 65.60 ? 161 GLY D CA  1 
ATOM 3321 C C   . GLY D 1 21  ? 17.648  10.265  54.674  1.00 65.14 ? 161 GLY D C   1 
ATOM 3322 O O   . GLY D 1 21  ? 17.015  9.869   53.696  1.00 65.38 ? 161 GLY D O   1 
ATOM 3323 N N   . SER D 1 22  ? 18.720  11.042  54.582  1.00 64.51 ? 162 SER D N   1 
ATOM 3324 C CA  . SER D 1 22  ? 19.256  11.502  53.310  1.00 64.09 ? 162 SER D CA  1 
ATOM 3325 C C   . SER D 1 22  ? 20.679  10.975  53.136  1.00 64.67 ? 162 SER D C   1 
ATOM 3326 O O   . SER D 1 22  ? 21.614  11.503  53.732  1.00 64.11 ? 162 SER D O   1 
ATOM 3327 C CB  . SER D 1 22  ? 19.257  13.029  53.280  1.00 63.43 ? 162 SER D CB  1 
ATOM 3328 O OG  . SER D 1 22  ? 20.246  13.518  52.395  1.00 64.16 ? 162 SER D OG  1 
ATOM 3329 N N   . PHE D 1 23  ? 20.840  9.934   52.324  1.00 65.85 ? 163 PHE D N   1 
ATOM 3330 C CA  . PHE D 1 23  ? 22.159  9.346   52.094  1.00 67.43 ? 163 PHE D CA  1 
ATOM 3331 C C   . PHE D 1 23  ? 22.520  9.251   50.618  1.00 67.35 ? 163 PHE D C   1 
ATOM 3332 O O   . PHE D 1 23  ? 21.713  9.583   49.750  1.00 67.05 ? 163 PHE D O   1 
ATOM 3333 C CB  . PHE D 1 23  ? 22.235  7.946   52.703  1.00 68.95 ? 163 PHE D CB  1 
ATOM 3334 C CG  . PHE D 1 23  ? 21.874  7.895   54.155  1.00 70.15 ? 163 PHE D CG  1 
ATOM 3335 C CD1 . PHE D 1 23  ? 20.545  7.783   54.549  1.00 70.41 ? 163 PHE D CD1 1 
ATOM 3336 C CD2 . PHE D 1 23  ? 22.860  7.967   55.131  1.00 70.49 ? 163 PHE D CD2 1 
ATOM 3337 C CE1 . PHE D 1 23  ? 20.203  7.739   55.896  1.00 70.92 ? 163 PHE D CE1 1 
ATOM 3338 C CE2 . PHE D 1 23  ? 22.529  7.925   56.481  1.00 71.70 ? 163 PHE D CE2 1 
ATOM 3339 C CZ  . PHE D 1 23  ? 21.197  7.811   56.865  1.00 71.01 ? 163 PHE D CZ  1 
ATOM 3340 N N   . ASN D 1 24  ? 23.741  8.794   50.341  1.00 67.40 ? 164 ASN D N   1 
ATOM 3341 C CA  . ASN D 1 24  ? 24.194  8.640   48.965  1.00 67.49 ? 164 ASN D CA  1 
ATOM 3342 C C   . ASN D 1 24  ? 23.334  7.554   48.330  1.00 67.67 ? 164 ASN D C   1 
ATOM 3343 O O   . ASN D 1 24  ? 22.578  6.878   49.028  1.00 67.79 ? 164 ASN D O   1 
ATOM 3344 C CB  . ASN D 1 24  ? 25.683  8.266   48.919  1.00 67.11 ? 164 ASN D CB  1 
ATOM 3345 C CG  . ASN D 1 24  ? 25.992  6.984   49.664  1.00 67.52 ? 164 ASN D CG  1 
ATOM 3346 O OD1 . ASN D 1 24  ? 25.570  5.902   49.262  1.00 68.24 ? 164 ASN D OD1 1 
ATOM 3347 N ND2 . ASN D 1 24  ? 26.735  7.099   50.759  1.00 67.10 ? 164 ASN D ND2 1 
ATOM 3348 N N   . TRP D 1 25  ? 23.441  7.388   47.015  1.00 67.70 ? 165 TRP D N   1 
ATOM 3349 C CA  . TRP D 1 25  ? 22.630  6.398   46.314  1.00 67.78 ? 165 TRP D CA  1 
ATOM 3350 C C   . TRP D 1 25  ? 22.915  4.947   46.696  1.00 69.24 ? 165 TRP D C   1 
ATOM 3351 O O   . TRP D 1 25  ? 22.021  4.097   46.640  1.00 69.59 ? 165 TRP D O   1 
ATOM 3352 C CB  . TRP D 1 25  ? 22.790  6.552   44.808  1.00 66.13 ? 165 TRP D CB  1 
ATOM 3353 C CG  . TRP D 1 25  ? 21.745  5.803   44.064  1.00 66.51 ? 165 TRP D CG  1 
ATOM 3354 C CD1 . TRP D 1 25  ? 20.507  6.257   43.706  1.00 66.78 ? 165 TRP D CD1 1 
ATOM 3355 C CD2 . TRP D 1 25  ? 21.823  4.447   43.612  1.00 66.18 ? 165 TRP D CD2 1 
ATOM 3356 N NE1 . TRP D 1 25  ? 19.810  5.266   43.055  1.00 66.63 ? 165 TRP D NE1 1 
ATOM 3357 C CE2 . TRP D 1 25  ? 20.595  4.146   42.982  1.00 66.09 ? 165 TRP D CE2 1 
ATOM 3358 C CE3 . TRP D 1 25  ? 22.814  3.458   43.674  1.00 64.27 ? 165 TRP D CE3 1 
ATOM 3359 C CZ2 . TRP D 1 25  ? 20.330  2.891   42.420  1.00 65.69 ? 165 TRP D CZ2 1 
ATOM 3360 C CZ3 . TRP D 1 25  ? 22.549  2.211   43.114  1.00 63.52 ? 165 TRP D CZ3 1 
ATOM 3361 C CH2 . TRP D 1 25  ? 21.318  1.941   42.494  1.00 64.27 ? 165 TRP D CH2 1 
ATOM 3362 N N   . GLU D 1 26  ? 24.159  4.661   47.071  1.00 69.81 ? 166 GLU D N   1 
ATOM 3363 C CA  . GLU D 1 26  ? 24.546  3.309   47.462  1.00 68.60 ? 166 GLU D CA  1 
ATOM 3364 C C   . GLU D 1 26  ? 23.785  2.926   48.725  1.00 67.45 ? 166 GLU D C   1 
ATOM 3365 O O   . GLU D 1 26  ? 23.105  1.900   48.775  1.00 66.93 ? 166 GLU D O   1 
ATOM 3366 C CB  . GLU D 1 26  ? 26.053  3.259   47.724  1.00 69.59 ? 166 GLU D CB  1 
ATOM 3367 C CG  . GLU D 1 26  ? 26.623  1.868   47.948  1.00 71.13 ? 166 GLU D CG  1 
ATOM 3368 C CD  . GLU D 1 26  ? 28.134  1.891   48.087  1.00 72.27 ? 166 GLU D CD  1 
ATOM 3369 O OE1 . GLU D 1 26  ? 28.629  2.558   49.018  1.00 71.82 ? 166 GLU D OE1 1 
ATOM 3370 O OE2 . GLU D 1 26  ? 28.824  1.250   47.265  1.00 73.04 ? 166 GLU D OE2 1 
ATOM 3371 N N   . LYS D 1 27  ? 23.902  3.777   49.739  1.00 66.57 ? 167 LYS D N   1 
ATOM 3372 C CA  . LYS D 1 27  ? 23.241  3.570   51.019  1.00 66.15 ? 167 LYS D CA  1 
ATOM 3373 C C   . LYS D 1 27  ? 21.738  3.398   50.852  1.00 66.31 ? 167 LYS D C   1 
ATOM 3374 O O   . LYS D 1 27  ? 21.198  2.331   51.135  1.00 66.24 ? 167 LYS D O   1 
ATOM 3375 C CB  . LYS D 1 27  ? 23.522  4.755   51.943  1.00 66.18 ? 167 LYS D CB  1 
ATOM 3376 C CG  . LYS D 1 27  ? 25.000  5.042   52.130  1.00 67.01 ? 167 LYS D CG  1 
ATOM 3377 C CD  . LYS D 1 27  ? 25.714  3.855   52.753  1.00 67.96 ? 167 LYS D CD  1 
ATOM 3378 C CE  . LYS D 1 27  ? 27.217  4.071   52.798  1.00 68.80 ? 167 LYS D CE  1 
ATOM 3379 N NZ  . LYS D 1 27  ? 27.915  2.939   53.473  1.00 70.24 ? 167 LYS D NZ  1 
ATOM 3380 N N   . SER D 1 28  ? 21.070  4.452   50.392  1.00 66.91 ? 168 SER D N   1 
ATOM 3381 C CA  . SER D 1 28  ? 19.624  4.429   50.189  1.00 66.63 ? 168 SER D CA  1 
ATOM 3382 C C   . SER D 1 28  ? 19.167  3.146   49.506  1.00 66.86 ? 168 SER D C   1 
ATOM 3383 O O   . SER D 1 28  ? 18.051  2.675   49.729  1.00 66.14 ? 168 SER D O   1 
ATOM 3384 C CB  . SER D 1 28  ? 19.190  5.636   49.356  1.00 66.62 ? 168 SER D CB  1 
ATOM 3385 O OG  . SER D 1 28  ? 19.488  6.844   50.031  1.00 66.74 ? 168 SER D OG  1 
ATOM 3386 N N   . GLN D 1 29  ? 20.034  2.591   48.668  1.00 67.30 ? 169 GLN D N   1 
ATOM 3387 C CA  . GLN D 1 29  ? 19.737  1.355   47.962  1.00 66.98 ? 169 GLN D CA  1 
ATOM 3388 C C   . GLN D 1 29  ? 19.786  0.191   48.947  1.00 68.02 ? 169 GLN D C   1 
ATOM 3389 O O   . GLN D 1 29  ? 18.896  -0.659  48.969  1.00 68.83 ? 169 GLN D O   1 
ATOM 3390 C CB  . GLN D 1 29  ? 20.766  1.131   46.855  1.00 65.07 ? 169 GLN D CB  1 
ATOM 3391 C CG  . GLN D 1 29  ? 20.680  -0.227  46.192  1.00 63.65 ? 169 GLN D CG  1 
ATOM 3392 C CD  . GLN D 1 29  ? 21.906  -0.539  45.363  1.00 63.26 ? 169 GLN D CD  1 
ATOM 3393 O OE1 . GLN D 1 29  ? 23.027  -0.554  45.874  1.00 61.72 ? 169 GLN D OE1 1 
ATOM 3394 N NE2 . GLN D 1 29  ? 21.702  -0.791  44.075  1.00 63.32 ? 169 GLN D NE2 1 
ATOM 3395 N N   . GLU D 1 30  ? 20.833  0.172   49.768  1.00 68.15 ? 170 GLU D N   1 
ATOM 3396 C CA  . GLU D 1 30  ? 21.040  -0.882  50.757  1.00 68.21 ? 170 GLU D CA  1 
ATOM 3397 C C   . GLU D 1 30  ? 20.007  -0.940  51.880  1.00 67.31 ? 170 GLU D C   1 
ATOM 3398 O O   . GLU D 1 30  ? 19.776  -2.005  52.451  1.00 68.99 ? 170 GLU D O   1 
ATOM 3399 C CB  . GLU D 1 30  ? 22.438  -0.757  51.366  1.00 68.92 ? 170 GLU D CB  1 
ATOM 3400 C CG  . GLU D 1 30  ? 23.560  -0.852  50.343  1.00 70.02 ? 170 GLU D CG  1 
ATOM 3401 C CD  . GLU D 1 30  ? 24.937  -0.721  50.968  1.00 70.06 ? 170 GLU D CD  1 
ATOM 3402 O OE1 . GLU D 1 30  ? 25.306  -1.598  51.774  1.00 69.37 ? 170 GLU D OE1 1 
ATOM 3403 O OE2 . GLU D 1 30  ? 25.651  0.259   50.656  1.00 70.08 ? 170 GLU D OE2 1 
ATOM 3404 N N   . LYS D 1 31  ? 19.396  0.190   52.214  1.00 64.99 ? 171 LYS D N   1 
ATOM 3405 C CA  . LYS D 1 31  ? 18.395  0.189   53.271  1.00 63.29 ? 171 LYS D CA  1 
ATOM 3406 C C   . LYS D 1 31  ? 17.033  -0.217  52.724  1.00 62.61 ? 171 LYS D C   1 
ATOM 3407 O O   . LYS D 1 31  ? 16.085  -0.403  53.483  1.00 62.78 ? 171 LYS D O   1 
ATOM 3408 C CB  . LYS D 1 31  ? 18.327  1.557   53.956  1.00 63.46 ? 171 LYS D CB  1 
ATOM 3409 C CG  . LYS D 1 31  ? 19.539  1.837   54.845  1.00 65.12 ? 171 LYS D CG  1 
ATOM 3410 C CD  . LYS D 1 31  ? 19.503  3.241   55.441  1.00 65.11 ? 171 LYS D CD  1 
ATOM 3411 C CE  . LYS D 1 31  ? 20.799  3.589   56.178  1.00 63.13 ? 171 LYS D CE  1 
ATOM 3412 N NZ  . LYS D 1 31  ? 21.031  2.730   57.370  1.00 61.79 ? 171 LYS D NZ  1 
ATOM 3413 N N   . CYS D 1 32  ? 16.942  -0.344  51.402  1.00 61.48 ? 172 CYS D N   1 
ATOM 3414 C CA  . CYS D 1 32  ? 15.702  -0.779  50.763  1.00 61.61 ? 172 CYS D CA  1 
ATOM 3415 C C   . CYS D 1 32  ? 15.763  -2.299  50.782  1.00 61.42 ? 172 CYS D C   1 
ATOM 3416 O O   . CYS D 1 32  ? 14.748  -2.976  50.941  1.00 61.80 ? 172 CYS D O   1 
ATOM 3417 C CB  . CYS D 1 32  ? 15.607  -0.307  49.306  1.00 60.77 ? 172 CYS D CB  1 
ATOM 3418 S SG  . CYS D 1 32  ? 15.106  1.424   48.993  1.00 62.50 ? 172 CYS D SG  1 
ATOM 3419 N N   . LEU D 1 33  ? 16.976  -2.819  50.609  1.00 60.72 ? 173 LEU D N   1 
ATOM 3420 C CA  . LEU D 1 33  ? 17.215  -4.256  50.617  1.00 58.95 ? 173 LEU D CA  1 
ATOM 3421 C C   . LEU D 1 33  ? 17.224  -4.698  52.069  1.00 57.46 ? 173 LEU D C   1 
ATOM 3422 O O   . LEU D 1 33  ? 16.911  -5.840  52.385  1.00 56.71 ? 173 LEU D O   1 
ATOM 3423 C CB  . LEU D 1 33  ? 18.558  -4.574  49.961  1.00 59.04 ? 173 LEU D CB  1 
ATOM 3424 C CG  . LEU D 1 33  ? 18.709  -4.054  48.528  1.00 60.12 ? 173 LEU D CG  1 
ATOM 3425 C CD1 . LEU D 1 33  ? 20.122  -4.309  48.029  1.00 61.43 ? 173 LEU D CD1 1 
ATOM 3426 C CD2 . LEU D 1 33  ? 17.683  -4.728  47.628  1.00 59.69 ? 173 LEU D CD2 1 
ATOM 3427 N N   . SER D 1 34  ? 17.589  -3.768  52.945  1.00 56.88 ? 174 SER D N   1 
ATOM 3428 C CA  . SER D 1 34  ? 17.627  -4.009  54.381  1.00 56.33 ? 174 SER D CA  1 
ATOM 3429 C C   . SER D 1 34  ? 16.187  -4.166  54.868  1.00 56.76 ? 174 SER D C   1 
ATOM 3430 O O   . SER D 1 34  ? 15.934  -4.641  55.977  1.00 56.79 ? 174 SER D O   1 
ATOM 3431 C CB  . SER D 1 34  ? 18.291  -2.824  55.083  1.00 55.19 ? 174 SER D CB  1 
ATOM 3432 O OG  . SER D 1 34  ? 18.190  -2.938  56.489  1.00 56.31 ? 174 SER D OG  1 
ATOM 3433 N N   . LEU D 1 35  ? 15.250  -3.756  54.018  1.00 56.45 ? 175 LEU D N   1 
ATOM 3434 C CA  . LEU D 1 35  ? 13.825  -3.841  54.314  1.00 55.25 ? 175 LEU D CA  1 
ATOM 3435 C C   . LEU D 1 35  ? 13.141  -4.774  53.325  1.00 54.90 ? 175 LEU D C   1 
ATOM 3436 O O   . LEU D 1 35  ? 11.913  -4.818  53.243  1.00 54.86 ? 175 LEU D O   1 
ATOM 3437 C CB  . LEU D 1 35  ? 13.180  -2.457  54.233  1.00 54.77 ? 175 LEU D CB  1 
ATOM 3438 C CG  . LEU D 1 35  ? 13.393  -1.509  55.414  1.00 54.34 ? 175 LEU D CG  1 
ATOM 3439 C CD1 . LEU D 1 35  ? 12.838  -0.140  55.065  1.00 52.72 ? 175 LEU D CD1 1 
ATOM 3440 C CD2 . LEU D 1 35  ? 12.707  -2.070  56.655  1.00 53.31 ? 175 LEU D CD2 1 
ATOM 3441 N N   . ASP D 1 36  ? 13.949  -5.510  52.569  1.00 54.56 ? 176 ASP D N   1 
ATOM 3442 C CA  . ASP D 1 36  ? 13.442  -6.452  51.581  1.00 54.56 ? 176 ASP D CA  1 
ATOM 3443 C C   . ASP D 1 36  ? 12.605  -5.781  50.496  1.00 53.85 ? 176 ASP D C   1 
ATOM 3444 O O   . ASP D 1 36  ? 11.434  -6.107  50.314  1.00 53.10 ? 176 ASP D O   1 
ATOM 3445 C CB  . ASP D 1 36  ? 12.615  -7.534  52.273  1.00 56.32 ? 176 ASP D CB  1 
ATOM 3446 C CG  . ASP D 1 36  ? 12.149  -8.606  51.314  1.00 58.31 ? 176 ASP D CG  1 
ATOM 3447 O OD1 . ASP D 1 36  ? 13.013  -9.200  50.635  1.00 59.96 ? 176 ASP D OD1 1 
ATOM 3448 O OD2 . ASP D 1 36  ? 10.926  -8.852  51.240  1.00 58.77 ? 176 ASP D OD2 1 
ATOM 3449 N N   . ALA D 1 37  ? 13.216  -4.846  49.775  1.00 53.99 ? 177 ALA D N   1 
ATOM 3450 C CA  . ALA D 1 37  ? 12.531  -4.126  48.705  1.00 53.52 ? 177 ALA D CA  1 
ATOM 3451 C C   . ALA D 1 37  ? 13.528  -3.429  47.789  1.00 52.84 ? 177 ALA D C   1 
ATOM 3452 O O   . ALA D 1 37  ? 14.735  -3.452  48.035  1.00 53.27 ? 177 ALA D O   1 
ATOM 3453 C CB  . ALA D 1 37  ? 11.569  -3.104  49.296  1.00 53.81 ? 177 ALA D CB  1 
ATOM 3454 N N   . LYS D 1 38  ? 13.012  -2.804  46.733  1.00 51.48 ? 178 LYS D N   1 
ATOM 3455 C CA  . LYS D 1 38  ? 13.849  -2.094  45.771  1.00 49.76 ? 178 LYS D CA  1 
ATOM 3456 C C   . LYS D 1 38  ? 13.475  -0.615  45.683  1.00 48.95 ? 178 LYS D C   1 
ATOM 3457 O O   . LYS D 1 38  ? 12.311  -0.252  45.862  1.00 48.24 ? 178 LYS D O   1 
ATOM 3458 C CB  . LYS D 1 38  ? 13.696  -2.719  44.385  1.00 48.06 ? 178 LYS D CB  1 
ATOM 3459 C CG  . LYS D 1 38  ? 12.301  -2.555  43.813  1.00 45.53 ? 178 LYS D CG  1 
ATOM 3460 C CD  . LYS D 1 38  ? 12.200  -3.117  42.411  1.00 45.17 ? 178 LYS D CD  1 
ATOM 3461 C CE  . LYS D 1 38  ? 10.783  -2.989  41.878  1.00 44.14 ? 178 LYS D CE  1 
ATOM 3462 N NZ  . LYS D 1 38  ? 10.635  -3.613  40.537  1.00 46.61 ? 178 LYS D NZ  1 
ATOM 3463 N N   . LEU D 1 39  ? 14.464  0.233   45.407  1.00 48.02 ? 179 LEU D N   1 
ATOM 3464 C CA  . LEU D 1 39  ? 14.221  1.666   45.265  1.00 47.44 ? 179 LEU D CA  1 
ATOM 3465 C C   . LEU D 1 39  ? 13.116  1.890   44.231  1.00 47.66 ? 179 LEU D C   1 
ATOM 3466 O O   . LEU D 1 39  ? 12.944  1.092   43.307  1.00 48.50 ? 179 LEU D O   1 
ATOM 3467 C CB  . LEU D 1 39  ? 15.497  2.383   44.815  1.00 46.37 ? 179 LEU D CB  1 
ATOM 3468 C CG  . LEU D 1 39  ? 16.550  2.707   45.876  1.00 46.24 ? 179 LEU D CG  1 
ATOM 3469 C CD1 . LEU D 1 39  ? 17.872  3.025   45.209  1.00 46.45 ? 179 LEU D CD1 1 
ATOM 3470 C CD2 . LEU D 1 39  ? 16.084  3.880   46.718  1.00 47.40 ? 179 LEU D CD2 1 
ATOM 3471 N N   . LEU D 1 40  ? 12.372  2.979   44.398  1.00 46.89 ? 180 LEU D N   1 
ATOM 3472 C CA  . LEU D 1 40  ? 11.273  3.327   43.505  1.00 44.37 ? 180 LEU D CA  1 
ATOM 3473 C C   . LEU D 1 40  ? 11.572  3.043   42.037  1.00 43.53 ? 180 LEU D C   1 
ATOM 3474 O O   . LEU D 1 40  ? 12.659  3.346   41.541  1.00 43.38 ? 180 LEU D O   1 
ATOM 3475 C CB  . LEU D 1 40  ? 10.918  4.808   43.672  1.00 43.27 ? 180 LEU D CB  1 
ATOM 3476 C CG  . LEU D 1 40  ? 9.851   5.374   42.732  1.00 43.72 ? 180 LEU D CG  1 
ATOM 3477 C CD1 . LEU D 1 40  ? 8.542   4.633   42.936  1.00 42.84 ? 180 LEU D CD1 1 
ATOM 3478 C CD2 . LEU D 1 40  ? 9.672   6.860   42.995  1.00 44.51 ? 180 LEU D CD2 1 
ATOM 3479 N N   . LYS D 1 41  ? 10.600  2.448   41.355  1.00 41.45 ? 181 LYS D N   1 
ATOM 3480 C CA  . LYS D 1 41  ? 10.723  2.143   39.939  1.00 40.68 ? 181 LYS D CA  1 
ATOM 3481 C C   . LYS D 1 41  ? 9.429   2.543   39.236  1.00 39.90 ? 181 LYS D C   1 
ATOM 3482 O O   . LYS D 1 41  ? 8.459   1.787   39.226  1.00 38.09 ? 181 LYS D O   1 
ATOM 3483 C CB  . LYS D 1 41  ? 10.981  0.652   39.715  1.00 42.46 ? 181 LYS D CB  1 
ATOM 3484 C CG  . LYS D 1 41  ? 11.013  0.277   38.230  1.00 44.75 ? 181 LYS D CG  1 
ATOM 3485 C CD  . LYS D 1 41  ? 11.117  -1.221  37.991  1.00 44.48 ? 181 LYS D CD  1 
ATOM 3486 C CE  . LYS D 1 41  ? 10.948  -1.539  36.509  1.00 45.03 ? 181 LYS D CE  1 
ATOM 3487 N NZ  . LYS D 1 41  ? 11.001  -2.998  36.212  1.00 45.79 ? 181 LYS D NZ  1 
ATOM 3488 N N   . ILE D 1 42  ? 9.420   3.734   38.645  1.00 39.72 ? 182 ILE D N   1 
ATOM 3489 C CA  . ILE D 1 42  ? 8.239   4.235   37.951  1.00 39.30 ? 182 ILE D CA  1 
ATOM 3490 C C   . ILE D 1 42  ? 8.057   3.575   36.587  1.00 40.14 ? 182 ILE D C   1 
ATOM 3491 O O   . ILE D 1 42  ? 8.805   3.855   35.655  1.00 40.64 ? 182 ILE D O   1 
ATOM 3492 C CB  . ILE D 1 42  ? 8.315   5.760   37.741  1.00 36.85 ? 182 ILE D CB  1 
ATOM 3493 C CG1 . ILE D 1 42  ? 8.736   6.452   39.038  1.00 36.95 ? 182 ILE D CG1 1 
ATOM 3494 C CG2 . ILE D 1 42  ? 6.955   6.283   37.319  1.00 37.39 ? 182 ILE D CG2 1 
ATOM 3495 C CD1 . ILE D 1 42  ? 8.894   7.957   38.917  1.00 36.49 ? 182 ILE D CD1 1 
ATOM 3496 N N   . ASN D 1 43  ? 7.054   2.708   36.473  1.00 41.13 ? 183 ASN D N   1 
ATOM 3497 C CA  . ASN D 1 43  ? 6.771   2.008   35.223  1.00 40.80 ? 183 ASN D CA  1 
ATOM 3498 C C   . ASN D 1 43  ? 5.534   2.547   34.523  1.00 40.93 ? 183 ASN D C   1 
ATOM 3499 O O   . ASN D 1 43  ? 4.847   1.804   33.824  1.00 42.05 ? 183 ASN D O   1 
ATOM 3500 C CB  . ASN D 1 43  ? 6.583   0.505   35.477  1.00 41.68 ? 183 ASN D CB  1 
ATOM 3501 C CG  . ASN D 1 43  ? 7.903   -0.248  35.569  1.00 43.49 ? 183 ASN D CG  1 
ATOM 3502 O OD1 . ASN D 1 43  ? 7.933   -1.435  35.896  1.00 44.11 ? 183 ASN D OD1 1 
ATOM 3503 N ND2 . ASN D 1 43  ? 8.999   0.437   35.272  1.00 43.58 ? 183 ASN D ND2 1 
ATOM 3504 N N   . SER D 1 44  ? 5.245   3.833   34.710  1.00 41.37 ? 184 SER D N   1 
ATOM 3505 C CA  . SER D 1 44  ? 4.080   4.450   34.072  1.00 41.87 ? 184 SER D CA  1 
ATOM 3506 C C   . SER D 1 44  ? 3.816   5.880   34.531  1.00 41.91 ? 184 SER D C   1 
ATOM 3507 O O   . SER D 1 44  ? 4.367   6.335   35.534  1.00 42.48 ? 184 SER D O   1 
ATOM 3508 C CB  . SER D 1 44  ? 2.827   3.614   34.330  1.00 40.12 ? 184 SER D CB  1 
ATOM 3509 O OG  . SER D 1 44  ? 2.569   3.511   35.716  1.00 38.75 ? 184 SER D OG  1 
ATOM 3510 N N   . THR D 1 45  ? 2.961   6.580   33.789  1.00 41.34 ? 185 THR D N   1 
ATOM 3511 C CA  . THR D 1 45  ? 2.612   7.957   34.117  1.00 42.93 ? 185 THR D CA  1 
ATOM 3512 C C   . THR D 1 45  ? 1.678   8.037   35.319  1.00 43.40 ? 185 THR D C   1 
ATOM 3513 O O   . THR D 1 45  ? 1.649   9.045   36.022  1.00 45.60 ? 185 THR D O   1 
ATOM 3514 C CB  . THR D 1 45  ? 1.948   8.682   32.919  1.00 42.97 ? 185 THR D CB  1 
ATOM 3515 O OG1 . THR D 1 45  ? 1.345   7.721   32.043  1.00 44.79 ? 185 THR D OG1 1 
ATOM 3516 C CG2 . THR D 1 45  ? 2.973   9.499   32.152  1.00 42.79 ? 185 THR D CG2 1 
ATOM 3517 N N   . ALA D 1 46  ? 0.907   6.982   35.553  1.00 42.34 ? 186 ALA D N   1 
ATOM 3518 C CA  . ALA D 1 46  ? 0.004   6.961   36.695  1.00 42.70 ? 186 ALA D CA  1 
ATOM 3519 C C   . ALA D 1 46  ? 0.895   6.802   37.920  1.00 44.15 ? 186 ALA D C   1 
ATOM 3520 O O   . ALA D 1 46  ? 0.595   7.296   39.009  1.00 44.88 ? 186 ALA D O   1 
ATOM 3521 C CB  . ALA D 1 46  ? -0.951  5.787   36.581  1.00 42.53 ? 186 ALA D CB  1 
ATOM 3522 N N   . ASP D 1 47  ? 2.006   6.105   37.712  1.00 44.34 ? 187 ASP D N   1 
ATOM 3523 C CA  . ASP D 1 47  ? 2.982   5.856   38.757  1.00 45.06 ? 187 ASP D CA  1 
ATOM 3524 C C   . ASP D 1 47  ? 3.644   7.158   39.174  1.00 45.22 ? 187 ASP D C   1 
ATOM 3525 O O   . ASP D 1 47  ? 3.931   7.366   40.354  1.00 46.06 ? 187 ASP D O   1 
ATOM 3526 C CB  . ASP D 1 47  ? 4.048   4.881   38.252  1.00 46.09 ? 187 ASP D CB  1 
ATOM 3527 C CG  . ASP D 1 47  ? 3.821   3.462   38.735  1.00 47.33 ? 187 ASP D CG  1 
ATOM 3528 O OD1 . ASP D 1 47  ? 2.652   3.019   38.769  1.00 45.70 ? 187 ASP D OD1 1 
ATOM 3529 O OD2 . ASP D 1 47  ? 4.819   2.786   39.071  1.00 46.65 ? 187 ASP D OD2 1 
ATOM 3530 N N   . LEU D 1 48  ? 3.880   8.034   38.203  1.00 43.44 ? 188 LEU D N   1 
ATOM 3531 C CA  . LEU D 1 48  ? 4.522   9.315   38.473  1.00 41.93 ? 188 LEU D CA  1 
ATOM 3532 C C   . LEU D 1 48  ? 3.539   10.354  39.023  1.00 42.49 ? 188 LEU D C   1 
ATOM 3533 O O   . LEU D 1 48  ? 3.932   11.263  39.751  1.00 41.73 ? 188 LEU D O   1 
ATOM 3534 C CB  . LEU D 1 48  ? 5.189   9.832   37.196  1.00 39.94 ? 188 LEU D CB  1 
ATOM 3535 C CG  . LEU D 1 48  ? 6.307   10.868  37.339  1.00 38.30 ? 188 LEU D CG  1 
ATOM 3536 C CD1 . LEU D 1 48  ? 7.384   10.591  36.307  1.00 37.90 ? 188 LEU D CD1 1 
ATOM 3537 C CD2 . LEU D 1 48  ? 5.761   12.269  37.174  1.00 37.26 ? 188 LEU D CD2 1 
ATOM 3538 N N   . ASP D 1 49  ? 2.261   10.220  38.683  1.00 42.44 ? 189 ASP D N   1 
ATOM 3539 C CA  . ASP D 1 49  ? 1.260   11.162  39.170  1.00 42.75 ? 189 ASP D CA  1 
ATOM 3540 C C   . ASP D 1 49  ? 0.959   10.910  40.639  1.00 41.86 ? 189 ASP D C   1 
ATOM 3541 O O   . ASP D 1 49  ? 0.487   11.798  41.345  1.00 43.88 ? 189 ASP D O   1 
ATOM 3542 C CB  . ASP D 1 49  ? -0.032  11.057  38.355  1.00 44.83 ? 189 ASP D CB  1 
ATOM 3543 C CG  . ASP D 1 49  ? 0.078   11.723  36.996  1.00 48.07 ? 189 ASP D CG  1 
ATOM 3544 O OD1 . ASP D 1 49  ? 0.596   12.859  36.933  1.00 49.46 ? 189 ASP D OD1 1 
ATOM 3545 O OD2 . ASP D 1 49  ? -0.363  11.122  35.992  1.00 51.57 ? 189 ASP D OD2 1 
ATOM 3546 N N   . PHE D 1 50  ? 1.237   9.693   41.093  1.00 40.38 ? 190 PHE D N   1 
ATOM 3547 C CA  . PHE D 1 50  ? 1.005   9.313   42.484  1.00 39.01 ? 190 PHE D CA  1 
ATOM 3548 C C   . PHE D 1 50  ? 2.169   9.750   43.373  1.00 37.49 ? 190 PHE D C   1 
ATOM 3549 O O   . PHE D 1 50  ? 1.970   10.393  44.404  1.00 36.88 ? 190 PHE D O   1 
ATOM 3550 C CB  . PHE D 1 50  ? 0.812   7.795   42.583  1.00 38.09 ? 190 PHE D CB  1 
ATOM 3551 C CG  . PHE D 1 50  ? 1.009   7.248   43.967  1.00 36.84 ? 190 PHE D CG  1 
ATOM 3552 C CD1 . PHE D 1 50  ? 0.117   7.562   44.985  1.00 36.51 ? 190 PHE D CD1 1 
ATOM 3553 C CD2 . PHE D 1 50  ? 2.102   6.428   44.257  1.00 34.59 ? 190 PHE D CD2 1 
ATOM 3554 C CE1 . PHE D 1 50  ? 0.312   7.068   46.273  1.00 34.32 ? 190 PHE D CE1 1 
ATOM 3555 C CE2 . PHE D 1 50  ? 2.303   5.935   45.532  1.00 31.70 ? 190 PHE D CE2 1 
ATOM 3556 C CZ  . PHE D 1 50  ? 1.408   6.253   46.543  1.00 33.03 ? 190 PHE D CZ  1 
ATOM 3557 N N   . ILE D 1 51  ? 3.383   9.394   42.972  1.00 35.91 ? 191 ILE D N   1 
ATOM 3558 C CA  . ILE D 1 51  ? 4.564   9.760   43.741  1.00 35.01 ? 191 ILE D CA  1 
ATOM 3559 C C   . ILE D 1 51  ? 4.645   11.272  43.930  1.00 35.11 ? 191 ILE D C   1 
ATOM 3560 O O   . ILE D 1 51  ? 5.304   11.754  44.848  1.00 35.86 ? 191 ILE D O   1 
ATOM 3561 C CB  . ILE D 1 51  ? 5.858   9.252   43.050  1.00 34.06 ? 191 ILE D CB  1 
ATOM 3562 C CG1 . ILE D 1 51  ? 5.943   7.729   43.164  1.00 33.13 ? 191 ILE D CG1 1 
ATOM 3563 C CG2 . ILE D 1 51  ? 7.089   9.884   43.689  1.00 34.87 ? 191 ILE D CG2 1 
ATOM 3564 C CD1 . ILE D 1 51  ? 5.982   7.227   44.588  1.00 30.23 ? 191 ILE D CD1 1 
ATOM 3565 N N   . GLN D 1 52  ? 3.968   12.021  43.067  1.00 36.09 ? 192 GLN D N   1 
ATOM 3566 C CA  . GLN D 1 52  ? 3.976   13.476  43.157  1.00 36.83 ? 192 GLN D CA  1 
ATOM 3567 C C   . GLN D 1 52  ? 2.924   13.974  44.139  1.00 37.21 ? 192 GLN D C   1 
ATOM 3568 O O   . GLN D 1 52  ? 3.134   14.969  44.832  1.00 36.73 ? 192 GLN D O   1 
ATOM 3569 C CB  . GLN D 1 52  ? 3.728   14.102  41.784  1.00 39.19 ? 192 GLN D CB  1 
ATOM 3570 C CG  . GLN D 1 52  ? 3.754   15.623  41.798  1.00 42.43 ? 192 GLN D CG  1 
ATOM 3571 C CD  . GLN D 1 52  ? 5.112   16.182  42.179  1.00 45.87 ? 192 GLN D CD  1 
ATOM 3572 O OE1 . GLN D 1 52  ? 5.703   15.789  43.185  1.00 47.96 ? 192 GLN D OE1 1 
ATOM 3573 N NE2 . GLN D 1 52  ? 5.610   17.114  41.376  1.00 47.79 ? 192 GLN D NE2 1 
ATOM 3574 N N   . GLN D 1 53  ? 1.786   13.293  44.189  1.00 38.61 ? 193 GLN D N   1 
ATOM 3575 C CA  . GLN D 1 53  ? 0.729   13.678  45.115  1.00 41.77 ? 193 GLN D CA  1 
ATOM 3576 C C   . GLN D 1 53  ? 1.213   13.323  46.518  1.00 42.38 ? 193 GLN D C   1 
ATOM 3577 O O   . GLN D 1 53  ? 0.753   13.882  47.514  1.00 42.69 ? 193 GLN D O   1 
ATOM 3578 C CB  . GLN D 1 53  ? -0.556  12.900  44.823  1.00 43.52 ? 193 GLN D CB  1 
ATOM 3579 C CG  . GLN D 1 53  ? -1.766  13.358  45.642  1.00 49.45 ? 193 GLN D CG  1 
ATOM 3580 C CD  . GLN D 1 53  ? -2.752  12.229  45.950  1.00 53.36 ? 193 GLN D CD  1 
ATOM 3581 O OE1 . GLN D 1 53  ? -3.105  11.436  45.074  1.00 54.03 ? 193 GLN D OE1 1 
ATOM 3582 N NE2 . GLN D 1 53  ? -3.207  12.165  47.203  1.00 54.22 ? 193 GLN D NE2 1 
ATOM 3583 N N   . ALA D 1 54  ? 2.154   12.387  46.575  1.00 42.12 ? 194 ALA D N   1 
ATOM 3584 C CA  . ALA D 1 54  ? 2.701   11.909  47.834  1.00 42.87 ? 194 ALA D CA  1 
ATOM 3585 C C   . ALA D 1 54  ? 3.814   12.774  48.417  1.00 44.17 ? 194 ALA D C   1 
ATOM 3586 O O   . ALA D 1 54  ? 4.101   12.695  49.611  1.00 47.08 ? 194 ALA D O   1 
ATOM 3587 C CB  . ALA D 1 54  ? 3.188   10.476  47.660  1.00 42.07 ? 194 ALA D CB  1 
ATOM 3588 N N   . ILE D 1 55  ? 4.454   13.587  47.589  1.00 43.30 ? 195 ILE D N   1 
ATOM 3589 C CA  . ILE D 1 55  ? 5.516   14.449  48.083  1.00 43.45 ? 195 ILE D CA  1 
ATOM 3590 C C   . ILE D 1 55  ? 5.199   15.882  47.694  1.00 43.74 ? 195 ILE D C   1 
ATOM 3591 O O   . ILE D 1 55  ? 6.057   16.761  47.743  1.00 43.74 ? 195 ILE D O   1 
ATOM 3592 C CB  . ILE D 1 55  ? 6.888   14.063  47.495  1.00 45.35 ? 195 ILE D CB  1 
ATOM 3593 C CG1 . ILE D 1 55  ? 6.919   14.343  45.992  1.00 46.06 ? 195 ILE D CG1 1 
ATOM 3594 C CG2 . ILE D 1 55  ? 7.168   12.597  47.755  1.00 44.80 ? 195 ILE D CG2 1 
ATOM 3595 C CD1 . ILE D 1 55  ? 8.307   14.294  45.396  1.00 46.93 ? 195 ILE D CD1 1 
ATOM 3596 N N   . SER D 1 56  ? 3.952   16.104  47.302  1.00 43.46 ? 196 SER D N   1 
ATOM 3597 C CA  . SER D 1 56  ? 3.485   17.423  46.898  1.00 44.94 ? 196 SER D CA  1 
ATOM 3598 C C   . SER D 1 56  ? 3.932   18.509  47.875  1.00 43.53 ? 196 SER D C   1 
ATOM 3599 O O   . SER D 1 56  ? 4.178   19.653  47.489  1.00 41.64 ? 196 SER D O   1 
ATOM 3600 C CB  . SER D 1 56  ? 1.959   17.418  46.805  1.00 47.55 ? 196 SER D CB  1 
ATOM 3601 O OG  . SER D 1 56  ? 1.378   17.092  48.058  1.00 52.10 ? 196 SER D OG  1 
ATOM 3602 N N   . TYR D 1 57  ? 4.031   18.135  49.144  1.00 44.33 ? 197 TYR D N   1 
ATOM 3603 C CA  . TYR D 1 57  ? 4.436   19.060  50.196  1.00 44.72 ? 197 TYR D CA  1 
ATOM 3604 C C   . TYR D 1 57  ? 5.945   19.056  50.438  1.00 43.92 ? 197 TYR D C   1 
ATOM 3605 O O   . TYR D 1 57  ? 6.401   19.379  51.534  1.00 44.94 ? 197 TYR D O   1 
ATOM 3606 C CB  . TYR D 1 57  ? 3.698   18.709  51.493  1.00 43.43 ? 197 TYR D CB  1 
ATOM 3607 C CG  . TYR D 1 57  ? 3.820   17.252  51.898  1.00 43.94 ? 197 TYR D CG  1 
ATOM 3608 C CD1 . TYR D 1 57  ? 5.027   16.731  52.379  1.00 42.98 ? 197 TYR D CD1 1 
ATOM 3609 C CD2 . TYR D 1 57  ? 2.729   16.391  51.794  1.00 42.61 ? 197 TYR D CD2 1 
ATOM 3610 C CE1 . TYR D 1 57  ? 5.138   15.391  52.745  1.00 42.39 ? 197 TYR D CE1 1 
ATOM 3611 C CE2 . TYR D 1 57  ? 2.832   15.048  52.158  1.00 43.27 ? 197 TYR D CE2 1 
ATOM 3612 C CZ  . TYR D 1 57  ? 4.037   14.554  52.631  1.00 43.07 ? 197 TYR D CZ  1 
ATOM 3613 O OH  . TYR D 1 57  ? 4.135   13.223  52.979  1.00 42.58 ? 197 TYR D OH  1 
ATOM 3614 N N   . SER D 1 58  ? 6.717   18.702  49.414  1.00 41.84 ? 198 SER D N   1 
ATOM 3615 C CA  . SER D 1 58  ? 8.166   18.656  49.546  1.00 40.06 ? 198 SER D CA  1 
ATOM 3616 C C   . SER D 1 58  ? 8.893   19.221  48.335  1.00 40.56 ? 198 SER D C   1 
ATOM 3617 O O   . SER D 1 58  ? 8.337   19.310  47.248  1.00 40.45 ? 198 SER D O   1 
ATOM 3618 C CB  . SER D 1 58  ? 8.621   17.216  49.780  1.00 39.21 ? 198 SER D CB  1 
ATOM 3619 O OG  . SER D 1 58  ? 10.035  17.124  49.809  1.00 37.38 ? 198 SER D OG  1 
ATOM 3620 N N   . SER D 1 59  ? 10.151  19.593  48.536  1.00 42.20 ? 199 SER D N   1 
ATOM 3621 C CA  . SER D 1 59  ? 10.971  20.142  47.468  1.00 44.24 ? 199 SER D CA  1 
ATOM 3622 C C   . SER D 1 59  ? 12.406  19.647  47.590  1.00 46.17 ? 199 SER D C   1 
ATOM 3623 O O   . SER D 1 59  ? 13.350  20.385  47.309  1.00 46.29 ? 199 SER D O   1 
ATOM 3624 C CB  . SER D 1 59  ? 10.942  21.666  47.523  1.00 43.14 ? 199 SER D CB  1 
ATOM 3625 O OG  . SER D 1 59  ? 9.617   22.136  47.360  1.00 45.46 ? 199 SER D OG  1 
ATOM 3626 N N   . PHE D 1 60  ? 12.563  18.394  48.011  1.00 47.45 ? 200 PHE D N   1 
ATOM 3627 C CA  . PHE D 1 60  ? 13.881  17.794  48.175  1.00 49.49 ? 200 PHE D CA  1 
ATOM 3628 C C   . PHE D 1 60  ? 14.042  16.629  47.218  1.00 49.42 ? 200 PHE D C   1 
ATOM 3629 O O   . PHE D 1 60  ? 13.059  16.060  46.751  1.00 50.18 ? 200 PHE D O   1 
ATOM 3630 C CB  . PHE D 1 60  ? 14.061  17.304  49.610  1.00 52.50 ? 200 PHE D CB  1 
ATOM 3631 C CG  . PHE D 1 60  ? 13.844  18.369  50.636  1.00 56.90 ? 200 PHE D CG  1 
ATOM 3632 C CD1 . PHE D 1 60  ? 12.905  18.194  51.646  1.00 58.69 ? 200 PHE D CD1 1 
ATOM 3633 C CD2 . PHE D 1 60  ? 14.561  19.561  50.580  1.00 59.24 ? 200 PHE D CD2 1 
ATOM 3634 C CE1 . PHE D 1 60  ? 12.677  19.193  52.588  1.00 60.97 ? 200 PHE D CE1 1 
ATOM 3635 C CE2 . PHE D 1 60  ? 14.344  20.569  51.516  1.00 61.83 ? 200 PHE D CE2 1 
ATOM 3636 C CZ  . PHE D 1 60  ? 13.397  20.384  52.524  1.00 61.96 ? 200 PHE D CZ  1 
ATOM 3637 N N   . PRO D 1 61  ? 15.289  16.261  46.906  1.00 48.81 ? 201 PRO D N   1 
ATOM 3638 C CA  . PRO D 1 61  ? 15.521  15.146  45.987  1.00 48.48 ? 201 PRO D CA  1 
ATOM 3639 C C   . PRO D 1 61  ? 15.344  13.768  46.623  1.00 47.95 ? 201 PRO D C   1 
ATOM 3640 O O   . PRO D 1 61  ? 15.955  13.454  47.646  1.00 48.27 ? 201 PRO D O   1 
ATOM 3641 C CB  . PRO D 1 61  ? 16.949  15.393  45.510  1.00 48.48 ? 201 PRO D CB  1 
ATOM 3642 C CG  . PRO D 1 61  ? 17.591  15.989  46.722  1.00 49.89 ? 201 PRO D CG  1 
ATOM 3643 C CD  . PRO D 1 61  ? 16.546  16.969  47.204  1.00 48.76 ? 201 PRO D CD  1 
ATOM 3644 N N   . PHE D 1 62  ? 14.492  12.954  46.009  1.00 46.71 ? 202 PHE D N   1 
ATOM 3645 C CA  . PHE D 1 62  ? 14.239  11.599  46.478  1.00 44.67 ? 202 PHE D CA  1 
ATOM 3646 C C   . PHE D 1 62  ? 14.848  10.628  45.480  1.00 44.68 ? 202 PHE D C   1 
ATOM 3647 O O   . PHE D 1 62  ? 14.463  10.613  44.313  1.00 45.09 ? 202 PHE D O   1 
ATOM 3648 C CB  . PHE D 1 62  ? 12.739  11.323  46.575  1.00 44.13 ? 202 PHE D CB  1 
ATOM 3649 C CG  . PHE D 1 62  ? 12.030  12.148  47.605  1.00 44.06 ? 202 PHE D CG  1 
ATOM 3650 C CD1 . PHE D 1 62  ? 11.795  13.499  47.389  1.00 44.75 ? 202 PHE D CD1 1 
ATOM 3651 C CD2 . PHE D 1 62  ? 11.578  11.571  48.786  1.00 42.86 ? 202 PHE D CD2 1 
ATOM 3652 C CE1 . PHE D 1 62  ? 11.115  14.266  48.334  1.00 45.89 ? 202 PHE D CE1 1 
ATOM 3653 C CE2 . PHE D 1 62  ? 10.898  12.328  49.737  1.00 44.15 ? 202 PHE D CE2 1 
ATOM 3654 C CZ  . PHE D 1 62  ? 10.666  13.679  49.510  1.00 44.44 ? 202 PHE D CZ  1 
ATOM 3655 N N   . TRP D 1 63  ? 15.801  9.822   45.937  1.00 44.17 ? 203 TRP D N   1 
ATOM 3656 C CA  . TRP D 1 63  ? 16.448  8.848   45.068  1.00 43.94 ? 203 TRP D CA  1 
ATOM 3657 C C   . TRP D 1 63  ? 15.442  7.807   44.590  1.00 44.83 ? 203 TRP D C   1 
ATOM 3658 O O   . TRP D 1 63  ? 14.507  7.455   45.316  1.00 43.01 ? 203 TRP D O   1 
ATOM 3659 C CB  . TRP D 1 63  ? 17.576  8.129   45.811  1.00 43.66 ? 203 TRP D CB  1 
ATOM 3660 C CG  . TRP D 1 63  ? 18.862  8.889   45.934  1.00 43.69 ? 203 TRP D CG  1 
ATOM 3661 C CD1 . TRP D 1 63  ? 19.581  9.100   47.079  1.00 43.93 ? 203 TRP D CD1 1 
ATOM 3662 C CD2 . TRP D 1 63  ? 19.633  9.461   44.867  1.00 43.27 ? 203 TRP D CD2 1 
ATOM 3663 N NE1 . TRP D 1 63  ? 20.752  9.762   46.791  1.00 44.03 ? 203 TRP D NE1 1 
ATOM 3664 C CE2 . TRP D 1 63  ? 20.809  9.997   45.442  1.00 43.71 ? 203 TRP D CE2 1 
ATOM 3665 C CE3 . TRP D 1 63  ? 19.445  9.573   43.484  1.00 42.07 ? 203 TRP D CE3 1 
ATOM 3666 C CZ2 . TRP D 1 63  ? 21.795  10.633  44.678  1.00 42.08 ? 203 TRP D CZ2 1 
ATOM 3667 C CZ3 . TRP D 1 63  ? 20.424  10.204  42.728  1.00 41.33 ? 203 TRP D CZ3 1 
ATOM 3668 C CH2 . TRP D 1 63  ? 21.585  10.727  43.328  1.00 41.88 ? 203 TRP D CH2 1 
ATOM 3669 N N   . MET D 1 64  ? 15.632  7.334   43.360  1.00 45.74 ? 204 MET D N   1 
ATOM 3670 C CA  . MET D 1 64  ? 14.779  6.300   42.781  1.00 46.15 ? 204 MET D CA  1 
ATOM 3671 C C   . MET D 1 64  ? 15.717  5.256   42.192  1.00 46.13 ? 204 MET D C   1 
ATOM 3672 O O   . MET D 1 64  ? 16.908  5.520   42.028  1.00 45.47 ? 204 MET D O   1 
ATOM 3673 C CB  . MET D 1 64  ? 13.850  6.866   41.696  1.00 44.92 ? 204 MET D CB  1 
ATOM 3674 C CG  . MET D 1 64  ? 14.538  7.469   40.492  1.00 44.55 ? 204 MET D CG  1 
ATOM 3675 S SD  . MET D 1 64  ? 13.392  7.628   39.106  1.00 43.18 ? 204 MET D SD  1 
ATOM 3676 C CE  . MET D 1 64  ? 12.345  8.952   39.642  1.00 44.68 ? 204 MET D CE  1 
ATOM 3677 N N   . GLY D 1 65  ? 15.191  4.077   41.880  1.00 46.57 ? 205 GLY D N   1 
ATOM 3678 C CA  . GLY D 1 65  ? 16.032  3.020   41.347  1.00 48.02 ? 205 GLY D CA  1 
ATOM 3679 C C   . GLY D 1 65  ? 16.510  3.174   39.914  1.00 48.91 ? 205 GLY D C   1 
ATOM 3680 O O   . GLY D 1 65  ? 16.405  2.233   39.129  1.00 49.39 ? 205 GLY D O   1 
ATOM 3681 N N   . LEU D 1 66  ? 17.043  4.342   39.563  1.00 48.41 ? 206 LEU D N   1 
ATOM 3682 C CA  . LEU D 1 66  ? 17.527  4.568   38.203  1.00 48.44 ? 206 LEU D CA  1 
ATOM 3683 C C   . LEU D 1 66  ? 18.964  5.075   38.233  1.00 49.64 ? 206 LEU D C   1 
ATOM 3684 O O   . LEU D 1 66  ? 19.342  5.796   39.157  1.00 50.21 ? 206 LEU D O   1 
ATOM 3685 C CB  . LEU D 1 66  ? 16.637  5.589   37.491  1.00 46.94 ? 206 LEU D CB  1 
ATOM 3686 C CG  . LEU D 1 66  ? 16.706  5.615   35.965  1.00 44.67 ? 206 LEU D CG  1 
ATOM 3687 C CD1 . LEU D 1 66  ? 16.196  4.290   35.424  1.00 44.23 ? 206 LEU D CD1 1 
ATOM 3688 C CD2 . LEU D 1 66  ? 15.868  6.758   35.425  1.00 43.11 ? 206 LEU D CD2 1 
ATOM 3689 N N   . SER D 1 67  ? 19.761  4.703   37.230  1.00 50.84 ? 207 SER D N   1 
ATOM 3690 C CA  . SER D 1 67  ? 21.160  5.135   37.175  1.00 51.91 ? 207 SER D CA  1 
ATOM 3691 C C   . SER D 1 67  ? 21.939  4.582   35.984  1.00 52.60 ? 207 SER D C   1 
ATOM 3692 O O   . SER D 1 67  ? 21.435  3.748   35.230  1.00 52.66 ? 207 SER D O   1 
ATOM 3693 C CB  . SER D 1 67  ? 21.884  4.739   38.472  1.00 51.90 ? 207 SER D CB  1 
ATOM 3694 O OG  . SER D 1 67  ? 21.750  3.352   38.739  1.00 50.97 ? 207 SER D OG  1 
ATOM 3695 N N   . ARG D 1 68  ? 23.170  5.071   35.827  1.00 53.15 ? 208 ARG D N   1 
ATOM 3696 C CA  . ARG D 1 68  ? 24.078  4.643   34.763  1.00 53.36 ? 208 ARG D CA  1 
ATOM 3697 C C   . ARG D 1 68  ? 25.492  5.134   35.096  1.00 54.20 ? 208 ARG D C   1 
ATOM 3698 O O   . ARG D 1 68  ? 25.658  6.048   35.901  1.00 53.71 ? 208 ARG D O   1 
ATOM 3699 C CB  . ARG D 1 68  ? 23.623  5.184   33.399  1.00 51.65 ? 208 ARG D CB  1 
ATOM 3700 C CG  . ARG D 1 68  ? 23.900  6.658   33.128  1.00 51.14 ? 208 ARG D CG  1 
ATOM 3701 C CD  . ARG D 1 68  ? 23.434  7.022   31.713  1.00 51.07 ? 208 ARG D CD  1 
ATOM 3702 N NE  . ARG D 1 68  ? 23.518  8.452   31.410  1.00 48.96 ? 208 ARG D NE  1 
ATOM 3703 C CZ  . ARG D 1 68  ? 22.913  9.032   30.373  1.00 46.78 ? 208 ARG D CZ  1 
ATOM 3704 N NH1 . ARG D 1 68  ? 22.179  8.307   29.539  1.00 44.05 ? 208 ARG D NH1 1 
ATOM 3705 N NH2 . ARG D 1 68  ? 23.036  10.338  30.170  1.00 44.66 ? 208 ARG D NH2 1 
ATOM 3706 N N   . ARG D 1 69  ? 26.506  4.525   34.485  1.00 55.41 ? 209 ARG D N   1 
ATOM 3707 C CA  . ARG D 1 69  ? 27.896  4.903   34.750  1.00 55.94 ? 209 ARG D CA  1 
ATOM 3708 C C   . ARG D 1 69  ? 28.552  5.627   33.577  1.00 56.94 ? 209 ARG D C   1 
ATOM 3709 O O   . ARG D 1 69  ? 29.612  6.239   33.728  1.00 56.63 ? 209 ARG D O   1 
ATOM 3710 C CB  . ARG D 1 69  ? 28.723  3.662   35.093  1.00 54.10 ? 209 ARG D CB  1 
ATOM 3711 C CG  . ARG D 1 69  ? 28.153  2.810   36.215  1.00 52.92 ? 209 ARG D CG  1 
ATOM 3712 C CD  . ARG D 1 69  ? 29.023  1.589   36.459  1.00 51.04 ? 209 ARG D CD  1 
ATOM 3713 N NE  . ARG D 1 69  ? 30.366  1.968   36.886  1.00 52.00 ? 209 ARG D NE  1 
ATOM 3714 C CZ  . ARG D 1 69  ? 30.649  2.539   38.055  1.00 52.10 ? 209 ARG D CZ  1 
ATOM 3715 N NH1 . ARG D 1 69  ? 29.680  2.795   38.925  1.00 51.83 ? 209 ARG D NH1 1 
ATOM 3716 N NH2 . ARG D 1 69  ? 31.901  2.864   38.350  1.00 49.81 ? 209 ARG D NH2 1 
ATOM 3717 N N   . ASN D 1 70  ? 27.918  5.548   32.412  1.00 57.43 ? 210 ASN D N   1 
ATOM 3718 C CA  . ASN D 1 70  ? 28.427  6.181   31.201  1.00 57.68 ? 210 ASN D CA  1 
ATOM 3719 C C   . ASN D 1 70  ? 27.258  6.746   30.393  1.00 57.89 ? 210 ASN D C   1 
ATOM 3720 O O   . ASN D 1 70  ? 26.192  6.140   30.336  1.00 57.84 ? 210 ASN D O   1 
ATOM 3721 C CB  . ASN D 1 70  ? 29.213  5.150   30.388  1.00 58.36 ? 210 ASN D CB  1 
ATOM 3722 C CG  . ASN D 1 70  ? 29.285  5.489   28.917  1.00 60.92 ? 210 ASN D CG  1 
ATOM 3723 O OD1 . ASN D 1 70  ? 29.762  6.555   28.529  1.00 63.06 ? 210 ASN D OD1 1 
ATOM 3724 N ND2 . ASN D 1 70  ? 28.814  4.571   28.082  1.00 61.29 ? 210 ASN D ND2 1 
ATOM 3725 N N   . PRO D 1 71  ? 27.440  7.927   29.773  1.00 57.97 ? 211 PRO D N   1 
ATOM 3726 C CA  . PRO D 1 71  ? 26.420  8.607   28.963  1.00 58.37 ? 211 PRO D CA  1 
ATOM 3727 C C   . PRO D 1 71  ? 25.877  7.838   27.758  1.00 58.66 ? 211 PRO D C   1 
ATOM 3728 O O   . PRO D 1 71  ? 25.052  8.358   27.006  1.00 57.05 ? 211 PRO D O   1 
ATOM 3729 C CB  . PRO D 1 71  ? 27.118  9.899   28.549  1.00 58.89 ? 211 PRO D CB  1 
ATOM 3730 C CG  . PRO D 1 71  ? 27.999  10.179  29.717  1.00 58.49 ? 211 PRO D CG  1 
ATOM 3731 C CD  . PRO D 1 71  ? 28.593  8.818   29.992  1.00 58.43 ? 211 PRO D CD  1 
ATOM 3732 N N   . SER D 1 72  ? 26.344  6.610   27.570  1.00 60.15 ? 212 SER D N   1 
ATOM 3733 C CA  . SER D 1 72  ? 25.876  5.780   26.464  1.00 61.93 ? 212 SER D CA  1 
ATOM 3734 C C   . SER D 1 72  ? 25.010  4.663   27.052  1.00 65.00 ? 212 SER D C   1 
ATOM 3735 O O   . SER D 1 72  ? 24.363  3.896   26.337  1.00 65.11 ? 212 SER D O   1 
ATOM 3736 C CB  . SER D 1 72  ? 27.068  5.199   25.712  1.00 59.50 ? 212 SER D CB  1 
ATOM 3737 O OG  . SER D 1 72  ? 27.946  6.235   25.313  1.00 55.99 ? 212 SER D OG  1 
ATOM 3738 N N   . TYR D 1 73  ? 25.021  4.595   28.377  1.00 67.97 ? 213 TYR D N   1 
ATOM 3739 C CA  . TYR D 1 73  ? 24.246  3.630   29.148  1.00 70.47 ? 213 TYR D CA  1 
ATOM 3740 C C   . TYR D 1 73  ? 22.765  3.972   29.036  1.00 70.60 ? 213 TYR D C   1 
ATOM 3741 O O   . TYR D 1 73  ? 22.361  5.084   29.383  1.00 71.25 ? 213 TYR D O   1 
ATOM 3742 C CB  . TYR D 1 73  ? 24.562  3.759   30.636  1.00 73.54 ? 213 TYR D CB  1 
ATOM 3743 C CG  . TYR D 1 73  ? 25.609  2.868   31.253  1.00 75.56 ? 213 TYR D CG  1 
ATOM 3744 C CD1 . TYR D 1 73  ? 26.944  2.936   30.866  1.00 76.94 ? 213 TYR D CD1 1 
ATOM 3745 C CD2 . TYR D 1 73  ? 25.278  2.051   32.334  1.00 76.09 ? 213 TYR D CD2 1 
ATOM 3746 C CE1 . TYR D 1 73  ? 27.928  2.220   31.553  1.00 77.54 ? 213 TYR D CE1 1 
ATOM 3747 C CE2 . TYR D 1 73  ? 26.244  1.339   33.024  1.00 76.89 ? 213 TYR D CE2 1 
ATOM 3748 C CZ  . TYR D 1 73  ? 27.569  1.426   32.634  1.00 77.43 ? 213 TYR D CZ  1 
ATOM 3749 O OH  . TYR D 1 73  ? 28.532  0.736   33.336  1.00 77.87 ? 213 TYR D OH  1 
ATOM 3750 N N   . PRO D 1 74  ? 21.932  3.044   28.550  1.00 69.78 ? 214 PRO D N   1 
ATOM 3751 C CA  . PRO D 1 74  ? 20.538  3.494   28.523  1.00 68.83 ? 214 PRO D CA  1 
ATOM 3752 C C   . PRO D 1 74  ? 20.157  3.482   30.009  1.00 66.91 ? 214 PRO D C   1 
ATOM 3753 O O   . PRO D 1 74  ? 20.409  2.488   30.686  1.00 66.59 ? 214 PRO D O   1 
ATOM 3754 C CB  . PRO D 1 74  ? 19.831  2.387   27.746  1.00 69.64 ? 214 PRO D CB  1 
ATOM 3755 C CG  . PRO D 1 74  ? 20.920  1.831   26.865  1.00 69.86 ? 214 PRO D CG  1 
ATOM 3756 C CD  . PRO D 1 74  ? 22.106  1.794   27.795  1.00 69.46 ? 214 PRO D CD  1 
ATOM 3757 N N   . TRP D 1 75  ? 19.593  4.566   30.534  1.00 64.64 ? 215 TRP D N   1 
ATOM 3758 C CA  . TRP D 1 75  ? 19.238  4.573   31.955  1.00 61.73 ? 215 TRP D CA  1 
ATOM 3759 C C   . TRP D 1 75  ? 18.552  3.251   32.319  1.00 60.58 ? 215 TRP D C   1 
ATOM 3760 O O   . TRP D 1 75  ? 17.524  2.893   31.734  1.00 59.82 ? 215 TRP D O   1 
ATOM 3761 C CB  . TRP D 1 75  ? 18.302  5.742   32.295  1.00 60.01 ? 215 TRP D CB  1 
ATOM 3762 C CG  . TRP D 1 75  ? 18.886  7.120   32.097  1.00 57.05 ? 215 TRP D CG  1 
ATOM 3763 C CD1 . TRP D 1 75  ? 18.645  7.970   31.055  1.00 56.02 ? 215 TRP D CD1 1 
ATOM 3764 C CD2 . TRP D 1 75  ? 19.774  7.816   32.983  1.00 55.15 ? 215 TRP D CD2 1 
ATOM 3765 N NE1 . TRP D 1 75  ? 19.320  9.153   31.239  1.00 53.60 ? 215 TRP D NE1 1 
ATOM 3766 C CE2 . TRP D 1 75  ? 20.021  9.086   32.412  1.00 53.84 ? 215 TRP D CE2 1 
ATOM 3767 C CE3 . TRP D 1 75  ? 20.383  7.492   34.203  1.00 54.27 ? 215 TRP D CE3 1 
ATOM 3768 C CZ2 . TRP D 1 75  ? 20.853  10.032  33.022  1.00 53.06 ? 215 TRP D CZ2 1 
ATOM 3769 C CZ3 . TRP D 1 75  ? 21.213  8.436   34.809  1.00 53.03 ? 215 TRP D CZ3 1 
ATOM 3770 C CH2 . TRP D 1 75  ? 21.438  9.690   34.215  1.00 52.28 ? 215 TRP D CH2 1 
ATOM 3771 N N   . LEU D 1 76  ? 19.128  2.528   33.278  1.00 58.66 ? 216 LEU D N   1 
ATOM 3772 C CA  . LEU D 1 76  ? 18.574  1.241   33.706  1.00 57.34 ? 216 LEU D CA  1 
ATOM 3773 C C   . LEU D 1 76  ? 18.129  1.250   35.159  1.00 56.80 ? 216 LEU D C   1 
ATOM 3774 O O   . LEU D 1 76  ? 18.728  1.924   35.996  1.00 57.44 ? 216 LEU D O   1 
ATOM 3775 C CB  . LEU D 1 76  ? 19.604  0.119   33.537  1.00 55.15 ? 216 LEU D CB  1 
ATOM 3776 C CG  . LEU D 1 76  ? 20.213  -0.190  32.170  1.00 53.53 ? 216 LEU D CG  1 
ATOM 3777 C CD1 . LEU D 1 76  ? 21.180  -1.353  32.318  1.00 52.13 ? 216 LEU D CD1 1 
ATOM 3778 C CD2 . LEU D 1 76  ? 19.126  -0.526  31.164  1.00 53.14 ? 216 LEU D CD2 1 
ATOM 3779 N N   . TRP D 1 77  ? 17.081  0.487   35.455  1.00 56.07 ? 217 TRP D N   1 
ATOM 3780 C CA  . TRP D 1 77  ? 16.582  0.387   36.819  1.00 54.48 ? 217 TRP D CA  1 
ATOM 3781 C C   . TRP D 1 77  ? 17.521  -0.545  37.573  1.00 53.62 ? 217 TRP D C   1 
ATOM 3782 O O   . TRP D 1 77  ? 18.654  -0.760  37.141  1.00 53.31 ? 217 TRP D O   1 
ATOM 3783 C CB  . TRP D 1 77  ? 15.156  -0.166  36.826  1.00 54.03 ? 217 TRP D CB  1 
ATOM 3784 C CG  . TRP D 1 77  ? 14.183  0.735   36.131  1.00 54.03 ? 217 TRP D CG  1 
ATOM 3785 C CD1 . TRP D 1 77  ? 13.623  0.550   34.899  1.00 53.40 ? 217 TRP D CD1 1 
ATOM 3786 C CD2 . TRP D 1 77  ? 13.695  1.993   36.610  1.00 54.67 ? 217 TRP D CD2 1 
ATOM 3787 N NE1 . TRP D 1 77  ? 12.817  1.619   34.580  1.00 53.29 ? 217 TRP D NE1 1 
ATOM 3788 C CE2 . TRP D 1 77  ? 12.846  2.519   35.612  1.00 53.88 ? 217 TRP D CE2 1 
ATOM 3789 C CE3 . TRP D 1 77  ? 13.900  2.730   37.784  1.00 55.00 ? 217 TRP D CE3 1 
ATOM 3790 C CZ2 . TRP D 1 77  ? 12.195  3.751   35.756  1.00 53.96 ? 217 TRP D CZ2 1 
ATOM 3791 C CZ3 . TRP D 1 77  ? 13.253  3.955   37.927  1.00 54.67 ? 217 TRP D CZ3 1 
ATOM 3792 C CH2 . TRP D 1 77  ? 12.412  4.452   36.916  1.00 54.10 ? 217 TRP D CH2 1 
ATOM 3793 N N   . GLU D 1 78  ? 17.066  -1.097  38.693  1.00 52.17 ? 218 GLU D N   1 
ATOM 3794 C CA  . GLU D 1 78  ? 17.911  -1.999  39.466  1.00 51.15 ? 218 GLU D CA  1 
ATOM 3795 C C   . GLU D 1 78  ? 17.841  -3.422  38.926  1.00 51.92 ? 218 GLU D C   1 
ATOM 3796 O O   . GLU D 1 78  ? 18.820  -4.169  38.992  1.00 52.74 ? 218 GLU D O   1 
ATOM 3797 C CB  . GLU D 1 78  ? 17.518  -1.966  40.941  1.00 49.24 ? 218 GLU D CB  1 
ATOM 3798 C CG  . GLU D 1 78  ? 17.790  -0.627  41.594  1.00 47.53 ? 218 GLU D CG  1 
ATOM 3799 C CD  . GLU D 1 78  ? 17.618  -0.657  43.099  1.00 47.57 ? 218 GLU D CD  1 
ATOM 3800 O OE1 . GLU D 1 78  ? 16.483  -0.883  43.577  1.00 43.73 ? 218 GLU D OE1 1 
ATOM 3801 O OE2 . GLU D 1 78  ? 18.631  -0.454  43.801  1.00 47.24 ? 218 GLU D OE2 1 
ATOM 3802 N N   . ASP D 1 79  ? 16.683  -3.794  38.392  1.00 51.53 ? 219 ASP D N   1 
ATOM 3803 C CA  . ASP D 1 79  ? 16.510  -5.122  37.821  1.00 50.61 ? 219 ASP D CA  1 
ATOM 3804 C C   . ASP D 1 79  ? 17.363  -5.237  36.556  1.00 49.79 ? 219 ASP D C   1 
ATOM 3805 O O   . ASP D 1 79  ? 17.691  -6.335  36.106  1.00 49.61 ? 219 ASP D O   1 
ATOM 3806 C CB  . ASP D 1 79  ? 15.038  -5.357  37.486  1.00 51.95 ? 219 ASP D CB  1 
ATOM 3807 C CG  . ASP D 1 79  ? 14.412  -4.180  36.768  1.00 53.80 ? 219 ASP D CG  1 
ATOM 3808 O OD1 . ASP D 1 79  ? 14.929  -3.787  35.702  1.00 53.99 ? 219 ASP D OD1 1 
ATOM 3809 O OD2 . ASP D 1 79  ? 13.400  -3.649  37.272  1.00 54.97 ? 219 ASP D OD2 1 
ATOM 3810 N N   . GLY D 1 80  ? 17.721  -4.090  35.989  1.00 48.55 ? 220 GLY D N   1 
ATOM 3811 C CA  . GLY D 1 80  ? 18.539  -4.085  34.793  1.00 45.64 ? 220 GLY D CA  1 
ATOM 3812 C C   . GLY D 1 80  ? 17.755  -3.826  33.528  1.00 43.72 ? 220 GLY D C   1 
ATOM 3813 O O   . GLY D 1 80  ? 18.296  -3.951  32.435  1.00 43.52 ? 220 GLY D O   1 
ATOM 3814 N N   . SER D 1 81  ? 16.480  -3.476  33.666  1.00 43.17 ? 221 SER D N   1 
ATOM 3815 C CA  . SER D 1 81  ? 15.649  -3.187  32.504  1.00 43.93 ? 221 SER D CA  1 
ATOM 3816 C C   . SER D 1 81  ? 15.819  -1.712  32.149  1.00 45.99 ? 221 SER D C   1 
ATOM 3817 O O   . SER D 1 81  ? 16.110  -0.884  33.016  1.00 46.89 ? 221 SER D O   1 
ATOM 3818 C CB  . SER D 1 81  ? 14.175  -3.496  32.793  1.00 42.72 ? 221 SER D CB  1 
ATOM 3819 O OG  . SER D 1 81  ? 13.642  -2.634  33.781  1.00 42.46 ? 221 SER D OG  1 
ATOM 3820 N N   . PRO D 1 82  ? 15.658  -1.363  30.864  1.00 47.12 ? 222 PRO D N   1 
ATOM 3821 C CA  . PRO D 1 82  ? 15.811  0.036   30.463  1.00 47.52 ? 222 PRO D CA  1 
ATOM 3822 C C   . PRO D 1 82  ? 14.604  0.898   30.812  1.00 48.12 ? 222 PRO D C   1 
ATOM 3823 O O   . PRO D 1 82  ? 13.480  0.407   30.931  1.00 46.96 ? 222 PRO D O   1 
ATOM 3824 C CB  . PRO D 1 82  ? 16.036  -0.066  28.960  1.00 46.51 ? 222 PRO D CB  1 
ATOM 3825 C CG  . PRO D 1 82  ? 15.157  -1.214  28.593  1.00 46.24 ? 222 PRO D CG  1 
ATOM 3826 C CD  . PRO D 1 82  ? 15.455  -2.225  29.686  1.00 46.60 ? 222 PRO D CD  1 
ATOM 3827 N N   . LEU D 1 83  ? 14.857  2.190   30.981  1.00 49.70 ? 223 LEU D N   1 
ATOM 3828 C CA  . LEU D 1 83  ? 13.810  3.150   31.298  1.00 51.51 ? 223 LEU D CA  1 
ATOM 3829 C C   . LEU D 1 83  ? 12.854  3.274   30.118  1.00 52.46 ? 223 LEU D C   1 
ATOM 3830 O O   . LEU D 1 83  ? 13.261  3.659   29.024  1.00 52.91 ? 223 LEU D O   1 
ATOM 3831 C CB  . LEU D 1 83  ? 14.442  4.511   31.608  1.00 50.83 ? 223 LEU D CB  1 
ATOM 3832 C CG  . LEU D 1 83  ? 13.663  5.794   31.294  1.00 51.62 ? 223 LEU D CG  1 
ATOM 3833 C CD1 . LEU D 1 83  ? 12.409  5.891   32.144  1.00 50.76 ? 223 LEU D CD1 1 
ATOM 3834 C CD2 . LEU D 1 83  ? 14.572  6.989   31.540  1.00 51.47 ? 223 LEU D CD2 1 
ATOM 3835 N N   . MET D 1 84  ? 11.587  2.942   30.334  1.00 54.32 ? 224 MET D N   1 
ATOM 3836 C CA  . MET D 1 84  ? 10.603  3.038   29.267  1.00 57.05 ? 224 MET D CA  1 
ATOM 3837 C C   . MET D 1 84  ? 10.537  4.476   28.775  1.00 57.36 ? 224 MET D C   1 
ATOM 3838 O O   . MET D 1 84  ? 10.482  5.411   29.573  1.00 58.08 ? 224 MET D O   1 
ATOM 3839 C CB  . MET D 1 84  ? 9.216   2.624   29.766  1.00 60.61 ? 224 MET D CB  1 
ATOM 3840 C CG  . MET D 1 84  ? 8.170   2.527   28.654  1.00 64.95 ? 224 MET D CG  1 
ATOM 3841 S SD  . MET D 1 84  ? 6.449   2.652   29.207  1.00 70.14 ? 224 MET D SD  1 
ATOM 3842 C CE  . MET D 1 84  ? 5.986   4.260   28.508  1.00 65.91 ? 224 MET D CE  1 
ATOM 3843 N N   . PRO D 1 85  ? 10.554  4.677   27.452  1.00 58.08 ? 225 PRO D N   1 
ATOM 3844 C CA  . PRO D 1 85  ? 10.486  6.045   26.938  1.00 58.34 ? 225 PRO D CA  1 
ATOM 3845 C C   . PRO D 1 85  ? 9.061   6.588   26.994  1.00 59.42 ? 225 PRO D C   1 
ATOM 3846 O O   . PRO D 1 85  ? 8.089   5.824   26.961  1.00 59.67 ? 225 PRO D O   1 
ATOM 3847 C CB  . PRO D 1 85  ? 10.999  5.897   25.514  1.00 58.01 ? 225 PRO D CB  1 
ATOM 3848 C CG  . PRO D 1 85  ? 10.498  4.533   25.132  1.00 57.61 ? 225 PRO D CG  1 
ATOM 3849 C CD  . PRO D 1 85  ? 10.814  3.716   26.363  1.00 57.12 ? 225 PRO D CD  1 
ATOM 3850 N N   . HIS D 1 86  ? 8.948   7.909   27.089  1.00 59.41 ? 226 HIS D N   1 
ATOM 3851 C CA  . HIS D 1 86  ? 7.655   8.586   27.143  1.00 60.21 ? 226 HIS D CA  1 
ATOM 3852 C C   . HIS D 1 86  ? 7.019   8.579   28.527  1.00 58.36 ? 226 HIS D C   1 
ATOM 3853 O O   . HIS D 1 86  ? 5.796   8.567   28.661  1.00 58.75 ? 226 HIS D O   1 
ATOM 3854 C CB  . HIS D 1 86  ? 6.693   7.974   26.120  1.00 64.39 ? 226 HIS D CB  1 
ATOM 3855 C CG  . HIS D 1 86  ? 7.245   7.941   24.730  1.00 70.08 ? 226 HIS D CG  1 
ATOM 3856 N ND1 . HIS D 1 86  ? 7.638   9.080   24.059  1.00 71.57 ? 226 HIS D ND1 1 
ATOM 3857 C CD2 . HIS D 1 86  ? 7.511   6.904   23.899  1.00 72.01 ? 226 HIS D CD2 1 
ATOM 3858 C CE1 . HIS D 1 86  ? 8.123   8.745   22.876  1.00 72.69 ? 226 HIS D CE1 1 
ATOM 3859 N NE2 . HIS D 1 86  ? 8.058   7.431   22.755  1.00 73.20 ? 226 HIS D NE2 1 
ATOM 3860 N N   . LEU D 1 87  ? 7.860   8.587   29.555  1.00 55.70 ? 227 LEU D N   1 
ATOM 3861 C CA  . LEU D 1 87  ? 7.398   8.621   30.935  1.00 52.30 ? 227 LEU D CA  1 
ATOM 3862 C C   . LEU D 1 87  ? 7.828   9.963   31.508  1.00 50.16 ? 227 LEU D C   1 
ATOM 3863 O O   . LEU D 1 87  ? 7.017   10.869  31.706  1.00 49.79 ? 227 LEU D O   1 
ATOM 3864 C CB  . LEU D 1 87  ? 8.035   7.493   31.746  1.00 51.62 ? 227 LEU D CB  1 
ATOM 3865 C CG  . LEU D 1 87  ? 7.564   6.074   31.432  1.00 52.67 ? 227 LEU D CG  1 
ATOM 3866 C CD1 . LEU D 1 87  ? 8.299   5.085   32.331  1.00 53.19 ? 227 LEU D CD1 1 
ATOM 3867 C CD2 . LEU D 1 87  ? 6.056   5.976   31.641  1.00 52.66 ? 227 LEU D CD2 1 
ATOM 3868 N N   . PHE D 1 88  ? 9.123   10.079  31.761  1.00 47.58 ? 228 PHE D N   1 
ATOM 3869 C CA  . PHE D 1 88  ? 9.697   11.300  32.291  1.00 45.74 ? 228 PHE D CA  1 
ATOM 3870 C C   . PHE D 1 88  ? 11.016  11.565  31.581  1.00 45.79 ? 228 PHE D C   1 
ATOM 3871 O O   . PHE D 1 88  ? 11.626  10.652  31.022  1.00 43.71 ? 228 PHE D O   1 
ATOM 3872 C CB  . PHE D 1 88  ? 9.919   11.177  33.804  1.00 45.22 ? 228 PHE D CB  1 
ATOM 3873 C CG  . PHE D 1 88  ? 10.762  9.999   34.208  1.00 44.91 ? 228 PHE D CG  1 
ATOM 3874 C CD1 . PHE D 1 88  ? 12.123  9.955   33.918  1.00 44.67 ? 228 PHE D CD1 1 
ATOM 3875 C CD2 . PHE D 1 88  ? 10.192  8.927   34.881  1.00 44.71 ? 228 PHE D CD2 1 
ATOM 3876 C CE1 . PHE D 1 88  ? 12.897  8.858   34.292  1.00 43.71 ? 228 PHE D CE1 1 
ATOM 3877 C CE2 . PHE D 1 88  ? 10.960  7.828   35.258  1.00 43.94 ? 228 PHE D CE2 1 
ATOM 3878 C CZ  . PHE D 1 88  ? 12.311  7.795   34.964  1.00 42.25 ? 228 PHE D CZ  1 
ATOM 3879 N N   . ARG D 1 89  ? 11.443  12.822  31.607  1.00 46.67 ? 229 ARG D N   1 
ATOM 3880 C CA  . ARG D 1 89  ? 12.686  13.242  30.974  1.00 46.38 ? 229 ARG D CA  1 
ATOM 3881 C C   . ARG D 1 89  ? 13.759  13.412  32.040  1.00 44.47 ? 229 ARG D C   1 
ATOM 3882 O O   . ARG D 1 89  ? 13.569  14.142  33.009  1.00 44.15 ? 229 ARG D O   1 
ATOM 3883 C CB  . ARG D 1 89  ? 12.449  14.563  30.240  1.00 48.93 ? 229 ARG D CB  1 
ATOM 3884 C CG  . ARG D 1 89  ? 13.680  15.255  29.700  1.00 54.13 ? 229 ARG D CG  1 
ATOM 3885 C CD  . ARG D 1 89  ? 13.311  16.663  29.240  1.00 58.91 ? 229 ARG D CD  1 
ATOM 3886 N NE  . ARG D 1 89  ? 12.441  16.665  28.064  1.00 63.90 ? 229 ARG D NE  1 
ATOM 3887 C CZ  . ARG D 1 89  ? 11.719  17.712  27.664  1.00 66.01 ? 229 ARG D CZ  1 
ATOM 3888 N NH1 . ARG D 1 89  ? 11.751  18.851  28.348  1.00 67.40 ? 229 ARG D NH1 1 
ATOM 3889 N NH2 . ARG D 1 89  ? 10.972  17.629  26.569  1.00 66.11 ? 229 ARG D NH2 1 
ATOM 3890 N N   . VAL D 1 90  ? 14.880  12.721  31.873  1.00 43.94 ? 230 VAL D N   1 
ATOM 3891 C CA  . VAL D 1 90  ? 15.965  12.828  32.838  1.00 43.70 ? 230 VAL D CA  1 
ATOM 3892 C C   . VAL D 1 90  ? 16.737  14.112  32.585  1.00 43.47 ? 230 VAL D C   1 
ATOM 3893 O O   . VAL D 1 90  ? 17.412  14.257  31.565  1.00 43.60 ? 230 VAL D O   1 
ATOM 3894 C CB  . VAL D 1 90  ? 16.945  11.636  32.746  1.00 43.65 ? 230 VAL D CB  1 
ATOM 3895 C CG1 . VAL D 1 90  ? 18.035  11.783  33.798  1.00 43.30 ? 230 VAL D CG1 1 
ATOM 3896 C CG2 . VAL D 1 90  ? 16.196  10.326  32.940  1.00 42.92 ? 230 VAL D CG2 1 
ATOM 3897 N N   . ARG D 1 91  ? 16.619  15.044  33.523  1.00 42.97 ? 231 ARG D N   1 
ATOM 3898 C CA  . ARG D 1 91  ? 17.292  16.334  33.443  1.00 42.75 ? 231 ARG D CA  1 
ATOM 3899 C C   . ARG D 1 91  ? 18.568  16.281  34.294  1.00 42.67 ? 231 ARG D C   1 
ATOM 3900 O O   . ARG D 1 91  ? 18.946  15.218  34.789  1.00 43.58 ? 231 ARG D O   1 
ATOM 3901 C CB  . ARG D 1 91  ? 16.353  17.427  33.972  1.00 42.64 ? 231 ARG D CB  1 
ATOM 3902 C CG  . ARG D 1 91  ? 15.006  17.539  33.242  1.00 41.15 ? 231 ARG D CG  1 
ATOM 3903 C CD  . ARG D 1 91  ? 13.989  18.298  34.100  1.00 40.45 ? 231 ARG D CD  1 
ATOM 3904 N NE  . ARG D 1 91  ? 13.134  19.203  33.329  1.00 39.93 ? 231 ARG D NE  1 
ATOM 3905 C CZ  . ARG D 1 91  ? 11.852  18.985  33.043  1.00 39.62 ? 231 ARG D CZ  1 
ATOM 3906 N NH1 . ARG D 1 91  ? 11.247  17.879  33.459  1.00 39.18 ? 231 ARG D NH1 1 
ATOM 3907 N NH2 . ARG D 1 91  ? 11.167  19.883  32.345  1.00 37.76 ? 231 ARG D NH2 1 
ATOM 3908 N N   . GLY D 1 92  ? 19.236  17.419  34.450  1.00 41.84 ? 232 GLY D N   1 
ATOM 3909 C CA  . GLY D 1 92  ? 20.431  17.457  35.275  1.00 42.03 ? 232 GLY D CA  1 
ATOM 3910 C C   . GLY D 1 92  ? 21.768  17.172  34.620  1.00 43.11 ? 232 GLY D C   1 
ATOM 3911 O O   . GLY D 1 92  ? 22.047  17.631  33.515  1.00 43.21 ? 232 GLY D O   1 
ATOM 3912 N N   . ALA D 1 93  ? 22.601  16.412  35.326  1.00 45.09 ? 233 ALA D N   1 
ATOM 3913 C CA  . ALA D 1 93  ? 23.937  16.052  34.862  1.00 47.46 ? 233 ALA D CA  1 
ATOM 3914 C C   . ALA D 1 93  ? 23.918  14.814  33.982  1.00 50.06 ? 233 ALA D C   1 
ATOM 3915 O O   . ALA D 1 93  ? 24.649  13.852  34.224  1.00 50.78 ? 233 ALA D O   1 
ATOM 3916 C CB  . ALA D 1 93  ? 24.847  15.820  36.055  1.00 46.64 ? 233 ALA D CB  1 
ATOM 3917 N N   . VAL D 1 94  ? 23.085  14.850  32.950  1.00 52.18 ? 234 VAL D N   1 
ATOM 3918 C CA  . VAL D 1 94  ? 22.959  13.731  32.032  1.00 54.01 ? 234 VAL D CA  1 
ATOM 3919 C C   . VAL D 1 94  ? 24.131  13.663  31.057  1.00 56.21 ? 234 VAL D C   1 
ATOM 3920 O O   . VAL D 1 94  ? 23.955  13.314  29.889  1.00 57.54 ? 234 VAL D O   1 
ATOM 3921 C CB  . VAL D 1 94  ? 21.650  13.839  31.234  1.00 53.53 ? 234 VAL D CB  1 
ATOM 3922 C CG1 . VAL D 1 94  ? 20.467  13.794  32.181  1.00 52.84 ? 234 VAL D CG1 1 
ATOM 3923 C CG2 . VAL D 1 94  ? 21.632  15.134  30.439  1.00 53.90 ? 234 VAL D CG2 1 
ATOM 3924 N N   . SER D 1 95  ? 25.328  13.986  31.539  1.00 57.32 ? 235 SER D N   1 
ATOM 3925 C CA  . SER D 1 95  ? 26.514  13.962  30.691  1.00 58.39 ? 235 SER D CA  1 
ATOM 3926 C C   . SER D 1 95  ? 27.813  13.739  31.458  1.00 59.66 ? 235 SER D C   1 
ATOM 3927 O O   . SER D 1 95  ? 28.748  13.127  30.939  1.00 59.79 ? 235 SER D O   1 
ATOM 3928 C CB  . SER D 1 95  ? 26.599  15.264  29.889  1.00 59.29 ? 235 SER D CB  1 
ATOM 3929 O OG  . SER D 1 95  ? 26.373  16.395  30.715  1.00 59.60 ? 235 SER D OG  1 
ATOM 3930 N N   . GLN D 1 96  ? 27.872  14.234  32.691  1.00 61.35 ? 236 GLN D N   1 
ATOM 3931 C CA  . GLN D 1 96  ? 29.067  14.086  33.518  1.00 63.37 ? 236 GLN D CA  1 
ATOM 3932 C C   . GLN D 1 96  ? 29.260  12.648  33.986  1.00 64.36 ? 236 GLN D C   1 
ATOM 3933 O O   . GLN D 1 96  ? 28.291  11.924  34.214  1.00 65.41 ? 236 GLN D O   1 
ATOM 3934 C CB  . GLN D 1 96  ? 28.986  15.008  34.736  1.00 64.26 ? 236 GLN D CB  1 
ATOM 3935 C CG  . GLN D 1 96  ? 29.033  16.493  34.414  1.00 66.46 ? 236 GLN D CG  1 
ATOM 3936 C CD  . GLN D 1 96  ? 27.956  16.919  33.433  1.00 68.18 ? 236 GLN D CD  1 
ATOM 3937 O OE1 . GLN D 1 96  ? 26.775  16.623  33.619  1.00 69.30 ? 236 GLN D OE1 1 
ATOM 3938 N NE2 . GLN D 1 96  ? 28.359  17.625  32.383  1.00 68.87 ? 236 GLN D NE2 1 
ATOM 3939 N N   . THR D 1 97  ? 30.517  12.241  34.131  1.00 64.92 ? 237 THR D N   1 
ATOM 3940 C CA  . THR D 1 97  ? 30.843  10.889  34.576  1.00 65.52 ? 237 THR D CA  1 
ATOM 3941 C C   . THR D 1 97  ? 31.559  10.939  35.921  1.00 65.38 ? 237 THR D C   1 
ATOM 3942 O O   . THR D 1 97  ? 32.686  11.423  36.022  1.00 65.19 ? 237 THR D O   1 
ATOM 3943 C CB  . THR D 1 97  ? 31.747  10.172  33.558  1.00 66.00 ? 237 THR D CB  1 
ATOM 3944 O OG1 . THR D 1 97  ? 31.126  10.202  32.268  1.00 66.54 ? 237 THR D OG1 1 
ATOM 3945 C CG2 . THR D 1 97  ? 31.976  8.722   33.975  1.00 65.82 ? 237 THR D CG2 1 
ATOM 3946 N N   . TYR D 1 98  ? 30.901  10.425  36.953  1.00 65.37 ? 238 TYR D N   1 
ATOM 3947 C CA  . TYR D 1 98  ? 31.474  10.435  38.290  1.00 65.50 ? 238 TYR D CA  1 
ATOM 3948 C C   . TYR D 1 98  ? 32.074  9.091   38.666  1.00 64.46 ? 238 TYR D C   1 
ATOM 3949 O O   . TYR D 1 98  ? 31.625  8.044   38.200  1.00 64.49 ? 238 TYR D O   1 
ATOM 3950 C CB  . TYR D 1 98  ? 30.403  10.838  39.306  1.00 66.75 ? 238 TYR D CB  1 
ATOM 3951 C CG  . TYR D 1 98  ? 29.561  11.995  38.822  1.00 67.92 ? 238 TYR D CG  1 
ATOM 3952 C CD1 . TYR D 1 98  ? 28.412  11.775  38.062  1.00 67.88 ? 238 TYR D CD1 1 
ATOM 3953 C CD2 . TYR D 1 98  ? 29.951  13.312  39.062  1.00 66.77 ? 238 TYR D CD2 1 
ATOM 3954 C CE1 . TYR D 1 98  ? 27.674  12.838  37.549  1.00 67.14 ? 238 TYR D CE1 1 
ATOM 3955 C CE2 . TYR D 1 98  ? 29.222  14.381  38.554  1.00 66.01 ? 238 TYR D CE2 1 
ATOM 3956 C CZ  . TYR D 1 98  ? 28.087  14.136  37.798  1.00 66.89 ? 238 TYR D CZ  1 
ATOM 3957 O OH  . TYR D 1 98  ? 27.368  15.187  37.283  1.00 66.65 ? 238 TYR D OH  1 
ATOM 3958 N N   . PRO D 1 99  ? 33.110  9.107   39.519  1.00 63.04 ? 239 PRO D N   1 
ATOM 3959 C CA  . PRO D 1 99  ? 33.805  7.906   39.986  1.00 62.52 ? 239 PRO D CA  1 
ATOM 3960 C C   . PRO D 1 99  ? 32.864  6.907   40.653  1.00 62.39 ? 239 PRO D C   1 
ATOM 3961 O O   . PRO D 1 99  ? 33.246  5.772   40.932  1.00 61.56 ? 239 PRO D O   1 
ATOM 3962 C CB  . PRO D 1 99  ? 34.827  8.468   40.966  1.00 62.78 ? 239 PRO D CB  1 
ATOM 3963 C CG  . PRO D 1 99  ? 35.123  9.816   40.400  1.00 62.61 ? 239 PRO D CG  1 
ATOM 3964 C CD  . PRO D 1 99  ? 33.750  10.317  40.060  1.00 62.69 ? 239 PRO D CD  1 
ATOM 3965 N N   . SER D 1 100 ? 31.631  7.335   40.901  1.00 62.45 ? 240 SER D N   1 
ATOM 3966 C CA  . SER D 1 100 ? 30.649  6.478   41.550  1.00 61.77 ? 240 SER D CA  1 
ATOM 3967 C C   . SER D 1 100 ? 29.363  6.346   40.747  1.00 61.21 ? 240 SER D C   1 
ATOM 3968 O O   . SER D 1 100 ? 28.321  5.981   41.292  1.00 61.17 ? 240 SER D O   1 
ATOM 3969 C CB  . SER D 1 100 ? 30.323  7.029   42.936  1.00 62.76 ? 240 SER D CB  1 
ATOM 3970 O OG  . SER D 1 100 ? 31.506  7.236   43.689  1.00 63.74 ? 240 SER D OG  1 
ATOM 3971 N N   . GLY D 1 101 ? 29.436  6.640   39.453  1.00 60.32 ? 241 GLY D N   1 
ATOM 3972 C CA  . GLY D 1 101 ? 28.256  6.543   38.616  1.00 58.40 ? 241 GLY D CA  1 
ATOM 3973 C C   . GLY D 1 101 ? 27.320  7.725   38.785  1.00 57.81 ? 241 GLY D C   1 
ATOM 3974 O O   . GLY D 1 101 ? 27.483  8.543   39.694  1.00 57.83 ? 241 GLY D O   1 
ATOM 3975 N N   . THR D 1 102 ? 26.334  7.811   37.898  1.00 56.86 ? 242 THR D N   1 
ATOM 3976 C CA  . THR D 1 102 ? 25.355  8.888   37.926  1.00 55.33 ? 242 THR D CA  1 
ATOM 3977 C C   . THR D 1 102 ? 23.970  8.311   38.208  1.00 54.55 ? 242 THR D C   1 
ATOM 3978 O O   . THR D 1 102 ? 23.508  7.396   37.524  1.00 53.75 ? 242 THR D O   1 
ATOM 3979 C CB  . THR D 1 102 ? 25.341  9.649   36.587  1.00 55.77 ? 242 THR D CB  1 
ATOM 3980 O OG1 . THR D 1 102 ? 26.670  10.093  36.281  1.00 55.79 ? 242 THR D OG1 1 
ATOM 3981 C CG2 . THR D 1 102 ? 24.411  10.854  36.667  1.00 54.69 ? 242 THR D CG2 1 
ATOM 3982 N N   . CYS D 1 103 ? 23.312  8.864   39.220  1.00 53.75 ? 243 CYS D N   1 
ATOM 3983 C CA  . CYS D 1 103 ? 21.998  8.396   39.632  1.00 52.83 ? 243 CYS D CA  1 
ATOM 3984 C C   . CYS D 1 103 ? 20.893  9.427   39.410  1.00 52.19 ? 243 CYS D C   1 
ATOM 3985 O O   . CYS D 1 103 ? 21.137  10.632  39.456  1.00 52.21 ? 243 CYS D O   1 
ATOM 3986 C CB  . CYS D 1 103 ? 22.071  7.988   41.105  1.00 53.54 ? 243 CYS D CB  1 
ATOM 3987 S SG  . CYS D 1 103 ? 23.193  6.580   41.397  1.00 53.06 ? 243 CYS D SG  1 
ATOM 3988 N N   . ALA D 1 104 ? 19.678  8.942   39.167  1.00 51.29 ? 244 ALA D N   1 
ATOM 3989 C CA  . ALA D 1 104 ? 18.529  9.814   38.925  1.00 50.15 ? 244 ALA D CA  1 
ATOM 3990 C C   . ALA D 1 104 ? 17.557  9.872   40.101  1.00 49.60 ? 244 ALA D C   1 
ATOM 3991 O O   . ALA D 1 104 ? 17.268  8.862   40.738  1.00 49.69 ? 244 ALA D O   1 
ATOM 3992 C CB  . ALA D 1 104 ? 17.790  9.364   37.664  1.00 47.76 ? 244 ALA D CB  1 
ATOM 3993 N N   . TYR D 1 105 ? 17.049  11.066  40.380  1.00 50.01 ? 245 TYR D N   1 
ATOM 3994 C CA  . TYR D 1 105 ? 16.100  11.256  41.469  1.00 49.02 ? 245 TYR D CA  1 
ATOM 3995 C C   . TYR D 1 105 ? 14.936  12.108  40.983  1.00 47.44 ? 245 TYR D C   1 
ATOM 3996 O O   . TYR D 1 105 ? 15.013  12.718  39.920  1.00 46.95 ? 245 TYR D O   1 
ATOM 3997 C CB  . TYR D 1 105 ? 16.785  11.931  42.669  1.00 49.49 ? 245 TYR D CB  1 
ATOM 3998 C CG  . TYR D 1 105 ? 17.270  13.352  42.435  1.00 50.54 ? 245 TYR D CG  1 
ATOM 3999 C CD1 . TYR D 1 105 ? 16.369  14.410  42.291  1.00 51.56 ? 245 TYR D CD1 1 
ATOM 4000 C CD2 . TYR D 1 105 ? 18.636  13.641  42.379  1.00 50.62 ? 245 TYR D CD2 1 
ATOM 4001 C CE1 . TYR D 1 105 ? 16.817  15.721  42.101  1.00 51.07 ? 245 TYR D CE1 1 
ATOM 4002 C CE2 . TYR D 1 105 ? 19.093  14.944  42.189  1.00 49.74 ? 245 TYR D CE2 1 
ATOM 4003 C CZ  . TYR D 1 105 ? 18.180  15.977  42.053  1.00 50.58 ? 245 TYR D CZ  1 
ATOM 4004 O OH  . TYR D 1 105 ? 18.631  17.266  41.888  1.00 49.38 ? 245 TYR D OH  1 
ATOM 4005 N N   . ILE D 1 106 ? 13.854  12.135  41.754  1.00 45.45 ? 246 ILE D N   1 
ATOM 4006 C CA  . ILE D 1 106 ? 12.701  12.942  41.390  1.00 43.10 ? 246 ILE D CA  1 
ATOM 4007 C C   . ILE D 1 106 ? 12.573  14.101  42.359  1.00 42.62 ? 246 ILE D C   1 
ATOM 4008 O O   . ILE D 1 106 ? 12.660  13.932  43.573  1.00 41.95 ? 246 ILE D O   1 
ATOM 4009 C CB  . ILE D 1 106 ? 11.393  12.133  41.411  1.00 42.66 ? 246 ILE D CB  1 
ATOM 4010 C CG1 . ILE D 1 106 ? 10.231  13.036  40.999  1.00 42.29 ? 246 ILE D CG1 1 
ATOM 4011 C CG2 . ILE D 1 106 ? 11.143  11.571  42.798  1.00 43.88 ? 246 ILE D CG2 1 
ATOM 4012 C CD1 . ILE D 1 106 ? 8.929   12.301  40.793  1.00 41.27 ? 246 ILE D CD1 1 
ATOM 4013 N N   . GLN D 1 107 ? 12.376  15.289  41.810  1.00 42.79 ? 247 GLN D N   1 
ATOM 4014 C CA  . GLN D 1 107 ? 12.241  16.478  42.627  1.00 42.79 ? 247 GLN D CA  1 
ATOM 4015 C C   . GLN D 1 107 ? 11.301  17.461  41.965  1.00 43.14 ? 247 GLN D C   1 
ATOM 4016 O O   . GLN D 1 107 ? 11.432  17.760  40.780  1.00 42.88 ? 247 GLN D O   1 
ATOM 4017 C CB  . GLN D 1 107 ? 13.607  17.121  42.849  1.00 41.19 ? 247 GLN D CB  1 
ATOM 4018 C CG  . GLN D 1 107 ? 13.548  18.503  43.458  1.00 40.14 ? 247 GLN D CG  1 
ATOM 4019 C CD  . GLN D 1 107 ? 14.883  18.940  44.004  1.00 40.10 ? 247 GLN D CD  1 
ATOM 4020 O OE1 . GLN D 1 107 ? 15.900  18.862  43.319  1.00 41.51 ? 247 GLN D OE1 1 
ATOM 4021 N NE2 . GLN D 1 107 ? 14.889  19.404  45.246  1.00 41.41 ? 247 GLN D NE2 1 
ATOM 4022 N N   . ARG D 1 108 ? 10.350  17.962  42.742  1.00 44.49 ? 248 ARG D N   1 
ATOM 4023 C CA  . ARG D 1 108 ? 9.373   18.903  42.227  1.00 45.11 ? 248 ARG D CA  1 
ATOM 4024 C C   . ARG D 1 108 ? 8.662   18.248  41.052  1.00 46.46 ? 248 ARG D C   1 
ATOM 4025 O O   . ARG D 1 108 ? 8.222   18.926  40.121  1.00 48.40 ? 248 ARG D O   1 
ATOM 4026 C CB  . ARG D 1 108 ? 10.056  20.203  41.784  1.00 44.06 ? 248 ARG D CB  1 
ATOM 4027 C CG  . ARG D 1 108 ? 10.701  20.989  42.926  1.00 41.75 ? 248 ARG D CG  1 
ATOM 4028 C CD  . ARG D 1 108 ? 10.543  22.488  42.717  1.00 40.23 ? 248 ARG D CD  1 
ATOM 4029 N NE  . ARG D 1 108 ? 11.077  23.271  43.826  1.00 39.74 ? 248 ARG D NE  1 
ATOM 4030 C CZ  . ARG D 1 108 ? 12.372  23.386  44.106  1.00 41.06 ? 248 ARG D CZ  1 
ATOM 4031 N NH1 . ARG D 1 108 ? 13.271  22.767  43.356  1.00 40.41 ? 248 ARG D NH1 1 
ATOM 4032 N NH2 . ARG D 1 108 ? 12.770  24.128  45.132  1.00 40.85 ? 248 ARG D NH2 1 
ATOM 4033 N N   . GLY D 1 109 ? 8.567   16.919  41.102  1.00 46.25 ? 249 GLY D N   1 
ATOM 4034 C CA  . GLY D 1 109 ? 7.895   16.172  40.055  1.00 44.77 ? 249 GLY D CA  1 
ATOM 4035 C C   . GLY D 1 109 ? 8.690   15.966  38.785  1.00 44.76 ? 249 GLY D C   1 
ATOM 4036 O O   . GLY D 1 109 ? 8.142   15.514  37.780  1.00 46.50 ? 249 GLY D O   1 
ATOM 4037 N N   . ALA D 1 110 ? 9.975   16.296  38.821  1.00 43.75 ? 250 ALA D N   1 
ATOM 4038 C CA  . ALA D 1 110 ? 10.836  16.131  37.655  1.00 44.33 ? 250 ALA D CA  1 
ATOM 4039 C C   . ALA D 1 110 ? 12.057  15.294  38.018  1.00 44.12 ? 250 ALA D C   1 
ATOM 4040 O O   . ALA D 1 110 ? 12.561  15.374  39.136  1.00 44.99 ? 250 ALA D O   1 
ATOM 4041 C CB  . ALA D 1 110 ? 11.270  17.496  37.123  1.00 44.22 ? 250 ALA D CB  1 
ATOM 4042 N N   . VAL D 1 111 ? 12.528  14.491  37.069  1.00 43.83 ? 251 VAL D N   1 
ATOM 4043 C CA  . VAL D 1 111 ? 13.688  13.632  37.296  1.00 43.93 ? 251 VAL D CA  1 
ATOM 4044 C C   . VAL D 1 111 ? 14.993  14.320  36.898  1.00 45.14 ? 251 VAL D C   1 
ATOM 4045 O O   . VAL D 1 111 ? 15.099  14.891  35.814  1.00 46.21 ? 251 VAL D O   1 
ATOM 4046 C CB  . VAL D 1 111 ? 13.559  12.316  36.504  1.00 41.76 ? 251 VAL D CB  1 
ATOM 4047 C CG1 . VAL D 1 111 ? 14.693  11.378  36.873  1.00 41.27 ? 251 VAL D CG1 1 
ATOM 4048 C CG2 . VAL D 1 111 ? 12.209  11.674  36.782  1.00 40.18 ? 251 VAL D CG2 1 
ATOM 4049 N N   . TYR D 1 112 ? 15.985  14.259  37.782  1.00 46.96 ? 252 TYR D N   1 
ATOM 4050 C CA  . TYR D 1 112 ? 17.281  14.882  37.529  1.00 47.57 ? 252 TYR D CA  1 
ATOM 4051 C C   . TYR D 1 112 ? 18.435  13.910  37.768  1.00 48.11 ? 252 TYR D C   1 
ATOM 4052 O O   . TYR D 1 112 ? 18.429  13.148  38.733  1.00 47.71 ? 252 TYR D O   1 
ATOM 4053 C CB  . TYR D 1 112 ? 17.482  16.103  38.433  1.00 47.83 ? 252 TYR D CB  1 
ATOM 4054 C CG  . TYR D 1 112 ? 16.378  17.136  38.376  1.00 48.94 ? 252 TYR D CG  1 
ATOM 4055 C CD1 . TYR D 1 112 ? 15.144  16.907  38.986  1.00 49.11 ? 252 TYR D CD1 1 
ATOM 4056 C CD2 . TYR D 1 112 ? 16.572  18.354  37.725  1.00 49.50 ? 252 TYR D CD2 1 
ATOM 4057 C CE1 . TYR D 1 112 ? 14.133  17.865  38.951  1.00 48.68 ? 252 TYR D CE1 1 
ATOM 4058 C CE2 . TYR D 1 112 ? 15.566  19.318  37.683  1.00 49.73 ? 252 TYR D CE2 1 
ATOM 4059 C CZ  . TYR D 1 112 ? 14.352  19.067  38.300  1.00 49.39 ? 252 TYR D CZ  1 
ATOM 4060 O OH  . TYR D 1 112 ? 13.363  20.022  38.274  1.00 49.99 ? 252 TYR D OH  1 
ATOM 4061 N N   . ALA D 1 113 ? 19.428  13.954  36.887  1.00 49.10 ? 253 ALA D N   1 
ATOM 4062 C CA  . ALA D 1 113 ? 20.602  13.100  37.001  1.00 51.42 ? 253 ALA D CA  1 
ATOM 4063 C C   . ALA D 1 113 ? 21.646  13.811  37.855  1.00 53.22 ? 253 ALA D C   1 
ATOM 4064 O O   . ALA D 1 113 ? 21.852  15.014  37.715  1.00 54.39 ? 253 ALA D O   1 
ATOM 4065 C CB  . ALA D 1 113 ? 21.160  12.810  35.625  1.00 51.71 ? 253 ALA D CB  1 
ATOM 4066 N N   . GLU D 1 114 ? 22.315  13.067  38.727  1.00 55.12 ? 254 GLU D N   1 
ATOM 4067 C CA  . GLU D 1 114 ? 23.311  13.658  39.613  1.00 57.45 ? 254 GLU D CA  1 
ATOM 4068 C C   . GLU D 1 114 ? 24.346  12.631  40.065  1.00 58.01 ? 254 GLU D C   1 
ATOM 4069 O O   . GLU D 1 114 ? 24.186  11.435  39.826  1.00 58.50 ? 254 GLU D O   1 
ATOM 4070 C CB  . GLU D 1 114 ? 22.596  14.254  40.834  1.00 59.96 ? 254 GLU D CB  1 
ATOM 4071 C CG  . GLU D 1 114 ? 23.488  14.940  41.860  1.00 63.38 ? 254 GLU D CG  1 
ATOM 4072 C CD  . GLU D 1 114 ? 24.272  16.107  41.283  1.00 66.11 ? 254 GLU D CD  1 
ATOM 4073 O OE1 . GLU D 1 114 ? 25.257  15.868  40.550  1.00 66.82 ? 254 GLU D OE1 1 
ATOM 4074 O OE2 . GLU D 1 114 ? 23.897  17.268  41.558  1.00 65.62 ? 254 GLU D OE2 1 
ATOM 4075 N N   . ASN D 1 115 ? 25.409  13.106  40.711  1.00 58.48 ? 255 ASN D N   1 
ATOM 4076 C CA  . ASN D 1 115 ? 26.461  12.227  41.215  1.00 59.14 ? 255 ASN D CA  1 
ATOM 4077 C C   . ASN D 1 115 ? 25.884  11.424  42.376  1.00 58.40 ? 255 ASN D C   1 
ATOM 4078 O O   . ASN D 1 115 ? 25.402  11.997  43.352  1.00 58.93 ? 255 ASN D O   1 
ATOM 4079 C CB  . ASN D 1 115 ? 27.652  13.047  41.713  1.00 61.38 ? 255 ASN D CB  1 
ATOM 4080 C CG  . ASN D 1 115 ? 28.804  12.176  42.177  1.00 63.67 ? 255 ASN D CG  1 
ATOM 4081 O OD1 . ASN D 1 115 ? 28.596  11.081  42.699  1.00 64.88 ? 255 ASN D OD1 1 
ATOM 4082 N ND2 . ASN D 1 115 ? 30.027  12.666  42.004  1.00 64.50 ? 255 ASN D ND2 1 
ATOM 4083 N N   . CYS D 1 116 ? 25.943  10.101  42.280  1.00 57.52 ? 256 CYS D N   1 
ATOM 4084 C CA  . CYS D 1 116 ? 25.392  9.244   43.322  1.00 56.91 ? 256 CYS D CA  1 
ATOM 4085 C C   . CYS D 1 116 ? 25.977  9.489   44.718  1.00 56.99 ? 256 CYS D C   1 
ATOM 4086 O O   . CYS D 1 116 ? 25.261  9.378   45.712  1.00 57.28 ? 256 CYS D O   1 
ATOM 4087 C CB  . CYS D 1 116 ? 25.570  7.770   42.942  1.00 56.14 ? 256 CYS D CB  1 
ATOM 4088 S SG  . CYS D 1 116 ? 25.075  7.332   41.239  1.00 55.69 ? 256 CYS D SG  1 
ATOM 4089 N N   . ILE D 1 117 ? 27.263  9.830   44.804  1.00 56.41 ? 257 ILE D N   1 
ATOM 4090 C CA  . ILE D 1 117 ? 27.881  10.062  46.108  1.00 56.23 ? 257 ILE D CA  1 
ATOM 4091 C C   . ILE D 1 117 ? 27.244  11.221  46.859  1.00 55.95 ? 257 ILE D C   1 
ATOM 4092 O O   . ILE D 1 117 ? 27.613  11.504  47.999  1.00 56.44 ? 257 ILE D O   1 
ATOM 4093 C CB  . ILE D 1 117 ? 29.412  10.316  46.000  1.00 57.05 ? 257 ILE D CB  1 
ATOM 4094 C CG1 . ILE D 1 117 ? 29.703  11.586  45.199  1.00 57.05 ? 257 ILE D CG1 1 
ATOM 4095 C CG2 . ILE D 1 117 ? 30.086  9.121   45.371  1.00 57.63 ? 257 ILE D CG2 1 
ATOM 4096 C CD1 . ILE D 1 117 ? 29.543  12.868  45.986  1.00 57.79 ? 257 ILE D CD1 1 
ATOM 4097 N N   . LEU D 1 118 ? 26.297  11.897  46.214  1.00 55.34 ? 258 LEU D N   1 
ATOM 4098 C CA  . LEU D 1 118 ? 25.603  13.016  46.841  1.00 54.51 ? 258 LEU D CA  1 
ATOM 4099 C C   . LEU D 1 118 ? 24.407  12.478  47.608  1.00 52.85 ? 258 LEU D C   1 
ATOM 4100 O O   . LEU D 1 118 ? 23.721  11.570  47.139  1.00 52.53 ? 258 LEU D O   1 
ATOM 4101 C CB  . LEU D 1 118 ? 25.156  14.037  45.789  1.00 56.56 ? 258 LEU D CB  1 
ATOM 4102 C CG  . LEU D 1 118 ? 26.293  14.863  45.167  1.00 57.50 ? 258 LEU D CG  1 
ATOM 4103 C CD1 . LEU D 1 118 ? 25.722  15.828  44.141  1.00 57.27 ? 258 LEU D CD1 1 
ATOM 4104 C CD2 . LEU D 1 118 ? 27.048  15.628  46.258  1.00 56.82 ? 258 LEU D CD2 1 
ATOM 4105 N N   . ALA D 1 119 ? 24.166  13.043  48.788  1.00 51.01 ? 259 ALA D N   1 
ATOM 4106 C CA  . ALA D 1 119 ? 23.079  12.600  49.652  1.00 50.35 ? 259 ALA D CA  1 
ATOM 4107 C C   . ALA D 1 119 ? 21.714  13.225  49.385  1.00 49.98 ? 259 ALA D C   1 
ATOM 4108 O O   . ALA D 1 119 ? 21.583  14.442  49.240  1.00 48.81 ? 259 ALA D O   1 
ATOM 4109 C CB  . ALA D 1 119 ? 23.468  12.818  51.111  1.00 49.71 ? 259 ALA D CB  1 
ATOM 4110 N N   . ALA D 1 120 ? 20.699  12.367  49.340  1.00 49.48 ? 260 ALA D N   1 
ATOM 4111 C CA  . ALA D 1 120 ? 19.318  12.780  49.115  1.00 49.57 ? 260 ALA D CA  1 
ATOM 4112 C C   . ALA D 1 120 ? 18.411  11.658  49.609  1.00 49.76 ? 260 ALA D C   1 
ATOM 4113 O O   . ALA D 1 120 ? 18.854  10.517  49.744  1.00 51.06 ? 260 ALA D O   1 
ATOM 4114 C CB  . ALA D 1 120 ? 19.080  13.034  47.640  1.00 49.58 ? 260 ALA D CB  1 
ATOM 4115 N N   . PHE D 1 121 ? 17.149  11.977  49.881  1.00 48.76 ? 261 PHE D N   1 
ATOM 4116 C CA  . PHE D 1 121 ? 16.200  10.977  50.362  1.00 47.70 ? 261 PHE D CA  1 
ATOM 4117 C C   . PHE D 1 121 ? 16.069  9.829   49.378  1.00 47.05 ? 261 PHE D C   1 
ATOM 4118 O O   . PHE D 1 121 ? 16.899  9.659   48.490  1.00 47.92 ? 261 PHE D O   1 
ATOM 4119 C CB  . PHE D 1 121 ? 14.822  11.599  50.580  1.00 48.66 ? 261 PHE D CB  1 
ATOM 4120 C CG  . PHE D 1 121 ? 14.756  12.537  51.746  1.00 51.05 ? 261 PHE D CG  1 
ATOM 4121 C CD1 . PHE D 1 121 ? 15.528  13.693  51.772  1.00 51.88 ? 261 PHE D CD1 1 
ATOM 4122 C CD2 . PHE D 1 121 ? 13.919  12.267  52.820  1.00 52.00 ? 261 PHE D CD2 1 
ATOM 4123 C CE1 . PHE D 1 121 ? 15.464  14.568  52.851  1.00 52.30 ? 261 PHE D CE1 1 
ATOM 4124 C CE2 . PHE D 1 121 ? 13.848  13.136  53.905  1.00 53.17 ? 261 PHE D CE2 1 
ATOM 4125 C CZ  . PHE D 1 121 ? 14.623  14.288  53.919  1.00 52.47 ? 261 PHE D CZ  1 
ATOM 4126 N N   . SER D 1 122 ? 15.015  9.041   49.542  1.00 46.11 ? 262 SER D N   1 
ATOM 4127 C CA  . SER D 1 122 ? 14.771  7.909   48.666  1.00 45.31 ? 262 SER D CA  1 
ATOM 4128 C C   . SER D 1 122 ? 13.373  7.358   48.891  1.00 45.62 ? 262 SER D C   1 
ATOM 4129 O O   . SER D 1 122 ? 12.685  7.742   49.839  1.00 45.28 ? 262 SER D O   1 
ATOM 4130 C CB  . SER D 1 122 ? 15.817  6.816   48.907  1.00 45.58 ? 262 SER D CB  1 
ATOM 4131 O OG  . SER D 1 122 ? 15.993  6.564   50.291  1.00 47.14 ? 262 SER D OG  1 
ATOM 4132 N N   . ILE D 1 123 ? 12.953  6.467   48.001  1.00 45.83 ? 263 ILE D N   1 
ATOM 4133 C CA  . ILE D 1 123 ? 11.638  5.849   48.089  1.00 45.50 ? 263 ILE D CA  1 
ATOM 4134 C C   . ILE D 1 123 ? 11.766  4.368   47.753  1.00 46.30 ? 263 ILE D C   1 
ATOM 4135 O O   . ILE D 1 123 ? 12.111  4.015   46.631  1.00 45.64 ? 263 ILE D O   1 
ATOM 4136 C CB  . ILE D 1 123 ? 10.647  6.489   47.086  1.00 44.39 ? 263 ILE D CB  1 
ATOM 4137 C CG1 . ILE D 1 123 ? 10.534  7.993   47.335  1.00 42.77 ? 263 ILE D CG1 1 
ATOM 4138 C CG2 . ILE D 1 123 ? 9.281   5.834   47.217  1.00 45.13 ? 263 ILE D CG2 1 
ATOM 4139 C CD1 . ILE D 1 123 ? 9.668   8.718   46.320  1.00 41.53 ? 263 ILE D CD1 1 
ATOM 4140 N N   . CYS D 1 124 ? 11.504  3.500   48.723  1.00 48.29 ? 264 CYS D N   1 
ATOM 4141 C CA  . CYS D 1 124 ? 11.587  2.067   48.469  1.00 50.42 ? 264 CYS D CA  1 
ATOM 4142 C C   . CYS D 1 124 ? 10.186  1.546   48.156  1.00 51.71 ? 264 CYS D C   1 
ATOM 4143 O O   . CYS D 1 124 ? 9.191   2.087   48.646  1.00 51.75 ? 264 CYS D O   1 
ATOM 4144 C CB  . CYS D 1 124 ? 12.130  1.312   49.688  1.00 51.51 ? 264 CYS D CB  1 
ATOM 4145 S SG  . CYS D 1 124 ? 13.712  1.866   50.405  1.00 53.93 ? 264 CYS D SG  1 
ATOM 4146 N N   . GLN D 1 125 ? 10.108  0.500   47.338  1.00 52.57 ? 265 GLN D N   1 
ATOM 4147 C CA  . GLN D 1 125 ? 8.820   -0.092  46.993  1.00 53.70 ? 265 GLN D CA  1 
ATOM 4148 C C   . GLN D 1 125 ? 8.932   -1.612  46.936  1.00 53.78 ? 265 GLN D C   1 
ATOM 4149 O O   . GLN D 1 125 ? 10.028  -2.155  46.777  1.00 53.50 ? 265 GLN D O   1 
ATOM 4150 C CB  . GLN D 1 125 ? 8.318   0.433   45.640  1.00 54.37 ? 265 GLN D CB  1 
ATOM 4151 C CG  . GLN D 1 125 ? 8.924   -0.253  44.420  1.00 55.40 ? 265 GLN D CG  1 
ATOM 4152 C CD  . GLN D 1 125 ? 8.263   0.174   43.117  1.00 56.67 ? 265 GLN D CD  1 
ATOM 4153 O OE1 . GLN D 1 125 ? 8.290   1.349   42.749  1.00 59.69 ? 265 GLN D OE1 1 
ATOM 4154 N NE2 . GLN D 1 125 ? 7.665   -0.780  42.413  1.00 56.75 ? 265 GLN D NE2 1 
ATOM 4155 N N   . LYS D 1 126 ? 7.796   -2.292  47.079  1.00 53.20 ? 266 LYS D N   1 
ATOM 4156 C CA  . LYS D 1 126 ? 7.759   -3.750  47.017  1.00 52.43 ? 266 LYS D CA  1 
ATOM 4157 C C   . LYS D 1 126 ? 6.319   -4.241  46.930  1.00 51.77 ? 266 LYS D C   1 
ATOM 4158 O O   . LYS D 1 126 ? 5.416   -3.643  47.511  1.00 50.84 ? 266 LYS D O   1 
ATOM 4159 C CB  . LYS D 1 126 ? 8.460   -4.368  48.234  1.00 52.32 ? 266 LYS D CB  1 
ATOM 4160 C CG  . LYS D 1 126 ? 7.723   -4.234  49.559  1.00 53.68 ? 266 LYS D CG  1 
ATOM 4161 C CD  . LYS D 1 126 ? 8.584   -4.785  50.691  1.00 53.61 ? 266 LYS D CD  1 
ATOM 4162 C CE  . LYS D 1 126 ? 7.923   -4.630  52.051  1.00 53.61 ? 266 LYS D CE  1 
ATOM 4163 N NZ  . LYS D 1 126 ? 8.882   -4.936  53.151  1.00 54.27 ? 266 LYS D NZ  1 
ATOM 4164 N N   . LYS D 1 127 ? 6.115   -5.331  46.197  1.00 51.91 ? 267 LYS D N   1 
ATOM 4165 C CA  . LYS D 1 127 ? 4.787   -5.902  46.009  1.00 52.97 ? 267 LYS D CA  1 
ATOM 4166 C C   . LYS D 1 127 ? 3.950   -5.980  47.279  1.00 53.45 ? 267 LYS D C   1 
ATOM 4167 O O   . LYS D 1 127 ? 4.427   -6.407  48.330  1.00 52.63 ? 267 LYS D O   1 
ATOM 4168 C CB  . LYS D 1 127 ? 4.894   -7.292  45.372  1.00 54.52 ? 267 LYS D CB  1 
ATOM 4169 C CG  . LYS D 1 127 ? 5.156   -7.250  43.873  1.00 56.50 ? 267 LYS D CG  1 
ATOM 4170 C CD  . LYS D 1 127 ? 5.129   -8.637  43.238  1.00 57.92 ? 267 LYS D CD  1 
ATOM 4171 C CE  . LYS D 1 127 ? 6.353   -9.466  43.608  1.00 58.35 ? 267 LYS D CE  1 
ATOM 4172 N NZ  . LYS D 1 127 ? 6.370   -10.769 42.882  1.00 56.34 ? 267 LYS D NZ  1 
ATOM 4173 N N   . ALA D 1 128 ? 2.694   -5.558  47.168  1.00 53.83 ? 268 ALA D N   1 
ATOM 4174 C CA  . ALA D 1 128 ? 1.768   -5.572  48.292  1.00 54.47 ? 268 ALA D CA  1 
ATOM 4175 C C   . ALA D 1 128 ? 1.039   -6.913  48.377  1.00 55.68 ? 268 ALA D C   1 
ATOM 4176 O O   . ALA D 1 128 ? 0.667   -7.490  47.355  1.00 56.39 ? 268 ALA D O   1 
ATOM 4177 C CB  . ALA D 1 128 ? 0.765   -4.438  48.145  1.00 54.41 ? 268 ALA D CB  1 
ATOM 4178 N N   . ASN D 1 129 ? 0.836   -7.399  49.600  1.00 56.80 ? 269 ASN D N   1 
ATOM 4179 C CA  . ASN D 1 129 ? 0.155   -8.670  49.836  1.00 57.44 ? 269 ASN D CA  1 
ATOM 4180 C C   . ASN D 1 129 ? -1.361  -8.474  49.919  1.00 59.28 ? 269 ASN D C   1 
ATOM 4181 O O   . ASN D 1 129 ? -1.868  -7.839  50.843  1.00 60.00 ? 269 ASN D O   1 
ATOM 4182 C CB  . ASN D 1 129 ? 0.687   -9.301  51.123  1.00 54.37 ? 269 ASN D CB  1 
ATOM 4183 C CG  . ASN D 1 129 ? 0.071   -10.650 51.409  1.00 54.58 ? 269 ASN D CG  1 
ATOM 4184 O OD1 . ASN D 1 129 ? 0.649   -11.464 52.127  1.00 55.23 ? 269 ASN D OD1 1 
ATOM 4185 N ND2 . ASN D 1 129 ? -1.112  -10.893 50.860  1.00 54.19 ? 269 ASN D ND2 1 
ATOM 4186 N N   . LEU D 1 130 ? -2.077  -9.043  48.954  1.00 61.22 ? 270 LEU D N   1 
ATOM 4187 C CA  . LEU D 1 130 ? -3.528  -8.910  48.880  1.00 63.18 ? 270 LEU D CA  1 
ATOM 4188 C C   . LEU D 1 130 ? -4.315  -10.151 49.306  1.00 65.55 ? 270 LEU D C   1 
ATOM 4189 O O   . LEU D 1 130 ? -5.473  -10.314 48.911  1.00 65.59 ? 270 LEU D O   1 
ATOM 4190 C CB  . LEU D 1 130 ? -3.923  -8.517  47.453  1.00 61.50 ? 270 LEU D CB  1 
ATOM 4191 C CG  . LEU D 1 130 ? -3.312  -7.196  46.973  1.00 61.18 ? 270 LEU D CG  1 
ATOM 4192 C CD1 . LEU D 1 130 ? -3.437  -7.059  45.464  1.00 60.83 ? 270 LEU D CD1 1 
ATOM 4193 C CD2 . LEU D 1 130 ? -3.998  -6.045  47.686  1.00 59.92 ? 270 LEU D CD2 1 
ATOM 4194 N N   . ALA E 1 2   ? -28.805 31.350  54.901  1.00 36.47 ? 142 ALA E N   1 
ATOM 4195 C CA  . ALA E 1 2   ? -28.294 32.752  54.901  1.00 37.03 ? 142 ALA E CA  1 
ATOM 4196 C C   . ALA E 1 2   ? -27.490 33.044  53.637  1.00 36.68 ? 142 ALA E C   1 
ATOM 4197 O O   . ALA E 1 2   ? -26.607 32.274  53.258  1.00 35.77 ? 142 ALA E O   1 
ATOM 4198 C CB  . ALA E 1 2   ? -27.429 32.990  56.128  1.00 37.89 ? 142 ALA E CB  1 
ATOM 4199 N N   . PRO E 1 3   ? -27.807 34.159  52.960  1.00 36.69 ? 143 PRO E N   1 
ATOM 4200 C CA  . PRO E 1 3   ? -27.158 34.620  51.728  1.00 36.30 ? 143 PRO E CA  1 
ATOM 4201 C C   . PRO E 1 3   ? -25.707 35.044  51.896  1.00 36.56 ? 143 PRO E C   1 
ATOM 4202 O O   . PRO E 1 3   ? -24.877 34.738  51.046  1.00 38.20 ? 143 PRO E O   1 
ATOM 4203 C CB  . PRO E 1 3   ? -28.043 35.782  51.288  1.00 36.01 ? 143 PRO E CB  1 
ATOM 4204 C CG  . PRO E 1 3   ? -29.388 35.362  51.766  1.00 36.09 ? 143 PRO E CG  1 
ATOM 4205 C CD  . PRO E 1 3   ? -29.078 34.875  53.160  1.00 37.49 ? 143 PRO E CD  1 
ATOM 4206 N N   . CYS E 1 4   ? -25.400 35.748  52.983  1.00 35.62 ? 144 CYS E N   1 
ATOM 4207 C CA  . CYS E 1 4   ? -24.034 36.209  53.219  1.00 34.60 ? 144 CYS E CA  1 
ATOM 4208 C C   . CYS E 1 4   ? -23.604 36.064  54.663  1.00 33.30 ? 144 CYS E C   1 
ATOM 4209 O O   . CYS E 1 4   ? -24.430 36.117  55.568  1.00 33.53 ? 144 CYS E O   1 
ATOM 4210 C CB  . CYS E 1 4   ? -23.895 37.677  52.829  1.00 35.44 ? 144 CYS E CB  1 
ATOM 4211 S SG  . CYS E 1 4   ? -24.205 38.032  51.079  1.00 41.50 ? 144 CYS E SG  1 
ATOM 4212 N N   . PRO E 1 5   ? -22.295 35.883  54.901  1.00 33.37 ? 145 PRO E N   1 
ATOM 4213 C CA  . PRO E 1 5   ? -21.844 35.749  56.286  1.00 32.75 ? 145 PRO E CA  1 
ATOM 4214 C C   . PRO E 1 5   ? -22.283 37.037  56.958  1.00 34.04 ? 145 PRO E C   1 
ATOM 4215 O O   . PRO E 1 5   ? -22.649 37.994  56.274  1.00 35.95 ? 145 PRO E O   1 
ATOM 4216 C CB  . PRO E 1 5   ? -20.327 35.667  56.152  1.00 31.90 ? 145 PRO E CB  1 
ATOM 4217 C CG  . PRO E 1 5   ? -20.126 35.095  54.779  1.00 33.36 ? 145 PRO E CG  1 
ATOM 4218 C CD  . PRO E 1 5   ? -21.157 35.827  53.968  1.00 34.82 ? 145 PRO E CD  1 
ATOM 4219 N N   . GLN E 1 6   ? -22.259 37.082  58.281  1.00 33.06 ? 146 GLN E N   1 
ATOM 4220 C CA  . GLN E 1 6   ? -22.667 38.298  58.950  1.00 31.80 ? 146 GLN E CA  1 
ATOM 4221 C C   . GLN E 1 6   ? -21.667 39.399  58.632  1.00 31.53 ? 146 GLN E C   1 
ATOM 4222 O O   . GLN E 1 6   ? -20.604 39.134  58.075  1.00 29.68 ? 146 GLN E O   1 
ATOM 4223 C CB  . GLN E 1 6   ? -22.745 38.065  60.451  1.00 32.21 ? 146 GLN E CB  1 
ATOM 4224 C CG  . GLN E 1 6   ? -23.613 36.885  60.817  1.00 32.82 ? 146 GLN E CG  1 
ATOM 4225 C CD  . GLN E 1 6   ? -23.850 36.781  62.300  1.00 33.95 ? 146 GLN E CD  1 
ATOM 4226 O OE1 . GLN E 1 6   ? -24.430 37.679  62.908  1.00 34.93 ? 146 GLN E OE1 1 
ATOM 4227 N NE2 . GLN E 1 6   ? -23.406 35.680  62.896  1.00 34.45 ? 146 GLN E NE2 1 
ATOM 4228 N N   . ASP E 1 7   ? -22.004 40.624  58.915  1.00 32.44 ? 147 ASP E N   1 
ATOM 4229 C CA  . ASP E 1 7   ? -21.112 41.693  58.752  1.00 34.65 ? 147 ASP E CA  1 
ATOM 4230 C C   . ASP E 1 7   ? -20.928 42.160  57.334  1.00 35.37 ? 147 ASP E C   1 
ATOM 4231 O O   . ASP E 1 7   ? -20.523 43.254  57.115  1.00 36.37 ? 147 ASP E O   1 
ATOM 4232 C CB  . ASP E 1 7   ? -19.788 41.311  59.323  1.00 36.56 ? 147 ASP E CB  1 
ATOM 4233 C CG  . ASP E 1 7   ? -19.720 41.374  60.789  1.00 38.21 ? 147 ASP E CG  1 
ATOM 4234 O OD1 . ASP E 1 7   ? -20.692 41.525  61.460  1.00 38.37 ? 147 ASP E OD1 1 
ATOM 4235 O OD2 . ASP E 1 7   ? -18.677 41.251  61.364  1.00 39.32 ? 147 ASP E OD2 1 
ATOM 4236 N N   . TRP E 1 8   ? -21.139 41.292  56.372  1.00 35.41 ? 148 TRP E N   1 
ATOM 4237 C CA  . TRP E 1 8   ? -21.061 41.641  54.959  1.00 34.42 ? 148 TRP E CA  1 
ATOM 4238 C C   . TRP E 1 8   ? -22.369 42.287  54.533  1.00 34.14 ? 148 TRP E C   1 
ATOM 4239 O O   . TRP E 1 8   ? -23.283 42.439  55.341  1.00 34.23 ? 148 TRP E O   1 
ATOM 4240 C CB  . TRP E 1 8   ? -20.804 40.390  54.115  1.00 33.79 ? 148 TRP E CB  1 
ATOM 4241 C CG  . TRP E 1 8   ? -19.478 39.750  54.374  1.00 34.75 ? 148 TRP E CG  1 
ATOM 4242 C CD1 . TRP E 1 8   ? -18.971 39.379  55.585  1.00 35.59 ? 148 TRP E CD1 1 
ATOM 4243 C CD2 . TRP E 1 8   ? -18.494 39.384  53.399  1.00 35.05 ? 148 TRP E CD2 1 
ATOM 4244 N NE1 . TRP E 1 8   ? -17.734 38.805  55.427  1.00 35.98 ? 148 TRP E NE1 1 
ATOM 4245 C CE2 . TRP E 1 8   ? -17.415 38.794  54.093  1.00 35.31 ? 148 TRP E CE2 1 
ATOM 4246 C CE3 . TRP E 1 8   ? -18.419 39.494  52.003  1.00 35.15 ? 148 TRP E CE3 1 
ATOM 4247 C CZ2 . TRP E 1 8   ? -16.274 38.314  53.443  1.00 34.12 ? 148 TRP E CZ2 1 
ATOM 4248 C CZ3 . TRP E 1 8   ? -17.283 39.015  51.355  1.00 34.80 ? 148 TRP E CZ3 1 
ATOM 4249 C CH2 . TRP E 1 8   ? -16.227 38.433  52.078  1.00 33.69 ? 148 TRP E CH2 1 
ATOM 4250 N N   . ILE E 1 9   ? -22.443 42.692  53.270  1.00 33.58 ? 149 ILE E N   1 
ATOM 4251 C CA  . ILE E 1 9   ? -23.655 43.284  52.728  1.00 33.47 ? 149 ILE E CA  1 
ATOM 4252 C C   . ILE E 1 9   ? -24.088 42.383  51.592  1.00 35.43 ? 149 ILE E C   1 
ATOM 4253 O O   . ILE E 1 9   ? -23.281 42.023  50.737  1.00 35.78 ? 149 ILE E O   1 
ATOM 4254 C CB  . ILE E 1 9   ? -23.422 44.684  52.143  1.00 33.46 ? 149 ILE E CB  1 
ATOM 4255 C CG1 . ILE E 1 9   ? -22.953 45.644  53.230  1.00 34.83 ? 149 ILE E CG1 1 
ATOM 4256 C CG2 . ILE E 1 9   ? -24.709 45.200  51.531  1.00 32.48 ? 149 ILE E CG2 1 
ATOM 4257 C CD1 . ILE E 1 9   ? -22.606 47.021  52.707  1.00 35.90 ? 149 ILE E CD1 1 
ATOM 4258 N N   . TRP E 1 10  ? -25.357 42.005  51.588  1.00 38.02 ? 150 TRP E N   1 
ATOM 4259 C CA  . TRP E 1 10  ? -25.871 41.153  50.531  1.00 39.86 ? 150 TRP E CA  1 
ATOM 4260 C C   . TRP E 1 10  ? -26.558 42.022  49.489  1.00 41.62 ? 150 TRP E C   1 
ATOM 4261 O O   . TRP E 1 10  ? -27.588 42.639  49.760  1.00 41.98 ? 150 TRP E O   1 
ATOM 4262 C CB  . TRP E 1 10  ? -26.846 40.125  51.102  1.00 39.63 ? 150 TRP E CB  1 
ATOM 4263 C CG  . TRP E 1 10  ? -27.660 39.419  50.066  1.00 41.58 ? 150 TRP E CG  1 
ATOM 4264 C CD1 . TRP E 1 10  ? -27.226 38.926  48.870  1.00 42.51 ? 150 TRP E CD1 1 
ATOM 4265 C CD2 . TRP E 1 10  ? -29.056 39.130  50.135  1.00 43.00 ? 150 TRP E CD2 1 
ATOM 4266 N NE1 . TRP E 1 10  ? -28.267 38.347  48.188  1.00 41.12 ? 150 TRP E NE1 1 
ATOM 4267 C CE2 . TRP E 1 10  ? -29.405 38.456  48.945  1.00 41.91 ? 150 TRP E CE2 1 
ATOM 4268 C CE3 . TRP E 1 10  ? -30.051 39.369  51.092  1.00 44.68 ? 150 TRP E CE3 1 
ATOM 4269 C CZ2 . TRP E 1 10  ? -30.704 38.026  48.680  1.00 42.70 ? 150 TRP E CZ2 1 
ATOM 4270 C CZ3 . TRP E 1 10  ? -31.344 38.941  50.831  1.00 44.93 ? 150 TRP E CZ3 1 
ATOM 4271 C CH2 . TRP E 1 10  ? -31.658 38.273  49.633  1.00 43.65 ? 150 TRP E CH2 1 
ATOM 4272 N N   . HIS E 1 11  ? -25.963 42.075  48.301  1.00 42.38 ? 151 HIS E N   1 
ATOM 4273 C CA  . HIS E 1 11  ? -26.494 42.867  47.199  1.00 42.22 ? 151 HIS E CA  1 
ATOM 4274 C C   . HIS E 1 11  ? -26.441 42.043  45.920  1.00 43.44 ? 151 HIS E C   1 
ATOM 4275 O O   . HIS E 1 11  ? -25.364 41.788  45.381  1.00 44.72 ? 151 HIS E O   1 
ATOM 4276 C CB  . HIS E 1 11  ? -25.666 44.133  47.019  1.00 39.88 ? 151 HIS E CB  1 
ATOM 4277 C CG  . HIS E 1 11  ? -26.092 44.965  45.855  1.00 38.08 ? 151 HIS E CG  1 
ATOM 4278 N ND1 . HIS E 1 11  ? -27.149 45.846  45.917  1.00 38.57 ? 151 HIS E ND1 1 
ATOM 4279 C CD2 . HIS E 1 11  ? -25.630 45.020  44.586  1.00 39.19 ? 151 HIS E CD2 1 
ATOM 4280 C CE1 . HIS E 1 11  ? -27.320 46.409  44.735  1.00 38.20 ? 151 HIS E CE1 1 
ATOM 4281 N NE2 . HIS E 1 11  ? -26.411 45.924  43.909  1.00 39.74 ? 151 HIS E NE2 1 
ATOM 4282 N N   . GLY E 1 12  ? -27.609 41.630  45.441  1.00 44.14 ? 152 GLY E N   1 
ATOM 4283 C CA  . GLY E 1 12  ? -27.671 40.827  44.235  1.00 43.99 ? 152 GLY E CA  1 
ATOM 4284 C C   . GLY E 1 12  ? -27.222 39.401  44.486  1.00 44.23 ? 152 GLY E C   1 
ATOM 4285 O O   . GLY E 1 12  ? -27.681 38.747  45.421  1.00 44.61 ? 152 GLY E O   1 
ATOM 4286 N N   . GLU E 1 13  ? -26.317 38.913  43.649  1.00 44.84 ? 153 GLU E N   1 
ATOM 4287 C CA  . GLU E 1 13  ? -25.810 37.559  43.797  1.00 45.18 ? 153 GLU E CA  1 
ATOM 4288 C C   . GLU E 1 13  ? -24.501 37.569  44.563  1.00 44.75 ? 153 GLU E C   1 
ATOM 4289 O O   . GLU E 1 13  ? -23.917 36.520  44.821  1.00 45.22 ? 153 GLU E O   1 
ATOM 4290 C CB  . GLU E 1 13  ? -25.606 36.927  42.421  1.00 46.07 ? 153 GLU E CB  1 
ATOM 4291 C CG  . GLU E 1 13  ? -24.979 37.862  41.407  1.00 47.60 ? 153 GLU E CG  1 
ATOM 4292 C CD  . GLU E 1 13  ? -25.024 37.307  39.997  1.00 49.23 ? 153 GLU E CD  1 
ATOM 4293 O OE1 . GLU E 1 13  ? -24.801 38.083  39.046  1.00 49.39 ? 153 GLU E OE1 1 
ATOM 4294 O OE2 . GLU E 1 13  ? -25.277 36.094  39.839  1.00 48.98 ? 153 GLU E OE2 1 
ATOM 4295 N N   . ASN E 1 14  ? -24.050 38.757  44.946  1.00 44.69 ? 154 ASN E N   1 
ATOM 4296 C CA  . ASN E 1 14  ? -22.790 38.869  45.662  1.00 45.01 ? 154 ASN E CA  1 
ATOM 4297 C C   . ASN E 1 14  ? -22.880 39.384  47.090  1.00 45.07 ? 154 ASN E C   1 
ATOM 4298 O O   . ASN E 1 14  ? -23.880 39.981  47.499  1.00 45.38 ? 154 ASN E O   1 
ATOM 4299 C CB  . ASN E 1 14  ? -21.825 39.760  44.883  1.00 45.60 ? 154 ASN E CB  1 
ATOM 4300 C CG  . ASN E 1 14  ? -21.513 39.216  43.506  1.00 45.53 ? 154 ASN E CG  1 
ATOM 4301 O OD1 . ASN E 1 14  ? -21.148 38.050  43.356  1.00 45.46 ? 154 ASN E OD1 1 
ATOM 4302 N ND2 . ASN E 1 14  ? -21.643 40.064  42.491  1.00 44.24 ? 154 ASN E ND2 1 
ATOM 4303 N N   . CYS E 1 15  ? -21.804 39.141  47.834  1.00 43.43 ? 155 CYS E N   1 
ATOM 4304 C CA  . CYS E 1 15  ? -21.668 39.567  49.219  1.00 41.32 ? 155 CYS E CA  1 
ATOM 4305 C C   . CYS E 1 15  ? -20.486 40.516  49.247  1.00 39.80 ? 155 CYS E C   1 
ATOM 4306 O O   . CYS E 1 15  ? -19.438 40.215  48.676  1.00 39.20 ? 155 CYS E O   1 
ATOM 4307 C CB  . CYS E 1 15  ? -21.371 38.372  50.120  1.00 41.90 ? 155 CYS E CB  1 
ATOM 4308 S SG  . CYS E 1 15  ? -22.668 37.104  50.137  1.00 42.90 ? 155 CYS E SG  1 
ATOM 4309 N N   . TYR E 1 16  ? -20.644 41.655  49.909  1.00 37.70 ? 156 TYR E N   1 
ATOM 4310 C CA  . TYR E 1 16  ? -19.565 42.625  49.962  1.00 35.92 ? 156 TYR E CA  1 
ATOM 4311 C C   . TYR E 1 16  ? -19.085 42.937  51.365  1.00 36.59 ? 156 TYR E C   1 
ATOM 4312 O O   . TYR E 1 16  ? -19.886 43.142  52.280  1.00 36.11 ? 156 TYR E O   1 
ATOM 4313 C CB  . TYR E 1 16  ? -19.986 43.921  49.260  1.00 33.66 ? 156 TYR E CB  1 
ATOM 4314 C CG  . TYR E 1 16  ? -20.299 43.732  47.794  1.00 31.22 ? 156 TYR E CG  1 
ATOM 4315 C CD1 . TYR E 1 16  ? -21.515 43.190  47.389  1.00 30.58 ? 156 TYR E CD1 1 
ATOM 4316 C CD2 . TYR E 1 16  ? -19.361 44.051  46.816  1.00 29.83 ? 156 TYR E CD2 1 
ATOM 4317 C CE1 . TYR E 1 16  ? -21.790 42.966  46.048  1.00 30.02 ? 156 TYR E CE1 1 
ATOM 4318 C CE2 . TYR E 1 16  ? -19.623 43.831  45.475  1.00 30.68 ? 156 TYR E CE2 1 
ATOM 4319 C CZ  . TYR E 1 16  ? -20.840 43.289  45.097  1.00 31.25 ? 156 TYR E CZ  1 
ATOM 4320 O OH  . TYR E 1 16  ? -21.104 43.079  43.764  1.00 32.94 ? 156 TYR E OH  1 
ATOM 4321 N N   . LEU E 1 17  ? -17.764 42.968  51.520  1.00 36.03 ? 157 LEU E N   1 
ATOM 4322 C CA  . LEU E 1 17  ? -17.153 43.276  52.799  1.00 35.60 ? 157 LEU E CA  1 
ATOM 4323 C C   . LEU E 1 17  ? -16.309 44.529  52.663  1.00 37.15 ? 157 LEU E C   1 
ATOM 4324 O O   . LEU E 1 17  ? -15.482 44.637  51.762  1.00 36.07 ? 157 LEU E O   1 
ATOM 4325 C CB  . LEU E 1 17  ? -16.268 42.124  53.268  1.00 34.23 ? 157 LEU E CB  1 
ATOM 4326 C CG  . LEU E 1 17  ? -15.674 42.335  54.661  1.00 32.06 ? 157 LEU E CG  1 
ATOM 4327 C CD1 . LEU E 1 17  ? -16.789 42.324  55.690  1.00 32.90 ? 157 LEU E CD1 1 
ATOM 4328 C CD2 . LEU E 1 17  ? -14.676 41.245  54.969  1.00 30.68 ? 157 LEU E CD2 1 
ATOM 4329 N N   . PHE E 1 18  ? -16.529 45.478  53.563  1.00 40.51 ? 158 PHE E N   1 
ATOM 4330 C CA  . PHE E 1 18  ? -15.778 46.723  53.561  1.00 42.20 ? 158 PHE E CA  1 
ATOM 4331 C C   . PHE E 1 18  ? -14.764 46.627  54.692  1.00 45.49 ? 158 PHE E C   1 
ATOM 4332 O O   . PHE E 1 18  ? -15.064 46.950  55.840  1.00 46.55 ? 158 PHE E O   1 
ATOM 4333 C CB  . PHE E 1 18  ? -16.728 47.903  53.773  1.00 40.21 ? 158 PHE E CB  1 
ATOM 4334 C CG  . PHE E 1 18  ? -17.681 48.131  52.623  1.00 39.17 ? 158 PHE E CG  1 
ATOM 4335 C CD1 . PHE E 1 18  ? -18.449 47.089  52.118  1.00 38.23 ? 158 PHE E CD1 1 
ATOM 4336 C CD2 . PHE E 1 18  ? -17.814 49.391  52.049  1.00 38.72 ? 158 PHE E CD2 1 
ATOM 4337 C CE1 . PHE E 1 18  ? -19.335 47.300  51.060  1.00 36.87 ? 158 PHE E CE1 1 
ATOM 4338 C CE2 . PHE E 1 18  ? -18.696 49.605  50.995  1.00 36.84 ? 158 PHE E CE2 1 
ATOM 4339 C CZ  . PHE E 1 18  ? -19.455 48.560  50.500  1.00 36.83 ? 158 PHE E CZ  1 
ATOM 4340 N N   . SER E 1 19  ? -13.565 46.158  54.356  1.00 48.77 ? 159 SER E N   1 
ATOM 4341 C CA  . SER E 1 19  ? -12.493 45.989  55.332  1.00 51.07 ? 159 SER E CA  1 
ATOM 4342 C C   . SER E 1 19  ? -12.048 47.279  56.004  1.00 51.94 ? 159 SER E C   1 
ATOM 4343 O O   . SER E 1 19  ? -11.985 48.336  55.377  1.00 52.69 ? 159 SER E O   1 
ATOM 4344 C CB  . SER E 1 19  ? -11.277 45.326  54.679  1.00 51.88 ? 159 SER E CB  1 
ATOM 4345 O OG  . SER E 1 19  ? -10.185 45.266  55.586  1.00 53.59 ? 159 SER E OG  1 
ATOM 4346 N N   . SER E 1 20  ? -11.733 47.174  57.290  1.00 54.13 ? 160 SER E N   1 
ATOM 4347 C CA  . SER E 1 20  ? -11.277 48.317  58.074  1.00 55.15 ? 160 SER E CA  1 
ATOM 4348 C C   . SER E 1 20  ? -9.763  48.505  57.950  1.00 54.16 ? 160 SER E C   1 
ATOM 4349 O O   . SER E 1 20  ? -9.263  49.626  58.011  1.00 54.37 ? 160 SER E O   1 
ATOM 4350 C CB  . SER E 1 20  ? -11.665 48.129  59.545  1.00 55.61 ? 160 SER E CB  1 
ATOM 4351 O OG  . SER E 1 20  ? -11.301 46.839  60.005  1.00 55.50 ? 160 SER E OG  1 
ATOM 4352 N N   . GLY E 1 21  ? -9.034  47.406  57.780  1.00 52.78 ? 161 GLY E N   1 
ATOM 4353 C CA  . GLY E 1 21  ? -7.595  47.511  57.644  1.00 51.47 ? 161 GLY E CA  1 
ATOM 4354 C C   . GLY E 1 21  ? -7.232  48.423  56.485  1.00 51.21 ? 161 GLY E C   1 
ATOM 4355 O O   . GLY E 1 21  ? -7.873  48.385  55.433  1.00 51.37 ? 161 GLY E O   1 
ATOM 4356 N N   . SER E 1 22  ? -6.207  49.248  56.671  1.00 50.30 ? 162 SER E N   1 
ATOM 4357 C CA  . SER E 1 22  ? -5.774  50.167  55.625  1.00 49.09 ? 162 SER E CA  1 
ATOM 4358 C C   . SER E 1 22  ? -4.411  49.741  55.090  1.00 48.20 ? 162 SER E C   1 
ATOM 4359 O O   . SER E 1 22  ? -3.411  50.407  55.336  1.00 47.70 ? 162 SER E O   1 
ATOM 4360 C CB  . SER E 1 22  ? -5.693  51.588  56.182  1.00 48.58 ? 162 SER E CB  1 
ATOM 4361 O OG  . SER E 1 22  ? -5.549  52.538  55.143  1.00 47.47 ? 162 SER E OG  1 
ATOM 4362 N N   . PHE E 1 23  ? -4.381  48.638  54.346  1.00 47.84 ? 163 PHE E N   1 
ATOM 4363 C CA  . PHE E 1 23  ? -3.134  48.114  53.803  1.00 47.23 ? 163 PHE E CA  1 
ATOM 4364 C C   . PHE E 1 23  ? -2.909  48.443  52.335  1.00 47.27 ? 163 PHE E C   1 
ATOM 4365 O O   . PHE E 1 23  ? -3.727  49.100  51.696  1.00 46.47 ? 163 PHE E O   1 
ATOM 4366 C CB  . PHE E 1 23  ? -3.083  46.596  53.971  1.00 47.76 ? 163 PHE E CB  1 
ATOM 4367 C CG  . PHE E 1 23  ? -3.427  46.123  55.350  1.00 47.02 ? 163 PHE E CG  1 
ATOM 4368 C CD1 . PHE E 1 23  ? -4.731  46.203  55.821  1.00 46.55 ? 163 PHE E CD1 1 
ATOM 4369 C CD2 . PHE E 1 23  ? -2.452  45.564  56.168  1.00 47.44 ? 163 PHE E CD2 1 
ATOM 4370 C CE1 . PHE E 1 23  ? -5.061  45.729  57.082  1.00 47.59 ? 163 PHE E CE1 1 
ATOM 4371 C CE2 . PHE E 1 23  ? -2.774  45.087  57.436  1.00 48.13 ? 163 PHE E CE2 1 
ATOM 4372 C CZ  . PHE E 1 23  ? -4.083  45.169  57.893  1.00 48.11 ? 163 PHE E CZ  1 
ATOM 4373 N N   . ASN E 1 24  ? -1.782  47.966  51.812  1.00 47.79 ? 164 ASN E N   1 
ATOM 4374 C CA  . ASN E 1 24  ? -1.410  48.178  50.420  1.00 47.41 ? 164 ASN E CA  1 
ATOM 4375 C C   . ASN E 1 24  ? -2.126  47.141  49.563  1.00 45.91 ? 164 ASN E C   1 
ATOM 4376 O O   . ASN E 1 24  ? -2.505  46.081  50.053  1.00 46.16 ? 164 ASN E O   1 
ATOM 4377 C CB  . ASN E 1 24  ? 0.108   48.054  50.261  1.00 48.61 ? 164 ASN E CB  1 
ATOM 4378 C CG  . ASN E 1 24  ? 0.624   46.697  50.676  1.00 50.23 ? 164 ASN E CG  1 
ATOM 4379 O OD1 . ASN E 1 24  ? 0.482   45.717  49.945  1.00 51.72 ? 164 ASN E OD1 1 
ATOM 4380 N ND2 . ASN E 1 24  ? 1.217   46.626  51.864  1.00 50.06 ? 164 ASN E ND2 1 
ATOM 4381 N N   . TRP E 1 25  ? -2.298  47.445  48.283  1.00 44.11 ? 165 TRP E N   1 
ATOM 4382 C CA  . TRP E 1 25  ? -3.012  46.557  47.378  1.00 42.80 ? 165 TRP E CA  1 
ATOM 4383 C C   . TRP E 1 25  ? -2.729  45.066  47.533  1.00 44.29 ? 165 TRP E C   1 
ATOM 4384 O O   . TRP E 1 25  ? -3.661  44.260  47.528  1.00 44.17 ? 165 TRP E O   1 
ATOM 4385 C CB  . TRP E 1 25  ? -2.766  46.955  45.921  1.00 39.53 ? 165 TRP E CB  1 
ATOM 4386 C CG  . TRP E 1 25  ? -3.845  46.443  45.019  1.00 35.85 ? 165 TRP E CG  1 
ATOM 4387 C CD1 . TRP E 1 25  ? -5.074  46.999  44.816  1.00 34.66 ? 165 TRP E CD1 1 
ATOM 4388 C CD2 . TRP E 1 25  ? -3.821  45.234  44.252  1.00 34.52 ? 165 TRP E CD2 1 
ATOM 4389 N NE1 . TRP E 1 25  ? -5.820  46.213  43.974  1.00 32.59 ? 165 TRP E NE1 1 
ATOM 4390 C CE2 . TRP E 1 25  ? -5.077  45.122  43.613  1.00 33.76 ? 165 TRP E CE2 1 
ATOM 4391 C CE3 . TRP E 1 25  ? -2.864  44.231  44.047  1.00 32.69 ? 165 TRP E CE3 1 
ATOM 4392 C CZ2 . TRP E 1 25  ? -5.399  44.048  42.778  1.00 32.93 ? 165 TRP E CZ2 1 
ATOM 4393 C CZ3 . TRP E 1 25  ? -3.184  43.164  43.219  1.00 32.93 ? 165 TRP E CZ3 1 
ATOM 4394 C CH2 . TRP E 1 25  ? -4.445  43.081  42.595  1.00 32.86 ? 165 TRP E CH2 1 
ATOM 4395 N N   . GLU E 1 26  ? -1.459  44.691  47.665  1.00 46.64 ? 166 GLU E N   1 
ATOM 4396 C CA  . GLU E 1 26  ? -1.117  43.276  47.795  1.00 48.93 ? 166 GLU E CA  1 
ATOM 4397 C C   . GLU E 1 26  ? -1.616  42.646  49.088  1.00 48.75 ? 166 GLU E C   1 
ATOM 4398 O O   . GLU E 1 26  ? -2.269  41.605  49.058  1.00 48.92 ? 166 GLU E O   1 
ATOM 4399 C CB  . GLU E 1 26  ? 0.393   43.056  47.676  1.00 50.53 ? 166 GLU E CB  1 
ATOM 4400 C CG  . GLU E 1 26  ? 0.796   41.592  47.858  1.00 53.76 ? 166 GLU E CG  1 
ATOM 4401 C CD  . GLU E 1 26  ? 2.273   41.345  47.622  1.00 55.60 ? 166 GLU E CD  1 
ATOM 4402 O OE1 . GLU E 1 26  ? 3.098   42.101  48.178  1.00 57.42 ? 166 GLU E OE1 1 
ATOM 4403 O OE2 . GLU E 1 26  ? 2.608   40.388  46.889  1.00 55.31 ? 166 GLU E OE2 1 
ATOM 4404 N N   . LYS E 1 27  ? -1.306  43.264  50.223  1.00 48.77 ? 167 LYS E N   1 
ATOM 4405 C CA  . LYS E 1 27  ? -1.754  42.736  51.506  1.00 48.67 ? 167 LYS E CA  1 
ATOM 4406 C C   . LYS E 1 27  ? -3.282  42.718  51.550  1.00 46.90 ? 167 LYS E C   1 
ATOM 4407 O O   . LYS E 1 27  ? -3.881  41.811  52.132  1.00 45.54 ? 167 LYS E O   1 
ATOM 4408 C CB  . LYS E 1 27  ? -1.206  43.590  52.655  1.00 51.61 ? 167 LYS E CB  1 
ATOM 4409 C CG  . LYS E 1 27  ? 0.322   43.602  52.768  1.00 54.82 ? 167 LYS E CG  1 
ATOM 4410 C CD  . LYS E 1 27  ? 0.888   42.223  53.102  1.00 55.84 ? 167 LYS E CD  1 
ATOM 4411 C CE  . LYS E 1 27  ? 2.386   42.295  53.385  1.00 56.08 ? 167 LYS E CE  1 
ATOM 4412 N NZ  . LYS E 1 27  ? 2.970   40.952  53.678  1.00 55.90 ? 167 LYS E NZ  1 
ATOM 4413 N N   . SER E 1 28  ? -3.898  43.721  50.921  1.00 45.39 ? 168 SER E N   1 
ATOM 4414 C CA  . SER E 1 28  ? -5.355  43.838  50.866  1.00 43.20 ? 168 SER E CA  1 
ATOM 4415 C C   . SER E 1 28  ? -5.936  42.688  50.067  1.00 42.52 ? 168 SER E C   1 
ATOM 4416 O O   . SER E 1 28  ? -7.030  42.205  50.361  1.00 43.53 ? 168 SER E O   1 
ATOM 4417 C CB  . SER E 1 28  ? -5.766  45.159  50.215  1.00 41.64 ? 168 SER E CB  1 
ATOM 4418 O OG  . SER E 1 28  ? -5.265  46.260  50.947  1.00 43.92 ? 168 SER E OG  1 
ATOM 4419 N N   . GLN E 1 29  ? -5.190  42.254  49.057  1.00 41.05 ? 169 GLN E N   1 
ATOM 4420 C CA  . GLN E 1 29  ? -5.605  41.155  48.195  1.00 39.19 ? 169 GLN E CA  1 
ATOM 4421 C C   . GLN E 1 29  ? -5.608  39.832  48.955  1.00 39.40 ? 169 GLN E C   1 
ATOM 4422 O O   . GLN E 1 29  ? -6.482  38.993  48.746  1.00 37.76 ? 169 GLN E O   1 
ATOM 4423 C CB  . GLN E 1 29  ? -4.667  41.079  46.995  1.00 38.07 ? 169 GLN E CB  1 
ATOM 4424 C CG  . GLN E 1 29  ? -4.912  39.924  46.059  1.00 37.71 ? 169 GLN E CG  1 
ATOM 4425 C CD  . GLN E 1 29  ? -3.929  39.920  44.916  1.00 36.43 ? 169 GLN E CD  1 
ATOM 4426 O OE1 . GLN E 1 29  ? -2.723  40.039  45.127  1.00 36.94 ? 169 GLN E OE1 1 
ATOM 4427 N NE2 . GLN E 1 29  ? -4.434  39.778  43.696  1.00 35.75 ? 169 GLN E NE2 1 
ATOM 4428 N N   . GLU E 1 30  ? -4.630  39.655  49.840  1.00 41.40 ? 170 GLU E N   1 
ATOM 4429 C CA  . GLU E 1 30  ? -4.528  38.442  50.647  1.00 42.62 ? 170 GLU E CA  1 
ATOM 4430 C C   . GLU E 1 30  ? -5.686  38.403  51.628  1.00 42.82 ? 170 GLU E C   1 
ATOM 4431 O O   . GLU E 1 30  ? -6.223  37.339  51.929  1.00 43.80 ? 170 GLU E O   1 
ATOM 4432 C CB  . GLU E 1 30  ? -3.224  38.421  51.441  1.00 44.77 ? 170 GLU E CB  1 
ATOM 4433 C CG  . GLU E 1 30  ? -1.959  38.439  50.612  1.00 49.65 ? 170 GLU E CG  1 
ATOM 4434 C CD  . GLU E 1 30  ? -0.719  38.372  51.483  1.00 52.53 ? 170 GLU E CD  1 
ATOM 4435 O OE1 . GLU E 1 30  ? -0.541  37.337  52.155  1.00 55.64 ? 170 GLU E OE1 1 
ATOM 4436 O OE2 . GLU E 1 30  ? 0.070   39.346  51.508  1.00 54.54 ? 170 GLU E OE2 1 
ATOM 4437 N N   . LYS E 1 31  ? -6.052  39.572  52.140  1.00 42.35 ? 171 LYS E N   1 
ATOM 4438 C CA  . LYS E 1 31  ? -7.156  39.678  53.083  1.00 43.44 ? 171 LYS E CA  1 
ATOM 4439 C C   . LYS E 1 31  ? -8.432  39.076  52.499  1.00 42.37 ? 171 LYS E C   1 
ATOM 4440 O O   . LYS E 1 31  ? -9.098  38.263  53.143  1.00 43.02 ? 171 LYS E O   1 
ATOM 4441 C CB  . LYS E 1 31  ? -7.391  41.146  53.449  1.00 45.66 ? 171 LYS E CB  1 
ATOM 4442 C CG  . LYS E 1 31  ? -6.433  41.683  54.506  1.00 47.61 ? 171 LYS E CG  1 
ATOM 4443 C CD  . LYS E 1 31  ? -6.764  41.120  55.881  1.00 49.03 ? 171 LYS E CD  1 
ATOM 4444 C CE  . LYS E 1 31  ? -5.743  41.561  56.913  1.00 50.06 ? 171 LYS E CE  1 
ATOM 4445 N NZ  . LYS E 1 31  ? -4.397  41.012  56.596  1.00 52.17 ? 171 LYS E NZ  1 
ATOM 4446 N N   . CYS E 1 32  ? -8.768  39.480  51.278  1.00 39.64 ? 172 CYS E N   1 
ATOM 4447 C CA  . CYS E 1 32  ? -9.963  38.975  50.613  1.00 36.52 ? 172 CYS E CA  1 
ATOM 4448 C C   . CYS E 1 32  ? -9.838  37.487  50.310  1.00 35.14 ? 172 CYS E C   1 
ATOM 4449 O O   . CYS E 1 32  ? -10.763 36.711  50.541  1.00 34.87 ? 172 CYS E O   1 
ATOM 4450 C CB  . CYS E 1 32  ? -10.207 39.716  49.298  1.00 35.42 ? 172 CYS E CB  1 
ATOM 4451 S SG  . CYS E 1 32  ? -10.650 41.484  49.392  1.00 36.37 ? 172 CYS E SG  1 
ATOM 4452 N N   . LEU E 1 33  ? -8.688  37.094  49.782  1.00 34.67 ? 173 LEU E N   1 
ATOM 4453 C CA  . LEU E 1 33  ? -8.452  35.704  49.426  1.00 34.00 ? 173 LEU E CA  1 
ATOM 4454 C C   . LEU E 1 33  ? -8.675  34.795  50.621  1.00 33.68 ? 173 LEU E C   1 
ATOM 4455 O O   . LEU E 1 33  ? -9.323  33.761  50.508  1.00 34.34 ? 173 LEU E O   1 
ATOM 4456 C CB  . LEU E 1 33  ? -7.031  35.539  48.891  1.00 33.94 ? 173 LEU E CB  1 
ATOM 4457 C CG  . LEU E 1 33  ? -6.845  34.412  47.876  1.00 35.63 ? 173 LEU E CG  1 
ATOM 4458 C CD1 . LEU E 1 33  ? -6.754  33.073  48.576  1.00 37.73 ? 173 LEU E CD1 1 
ATOM 4459 C CD2 . LEU E 1 33  ? -8.006  34.442  46.889  1.00 37.67 ? 173 LEU E CD2 1 
ATOM 4460 N N   . SER E 1 34  ? -8.134  35.194  51.765  1.00 33.37 ? 174 SER E N   1 
ATOM 4461 C CA  . SER E 1 34  ? -8.279  34.433  52.999  1.00 32.96 ? 174 SER E CA  1 
ATOM 4462 C C   . SER E 1 34  ? -9.744  34.383  53.417  1.00 33.54 ? 174 SER E C   1 
ATOM 4463 O O   . SER E 1 34  ? -10.235 33.357  53.888  1.00 33.97 ? 174 SER E O   1 
ATOM 4464 C CB  . SER E 1 34  ? -7.460  35.089  54.103  1.00 32.82 ? 174 SER E CB  1 
ATOM 4465 O OG  . SER E 1 34  ? -7.769  36.467  54.190  1.00 33.37 ? 174 SER E OG  1 
ATOM 4466 N N   . LEU E 1 35  ? -10.437 35.504  53.245  1.00 33.55 ? 175 LEU E N   1 
ATOM 4467 C CA  . LEU E 1 35  ? -11.843 35.597  53.605  1.00 31.75 ? 175 LEU E CA  1 
ATOM 4468 C C   . LEU E 1 35  ? -12.737 34.847  52.645  1.00 31.36 ? 175 LEU E C   1 
ATOM 4469 O O   . LEU E 1 35  ? -13.952 35.018  52.658  1.00 29.93 ? 175 LEU E O   1 
ATOM 4470 C CB  . LEU E 1 35  ? -12.265 37.059  53.677  1.00 32.31 ? 175 LEU E CB  1 
ATOM 4471 C CG  . LEU E 1 35  ? -11.963 37.658  55.047  1.00 33.69 ? 175 LEU E CG  1 
ATOM 4472 C CD1 . LEU E 1 35  ? -11.792 39.159  54.956  1.00 33.45 ? 175 LEU E CD1 1 
ATOM 4473 C CD2 . LEU E 1 35  ? -13.087 37.277  55.993  1.00 32.61 ? 175 LEU E CD2 1 
ATOM 4474 N N   . ASP E 1 36  ? -12.126 34.017  51.807  1.00 33.45 ? 176 ASP E N   1 
ATOM 4475 C CA  . ASP E 1 36  ? -12.873 33.219  50.848  1.00 36.42 ? 176 ASP E CA  1 
ATOM 4476 C C   . ASP E 1 36  ? -13.523 34.108  49.796  1.00 36.58 ? 176 ASP E C   1 
ATOM 4477 O O   . ASP E 1 36  ? -14.527 33.735  49.190  1.00 37.37 ? 176 ASP E O   1 
ATOM 4478 C CB  . ASP E 1 36  ? -13.946 32.425  51.588  1.00 41.13 ? 176 ASP E CB  1 
ATOM 4479 C CG  . ASP E 1 36  ? -13.988 30.980  51.173  1.00 45.78 ? 176 ASP E CG  1 
ATOM 4480 O OD1 . ASP E 1 36  ? -12.906 30.356  51.114  1.00 47.76 ? 176 ASP E OD1 1 
ATOM 4481 O OD2 . ASP E 1 36  ? -15.100 30.466  50.922  1.00 50.58 ? 176 ASP E OD2 1 
ATOM 4482 N N   . ALA E 1 37  ? -12.942 35.283  49.579  1.00 35.34 ? 177 ALA E N   1 
ATOM 4483 C CA  . ALA E 1 37  ? -13.484 36.227  48.613  1.00 35.16 ? 177 ALA E CA  1 
ATOM 4484 C C   . ALA E 1 37  ? -12.415 36.749  47.662  1.00 34.58 ? 177 ALA E C   1 
ATOM 4485 O O   . ALA E 1 37  ? -11.383 36.109  47.457  1.00 35.76 ? 177 ALA E O   1 
ATOM 4486 C CB  . ALA E 1 37  ? -14.143 37.395  49.350  1.00 35.07 ? 177 ALA E CB  1 
ATOM 4487 N N   . LYS E 1 38  ? -12.683 37.912  47.076  1.00 33.20 ? 178 LYS E N   1 
ATOM 4488 C CA  . LYS E 1 38  ? -11.758 38.560  46.160  1.00 32.01 ? 178 LYS E CA  1 
ATOM 4489 C C   . LYS E 1 38  ? -12.061 40.046  46.174  1.00 32.29 ? 178 LYS E C   1 
ATOM 4490 O O   . LYS E 1 38  ? -13.133 40.461  46.613  1.00 34.44 ? 178 LYS E O   1 
ATOM 4491 C CB  . LYS E 1 38  ? -11.919 38.014  44.742  1.00 32.05 ? 178 LYS E CB  1 
ATOM 4492 C CG  . LYS E 1 38  ? -13.240 38.345  44.077  1.00 31.68 ? 178 LYS E CG  1 
ATOM 4493 C CD  . LYS E 1 38  ? -13.227 37.888  42.630  1.00 30.69 ? 178 LYS E CD  1 
ATOM 4494 C CE  . LYS E 1 38  ? -14.501 38.271  41.901  1.00 30.93 ? 178 LYS E CE  1 
ATOM 4495 N NZ  . LYS E 1 38  ? -14.403 37.941  40.454  1.00 30.22 ? 178 LYS E NZ  1 
ATOM 4496 N N   . LEU E 1 39  ? -11.123 40.852  45.695  1.00 31.05 ? 179 LEU E N   1 
ATOM 4497 C CA  . LEU E 1 39  ? -11.319 42.294  45.681  1.00 30.27 ? 179 LEU E CA  1 
ATOM 4498 C C   . LEU E 1 39  ? -12.425 42.709  44.728  1.00 31.89 ? 179 LEU E C   1 
ATOM 4499 O O   . LEU E 1 39  ? -12.554 42.160  43.632  1.00 33.60 ? 179 LEU E O   1 
ATOM 4500 C CB  . LEU E 1 39  ? -10.016 43.001  45.309  1.00 27.17 ? 179 LEU E CB  1 
ATOM 4501 C CG  . LEU E 1 39  ? -8.992  43.084  46.440  1.00 23.85 ? 179 LEU E CG  1 
ATOM 4502 C CD1 . LEU E 1 39  ? -7.613  43.356  45.876  1.00 23.48 ? 179 LEU E CD1 1 
ATOM 4503 C CD2 . LEU E 1 39  ? -9.413  44.169  47.411  1.00 21.03 ? 179 LEU E CD2 1 
ATOM 4504 N N   . LEU E 1 40  ? -13.223 43.678  45.166  1.00 32.09 ? 180 LEU E N   1 
ATOM 4505 C CA  . LEU E 1 40  ? -14.331 44.208  44.385  1.00 32.22 ? 180 LEU E CA  1 
ATOM 4506 C C   . LEU E 1 40  ? -14.000 44.293  42.907  1.00 34.30 ? 180 LEU E C   1 
ATOM 4507 O O   . LEU E 1 40  ? -12.975 44.859  42.528  1.00 34.54 ? 180 LEU E O   1 
ATOM 4508 C CB  . LEU E 1 40  ? -14.698 45.606  44.881  1.00 31.21 ? 180 LEU E CB  1 
ATOM 4509 C CG  . LEU E 1 40  ? -15.579 46.443  43.950  1.00 28.96 ? 180 LEU E CG  1 
ATOM 4510 C CD1 . LEU E 1 40  ? -17.008 45.936  43.991  1.00 27.81 ? 180 LEU E CD1 1 
ATOM 4511 C CD2 . LEU E 1 40  ? -15.521 47.895  44.373  1.00 28.93 ? 180 LEU E CD2 1 
ATOM 4512 N N   . LYS E 1 41  ? -14.875 43.729  42.080  1.00 36.25 ? 181 LYS E N   1 
ATOM 4513 C CA  . LYS E 1 41  ? -14.713 43.759  40.631  1.00 39.25 ? 181 LYS E CA  1 
ATOM 4514 C C   . LYS E 1 41  ? -16.018 44.272  40.052  1.00 41.68 ? 181 LYS E C   1 
ATOM 4515 O O   . LYS E 1 41  ? -17.045 43.601  40.147  1.00 42.59 ? 181 LYS E O   1 
ATOM 4516 C CB  . LYS E 1 41  ? -14.426 42.362  40.088  1.00 38.99 ? 181 LYS E CB  1 
ATOM 4517 C CG  . LYS E 1 41  ? -14.674 42.226  38.595  1.00 38.12 ? 181 LYS E CG  1 
ATOM 4518 C CD  . LYS E 1 41  ? -14.313 40.843  38.096  1.00 38.53 ? 181 LYS E CD  1 
ATOM 4519 C CE  . LYS E 1 41  ? -14.731 40.656  36.652  1.00 38.57 ? 181 LYS E CE  1 
ATOM 4520 N NZ  . LYS E 1 41  ? -14.268 39.349  36.106  1.00 41.35 ? 181 LYS E NZ  1 
ATOM 4521 N N   . ILE E 1 42  ? -15.980 45.460  39.457  1.00 44.23 ? 182 ILE E N   1 
ATOM 4522 C CA  . ILE E 1 42  ? -17.184 46.059  38.895  1.00 46.57 ? 182 ILE E CA  1 
ATOM 4523 C C   . ILE E 1 42  ? -17.445 45.612  37.470  1.00 47.70 ? 182 ILE E C   1 
ATOM 4524 O O   . ILE E 1 42  ? -16.713 45.984  36.554  1.00 47.67 ? 182 ILE E O   1 
ATOM 4525 C CB  . ILE E 1 42  ? -17.104 47.596  38.914  1.00 46.83 ? 182 ILE E CB  1 
ATOM 4526 C CG1 . ILE E 1 42  ? -16.737 48.077  40.321  1.00 46.69 ? 182 ILE E CG1 1 
ATOM 4527 C CG2 . ILE E 1 42  ? -18.444 48.187  38.488  1.00 47.41 ? 182 ILE E CG2 1 
ATOM 4528 C CD1 . ILE E 1 42  ? -16.590 49.574  40.450  1.00 44.93 ? 182 ILE E CD1 1 
ATOM 4529 N N   . ASN E 1 43  ? -18.498 44.821  37.290  1.00 49.02 ? 183 ASN E N   1 
ATOM 4530 C CA  . ASN E 1 43  ? -18.859 44.320  35.971  1.00 51.67 ? 183 ASN E CA  1 
ATOM 4531 C C   . ASN E 1 43  ? -20.202 44.867  35.498  1.00 52.35 ? 183 ASN E C   1 
ATOM 4532 O O   . ASN E 1 43  ? -21.047 44.117  35.012  1.00 52.49 ? 183 ASN E O   1 
ATOM 4533 C CB  . ASN E 1 43  ? -18.893 42.788  35.979  1.00 54.07 ? 183 ASN E CB  1 
ATOM 4534 C CG  . ASN E 1 43  ? -19.628 42.226  37.182  1.00 56.06 ? 183 ASN E CG  1 
ATOM 4535 O OD1 . ASN E 1 43  ? -20.748 42.635  37.485  1.00 58.05 ? 183 ASN E OD1 1 
ATOM 4536 N ND2 . ASN E 1 43  ? -19.002 41.277  37.872  1.00 56.00 ? 183 ASN E ND2 1 
ATOM 4537 N N   . SER E 1 44  ? -20.386 46.177  35.649  1.00 53.22 ? 184 SER E N   1 
ATOM 4538 C CA  . SER E 1 44  ? -21.609 46.863  35.233  1.00 53.70 ? 184 SER E CA  1 
ATOM 4539 C C   . SER E 1 44  ? -21.747 48.204  35.941  1.00 54.23 ? 184 SER E C   1 
ATOM 4540 O O   . SER E 1 44  ? -21.314 48.367  37.080  1.00 53.83 ? 184 SER E O   1 
ATOM 4541 C CB  . SER E 1 44  ? -22.846 46.021  35.543  1.00 53.20 ? 184 SER E CB  1 
ATOM 4542 O OG  . SER E 1 44  ? -23.108 46.008  36.932  1.00 53.32 ? 184 SER E OG  1 
ATOM 4543 N N   . THR E 1 45  ? -22.368 49.157  35.255  1.00 55.50 ? 185 THR E N   1 
ATOM 4544 C CA  . THR E 1 45  ? -22.582 50.492  35.798  1.00 56.02 ? 185 THR E CA  1 
ATOM 4545 C C   . THR E 1 45  ? -23.421 50.480  37.073  1.00 55.17 ? 185 THR E C   1 
ATOM 4546 O O   . THR E 1 45  ? -23.256 51.341  37.935  1.00 55.10 ? 185 THR E O   1 
ATOM 4547 C CB  . THR E 1 45  ? -23.276 51.396  34.771  1.00 57.28 ? 185 THR E CB  1 
ATOM 4548 O OG1 . THR E 1 45  ? -24.453 50.739  34.281  1.00 59.04 ? 185 THR E OG1 1 
ATOM 4549 C CG2 . THR E 1 45  ? -22.336 51.701  33.613  1.00 57.09 ? 185 THR E CG2 1 
ATOM 4550 N N   . ALA E 1 46  ? -24.326 49.513  37.188  1.00 54.25 ? 186 ALA E N   1 
ATOM 4551 C CA  . ALA E 1 46  ? -25.168 49.412  38.375  1.00 52.50 ? 186 ALA E CA  1 
ATOM 4552 C C   . ALA E 1 46  ? -24.291 49.200  39.600  1.00 50.89 ? 186 ALA E C   1 
ATOM 4553 O O   . ALA E 1 46  ? -24.438 49.891  40.606  1.00 50.36 ? 186 ALA E O   1 
ATOM 4554 C CB  . ALA E 1 46  ? -26.146 48.260  38.230  1.00 53.62 ? 186 ALA E CB  1 
ATOM 4555 N N   . ASP E 1 47  ? -23.377 48.239  39.503  1.00 48.52 ? 187 ASP E N   1 
ATOM 4556 C CA  . ASP E 1 47  ? -22.459 47.932  40.591  1.00 47.45 ? 187 ASP E CA  1 
ATOM 4557 C C   . ASP E 1 47  ? -21.696 49.164  41.073  1.00 46.65 ? 187 ASP E C   1 
ATOM 4558 O O   . ASP E 1 47  ? -21.708 49.481  42.261  1.00 47.98 ? 187 ASP E O   1 
ATOM 4559 C CB  . ASP E 1 47  ? -21.470 46.856  40.144  1.00 48.39 ? 187 ASP E CB  1 
ATOM 4560 C CG  . ASP E 1 47  ? -22.098 45.480  40.090  1.00 48.99 ? 187 ASP E CG  1 
ATOM 4561 O OD1 . ASP E 1 47  ? -23.344 45.401  40.017  1.00 49.04 ? 187 ASP E OD1 1 
ATOM 4562 O OD2 . ASP E 1 47  ? -21.346 44.480  40.112  1.00 48.42 ? 187 ASP E OD2 1 
ATOM 4563 N N   . LEU E 1 48  ? -21.032 49.856  40.153  1.00 44.64 ? 188 LEU E N   1 
ATOM 4564 C CA  . LEU E 1 48  ? -20.272 51.047  40.509  1.00 43.20 ? 188 LEU E CA  1 
ATOM 4565 C C   . LEU E 1 48  ? -21.126 52.022  41.300  1.00 43.42 ? 188 LEU E C   1 
ATOM 4566 O O   . LEU E 1 48  ? -20.621 52.744  42.153  1.00 43.26 ? 188 LEU E O   1 
ATOM 4567 C CB  . LEU E 1 48  ? -19.751 51.750  39.259  1.00 43.27 ? 188 LEU E CB  1 
ATOM 4568 C CG  . LEU E 1 48  ? -18.963 53.033  39.532  1.00 42.97 ? 188 LEU E CG  1 
ATOM 4569 C CD1 . LEU E 1 48  ? -17.475 52.732  39.507  1.00 42.01 ? 188 LEU E CD1 1 
ATOM 4570 C CD2 . LEU E 1 48  ? -19.309 54.079  38.485  1.00 42.26 ? 188 LEU E CD2 1 
ATOM 4571 N N   . ASP E 1 49  ? -22.421 52.052  41.010  1.00 45.21 ? 189 ASP E N   1 
ATOM 4572 C CA  . ASP E 1 49  ? -23.325 52.949  41.720  1.00 46.39 ? 189 ASP E CA  1 
ATOM 4573 C C   . ASP E 1 49  ? -23.661 52.401  43.099  1.00 46.49 ? 189 ASP E C   1 
ATOM 4574 O O   . ASP E 1 49  ? -23.625 53.135  44.089  1.00 47.59 ? 189 ASP E O   1 
ATOM 4575 C CB  . ASP E 1 49  ? -24.611 53.174  40.921  1.00 47.95 ? 189 ASP E CB  1 
ATOM 4576 C CG  . ASP E 1 49  ? -24.409 54.101  39.737  1.00 49.78 ? 189 ASP E CG  1 
ATOM 4577 O OD1 . ASP E 1 49  ? -23.728 55.139  39.901  1.00 48.75 ? 189 ASP E OD1 1 
ATOM 4578 O OD2 . ASP E 1 49  ? -24.942 53.796  38.648  1.00 51.39 ? 189 ASP E OD2 1 
ATOM 4579 N N   . PHE E 1 50  ? -23.989 51.113  43.168  1.00 44.95 ? 190 PHE E N   1 
ATOM 4580 C CA  . PHE E 1 50  ? -24.308 50.490  44.447  1.00 44.98 ? 190 PHE E CA  1 
ATOM 4581 C C   . PHE E 1 50  ? -23.184 50.750  45.448  1.00 46.33 ? 190 PHE E C   1 
ATOM 4582 O O   . PHE E 1 50  ? -23.431 51.158  46.584  1.00 46.92 ? 190 PHE E O   1 
ATOM 4583 C CB  . PHE E 1 50  ? -24.497 48.979  44.278  1.00 43.49 ? 190 PHE E CB  1 
ATOM 4584 C CG  . PHE E 1 50  ? -24.303 48.203  45.550  1.00 43.05 ? 190 PHE E CG  1 
ATOM 4585 C CD1 . PHE E 1 50  ? -25.140 48.403  46.640  1.00 41.29 ? 190 PHE E CD1 1 
ATOM 4586 C CD2 . PHE E 1 50  ? -23.237 47.311  45.675  1.00 43.41 ? 190 PHE E CD2 1 
ATOM 4587 C CE1 . PHE E 1 50  ? -24.917 47.729  47.837  1.00 42.19 ? 190 PHE E CE1 1 
ATOM 4588 C CE2 . PHE E 1 50  ? -23.006 46.635  46.866  1.00 42.32 ? 190 PHE E CE2 1 
ATOM 4589 C CZ  . PHE E 1 50  ? -23.847 46.845  47.950  1.00 41.95 ? 190 PHE E CZ  1 
ATOM 4590 N N   . ILE E 1 51  ? -21.950 50.518  45.009  1.00 47.08 ? 191 ILE E N   1 
ATOM 4591 C CA  . ILE E 1 51  ? -20.776 50.706  45.852  1.00 46.69 ? 191 ILE E CA  1 
ATOM 4592 C C   . ILE E 1 51  ? -20.538 52.165  46.235  1.00 47.26 ? 191 ILE E C   1 
ATOM 4593 O O   . ILE E 1 51  ? -20.259 52.461  47.395  1.00 47.58 ? 191 ILE E O   1 
ATOM 4594 C CB  . ILE E 1 51  ? -19.513 50.137  45.162  1.00 45.97 ? 191 ILE E CB  1 
ATOM 4595 C CG1 . ILE E 1 51  ? -19.668 48.626  44.965  1.00 45.37 ? 191 ILE E CG1 1 
ATOM 4596 C CG2 . ILE E 1 51  ? -18.278 50.432  45.995  1.00 44.68 ? 191 ILE E CG2 1 
ATOM 4597 C CD1 . ILE E 1 51  ? -19.753 47.831  46.258  1.00 45.02 ? 191 ILE E CD1 1 
ATOM 4598 N N   . GLN E 1 52  ? -20.642 53.074  45.272  1.00 48.58 ? 192 GLN E N   1 
ATOM 4599 C CA  . GLN E 1 52  ? -20.443 54.491  45.555  1.00 51.22 ? 192 GLN E CA  1 
ATOM 4600 C C   . GLN E 1 52  ? -21.487 54.863  46.598  1.00 52.55 ? 192 GLN E C   1 
ATOM 4601 O O   . GLN E 1 52  ? -21.176 55.445  47.638  1.00 52.34 ? 192 GLN E O   1 
ATOM 4602 C CB  . GLN E 1 52  ? -20.647 55.314  44.283  1.00 53.05 ? 192 GLN E CB  1 
ATOM 4603 C CG  . GLN E 1 52  ? -20.180 56.771  44.356  1.00 57.37 ? 192 GLN E CG  1 
ATOM 4604 C CD  . GLN E 1 52  ? -20.961 57.615  45.355  1.00 59.04 ? 192 GLN E CD  1 
ATOM 4605 O OE1 . GLN E 1 52  ? -20.718 57.556  46.562  1.00 60.81 ? 192 GLN E OE1 1 
ATOM 4606 N NE2 . GLN E 1 52  ? -21.907 58.404  44.853  1.00 57.20 ? 192 GLN E NE2 1 
ATOM 4607 N N   . GLN E 1 53  ? -22.730 54.500  46.308  1.00 54.91 ? 193 GLN E N   1 
ATOM 4608 C CA  . GLN E 1 53  ? -23.849 54.757  47.204  1.00 56.68 ? 193 GLN E CA  1 
ATOM 4609 C C   . GLN E 1 53  ? -23.507 54.315  48.620  1.00 56.50 ? 193 GLN E C   1 
ATOM 4610 O O   . GLN E 1 53  ? -23.677 55.069  49.574  1.00 57.79 ? 193 GLN E O   1 
ATOM 4611 C CB  . GLN E 1 53  ? -25.081 53.990  46.721  1.00 58.35 ? 193 GLN E CB  1 
ATOM 4612 C CG  . GLN E 1 53  ? -26.188 53.854  47.755  1.00 62.00 ? 193 GLN E CG  1 
ATOM 4613 C CD  . GLN E 1 53  ? -27.225 52.809  47.366  1.00 65.47 ? 193 GLN E CD  1 
ATOM 4614 O OE1 . GLN E 1 53  ? -27.907 52.937  46.346  1.00 65.20 ? 193 GLN E OE1 1 
ATOM 4615 N NE2 . GLN E 1 53  ? -27.345 51.764  48.181  1.00 66.71 ? 193 GLN E NE2 1 
ATOM 4616 N N   . ALA E 1 54  ? -23.010 53.089  48.738  1.00 55.76 ? 194 ALA E N   1 
ATOM 4617 C CA  . ALA E 1 54  ? -22.665 52.502  50.026  1.00 55.15 ? 194 ALA E CA  1 
ATOM 4618 C C   . ALA E 1 54  ? -21.478 53.108  50.777  1.00 54.75 ? 194 ALA E C   1 
ATOM 4619 O O   . ALA E 1 54  ? -21.208 52.711  51.911  1.00 55.93 ? 194 ALA E O   1 
ATOM 4620 C CB  . ALA E 1 54  ? -22.450 51.003  49.853  1.00 55.95 ? 194 ALA E CB  1 
ATOM 4621 N N   . ILE E 1 55  ? -20.761 54.049  50.171  1.00 53.37 ? 195 ILE E N   1 
ATOM 4622 C CA  . ILE E 1 55  ? -19.627 54.658  50.862  1.00 52.59 ? 195 ILE E CA  1 
ATOM 4623 C C   . ILE E 1 55  ? -19.541 56.162  50.706  1.00 52.82 ? 195 ILE E C   1 
ATOM 4624 O O   . ILE E 1 55  ? -18.508 56.757  51.004  1.00 53.02 ? 195 ILE E O   1 
ATOM 4625 C CB  . ILE E 1 55  ? -18.274 54.065  50.410  1.00 51.05 ? 195 ILE E CB  1 
ATOM 4626 C CG1 . ILE E 1 55  ? -18.118 54.189  48.896  1.00 50.81 ? 195 ILE E CG1 1 
ATOM 4627 C CG2 . ILE E 1 55  ? -18.171 52.634  50.850  1.00 51.23 ? 195 ILE E CG2 1 
ATOM 4628 C CD1 . ILE E 1 55  ? -16.773 53.723  48.386  1.00 50.91 ? 195 ILE E CD1 1 
ATOM 4629 N N   . SER E 1 56  ? -20.620 56.780  50.242  1.00 53.15 ? 196 SER E N   1 
ATOM 4630 C CA  . SER E 1 56  ? -20.635 58.227  50.068  1.00 54.09 ? 196 SER E CA  1 
ATOM 4631 C C   . SER E 1 56  ? -20.183 58.951  51.339  1.00 54.22 ? 196 SER E C   1 
ATOM 4632 O O   . SER E 1 56  ? -19.784 60.114  51.294  1.00 52.95 ? 196 SER E O   1 
ATOM 4633 C CB  . SER E 1 56  ? -22.039 58.688  49.668  1.00 53.63 ? 196 SER E CB  1 
ATOM 4634 O OG  . SER E 1 56  ? -23.023 58.071  50.479  1.00 55.51 ? 196 SER E OG  1 
ATOM 4635 N N   . TYR E 1 57  ? -20.232 58.250  52.468  1.00 55.66 ? 197 TYR E N   1 
ATOM 4636 C CA  . TYR E 1 57  ? -19.836 58.824  53.752  1.00 57.99 ? 197 TYR E CA  1 
ATOM 4637 C C   . TYR E 1 57  ? -18.410 58.478  54.162  1.00 58.02 ? 197 TYR E C   1 
ATOM 4638 O O   . TYR E 1 57  ? -18.111 58.340  55.349  1.00 59.20 ? 197 TYR E O   1 
ATOM 4639 C CB  . TYR E 1 57  ? -20.801 58.363  54.843  1.00 60.21 ? 197 TYR E CB  1 
ATOM 4640 C CG  . TYR E 1 57  ? -21.091 56.883  54.803  1.00 61.87 ? 197 TYR E CG  1 
ATOM 4641 C CD1 . TYR E 1 57  ? -20.110 55.949  55.130  1.00 62.14 ? 197 TYR E CD1 1 
ATOM 4642 C CD2 . TYR E 1 57  ? -22.347 56.416  54.420  1.00 63.30 ? 197 TYR E CD2 1 
ATOM 4643 C CE1 . TYR E 1 57  ? -20.373 54.585  55.076  1.00 64.48 ? 197 TYR E CE1 1 
ATOM 4644 C CE2 . TYR E 1 57  ? -22.622 55.057  54.363  1.00 64.90 ? 197 TYR E CE2 1 
ATOM 4645 C CZ  . TYR E 1 57  ? -21.632 54.147  54.691  1.00 65.78 ? 197 TYR E CZ  1 
ATOM 4646 O OH  . TYR E 1 57  ? -21.905 52.799  54.633  1.00 67.88 ? 197 TYR E OH  1 
ATOM 4647 N N   . SER E 1 58  ? -17.529 58.342  53.180  1.00 57.16 ? 198 SER E N   1 
ATOM 4648 C CA  . SER E 1 58  ? -16.142 58.022  53.465  1.00 56.11 ? 198 SER E CA  1 
ATOM 4649 C C   . SER E 1 58  ? -15.249 58.754  52.474  1.00 56.36 ? 198 SER E C   1 
ATOM 4650 O O   . SER E 1 58  ? -15.390 58.598  51.265  1.00 56.42 ? 198 SER E O   1 
ATOM 4651 C CB  . SER E 1 58  ? -15.924 56.515  53.364  1.00 55.41 ? 198 SER E CB  1 
ATOM 4652 O OG  . SER E 1 58  ? -14.695 56.143  53.955  1.00 56.03 ? 198 SER E OG  1 
ATOM 4653 N N   . SER E 1 59  ? -14.340 59.569  52.991  1.00 57.11 ? 199 SER E N   1 
ATOM 4654 C CA  . SER E 1 59  ? -13.421 60.325  52.148  1.00 58.43 ? 199 SER E CA  1 
ATOM 4655 C C   . SER E 1 59  ? -12.178 59.497  51.812  1.00 57.53 ? 199 SER E C   1 
ATOM 4656 O O   . SER E 1 59  ? -11.348 59.904  50.996  1.00 57.44 ? 199 SER E O   1 
ATOM 4657 C CB  . SER E 1 59  ? -13.015 61.618  52.864  1.00 60.17 ? 199 SER E CB  1 
ATOM 4658 O OG  . SER E 1 59  ? -12.663 61.353  54.214  1.00 62.83 ? 199 SER E OG  1 
ATOM 4659 N N   . PHE E 1 60  ? -12.066 58.330  52.440  1.00 55.14 ? 200 PHE E N   1 
ATOM 4660 C CA  . PHE E 1 60  ? -10.928 57.447  52.226  1.00 51.68 ? 200 PHE E CA  1 
ATOM 4661 C C   . PHE E 1 60  ? -11.117 56.562  51.003  1.00 49.19 ? 200 PHE E C   1 
ATOM 4662 O O   . PHE E 1 60  ? -12.241 56.252  50.613  1.00 49.17 ? 200 PHE E O   1 
ATOM 4663 C CB  . PHE E 1 60  ? -10.696 56.599  53.473  1.00 51.82 ? 200 PHE E CB  1 
ATOM 4664 C CG  . PHE E 1 60  ? -10.339 57.410  54.684  1.00 53.07 ? 200 PHE E CG  1 
ATOM 4665 C CD1 . PHE E 1 60  ? -9.134  57.199  55.348  1.00 53.09 ? 200 PHE E CD1 1 
ATOM 4666 C CD2 . PHE E 1 60  ? -11.196 58.407  55.147  1.00 53.10 ? 200 PHE E CD2 1 
ATOM 4667 C CE1 . PHE E 1 60  ? -8.782  57.971  56.450  1.00 52.87 ? 200 PHE E CE1 1 
ATOM 4668 C CE2 . PHE E 1 60  ? -10.855 59.185  56.247  1.00 54.50 ? 200 PHE E CE2 1 
ATOM 4669 C CZ  . PHE E 1 60  ? -9.643  58.965  56.901  1.00 54.63 ? 200 PHE E CZ  1 
ATOM 4670 N N   . PRO E 1 61  ? -10.008 56.149  50.376  1.00 46.89 ? 201 PRO E N   1 
ATOM 4671 C CA  . PRO E 1 61  ? -10.048 55.301  49.187  1.00 45.19 ? 201 PRO E CA  1 
ATOM 4672 C C   . PRO E 1 61  ? -10.178 53.815  49.497  1.00 43.74 ? 201 PRO E C   1 
ATOM 4673 O O   . PRO E 1 61  ? -9.704  53.340  50.531  1.00 44.21 ? 201 PRO E O   1 
ATOM 4674 C CB  . PRO E 1 61  ? -8.727  55.627  48.510  1.00 45.25 ? 201 PRO E CB  1 
ATOM 4675 C CG  . PRO E 1 61  ? -7.813  55.730  49.687  1.00 45.94 ? 201 PRO E CG  1 
ATOM 4676 C CD  . PRO E 1 61  ? -8.623  56.557  50.673  1.00 46.29 ? 201 PRO E CD  1 
ATOM 4677 N N   . PHE E 1 62  ? -10.824 53.094  48.585  1.00 40.80 ? 202 PHE E N   1 
ATOM 4678 C CA  . PHE E 1 62  ? -11.008 51.655  48.713  1.00 37.75 ? 202 PHE E CA  1 
ATOM 4679 C C   . PHE E 1 62  ? -10.428 50.965  47.485  1.00 36.24 ? 202 PHE E C   1 
ATOM 4680 O O   . PHE E 1 62  ? -10.760 51.317  46.354  1.00 36.43 ? 202 PHE E O   1 
ATOM 4681 C CB  . PHE E 1 62  ? -12.492 51.302  48.822  1.00 36.51 ? 202 PHE E CB  1 
ATOM 4682 C CG  . PHE E 1 62  ? -13.114 51.682  50.129  1.00 35.70 ? 202 PHE E CG  1 
ATOM 4683 C CD1 . PHE E 1 62  ? -13.385 53.011  50.429  1.00 35.36 ? 202 PHE E CD1 1 
ATOM 4684 C CD2 . PHE E 1 62  ? -13.438 50.703  51.062  1.00 36.01 ? 202 PHE E CD2 1 
ATOM 4685 C CE1 . PHE E 1 62  ? -13.975 53.361  51.641  1.00 34.62 ? 202 PHE E CE1 1 
ATOM 4686 C CE2 . PHE E 1 62  ? -14.025 51.041  52.273  1.00 35.04 ? 202 PHE E CE2 1 
ATOM 4687 C CZ  . PHE E 1 62  ? -14.294 52.375  52.563  1.00 35.00 ? 202 PHE E CZ  1 
ATOM 4688 N N   . TRP E 1 63  ? -9.557  49.986  47.706  1.00 34.20 ? 203 TRP E N   1 
ATOM 4689 C CA  . TRP E 1 63  ? -8.957  49.249  46.601  1.00 32.31 ? 203 TRP E CA  1 
ATOM 4690 C C   . TRP E 1 63  ? -9.991  48.321  45.968  1.00 32.83 ? 203 TRP E C   1 
ATOM 4691 O O   . TRP E 1 63  ? -10.968 47.926  46.607  1.00 29.58 ? 203 TRP E O   1 
ATOM 4692 C CB  . TRP E 1 63  ? -7.791  48.378  47.087  1.00 29.55 ? 203 TRP E CB  1 
ATOM 4693 C CG  . TRP E 1 63  ? -6.517  49.083  47.446  1.00 27.92 ? 203 TRP E CG  1 
ATOM 4694 C CD1 . TRP E 1 63  ? -5.814  48.948  48.608  1.00 27.43 ? 203 TRP E CD1 1 
ATOM 4695 C CD2 . TRP E 1 63  ? -5.738  49.944  46.607  1.00 27.85 ? 203 TRP E CD2 1 
ATOM 4696 N NE1 . TRP E 1 63  ? -4.646  49.667  48.547  1.00 27.06 ? 203 TRP E NE1 1 
ATOM 4697 C CE2 . TRP E 1 63  ? -4.574  50.290  47.331  1.00 27.39 ? 203 TRP E CE2 1 
ATOM 4698 C CE3 . TRP E 1 63  ? -5.911  50.459  45.316  1.00 27.60 ? 203 TRP E CE3 1 
ATOM 4699 C CZ2 . TRP E 1 63  ? -3.584  51.120  46.805  1.00 27.97 ? 203 TRP E CZ2 1 
ATOM 4700 C CZ3 . TRP E 1 63  ? -4.926  51.286  44.792  1.00 27.50 ? 203 TRP E CZ3 1 
ATOM 4701 C CH2 . TRP E 1 63  ? -3.777  51.611  45.539  1.00 29.17 ? 203 TRP E CH2 1 
ATOM 4702 N N   . MET E 1 64  ? -9.766  47.990  44.700  1.00 34.70 ? 204 MET E N   1 
ATOM 4703 C CA  . MET E 1 64  ? -10.614 47.061  43.966  1.00 34.77 ? 204 MET E CA  1 
ATOM 4704 C C   . MET E 1 64  ? -9.632  46.165  43.224  1.00 34.95 ? 204 MET E C   1 
ATOM 4705 O O   . MET E 1 64  ? -8.441  46.469  43.169  1.00 34.07 ? 204 MET E O   1 
ATOM 4706 C CB  . MET E 1 64  ? -11.556 47.787  42.992  1.00 34.84 ? 204 MET E CB  1 
ATOM 4707 C CG  . MET E 1 64  ? -10.928 48.875  42.138  1.00 36.84 ? 204 MET E CG  1 
ATOM 4708 S SD  . MET E 1 64  ? -12.058 49.416  40.818  1.00 38.98 ? 204 MET E SD  1 
ATOM 4709 C CE  . MET E 1 64  ? -13.064 50.642  41.653  1.00 38.20 ? 204 MET E CE  1 
ATOM 4710 N N   . GLY E 1 65  ? -10.112 45.057  42.674  1.00 36.36 ? 205 GLY E N   1 
ATOM 4711 C CA  . GLY E 1 65  ? -9.218  44.147  41.977  1.00 36.96 ? 205 GLY E CA  1 
ATOM 4712 C C   . GLY E 1 65  ? -8.740  44.571  40.599  1.00 36.99 ? 205 GLY E C   1 
ATOM 4713 O O   . GLY E 1 65  ? -8.410  43.717  39.781  1.00 37.75 ? 205 GLY E O   1 
ATOM 4714 N N   . LEU E 1 66  ? -8.688  45.873  40.334  1.00 36.20 ? 206 LEU E N   1 
ATOM 4715 C CA  . LEU E 1 66  ? -8.250  46.372  39.033  1.00 35.33 ? 206 LEU E CA  1 
ATOM 4716 C C   . LEU E 1 66  ? -6.816  46.894  39.101  1.00 36.48 ? 206 LEU E C   1 
ATOM 4717 O O   . LEU E 1 66  ? -6.499  47.736  39.947  1.00 36.19 ? 206 LEU E O   1 
ATOM 4718 C CB  . LEU E 1 66  ? -9.190  47.486  38.573  1.00 35.20 ? 206 LEU E CB  1 
ATOM 4719 C CG  . LEU E 1 66  ? -8.980  48.065  37.175  1.00 35.96 ? 206 LEU E CG  1 
ATOM 4720 C CD1 . LEU E 1 66  ? -9.169  46.974  36.139  1.00 36.42 ? 206 LEU E CD1 1 
ATOM 4721 C CD2 . LEU E 1 66  ? -9.966  49.201  36.941  1.00 35.47 ? 206 LEU E CD2 1 
ATOM 4722 N N   . SER E 1 67  ? -5.953  46.407  38.208  1.00 37.60 ? 207 SER E N   1 
ATOM 4723 C CA  . SER E 1 67  ? -4.552  46.833  38.206  1.00 38.53 ? 207 SER E CA  1 
ATOM 4724 C C   . SER E 1 67  ? -3.789  46.660  36.884  1.00 40.40 ? 207 SER E C   1 
ATOM 4725 O O   . SER E 1 67  ? -4.362  46.283  35.859  1.00 39.71 ? 207 SER E O   1 
ATOM 4726 C CB  . SER E 1 67  ? -3.803  46.085  39.306  1.00 35.87 ? 207 SER E CB  1 
ATOM 4727 O OG  . SER E 1 67  ? -3.987  44.689  39.145  1.00 34.72 ? 207 SER E OG  1 
ATOM 4728 N N   . ARG E 1 68  ? -2.488  46.955  36.937  1.00 42.83 ? 208 ARG E N   1 
ATOM 4729 C CA  . ARG E 1 68  ? -1.568  46.837  35.799  1.00 44.66 ? 208 ARG E CA  1 
ATOM 4730 C C   . ARG E 1 68  ? -0.180  47.355  36.193  1.00 46.48 ? 208 ARG E C   1 
ATOM 4731 O O   . ARG E 1 68  ? -0.057  48.436  36.768  1.00 47.06 ? 208 ARG E O   1 
ATOM 4732 C CB  . ARG E 1 68  ? -2.087  47.612  34.580  1.00 44.25 ? 208 ARG E CB  1 
ATOM 4733 C CG  . ARG E 1 68  ? -1.866  49.117  34.606  1.00 44.29 ? 208 ARG E CG  1 
ATOM 4734 C CD  . ARG E 1 68  ? -2.318  49.730  33.286  1.00 45.52 ? 208 ARG E CD  1 
ATOM 4735 N NE  . ARG E 1 68  ? -2.165  51.182  33.244  1.00 48.44 ? 208 ARG E NE  1 
ATOM 4736 C CZ  . ARG E 1 68  ? -2.544  51.942  32.220  1.00 49.44 ? 208 ARG E CZ  1 
ATOM 4737 N NH1 . ARG E 1 68  ? -3.099  51.385  31.151  1.00 49.80 ? 208 ARG E NH1 1 
ATOM 4738 N NH2 . ARG E 1 68  ? -2.378  53.259  32.267  1.00 49.56 ? 208 ARG E NH2 1 
ATOM 4739 N N   . ARG E 1 69  ? 0.862   46.588  35.878  1.00 48.48 ? 209 ARG E N   1 
ATOM 4740 C CA  . ARG E 1 69  ? 2.231   46.972  36.227  1.00 50.95 ? 209 ARG E CA  1 
ATOM 4741 C C   . ARG E 1 69  ? 2.662   48.373  35.795  1.00 52.47 ? 209 ARG E C   1 
ATOM 4742 O O   . ARG E 1 69  ? 3.320   49.082  36.558  1.00 54.36 ? 209 ARG E O   1 
ATOM 4743 C CB  . ARG E 1 69  ? 3.226   45.931  35.705  1.00 51.69 ? 209 ARG E CB  1 
ATOM 4744 C CG  . ARG E 1 69  ? 3.325   44.689  36.590  1.00 53.13 ? 209 ARG E CG  1 
ATOM 4745 C CD  . ARG E 1 69  ? 4.474   43.778  36.179  1.00 53.90 ? 209 ARG E CD  1 
ATOM 4746 N NE  . ARG E 1 69  ? 5.771   44.451  36.236  1.00 53.39 ? 209 ARG E NE  1 
ATOM 4747 C CZ  . ARG E 1 69  ? 6.340   44.898  37.350  1.00 52.33 ? 209 ARG E CZ  1 
ATOM 4748 N NH1 . ARG E 1 69  ? 5.733   44.750  38.517  1.00 52.90 ? 209 ARG E NH1 1 
ATOM 4749 N NH2 . ARG E 1 69  ? 7.521   45.496  37.297  1.00 52.05 ? 209 ARG E NH2 1 
ATOM 4750 N N   . ASN E 1 70  ? 2.315   48.768  34.576  1.00 53.34 ? 210 ASN E N   1 
ATOM 4751 C CA  . ASN E 1 70  ? 2.646   50.105  34.088  1.00 54.78 ? 210 ASN E CA  1 
ATOM 4752 C C   . ASN E 1 70  ? 2.006   50.371  32.727  1.00 55.11 ? 210 ASN E C   1 
ATOM 4753 O O   . ASN E 1 70  ? 1.669   49.434  32.002  1.00 54.32 ? 210 ASN E O   1 
ATOM 4754 C CB  . ASN E 1 70  ? 4.174   50.331  34.040  1.00 55.59 ? 210 ASN E CB  1 
ATOM 4755 C CG  . ASN E 1 70  ? 4.885   49.422  33.061  1.00 56.04 ? 210 ASN E CG  1 
ATOM 4756 O OD1 . ASN E 1 70  ? 4.494   49.304  31.901  1.00 57.32 ? 210 ASN E OD1 1 
ATOM 4757 N ND2 . ASN E 1 70  ? 5.956   48.787  33.524  1.00 56.06 ? 210 ASN E ND2 1 
ATOM 4758 N N   . PRO E 1 71  ? 1.831   51.661  32.370  1.00 56.10 ? 211 PRO E N   1 
ATOM 4759 C CA  . PRO E 1 71  ? 1.230   52.139  31.121  1.00 55.73 ? 211 PRO E CA  1 
ATOM 4760 C C   . PRO E 1 71  ? 1.182   51.183  29.934  1.00 55.06 ? 211 PRO E C   1 
ATOM 4761 O O   . PRO E 1 71  ? 0.248   51.251  29.133  1.00 53.98 ? 211 PRO E O   1 
ATOM 4762 C CB  . PRO E 1 71  ? 2.025   53.405  30.836  1.00 56.82 ? 211 PRO E CB  1 
ATOM 4763 C CG  . PRO E 1 71  ? 2.137   53.988  32.202  1.00 56.33 ? 211 PRO E CG  1 
ATOM 4764 C CD  . PRO E 1 71  ? 2.498   52.781  33.067  1.00 56.16 ? 211 PRO E CD  1 
ATOM 4765 N N   . SER E 1 72  ? 2.173   50.302  29.812  1.00 54.27 ? 212 SER E N   1 
ATOM 4766 C CA  . SER E 1 72  ? 2.183   49.349  28.710  1.00 54.56 ? 212 SER E CA  1 
ATOM 4767 C C   . SER E 1 72  ? 1.172   48.246  29.005  1.00 56.21 ? 212 SER E C   1 
ATOM 4768 O O   . SER E 1 72  ? 0.305   47.957  28.177  1.00 57.22 ? 212 SER E O   1 
ATOM 4769 C CB  . SER E 1 72  ? 3.580   48.757  28.518  1.00 51.98 ? 212 SER E CB  1 
ATOM 4770 O OG  . SER E 1 72  ? 4.004   48.061  29.672  1.00 51.76 ? 212 SER E OG  1 
ATOM 4771 N N   . TYR E 1 73  ? 1.283   47.633  30.185  1.00 56.78 ? 213 TYR E N   1 
ATOM 4772 C CA  . TYR E 1 73  ? 0.349   46.581  30.586  1.00 56.88 ? 213 TYR E CA  1 
ATOM 4773 C C   . TYR E 1 73  ? -1.044  47.212  30.626  1.00 56.28 ? 213 TYR E C   1 
ATOM 4774 O O   . TYR E 1 73  ? -1.186  48.379  30.982  1.00 57.83 ? 213 TYR E O   1 
ATOM 4775 C CB  . TYR E 1 73  ? 0.651   46.063  32.001  1.00 57.98 ? 213 TYR E CB  1 
ATOM 4776 C CG  . TYR E 1 73  ? 1.974   45.353  32.236  1.00 59.81 ? 213 TYR E CG  1 
ATOM 4777 C CD1 . TYR E 1 73  ? 3.182   46.053  32.248  1.00 60.77 ? 213 TYR E CD1 1 
ATOM 4778 C CD2 . TYR E 1 73  ? 2.003   43.991  32.545  1.00 59.48 ? 213 TYR E CD2 1 
ATOM 4779 C CE1 . TYR E 1 73  ? 4.388   45.413  32.576  1.00 59.93 ? 213 TYR E CE1 1 
ATOM 4780 C CE2 . TYR E 1 73  ? 3.198   43.345  32.870  1.00 59.77 ? 213 TYR E CE2 1 
ATOM 4781 C CZ  . TYR E 1 73  ? 4.384   44.060  32.888  1.00 59.69 ? 213 TYR E CZ  1 
ATOM 4782 O OH  . TYR E 1 73  ? 5.557   43.428  33.242  1.00 59.71 ? 213 TYR E OH  1 
ATOM 4783 N N   . PRO E 1 74  ? -2.088  46.457  30.252  1.00 54.83 ? 214 PRO E N   1 
ATOM 4784 C CA  . PRO E 1 74  ? -3.446  47.015  30.285  1.00 53.27 ? 214 PRO E CA  1 
ATOM 4785 C C   . PRO E 1 74  ? -4.130  46.721  31.629  1.00 52.45 ? 214 PRO E C   1 
ATOM 4786 O O   . PRO E 1 74  ? -3.661  45.873  32.390  1.00 52.56 ? 214 PRO E O   1 
ATOM 4787 C CB  . PRO E 1 74  ? -4.123  46.312  29.119  1.00 52.75 ? 214 PRO E CB  1 
ATOM 4788 C CG  . PRO E 1 74  ? -3.511  44.947  29.185  1.00 54.26 ? 214 PRO E CG  1 
ATOM 4789 C CD  . PRO E 1 74  ? -2.042  45.241  29.418  1.00 53.93 ? 214 PRO E CD  1 
ATOM 4790 N N   . TRP E 1 75  ? -5.231  47.415  31.919  1.00 51.59 ? 215 TRP E N   1 
ATOM 4791 C CA  . TRP E 1 75  ? -5.950  47.209  33.178  1.00 50.11 ? 215 TRP E CA  1 
ATOM 4792 C C   . TRP E 1 75  ? -6.679  45.877  33.212  1.00 49.53 ? 215 TRP E C   1 
ATOM 4793 O O   . TRP E 1 75  ? -7.460  45.568  32.313  1.00 50.24 ? 215 TRP E O   1 
ATOM 4794 C CB  . TRP E 1 75  ? -6.970  48.323  33.422  1.00 50.04 ? 215 TRP E CB  1 
ATOM 4795 C CG  . TRP E 1 75  ? -6.376  49.683  33.616  1.00 50.81 ? 215 TRP E CG  1 
ATOM 4796 C CD1 . TRP E 1 75  ? -6.339  50.694  32.704  1.00 51.74 ? 215 TRP E CD1 1 
ATOM 4797 C CD2 . TRP E 1 75  ? -5.745  50.188  34.801  1.00 49.78 ? 215 TRP E CD2 1 
ATOM 4798 N NE1 . TRP E 1 75  ? -5.731  51.800  33.245  1.00 52.28 ? 215 TRP E NE1 1 
ATOM 4799 C CE2 . TRP E 1 75  ? -5.357  51.517  34.532  1.00 50.22 ? 215 TRP E CE2 1 
ATOM 4800 C CE3 . TRP E 1 75  ? -5.475  49.648  36.065  1.00 48.93 ? 215 TRP E CE3 1 
ATOM 4801 C CZ2 . TRP E 1 75  ? -4.706  52.316  35.477  1.00 49.87 ? 215 TRP E CZ2 1 
ATOM 4802 C CZ3 . TRP E 1 75  ? -4.826  50.443  37.006  1.00 48.68 ? 215 TRP E CZ3 1 
ATOM 4803 C CH2 . TRP E 1 75  ? -4.453  51.764  36.706  1.00 49.09 ? 215 TRP E CH2 1 
ATOM 4804 N N   . LEU E 1 76  ? -6.430  45.096  34.260  1.00 48.93 ? 216 LEU E N   1 
ATOM 4805 C CA  . LEU E 1 76  ? -7.068  43.792  34.410  1.00 48.44 ? 216 LEU E CA  1 
ATOM 4806 C C   . LEU E 1 76  ? -7.437  43.492  35.854  1.00 48.00 ? 216 LEU E C   1 
ATOM 4807 O O   . LEU E 1 76  ? -6.796  43.986  36.786  1.00 49.31 ? 216 LEU E O   1 
ATOM 4808 C CB  . LEU E 1 76  ? -6.142  42.680  33.911  1.00 48.27 ? 216 LEU E CB  1 
ATOM 4809 C CG  . LEU E 1 76  ? -5.784  42.634  32.427  1.00 48.91 ? 216 LEU E CG  1 
ATOM 4810 C CD1 . LEU E 1 76  ? -4.806  41.493  32.193  1.00 50.42 ? 216 LEU E CD1 1 
ATOM 4811 C CD2 . LEU E 1 76  ? -7.039  42.445  31.587  1.00 46.80 ? 216 LEU E CD2 1 
ATOM 4812 N N   . TRP E 1 77  ? -8.474  42.677  36.033  1.00 46.83 ? 217 TRP E N   1 
ATOM 4813 C CA  . TRP E 1 77  ? -8.896  42.280  37.368  1.00 45.77 ? 217 TRP E CA  1 
ATOM 4814 C C   . TRP E 1 77  ? -8.015  41.108  37.793  1.00 45.71 ? 217 TRP E C   1 
ATOM 4815 O O   . TRP E 1 77  ? -7.251  40.570  36.987  1.00 45.71 ? 217 TRP E O   1 
ATOM 4816 C CB  . TRP E 1 77  ? -10.365 41.851  37.374  1.00 44.08 ? 217 TRP E CB  1 
ATOM 4817 C CG  . TRP E 1 77  ? -11.283 42.862  36.790  1.00 43.01 ? 217 TRP E CG  1 
ATOM 4818 C CD1 . TRP E 1 77  ? -11.812 42.853  35.536  1.00 42.31 ? 217 TRP E CD1 1 
ATOM 4819 C CD2 . TRP E 1 77  ? -11.775 44.049  37.428  1.00 43.16 ? 217 TRP E CD2 1 
ATOM 4820 N NE1 . TRP E 1 77  ? -12.606 43.959  35.349  1.00 43.15 ? 217 TRP E NE1 1 
ATOM 4821 C CE2 . TRP E 1 77  ? -12.600 44.712  36.493  1.00 42.85 ? 217 TRP E CE2 1 
ATOM 4822 C CE3 . TRP E 1 77  ? -11.597 44.619  38.695  1.00 42.48 ? 217 TRP E CE3 1 
ATOM 4823 C CZ2 . TRP E 1 77  ? -13.251 45.917  36.786  1.00 42.79 ? 217 TRP E CZ2 1 
ATOM 4824 C CZ3 . TRP E 1 77  ? -12.246 45.821  38.985  1.00 43.18 ? 217 TRP E CZ3 1 
ATOM 4825 C CH2 . TRP E 1 77  ? -13.061 46.455  38.033  1.00 42.11 ? 217 TRP E CH2 1 
ATOM 4826 N N   . GLU E 1 78  ? -8.118  40.718  39.059  1.00 45.24 ? 218 GLU E N   1 
ATOM 4827 C CA  . GLU E 1 78  ? -7.329  39.614  39.581  1.00 44.51 ? 218 GLU E CA  1 
ATOM 4828 C C   . GLU E 1 78  ? -7.455  38.356  38.723  1.00 45.26 ? 218 GLU E C   1 
ATOM 4829 O O   . GLU E 1 78  ? -6.461  37.692  38.438  1.00 45.42 ? 218 GLU E O   1 
ATOM 4830 C CB  . GLU E 1 78  ? -7.760  39.312  41.015  1.00 44.06 ? 218 GLU E CB  1 
ATOM 4831 C CG  . GLU E 1 78  ? -7.411  40.408  42.005  1.00 44.81 ? 218 GLU E CG  1 
ATOM 4832 C CD  . GLU E 1 78  ? -8.134  40.254  43.333  1.00 46.35 ? 218 GLU E CD  1 
ATOM 4833 O OE1 . GLU E 1 78  ? -9.353  40.530  43.381  1.00 46.75 ? 218 GLU E OE1 1 
ATOM 4834 O OE2 . GLU E 1 78  ? -7.490  39.852  44.326  1.00 44.82 ? 218 GLU E OE2 1 
ATOM 4835 N N   . ASP E 1 79  ? -8.673  38.033  38.300  1.00 45.52 ? 219 ASP E N   1 
ATOM 4836 C CA  . ASP E 1 79  ? -8.895  36.835  37.496  1.00 45.84 ? 219 ASP E CA  1 
ATOM 4837 C C   . ASP E 1 79  ? -8.240  36.885  36.114  1.00 46.66 ? 219 ASP E C   1 
ATOM 4838 O O   . ASP E 1 79  ? -8.033  35.846  35.481  1.00 48.20 ? 219 ASP E O   1 
ATOM 4839 C CB  . ASP E 1 79  ? -10.397 36.572  37.362  1.00 44.01 ? 219 ASP E CB  1 
ATOM 4840 C CG  . ASP E 1 79  ? -11.105 37.645  36.574  1.00 44.37 ? 219 ASP E CG  1 
ATOM 4841 O OD1 . ASP E 1 79  ? -10.618 38.793  36.572  1.00 46.27 ? 219 ASP E OD1 1 
ATOM 4842 O OD2 . ASP E 1 79  ? -12.153 37.347  35.969  1.00 42.62 ? 219 ASP E OD2 1 
ATOM 4843 N N   . GLY E 1 80  ? -7.906  38.085  35.649  1.00 46.70 ? 220 GLY E N   1 
ATOM 4844 C CA  . GLY E 1 80  ? -7.275  38.216  34.349  1.00 45.92 ? 220 GLY E CA  1 
ATOM 4845 C C   . GLY E 1 80  ? -8.178  38.839  33.304  1.00 46.08 ? 220 GLY E C   1 
ATOM 4846 O O   . GLY E 1 80  ? -7.712  39.250  32.243  1.00 46.74 ? 220 GLY E O   1 
ATOM 4847 N N   . SER E 1 81  ? -9.472  38.913  33.601  1.00 45.77 ? 221 SER E N   1 
ATOM 4848 C CA  . SER E 1 81  ? -10.441 39.495  32.680  1.00 46.53 ? 221 SER E CA  1 
ATOM 4849 C C   . SER E 1 81  ? -10.192 40.990  32.502  1.00 47.10 ? 221 SER E C   1 
ATOM 4850 O O   . SER E 1 81  ? -9.844  41.685  33.452  1.00 48.28 ? 221 SER E O   1 
ATOM 4851 C CB  . SER E 1 81  ? -11.859 39.270  33.203  1.00 47.86 ? 221 SER E CB  1 
ATOM 4852 O OG  . SER E 1 81  ? -12.035 39.887  34.464  1.00 49.48 ? 221 SER E OG  1 
ATOM 4853 N N   . PRO E 1 82  ? -10.377 41.505  31.276  1.00 48.08 ? 222 PRO E N   1 
ATOM 4854 C CA  . PRO E 1 82  ? -10.174 42.923  30.948  1.00 47.21 ? 222 PRO E CA  1 
ATOM 4855 C C   . PRO E 1 82  ? -11.243 43.872  31.487  1.00 46.20 ? 222 PRO E C   1 
ATOM 4856 O O   . PRO E 1 82  ? -12.369 43.461  31.768  1.00 45.34 ? 222 PRO E O   1 
ATOM 4857 C CB  . PRO E 1 82  ? -10.133 42.914  29.426  1.00 48.15 ? 222 PRO E CB  1 
ATOM 4858 C CG  . PRO E 1 82  ? -11.118 41.833  29.089  1.00 48.57 ? 222 PRO E CG  1 
ATOM 4859 C CD  . PRO E 1 82  ? -10.753 40.738  30.073  1.00 48.26 ? 222 PRO E CD  1 
ATOM 4860 N N   . LEU E 1 83  ? -10.877 45.145  31.616  1.00 45.66 ? 223 LEU E N   1 
ATOM 4861 C CA  . LEU E 1 83  ? -11.786 46.175  32.115  1.00 45.68 ? 223 LEU E CA  1 
ATOM 4862 C C   . LEU E 1 83  ? -12.858 46.568  31.104  1.00 46.25 ? 223 LEU E C   1 
ATOM 4863 O O   . LEU E 1 83  ? -12.631 47.412  30.240  1.00 45.17 ? 223 LEU E O   1 
ATOM 4864 C CB  . LEU E 1 83  ? -10.996 47.420  32.511  1.00 45.01 ? 223 LEU E CB  1 
ATOM 4865 C CG  . LEU E 1 83  ? -11.843 48.650  32.845  1.00 45.81 ? 223 LEU E CG  1 
ATOM 4866 C CD1 . LEU E 1 83  ? -12.800 48.323  33.981  1.00 45.39 ? 223 LEU E CD1 1 
ATOM 4867 C CD2 . LEU E 1 83  ? -10.939 49.816  33.213  1.00 45.32 ? 223 LEU E CD2 1 
ATOM 4868 N N   . MET E 1 84  ? -14.031 45.960  31.225  1.00 48.74 ? 224 MET E N   1 
ATOM 4869 C CA  . MET E 1 84  ? -15.144 46.242  30.323  1.00 51.84 ? 224 MET E CA  1 
ATOM 4870 C C   . MET E 1 84  ? -15.268 47.749  30.081  1.00 52.27 ? 224 MET E C   1 
ATOM 4871 O O   . MET E 1 84  ? -15.351 48.534  31.025  1.00 52.88 ? 224 MET E O   1 
ATOM 4872 C CB  . MET E 1 84  ? -16.436 45.678  30.923  1.00 54.07 ? 224 MET E CB  1 
ATOM 4873 C CG  . MET E 1 84  ? -17.649 45.706  30.008  1.00 57.09 ? 224 MET E CG  1 
ATOM 4874 S SD  . MET E 1 84  ? -18.860 44.436  30.481  1.00 60.94 ? 224 MET E SD  1 
ATOM 4875 C CE  . MET E 1 84  ? -19.521 45.139  31.983  1.00 61.34 ? 224 MET E CE  1 
ATOM 4876 N N   . PRO E 1 85  ? -15.283 48.167  28.804  1.00 52.73 ? 225 PRO E N   1 
ATOM 4877 C CA  . PRO E 1 85  ? -15.390 49.573  28.398  1.00 52.39 ? 225 PRO E CA  1 
ATOM 4878 C C   . PRO E 1 85  ? -16.683 50.307  28.740  1.00 52.20 ? 225 PRO E C   1 
ATOM 4879 O O   . PRO E 1 85  ? -17.749 49.707  28.895  1.00 50.81 ? 225 PRO E O   1 
ATOM 4880 C CB  . PRO E 1 85  ? -15.154 49.510  26.892  1.00 51.74 ? 225 PRO E CB  1 
ATOM 4881 C CG  . PRO E 1 85  ? -15.750 48.193  26.527  1.00 51.73 ? 225 PRO E CG  1 
ATOM 4882 C CD  . PRO E 1 85  ? -15.216 47.293  27.618  1.00 52.78 ? 225 PRO E CD  1 
ATOM 4883 N N   . HIS E 1 86  ? -16.559 51.625  28.843  1.00 53.75 ? 226 HIS E N   1 
ATOM 4884 C CA  . HIS E 1 86  ? -17.676 52.512  29.141  1.00 55.68 ? 226 HIS E CA  1 
ATOM 4885 C C   . HIS E 1 86  ? -18.326 52.192  30.482  1.00 55.26 ? 226 HIS E C   1 
ATOM 4886 O O   . HIS E 1 86  ? -19.548 52.092  30.584  1.00 56.34 ? 226 HIS E O   1 
ATOM 4887 C CB  . HIS E 1 86  ? -18.716 52.437  28.017  1.00 58.92 ? 226 HIS E CB  1 
ATOM 4888 C CG  . HIS E 1 86  ? -18.123 52.491  26.640  1.00 61.75 ? 226 HIS E CG  1 
ATOM 4889 N ND1 . HIS E 1 86  ? -17.512 53.617  26.130  1.00 62.87 ? 226 HIS E ND1 1 
ATOM 4890 C CD2 . HIS E 1 86  ? -18.018 51.540  25.679  1.00 61.54 ? 226 HIS E CD2 1 
ATOM 4891 C CE1 . HIS E 1 86  ? -17.056 53.358  24.917  1.00 62.52 ? 226 HIS E CE1 1 
ATOM 4892 N NE2 . HIS E 1 86  ? -17.350 52.105  24.621  1.00 62.77 ? 226 HIS E NE2 1 
ATOM 4893 N N   . LEU E 1 87  ? -17.494 52.026  31.507  1.00 54.07 ? 227 LEU E N   1 
ATOM 4894 C CA  . LEU E 1 87  ? -17.967 51.741  32.857  1.00 51.58 ? 227 LEU E CA  1 
ATOM 4895 C C   . LEU E 1 87  ? -17.532 52.882  33.758  1.00 50.52 ? 227 LEU E C   1 
ATOM 4896 O O   . LEU E 1 87  ? -18.317 53.405  34.550  1.00 51.03 ? 227 LEU E O   1 
ATOM 4897 C CB  . LEU E 1 87  ? -17.381 50.425  33.361  1.00 51.80 ? 227 LEU E CB  1 
ATOM 4898 C CG  . LEU E 1 87  ? -18.035 49.168  32.782  1.00 53.42 ? 227 LEU E CG  1 
ATOM 4899 C CD1 . LEU E 1 87  ? -17.286 47.926  33.245  1.00 52.27 ? 227 LEU E CD1 1 
ATOM 4900 C CD2 . LEU E 1 87  ? -19.496 49.115  33.220  1.00 53.77 ? 227 LEU E CD2 1 
ATOM 4901 N N   . PHE E 1 88  ? -16.269 53.266  33.617  1.00 48.03 ? 228 PHE E N   1 
ATOM 4902 C CA  . PHE E 1 88  ? -15.695 54.355  34.390  1.00 47.48 ? 228 PHE E CA  1 
ATOM 4903 C C   . PHE E 1 88  ? -14.318 54.681  33.831  1.00 48.33 ? 228 PHE E C   1 
ATOM 4904 O O   . PHE E 1 88  ? -13.674 53.837  33.211  1.00 48.71 ? 228 PHE E O   1 
ATOM 4905 C CB  . PHE E 1 88  ? -15.598 53.970  35.873  1.00 44.99 ? 228 PHE E CB  1 
ATOM 4906 C CG  . PHE E 1 88  ? -14.823 52.705  36.131  1.00 44.48 ? 228 PHE E CG  1 
ATOM 4907 C CD1 . PHE E 1 88  ? -13.434 52.682  36.016  1.00 44.77 ? 228 PHE E CD1 1 
ATOM 4908 C CD2 . PHE E 1 88  ? -15.483 51.532  36.483  1.00 42.32 ? 228 PHE E CD2 1 
ATOM 4909 C CE1 . PHE E 1 88  ? -12.717 51.509  36.243  1.00 43.03 ? 228 PHE E CE1 1 
ATOM 4910 C CE2 . PHE E 1 88  ? -14.778 50.357  36.711  1.00 40.41 ? 228 PHE E CE2 1 
ATOM 4911 C CZ  . PHE E 1 88  ? -13.392 50.345  36.593  1.00 42.97 ? 228 PHE E CZ  1 
ATOM 4912 N N   . ARG E 1 89  ? -13.879 55.916  34.026  1.00 49.91 ? 229 ARG E N   1 
ATOM 4913 C CA  . ARG E 1 89  ? -12.567 56.333  33.552  1.00 51.63 ? 229 ARG E CA  1 
ATOM 4914 C C   . ARG E 1 89  ? -11.642 56.354  34.762  1.00 51.11 ? 229 ARG E C   1 
ATOM 4915 O O   . ARG E 1 89  ? -12.007 56.879  35.812  1.00 50.97 ? 229 ARG E O   1 
ATOM 4916 C CB  . ARG E 1 89  ? -12.632 57.742  32.954  1.00 55.25 ? 229 ARG E CB  1 
ATOM 4917 C CG  . ARG E 1 89  ? -13.684 57.953  31.873  1.00 60.80 ? 229 ARG E CG  1 
ATOM 4918 C CD  . ARG E 1 89  ? -13.745 59.433  31.496  1.00 64.49 ? 229 ARG E CD  1 
ATOM 4919 N NE  . ARG E 1 89  ? -14.851 59.761  30.599  1.00 66.29 ? 229 ARG E NE  1 
ATOM 4920 C CZ  . ARG E 1 89  ? -14.941 59.359  29.334  1.00 66.50 ? 229 ARG E CZ  1 
ATOM 4921 N NH1 . ARG E 1 89  ? -13.988 58.606  28.801  1.00 66.24 ? 229 ARG E NH1 1 
ATOM 4922 N NH2 . ARG E 1 89  ? -15.986 59.716  28.599  1.00 66.78 ? 229 ARG E NH2 1 
ATOM 4923 N N   . VAL E 1 90  ? -10.456 55.771  34.633  1.00 50.15 ? 230 VAL E N   1 
ATOM 4924 C CA  . VAL E 1 90  ? -9.509  55.781  35.741  1.00 48.97 ? 230 VAL E CA  1 
ATOM 4925 C C   . VAL E 1 90  ? -8.874  57.171  35.754  1.00 49.34 ? 230 VAL E C   1 
ATOM 4926 O O   . VAL E 1 90  ? -8.731  57.799  34.708  1.00 48.81 ? 230 VAL E O   1 
ATOM 4927 C CB  . VAL E 1 90  ? -8.422  54.707  35.555  1.00 47.51 ? 230 VAL E CB  1 
ATOM 4928 C CG1 . VAL E 1 90  ? -7.553  54.618  36.802  1.00 46.29 ? 230 VAL E CG1 1 
ATOM 4929 C CG2 . VAL E 1 90  ? -9.072  53.368  35.259  1.00 45.57 ? 230 VAL E CG2 1 
ATOM 4930 N N   . ARG E 1 91  ? -8.496  57.659  36.931  1.00 50.18 ? 231 ARG E N   1 
ATOM 4931 C CA  . ARG E 1 91  ? -7.912  58.992  37.023  1.00 51.11 ? 231 ARG E CA  1 
ATOM 4932 C C   . ARG E 1 91  ? -6.618  59.081  37.823  1.00 52.45 ? 231 ARG E C   1 
ATOM 4933 O O   . ARG E 1 91  ? -6.273  58.179  38.583  1.00 52.32 ? 231 ARG E O   1 
ATOM 4934 C CB  . ARG E 1 91  ? -8.935  59.959  37.625  1.00 50.67 ? 231 ARG E CB  1 
ATOM 4935 C CG  . ARG E 1 91  ? -10.260 59.995  36.886  1.00 50.92 ? 231 ARG E CG  1 
ATOM 4936 C CD  . ARG E 1 91  ? -11.239 60.959  37.530  1.00 52.79 ? 231 ARG E CD  1 
ATOM 4937 N NE  . ARG E 1 91  ? -12.509 60.985  36.812  1.00 56.78 ? 231 ARG E NE  1 
ATOM 4938 C CZ  . ARG E 1 91  ? -13.302 59.927  36.659  1.00 59.03 ? 231 ARG E CZ  1 
ATOM 4939 N NH1 . ARG E 1 91  ? -12.956 58.754  37.177  1.00 59.88 ? 231 ARG E NH1 1 
ATOM 4940 N NH2 . ARG E 1 91  ? -14.440 60.037  35.983  1.00 60.39 ? 231 ARG E NH2 1 
ATOM 4941 N N   . GLY E 1 92  ? -5.904  60.186  37.630  1.00 54.04 ? 232 GLY E N   1 
ATOM 4942 C CA  . GLY E 1 92  ? -4.666  60.416  38.347  1.00 56.15 ? 232 GLY E CA  1 
ATOM 4943 C C   . GLY E 1 92  ? -3.403  59.828  37.749  1.00 57.23 ? 232 GLY E C   1 
ATOM 4944 O O   . GLY E 1 92  ? -3.064  60.086  36.592  1.00 57.28 ? 232 GLY E O   1 
ATOM 4945 N N   . ALA E 1 93  ? -2.709  59.033  38.559  1.00 57.53 ? 233 ALA E N   1 
ATOM 4946 C CA  . ALA E 1 93  ? -1.457  58.393  38.173  1.00 57.52 ? 233 ALA E CA  1 
ATOM 4947 C C   . ALA E 1 93  ? -1.565  57.460  36.973  1.00 57.69 ? 233 ALA E C   1 
ATOM 4948 O O   . ALA E 1 93  ? -0.757  56.547  36.825  1.00 57.21 ? 233 ALA E O   1 
ATOM 4949 C CB  . ALA E 1 93  ? -0.887  57.631  39.364  1.00 57.13 ? 233 ALA E CB  1 
ATOM 4950 N N   . VAL E 1 94  ? -2.552  57.691  36.116  1.00 58.21 ? 234 VAL E N   1 
ATOM 4951 C CA  . VAL E 1 94  ? -2.741  56.857  34.935  1.00 58.97 ? 234 VAL E CA  1 
ATOM 4952 C C   . VAL E 1 94  ? -1.575  56.993  33.963  1.00 59.92 ? 234 VAL E C   1 
ATOM 4953 O O   . VAL E 1 94  ? -1.699  56.661  32.783  1.00 61.71 ? 234 VAL E O   1 
ATOM 4954 C CB  . VAL E 1 94  ? -4.033  57.240  34.193  1.00 58.89 ? 234 VAL E CB  1 
ATOM 4955 C CG1 . VAL E 1 94  ? -5.230  57.034  35.103  1.00 58.56 ? 234 VAL E CG1 1 
ATOM 4956 C CG2 . VAL E 1 94  ? -3.956  58.688  33.729  1.00 59.19 ? 234 VAL E CG2 1 
ATOM 4957 N N   . SER E 1 95  ? -0.442  57.473  34.464  1.00 59.80 ? 235 SER E N   1 
ATOM 4958 C CA  . SER E 1 95  ? 0.738   57.669  33.634  1.00 58.76 ? 235 SER E CA  1 
ATOM 4959 C C   . SER E 1 95  ? 2.007   57.126  34.278  1.00 58.73 ? 235 SER E C   1 
ATOM 4960 O O   . SER E 1 95  ? 2.779   56.413  33.639  1.00 58.28 ? 235 SER E O   1 
ATOM 4961 C CB  . SER E 1 95  ? 0.906   59.162  33.341  1.00 59.09 ? 235 SER E CB  1 
ATOM 4962 O OG  . SER E 1 95  ? 0.823   59.927  34.535  1.00 56.54 ? 235 SER E OG  1 
ATOM 4963 N N   . GLN E 1 96  ? 2.218   57.467  35.545  1.00 59.80 ? 236 GLN E N   1 
ATOM 4964 C CA  . GLN E 1 96  ? 3.401   57.031  36.284  1.00 60.70 ? 236 GLN E CA  1 
ATOM 4965 C C   . GLN E 1 96  ? 3.619   55.514  36.324  1.00 60.69 ? 236 GLN E C   1 
ATOM 4966 O O   . GLN E 1 96  ? 2.668   54.731  36.291  1.00 60.51 ? 236 GLN E O   1 
ATOM 4967 C CB  . GLN E 1 96  ? 3.350   57.559  37.724  1.00 61.29 ? 236 GLN E CB  1 
ATOM 4968 C CG  . GLN E 1 96  ? 3.784   59.009  37.914  1.00 62.50 ? 236 GLN E CG  1 
ATOM 4969 C CD  . GLN E 1 96  ? 2.846   60.008  37.265  1.00 64.43 ? 236 GLN E CD  1 
ATOM 4970 O OE1 . GLN E 1 96  ? 1.630   59.945  37.445  1.00 65.36 ? 236 GLN E OE1 1 
ATOM 4971 N NE2 . GLN E 1 96  ? 3.411   60.949  36.517  1.00 65.09 ? 236 GLN E NE2 1 
ATOM 4972 N N   . THR E 1 97  ? 4.887   55.117  36.398  1.00 60.20 ? 237 THR E N   1 
ATOM 4973 C CA  . THR E 1 97  ? 5.274   53.710  36.477  1.00 60.02 ? 237 THR E CA  1 
ATOM 4974 C C   . THR E 1 97  ? 5.917   53.470  37.836  1.00 60.09 ? 237 THR E C   1 
ATOM 4975 O O   . THR E 1 97  ? 6.993   53.988  38.115  1.00 61.39 ? 237 THR E O   1 
ATOM 4976 C CB  . THR E 1 97  ? 6.309   53.332  35.398  1.00 59.55 ? 237 THR E CB  1 
ATOM 4977 O OG1 . THR E 1 97  ? 5.669   53.254  34.121  1.00 60.09 ? 237 THR E OG1 1 
ATOM 4978 C CG2 . THR E 1 97  ? 6.947   51.992  35.723  1.00 59.56 ? 237 THR E CG2 1 
ATOM 4979 N N   . TYR E 1 98  ? 5.262   52.684  38.679  1.00 59.87 ? 238 TYR E N   1 
ATOM 4980 C CA  . TYR E 1 98  ? 5.799   52.402  40.003  1.00 59.48 ? 238 TYR E CA  1 
ATOM 4981 C C   . TYR E 1 98  ? 6.391   50.998  40.044  1.00 59.54 ? 238 TYR E C   1 
ATOM 4982 O O   . TYR E 1 98  ? 5.984   50.124  39.280  1.00 59.95 ? 238 TYR E O   1 
ATOM 4983 C CB  . TYR E 1 98  ? 4.700   52.535  41.060  1.00 59.42 ? 238 TYR E CB  1 
ATOM 4984 C CG  . TYR E 1 98  ? 3.947   53.848  41.008  1.00 58.81 ? 238 TYR E CG  1 
ATOM 4985 C CD1 . TYR E 1 98  ? 2.598   53.886  40.658  1.00 58.86 ? 238 TYR E CD1 1 
ATOM 4986 C CD2 . TYR E 1 98  ? 4.581   55.053  41.310  1.00 57.81 ? 238 TYR E CD2 1 
ATOM 4987 C CE1 . TYR E 1 98  ? 1.897   55.091  40.612  1.00 58.49 ? 238 TYR E CE1 1 
ATOM 4988 C CE2 . TYR E 1 98  ? 3.890   56.261  41.267  1.00 57.08 ? 238 TYR E CE2 1 
ATOM 4989 C CZ  . TYR E 1 98  ? 2.548   56.271  40.920  1.00 57.12 ? 238 TYR E CZ  1 
ATOM 4990 O OH  . TYR E 1 98  ? 1.851   57.453  40.896  1.00 56.86 ? 238 TYR E OH  1 
ATOM 4991 N N   . PRO E 1 99  ? 7.369   50.768  40.934  1.00 59.40 ? 239 PRO E N   1 
ATOM 4992 C CA  . PRO E 1 99  ? 8.025   49.462  41.076  1.00 58.72 ? 239 PRO E CA  1 
ATOM 4993 C C   . PRO E 1 99  ? 7.054   48.352  41.464  1.00 58.22 ? 239 PRO E C   1 
ATOM 4994 O O   . PRO E 1 99  ? 7.198   47.204  41.043  1.00 57.05 ? 239 PRO E O   1 
ATOM 4995 C CB  . PRO E 1 99  ? 9.060   49.716  42.167  1.00 58.92 ? 239 PRO E CB  1 
ATOM 4996 C CG  . PRO E 1 99  ? 9.397   51.159  41.980  1.00 58.81 ? 239 PRO E CG  1 
ATOM 4997 C CD  . PRO E 1 99  ? 8.038   51.777  41.772  1.00 59.46 ? 239 PRO E CD  1 
ATOM 4998 N N   . SER E 1 100 ? 6.068   48.710  42.277  1.00 58.39 ? 240 SER E N   1 
ATOM 4999 C CA  . SER E 1 100 ? 5.069   47.760  42.745  1.00 58.01 ? 240 SER E CA  1 
ATOM 5000 C C   . SER E 1 100 ? 3.825   47.698  41.854  1.00 56.96 ? 240 SER E C   1 
ATOM 5001 O O   . SER E 1 100 ? 2.859   47.007  42.176  1.00 56.84 ? 240 SER E O   1 
ATOM 5002 C CB  . SER E 1 100 ? 4.668   48.115  44.176  1.00 58.44 ? 240 SER E CB  1 
ATOM 5003 O OG  . SER E 1 100 ? 4.412   49.506  44.290  1.00 60.59 ? 240 SER E OG  1 
ATOM 5004 N N   . GLY E 1 101 ? 3.854   48.415  40.735  1.00 55.54 ? 241 GLY E N   1 
ATOM 5005 C CA  . GLY E 1 101 ? 2.718   48.414  39.830  1.00 53.73 ? 241 GLY E CA  1 
ATOM 5006 C C   . GLY E 1 101 ? 1.715   49.508  40.139  1.00 52.96 ? 241 GLY E C   1 
ATOM 5007 O O   . GLY E 1 101 ? 1.846   50.221  41.139  1.00 51.19 ? 241 GLY E O   1 
ATOM 5008 N N   . THR E 1 102 ? 0.712   49.645  39.276  1.00 51.62 ? 242 THR E N   1 
ATOM 5009 C CA  . THR E 1 102 ? -0.320  50.654  39.467  1.00 50.17 ? 242 THR E CA  1 
ATOM 5010 C C   . THR E 1 102 ? -1.654  49.991  39.781  1.00 49.28 ? 242 THR E C   1 
ATOM 5011 O O   . THR E 1 102 ? -2.128  49.138  39.030  1.00 50.04 ? 242 THR E O   1 
ATOM 5012 C CB  . THR E 1 102 ? -0.488  51.525  38.215  1.00 49.78 ? 242 THR E CB  1 
ATOM 5013 O OG1 . THR E 1 102 ? 0.782   52.064  37.841  1.00 51.53 ? 242 THR E OG1 1 
ATOM 5014 C CG2 . THR E 1 102 ? -1.448  52.674  38.490  1.00 49.62 ? 242 THR E CG2 1 
ATOM 5015 N N   . CYS E 1 103 ? -2.255  50.385  40.897  1.00 47.53 ? 243 CYS E N   1 
ATOM 5016 C CA  . CYS E 1 103 ? -3.532  49.825  41.304  1.00 45.60 ? 243 CYS E CA  1 
ATOM 5017 C C   . CYS E 1 103 ? -4.608  50.900  41.324  1.00 44.83 ? 243 CYS E C   1 
ATOM 5018 O O   . CYS E 1 103 ? -4.303  52.083  41.460  1.00 43.41 ? 243 CYS E O   1 
ATOM 5019 C CB  . CYS E 1 103 ? -3.377  49.158  42.667  1.00 45.37 ? 243 CYS E CB  1 
ATOM 5020 S SG  . CYS E 1 103 ? -2.321  47.685  42.534  1.00 43.87 ? 243 CYS E SG  1 
ATOM 5021 N N   . ALA E 1 104 ? -5.864  50.487  41.169  1.00 44.54 ? 244 ALA E N   1 
ATOM 5022 C CA  . ALA E 1 104 ? -6.976  51.431  41.141  1.00 44.14 ? 244 ALA E CA  1 
ATOM 5023 C C   . ALA E 1 104 ? -7.890  51.347  42.358  1.00 44.42 ? 244 ALA E C   1 
ATOM 5024 O O   . ALA E 1 104 ? -8.201  50.263  42.854  1.00 43.66 ? 244 ALA E O   1 
ATOM 5025 C CB  . ALA E 1 104 ? -7.792  51.229  39.868  1.00 43.05 ? 244 ALA E CB  1 
ATOM 5026 N N   . TYR E 1 105 ? -8.317  52.509  42.836  1.00 44.97 ? 245 TYR E N   1 
ATOM 5027 C CA  . TYR E 1 105 ? -9.208  52.574  43.982  1.00 45.93 ? 245 TYR E CA  1 
ATOM 5028 C C   . TYR E 1 105 ? -10.375 53.492  43.669  1.00 46.62 ? 245 TYR E C   1 
ATOM 5029 O O   . TYR E 1 105 ? -10.311 54.302  42.744  1.00 45.65 ? 245 TYR E O   1 
ATOM 5030 C CB  . TYR E 1 105 ? -8.464  53.080  45.234  1.00 45.16 ? 245 TYR E CB  1 
ATOM 5031 C CG  . TYR E 1 105 ? -7.946  54.509  45.177  1.00 44.74 ? 245 TYR E CG  1 
ATOM 5032 C CD1 . TYR E 1 105 ? -8.803  55.583  44.928  1.00 44.62 ? 245 TYR E CD1 1 
ATOM 5033 C CD2 . TYR E 1 105 ? -6.597  54.789  45.396  1.00 45.32 ? 245 TYR E CD2 1 
ATOM 5034 C CE1 . TYR E 1 105 ? -8.332  56.901  44.896  1.00 43.97 ? 245 TYR E CE1 1 
ATOM 5035 C CE2 . TYR E 1 105 ? -6.115  56.103  45.367  1.00 45.59 ? 245 TYR E CE2 1 
ATOM 5036 C CZ  . TYR E 1 105 ? -6.988  57.153  45.117  1.00 45.10 ? 245 TYR E CZ  1 
ATOM 5037 O OH  . TYR E 1 105 ? -6.518  58.449  45.090  1.00 44.05 ? 245 TYR E OH  1 
ATOM 5038 N N   . ILE E 1 106 ? -11.446 53.351  44.439  1.00 48.14 ? 246 ILE E N   1 
ATOM 5039 C CA  . ILE E 1 106 ? -12.615 54.194  44.260  1.00 48.98 ? 246 ILE E CA  1 
ATOM 5040 C C   . ILE E 1 106 ? -12.753 55.083  45.493  1.00 49.36 ? 246 ILE E C   1 
ATOM 5041 O O   . ILE E 1 106 ? -12.579 54.629  46.623  1.00 48.00 ? 246 ILE E O   1 
ATOM 5042 C CB  . ILE E 1 106 ? -13.889 53.354  44.058  1.00 48.21 ? 246 ILE E CB  1 
ATOM 5043 C CG1 . ILE E 1 106 ? -15.110 54.271  44.016  1.00 49.04 ? 246 ILE E CG1 1 
ATOM 5044 C CG2 . ILE E 1 106 ? -14.005 52.322  45.156  1.00 47.26 ? 246 ILE E CG2 1 
ATOM 5045 C CD1 . ILE E 1 106 ? -16.312 53.656  43.340  1.00 50.92 ? 246 ILE E CD1 1 
ATOM 5046 N N   . GLN E 1 107 ? -13.037 56.358  45.258  1.00 50.85 ? 247 GLN E N   1 
ATOM 5047 C CA  . GLN E 1 107 ? -13.181 57.338  46.326  1.00 53.48 ? 247 GLN E CA  1 
ATOM 5048 C C   . GLN E 1 107 ? -13.720 58.618  45.708  1.00 55.34 ? 247 GLN E C   1 
ATOM 5049 O O   . GLN E 1 107 ? -13.434 58.920  44.550  1.00 55.03 ? 247 GLN E O   1 
ATOM 5050 C CB  . GLN E 1 107 ? -11.820 57.611  46.971  1.00 53.28 ? 247 GLN E CB  1 
ATOM 5051 C CG  . GLN E 1 107 ? -11.838 58.652  48.075  1.00 53.63 ? 247 GLN E CG  1 
ATOM 5052 C CD  . GLN E 1 107 ? -10.614 59.538  48.034  1.00 55.34 ? 247 GLN E CD  1 
ATOM 5053 O OE1 . GLN E 1 107 ? -10.453 60.349  47.120  1.00 57.49 ? 247 GLN E OE1 1 
ATOM 5054 N NE2 . GLN E 1 107 ? -9.737  59.384  49.017  1.00 55.53 ? 247 GLN E NE2 1 
ATOM 5055 N N   . ARG E 1 108 ? -14.497 59.369  46.479  1.00 58.32 ? 248 ARG E N   1 
ATOM 5056 C CA  . ARG E 1 108 ? -15.071 60.617  45.991  1.00 60.63 ? 248 ARG E CA  1 
ATOM 5057 C C   . ARG E 1 108 ? -15.919 60.358  44.746  1.00 59.99 ? 248 ARG E C   1 
ATOM 5058 O O   . ARG E 1 108 ? -16.154 61.264  43.942  1.00 59.96 ? 248 ARG E O   1 
ATOM 5059 C CB  . ARG E 1 108 ? -13.959 61.629  45.667  1.00 63.41 ? 248 ARG E CB  1 
ATOM 5060 C CG  . ARG E 1 108 ? -13.043 61.949  46.848  1.00 66.37 ? 248 ARG E CG  1 
ATOM 5061 C CD  . ARG E 1 108 ? -13.826 62.531  48.015  1.00 68.90 ? 248 ARG E CD  1 
ATOM 5062 N NE  . ARG E 1 108 ? -14.247 63.909  47.775  1.00 73.10 ? 248 ARG E NE  1 
ATOM 5063 C CZ  . ARG E 1 108 ? -15.088 64.583  48.558  1.00 75.36 ? 248 ARG E CZ  1 
ATOM 5064 N NH1 . ARG E 1 108 ? -15.607 64.002  49.633  1.00 75.66 ? 248 ARG E NH1 1 
ATOM 5065 N NH2 . ARG E 1 108 ? -15.403 65.842  48.275  1.00 76.15 ? 248 ARG E NH2 1 
ATOM 5066 N N   . GLY E 1 109 ? -16.368 59.114  44.590  1.00 58.36 ? 249 GLY E N   1 
ATOM 5067 C CA  . GLY E 1 109 ? -17.195 58.762  43.450  1.00 56.33 ? 249 GLY E CA  1 
ATOM 5068 C C   . GLY E 1 109 ? -16.451 58.174  42.265  1.00 55.07 ? 249 GLY E C   1 
ATOM 5069 O O   . GLY E 1 109 ? -16.887 57.176  41.692  1.00 55.99 ? 249 GLY E O   1 
ATOM 5070 N N   . ALA E 1 110 ? -15.330 58.783  41.894  1.00 52.64 ? 250 ALA E N   1 
ATOM 5071 C CA  . ALA E 1 110 ? -14.546 58.305  40.761  1.00 50.06 ? 250 ALA E CA  1 
ATOM 5072 C C   . ALA E 1 110 ? -13.556 57.202  41.129  1.00 49.06 ? 250 ALA E C   1 
ATOM 5073 O O   . ALA E 1 110 ? -13.453 56.797  42.284  1.00 49.87 ? 250 ALA E O   1 
ATOM 5074 C CB  . ALA E 1 110 ? -13.804 59.470  40.125  1.00 48.28 ? 250 ALA E CB  1 
ATOM 5075 N N   . VAL E 1 111 ? -12.835 56.722  40.121  1.00 47.57 ? 251 VAL E N   1 
ATOM 5076 C CA  . VAL E 1 111 ? -11.826 55.680  40.284  1.00 45.02 ? 251 VAL E CA  1 
ATOM 5077 C C   . VAL E 1 111 ? -10.479 56.312  39.937  1.00 45.46 ? 251 VAL E C   1 
ATOM 5078 O O   . VAL E 1 111 ? -10.354 56.981  38.911  1.00 46.17 ? 251 VAL E O   1 
ATOM 5079 C CB  . VAL E 1 111 ? -12.086 54.502  39.317  1.00 43.23 ? 251 VAL E CB  1 
ATOM 5080 C CG1 . VAL E 1 111 ? -11.044 53.424  39.516  1.00 42.19 ? 251 VAL E CG1 1 
ATOM 5081 C CG2 . VAL E 1 111 ? -13.476 53.947  39.535  1.00 40.77 ? 251 VAL E CG2 1 
ATOM 5082 N N   . TYR E 1 112 ? -9.474  56.110  40.782  1.00 45.41 ? 252 TYR E N   1 
ATOM 5083 C CA  . TYR E 1 112 ? -8.158  56.691  40.529  1.00 46.03 ? 252 TYR E CA  1 
ATOM 5084 C C   . TYR E 1 112 ? -7.027  55.665  40.519  1.00 46.58 ? 252 TYR E C   1 
ATOM 5085 O O   . TYR E 1 112 ? -7.045  54.692  41.276  1.00 47.28 ? 252 TYR E O   1 
ATOM 5086 C CB  . TYR E 1 112 ? -7.824  57.752  41.583  1.00 46.94 ? 252 TYR E CB  1 
ATOM 5087 C CG  . TYR E 1 112 ? -8.904  58.784  41.831  1.00 48.83 ? 252 TYR E CG  1 
ATOM 5088 C CD1 . TYR E 1 112 ? -10.070 58.453  42.524  1.00 49.17 ? 252 TYR E CD1 1 
ATOM 5089 C CD2 . TYR E 1 112 ? -8.747  60.102  41.400  1.00 48.35 ? 252 TYR E CD2 1 
ATOM 5090 C CE1 . TYR E 1 112 ? -11.050 59.410  42.784  1.00 49.75 ? 252 TYR E CE1 1 
ATOM 5091 C CE2 . TYR E 1 112 ? -9.718  61.064  41.653  1.00 48.52 ? 252 TYR E CE2 1 
ATOM 5092 C CZ  . TYR E 1 112 ? -10.866 60.713  42.346  1.00 50.22 ? 252 TYR E CZ  1 
ATOM 5093 O OH  . TYR E 1 112 ? -11.827 61.662  42.612  1.00 50.42 ? 252 TYR E OH  1 
ATOM 5094 N N   . ALA E 1 113 ? -6.045  55.890  39.653  1.00 46.33 ? 253 ALA E N   1 
ATOM 5095 C CA  . ALA E 1 113 ? -4.884  55.016  39.572  1.00 46.13 ? 253 ALA E CA  1 
ATOM 5096 C C   . ALA E 1 113 ? -3.929  55.506  40.658  1.00 45.98 ? 253 ALA E C   1 
ATOM 5097 O O   . ALA E 1 113 ? -3.803  56.712  40.890  1.00 46.41 ? 253 ALA E O   1 
ATOM 5098 C CB  . ALA E 1 113 ? -4.235  55.125  38.204  1.00 46.40 ? 253 ALA E CB  1 
ATOM 5099 N N   . GLU E 1 114 ? -3.255  54.578  41.323  1.00 45.03 ? 254 GLU E N   1 
ATOM 5100 C CA  . GLU E 1 114 ? -2.350  54.951  42.400  1.00 44.99 ? 254 GLU E CA  1 
ATOM 5101 C C   . GLU E 1 114 ? -1.239  53.922  42.547  1.00 44.73 ? 254 GLU E C   1 
ATOM 5102 O O   . GLU E 1 114 ? -1.287  52.850  41.947  1.00 45.11 ? 254 GLU E O   1 
ATOM 5103 C CB  . GLU E 1 114 ? -3.152  55.053  43.704  1.00 44.92 ? 254 GLU E CB  1 
ATOM 5104 C CG  . GLU E 1 114 ? -2.416  55.629  44.902  1.00 46.90 ? 254 GLU E CG  1 
ATOM 5105 C CD  . GLU E 1 114 ? -1.990  57.071  44.696  1.00 49.61 ? 254 GLU E CD  1 
ATOM 5106 O OE1 . GLU E 1 114 ? -0.850  57.294  44.237  1.00 52.21 ? 254 GLU E OE1 1 
ATOM 5107 O OE2 . GLU E 1 114 ? -2.799  57.981  44.984  1.00 49.85 ? 254 GLU E OE2 1 
ATOM 5108 N N   . ASN E 1 115 ? -0.229  54.261  43.339  1.00 44.10 ? 255 ASN E N   1 
ATOM 5109 C CA  . ASN E 1 115 ? 0.875   53.350  43.585  1.00 42.73 ? 255 ASN E CA  1 
ATOM 5110 C C   . ASN E 1 115 ? 0.268   52.182  44.352  1.00 43.11 ? 255 ASN E C   1 
ATOM 5111 O O   . ASN E 1 115 ? -0.521  52.391  45.278  1.00 42.85 ? 255 ASN E O   1 
ATOM 5112 C CB  . ASN E 1 115 ? 1.937   54.033  44.445  1.00 42.10 ? 255 ASN E CB  1 
ATOM 5113 C CG  . ASN E 1 115 ? 3.225   53.248  44.506  1.00 42.30 ? 255 ASN E CG  1 
ATOM 5114 O OD1 . ASN E 1 115 ? 3.218   52.024  44.647  1.00 42.03 ? 255 ASN E OD1 1 
ATOM 5115 N ND2 . ASN E 1 115 ? 4.345   53.949  44.406  1.00 42.94 ? 255 ASN E ND2 1 
ATOM 5116 N N   . CYS E 1 116 ? 0.626   50.956  43.980  1.00 43.39 ? 256 CYS E N   1 
ATOM 5117 C CA  . CYS E 1 116 ? 0.069   49.796  44.661  1.00 42.47 ? 256 CYS E CA  1 
ATOM 5118 C C   . CYS E 1 116 ? 0.575   49.623  46.090  1.00 42.12 ? 256 CYS E C   1 
ATOM 5119 O O   . CYS E 1 116 ? -0.082  48.962  46.890  1.00 43.85 ? 256 CYS E O   1 
ATOM 5120 C CB  . CYS E 1 116 ? 0.328   48.515  43.868  1.00 42.38 ? 256 CYS E CB  1 
ATOM 5121 S SG  . CYS E 1 116 ? -0.460  48.434  42.223  1.00 42.87 ? 256 CYS E SG  1 
ATOM 5122 N N   . ILE E 1 117 ? 1.726   50.204  46.428  1.00 40.68 ? 257 ILE E N   1 
ATOM 5123 C CA  . ILE E 1 117 ? 2.232   50.064  47.793  1.00 38.84 ? 257 ILE E CA  1 
ATOM 5124 C C   . ILE E 1 117 ? 1.538   51.004  48.755  1.00 37.93 ? 257 ILE E C   1 
ATOM 5125 O O   . ILE E 1 117 ? 1.608   50.808  49.962  1.00 40.10 ? 257 ILE E O   1 
ATOM 5126 C CB  . ILE E 1 117 ? 3.754   50.307  47.907  1.00 37.54 ? 257 ILE E CB  1 
ATOM 5127 C CG1 . ILE E 1 117 ? 4.150   51.555  47.126  1.00 39.54 ? 257 ILE E CG1 1 
ATOM 5128 C CG2 . ILE E 1 117 ? 4.508   49.078  47.451  1.00 36.58 ? 257 ILE E CG2 1 
ATOM 5129 C CD1 . ILE E 1 117 ? 5.613   51.934  47.263  1.00 42.14 ? 257 ILE E CD1 1 
ATOM 5130 N N   . LEU E 1 118 ? 0.876   52.029  48.233  1.00 37.27 ? 258 LEU E N   1 
ATOM 5131 C CA  . LEU E 1 118 ? 0.171   52.956  49.104  1.00 38.19 ? 258 LEU E CA  1 
ATOM 5132 C C   . LEU E 1 118 ? -0.933  52.179  49.803  1.00 37.56 ? 258 LEU E C   1 
ATOM 5133 O O   . LEU E 1 118 ? -1.483  51.233  49.245  1.00 38.69 ? 258 LEU E O   1 
ATOM 5134 C CB  . LEU E 1 118 ? -0.398  54.133  48.299  1.00 41.25 ? 258 LEU E CB  1 
ATOM 5135 C CG  . LEU E 1 118 ? 0.652   55.136  47.787  1.00 42.77 ? 258 LEU E CG  1 
ATOM 5136 C CD1 . LEU E 1 118 ? -0.014  56.212  46.948  1.00 40.01 ? 258 LEU E CD1 1 
ATOM 5137 C CD2 . LEU E 1 118 ? 1.391   55.772  48.968  1.00 42.71 ? 258 LEU E CD2 1 
ATOM 5138 N N   . ALA E 1 119 ? -1.243  52.568  51.032  1.00 36.90 ? 259 ALA E N   1 
ATOM 5139 C CA  . ALA E 1 119 ? -2.263  51.876  51.807  1.00 36.34 ? 259 ALA E CA  1 
ATOM 5140 C C   . ALA E 1 119 ? -3.657  52.469  51.650  1.00 36.05 ? 259 ALA E C   1 
ATOM 5141 O O   . ALA E 1 119 ? -3.822  53.650  51.336  1.00 36.36 ? 259 ALA E O   1 
ATOM 5142 C CB  . ALA E 1 119 ? -1.873  51.863  53.275  1.00 36.17 ? 259 ALA E CB  1 
ATOM 5143 N N   . ALA E 1 120 ? -4.662  51.632  51.875  1.00 35.44 ? 260 ALA E N   1 
ATOM 5144 C CA  . ALA E 1 120 ? -6.049  52.057  51.775  1.00 35.25 ? 260 ALA E CA  1 
ATOM 5145 C C   . ALA E 1 120 ? -6.956  50.919  52.194  1.00 34.71 ? 260 ALA E C   1 
ATOM 5146 O O   . ALA E 1 120 ? -6.522  49.776  52.310  1.00 33.48 ? 260 ALA E O   1 
ATOM 5147 C CB  . ALA E 1 120 ? -6.369  52.469  50.348  1.00 34.63 ? 260 ALA E CB  1 
ATOM 5148 N N   . PHE E 1 121 ? -8.218  51.240  52.444  1.00 35.88 ? 261 PHE E N   1 
ATOM 5149 C CA  . PHE E 1 121 ? -9.172  50.205  52.799  1.00 37.16 ? 261 PHE E CA  1 
ATOM 5150 C C   . PHE E 1 121 ? -9.480  49.501  51.482  1.00 35.63 ? 261 PHE E C   1 
ATOM 5151 O O   . PHE E 1 121 ? -9.158  50.009  50.407  1.00 34.44 ? 261 PHE E O   1 
ATOM 5152 C CB  . PHE E 1 121 ? -10.458 50.802  53.381  1.00 38.04 ? 261 PHE E CB  1 
ATOM 5153 C CG  . PHE E 1 121 ? -10.231 51.702  54.557  1.00 39.55 ? 261 PHE E CG  1 
ATOM 5154 C CD1 . PHE E 1 121 ? -10.089 53.074  54.384  1.00 40.77 ? 261 PHE E CD1 1 
ATOM 5155 C CD2 . PHE E 1 121 ? -10.147 51.180  55.839  1.00 40.26 ? 261 PHE E CD2 1 
ATOM 5156 C CE1 . PHE E 1 121 ? -9.871  53.912  55.476  1.00 40.13 ? 261 PHE E CE1 1 
ATOM 5157 C CE2 . PHE E 1 121 ? -9.928  52.012  56.933  1.00 40.58 ? 261 PHE E CE2 1 
ATOM 5158 C CZ  . PHE E 1 121 ? -9.790  53.378  56.750  1.00 39.69 ? 261 PHE E CZ  1 
ATOM 5159 N N   . SER E 1 122 ? -10.100 48.336  51.559  1.00 33.21 ? 262 SER E N   1 
ATOM 5160 C CA  . SER E 1 122 ? -10.421 47.601  50.356  1.00 32.81 ? 262 SER E CA  1 
ATOM 5161 C C   . SER E 1 122 ? -11.815 47.030  50.462  1.00 34.08 ? 262 SER E C   1 
ATOM 5162 O O   . SER E 1 122 ? -12.434 47.078  51.521  1.00 36.98 ? 262 SER E O   1 
ATOM 5163 C CB  . SER E 1 122 ? -9.403  46.481  50.150  1.00 31.57 ? 262 SER E CB  1 
ATOM 5164 O OG  . SER E 1 122 ? -9.210  45.748  51.344  1.00 31.02 ? 262 SER E OG  1 
ATOM 5165 N N   . ILE E 1 123 ? -12.312 46.500  49.354  1.00 33.36 ? 263 ILE E N   1 
ATOM 5166 C CA  . ILE E 1 123 ? -13.634 45.905  49.330  1.00 33.05 ? 263 ILE E CA  1 
ATOM 5167 C C   . ILE E 1 123 ? -13.519 44.507  48.759  1.00 34.80 ? 263 ILE E C   1 
ATOM 5168 O O   . ILE E 1 123 ? -12.921 44.303  47.704  1.00 36.81 ? 263 ILE E O   1 
ATOM 5169 C CB  . ILE E 1 123 ? -14.610 46.720  48.459  1.00 33.05 ? 263 ILE E CB  1 
ATOM 5170 C CG1 . ILE E 1 123 ? -14.793 48.116  49.058  1.00 33.01 ? 263 ILE E CG1 1 
ATOM 5171 C CG2 . ILE E 1 123 ? -15.948 46.001  48.361  1.00 31.83 ? 263 ILE E CG2 1 
ATOM 5172 C CD1 . ILE E 1 123 ? -15.746 48.998  48.290  1.00 31.84 ? 263 ILE E CD1 1 
ATOM 5173 N N   . CYS E 1 124 ? -14.077 43.541  49.476  1.00 35.73 ? 264 CYS E N   1 
ATOM 5174 C CA  . CYS E 1 124 ? -14.057 42.158  49.032  1.00 33.97 ? 264 CYS E CA  1 
ATOM 5175 C C   . CYS E 1 124 ? -15.469 41.758  48.640  1.00 34.20 ? 264 CYS E C   1 
ATOM 5176 O O   . CYS E 1 124 ? -16.451 42.303  49.154  1.00 33.62 ? 264 CYS E O   1 
ATOM 5177 C CB  . CYS E 1 124 ? -13.592 41.227  50.146  1.00 33.01 ? 264 CYS E CB  1 
ATOM 5178 S SG  . CYS E 1 124 ? -11.990 41.611  50.912  1.00 34.42 ? 264 CYS E SG  1 
ATOM 5179 N N   . GLN E 1 125 ? -15.568 40.806  47.725  1.00 33.26 ? 265 GLN E N   1 
ATOM 5180 C CA  . GLN E 1 125 ? -16.862 40.320  47.296  1.00 33.26 ? 265 GLN E CA  1 
ATOM 5181 C C   . GLN E 1 125 ? -16.740 38.836  47.019  1.00 33.55 ? 265 GLN E C   1 
ATOM 5182 O O   . GLN E 1 125 ? -15.638 38.318  46.840  1.00 32.61 ? 265 GLN E O   1 
ATOM 5183 C CB  . GLN E 1 125 ? -17.333 41.054  46.034  1.00 35.03 ? 265 GLN E CB  1 
ATOM 5184 C CG  . GLN E 1 125 ? -16.597 40.695  44.750  1.00 36.32 ? 265 GLN E CG  1 
ATOM 5185 C CD  . GLN E 1 125 ? -17.152 41.433  43.541  1.00 38.76 ? 265 GLN E CD  1 
ATOM 5186 O OE1 . GLN E 1 125 ? -17.016 42.653  43.427  1.00 41.74 ? 265 GLN E OE1 1 
ATOM 5187 N NE2 . GLN E 1 125 ? -17.788 40.697  42.636  1.00 38.18 ? 265 GLN E NE2 1 
ATOM 5188 N N   . LYS E 1 126 ? -17.877 38.155  47.013  1.00 33.58 ? 266 LYS E N   1 
ATOM 5189 C CA  . LYS E 1 126 ? -17.923 36.732  46.730  1.00 33.97 ? 266 LYS E CA  1 
ATOM 5190 C C   . LYS E 1 126 ? -19.366 36.360  46.477  1.00 36.51 ? 266 LYS E C   1 
ATOM 5191 O O   . LYS E 1 126 ? -20.273 37.071  46.903  1.00 39.24 ? 266 LYS E O   1 
ATOM 5192 C CB  . LYS E 1 126 ? -17.349 35.914  47.890  1.00 32.65 ? 266 LYS E CB  1 
ATOM 5193 C CG  . LYS E 1 126 ? -18.084 35.991  49.216  1.00 31.80 ? 266 LYS E CG  1 
ATOM 5194 C CD  . LYS E 1 126 ? -17.359 35.107  50.226  1.00 30.53 ? 266 LYS E CD  1 
ATOM 5195 C CE  . LYS E 1 126 ? -17.841 35.318  51.645  1.00 31.18 ? 266 LYS E CE  1 
ATOM 5196 N NZ  . LYS E 1 126 ? -16.834 34.796  52.615  1.00 29.38 ? 266 LYS E NZ  1 
ATOM 5197 N N   . LYS E 1 127 ? -19.587 35.260  45.768  1.00 38.65 ? 267 LYS E N   1 
ATOM 5198 C CA  . LYS E 1 127 ? -20.947 34.841  45.467  1.00 40.18 ? 267 LYS E CA  1 
ATOM 5199 C C   . LYS E 1 127 ? -21.748 34.609  46.743  1.00 41.44 ? 267 LYS E C   1 
ATOM 5200 O O   . LYS E 1 127 ? -21.232 34.093  47.737  1.00 41.85 ? 267 LYS E O   1 
ATOM 5201 C CB  . LYS E 1 127 ? -20.933 33.574  44.614  1.00 39.57 ? 267 LYS E CB  1 
ATOM 5202 C CG  . LYS E 1 127 ? -20.013 32.484  45.141  1.00 43.86 ? 267 LYS E CG  1 
ATOM 5203 C CD  . LYS E 1 127 ? -20.333 31.136  44.494  1.00 44.40 ? 267 LYS E CD  1 
ATOM 5204 C CE  . LYS E 1 127 ? -19.352 30.041  44.911  1.00 42.04 ? 267 LYS E CE  1 
ATOM 5205 N NZ  . LYS E 1 127 ? -18.000 30.252  44.319  1.00 37.50 ? 267 LYS E NZ  1 
ATOM 5206 N N   . ALA E 1 128 ? -23.009 35.015  46.718  1.00 42.45 ? 268 ALA E N   1 
ATOM 5207 C CA  . ALA E 1 128 ? -23.886 34.840  47.864  1.00 44.40 ? 268 ALA E CA  1 
ATOM 5208 C C   . ALA E 1 128 ? -24.574 33.499  47.683  1.00 45.44 ? 268 ALA E C   1 
ATOM 5209 O O   . ALA E 1 128 ? -24.681 33.011  46.563  1.00 47.07 ? 268 ALA E O   1 
ATOM 5210 C CB  . ALA E 1 128 ? -24.922 35.962  47.904  1.00 44.01 ? 268 ALA E CB  1 
ATOM 5211 N N   . ASN E 1 129 ? -25.026 32.890  48.772  1.00 46.97 ? 269 ASN E N   1 
ATOM 5212 C CA  . ASN E 1 129 ? -25.718 31.612  48.656  1.00 49.04 ? 269 ASN E CA  1 
ATOM 5213 C C   . ASN E 1 129 ? -27.151 31.908  48.225  1.00 50.10 ? 269 ASN E C   1 
ATOM 5214 O O   . ASN E 1 129 ? -27.564 33.065  48.209  1.00 49.14 ? 269 ASN E O   1 
ATOM 5215 C CB  . ASN E 1 129 ? -25.727 30.868  49.991  1.00 49.11 ? 269 ASN E CB  1 
ATOM 5216 C CG  . ASN E 1 129 ? -26.364 29.494  49.883  1.00 50.40 ? 269 ASN E CG  1 
ATOM 5217 O OD1 . ASN E 1 129 ? -25.775 28.561  49.331  1.00 50.59 ? 269 ASN E OD1 1 
ATOM 5218 N ND2 . ASN E 1 129 ? -27.581 29.366  50.400  1.00 51.22 ? 269 ASN E ND2 1 
ATOM 5219 N N   . LEU E 1 130 ? -27.906 30.868  47.881  1.00 51.96 ? 270 LEU E N   1 
ATOM 5220 C CA  . LEU E 1 130 ? -29.290 31.036  47.442  1.00 53.93 ? 270 LEU E CA  1 
ATOM 5221 C C   . LEU E 1 130 ? -30.058 29.726  47.290  1.00 54.49 ? 270 LEU E C   1 
ATOM 5222 O O   . LEU E 1 130 ? -31.240 29.698  47.703  1.00 54.43 ? 270 LEU E O   1 
ATOM 5223 C CB  . LEU E 1 130 ? -29.330 31.809  46.122  1.00 54.87 ? 270 LEU E CB  1 
ATOM 5224 C CG  . LEU E 1 130 ? -29.524 33.316  46.290  1.00 55.98 ? 270 LEU E CG  1 
ATOM 5225 C CD1 . LEU E 1 130 ? -29.087 34.047  45.026  1.00 55.10 ? 270 LEU E CD1 1 
ATOM 5226 C CD2 . LEU E 1 130 ? -30.992 33.597  46.640  1.00 56.67 ? 270 LEU E CD2 1 
ATOM 5227 N N   . MET F 1 1   ? -36.516 33.004  56.274  1.00 52.37 ? 141 MET F N   1 
ATOM 5228 C CA  . MET F 1 1   ? -35.639 33.188  55.082  1.00 52.88 ? 141 MET F CA  1 
ATOM 5229 C C   . MET F 1 1   ? -34.403 34.005  55.443  1.00 50.92 ? 141 MET F C   1 
ATOM 5230 O O   . MET F 1 1   ? -33.969 34.000  56.596  1.00 51.08 ? 141 MET F O   1 
ATOM 5231 C CB  . MET F 1 1   ? -36.417 33.878  53.958  1.00 54.67 ? 141 MET F CB  1 
ATOM 5232 C CG  . MET F 1 1   ? -37.602 33.068  53.463  1.00 58.83 ? 141 MET F CG  1 
ATOM 5233 S SD  . MET F 1 1   ? -38.416 33.801  52.040  1.00 62.25 ? 141 MET F SD  1 
ATOM 5234 C CE  . MET F 1 1   ? -37.618 32.896  50.714  1.00 61.39 ? 141 MET F CE  1 
ATOM 5235 N N   . ALA F 1 2   ? -33.839 34.702  54.459  1.00 47.82 ? 142 ALA F N   1 
ATOM 5236 C CA  . ALA F 1 2   ? -32.650 35.516  54.682  1.00 44.37 ? 142 ALA F CA  1 
ATOM 5237 C C   . ALA F 1 2   ? -32.744 36.271  56.000  1.00 42.80 ? 142 ALA F C   1 
ATOM 5238 O O   . ALA F 1 2   ? -33.787 36.833  56.333  1.00 43.75 ? 142 ALA F O   1 
ATOM 5239 C CB  . ALA F 1 2   ? -32.467 36.490  53.538  1.00 44.77 ? 142 ALA F CB  1 
ATOM 5240 N N   . PRO F 1 3   ? -31.647 36.292  56.772  1.00 40.92 ? 143 PRO F N   1 
ATOM 5241 C CA  . PRO F 1 3   ? -31.634 36.986  58.060  1.00 39.14 ? 143 PRO F CA  1 
ATOM 5242 C C   . PRO F 1 3   ? -31.952 38.458  57.898  1.00 38.83 ? 143 PRO F C   1 
ATOM 5243 O O   . PRO F 1 3   ? -32.689 39.031  58.695  1.00 38.10 ? 143 PRO F O   1 
ATOM 5244 C CB  . PRO F 1 3   ? -30.209 36.764  58.559  1.00 39.12 ? 143 PRO F CB  1 
ATOM 5245 C CG  . PRO F 1 3   ? -29.809 35.477  57.907  1.00 39.07 ? 143 PRO F CG  1 
ATOM 5246 C CD  . PRO F 1 3   ? -30.349 35.648  56.514  1.00 39.51 ? 143 PRO F CD  1 
ATOM 5247 N N   . CYS F 1 4   ? -31.400 39.063  56.851  1.00 39.61 ? 144 CYS F N   1 
ATOM 5248 C CA  . CYS F 1 4   ? -31.608 40.483  56.590  1.00 39.29 ? 144 CYS F CA  1 
ATOM 5249 C C   . CYS F 1 4   ? -31.876 40.801  55.127  1.00 38.42 ? 144 CYS F C   1 
ATOM 5250 O O   . CYS F 1 4   ? -31.499 40.043  54.229  1.00 38.08 ? 144 CYS F O   1 
ATOM 5251 C CB  . CYS F 1 4   ? -30.383 41.278  57.039  1.00 39.29 ? 144 CYS F CB  1 
ATOM 5252 S SG  . CYS F 1 4   ? -30.021 41.144  58.810  1.00 42.43 ? 144 CYS F SG  1 
ATOM 5253 N N   . PRO F 1 5   ? -32.533 41.940  54.867  1.00 37.56 ? 145 PRO F N   1 
ATOM 5254 C CA  . PRO F 1 5   ? -32.835 42.345  53.496  1.00 37.44 ? 145 PRO F CA  1 
ATOM 5255 C C   . PRO F 1 5   ? -31.507 42.584  52.793  1.00 38.84 ? 145 PRO F C   1 
ATOM 5256 O O   . PRO F 1 5   ? -30.444 42.379  53.374  1.00 38.63 ? 145 PRO F O   1 
ATOM 5257 C CB  . PRO F 1 5   ? -33.615 43.643  53.685  1.00 36.07 ? 145 PRO F CB  1 
ATOM 5258 C CG  . PRO F 1 5   ? -34.246 43.478  55.033  1.00 35.04 ? 145 PRO F CG  1 
ATOM 5259 C CD  . PRO F 1 5   ? -33.121 42.885  55.830  1.00 37.08 ? 145 PRO F CD  1 
ATOM 5260 N N   . GLN F 1 6   ? -31.562 43.011  51.542  1.00 40.18 ? 146 GLN F N   1 
ATOM 5261 C CA  . GLN F 1 6   ? -30.338 43.294  50.819  1.00 40.32 ? 146 GLN F CA  1 
ATOM 5262 C C   . GLN F 1 6   ? -29.908 44.714  51.158  1.00 39.57 ? 146 GLN F C   1 
ATOM 5263 O O   . GLN F 1 6   ? -30.731 45.543  51.543  1.00 39.23 ? 146 GLN F O   1 
ATOM 5264 C CB  . GLN F 1 6   ? -30.562 43.153  49.315  1.00 41.81 ? 146 GLN F CB  1 
ATOM 5265 C CG  . GLN F 1 6   ? -30.741 41.720  48.863  1.00 44.69 ? 146 GLN F CG  1 
ATOM 5266 C CD  . GLN F 1 6   ? -30.782 41.594  47.360  1.00 46.46 ? 146 GLN F CD  1 
ATOM 5267 O OE1 . GLN F 1 6   ? -29.974 42.199  46.655  1.00 47.10 ? 146 GLN F OE1 1 
ATOM 5268 N NE2 . GLN F 1 6   ? -31.720 40.800  46.857  1.00 46.54 ? 146 GLN F NE2 1 
ATOM 5269 N N   . ASP F 1 7   ? -28.613 44.981  51.024  1.00 39.03 ? 147 ASP F N   1 
ATOM 5270 C CA  . ASP F 1 7   ? -28.060 46.296  51.310  1.00 37.51 ? 147 ASP F CA  1 
ATOM 5271 C C   . ASP F 1 7   ? -28.020 46.612  52.793  1.00 35.41 ? 147 ASP F C   1 
ATOM 5272 O O   . ASP F 1 7   ? -27.746 47.743  53.185  1.00 34.93 ? 147 ASP F O   1 
ATOM 5273 C CB  . ASP F 1 7   ? -28.844 47.374  50.562  1.00 38.69 ? 147 ASP F CB  1 
ATOM 5274 C CG  . ASP F 1 7   ? -28.742 47.216  49.067  1.00 38.50 ? 147 ASP F CG  1 
ATOM 5275 O OD1 . ASP F 1 7   ? -27.959 46.346  48.628  1.00 39.13 ? 147 ASP F OD1 1 
ATOM 5276 O OD2 . ASP F 1 7   ? -29.431 47.955  48.335  1.00 39.24 ? 147 ASP F OD2 1 
ATOM 5277 N N   . TRP F 1 8   ? -28.311 45.612  53.614  1.00 33.75 ? 148 TRP F N   1 
ATOM 5278 C CA  . TRP F 1 8   ? -28.259 45.782  55.058  1.00 33.87 ? 148 TRP F CA  1 
ATOM 5279 C C   . TRP F 1 8   ? -27.103 44.928  55.547  1.00 34.25 ? 148 TRP F C   1 
ATOM 5280 O O   . TRP F 1 8   ? -26.480 44.214  54.764  1.00 34.78 ? 148 TRP F O   1 
ATOM 5281 C CB  . TRP F 1 8   ? -29.563 45.327  55.716  1.00 32.77 ? 148 TRP F CB  1 
ATOM 5282 C CG  . TRP F 1 8   ? -30.710 46.247  55.455  1.00 33.75 ? 148 TRP F CG  1 
ATOM 5283 C CD1 . TRP F 1 8   ? -31.247 46.565  54.241  1.00 32.58 ? 148 TRP F CD1 1 
ATOM 5284 C CD2 . TRP F 1 8   ? -31.451 46.993  56.429  1.00 32.95 ? 148 TRP F CD2 1 
ATOM 5285 N NE1 . TRP F 1 8   ? -32.273 47.464  54.397  1.00 30.92 ? 148 TRP F NE1 1 
ATOM 5286 C CE2 . TRP F 1 8   ? -32.419 47.746  55.730  1.00 32.76 ? 148 TRP F CE2 1 
ATOM 5287 C CE3 . TRP F 1 8   ? -31.387 47.102  57.824  1.00 32.67 ? 148 TRP F CE3 1 
ATOM 5288 C CZ2 . TRP F 1 8   ? -33.320 48.597  56.379  1.00 33.11 ? 148 TRP F CZ2 1 
ATOM 5289 C CZ3 . TRP F 1 8   ? -32.281 47.947  58.469  1.00 33.51 ? 148 TRP F CZ3 1 
ATOM 5290 C CH2 . TRP F 1 8   ? -33.234 48.685  57.744  1.00 33.29 ? 148 TRP F CH2 1 
ATOM 5291 N N   . ILE F 1 9   ? -26.805 45.010  56.835  1.00 34.22 ? 149 ILE F N   1 
ATOM 5292 C CA  . ILE F 1 9   ? -25.723 44.228  57.404  1.00 34.13 ? 149 ILE F CA  1 
ATOM 5293 C C   . ILE F 1 9   ? -26.266 43.396  58.556  1.00 34.97 ? 149 ILE F C   1 
ATOM 5294 O O   . ILE F 1 9   ? -26.796 43.937  59.524  1.00 36.59 ? 149 ILE F O   1 
ATOM 5295 C CB  . ILE F 1 9   ? -24.589 45.140  57.911  1.00 33.88 ? 149 ILE F CB  1 
ATOM 5296 C CG1 . ILE F 1 9   ? -23.960 45.883  56.731  1.00 34.98 ? 149 ILE F CG1 1 
ATOM 5297 C CG2 . ILE F 1 9   ? -23.545 44.320  58.647  1.00 33.11 ? 149 ILE F CG2 1 
ATOM 5298 C CD1 . ILE F 1 9   ? -22.670 46.605  57.073  1.00 37.53 ? 149 ILE F CD1 1 
ATOM 5299 N N   . TRP F 1 10  ? -26.153 42.080  58.440  1.00 34.45 ? 150 TRP F N   1 
ATOM 5300 C CA  . TRP F 1 10  ? -26.640 41.200  59.488  1.00 36.11 ? 150 TRP F CA  1 
ATOM 5301 C C   . TRP F 1 10  ? -25.564 40.989  60.532  1.00 36.77 ? 150 TRP F C   1 
ATOM 5302 O O   . TRP F 1 10  ? -24.461 40.548  60.225  1.00 36.59 ? 150 TRP F O   1 
ATOM 5303 C CB  . TRP F 1 10  ? -27.083 39.853  58.901  1.00 37.69 ? 150 TRP F CB  1 
ATOM 5304 C CG  . TRP F 1 10  ? -27.319 38.777  59.935  1.00 38.92 ? 150 TRP F CG  1 
ATOM 5305 C CD1 . TRP F 1 10  ? -27.915 38.924  61.157  1.00 40.56 ? 150 TRP F CD1 1 
ATOM 5306 C CD2 . TRP F 1 10  ? -26.972 37.390  59.825  1.00 39.37 ? 150 TRP F CD2 1 
ATOM 5307 N NE1 . TRP F 1 10  ? -27.956 37.715  61.817  1.00 39.71 ? 150 TRP F NE1 1 
ATOM 5308 C CE2 . TRP F 1 10  ? -27.384 36.757  61.022  1.00 38.95 ? 150 TRP F CE2 1 
ATOM 5309 C CE3 . TRP F 1 10  ? -26.350 36.619  58.832  1.00 39.58 ? 150 TRP F CE3 1 
ATOM 5310 C CZ2 . TRP F 1 10  ? -27.197 35.390  61.252  1.00 37.63 ? 150 TRP F CZ2 1 
ATOM 5311 C CZ3 . TRP F 1 10  ? -26.165 35.255  59.062  1.00 39.15 ? 150 TRP F CZ3 1 
ATOM 5312 C CH2 . TRP F 1 10  ? -26.586 34.658  60.264  1.00 37.93 ? 150 TRP F CH2 1 
ATOM 5313 N N   . HIS F 1 11  ? -25.900 41.314  61.773  1.00 38.34 ? 151 HIS F N   1 
ATOM 5314 C CA  . HIS F 1 11  ? -24.976 41.168  62.886  1.00 39.77 ? 151 HIS F CA  1 
ATOM 5315 C C   . HIS F 1 11  ? -25.759 40.823  64.144  1.00 40.78 ? 151 HIS F C   1 
ATOM 5316 O O   . HIS F 1 11  ? -26.647 41.568  64.551  1.00 42.64 ? 151 HIS F O   1 
ATOM 5317 C CB  . HIS F 1 11  ? -24.202 42.467  63.097  1.00 38.84 ? 151 HIS F CB  1 
ATOM 5318 C CG  . HIS F 1 11  ? -23.243 42.414  64.242  1.00 38.83 ? 151 HIS F CG  1 
ATOM 5319 N ND1 . HIS F 1 11  ? -22.185 41.533  64.284  1.00 39.08 ? 151 HIS F ND1 1 
ATOM 5320 C CD2 . HIS F 1 11  ? -23.191 43.123  65.391  1.00 38.76 ? 151 HIS F CD2 1 
ATOM 5321 C CE1 . HIS F 1 11  ? -21.521 41.702  65.412  1.00 37.85 ? 151 HIS F CE1 1 
ATOM 5322 N NE2 . HIS F 1 11  ? -22.110 42.660  66.102  1.00 38.24 ? 151 HIS F NE2 1 
ATOM 5323 N N   . GLY F 1 12  ? -25.428 39.692  64.757  1.00 41.56 ? 152 GLY F N   1 
ATOM 5324 C CA  . GLY F 1 12  ? -26.132 39.280  65.954  1.00 42.14 ? 152 GLY F CA  1 
ATOM 5325 C C   . GLY F 1 12  ? -27.615 39.149  65.676  1.00 42.57 ? 152 GLY F C   1 
ATOM 5326 O O   . GLY F 1 12  ? -28.017 38.555  64.676  1.00 43.69 ? 152 GLY F O   1 
ATOM 5327 N N   . GLU F 1 13  ? -28.429 39.722  66.552  1.00 42.86 ? 153 GLU F N   1 
ATOM 5328 C CA  . GLU F 1 13  ? -29.876 39.654  66.407  1.00 44.53 ? 153 GLU F CA  1 
ATOM 5329 C C   . GLU F 1 13  ? -30.453 40.809  65.601  1.00 43.96 ? 153 GLU F C   1 
ATOM 5330 O O   . GLU F 1 13  ? -31.669 40.986  65.563  1.00 45.36 ? 153 GLU F O   1 
ATOM 5331 C CB  . GLU F 1 13  ? -30.550 39.635  67.787  1.00 46.94 ? 153 GLU F CB  1 
ATOM 5332 C CG  . GLU F 1 13  ? -30.212 38.424  68.659  1.00 49.28 ? 153 GLU F CG  1 
ATOM 5333 C CD  . GLU F 1 13  ? -31.061 38.358  69.920  1.00 49.27 ? 153 GLU F CD  1 
ATOM 5334 O OE1 . GLU F 1 13  ? -30.961 39.281  70.756  1.00 48.53 ? 153 GLU F OE1 1 
ATOM 5335 O OE2 . GLU F 1 13  ? -31.832 37.383  70.068  1.00 49.56 ? 153 GLU F OE2 1 
ATOM 5336 N N   . ASN F 1 14  ? -29.602 41.590  64.945  1.00 44.01 ? 154 ASN F N   1 
ATOM 5337 C CA  . ASN F 1 14  ? -30.100 42.730  64.183  1.00 44.17 ? 154 ASN F CA  1 
ATOM 5338 C C   . ASN F 1 14  ? -29.555 42.915  62.774  1.00 42.54 ? 154 ASN F C   1 
ATOM 5339 O O   . ASN F 1 14  ? -28.575 42.283  62.367  1.00 41.74 ? 154 ASN F O   1 
ATOM 5340 C CB  . ASN F 1 14  ? -29.858 44.019  64.968  1.00 47.19 ? 154 ASN F CB  1 
ATOM 5341 C CG  . ASN F 1 14  ? -30.547 44.017  66.316  1.00 49.47 ? 154 ASN F CG  1 
ATOM 5342 O OD1 . ASN F 1 14  ? -31.774 43.934  66.400  1.00 50.37 ? 154 ASN F OD1 1 
ATOM 5343 N ND2 . ASN F 1 14  ? -29.758 44.106  67.383  1.00 48.07 ? 154 ASN F ND2 1 
ATOM 5344 N N   . CYS F 1 15  ? -30.222 43.802  62.041  1.00 39.90 ? 155 CYS F N   1 
ATOM 5345 C CA  . CYS F 1 15  ? -29.852 44.148  60.677  1.00 38.72 ? 155 CYS F CA  1 
ATOM 5346 C C   . CYS F 1 15  ? -29.556 45.640  60.690  1.00 36.89 ? 155 CYS F C   1 
ATOM 5347 O O   . CYS F 1 15  ? -30.358 46.429  61.191  1.00 36.21 ? 155 CYS F O   1 
ATOM 5348 C CB  . CYS F 1 15  ? -31.010 43.874  59.716  1.00 40.05 ? 155 CYS F CB  1 
ATOM 5349 S SG  . CYS F 1 15  ? -31.574 42.145  59.649  1.00 42.48 ? 155 CYS F SG  1 
ATOM 5350 N N   . TYR F 1 16  ? -28.414 46.031  60.139  1.00 33.82 ? 156 TYR F N   1 
ATOM 5351 C CA  . TYR F 1 16  ? -28.055 47.439  60.126  1.00 32.97 ? 156 TYR F CA  1 
ATOM 5352 C C   . TYR F 1 16  ? -27.997 48.068  58.748  1.00 32.64 ? 156 TYR F C   1 
ATOM 5353 O O   . TYR F 1 16  ? -27.540 47.453  57.786  1.00 33.78 ? 156 TYR F O   1 
ATOM 5354 C CB  . TYR F 1 16  ? -26.718 47.640  60.836  1.00 33.41 ? 156 TYR F CB  1 
ATOM 5355 C CG  . TYR F 1 16  ? -26.756 47.190  62.274  1.00 33.46 ? 156 TYR F CG  1 
ATOM 5356 C CD1 . TYR F 1 16  ? -26.524 45.860  62.615  1.00 31.00 ? 156 TYR F CD1 1 
ATOM 5357 C CD2 . TYR F 1 16  ? -27.085 48.085  63.289  1.00 32.71 ? 156 TYR F CD2 1 
ATOM 5358 C CE1 . TYR F 1 16  ? -26.620 45.432  63.929  1.00 31.44 ? 156 TYR F CE1 1 
ATOM 5359 C CE2 . TYR F 1 16  ? -27.187 47.667  64.604  1.00 33.30 ? 156 TYR F CE2 1 
ATOM 5360 C CZ  . TYR F 1 16  ? -26.954 46.341  64.918  1.00 32.70 ? 156 TYR F CZ  1 
ATOM 5361 O OH  . TYR F 1 16  ? -27.072 45.928  66.222  1.00 33.92 ? 156 TYR F OH  1 
ATOM 5362 N N   . LEU F 1 17  ? -28.476 49.303  58.661  1.00 31.49 ? 157 LEU F N   1 
ATOM 5363 C CA  . LEU F 1 17  ? -28.463 50.041  57.410  1.00 30.28 ? 157 LEU F CA  1 
ATOM 5364 C C   . LEU F 1 17  ? -27.745 51.372  57.600  1.00 32.04 ? 157 LEU F C   1 
ATOM 5365 O O   . LEU F 1 17  ? -28.117 52.176  58.455  1.00 29.39 ? 157 LEU F O   1 
ATOM 5366 C CB  . LEU F 1 17  ? -29.882 50.310  56.918  1.00 26.06 ? 157 LEU F CB  1 
ATOM 5367 C CG  . LEU F 1 17  ? -29.880 50.990  55.550  1.00 21.83 ? 157 LEU F CG  1 
ATOM 5368 C CD1 . LEU F 1 17  ? -29.396 49.994  54.522  1.00 18.82 ? 157 LEU F CD1 1 
ATOM 5369 C CD2 . LEU F 1 17  ? -31.261 51.486  55.197  1.00 21.72 ? 157 LEU F CD2 1 
ATOM 5370 N N   . PHE F 1 18  ? -26.706 51.597  56.803  1.00 34.44 ? 158 PHE F N   1 
ATOM 5371 C CA  . PHE F 1 18  ? -25.958 52.837  56.889  1.00 37.39 ? 158 PHE F CA  1 
ATOM 5372 C C   . PHE F 1 18  ? -26.421 53.752  55.776  1.00 39.69 ? 158 PHE F C   1 
ATOM 5373 O O   . PHE F 1 18  ? -25.868 53.754  54.678  1.00 40.94 ? 158 PHE F O   1 
ATOM 5374 C CB  . PHE F 1 18  ? -24.460 52.560  56.782  1.00 36.91 ? 158 PHE F CB  1 
ATOM 5375 C CG  . PHE F 1 18  ? -23.954 51.627  57.838  1.00 37.05 ? 158 PHE F CG  1 
ATOM 5376 C CD1 . PHE F 1 18  ? -24.190 50.262  57.747  1.00 38.19 ? 158 PHE F CD1 1 
ATOM 5377 C CD2 . PHE F 1 18  ? -23.291 52.119  58.954  1.00 36.68 ? 158 PHE F CD2 1 
ATOM 5378 C CE1 . PHE F 1 18  ? -23.778 49.399  58.757  1.00 38.93 ? 158 PHE F CE1 1 
ATOM 5379 C CE2 . PHE F 1 18  ? -22.876 51.270  59.965  1.00 37.18 ? 158 PHE F CE2 1 
ATOM 5380 C CZ  . PHE F 1 18  ? -23.120 49.904  59.868  1.00 39.38 ? 158 PHE F CZ  1 
ATOM 5381 N N   . SER F 1 19  ? -27.465 54.515  56.075  1.00 42.38 ? 159 SER F N   1 
ATOM 5382 C CA  . SER F 1 19  ? -28.049 55.453  55.131  1.00 44.45 ? 159 SER F CA  1 
ATOM 5383 C C   . SER F 1 19  ? -27.002 56.140  54.268  1.00 45.44 ? 159 SER F C   1 
ATOM 5384 O O   . SER F 1 19  ? -25.880 56.400  54.708  1.00 43.95 ? 159 SER F O   1 
ATOM 5385 C CB  . SER F 1 19  ? -28.841 56.511  55.888  1.00 45.86 ? 159 SER F CB  1 
ATOM 5386 O OG  . SER F 1 19  ? -28.007 57.165  56.829  1.00 47.60 ? 159 SER F OG  1 
ATOM 5387 N N   . SER F 1 20  ? -27.384 56.428  53.031  1.00 47.49 ? 160 SER F N   1 
ATOM 5388 C CA  . SER F 1 20  ? -26.504 57.099  52.086  1.00 48.94 ? 160 SER F CA  1 
ATOM 5389 C C   . SER F 1 20  ? -26.793 58.596  52.159  1.00 48.96 ? 160 SER F C   1 
ATOM 5390 O O   . SER F 1 20  ? -25.940 59.426  51.837  1.00 49.20 ? 160 SER F O   1 
ATOM 5391 C CB  . SER F 1 20  ? -26.774 56.584  50.672  1.00 48.02 ? 160 SER F CB  1 
ATOM 5392 O OG  . SER F 1 20  ? -28.154 56.691  50.362  1.00 47.12 ? 160 SER F OG  1 
ATOM 5393 N N   . GLY F 1 21  ? -28.003 58.927  52.599  1.00 47.94 ? 161 GLY F N   1 
ATOM 5394 C CA  . GLY F 1 21  ? -28.399 60.317  52.705  1.00 48.27 ? 161 GLY F CA  1 
ATOM 5395 C C   . GLY F 1 21  ? -27.865 61.022  53.933  1.00 47.94 ? 161 GLY F C   1 
ATOM 5396 O O   . GLY F 1 21  ? -27.342 60.393  54.852  1.00 49.03 ? 161 GLY F O   1 
ATOM 5397 N N   . SER F 1 22  ? -28.000 62.342  53.940  1.00 46.97 ? 162 SER F N   1 
ATOM 5398 C CA  . SER F 1 22  ? -27.551 63.164  55.051  1.00 46.64 ? 162 SER F CA  1 
ATOM 5399 C C   . SER F 1 22  ? -28.649 64.181  55.353  1.00 47.43 ? 162 SER F C   1 
ATOM 5400 O O   . SER F 1 22  ? -28.793 65.181  54.649  1.00 48.28 ? 162 SER F O   1 
ATOM 5401 C CB  . SER F 1 22  ? -26.257 63.883  54.680  1.00 45.71 ? 162 SER F CB  1 
ATOM 5402 O OG  . SER F 1 22  ? -25.762 64.623  55.779  1.00 45.84 ? 162 SER F OG  1 
ATOM 5403 N N   . PHE F 1 23  ? -29.432 63.917  56.393  1.00 47.40 ? 163 PHE F N   1 
ATOM 5404 C CA  . PHE F 1 23  ? -30.526 64.809  56.757  1.00 47.63 ? 163 PHE F CA  1 
ATOM 5405 C C   . PHE F 1 23  ? -30.579 64.993  58.266  1.00 47.16 ? 163 PHE F C   1 
ATOM 5406 O O   . PHE F 1 23  ? -29.924 64.260  59.009  1.00 47.01 ? 163 PHE F O   1 
ATOM 5407 C CB  . PHE F 1 23  ? -31.865 64.239  56.268  1.00 47.84 ? 163 PHE F CB  1 
ATOM 5408 C CG  . PHE F 1 23  ? -31.809 63.649  54.885  1.00 48.05 ? 163 PHE F CG  1 
ATOM 5409 C CD1 . PHE F 1 23  ? -31.716 62.273  54.704  1.00 48.14 ? 163 PHE F CD1 1 
ATOM 5410 C CD2 . PHE F 1 23  ? -31.829 64.471  53.764  1.00 48.10 ? 163 PHE F CD2 1 
ATOM 5411 C CE1 . PHE F 1 23  ? -31.647 61.725  53.430  1.00 46.93 ? 163 PHE F CE1 1 
ATOM 5412 C CE2 . PHE F 1 23  ? -31.761 63.933  52.486  1.00 47.43 ? 163 PHE F CE2 1 
ATOM 5413 C CZ  . PHE F 1 23  ? -31.668 62.557  52.320  1.00 47.96 ? 163 PHE F CZ  1 
ATOM 5414 N N   . ASN F 1 24  ? -31.365 65.970  58.713  1.00 45.90 ? 164 ASN F N   1 
ATOM 5415 C CA  . ASN F 1 24  ? -31.504 66.234  60.138  1.00 44.90 ? 164 ASN F CA  1 
ATOM 5416 C C   . ASN F 1 24  ? -32.027 64.994  60.854  1.00 43.50 ? 164 ASN F C   1 
ATOM 5417 O O   . ASN F 1 24  ? -32.610 64.107  60.234  1.00 42.26 ? 164 ASN F O   1 
ATOM 5418 C CB  . ASN F 1 24  ? -32.435 67.429  60.386  1.00 45.74 ? 164 ASN F CB  1 
ATOM 5419 C CG  . ASN F 1 24  ? -33.768 67.292  59.682  1.00 47.15 ? 164 ASN F CG  1 
ATOM 5420 O OD1 . ASN F 1 24  ? -34.465 66.289  59.828  1.00 46.62 ? 164 ASN F OD1 1 
ATOM 5421 N ND2 . ASN F 1 24  ? -34.134 68.312  58.915  1.00 50.12 ? 164 ASN F ND2 1 
ATOM 5422 N N   . TRP F 1 25  ? -31.813 64.947  62.164  1.00 41.86 ? 165 TRP F N   1 
ATOM 5423 C CA  . TRP F 1 25  ? -32.218 63.817  62.990  1.00 41.39 ? 165 TRP F CA  1 
ATOM 5424 C C   . TRP F 1 25  ? -33.674 63.393  62.820  1.00 43.06 ? 165 TRP F C   1 
ATOM 5425 O O   . TRP F 1 25  ? -34.014 62.229  63.039  1.00 44.67 ? 165 TRP F O   1 
ATOM 5426 C CB  . TRP F 1 25  ? -31.961 64.141  64.457  1.00 37.71 ? 165 TRP F CB  1 
ATOM 5427 C CG  . TRP F 1 25  ? -31.967 62.947  65.324  1.00 34.13 ? 165 TRP F CG  1 
ATOM 5428 C CD1 . TRP F 1 25  ? -30.927 62.106  65.558  1.00 33.86 ? 165 TRP F CD1 1 
ATOM 5429 C CD2 . TRP F 1 25  ? -33.078 62.430  66.061  1.00 34.54 ? 165 TRP F CD2 1 
ATOM 5430 N NE1 . TRP F 1 25  ? -31.316 61.090  66.396  1.00 33.89 ? 165 TRP F NE1 1 
ATOM 5431 C CE2 . TRP F 1 25  ? -32.635 61.263  66.718  1.00 33.66 ? 165 TRP F CE2 1 
ATOM 5432 C CE3 . TRP F 1 25  ? -34.410 62.835  66.223  1.00 33.74 ? 165 TRP F CE3 1 
ATOM 5433 C CZ2 . TRP F 1 25  ? -33.473 60.498  67.533  1.00 32.33 ? 165 TRP F CZ2 1 
ATOM 5434 C CZ3 . TRP F 1 25  ? -35.244 62.071  67.034  1.00 33.45 ? 165 TRP F CZ3 1 
ATOM 5435 C CH2 . TRP F 1 25  ? -34.770 60.915  67.676  1.00 32.01 ? 165 TRP F CH2 1 
ATOM 5436 N N   . GLU F 1 26  ? -34.529 64.333  62.429  1.00 44.28 ? 166 GLU F N   1 
ATOM 5437 C CA  . GLU F 1 26  ? -35.950 64.055  62.251  1.00 44.63 ? 166 GLU F CA  1 
ATOM 5438 C C   . GLU F 1 26  ? -36.229 63.341  60.928  1.00 45.01 ? 166 GLU F C   1 
ATOM 5439 O O   . GLU F 1 26  ? -37.010 62.394  60.881  1.00 44.90 ? 166 GLU F O   1 
ATOM 5440 C CB  . GLU F 1 26  ? -36.735 65.363  62.336  1.00 44.92 ? 166 GLU F CB  1 
ATOM 5441 C CG  . GLU F 1 26  ? -38.210 65.217  62.655  1.00 46.51 ? 166 GLU F CG  1 
ATOM 5442 C CD  . GLU F 1 26  ? -38.868 66.563  62.903  1.00 48.94 ? 166 GLU F CD  1 
ATOM 5443 O OE1 . GLU F 1 26  ? -38.208 67.594  62.651  1.00 50.87 ? 166 GLU F OE1 1 
ATOM 5444 O OE2 . GLU F 1 26  ? -40.038 66.596  63.342  1.00 50.22 ? 166 GLU F OE2 1 
ATOM 5445 N N   . LYS F 1 27  ? -35.599 63.798  59.852  1.00 46.80 ? 167 LYS F N   1 
ATOM 5446 C CA  . LYS F 1 27  ? -35.779 63.154  58.558  1.00 48.79 ? 167 LYS F CA  1 
ATOM 5447 C C   . LYS F 1 27  ? -35.062 61.815  58.635  1.00 49.50 ? 167 LYS F C   1 
ATOM 5448 O O   . LYS F 1 27  ? -35.442 60.850  57.970  1.00 49.85 ? 167 LYS F O   1 
ATOM 5449 C CB  . LYS F 1 27  ? -35.186 64.010  57.433  1.00 51.34 ? 167 LYS F CB  1 
ATOM 5450 C CG  . LYS F 1 27  ? -36.111 65.119  56.954  1.00 54.55 ? 167 LYS F CG  1 
ATOM 5451 C CD  . LYS F 1 27  ? -37.410 64.536  56.400  1.00 58.53 ? 167 LYS F CD  1 
ATOM 5452 C CE  . LYS F 1 27  ? -38.435 65.618  56.067  1.00 60.03 ? 167 LYS F CE  1 
ATOM 5453 N NZ  . LYS F 1 27  ? -39.753 65.037  55.667  1.00 58.64 ? 167 LYS F NZ  1 
ATOM 5454 N N   . SER F 1 28  ? -34.018 61.771  59.459  1.00 49.47 ? 168 SER F N   1 
ATOM 5455 C CA  . SER F 1 28  ? -33.254 60.550  59.661  1.00 48.96 ? 168 SER F CA  1 
ATOM 5456 C C   . SER F 1 28  ? -34.156 59.602  60.429  1.00 49.01 ? 168 SER F C   1 
ATOM 5457 O O   . SER F 1 28  ? -34.167 58.398  60.178  1.00 48.77 ? 168 SER F O   1 
ATOM 5458 C CB  . SER F 1 28  ? -31.988 60.830  60.473  1.00 50.02 ? 168 SER F CB  1 
ATOM 5459 O OG  . SER F 1 28  ? -31.089 61.658  59.755  1.00 50.43 ? 168 SER F OG  1 
ATOM 5460 N N   . GLN F 1 29  ? -34.917 60.158  61.367  1.00 48.98 ? 169 GLN F N   1 
ATOM 5461 C CA  . GLN F 1 29  ? -35.840 59.362  62.160  1.00 49.09 ? 169 GLN F CA  1 
ATOM 5462 C C   . GLN F 1 29  ? -36.924 58.788  61.260  1.00 49.17 ? 169 GLN F C   1 
ATOM 5463 O O   . GLN F 1 29  ? -37.393 57.672  61.467  1.00 48.87 ? 169 GLN F O   1 
ATOM 5464 C CB  . GLN F 1 29  ? -36.487 60.206  63.258  1.00 49.08 ? 169 GLN F CB  1 
ATOM 5465 C CG  . GLN F 1 29  ? -37.713 59.542  63.876  1.00 49.51 ? 169 GLN F CG  1 
ATOM 5466 C CD  . GLN F 1 29  ? -38.236 60.270  65.093  1.00 49.00 ? 169 GLN F CD  1 
ATOM 5467 O OE1 . GLN F 1 29  ? -38.538 61.462  65.040  1.00 48.02 ? 169 GLN F OE1 1 
ATOM 5468 N NE2 . GLN F 1 29  ? -38.352 59.552  66.200  1.00 49.31 ? 169 GLN F NE2 1 
ATOM 5469 N N   . GLU F 1 30  ? -37.322 59.559  60.259  1.00 49.75 ? 170 GLU F N   1 
ATOM 5470 C CA  . GLU F 1 30  ? -38.346 59.105  59.336  1.00 51.16 ? 170 GLU F CA  1 
ATOM 5471 C C   . GLU F 1 30  ? -37.839 57.977  58.441  1.00 51.40 ? 170 GLU F C   1 
ATOM 5472 O O   . GLU F 1 30  ? -38.433 56.897  58.403  1.00 51.68 ? 170 GLU F O   1 
ATOM 5473 C CB  . GLU F 1 30  ? -38.845 60.280  58.495  1.00 52.99 ? 170 GLU F CB  1 
ATOM 5474 C CG  . GLU F 1 30  ? -39.877 61.135  59.216  1.00 56.65 ? 170 GLU F CG  1 
ATOM 5475 C CD  . GLU F 1 30  ? -40.261 62.379  58.438  1.00 59.48 ? 170 GLU F CD  1 
ATOM 5476 O OE1 . GLU F 1 30  ? -40.413 62.286  57.200  1.00 58.75 ? 170 GLU F OE1 1 
ATOM 5477 O OE2 . GLU F 1 30  ? -40.422 63.448  59.069  1.00 61.53 ? 170 GLU F OE2 1 
ATOM 5478 N N   . LYS F 1 31  ? -36.741 58.222  57.732  1.00 50.79 ? 171 LYS F N   1 
ATOM 5479 C CA  . LYS F 1 31  ? -36.174 57.212  56.842  1.00 51.10 ? 171 LYS F CA  1 
ATOM 5480 C C   . LYS F 1 31  ? -36.206 55.821  57.469  1.00 50.15 ? 171 LYS F C   1 
ATOM 5481 O O   . LYS F 1 31  ? -36.564 54.849  56.807  1.00 51.06 ? 171 LYS F O   1 
ATOM 5482 C CB  . LYS F 1 31  ? -34.730 57.565  56.472  1.00 52.53 ? 171 LYS F CB  1 
ATOM 5483 C CG  . LYS F 1 31  ? -34.564 58.792  55.579  1.00 54.95 ? 171 LYS F CG  1 
ATOM 5484 C CD  . LYS F 1 31  ? -35.138 58.567  54.183  1.00 57.06 ? 171 LYS F CD  1 
ATOM 5485 C CE  . LYS F 1 31  ? -34.688 59.659  53.210  1.00 57.61 ? 171 LYS F CE  1 
ATOM 5486 N NZ  . LYS F 1 31  ? -35.028 61.031  53.686  1.00 56.03 ? 171 LYS F NZ  1 
ATOM 5487 N N   . CYS F 1 32  ? -35.839 55.728  58.744  1.00 47.91 ? 172 CYS F N   1 
ATOM 5488 C CA  . CYS F 1 32  ? -35.828 54.439  59.429  1.00 46.09 ? 172 CYS F CA  1 
ATOM 5489 C C   . CYS F 1 32  ? -37.220 53.856  59.655  1.00 44.67 ? 172 CYS F C   1 
ATOM 5490 O O   . CYS F 1 32  ? -37.413 52.645  59.543  1.00 44.92 ? 172 CYS F O   1 
ATOM 5491 C CB  . CYS F 1 32  ? -35.116 54.540  60.781  1.00 45.58 ? 172 CYS F CB  1 
ATOM 5492 S SG  . CYS F 1 32  ? -33.327 54.892  60.733  1.00 44.93 ? 172 CYS F SG  1 
ATOM 5493 N N   . LEU F 1 33  ? -38.188 54.706  59.980  1.00 42.72 ? 173 LEU F N   1 
ATOM 5494 C CA  . LEU F 1 33  ? -39.539 54.219  60.225  1.00 40.90 ? 173 LEU F CA  1 
ATOM 5495 C C   . LEU F 1 33  ? -40.231 53.784  58.947  1.00 39.95 ? 173 LEU F C   1 
ATOM 5496 O O   . LEU F 1 33  ? -41.122 52.941  58.989  1.00 41.04 ? 173 LEU F O   1 
ATOM 5497 C CB  . LEU F 1 33  ? -40.378 55.278  60.947  1.00 40.11 ? 173 LEU F CB  1 
ATOM 5498 C CG  . LEU F 1 33  ? -40.006 55.501  62.420  1.00 41.48 ? 173 LEU F CG  1 
ATOM 5499 C CD1 . LEU F 1 33  ? -40.855 56.618  63.006  1.00 40.38 ? 173 LEU F CD1 1 
ATOM 5500 C CD2 . LEU F 1 33  ? -40.196 54.205  63.212  1.00 40.60 ? 173 LEU F CD2 1 
ATOM 5501 N N   . SER F 1 34  ? -39.815 54.348  57.814  1.00 38.21 ? 174 SER F N   1 
ATOM 5502 C CA  . SER F 1 34  ? -40.406 53.996  56.526  1.00 35.53 ? 174 SER F CA  1 
ATOM 5503 C C   . SER F 1 34  ? -39.826 52.675  56.055  1.00 34.85 ? 174 SER F C   1 
ATOM 5504 O O   . SER F 1 34  ? -40.431 51.969  55.258  1.00 36.22 ? 174 SER F O   1 
ATOM 5505 C CB  . SER F 1 34  ? -40.120 55.076  55.484  1.00 34.89 ? 174 SER F CB  1 
ATOM 5506 O OG  . SER F 1 34  ? -38.755 55.071  55.114  1.00 35.46 ? 174 SER F OG  1 
ATOM 5507 N N   . LEU F 1 35  ? -38.638 52.349  56.548  1.00 34.31 ? 175 LEU F N   1 
ATOM 5508 C CA  . LEU F 1 35  ? -37.985 51.098  56.195  1.00 34.43 ? 175 LEU F CA  1 
ATOM 5509 C C   . LEU F 1 35  ? -38.306 50.054  57.256  1.00 35.38 ? 175 LEU F C   1 
ATOM 5510 O O   . LEU F 1 35  ? -37.603 49.052  57.397  1.00 36.58 ? 175 LEU F O   1 
ATOM 5511 C CB  . LEU F 1 35  ? -36.470 51.296  56.081  1.00 32.80 ? 175 LEU F CB  1 
ATOM 5512 C CG  . LEU F 1 35  ? -36.013 52.037  54.823  1.00 32.27 ? 175 LEU F CG  1 
ATOM 5513 C CD1 . LEU F 1 35  ? -34.530 52.350  54.901  1.00 31.87 ? 175 LEU F CD1 1 
ATOM 5514 C CD2 . LEU F 1 35  ? -36.317 51.183  53.606  1.00 29.83 ? 175 LEU F CD2 1 
ATOM 5515 N N   . ASP F 1 36  ? -39.375 50.306  58.005  1.00 34.73 ? 176 ASP F N   1 
ATOM 5516 C CA  . ASP F 1 36  ? -39.819 49.394  59.047  1.00 35.28 ? 176 ASP F CA  1 
ATOM 5517 C C   . ASP F 1 36  ? -38.718 49.178  60.080  1.00 35.94 ? 176 ASP F C   1 
ATOM 5518 O O   . ASP F 1 36  ? -38.645 48.127  60.722  1.00 36.32 ? 176 ASP F O   1 
ATOM 5519 C CB  . ASP F 1 36  ? -40.222 48.057  58.419  1.00 36.28 ? 176 ASP F CB  1 
ATOM 5520 C CG  . ASP F 1 36  ? -41.366 47.389  59.154  1.00 38.90 ? 176 ASP F CG  1 
ATOM 5521 O OD1 . ASP F 1 36  ? -42.385 48.073  59.391  1.00 38.34 ? 176 ASP F OD1 1 
ATOM 5522 O OD2 . ASP F 1 36  ? -41.254 46.187  59.486  1.00 40.29 ? 176 ASP F OD2 1 
ATOM 5523 N N   . ALA F 1 37  ? -37.864 50.185  60.240  1.00 35.45 ? 177 ALA F N   1 
ATOM 5524 C CA  . ALA F 1 37  ? -36.762 50.109  61.192  1.00 33.98 ? 177 ALA F CA  1 
ATOM 5525 C C   . ALA F 1 37  ? -36.771 51.303  62.137  1.00 33.21 ? 177 ALA F C   1 
ATOM 5526 O O   . ALA F 1 37  ? -37.750 52.050  62.203  1.00 34.45 ? 177 ALA F O   1 
ATOM 5527 C CB  . ALA F 1 37  ? -35.434 50.044  60.446  1.00 33.25 ? 177 ALA F CB  1 
ATOM 5528 N N   . LYS F 1 38  ? -35.670 51.473  62.861  1.00 30.50 ? 178 LYS F N   1 
ATOM 5529 C CA  . LYS F 1 38  ? -35.517 52.566  63.812  1.00 27.07 ? 178 LYS F CA  1 
ATOM 5530 C C   . LYS F 1 38  ? -34.047 52.955  63.859  1.00 26.21 ? 178 LYS F C   1 
ATOM 5531 O O   . LYS F 1 38  ? -33.189 52.180  63.454  1.00 26.66 ? 178 LYS F O   1 
ATOM 5532 C CB  . LYS F 1 38  ? -35.954 52.114  65.204  1.00 23.66 ? 178 LYS F CB  1 
ATOM 5533 C CG  . LYS F 1 38  ? -35.073 51.013  65.781  1.00 22.11 ? 178 LYS F CG  1 
ATOM 5534 C CD  . LYS F 1 38  ? -35.468 50.660  67.200  1.00 19.70 ? 178 LYS F CD  1 
ATOM 5535 C CE  . LYS F 1 38  ? -34.532 49.635  67.798  1.00 17.66 ? 178 LYS F CE  1 
ATOM 5536 N NZ  . LYS F 1 38  ? -34.887 49.359  69.214  1.00 19.75 ? 178 LYS F NZ  1 
ATOM 5537 N N   . LEU F 1 39  ? -33.754 54.149  64.359  1.00 25.14 ? 179 LEU F N   1 
ATOM 5538 C CA  . LEU F 1 39  ? -32.372 54.593  64.455  1.00 24.75 ? 179 LEU F CA  1 
ATOM 5539 C C   . LEU F 1 39  ? -31.601 53.716  65.437  1.00 25.68 ? 179 LEU F C   1 
ATOM 5540 O O   . LEU F 1 39  ? -32.169 53.188  66.394  1.00 26.13 ? 179 LEU F O   1 
ATOM 5541 C CB  . LEU F 1 39  ? -32.311 56.055  64.898  1.00 24.34 ? 179 LEU F CB  1 
ATOM 5542 C CG  . LEU F 1 39  ? -32.662 57.118  63.856  1.00 22.97 ? 179 LEU F CG  1 
ATOM 5543 C CD1 . LEU F 1 39  ? -32.775 58.476  64.527  1.00 23.21 ? 179 LEU F CD1 1 
ATOM 5544 C CD2 . LEU F 1 39  ? -31.594 57.141  62.775  1.00 19.13 ? 179 LEU F CD2 1 
ATOM 5545 N N   . LEU F 1 40  ? -30.305 53.567  65.184  1.00 25.71 ? 180 LEU F N   1 
ATOM 5546 C CA  . LEU F 1 40  ? -29.424 52.751  66.007  1.00 26.38 ? 180 LEU F CA  1 
ATOM 5547 C C   . LEU F 1 40  ? -29.649 52.932  67.497  1.00 29.41 ? 180 LEU F C   1 
ATOM 5548 O O   . LEU F 1 40  ? -29.784 54.055  67.974  1.00 31.98 ? 180 LEU F O   1 
ATOM 5549 C CB  . LEU F 1 40  ? -27.974 53.087  65.674  1.00 25.40 ? 180 LEU F CB  1 
ATOM 5550 C CG  . LEU F 1 40  ? -26.858 52.653  66.623  1.00 24.49 ? 180 LEU F CG  1 
ATOM 5551 C CD1 . LEU F 1 40  ? -26.863 51.145  66.799  1.00 23.69 ? 180 LEU F CD1 1 
ATOM 5552 C CD2 . LEU F 1 40  ? -25.530 53.122  66.055  1.00 23.48 ? 180 LEU F CD2 1 
ATOM 5553 N N   . LYS F 1 41  ? -29.696 51.818  68.223  1.00 30.81 ? 181 LYS F N   1 
ATOM 5554 C CA  . LYS F 1 41  ? -29.867 51.834  69.673  1.00 31.10 ? 181 LYS F CA  1 
ATOM 5555 C C   . LYS F 1 41  ? -28.866 50.873  70.291  1.00 31.69 ? 181 LYS F C   1 
ATOM 5556 O O   . LYS F 1 41  ? -28.840 49.689  69.962  1.00 32.01 ? 181 LYS F O   1 
ATOM 5557 C CB  . LYS F 1 41  ? -31.279 51.418  70.084  1.00 32.10 ? 181 LYS F CB  1 
ATOM 5558 C CG  . LYS F 1 41  ? -31.415 51.185  71.589  1.00 32.28 ? 181 LYS F CG  1 
ATOM 5559 C CD  . LYS F 1 41  ? -32.857 50.953  72.002  1.00 33.36 ? 181 LYS F CD  1 
ATOM 5560 C CE  . LYS F 1 41  ? -32.956 50.577  73.472  1.00 34.52 ? 181 LYS F CE  1 
ATOM 5561 N NZ  . LYS F 1 41  ? -34.373 50.422  73.911  1.00 35.88 ? 181 LYS F NZ  1 
ATOM 5562 N N   . ILE F 1 42  ? -28.052 51.392  71.199  1.00 32.54 ? 182 ILE F N   1 
ATOM 5563 C CA  . ILE F 1 42  ? -27.021 50.603  71.848  1.00 33.50 ? 182 ILE F CA  1 
ATOM 5564 C C   . ILE F 1 42  ? -27.419 50.110  73.234  1.00 35.69 ? 182 ILE F C   1 
ATOM 5565 O O   . ILE F 1 42  ? -27.823 50.901  74.089  1.00 35.44 ? 182 ILE F O   1 
ATOM 5566 C CB  . ILE F 1 42  ? -25.728 51.428  71.947  1.00 31.89 ? 182 ILE F CB  1 
ATOM 5567 C CG1 . ILE F 1 42  ? -25.313 51.870  70.543  1.00 31.49 ? 182 ILE F CG1 1 
ATOM 5568 C CG2 . ILE F 1 42  ? -24.632 50.615  72.602  1.00 32.82 ? 182 ILE F CG2 1 
ATOM 5569 C CD1 . ILE F 1 42  ? -24.062 52.686  70.503  1.00 33.71 ? 182 ILE F CD1 1 
ATOM 5570 N N   . ASN F 1 43  ? -27.297 48.799  73.446  1.00 38.06 ? 183 ASN F N   1 
ATOM 5571 C CA  . ASN F 1 43  ? -27.628 48.185  74.731  1.00 40.74 ? 183 ASN F CA  1 
ATOM 5572 C C   . ASN F 1 43  ? -26.403 47.613  75.429  1.00 42.13 ? 183 ASN F C   1 
ATOM 5573 O O   . ASN F 1 43  ? -26.402 47.425  76.648  1.00 44.09 ? 183 ASN F O   1 
ATOM 5574 C CB  . ASN F 1 43  ? -28.663 47.076  74.552  1.00 42.48 ? 183 ASN F CB  1 
ATOM 5575 C CG  . ASN F 1 43  ? -29.996 47.600  74.064  1.00 46.59 ? 183 ASN F CG  1 
ATOM 5576 O OD1 . ASN F 1 43  ? -30.249 47.661  72.860  1.00 49.24 ? 183 ASN F OD1 1 
ATOM 5577 N ND2 . ASN F 1 43  ? -30.854 48.002  75.001  1.00 47.30 ? 183 ASN F ND2 1 
ATOM 5578 N N   . SER F 1 44  ? -25.361 47.337  74.655  1.00 42.16 ? 184 SER F N   1 
ATOM 5579 C CA  . SER F 1 44  ? -24.131 46.792  75.206  1.00 42.49 ? 184 SER F CA  1 
ATOM 5580 C C   . SER F 1 44  ? -22.937 47.429  74.513  1.00 42.62 ? 184 SER F C   1 
ATOM 5581 O O   . SER F 1 44  ? -23.070 48.010  73.436  1.00 41.79 ? 184 SER F O   1 
ATOM 5582 C CB  . SER F 1 44  ? -24.090 45.279  75.006  1.00 42.93 ? 184 SER F CB  1 
ATOM 5583 O OG  . SER F 1 44  ? -24.075 44.964  73.627  1.00 44.27 ? 184 SER F OG  1 
ATOM 5584 N N   . THR F 1 45  ? -21.770 47.328  75.139  1.00 43.17 ? 185 THR F N   1 
ATOM 5585 C CA  . THR F 1 45  ? -20.564 47.887  74.553  1.00 42.74 ? 185 THR F CA  1 
ATOM 5586 C C   . THR F 1 45  ? -20.286 47.107  73.279  1.00 43.27 ? 185 THR F C   1 
ATOM 5587 O O   . THR F 1 45  ? -19.759 47.656  72.310  1.00 44.26 ? 185 THR F O   1 
ATOM 5588 C CB  . THR F 1 45  ? -19.363 47.753  75.499  1.00 41.71 ? 185 THR F CB  1 
ATOM 5589 O OG1 . THR F 1 45  ? -19.186 46.378  75.850  1.00 41.84 ? 185 THR F OG1 1 
ATOM 5590 C CG2 . THR F 1 45  ? -19.588 48.564  76.757  1.00 41.03 ? 185 THR F CG2 1 
ATOM 5591 N N   . ALA F 1 46  ? -20.648 45.824  73.291  1.00 41.83 ? 186 ALA F N   1 
ATOM 5592 C CA  . ALA F 1 46  ? -20.461 44.956  72.135  1.00 39.93 ? 186 ALA F CA  1 
ATOM 5593 C C   . ALA F 1 46  ? -21.111 45.638  70.937  1.00 40.38 ? 186 ALA F C   1 
ATOM 5594 O O   . ALA F 1 46  ? -20.582 45.621  69.823  1.00 38.62 ? 186 ALA F O   1 
ATOM 5595 C CB  . ALA F 1 46  ? -21.112 43.616  72.390  1.00 38.59 ? 186 ALA F CB  1 
ATOM 5596 N N   . ASP F 1 47  ? -22.266 46.243  71.182  1.00 40.83 ? 187 ASP F N   1 
ATOM 5597 C CA  . ASP F 1 47  ? -22.989 46.952  70.143  1.00 41.34 ? 187 ASP F CA  1 
ATOM 5598 C C   . ASP F 1 47  ? -22.136 48.104  69.609  1.00 41.58 ? 187 ASP F C   1 
ATOM 5599 O O   . ASP F 1 47  ? -22.058 48.326  68.400  1.00 42.72 ? 187 ASP F O   1 
ATOM 5600 C CB  . ASP F 1 47  ? -24.311 47.483  70.709  1.00 42.13 ? 187 ASP F CB  1 
ATOM 5601 C CG  . ASP F 1 47  ? -25.303 46.370  71.016  1.00 44.57 ? 187 ASP F CG  1 
ATOM 5602 O OD1 . ASP F 1 47  ? -24.855 45.271  71.399  1.00 45.12 ? 187 ASP F OD1 1 
ATOM 5603 O OD2 . ASP F 1 47  ? -26.528 46.590  70.883  1.00 43.53 ? 187 ASP F OD2 1 
ATOM 5604 N N   . LEU F 1 48  ? -21.483 48.829  70.509  1.00 41.14 ? 188 LEU F N   1 
ATOM 5605 C CA  . LEU F 1 48  ? -20.653 49.953  70.097  1.00 40.69 ? 188 LEU F CA  1 
ATOM 5606 C C   . LEU F 1 48  ? -19.416 49.465  69.355  1.00 41.28 ? 188 LEU F C   1 
ATOM 5607 O O   . LEU F 1 48  ? -19.011 50.063  68.358  1.00 42.44 ? 188 LEU F O   1 
ATOM 5608 C CB  . LEU F 1 48  ? -20.231 50.782  71.309  1.00 40.47 ? 188 LEU F CB  1 
ATOM 5609 C CG  . LEU F 1 48  ? -19.685 52.168  70.966  1.00 40.80 ? 188 LEU F CG  1 
ATOM 5610 C CD1 . LEU F 1 48  ? -20.818 53.042  70.462  1.00 40.53 ? 188 LEU F CD1 1 
ATOM 5611 C CD2 . LEU F 1 48  ? -19.048 52.795  72.190  1.00 42.11 ? 188 LEU F CD2 1 
ATOM 5612 N N   . ASP F 1 49  ? -18.817 48.379  69.839  1.00 40.87 ? 189 ASP F N   1 
ATOM 5613 C CA  . ASP F 1 49  ? -17.629 47.828  69.195  1.00 39.46 ? 189 ASP F CA  1 
ATOM 5614 C C   . ASP F 1 49  ? -17.915 47.505  67.734  1.00 39.20 ? 189 ASP F C   1 
ATOM 5615 O O   . ASP F 1 49  ? -17.100 47.789  66.856  1.00 39.00 ? 189 ASP F O   1 
ATOM 5616 C CB  . ASP F 1 49  ? -17.152 46.559  69.915  1.00 38.65 ? 189 ASP F CB  1 
ATOM 5617 C CG  . ASP F 1 49  ? -16.640 46.839  71.313  1.00 39.80 ? 189 ASP F CG  1 
ATOM 5618 O OD1 . ASP F 1 49  ? -15.815 47.762  71.473  1.00 41.33 ? 189 ASP F OD1 1 
ATOM 5619 O OD2 . ASP F 1 49  ? -17.056 46.133  72.254  1.00 41.75 ? 189 ASP F OD2 1 
ATOM 5620 N N   . PHE F 1 50  ? -19.078 46.914  67.477  1.00 37.53 ? 190 PHE F N   1 
ATOM 5621 C CA  . PHE F 1 50  ? -19.458 46.560  66.122  1.00 35.49 ? 190 PHE F CA  1 
ATOM 5622 C C   . PHE F 1 50  ? -19.633 47.783  65.249  1.00 35.81 ? 190 PHE F C   1 
ATOM 5623 O O   . PHE F 1 50  ? -19.053 47.868  64.174  1.00 38.38 ? 190 PHE F O   1 
ATOM 5624 C CB  . PHE F 1 50  ? -20.759 45.769  66.110  1.00 36.36 ? 190 PHE F CB  1 
ATOM 5625 C CG  . PHE F 1 50  ? -21.429 45.757  64.774  1.00 35.73 ? 190 PHE F CG  1 
ATOM 5626 C CD1 . PHE F 1 50  ? -20.832 45.122  63.691  1.00 37.27 ? 190 PHE F CD1 1 
ATOM 5627 C CD2 . PHE F 1 50  ? -22.628 46.430  64.581  1.00 36.29 ? 190 PHE F CD2 1 
ATOM 5628 C CE1 . PHE F 1 50  ? -21.418 45.164  62.429  1.00 38.00 ? 190 PHE F CE1 1 
ATOM 5629 C CE2 . PHE F 1 50  ? -23.223 46.481  63.325  1.00 37.86 ? 190 PHE F CE2 1 
ATOM 5630 C CZ  . PHE F 1 50  ? -22.617 45.846  62.246  1.00 37.74 ? 190 PHE F CZ  1 
ATOM 5631 N N   . ILE F 1 51  ? -20.449 48.726  65.699  1.00 37.05 ? 191 ILE F N   1 
ATOM 5632 C CA  . ILE F 1 51  ? -20.684 49.931  64.922  1.00 38.91 ? 191 ILE F CA  1 
ATOM 5633 C C   . ILE F 1 51  ? -19.382 50.677  64.664  1.00 40.31 ? 191 ILE F C   1 
ATOM 5634 O O   . ILE F 1 51  ? -19.178 51.223  63.580  1.00 40.77 ? 191 ILE F O   1 
ATOM 5635 C CB  . ILE F 1 51  ? -21.688 50.862  65.631  1.00 39.19 ? 191 ILE F CB  1 
ATOM 5636 C CG1 . ILE F 1 51  ? -23.057 50.179  65.702  1.00 39.98 ? 191 ILE F CG1 1 
ATOM 5637 C CG2 . ILE F 1 51  ? -21.796 52.184  64.891  1.00 38.42 ? 191 ILE F CG2 1 
ATOM 5638 C CD1 . ILE F 1 51  ? -23.613 49.749  64.348  1.00 37.79 ? 191 ILE F CD1 1 
ATOM 5639 N N   . GLN F 1 52  ? -18.499 50.694  65.657  1.00 41.33 ? 192 GLN F N   1 
ATOM 5640 C CA  . GLN F 1 52  ? -17.214 51.365  65.515  1.00 43.00 ? 192 GLN F CA  1 
ATOM 5641 C C   . GLN F 1 52  ? -16.409 50.738  64.383  1.00 42.82 ? 192 GLN F C   1 
ATOM 5642 O O   . GLN F 1 52  ? -16.004 51.419  63.443  1.00 41.67 ? 192 GLN F O   1 
ATOM 5643 C CB  . GLN F 1 52  ? -16.423 51.277  66.823  1.00 45.17 ? 192 GLN F CB  1 
ATOM 5644 C CG  . GLN F 1 52  ? -14.921 51.568  66.683  1.00 49.25 ? 192 GLN F CG  1 
ATOM 5645 C CD  . GLN F 1 52  ? -14.616 52.950  66.119  1.00 50.75 ? 192 GLN F CD  1 
ATOM 5646 O OE1 . GLN F 1 52  ? -14.954 53.261  64.976  1.00 51.74 ? 192 GLN F OE1 1 
ATOM 5647 N NE2 . GLN F 1 52  ? -13.970 53.785  66.923  1.00 53.05 ? 192 GLN F NE2 1 
ATOM 5648 N N   . GLN F 1 53  ? -16.176 49.437  64.481  1.00 44.42 ? 193 GLN F N   1 
ATOM 5649 C CA  . GLN F 1 53  ? -15.422 48.725  63.460  1.00 47.40 ? 193 GLN F CA  1 
ATOM 5650 C C   . GLN F 1 53  ? -16.113 48.794  62.102  1.00 46.96 ? 193 GLN F C   1 
ATOM 5651 O O   . GLN F 1 53  ? -15.456 48.748  61.064  1.00 46.29 ? 193 GLN F O   1 
ATOM 5652 C CB  . GLN F 1 53  ? -15.230 47.260  63.869  1.00 50.31 ? 193 GLN F CB  1 
ATOM 5653 C CG  . GLN F 1 53  ? -14.255 47.052  65.022  1.00 57.24 ? 193 GLN F CG  1 
ATOM 5654 C CD  . GLN F 1 53  ? -14.053 45.584  65.364  1.00 61.92 ? 193 GLN F CD  1 
ATOM 5655 O OE1 . GLN F 1 53  ? -14.922 44.945  65.966  1.00 63.09 ? 193 GLN F OE1 1 
ATOM 5656 N NE2 . GLN F 1 53  ? -12.905 45.037  64.969  1.00 63.59 ? 193 GLN F NE2 1 
ATOM 5657 N N   . ALA F 1 54  ? -17.438 48.909  62.119  1.00 46.17 ? 194 ALA F N   1 
ATOM 5658 C CA  . ALA F 1 54  ? -18.222 48.974  60.893  1.00 45.26 ? 194 ALA F CA  1 
ATOM 5659 C C   . ALA F 1 54  ? -18.023 50.284  60.145  1.00 45.83 ? 194 ALA F C   1 
ATOM 5660 O O   . ALA F 1 54  ? -17.816 50.284  58.936  1.00 46.14 ? 194 ALA F O   1 
ATOM 5661 C CB  . ALA F 1 54  ? -19.687 48.785  61.210  1.00 44.64 ? 194 ALA F CB  1 
ATOM 5662 N N   . ILE F 1 55  ? -18.092 51.398  60.864  1.00 46.92 ? 195 ILE F N   1 
ATOM 5663 C CA  . ILE F 1 55  ? -17.921 52.712  60.248  1.00 48.24 ? 195 ILE F CA  1 
ATOM 5664 C C   . ILE F 1 55  ? -16.518 53.290  60.448  1.00 48.82 ? 195 ILE F C   1 
ATOM 5665 O O   . ILE F 1 55  ? -16.278 54.463  60.152  1.00 47.26 ? 195 ILE F O   1 
ATOM 5666 C CB  . ILE F 1 55  ? -18.936 53.725  60.817  1.00 48.31 ? 195 ILE F CB  1 
ATOM 5667 C CG1 . ILE F 1 55  ? -18.680 53.937  62.312  1.00 47.92 ? 195 ILE F CG1 1 
ATOM 5668 C CG2 . ILE F 1 55  ? -20.347 53.221  60.593  1.00 47.84 ? 195 ILE F CG2 1 
ATOM 5669 C CD1 . ILE F 1 55  ? -19.492 55.056  62.923  1.00 49.00 ? 195 ILE F CD1 1 
ATOM 5670 N N   . SER F 1 56  ? -15.595 52.468  60.941  1.00 49.52 ? 196 SER F N   1 
ATOM 5671 C CA  . SER F 1 56  ? -14.230 52.915  61.197  1.00 50.53 ? 196 SER F CA  1 
ATOM 5672 C C   . SER F 1 56  ? -13.641 53.683  60.023  1.00 51.78 ? 196 SER F C   1 
ATOM 5673 O O   . SER F 1 56  ? -12.984 54.705  60.210  1.00 53.48 ? 196 SER F O   1 
ATOM 5674 C CB  . SER F 1 56  ? -13.324 51.723  61.515  1.00 49.90 ? 196 SER F CB  1 
ATOM 5675 O OG  . SER F 1 56  ? -13.013 50.992  60.343  1.00 49.24 ? 196 SER F OG  1 
ATOM 5676 N N   . TYR F 1 57  ? -13.883 53.189  58.813  1.00 51.83 ? 197 TYR F N   1 
ATOM 5677 C CA  . TYR F 1 57  ? -13.361 53.812  57.602  1.00 50.56 ? 197 TYR F CA  1 
ATOM 5678 C C   . TYR F 1 57  ? -14.009 55.149  57.255  1.00 50.18 ? 197 TYR F C   1 
ATOM 5679 O O   . TYR F 1 57  ? -13.733 55.721  56.202  1.00 49.77 ? 197 TYR F O   1 
ATOM 5680 C CB  . TYR F 1 57  ? -13.522 52.849  56.423  1.00 49.76 ? 197 TYR F CB  1 
ATOM 5681 C CG  . TYR F 1 57  ? -14.941 52.381  56.201  1.00 47.70 ? 197 TYR F CG  1 
ATOM 5682 C CD1 . TYR F 1 57  ? -15.934 53.265  55.775  1.00 47.45 ? 197 TYR F CD1 1 
ATOM 5683 C CD2 . TYR F 1 57  ? -15.294 51.052  56.417  1.00 47.24 ? 197 TYR F CD2 1 
ATOM 5684 C CE1 . TYR F 1 57  ? -17.246 52.834  55.566  1.00 47.87 ? 197 TYR F CE1 1 
ATOM 5685 C CE2 . TYR F 1 57  ? -16.600 50.610  56.212  1.00 47.80 ? 197 TYR F CE2 1 
ATOM 5686 C CZ  . TYR F 1 57  ? -17.572 51.506  55.786  1.00 47.97 ? 197 TYR F CZ  1 
ATOM 5687 O OH  . TYR F 1 57  ? -18.863 51.072  55.578  1.00 47.85 ? 197 TYR F OH  1 
ATOM 5688 N N   . SER F 1 58  ? -14.865 55.652  58.136  1.00 50.17 ? 198 SER F N   1 
ATOM 5689 C CA  . SER F 1 58  ? -15.540 56.913  57.869  1.00 50.32 ? 198 SER F CA  1 
ATOM 5690 C C   . SER F 1 58  ? -14.968 58.090  58.641  1.00 51.94 ? 198 SER F C   1 
ATOM 5691 O O   . SER F 1 58  ? -14.096 57.930  59.495  1.00 53.28 ? 198 SER F O   1 
ATOM 5692 C CB  . SER F 1 58  ? -17.027 56.785  58.175  1.00 47.94 ? 198 SER F CB  1 
ATOM 5693 O OG  . SER F 1 58  ? -17.695 57.999  57.896  1.00 45.50 ? 198 SER F OG  1 
ATOM 5694 N N   . SER F 1 59  ? -15.475 59.277  58.327  1.00 53.22 ? 199 SER F N   1 
ATOM 5695 C CA  . SER F 1 59  ? -15.035 60.504  58.976  1.00 54.64 ? 199 SER F CA  1 
ATOM 5696 C C   . SER F 1 59  ? -16.215 61.337  59.479  1.00 54.74 ? 199 SER F C   1 
ATOM 5697 O O   . SER F 1 59  ? -16.111 61.999  60.513  1.00 55.36 ? 199 SER F O   1 
ATOM 5698 C CB  . SER F 1 59  ? -14.185 61.324  58.004  1.00 55.69 ? 199 SER F CB  1 
ATOM 5699 O OG  . SER F 1 59  ? -14.741 61.298  56.700  1.00 57.67 ? 199 SER F OG  1 
ATOM 5700 N N   . PHE F 1 60  ? -17.334 61.293  58.756  1.00 53.48 ? 200 PHE F N   1 
ATOM 5701 C CA  . PHE F 1 60  ? -18.532 62.044  59.133  1.00 51.63 ? 200 PHE F CA  1 
ATOM 5702 C C   . PHE F 1 60  ? -19.293 61.365  60.278  1.00 49.10 ? 200 PHE F C   1 
ATOM 5703 O O   . PHE F 1 60  ? -19.081 60.187  60.576  1.00 48.66 ? 200 PHE F O   1 
ATOM 5704 C CB  . PHE F 1 60  ? -19.471 62.199  57.933  1.00 54.77 ? 200 PHE F CB  1 
ATOM 5705 C CG  . PHE F 1 60  ? -18.766 62.468  56.630  1.00 58.98 ? 200 PHE F CG  1 
ATOM 5706 C CD1 . PHE F 1 60  ? -18.092 61.444  55.962  1.00 60.32 ? 200 PHE F CD1 1 
ATOM 5707 C CD2 . PHE F 1 60  ? -18.801 63.735  56.051  1.00 60.11 ? 200 PHE F CD2 1 
ATOM 5708 C CE1 . PHE F 1 60  ? -17.465 61.675  54.735  1.00 60.47 ? 200 PHE F CE1 1 
ATOM 5709 C CE2 . PHE F 1 60  ? -18.177 63.980  54.823  1.00 61.08 ? 200 PHE F CE2 1 
ATOM 5710 C CZ  . PHE F 1 60  ? -17.509 62.946  54.163  1.00 61.30 ? 200 PHE F CZ  1 
ATOM 5711 N N   . PRO F 1 61  ? -20.193 62.109  60.937  1.00 45.87 ? 201 PRO F N   1 
ATOM 5712 C CA  . PRO F 1 61  ? -20.998 61.604  62.056  1.00 43.35 ? 201 PRO F CA  1 
ATOM 5713 C C   . PRO F 1 61  ? -22.293 60.897  61.657  1.00 41.94 ? 201 PRO F C   1 
ATOM 5714 O O   . PRO F 1 61  ? -22.915 61.247  60.653  1.00 41.33 ? 201 PRO F O   1 
ATOM 5715 C CB  . PRO F 1 61  ? -21.268 62.865  62.860  1.00 43.52 ? 201 PRO F CB  1 
ATOM 5716 C CG  . PRO F 1 61  ? -21.437 63.880  61.796  1.00 43.34 ? 201 PRO F CG  1 
ATOM 5717 C CD  . PRO F 1 61  ? -20.301 63.575  60.843  1.00 43.35 ? 201 PRO F CD  1 
ATOM 5718 N N   . PHE F 1 62  ? -22.692 59.907  62.460  1.00 40.50 ? 202 PHE F N   1 
ATOM 5719 C CA  . PHE F 1 62  ? -23.920 59.139  62.224  1.00 38.37 ? 202 PHE F CA  1 
ATOM 5720 C C   . PHE F 1 62  ? -24.914 59.272  63.383  1.00 36.56 ? 202 PHE F C   1 
ATOM 5721 O O   . PHE F 1 62  ? -24.589 58.947  64.522  1.00 35.81 ? 202 PHE F O   1 
ATOM 5722 C CB  . PHE F 1 62  ? -23.624 57.644  62.056  1.00 38.75 ? 202 PHE F CB  1 
ATOM 5723 C CG  . PHE F 1 62  ? -22.863 57.293  60.811  1.00 40.96 ? 202 PHE F CG  1 
ATOM 5724 C CD1 . PHE F 1 62  ? -21.479 57.451  60.749  1.00 43.02 ? 202 PHE F CD1 1 
ATOM 5725 C CD2 . PHE F 1 62  ? -23.523 56.748  59.715  1.00 42.44 ? 202 PHE F CD2 1 
ATOM 5726 C CE1 . PHE F 1 62  ? -20.763 57.065  59.612  1.00 43.66 ? 202 PHE F CE1 1 
ATOM 5727 C CE2 . PHE F 1 62  ? -22.817 56.360  58.572  1.00 43.41 ? 202 PHE F CE2 1 
ATOM 5728 C CZ  . PHE F 1 62  ? -21.434 56.517  58.523  1.00 43.00 ? 202 PHE F CZ  1 
ATOM 5729 N N   . TRP F 1 63  ? -26.126 59.728  63.084  1.00 35.39 ? 203 TRP F N   1 
ATOM 5730 C CA  . TRP F 1 63  ? -27.168 59.874  64.098  1.00 34.14 ? 203 TRP F CA  1 
ATOM 5731 C C   . TRP F 1 63  ? -27.539 58.520  64.696  1.00 33.47 ? 203 TRP F C   1 
ATOM 5732 O O   . TRP F 1 63  ? -27.429 57.487  64.036  1.00 32.43 ? 203 TRP F O   1 
ATOM 5733 C CB  . TRP F 1 63  ? -28.442 60.460  63.483  1.00 35.35 ? 203 TRP F CB  1 
ATOM 5734 C CG  . TRP F 1 63  ? -28.418 61.923  63.159  1.00 37.28 ? 203 TRP F CG  1 
ATOM 5735 C CD1 . TRP F 1 63  ? -28.819 62.505  61.988  1.00 37.64 ? 203 TRP F CD1 1 
ATOM 5736 C CD2 . TRP F 1 63  ? -28.063 62.997  64.038  1.00 37.18 ? 203 TRP F CD2 1 
ATOM 5737 N NE1 . TRP F 1 63  ? -28.741 63.872  62.086  1.00 36.92 ? 203 TRP F NE1 1 
ATOM 5738 C CE2 . TRP F 1 63  ? -28.282 64.202  63.333  1.00 36.97 ? 203 TRP F CE2 1 
ATOM 5739 C CE3 . TRP F 1 63  ? -27.587 63.060  65.354  1.00 38.02 ? 203 TRP F CE3 1 
ATOM 5740 C CZ2 . TRP F 1 63  ? -28.036 65.457  63.899  1.00 36.56 ? 203 TRP F CZ2 1 
ATOM 5741 C CZ3 . TRP F 1 63  ? -27.342 64.309  65.917  1.00 38.15 ? 203 TRP F CZ3 1 
ATOM 5742 C CH2 . TRP F 1 63  ? -27.570 65.490  65.188  1.00 38.10 ? 203 TRP F CH2 1 
ATOM 5743 N N   . MET F 1 64  ? -27.981 58.534  65.949  1.00 33.99 ? 204 MET F N   1 
ATOM 5744 C CA  . MET F 1 64  ? -28.435 57.325  66.629  1.00 34.57 ? 204 MET F CA  1 
ATOM 5745 C C   . MET F 1 64  ? -29.750 57.676  67.320  1.00 34.90 ? 204 MET F C   1 
ATOM 5746 O O   . MET F 1 64  ? -30.106 58.850  67.415  1.00 35.24 ? 204 MET F O   1 
ATOM 5747 C CB  . MET F 1 64  ? -27.403 56.815  67.643  1.00 33.30 ? 204 MET F CB  1 
ATOM 5748 C CG  . MET F 1 64  ? -26.941 57.809  68.681  1.00 33.10 ? 204 MET F CG  1 
ATOM 5749 S SD  . MET F 1 64  ? -25.997 56.930  69.941  1.00 36.39 ? 204 MET F SD  1 
ATOM 5750 C CE  . MET F 1 64  ? -24.558 56.420  69.019  1.00 35.55 ? 204 MET F CE  1 
ATOM 5751 N N   . GLY F 1 65  ? -30.478 56.674  67.794  1.00 34.38 ? 205 GLY F N   1 
ATOM 5752 C CA  . GLY F 1 65  ? -31.758 56.945  68.429  1.00 35.41 ? 205 GLY F CA  1 
ATOM 5753 C C   . GLY F 1 65  ? -31.735 57.681  69.759  1.00 35.05 ? 205 GLY F C   1 
ATOM 5754 O O   . GLY F 1 65  ? -32.736 57.678  70.477  1.00 36.21 ? 205 GLY F O   1 
ATOM 5755 N N   . LEU F 1 66  ? -30.620 58.329  70.085  1.00 33.22 ? 206 LEU F N   1 
ATOM 5756 C CA  . LEU F 1 66  ? -30.501 59.039  71.357  1.00 32.01 ? 206 LEU F CA  1 
ATOM 5757 C C   . LEU F 1 66  ? -30.734 60.544  71.234  1.00 31.58 ? 206 LEU F C   1 
ATOM 5758 O O   . LEU F 1 66  ? -30.214 61.184  70.327  1.00 31.76 ? 206 LEU F O   1 
ATOM 5759 C CB  . LEU F 1 66  ? -29.117 58.787  71.953  1.00 30.86 ? 206 LEU F CB  1 
ATOM 5760 C CG  . LEU F 1 66  ? -28.966 58.945  73.463  1.00 29.02 ? 206 LEU F CG  1 
ATOM 5761 C CD1 . LEU F 1 66  ? -29.753 57.845  74.153  1.00 29.76 ? 206 LEU F CD1 1 
ATOM 5762 C CD2 . LEU F 1 66  ? -27.499 58.860  73.846  1.00 28.82 ? 206 LEU F CD2 1 
ATOM 5763 N N   . SER F 1 67  ? -31.517 61.105  72.151  1.00 32.02 ? 207 SER F N   1 
ATOM 5764 C CA  . SER F 1 67  ? -31.802 62.536  72.142  1.00 32.52 ? 207 SER F CA  1 
ATOM 5765 C C   . SER F 1 67  ? -32.584 62.983  73.377  1.00 33.55 ? 207 SER F C   1 
ATOM 5766 O O   . SER F 1 67  ? -33.080 62.162  74.146  1.00 32.49 ? 207 SER F O   1 
ATOM 5767 C CB  . SER F 1 67  ? -32.592 62.920  70.892  1.00 31.14 ? 207 SER F CB  1 
ATOM 5768 O OG  . SER F 1 67  ? -33.944 62.524  71.015  1.00 32.67 ? 207 SER F OG  1 
ATOM 5769 N N   . ARG F 1 68  ? -32.673 64.301  73.547  1.00 35.25 ? 208 ARG F N   1 
ATOM 5770 C CA  . ARG F 1 68  ? -33.390 64.933  74.651  1.00 35.55 ? 208 ARG F CA  1 
ATOM 5771 C C   . ARG F 1 68  ? -33.589 66.395  74.272  1.00 35.95 ? 208 ARG F C   1 
ATOM 5772 O O   . ARG F 1 68  ? -32.807 66.944  73.496  1.00 35.29 ? 208 ARG F O   1 
ATOM 5773 C CB  . ARG F 1 68  ? -32.588 64.841  75.958  1.00 36.21 ? 208 ARG F CB  1 
ATOM 5774 C CG  . ARG F 1 68  ? -31.334 65.704  76.027  1.00 36.38 ? 208 ARG F CG  1 
ATOM 5775 C CD  . ARG F 1 68  ? -30.607 65.511  77.357  1.00 37.50 ? 208 ARG F CD  1 
ATOM 5776 N NE  . ARG F 1 68  ? -29.351 66.258  77.426  1.00 38.65 ? 208 ARG F NE  1 
ATOM 5777 C CZ  . ARG F 1 68  ? -28.504 66.203  78.449  1.00 38.72 ? 208 ARG F CZ  1 
ATOM 5778 N NH1 . ARG F 1 68  ? -28.775 65.436  79.496  1.00 36.95 ? 208 ARG F NH1 1 
ATOM 5779 N NH2 . ARG F 1 68  ? -27.382 66.912  78.425  1.00 38.43 ? 208 ARG F NH2 1 
ATOM 5780 N N   . ARG F 1 69  ? -34.627 67.031  74.806  1.00 36.85 ? 209 ARG F N   1 
ATOM 5781 C CA  . ARG F 1 69  ? -34.859 68.427  74.469  1.00 36.38 ? 209 ARG F CA  1 
ATOM 5782 C C   . ARG F 1 69  ? -34.106 69.395  75.374  1.00 35.99 ? 209 ARG F C   1 
ATOM 5783 O O   . ARG F 1 69  ? -33.593 70.402  74.895  1.00 35.78 ? 209 ARG F O   1 
ATOM 5784 C CB  . ARG F 1 69  ? -36.357 68.736  74.440  1.00 36.74 ? 209 ARG F CB  1 
ATOM 5785 C CG  . ARG F 1 69  ? -37.064 68.117  73.223  1.00 36.58 ? 209 ARG F CG  1 
ATOM 5786 C CD  . ARG F 1 69  ? -38.465 68.676  72.998  1.00 36.43 ? 209 ARG F CD  1 
ATOM 5787 N NE  . ARG F 1 69  ? -38.447 70.103  72.686  1.00 38.79 ? 209 ARG F NE  1 
ATOM 5788 C CZ  . ARG F 1 69  ? -38.000 70.620  71.545  1.00 38.94 ? 209 ARG F CZ  1 
ATOM 5789 N NH1 . ARG F 1 69  ? -37.531 69.825  70.593  1.00 38.99 ? 209 ARG F NH1 1 
ATOM 5790 N NH2 . ARG F 1 69  ? -38.019 71.934  71.360  1.00 36.53 ? 209 ARG F NH2 1 
ATOM 5791 N N   . ASN F 1 70  ? -34.027 69.106  76.669  1.00 36.86 ? 210 ASN F N   1 
ATOM 5792 C CA  . ASN F 1 70  ? -33.263 69.977  77.561  1.00 37.93 ? 210 ASN F CA  1 
ATOM 5793 C C   . ASN F 1 70  ? -32.463 69.142  78.565  1.00 36.83 ? 210 ASN F C   1 
ATOM 5794 O O   . ASN F 1 70  ? -32.881 68.055  78.965  1.00 35.81 ? 210 ASN F O   1 
ATOM 5795 C CB  . ASN F 1 70  ? -34.167 71.001  78.272  1.00 38.91 ? 210 ASN F CB  1 
ATOM 5796 C CG  . ASN F 1 70  ? -34.822 70.451  79.513  1.00 41.24 ? 210 ASN F CG  1 
ATOM 5797 O OD1 . ASN F 1 70  ? -34.154 70.151  80.501  1.00 43.14 ? 210 ASN F OD1 1 
ATOM 5798 N ND2 . ASN F 1 70  ? -36.142 70.319  79.474  1.00 42.66 ? 210 ASN F ND2 1 
ATOM 5799 N N   . PRO F 1 71  ? -31.289 69.648  78.973  1.00 36.24 ? 211 PRO F N   1 
ATOM 5800 C CA  . PRO F 1 71  ? -30.337 69.043  79.911  1.00 36.07 ? 211 PRO F CA  1 
ATOM 5801 C C   . PRO F 1 71  ? -30.872 68.567  81.253  1.00 36.84 ? 211 PRO F C   1 
ATOM 5802 O O   . PRO F 1 71  ? -30.288 67.684  81.876  1.00 37.89 ? 211 PRO F O   1 
ATOM 5803 C CB  . PRO F 1 71  ? -29.287 70.135  80.081  1.00 36.26 ? 211 PRO F CB  1 
ATOM 5804 C CG  . PRO F 1 71  ? -29.336 70.859  78.775  1.00 36.52 ? 211 PRO F CG  1 
ATOM 5805 C CD  . PRO F 1 71  ? -30.809 70.973  78.543  1.00 35.91 ? 211 PRO F CD  1 
ATOM 5806 N N   . SER F 1 72  ? -31.972 69.150  81.708  1.00 37.09 ? 212 SER F N   1 
ATOM 5807 C CA  . SER F 1 72  ? -32.537 68.767  82.993  1.00 39.04 ? 212 SER F CA  1 
ATOM 5808 C C   . SER F 1 72  ? -33.132 67.356  83.020  1.00 40.97 ? 212 SER F C   1 
ATOM 5809 O O   . SER F 1 72  ? -33.498 66.855  84.085  1.00 43.53 ? 212 SER F O   1 
ATOM 5810 C CB  . SER F 1 72  ? -33.592 69.790  83.413  1.00 39.66 ? 212 SER F CB  1 
ATOM 5811 O OG  . SER F 1 72  ? -33.016 71.082  83.497  1.00 40.54 ? 212 SER F OG  1 
ATOM 5812 N N   . TYR F 1 73  ? -33.233 66.719  81.855  1.00 40.76 ? 213 TYR F N   1 
ATOM 5813 C CA  . TYR F 1 73  ? -33.777 65.365  81.759  1.00 38.19 ? 213 TYR F CA  1 
ATOM 5814 C C   . TYR F 1 73  ? -32.748 64.419  81.146  1.00 36.10 ? 213 TYR F C   1 
ATOM 5815 O O   . TYR F 1 73  ? -31.872 64.840  80.394  1.00 36.96 ? 213 TYR F O   1 
ATOM 5816 C CB  . TYR F 1 73  ? -35.039 65.356  80.899  1.00 41.19 ? 213 TYR F CB  1 
ATOM 5817 C CG  . TYR F 1 73  ? -36.216 66.094  81.492  1.00 44.82 ? 213 TYR F CG  1 
ATOM 5818 C CD1 . TYR F 1 73  ? -36.852 65.626  82.642  1.00 46.66 ? 213 TYR F CD1 1 
ATOM 5819 C CD2 . TYR F 1 73  ? -36.724 67.240  80.879  1.00 46.78 ? 213 TYR F CD2 1 
ATOM 5820 C CE1 . TYR F 1 73  ? -37.972 66.279  83.166  1.00 48.24 ? 213 TYR F CE1 1 
ATOM 5821 C CE2 . TYR F 1 73  ? -37.840 67.902  81.394  1.00 48.69 ? 213 TYR F CE2 1 
ATOM 5822 C CZ  . TYR F 1 73  ? -38.459 67.413  82.534  1.00 48.55 ? 213 TYR F CZ  1 
ATOM 5823 O OH  . TYR F 1 73  ? -39.572 68.049  83.030  1.00 48.89 ? 213 TYR F OH  1 
ATOM 5824 N N   . PRO F 1 74  ? -32.855 63.119  81.448  1.00 33.48 ? 214 PRO F N   1 
ATOM 5825 C CA  . PRO F 1 74  ? -31.930 62.112  80.928  1.00 32.64 ? 214 PRO F CA  1 
ATOM 5826 C C   . PRO F 1 74  ? -31.934 61.977  79.407  1.00 33.59 ? 214 PRO F C   1 
ATOM 5827 O O   . PRO F 1 74  ? -32.794 62.528  78.716  1.00 32.51 ? 214 PRO F O   1 
ATOM 5828 C CB  . PRO F 1 74  ? -32.406 60.835  81.613  1.00 31.48 ? 214 PRO F CB  1 
ATOM 5829 C CG  . PRO F 1 74  ? -33.871 61.047  81.696  1.00 30.72 ? 214 PRO F CG  1 
ATOM 5830 C CD  . PRO F 1 74  ? -33.951 62.474  82.190  1.00 32.92 ? 214 PRO F CD  1 
ATOM 5831 N N   . TRP F 1 75  ? -30.945 61.243  78.906  1.00 34.61 ? 215 TRP F N   1 
ATOM 5832 C CA  . TRP F 1 75  ? -30.809 60.964  77.485  1.00 35.10 ? 215 TRP F CA  1 
ATOM 5833 C C   . TRP F 1 75  ? -31.693 59.748  77.205  1.00 34.71 ? 215 TRP F C   1 
ATOM 5834 O O   . TRP F 1 75  ? -31.521 58.700  77.831  1.00 34.30 ? 215 TRP F O   1 
ATOM 5835 C CB  . TRP F 1 75  ? -29.353 60.622  77.149  1.00 36.47 ? 215 TRP F CB  1 
ATOM 5836 C CG  . TRP F 1 75  ? -28.462 61.803  76.860  1.00 39.82 ? 215 TRP F CG  1 
ATOM 5837 C CD1 . TRP F 1 75  ? -27.382 62.218  77.589  1.00 40.61 ? 215 TRP F CD1 1 
ATOM 5838 C CD2 . TRP F 1 75  ? -28.545 62.685  75.731  1.00 39.33 ? 215 TRP F CD2 1 
ATOM 5839 N NE1 . TRP F 1 75  ? -26.788 63.300  76.983  1.00 40.27 ? 215 TRP F NE1 1 
ATOM 5840 C CE2 . TRP F 1 75  ? -27.481 63.608  75.844  1.00 39.21 ? 215 TRP F CE2 1 
ATOM 5841 C CE3 . TRP F 1 75  ? -29.416 62.785  74.637  1.00 39.08 ? 215 TRP F CE3 1 
ATOM 5842 C CZ2 . TRP F 1 75  ? -27.264 64.618  74.900  1.00 39.17 ? 215 TRP F CZ2 1 
ATOM 5843 C CZ3 . TRP F 1 75  ? -29.198 63.790  73.698  1.00 37.75 ? 215 TRP F CZ3 1 
ATOM 5844 C CH2 . TRP F 1 75  ? -28.132 64.692  73.838  1.00 40.02 ? 215 TRP F CH2 1 
ATOM 5845 N N   . LEU F 1 76  ? -32.635 59.879  76.276  1.00 33.53 ? 216 LEU F N   1 
ATOM 5846 C CA  . LEU F 1 76  ? -33.517 58.762  75.958  1.00 32.81 ? 216 LEU F CA  1 
ATOM 5847 C C   . LEU F 1 76  ? -33.393 58.294  74.515  1.00 33.07 ? 216 LEU F C   1 
ATOM 5848 O O   . LEU F 1 76  ? -32.866 58.998  73.655  1.00 31.88 ? 216 LEU F O   1 
ATOM 5849 C CB  . LEU F 1 76  ? -34.983 59.126  76.222  1.00 30.22 ? 216 LEU F CB  1 
ATOM 5850 C CG  . LEU F 1 76  ? -35.394 59.761  77.550  1.00 30.11 ? 216 LEU F CG  1 
ATOM 5851 C CD1 . LEU F 1 76  ? -36.908 59.751  77.630  1.00 26.91 ? 216 LEU F CD1 1 
ATOM 5852 C CD2 . LEU F 1 76  ? -34.801 59.008  78.726  1.00 30.07 ? 216 LEU F CD2 1 
ATOM 5853 N N   . TRP F 1 77  ? -33.883 57.087  74.265  1.00 34.44 ? 217 TRP F N   1 
ATOM 5854 C CA  . TRP F 1 77  ? -33.869 56.521  72.931  1.00 35.39 ? 217 TRP F CA  1 
ATOM 5855 C C   . TRP F 1 77  ? -35.179 56.932  72.281  1.00 37.03 ? 217 TRP F C   1 
ATOM 5856 O O   . TRP F 1 77  ? -35.905 57.770  72.816  1.00 38.66 ? 217 TRP F O   1 
ATOM 5857 C CB  . TRP F 1 77  ? -33.755 54.997  72.999  1.00 34.73 ? 217 TRP F CB  1 
ATOM 5858 C CG  . TRP F 1 77  ? -32.439 54.546  73.550  1.00 34.30 ? 217 TRP F CG  1 
ATOM 5859 C CD1 . TRP F 1 77  ? -32.204 53.989  74.774  1.00 33.75 ? 217 TRP F CD1 1 
ATOM 5860 C CD2 . TRP F 1 77  ? -31.163 54.669  72.913  1.00 33.65 ? 217 TRP F CD2 1 
ATOM 5861 N NE1 . TRP F 1 77  ? -30.859 53.761  74.941  1.00 33.51 ? 217 TRP F NE1 1 
ATOM 5862 C CE2 . TRP F 1 77  ? -30.198 54.171  73.815  1.00 33.52 ? 217 TRP F CE2 1 
ATOM 5863 C CE3 . TRP F 1 77  ? -30.743 55.158  71.668  1.00 32.91 ? 217 TRP F CE3 1 
ATOM 5864 C CZ2 . TRP F 1 77  ? -28.834 54.142  73.509  1.00 34.20 ? 217 TRP F CZ2 1 
ATOM 5865 C CZ3 . TRP F 1 77  ? -29.390 55.131  71.364  1.00 33.68 ? 217 TRP F CZ3 1 
ATOM 5866 C CH2 . TRP F 1 77  ? -28.449 54.627  72.284  1.00 35.92 ? 217 TRP F CH2 1 
ATOM 5867 N N   . GLU F 1 78  ? -35.486 56.353  71.129  1.00 37.46 ? 218 GLU F N   1 
ATOM 5868 C CA  . GLU F 1 78  ? -36.720 56.697  70.444  1.00 36.75 ? 218 GLU F CA  1 
ATOM 5869 C C   . GLU F 1 78  ? -37.940 56.135  71.163  1.00 38.07 ? 218 GLU F C   1 
ATOM 5870 O O   . GLU F 1 78  ? -38.997 56.761  71.177  1.00 39.53 ? 218 GLU F O   1 
ATOM 5871 C CB  . GLU F 1 78  ? -36.688 56.190  69.000  1.00 35.18 ? 218 GLU F CB  1 
ATOM 5872 C CG  . GLU F 1 78  ? -35.787 56.993  68.076  1.00 33.32 ? 218 GLU F CG  1 
ATOM 5873 C CD  . GLU F 1 78  ? -35.892 56.551  66.628  1.00 33.00 ? 218 GLU F CD  1 
ATOM 5874 O OE1 . GLU F 1 78  ? -35.395 55.453  66.300  1.00 34.60 ? 218 GLU F OE1 1 
ATOM 5875 O OE2 . GLU F 1 78  ? -36.479 57.300  65.820  1.00 30.17 ? 218 GLU F OE2 1 
ATOM 5876 N N   . ASP F 1 79  ? -37.792 54.964  71.774  1.00 39.40 ? 219 ASP F N   1 
ATOM 5877 C CA  . ASP F 1 79  ? -38.907 54.327  72.469  1.00 40.82 ? 219 ASP F CA  1 
ATOM 5878 C C   . ASP F 1 79  ? -39.118 54.809  73.901  1.00 40.92 ? 219 ASP F C   1 
ATOM 5879 O O   . ASP F 1 79  ? -40.019 54.339  74.591  1.00 40.16 ? 219 ASP F O   1 
ATOM 5880 C CB  . ASP F 1 79  ? -38.731 52.805  72.449  1.00 42.77 ? 219 ASP F CB  1 
ATOM 5881 C CG  . ASP F 1 79  ? -37.478 52.353  73.168  1.00 45.74 ? 219 ASP F CG  1 
ATOM 5882 O OD1 . ASP F 1 79  ? -36.500 53.130  73.201  1.00 48.97 ? 219 ASP F OD1 1 
ATOM 5883 O OD2 . ASP F 1 79  ? -37.466 51.217  73.688  1.00 46.56 ? 219 ASP F OD2 1 
ATOM 5884 N N   . GLY F 1 80  ? -38.287 55.741  74.353  1.00 41.83 ? 220 GLY F N   1 
ATOM 5885 C CA  . GLY F 1 80  ? -38.447 56.260  75.699  1.00 42.66 ? 220 GLY F CA  1 
ATOM 5886 C C   . GLY F 1 80  ? -37.627 55.595  76.790  1.00 43.17 ? 220 GLY F C   1 
ATOM 5887 O O   . GLY F 1 80  ? -37.705 55.996  77.955  1.00 42.86 ? 220 GLY F O   1 
ATOM 5888 N N   . SER F 1 81  ? -36.856 54.571  76.436  1.00 42.96 ? 221 SER F N   1 
ATOM 5889 C CA  . SER F 1 81  ? -36.020 53.901  77.422  1.00 42.50 ? 221 SER F CA  1 
ATOM 5890 C C   . SER F 1 81  ? -34.819 54.802  77.700  1.00 43.44 ? 221 SER F C   1 
ATOM 5891 O O   . SER F 1 81  ? -34.332 55.497  76.806  1.00 43.28 ? 221 SER F O   1 
ATOM 5892 C CB  . SER F 1 81  ? -35.576 52.534  76.901  1.00 41.42 ? 221 SER F CB  1 
ATOM 5893 O OG  . SER F 1 81  ? -35.378 52.560  75.501  1.00 40.23 ? 221 SER F OG  1 
ATOM 5894 N N   . PRO F 1 82  ? -34.332 54.811  78.950  1.00 43.87 ? 222 PRO F N   1 
ATOM 5895 C CA  . PRO F 1 82  ? -33.189 55.638  79.343  1.00 44.13 ? 222 PRO F CA  1 
ATOM 5896 C C   . PRO F 1 82  ? -31.858 55.107  78.824  1.00 44.60 ? 222 PRO F C   1 
ATOM 5897 O O   . PRO F 1 82  ? -31.759 53.952  78.409  1.00 44.17 ? 222 PRO F O   1 
ATOM 5898 C CB  . PRO F 1 82  ? -33.262 55.597  80.858  1.00 43.77 ? 222 PRO F CB  1 
ATOM 5899 C CG  . PRO F 1 82  ? -33.651 54.162  81.095  1.00 44.37 ? 222 PRO F CG  1 
ATOM 5900 C CD  . PRO F 1 82  ? -34.767 53.961  80.075  1.00 44.48 ? 222 PRO F CD  1 
ATOM 5901 N N   . LEU F 1 83  ? -30.838 55.959  78.855  1.00 44.82 ? 223 LEU F N   1 
ATOM 5902 C CA  . LEU F 1 83  ? -29.508 55.575  78.403  1.00 45.55 ? 223 LEU F CA  1 
ATOM 5903 C C   . LEU F 1 83  ? -28.769 54.831  79.500  1.00 47.45 ? 223 LEU F C   1 
ATOM 5904 O O   . LEU F 1 83  ? -28.151 55.445  80.365  1.00 47.62 ? 223 LEU F O   1 
ATOM 5905 C CB  . LEU F 1 83  ? -28.695 56.809  78.007  1.00 43.17 ? 223 LEU F CB  1 
ATOM 5906 C CG  . LEU F 1 83  ? -27.197 56.544  77.834  1.00 39.76 ? 223 LEU F CG  1 
ATOM 5907 C CD1 . LEU F 1 83  ? -26.969 55.593  76.677  1.00 40.93 ? 223 LEU F CD1 1 
ATOM 5908 C CD2 . LEU F 1 83  ? -26.473 57.842  77.596  1.00 38.33 ? 223 LEU F CD2 1 
ATOM 5909 N N   . MET F 1 84  ? -28.837 53.506  79.460  1.00 51.13 ? 224 MET F N   1 
ATOM 5910 C CA  . MET F 1 84  ? -28.165 52.678  80.450  1.00 55.14 ? 224 MET F CA  1 
ATOM 5911 C C   . MET F 1 84  ? -26.752 53.202  80.647  1.00 55.68 ? 224 MET F C   1 
ATOM 5912 O O   . MET F 1 84  ? -26.078 53.569  79.685  1.00 54.34 ? 224 MET F O   1 
ATOM 5913 C CB  . MET F 1 84  ? -28.101 51.230  79.966  1.00 59.91 ? 224 MET F CB  1 
ATOM 5914 C CG  . MET F 1 84  ? -27.481 50.258  80.959  1.00 67.30 ? 224 MET F CG  1 
ATOM 5915 S SD  . MET F 1 84  ? -27.052 48.664  80.210  1.00 75.34 ? 224 MET F SD  1 
ATOM 5916 C CE  . MET F 1 84  ? -25.259 48.684  80.419  1.00 73.24 ? 224 MET F CE  1 
ATOM 5917 N N   . PRO F 1 85  ? -26.284 53.252  81.901  1.00 57.28 ? 225 PRO F N   1 
ATOM 5918 C CA  . PRO F 1 85  ? -24.929 53.746  82.138  1.00 58.12 ? 225 PRO F CA  1 
ATOM 5919 C C   . PRO F 1 85  ? -23.859 52.696  81.838  1.00 59.52 ? 225 PRO F C   1 
ATOM 5920 O O   . PRO F 1 85  ? -24.147 51.498  81.732  1.00 60.33 ? 225 PRO F O   1 
ATOM 5921 C CB  . PRO F 1 85  ? -24.966 54.129  83.610  1.00 56.55 ? 225 PRO F CB  1 
ATOM 5922 C CG  . PRO F 1 85  ? -25.856 53.076  84.184  1.00 55.93 ? 225 PRO F CG  1 
ATOM 5923 C CD  . PRO F 1 85  ? -26.987 53.016  83.175  1.00 56.86 ? 225 PRO F CD  1 
ATOM 5924 N N   . HIS F 1 86  ? -22.625 53.165  81.688  1.00 59.67 ? 226 HIS F N   1 
ATOM 5925 C CA  . HIS F 1 86  ? -21.482 52.300  81.432  1.00 60.69 ? 226 HIS F CA  1 
ATOM 5926 C C   . HIS F 1 86  ? -21.378 51.773  80.007  1.00 59.16 ? 226 HIS F C   1 
ATOM 5927 O O   . HIS F 1 86  ? -20.799 50.714  79.768  1.00 59.06 ? 226 HIS F O   1 
ATOM 5928 C CB  . HIS F 1 86  ? -21.483 51.138  82.431  1.00 65.07 ? 226 HIS F CB  1 
ATOM 5929 C CG  . HIS F 1 86  ? -21.745 51.568  83.843  1.00 69.64 ? 226 HIS F CG  1 
ATOM 5930 N ND1 . HIS F 1 86  ? -21.036 52.578  84.455  1.00 71.90 ? 226 HIS F ND1 1 
ATOM 5931 C CD2 . HIS F 1 86  ? -22.664 51.151  84.746  1.00 71.41 ? 226 HIS F CD2 1 
ATOM 5932 C CE1 . HIS F 1 86  ? -21.509 52.769  85.675  1.00 72.94 ? 226 HIS F CE1 1 
ATOM 5933 N NE2 . HIS F 1 86  ? -22.497 51.916  85.876  1.00 72.38 ? 226 HIS F NE2 1 
ATOM 5934 N N   . LEU F 1 87  ? -21.943 52.518  79.063  1.00 57.36 ? 227 LEU F N   1 
ATOM 5935 C CA  . LEU F 1 87  ? -21.872 52.155  77.653  1.00 55.58 ? 227 LEU F CA  1 
ATOM 5936 C C   . LEU F 1 87  ? -20.937 53.166  77.001  1.00 54.31 ? 227 LEU F C   1 
ATOM 5937 O O   . LEU F 1 87  ? -19.868 52.814  76.504  1.00 54.49 ? 227 LEU F O   1 
ATOM 5938 C CB  . LEU F 1 87  ? -23.253 52.219  76.998  1.00 54.94 ? 227 LEU F CB  1 
ATOM 5939 C CG  . LEU F 1 87  ? -24.278 51.181  77.455  1.00 54.89 ? 227 LEU F CG  1 
ATOM 5940 C CD1 . LEU F 1 87  ? -25.537 51.316  76.612  1.00 54.47 ? 227 LEU F CD1 1 
ATOM 5941 C CD2 . LEU F 1 87  ? -23.692 49.780  77.321  1.00 54.35 ? 227 LEU F CD2 1 
ATOM 5942 N N   . PHE F 1 88  ? -21.351 54.427  77.010  1.00 53.06 ? 228 PHE F N   1 
ATOM 5943 C CA  . PHE F 1 88  ? -20.539 55.502  76.461  1.00 52.98 ? 228 PHE F CA  1 
ATOM 5944 C C   . PHE F 1 88  ? -20.825 56.807  77.204  1.00 53.11 ? 228 PHE F C   1 
ATOM 5945 O O   . PHE F 1 88  ? -21.721 56.867  78.047  1.00 52.74 ? 228 PHE F O   1 
ATOM 5946 C CB  . PHE F 1 88  ? -20.763 55.645  74.945  1.00 51.14 ? 228 PHE F CB  1 
ATOM 5947 C CG  . PHE F 1 88  ? -22.192 55.869  74.543  1.00 50.45 ? 228 PHE F CG  1 
ATOM 5948 C CD1 . PHE F 1 88  ? -22.781 57.120  74.670  1.00 50.48 ? 228 PHE F CD1 1 
ATOM 5949 C CD2 . PHE F 1 88  ? -22.941 54.831  74.003  1.00 50.75 ? 228 PHE F CD2 1 
ATOM 5950 C CE1 . PHE F 1 88  ? -24.095 57.335  74.262  1.00 50.83 ? 228 PHE F CE1 1 
ATOM 5951 C CE2 . PHE F 1 88  ? -24.253 55.036  73.594  1.00 51.12 ? 228 PHE F CE2 1 
ATOM 5952 C CZ  . PHE F 1 88  ? -24.831 56.292  73.722  1.00 50.67 ? 228 PHE F CZ  1 
ATOM 5953 N N   . ARG F 1 89  ? -20.049 57.841  76.898  1.00 52.79 ? 229 ARG F N   1 
ATOM 5954 C CA  . ARG F 1 89  ? -20.186 59.138  77.551  1.00 52.07 ? 229 ARG F CA  1 
ATOM 5955 C C   . ARG F 1 89  ? -20.497 60.238  76.537  1.00 50.72 ? 229 ARG F C   1 
ATOM 5956 O O   . ARG F 1 89  ? -19.616 60.674  75.797  1.00 50.43 ? 229 ARG F O   1 
ATOM 5957 C CB  . ARG F 1 89  ? -18.882 59.448  78.287  1.00 55.07 ? 229 ARG F CB  1 
ATOM 5958 C CG  . ARG F 1 89  ? -18.894 60.661  79.196  1.00 59.79 ? 229 ARG F CG  1 
ATOM 5959 C CD  . ARG F 1 89  ? -17.607 60.690  80.013  1.00 62.59 ? 229 ARG F CD  1 
ATOM 5960 N NE  . ARG F 1 89  ? -17.735 61.491  81.227  1.00 66.96 ? 229 ARG F NE  1 
ATOM 5961 C CZ  . ARG F 1 89  ? -16.908 61.408  82.266  1.00 67.10 ? 229 ARG F CZ  1 
ATOM 5962 N NH1 . ARG F 1 89  ? -15.892 60.555  82.238  1.00 66.47 ? 229 ARG F NH1 1 
ATOM 5963 N NH2 . ARG F 1 89  ? -17.097 62.177  83.333  1.00 66.05 ? 229 ARG F NH2 1 
ATOM 5964 N N   . VAL F 1 90  ? -21.749 60.685  76.501  1.00 49.28 ? 230 VAL F N   1 
ATOM 5965 C CA  . VAL F 1 90  ? -22.152 61.735  75.571  1.00 48.00 ? 230 VAL F CA  1 
ATOM 5966 C C   . VAL F 1 90  ? -21.307 62.998  75.775  1.00 49.11 ? 230 VAL F C   1 
ATOM 5967 O O   . VAL F 1 90  ? -21.349 63.630  76.835  1.00 49.61 ? 230 VAL F O   1 
ATOM 5968 C CB  . VAL F 1 90  ? -23.638 62.101  75.746  1.00 45.22 ? 230 VAL F CB  1 
ATOM 5969 C CG1 . VAL F 1 90  ? -24.105 62.927  74.559  1.00 44.21 ? 230 VAL F CG1 1 
ATOM 5970 C CG2 . VAL F 1 90  ? -24.472 60.846  75.887  1.00 43.99 ? 230 VAL F CG2 1 
ATOM 5971 N N   . ARG F 1 91  ? -20.550 63.364  74.746  1.00 48.05 ? 231 ARG F N   1 
ATOM 5972 C CA  . ARG F 1 91  ? -19.682 64.533  74.800  1.00 46.74 ? 231 ARG F CA  1 
ATOM 5973 C C   . ARG F 1 91  ? -20.230 65.684  73.957  1.00 47.43 ? 231 ARG F C   1 
ATOM 5974 O O   . ARG F 1 91  ? -21.312 65.582  73.376  1.00 48.57 ? 231 ARG F O   1 
ATOM 5975 C CB  . ARG F 1 91  ? -18.293 64.141  74.298  1.00 46.26 ? 231 ARG F CB  1 
ATOM 5976 C CG  . ARG F 1 91  ? -17.631 63.039  75.118  1.00 44.33 ? 231 ARG F CG  1 
ATOM 5977 C CD  . ARG F 1 91  ? -16.486 62.373  74.367  1.00 40.90 ? 231 ARG F CD  1 
ATOM 5978 N NE  . ARG F 1 91  ? -15.668 61.544  75.249  1.00 38.06 ? 231 ARG F NE  1 
ATOM 5979 C CZ  . ARG F 1 91  ? -14.741 60.692  74.828  1.00 38.12 ? 231 ARG F CZ  1 
ATOM 5980 N NH1 . ARG F 1 91  ? -14.517 60.546  73.530  1.00 39.68 ? 231 ARG F NH1 1 
ATOM 5981 N NH2 . ARG F 1 91  ? -14.020 60.003  75.704  1.00 36.64 ? 231 ARG F NH2 1 
ATOM 5982 N N   . GLY F 1 92  ? -19.485 66.785  73.908  1.00 46.72 ? 232 GLY F N   1 
ATOM 5983 C CA  . GLY F 1 92  ? -19.902 67.926  73.110  1.00 46.80 ? 232 GLY F CA  1 
ATOM 5984 C C   . GLY F 1 92  ? -20.792 68.986  73.742  1.00 47.79 ? 232 GLY F C   1 
ATOM 5985 O O   . GLY F 1 92  ? -20.661 69.323  74.923  1.00 46.36 ? 232 GLY F O   1 
ATOM 5986 N N   . ALA F 1 93  ? -21.704 69.513  72.929  1.00 48.25 ? 233 ALA F N   1 
ATOM 5987 C CA  . ALA F 1 93  ? -22.637 70.560  73.338  1.00 49.89 ? 233 ALA F CA  1 
ATOM 5988 C C   . ALA F 1 93  ? -23.780 70.056  74.226  1.00 50.80 ? 233 ALA F C   1 
ATOM 5989 O O   . ALA F 1 93  ? -24.935 70.463  74.064  1.00 50.29 ? 233 ALA F O   1 
ATOM 5990 C CB  . ALA F 1 93  ? -23.201 71.234  72.094  1.00 49.04 ? 233 ALA F CB  1 
ATOM 5991 N N   . VAL F 1 94  ? -23.441 69.194  75.179  1.00 51.17 ? 234 VAL F N   1 
ATOM 5992 C CA  . VAL F 1 94  ? -24.414 68.598  76.087  1.00 51.86 ? 234 VAL F CA  1 
ATOM 5993 C C   . VAL F 1 94  ? -25.411 69.527  76.780  1.00 53.57 ? 234 VAL F C   1 
ATOM 5994 O O   . VAL F 1 94  ? -26.577 69.159  76.951  1.00 53.64 ? 234 VAL F O   1 
ATOM 5995 C CB  . VAL F 1 94  ? -23.701 67.779  77.176  1.00 50.70 ? 234 VAL F CB  1 
ATOM 5996 C CG1 . VAL F 1 94  ? -23.026 66.566  76.559  1.00 48.75 ? 234 VAL F CG1 1 
ATOM 5997 C CG2 . VAL F 1 94  ? -22.681 68.649  77.884  1.00 49.58 ? 234 VAL F CG2 1 
ATOM 5998 N N   . SER F 1 95  ? -24.973 70.719  77.177  1.00 54.97 ? 235 SER F N   1 
ATOM 5999 C CA  . SER F 1 95  ? -25.863 71.639  77.884  1.00 55.10 ? 235 SER F CA  1 
ATOM 6000 C C   . SER F 1 95  ? -26.665 72.611  77.021  1.00 54.24 ? 235 SER F C   1 
ATOM 6001 O O   . SER F 1 95  ? -27.638 73.198  77.492  1.00 54.46 ? 235 SER F O   1 
ATOM 6002 C CB  . SER F 1 95  ? -25.072 72.428  78.927  1.00 55.37 ? 235 SER F CB  1 
ATOM 6003 O OG  . SER F 1 95  ? -24.045 73.187  78.313  1.00 57.01 ? 235 SER F OG  1 
ATOM 6004 N N   . GLN F 1 96  ? -26.265 72.789  75.768  1.00 53.46 ? 236 GLN F N   1 
ATOM 6005 C CA  . GLN F 1 96  ? -26.984 73.699  74.884  1.00 53.00 ? 236 GLN F CA  1 
ATOM 6006 C C   . GLN F 1 96  ? -28.421 73.242  74.645  1.00 52.45 ? 236 GLN F C   1 
ATOM 6007 O O   . GLN F 1 96  ? -28.717 72.048  74.678  1.00 52.80 ? 236 GLN F O   1 
ATOM 6008 C CB  . GLN F 1 96  ? -26.251 73.825  73.547  1.00 54.54 ? 236 GLN F CB  1 
ATOM 6009 C CG  . GLN F 1 96  ? -25.044 74.742  73.592  1.00 57.28 ? 236 GLN F CG  1 
ATOM 6010 C CD  . GLN F 1 96  ? -24.047 74.339  74.658  1.00 59.32 ? 236 GLN F CD  1 
ATOM 6011 O OE1 . GLN F 1 96  ? -23.494 73.240  74.625  1.00 59.17 ? 236 GLN F OE1 1 
ATOM 6012 N NE2 . GLN F 1 96  ? -23.812 75.231  75.615  1.00 61.18 ? 236 GLN F NE2 1 
ATOM 6013 N N   . THR F 1 97  ? -29.311 74.204  74.412  1.00 51.51 ? 237 THR F N   1 
ATOM 6014 C CA  . THR F 1 97  ? -30.720 73.919  74.154  1.00 50.22 ? 237 THR F CA  1 
ATOM 6015 C C   . THR F 1 97  ? -31.128 74.551  72.831  1.00 48.91 ? 237 THR F C   1 
ATOM 6016 O O   . THR F 1 97  ? -31.400 75.746  72.765  1.00 48.76 ? 237 THR F O   1 
ATOM 6017 C CB  . THR F 1 97  ? -31.634 74.496  75.253  1.00 50.60 ? 237 THR F CB  1 
ATOM 6018 O OG1 . THR F 1 97  ? -31.177 74.059  76.537  1.00 52.18 ? 237 THR F OG1 1 
ATOM 6019 C CG2 . THR F 1 97  ? -33.065 74.022  75.056  1.00 51.66 ? 237 THR F CG2 1 
ATOM 6020 N N   . TYR F 1 98  ? -31.177 73.747  71.779  1.00 48.72 ? 238 TYR F N   1 
ATOM 6021 C CA  . TYR F 1 98  ? -31.552 74.251  70.465  1.00 49.41 ? 238 TYR F CA  1 
ATOM 6022 C C   . TYR F 1 98  ? -33.055 74.092  70.238  1.00 48.52 ? 238 TYR F C   1 
ATOM 6023 O O   . TYR F 1 98  ? -33.706 73.290  70.905  1.00 49.97 ? 238 TYR F O   1 
ATOM 6024 C CB  . TYR F 1 98  ? -30.766 73.509  69.381  1.00 51.34 ? 238 TYR F CB  1 
ATOM 6025 C CG  . TYR F 1 98  ? -29.290 73.356  69.692  1.00 52.80 ? 238 TYR F CG  1 
ATOM 6026 C CD1 . TYR F 1 98  ? -28.829 72.306  70.485  1.00 53.38 ? 238 TYR F CD1 1 
ATOM 6027 C CD2 . TYR F 1 98  ? -28.357 74.270  69.209  1.00 53.36 ? 238 TYR F CD2 1 
ATOM 6028 C CE1 . TYR F 1 98  ? -27.474 72.169  70.785  1.00 53.65 ? 238 TYR F CE1 1 
ATOM 6029 C CE2 . TYR F 1 98  ? -27.001 74.143  69.507  1.00 54.32 ? 238 TYR F CE2 1 
ATOM 6030 C CZ  . TYR F 1 98  ? -26.568 73.091  70.293  1.00 53.75 ? 238 TYR F CZ  1 
ATOM 6031 O OH  . TYR F 1 98  ? -25.230 72.957  70.582  1.00 54.84 ? 238 TYR F OH  1 
ATOM 6032 N N   . PRO F 1 99  ? -33.626 74.855  69.291  1.00 47.47 ? 239 PRO F N   1 
ATOM 6033 C CA  . PRO F 1 99  ? -35.063 74.767  69.011  1.00 46.37 ? 239 PRO F CA  1 
ATOM 6034 C C   . PRO F 1 99  ? -35.556 73.343  68.798  1.00 45.08 ? 239 PRO F C   1 
ATOM 6035 O O   . PRO F 1 99  ? -36.566 72.937  69.365  1.00 43.81 ? 239 PRO F O   1 
ATOM 6036 C CB  . PRO F 1 99  ? -35.222 75.627  67.758  1.00 46.51 ? 239 PRO F CB  1 
ATOM 6037 C CG  . PRO F 1 99  ? -34.172 76.678  67.949  1.00 47.41 ? 239 PRO F CG  1 
ATOM 6038 C CD  . PRO F 1 99  ? -32.988 75.859  68.421  1.00 47.85 ? 239 PRO F CD  1 
ATOM 6039 N N   . SER F 1 100 ? -34.830 72.587  67.984  1.00 45.77 ? 240 SER F N   1 
ATOM 6040 C CA  . SER F 1 100 ? -35.203 71.213  67.677  1.00 45.49 ? 240 SER F CA  1 
ATOM 6041 C C   . SER F 1 100 ? -34.659 70.214  68.689  1.00 45.84 ? 240 SER F C   1 
ATOM 6042 O O   . SER F 1 100 ? -34.881 69.014  68.572  1.00 45.95 ? 240 SER F O   1 
ATOM 6043 C CB  . SER F 1 100 ? -34.722 70.852  66.271  1.00 46.26 ? 240 SER F CB  1 
ATOM 6044 O OG  . SER F 1 100 ? -35.236 71.761  65.309  1.00 44.98 ? 240 SER F OG  1 
ATOM 6045 N N   . GLY F 1 101 ? -33.945 70.716  69.687  1.00 47.83 ? 241 GLY F N   1 
ATOM 6046 C CA  . GLY F 1 101 ? -33.403 69.844  70.712  1.00 48.72 ? 241 GLY F CA  1 
ATOM 6047 C C   . GLY F 1 101 ? -32.014 69.318  70.410  1.00 49.25 ? 241 GLY F C   1 
ATOM 6048 O O   . GLY F 1 101 ? -31.430 69.622  69.364  1.00 50.07 ? 241 GLY F O   1 
ATOM 6049 N N   . THR F 1 102 ? -31.483 68.524  71.334  1.00 47.69 ? 242 THR F N   1 
ATOM 6050 C CA  . THR F 1 102 ? -30.156 67.948  71.180  1.00 46.90 ? 242 THR F CA  1 
ATOM 6051 C C   . THR F 1 102 ? -30.249 66.476  70.793  1.00 45.87 ? 242 THR F C   1 
ATOM 6052 O O   . THR F 1 102 ? -31.025 65.717  71.367  1.00 45.12 ? 242 THR F O   1 
ATOM 6053 C CB  . THR F 1 102 ? -29.344 68.065  72.489  1.00 47.98 ? 242 THR F CB  1 
ATOM 6054 O OG1 . THR F 1 102 ? -29.263 69.440  72.887  1.00 48.17 ? 242 THR F OG1 1 
ATOM 6055 C CG2 . THR F 1 102 ? -27.936 67.519  72.289  1.00 47.64 ? 242 THR F CG2 1 
ATOM 6056 N N   . CYS F 1 103 ? -29.444 66.080  69.815  1.00 45.27 ? 243 CYS F N   1 
ATOM 6057 C CA  . CYS F 1 103 ? -29.418 64.704  69.339  1.00 42.97 ? 243 CYS F CA  1 
ATOM 6058 C C   . CYS F 1 103 ? -27.989 64.177  69.387  1.00 41.93 ? 243 CYS F C   1 
ATOM 6059 O O   . CYS F 1 103 ? -27.035 64.931  69.199  1.00 42.77 ? 243 CYS F O   1 
ATOM 6060 C CB  . CYS F 1 103 ? -29.973 64.641  67.914  1.00 43.92 ? 243 CYS F CB  1 
ATOM 6061 S SG  . CYS F 1 103 ? -31.777 64.883  67.853  1.00 46.14 ? 243 CYS F SG  1 
ATOM 6062 N N   . ALA F 1 104 ? -27.842 62.882  69.645  1.00 39.39 ? 244 ALA F N   1 
ATOM 6063 C CA  . ALA F 1 104 ? -26.525 62.270  69.734  1.00 36.73 ? 244 ALA F CA  1 
ATOM 6064 C C   . ALA F 1 104 ? -26.148 61.502  68.474  1.00 36.40 ? 244 ALA F C   1 
ATOM 6065 O O   . ALA F 1 104 ? -27.006 60.927  67.807  1.00 35.33 ? 244 ALA F O   1 
ATOM 6066 C CB  . ALA F 1 104 ? -26.473 61.344  70.943  1.00 34.71 ? 244 ALA F CB  1 
ATOM 6067 N N   . TYR F 1 105 ? -24.857 61.506  68.151  1.00 36.17 ? 245 TYR F N   1 
ATOM 6068 C CA  . TYR F 1 105 ? -24.351 60.790  66.986  1.00 36.82 ? 245 TYR F CA  1 
ATOM 6069 C C   . TYR F 1 105 ? -23.009 60.152  67.320  1.00 37.88 ? 245 TYR F C   1 
ATOM 6070 O O   . TYR F 1 105 ? -22.327 60.584  68.242  1.00 39.86 ? 245 TYR F O   1 
ATOM 6071 C CB  . TYR F 1 105 ? -24.208 61.734  65.780  1.00 35.85 ? 245 TYR F CB  1 
ATOM 6072 C CG  . TYR F 1 105 ? -23.164 62.824  65.908  1.00 35.51 ? 245 TYR F CG  1 
ATOM 6073 C CD1 . TYR F 1 105 ? -21.809 62.515  66.056  1.00 36.15 ? 245 TYR F CD1 1 
ATOM 6074 C CD2 . TYR F 1 105 ? -23.527 64.170  65.852  1.00 35.22 ? 245 TYR F CD2 1 
ATOM 6075 C CE1 . TYR F 1 105 ? -20.842 63.523  66.143  1.00 34.78 ? 245 TYR F CE1 1 
ATOM 6076 C CE2 . TYR F 1 105 ? -22.571 65.182  65.938  1.00 32.65 ? 245 TYR F CE2 1 
ATOM 6077 C CZ  . TYR F 1 105 ? -21.235 64.851  66.083  1.00 33.43 ? 245 TYR F CZ  1 
ATOM 6078 O OH  . TYR F 1 105 ? -20.293 65.847  66.172  1.00 33.47 ? 245 TYR F OH  1 
ATOM 6079 N N   . ILE F 1 106 ? -22.624 59.126  66.570  1.00 39.58 ? 246 ILE F N   1 
ATOM 6080 C CA  . ILE F 1 106 ? -21.354 58.456  66.815  1.00 40.37 ? 246 ILE F CA  1 
ATOM 6081 C C   . ILE F 1 106 ? -20.294 58.791  65.769  1.00 42.72 ? 246 ILE F C   1 
ATOM 6082 O O   . ILE F 1 106 ? -20.526 58.667  64.566  1.00 42.33 ? 246 ILE F O   1 
ATOM 6083 C CB  . ILE F 1 106 ? -21.536 56.927  66.878  1.00 39.23 ? 246 ILE F CB  1 
ATOM 6084 C CG1 . ILE F 1 106 ? -20.177 56.252  67.073  1.00 39.17 ? 246 ILE F CG1 1 
ATOM 6085 C CG2 . ILE F 1 106 ? -22.221 56.434  65.617  1.00 37.67 ? 246 ILE F CG2 1 
ATOM 6086 C CD1 . ILE F 1 106 ? -20.257 54.899  67.736  1.00 38.82 ? 246 ILE F CD1 1 
ATOM 6087 N N   . GLN F 1 107 ? -19.129 59.226  66.245  1.00 44.94 ? 247 GLN F N   1 
ATOM 6088 C CA  . GLN F 1 107 ? -18.013 59.582  65.374  1.00 46.36 ? 247 GLN F CA  1 
ATOM 6089 C C   . GLN F 1 107 ? -16.709 59.471  66.157  1.00 48.48 ? 247 GLN F C   1 
ATOM 6090 O O   . GLN F 1 107 ? -16.714 59.518  67.391  1.00 47.26 ? 247 GLN F O   1 
ATOM 6091 C CB  . GLN F 1 107 ? -18.178 61.008  64.849  1.00 45.61 ? 247 GLN F CB  1 
ATOM 6092 C CG  . GLN F 1 107 ? -17.136 61.403  63.824  1.00 43.55 ? 247 GLN F CG  1 
ATOM 6093 C CD  . GLN F 1 107 ? -17.240 62.855  63.430  1.00 43.56 ? 247 GLN F CD  1 
ATOM 6094 O OE1 . GLN F 1 107 ? -16.971 63.747  64.232  1.00 45.62 ? 247 GLN F OE1 1 
ATOM 6095 N NE2 . GLN F 1 107 ? -17.639 63.104  62.193  1.00 42.43 ? 247 GLN F NE2 1 
ATOM 6096 N N   . ARG F 1 108 ? -15.597 59.324  65.440  1.00 50.47 ? 248 ARG F N   1 
ATOM 6097 C CA  . ARG F 1 108 ? -14.289 59.187  66.076  1.00 52.22 ? 248 ARG F CA  1 
ATOM 6098 C C   . ARG F 1 108 ? -14.363 57.967  66.986  1.00 51.64 ? 248 ARG F C   1 
ATOM 6099 O O   . ARG F 1 108 ? -13.419 57.664  67.710  1.00 51.04 ? 248 ARG F O   1 
ATOM 6100 C CB  . ARG F 1 108 ? -13.961 60.410  66.941  1.00 54.86 ? 248 ARG F CB  1 
ATOM 6101 C CG  . ARG F 1 108 ? -14.200 61.783  66.308  1.00 58.98 ? 248 ARG F CG  1 
ATOM 6102 C CD  . ARG F 1 108 ? -13.081 62.229  65.380  1.00 60.11 ? 248 ARG F CD  1 
ATOM 6103 N NE  . ARG F 1 108 ? -13.232 61.695  64.030  1.00 63.96 ? 248 ARG F NE  1 
ATOM 6104 C CZ  . ARG F 1 108 ? -12.523 62.110  62.984  1.00 65.33 ? 248 ARG F CZ  1 
ATOM 6105 N NH1 . ARG F 1 108 ? -11.611 63.065  63.138  1.00 64.10 ? 248 ARG F NH1 1 
ATOM 6106 N NH2 . ARG F 1 108 ? -12.732 61.579  61.783  1.00 65.03 ? 248 ARG F NH2 1 
ATOM 6107 N N   . GLY F 1 109 ? -15.496 57.273  66.949  1.00 51.86 ? 249 GLY F N   1 
ATOM 6108 C CA  . GLY F 1 109 ? -15.683 56.113  67.798  1.00 52.82 ? 249 GLY F CA  1 
ATOM 6109 C C   . GLY F 1 109 ? -16.365 56.502  69.102  1.00 53.43 ? 249 GLY F C   1 
ATOM 6110 O O   . GLY F 1 109 ? -16.671 55.648  69.936  1.00 54.11 ? 249 GLY F O   1 
ATOM 6111 N N   . ALA F 1 110 ? -16.603 57.799  69.275  1.00 52.38 ? 250 ALA F N   1 
ATOM 6112 C CA  . ALA F 1 110 ? -17.248 58.318  70.475  1.00 52.76 ? 250 ALA F CA  1 
ATOM 6113 C C   . ALA F 1 110 ? -18.580 58.984  70.125  1.00 52.95 ? 250 ALA F C   1 
ATOM 6114 O O   . ALA F 1 110 ? -18.889 59.189  68.949  1.00 53.17 ? 250 ALA F O   1 
ATOM 6115 C CB  . ALA F 1 110 ? -16.328 59.315  71.169  1.00 53.10 ? 250 ALA F CB  1 
ATOM 6116 N N   . VAL F 1 111 ? -19.357 59.326  71.151  1.00 51.28 ? 251 VAL F N   1 
ATOM 6117 C CA  . VAL F 1 111 ? -20.662 59.954  70.962  1.00 49.21 ? 251 VAL F CA  1 
ATOM 6118 C C   . VAL F 1 111 ? -20.672 61.440  71.329  1.00 49.45 ? 251 VAL F C   1 
ATOM 6119 O O   . VAL F 1 111 ? -20.055 61.853  72.311  1.00 50.16 ? 251 VAL F O   1 
ATOM 6120 C CB  . VAL F 1 111 ? -21.734 59.223  71.788  1.00 47.33 ? 251 VAL F CB  1 
ATOM 6121 C CG1 . VAL F 1 111 ? -23.067 59.928  71.654  1.00 45.74 ? 251 VAL F CG1 1 
ATOM 6122 C CG2 . VAL F 1 111 ? -21.842 57.778  71.323  1.00 45.00 ? 251 VAL F CG2 1 
ATOM 6123 N N   . TYR F 1 112 ? -21.388 62.236  70.537  1.00 48.85 ? 252 TYR F N   1 
ATOM 6124 C CA  . TYR F 1 112 ? -21.460 63.679  70.754  1.00 48.73 ? 252 TYR F CA  1 
ATOM 6125 C C   . TYR F 1 112 ? -22.878 64.254  70.671  1.00 49.53 ? 252 TYR F C   1 
ATOM 6126 O O   . TYR F 1 112 ? -23.685 63.826  69.845  1.00 49.79 ? 252 TYR F O   1 
ATOM 6127 C CB  . TYR F 1 112 ? -20.596 64.403  69.718  1.00 47.69 ? 252 TYR F CB  1 
ATOM 6128 C CG  . TYR F 1 112 ? -19.172 63.905  69.612  1.00 48.35 ? 252 TYR F CG  1 
ATOM 6129 C CD1 . TYR F 1 112 ? -18.892 62.599  69.205  1.00 49.65 ? 252 TYR F CD1 1 
ATOM 6130 C CD2 . TYR F 1 112 ? -18.101 64.746  69.898  1.00 46.89 ? 252 TYR F CD2 1 
ATOM 6131 C CE1 . TYR F 1 112 ? -17.574 62.145  69.088  1.00 49.01 ? 252 TYR F CE1 1 
ATOM 6132 C CE2 . TYR F 1 112 ? -16.784 64.305  69.781  1.00 46.57 ? 252 TYR F CE2 1 
ATOM 6133 C CZ  . TYR F 1 112 ? -16.528 63.005  69.378  1.00 46.52 ? 252 TYR F CZ  1 
ATOM 6134 O OH  . TYR F 1 112 ? -15.230 62.566  69.273  1.00 44.40 ? 252 TYR F OH  1 
ATOM 6135 N N   . ALA F 1 113 ? -23.166 65.233  71.527  1.00 49.55 ? 253 ALA F N   1 
ATOM 6136 C CA  . ALA F 1 113 ? -24.463 65.903  71.533  1.00 50.39 ? 253 ALA F CA  1 
ATOM 6137 C C   . ALA F 1 113 ? -24.400 67.007  70.473  1.00 51.34 ? 253 ALA F C   1 
ATOM 6138 O O   . ALA F 1 113 ? -23.316 67.493  70.151  1.00 51.85 ? 253 ALA F O   1 
ATOM 6139 C CB  . ALA F 1 113 ? -24.734 66.499  72.901  1.00 50.14 ? 253 ALA F CB  1 
ATOM 6140 N N   . GLU F 1 114 ? -25.549 67.407  69.936  1.00 51.70 ? 254 GLU F N   1 
ATOM 6141 C CA  . GLU F 1 114 ? -25.572 68.432  68.894  1.00 52.12 ? 254 GLU F CA  1 
ATOM 6142 C C   . GLU F 1 114 ? -26.990 68.768  68.440  1.00 51.75 ? 254 GLU F C   1 
ATOM 6143 O O   . GLU F 1 114 ? -27.893 67.940  68.537  1.00 51.03 ? 254 GLU F O   1 
ATOM 6144 C CB  . GLU F 1 114 ? -24.761 67.945  67.688  1.00 53.44 ? 254 GLU F CB  1 
ATOM 6145 C CG  . GLU F 1 114 ? -24.764 68.870  66.476  1.00 55.75 ? 254 GLU F CG  1 
ATOM 6146 C CD  . GLU F 1 114 ? -23.905 70.105  66.670  1.00 57.51 ? 254 GLU F CD  1 
ATOM 6147 O OE1 . GLU F 1 114 ? -24.339 71.048  67.371  1.00 57.76 ? 254 GLU F OE1 1 
ATOM 6148 O OE2 . GLU F 1 114 ? -22.783 70.122  66.121  1.00 57.43 ? 254 GLU F OE2 1 
ATOM 6149 N N   . ASN F 1 115 ? -27.174 69.986  67.940  1.00 51.59 ? 255 ASN F N   1 
ATOM 6150 C CA  . ASN F 1 115 ? -28.476 70.424  67.450  1.00 51.78 ? 255 ASN F CA  1 
ATOM 6151 C C   . ASN F 1 115 ? -29.020 69.338  66.525  1.00 51.07 ? 255 ASN F C   1 
ATOM 6152 O O   . ASN F 1 115 ? -28.253 68.703  65.804  1.00 51.96 ? 255 ASN F O   1 
ATOM 6153 C CB  . ASN F 1 115 ? -28.325 71.735  66.676  1.00 52.14 ? 255 ASN F CB  1 
ATOM 6154 C CG  . ASN F 1 115 ? -29.660 72.330  66.265  1.00 52.09 ? 255 ASN F CG  1 
ATOM 6155 O OD1 . ASN F 1 115 ? -30.544 71.626  65.777  1.00 51.22 ? 255 ASN F OD1 1 
ATOM 6156 N ND2 . ASN F 1 115 ? -29.806 73.636  66.452  1.00 51.29 ? 255 ASN F ND2 1 
ATOM 6157 N N   . CYS F 1 116 ? -30.334 69.130  66.535  1.00 49.76 ? 256 CYS F N   1 
ATOM 6158 C CA  . CYS F 1 116 ? -30.938 68.099  65.696  1.00 48.18 ? 256 CYS F CA  1 
ATOM 6159 C C   . CYS F 1 116 ? -31.293 68.526  64.268  1.00 48.39 ? 256 CYS F C   1 
ATOM 6160 O O   . CYS F 1 116 ? -31.758 67.699  63.487  1.00 48.37 ? 256 CYS F O   1 
ATOM 6161 C CB  . CYS F 1 116 ? -32.197 67.530  66.351  1.00 47.53 ? 256 CYS F CB  1 
ATOM 6162 S SG  . CYS F 1 116 ? -32.042 66.887  68.051  1.00 48.14 ? 256 CYS F SG  1 
ATOM 6163 N N   . ILE F 1 117 ? -31.098 69.793  63.910  1.00 48.79 ? 257 ILE F N   1 
ATOM 6164 C CA  . ILE F 1 117 ? -31.412 70.211  62.542  1.00 49.76 ? 257 ILE F CA  1 
ATOM 6165 C C   . ILE F 1 117 ? -30.197 70.119  61.632  1.00 49.83 ? 257 ILE F C   1 
ATOM 6166 O O   . ILE F 1 117 ? -30.283 70.432  60.445  1.00 51.33 ? 257 ILE F O   1 
ATOM 6167 C CB  . ILE F 1 117 ? -31.987 71.659  62.463  1.00 50.48 ? 257 ILE F CB  1 
ATOM 6168 C CG1 . ILE F 1 117 ? -31.151 72.628  63.305  1.00 51.26 ? 257 ILE F CG1 1 
ATOM 6169 C CG2 . ILE F 1 117 ? -33.443 71.654  62.875  1.00 50.16 ? 257 ILE F CG2 1 
ATOM 6170 C CD1 . ILE F 1 117 ? -29.842 73.047  62.667  1.00 50.64 ? 257 ILE F CD1 1 
ATOM 6171 N N   . LEU F 1 118 ? -29.067 69.693  62.189  1.00 49.55 ? 258 LEU F N   1 
ATOM 6172 C CA  . LEU F 1 118 ? -27.848 69.554  61.402  1.00 49.48 ? 258 LEU F CA  1 
ATOM 6173 C C   . LEU F 1 118 ? -27.881 68.248  60.637  1.00 47.81 ? 258 LEU F C   1 
ATOM 6174 O O   . LEU F 1 118 ? -28.080 67.186  61.218  1.00 48.78 ? 258 LEU F O   1 
ATOM 6175 C CB  . LEU F 1 118 ? -26.605 69.589  62.294  1.00 51.04 ? 258 LEU F CB  1 
ATOM 6176 C CG  . LEU F 1 118 ? -26.310 70.918  62.998  1.00 53.76 ? 258 LEU F CG  1 
ATOM 6177 C CD1 . LEU F 1 118 ? -24.879 70.890  63.516  1.00 53.84 ? 258 LEU F CD1 1 
ATOM 6178 C CD2 . LEU F 1 118 ? -26.498 72.096  62.034  1.00 53.30 ? 258 LEU F CD2 1 
ATOM 6179 N N   . ALA F 1 119 ? -27.687 68.337  59.328  1.00 45.81 ? 259 ALA F N   1 
ATOM 6180 C CA  . ALA F 1 119 ? -27.698 67.164  58.470  1.00 44.26 ? 259 ALA F CA  1 
ATOM 6181 C C   . ALA F 1 119 ? -26.496 66.271  58.736  1.00 43.05 ? 259 ALA F C   1 
ATOM 6182 O O   . ALA F 1 119 ? -25.357 66.726  58.734  1.00 42.74 ? 259 ALA F O   1 
ATOM 6183 C CB  . ALA F 1 119 ? -27.714 67.589  57.011  1.00 44.15 ? 259 ALA F CB  1 
ATOM 6184 N N   . ALA F 1 120 ? -26.767 64.993  58.966  1.00 42.46 ? 260 ALA F N   1 
ATOM 6185 C CA  . ALA F 1 120 ? -25.727 64.010  59.229  1.00 41.12 ? 260 ALA F CA  1 
ATOM 6186 C C   . ALA F 1 120 ? -26.220 62.667  58.715  1.00 39.76 ? 260 ALA F C   1 
ATOM 6187 O O   . ALA F 1 120 ? -27.397 62.512  58.397  1.00 40.23 ? 260 ALA F O   1 
ATOM 6188 C CB  . ALA F 1 120 ? -25.452 63.924  60.724  1.00 41.66 ? 260 ALA F CB  1 
ATOM 6189 N N   . PHE F 1 121 ? -25.320 61.700  58.610  1.00 37.74 ? 261 PHE F N   1 
ATOM 6190 C CA  . PHE F 1 121 ? -25.731 60.386  58.162  1.00 36.38 ? 261 PHE F CA  1 
ATOM 6191 C C   . PHE F 1 121 ? -26.411 59.769  59.357  1.00 35.06 ? 261 PHE F C   1 
ATOM 6192 O O   . PHE F 1 121 ? -26.437 60.366  60.431  1.00 33.69 ? 261 PHE F O   1 
ATOM 6193 C CB  . PHE F 1 121 ? -24.529 59.541  57.750  1.00 38.33 ? 261 PHE F CB  1 
ATOM 6194 C CG  . PHE F 1 121 ? -23.927 59.957  56.448  1.00 41.92 ? 261 PHE F CG  1 
ATOM 6195 C CD1 . PHE F 1 121 ? -23.047 61.033  56.381  1.00 45.05 ? 261 PHE F CD1 1 
ATOM 6196 C CD2 . PHE F 1 121 ? -24.263 59.290  55.273  1.00 43.61 ? 261 PHE F CD2 1 
ATOM 6197 C CE1 . PHE F 1 121 ? -22.512 61.441  55.158  1.00 45.34 ? 261 PHE F CE1 1 
ATOM 6198 C CE2 . PHE F 1 121 ? -23.736 59.689  54.048  1.00 43.46 ? 261 PHE F CE2 1 
ATOM 6199 C CZ  . PHE F 1 121 ? -22.858 60.764  53.989  1.00 44.82 ? 261 PHE F CZ  1 
ATOM 6200 N N   . SER F 1 122 ? -26.963 58.581  59.176  1.00 34.54 ? 262 SER F N   1 
ATOM 6201 C CA  . SER F 1 122 ? -27.643 57.900  60.263  1.00 35.23 ? 262 SER F CA  1 
ATOM 6202 C C   . SER F 1 122 ? -27.554 56.395  60.086  1.00 37.22 ? 262 SER F C   1 
ATOM 6203 O O   . SER F 1 122 ? -27.041 55.905  59.076  1.00 37.78 ? 262 SER F O   1 
ATOM 6204 C CB  . SER F 1 122 ? -29.106 58.348  60.332  1.00 33.88 ? 262 SER F CB  1 
ATOM 6205 O OG  . SER F 1 122 ? -29.709 58.350  59.050  1.00 32.19 ? 262 SER F OG  1 
ATOM 6206 N N   . ILE F 1 123 ? -28.049 55.662  61.076  1.00 38.26 ? 263 ILE F N   1 
ATOM 6207 C CA  . ILE F 1 123 ? -28.013 54.210  61.035  1.00 38.66 ? 263 ILE F CA  1 
ATOM 6208 C C   . ILE F 1 123 ? -29.345 53.632  61.482  1.00 39.06 ? 263 ILE F C   1 
ATOM 6209 O O   . ILE F 1 123 ? -29.827 53.947  62.565  1.00 40.30 ? 263 ILE F O   1 
ATOM 6210 C CB  . ILE F 1 123 ? -26.892 53.672  61.948  1.00 37.58 ? 263 ILE F CB  1 
ATOM 6211 C CG1 . ILE F 1 123 ? -25.546 54.235  61.488  1.00 39.01 ? 263 ILE F CG1 1 
ATOM 6212 C CG2 . ILE F 1 123 ? -26.867 52.154  61.914  1.00 38.06 ? 263 ILE F CG2 1 
ATOM 6213 C CD1 . ILE F 1 123 ? -24.364 53.810  62.336  1.00 39.92 ? 263 ILE F CD1 1 
ATOM 6214 N N   . CYS F 1 124 ? -29.943 52.795  60.641  1.00 40.14 ? 264 CYS F N   1 
ATOM 6215 C CA  . CYS F 1 124 ? -31.218 52.167  60.974  1.00 40.57 ? 264 CYS F CA  1 
ATOM 6216 C C   . CYS F 1 124 ? -31.015 50.705  61.359  1.00 40.09 ? 264 CYS F C   1 
ATOM 6217 O O   . CYS F 1 124 ? -30.155 50.019  60.803  1.00 40.24 ? 264 CYS F O   1 
ATOM 6218 C CB  . CYS F 1 124 ? -32.191 52.214  59.792  1.00 40.90 ? 264 CYS F CB  1 
ATOM 6219 S SG  . CYS F 1 124 ? -32.619 53.856  59.135  1.00 44.15 ? 264 CYS F SG  1 
ATOM 6220 N N   . GLN F 1 125 ? -31.810 50.229  62.309  1.00 39.87 ? 265 GLN F N   1 
ATOM 6221 C CA  . GLN F 1 125 ? -31.719 48.842  62.728  1.00 39.98 ? 265 GLN F CA  1 
ATOM 6222 C C   . GLN F 1 125 ? -33.096 48.234  62.923  1.00 39.03 ? 265 GLN F C   1 
ATOM 6223 O O   . GLN F 1 125 ? -34.064 48.921  63.236  1.00 38.12 ? 265 GLN F O   1 
ATOM 6224 C CB  . GLN F 1 125 ? -30.908 48.705  64.023  1.00 41.35 ? 265 GLN F CB  1 
ATOM 6225 C CG  . GLN F 1 125 ? -31.655 49.041  65.301  1.00 43.18 ? 265 GLN F CG  1 
ATOM 6226 C CD  . GLN F 1 125 ? -30.836 48.731  66.542  1.00 43.31 ? 265 GLN F CD  1 
ATOM 6227 O OE1 . GLN F 1 125 ? -29.777 49.315  66.762  1.00 42.88 ? 265 GLN F OE1 1 
ATOM 6228 N NE2 . GLN F 1 125 ? -31.322 47.801  67.355  1.00 43.87 ? 265 GLN F NE2 1 
ATOM 6229 N N   . LYS F 1 126 ? -33.161 46.929  62.712  1.00 39.33 ? 266 LYS F N   1 
ATOM 6230 C CA  . LYS F 1 126 ? -34.380 46.164  62.866  1.00 39.22 ? 266 LYS F CA  1 
ATOM 6231 C C   . LYS F 1 126 ? -33.938 44.735  63.142  1.00 40.60 ? 266 LYS F C   1 
ATOM 6232 O O   . LYS F 1 126 ? -32.826 44.348  62.784  1.00 41.29 ? 266 LYS F O   1 
ATOM 6233 C CB  . LYS F 1 126 ? -35.248 46.276  61.606  1.00 38.78 ? 266 LYS F CB  1 
ATOM 6234 C CG  . LYS F 1 126 ? -34.609 45.885  60.279  1.00 38.76 ? 266 LYS F CG  1 
ATOM 6235 C CD  . LYS F 1 126 ? -35.519 46.335  59.132  1.00 38.05 ? 266 LYS F CD  1 
ATOM 6236 C CE  . LYS F 1 126 ? -35.360 45.496  57.870  1.00 39.87 ? 266 LYS F CE  1 
ATOM 6237 N NZ  . LYS F 1 126 ? -36.265 45.978  56.778  1.00 39.43 ? 266 LYS F NZ  1 
ATOM 6238 N N   . LYS F 1 127 ? -34.788 43.958  63.804  1.00 42.64 ? 267 LYS F N   1 
ATOM 6239 C CA  . LYS F 1 127 ? -34.426 42.592  64.154  1.00 43.38 ? 267 LYS F CA  1 
ATOM 6240 C C   . LYS F 1 127 ? -34.182 41.707  62.951  1.00 42.81 ? 267 LYS F C   1 
ATOM 6241 O O   . LYS F 1 127 ? -34.702 41.955  61.865  1.00 41.99 ? 267 LYS F O   1 
ATOM 6242 C CB  . LYS F 1 127 ? -35.497 41.956  65.043  1.00 44.92 ? 267 LYS F CB  1 
ATOM 6243 C CG  . LYS F 1 127 ? -35.651 42.611  66.405  1.00 47.63 ? 267 LYS F CG  1 
ATOM 6244 C CD  . LYS F 1 127 ? -36.405 41.701  67.378  1.00 52.31 ? 267 LYS F CD  1 
ATOM 6245 C CE  . LYS F 1 127 ? -37.848 41.420  66.943  1.00 54.55 ? 267 LYS F CE  1 
ATOM 6246 N NZ  . LYS F 1 127 ? -38.741 42.612  67.088  1.00 56.01 ? 267 LYS F NZ  1 
ATOM 6247 N N   . ALA F 1 128 ? -33.376 40.674  63.158  1.00 43.02 ? 268 ALA F N   1 
ATOM 6248 C CA  . ALA F 1 128 ? -33.055 39.729  62.103  1.00 44.71 ? 268 ALA F CA  1 
ATOM 6249 C C   . ALA F 1 128 ? -34.012 38.555  62.191  1.00 45.63 ? 268 ALA F C   1 
ATOM 6250 O O   . ALA F 1 128 ? -34.728 38.402  63.176  1.00 46.83 ? 268 ALA F O   1 
ATOM 6251 C CB  . ALA F 1 128 ? -31.620 39.242  62.255  1.00 44.70 ? 268 ALA F CB  1 
ATOM 6252 N N   . ASN F 1 129 ? -34.023 37.732  61.151  1.00 47.06 ? 269 ASN F N   1 
ATOM 6253 C CA  . ASN F 1 129 ? -34.875 36.552  61.109  1.00 47.77 ? 269 ASN F CA  1 
ATOM 6254 C C   . ASN F 1 129 ? -33.967 35.328  61.189  1.00 47.25 ? 269 ASN F C   1 
ATOM 6255 O O   . ASN F 1 129 ? -33.049 35.179  60.382  1.00 48.27 ? 269 ASN F O   1 
ATOM 6256 C CB  . ASN F 1 129 ? -35.686 36.537  59.811  1.00 49.90 ? 269 ASN F CB  1 
ATOM 6257 C CG  . ASN F 1 129 ? -36.424 35.234  59.602  1.00 51.95 ? 269 ASN F CG  1 
ATOM 6258 O OD1 . ASN F 1 129 ? -35.818 34.207  59.302  1.00 53.48 ? 269 ASN F OD1 1 
ATOM 6259 N ND2 . ASN F 1 129 ? -37.741 35.267  59.767  1.00 53.69 ? 269 ASN F ND2 1 
ATOM 6260 N N   . LEU F 1 130 ? -34.218 34.457  62.161  1.00 45.46 ? 270 LEU F N   1 
ATOM 6261 C CA  . LEU F 1 130 ? -33.383 33.275  62.337  1.00 44.14 ? 270 LEU F CA  1 
ATOM 6262 C C   . LEU F 1 130 ? -34.183 31.979  62.419  1.00 43.22 ? 270 LEU F C   1 
ATOM 6263 O O   . LEU F 1 130 ? -33.881 31.173  63.322  1.00 40.78 ? 270 LEU F O   1 
ATOM 6264 C CB  . LEU F 1 130 ? -32.552 33.433  63.610  1.00 43.94 ? 270 LEU F CB  1 
ATOM 6265 C CG  . LEU F 1 130 ? -32.020 34.845  63.881  1.00 43.42 ? 270 LEU F CG  1 
ATOM 6266 C CD1 . LEU F 1 130 ? -31.467 34.904  65.290  1.00 41.74 ? 270 LEU F CD1 1 
ATOM 6267 C CD2 . LEU F 1 130 ? -30.954 35.224  62.865  1.00 44.89 ? 270 LEU F CD2 1 
ATOM 6268 N N   . MET G 1 1   ? -35.309 47.299  -20.767 1.00 54.68 ? 141 MET G N   1 
ATOM 6269 C CA  . MET G 1 1   ? -34.443 47.972  -21.782 1.00 56.12 ? 141 MET G CA  1 
ATOM 6270 C C   . MET G 1 1   ? -33.111 47.228  -21.890 1.00 55.42 ? 141 MET G C   1 
ATOM 6271 O O   . MET G 1 1   ? -32.232 47.611  -22.668 1.00 55.72 ? 141 MET G O   1 
ATOM 6272 C CB  . MET G 1 1   ? -34.193 49.432  -21.369 1.00 58.96 ? 141 MET G CB  1 
ATOM 6273 C CG  . MET G 1 1   ? -33.408 50.293  -22.375 1.00 61.22 ? 141 MET G CG  1 
ATOM 6274 S SD  . MET G 1 1   ? -34.408 51.045  -23.701 1.00 65.95 ? 141 MET G SD  1 
ATOM 6275 C CE  . MET G 1 1   ? -33.233 51.080  -25.068 1.00 60.64 ? 141 MET G CE  1 
ATOM 6276 N N   . ALA G 1 2   ? -32.970 46.161  -21.107 1.00 53.19 ? 142 ALA G N   1 
ATOM 6277 C CA  . ALA G 1 2   ? -31.746 45.369  -21.102 1.00 50.79 ? 142 ALA G CA  1 
ATOM 6278 C C   . ALA G 1 2   ? -31.699 44.407  -22.283 1.00 50.38 ? 142 ALA G C   1 
ATOM 6279 O O   . ALA G 1 2   ? -32.692 43.755  -22.606 1.00 50.10 ? 142 ALA G O   1 
ATOM 6280 C CB  . ALA G 1 2   ? -31.634 44.599  -19.793 1.00 49.22 ? 142 ALA G CB  1 
ATOM 6281 N N   . PRO G 1 3   ? -30.538 44.313  -22.949 1.00 50.14 ? 143 PRO G N   1 
ATOM 6282 C CA  . PRO G 1 3   ? -30.392 43.416  -24.096 1.00 49.14 ? 143 PRO G CA  1 
ATOM 6283 C C   . PRO G 1 3   ? -30.723 41.977  -23.732 1.00 48.23 ? 143 PRO G C   1 
ATOM 6284 O O   . PRO G 1 3   ? -31.265 41.230  -24.547 1.00 48.40 ? 143 PRO G O   1 
ATOM 6285 C CB  . PRO G 1 3   ? -28.925 43.590  -24.483 1.00 48.91 ? 143 PRO G CB  1 
ATOM 6286 C CG  . PRO G 1 3   ? -28.660 45.012  -24.125 1.00 50.36 ? 143 PRO G CG  1 
ATOM 6287 C CD  . PRO G 1 3   ? -29.322 45.125  -22.768 1.00 50.44 ? 143 PRO G CD  1 
ATOM 6288 N N   . CYS G 1 4   ? -30.407 41.596  -22.499 1.00 46.87 ? 144 CYS G N   1 
ATOM 6289 C CA  . CYS G 1 4   ? -30.656 40.234  -22.049 1.00 47.15 ? 144 CYS G CA  1 
ATOM 6290 C C   . CYS G 1 4   ? -30.962 40.128  -20.561 1.00 46.45 ? 144 CYS G C   1 
ATOM 6291 O O   . CYS G 1 4   ? -30.812 41.091  -19.811 1.00 46.12 ? 144 CYS G O   1 
ATOM 6292 C CB  . CYS G 1 4   ? -29.436 39.361  -22.349 1.00 48.33 ? 144 CYS G CB  1 
ATOM 6293 S SG  . CYS G 1 4   ? -28.890 39.331  -24.085 1.00 49.48 ? 144 CYS G SG  1 
ATOM 6294 N N   . PRO G 1 5   ? -31.418 38.945  -20.123 1.00 46.24 ? 145 PRO G N   1 
ATOM 6295 C CA  . PRO G 1 5   ? -31.743 38.677  -18.722 1.00 46.91 ? 145 PRO G CA  1 
ATOM 6296 C C   . PRO G 1 5   ? -30.434 38.301  -18.037 1.00 47.41 ? 145 PRO G C   1 
ATOM 6297 O O   . PRO G 1 5   ? -29.572 37.680  -18.652 1.00 48.89 ? 145 PRO G O   1 
ATOM 6298 C CB  . PRO G 1 5   ? -32.697 37.488  -18.807 1.00 46.03 ? 145 PRO G CB  1 
ATOM 6299 C CG  . PRO G 1 5   ? -33.254 37.576  -20.193 1.00 45.87 ? 145 PRO G CG  1 
ATOM 6300 C CD  . PRO G 1 5   ? -32.039 37.930  -20.986 1.00 46.07 ? 145 PRO G CD  1 
ATOM 6301 N N   . GLN G 1 6   ? -30.276 38.674  -16.776 1.00 48.53 ? 146 GLN G N   1 
ATOM 6302 C CA  . GLN G 1 6   ? -29.047 38.364  -16.061 1.00 49.78 ? 146 GLN G CA  1 
ATOM 6303 C C   . GLN G 1 6   ? -28.598 36.918  -16.257 1.00 50.32 ? 146 GLN G C   1 
ATOM 6304 O O   . GLN G 1 6   ? -29.393 36.057  -16.636 1.00 49.36 ? 146 GLN G O   1 
ATOM 6305 C CB  . GLN G 1 6   ? -29.218 38.692  -14.575 1.00 50.76 ? 146 GLN G CB  1 
ATOM 6306 C CG  . GLN G 1 6   ? -29.223 40.193  -14.320 1.00 51.85 ? 146 GLN G CG  1 
ATOM 6307 C CD  . GLN G 1 6   ? -29.614 40.566  -12.910 1.00 53.42 ? 146 GLN G CD  1 
ATOM 6308 O OE1 . GLN G 1 6   ? -29.044 40.070  -11.935 1.00 54.16 ? 146 GLN G OE1 1 
ATOM 6309 N NE2 . GLN G 1 6   ? -30.590 41.457  -12.792 1.00 55.03 ? 146 GLN G NE2 1 
ATOM 6310 N N   . ASP G 1 7   ? -27.311 36.675  -16.016 1.00 51.11 ? 147 ASP G N   1 
ATOM 6311 C CA  . ASP G 1 7   ? -26.702 35.355  -16.165 1.00 50.78 ? 147 ASP G CA  1 
ATOM 6312 C C   . ASP G 1 7   ? -26.505 34.963  -17.625 1.00 51.38 ? 147 ASP G C   1 
ATOM 6313 O O   . ASP G 1 7   ? -25.632 34.151  -17.937 1.00 52.90 ? 147 ASP G O   1 
ATOM 6314 C CB  . ASP G 1 7   ? -27.534 34.285  -15.454 1.00 48.62 ? 147 ASP G CB  1 
ATOM 6315 C CG  . ASP G 1 7   ? -27.597 34.503  -13.963 1.00 46.64 ? 147 ASP G CG  1 
ATOM 6316 O OD1 . ASP G 1 7   ? -26.525 34.666  -13.349 1.00 46.56 ? 147 ASP G OD1 1 
ATOM 6317 O OD2 . ASP G 1 7   ? -28.709 34.510  -13.401 1.00 46.65 ? 147 ASP G OD2 1 
ATOM 6318 N N   . TRP G 1 8   ? -27.310 35.533  -18.518 1.00 49.66 ? 148 TRP G N   1 
ATOM 6319 C CA  . TRP G 1 8   ? -27.193 35.219  -19.938 1.00 49.50 ? 148 TRP G CA  1 
ATOM 6320 C C   . TRP G 1 8   ? -26.024 35.979  -20.541 1.00 49.40 ? 148 TRP G C   1 
ATOM 6321 O O   . TRP G 1 8   ? -25.546 36.949  -19.955 1.00 48.94 ? 148 TRP G O   1 
ATOM 6322 C CB  . TRP G 1 8   ? -28.478 35.589  -20.686 1.00 51.44 ? 148 TRP G CB  1 
ATOM 6323 C CG  . TRP G 1 8   ? -29.678 34.767  -20.307 1.00 52.15 ? 148 TRP G CG  1 
ATOM 6324 C CD1 . TRP G 1 8   ? -30.278 34.706  -19.085 1.00 53.19 ? 148 TRP G CD1 1 
ATOM 6325 C CD2 . TRP G 1 8   ? -30.415 33.884  -21.160 1.00 52.28 ? 148 TRP G CD2 1 
ATOM 6326 N NE1 . TRP G 1 8   ? -31.343 33.839  -19.121 1.00 53.66 ? 148 TRP G NE1 1 
ATOM 6327 C CE2 . TRP G 1 8   ? -31.448 33.318  -20.381 1.00 52.45 ? 148 TRP G CE2 1 
ATOM 6328 C CE3 . TRP G 1 8   ? -30.300 33.513  -22.505 1.00 53.90 ? 148 TRP G CE3 1 
ATOM 6329 C CZ2 . TRP G 1 8   ? -32.364 32.401  -20.906 1.00 51.80 ? 148 TRP G CZ2 1 
ATOM 6330 C CZ3 . TRP G 1 8   ? -31.212 32.600  -23.026 1.00 53.75 ? 148 TRP G CZ3 1 
ATOM 6331 C CH2 . TRP G 1 8   ? -32.229 32.054  -22.224 1.00 52.81 ? 148 TRP G CH2 1 
ATOM 6332 N N   . ILE G 1 9   ? -25.565 35.533  -21.708 1.00 48.91 ? 149 ILE G N   1 
ATOM 6333 C CA  . ILE G 1 9   ? -24.457 36.183  -22.403 1.00 48.60 ? 149 ILE G CA  1 
ATOM 6334 C C   . ILE G 1 9   ? -24.987 36.845  -23.665 1.00 49.99 ? 149 ILE G C   1 
ATOM 6335 O O   . ILE G 1 9   ? -25.620 36.188  -24.488 1.00 51.65 ? 149 ILE G O   1 
ATOM 6336 C CB  . ILE G 1 9   ? -23.379 35.180  -22.849 1.00 47.15 ? 149 ILE G CB  1 
ATOM 6337 C CG1 . ILE G 1 9   ? -22.938 34.315  -21.674 1.00 47.72 ? 149 ILE G CG1 1 
ATOM 6338 C CG2 . ILE G 1 9   ? -22.181 35.929  -23.415 1.00 46.05 ? 149 ILE G CG2 1 
ATOM 6339 C CD1 . ILE G 1 9   ? -21.962 33.224  -22.065 1.00 48.64 ? 149 ILE G CD1 1 
ATOM 6340 N N   . TRP G 1 10  ? -24.724 38.137  -23.829 1.00 50.68 ? 150 TRP G N   1 
ATOM 6341 C CA  . TRP G 1 10  ? -25.187 38.847  -25.014 1.00 51.06 ? 150 TRP G CA  1 
ATOM 6342 C C   . TRP G 1 10  ? -24.147 38.874  -26.127 1.00 50.54 ? 150 TRP G C   1 
ATOM 6343 O O   . TRP G 1 10  ? -23.054 39.401  -25.955 1.00 50.03 ? 150 TRP G O   1 
ATOM 6344 C CB  . TRP G 1 10  ? -25.593 40.281  -24.661 1.00 52.19 ? 150 TRP G CB  1 
ATOM 6345 C CG  . TRP G 1 10  ? -25.911 41.123  -25.865 1.00 52.52 ? 150 TRP G CG  1 
ATOM 6346 C CD1 . TRP G 1 10  ? -26.600 40.734  -26.979 1.00 53.19 ? 150 TRP G CD1 1 
ATOM 6347 C CD2 . TRP G 1 10  ? -25.556 42.494  -26.072 1.00 52.67 ? 150 TRP G CD2 1 
ATOM 6348 N NE1 . TRP G 1 10  ? -26.691 41.777  -27.869 1.00 53.68 ? 150 TRP G NE1 1 
ATOM 6349 C CE2 . TRP G 1 10  ? -26.057 42.871  -27.337 1.00 53.27 ? 150 TRP G CE2 1 
ATOM 6350 C CE3 . TRP G 1 10  ? -24.858 43.443  -25.312 1.00 53.24 ? 150 TRP G CE3 1 
ATOM 6351 C CZ2 . TRP G 1 10  ? -25.888 44.157  -27.860 1.00 52.59 ? 150 TRP G CZ2 1 
ATOM 6352 C CZ3 . TRP G 1 10  ? -24.688 44.725  -25.831 1.00 52.14 ? 150 TRP G CZ3 1 
ATOM 6353 C CH2 . TRP G 1 10  ? -25.201 45.067  -27.094 1.00 52.33 ? 150 TRP G CH2 1 
ATOM 6354 N N   . HIS G 1 11  ? -24.502 38.298  -27.269 1.00 51.16 ? 151 HIS G N   1 
ATOM 6355 C CA  . HIS G 1 11  ? -23.613 38.257  -28.424 1.00 52.58 ? 151 HIS G CA  1 
ATOM 6356 C C   . HIS G 1 11  ? -24.427 38.428  -29.702 1.00 53.23 ? 151 HIS G C   1 
ATOM 6357 O O   . HIS G 1 11  ? -25.259 37.578  -30.031 1.00 53.60 ? 151 HIS G O   1 
ATOM 6358 C CB  . HIS G 1 11  ? -22.869 36.924  -28.493 1.00 51.92 ? 151 HIS G CB  1 
ATOM 6359 C CG  . HIS G 1 11  ? -21.922 36.830  -29.648 1.00 52.36 ? 151 HIS G CG  1 
ATOM 6360 N ND1 . HIS G 1 11  ? -20.609 37.237  -29.568 1.00 53.11 ? 151 HIS G ND1 1 
ATOM 6361 C CD2 . HIS G 1 11  ? -22.113 36.424  -30.926 1.00 52.61 ? 151 HIS G CD2 1 
ATOM 6362 C CE1 . HIS G 1 11  ? -20.030 37.087  -30.747 1.00 52.90 ? 151 HIS G CE1 1 
ATOM 6363 N NE2 . HIS G 1 11  ? -20.923 36.595  -31.588 1.00 52.52 ? 151 HIS G NE2 1 
ATOM 6364 N N   . GLY G 1 12  ? -24.181 39.518  -30.422 1.00 52.39 ? 152 GLY G N   1 
ATOM 6365 C CA  . GLY G 1 12  ? -24.909 39.761  -31.653 1.00 52.44 ? 152 GLY G CA  1 
ATOM 6366 C C   . GLY G 1 12  ? -26.340 40.176  -31.379 1.00 53.71 ? 152 GLY G C   1 
ATOM 6367 O O   . GLY G 1 12  ? -26.589 41.014  -30.512 1.00 53.50 ? 152 GLY G O   1 
ATOM 6368 N N   . GLU G 1 13  ? -27.280 39.592  -32.118 1.00 54.98 ? 153 GLU G N   1 
ATOM 6369 C CA  . GLU G 1 13  ? -28.694 39.906  -31.947 1.00 56.15 ? 153 GLU G CA  1 
ATOM 6370 C C   . GLU G 1 13  ? -29.392 38.890  -31.051 1.00 56.49 ? 153 GLU G C   1 
ATOM 6371 O O   . GLU G 1 13  ? -30.619 38.798  -31.045 1.00 56.65 ? 153 GLU G O   1 
ATOM 6372 C CB  . GLU G 1 13  ? -29.405 39.941  -33.301 1.00 58.65 ? 153 GLU G CB  1 
ATOM 6373 C CG  . GLU G 1 13  ? -28.935 41.041  -34.242 1.00 63.14 ? 153 GLU G CG  1 
ATOM 6374 C CD  . GLU G 1 13  ? -29.892 41.263  -35.403 1.00 65.92 ? 153 GLU G CD  1 
ATOM 6375 O OE1 . GLU G 1 13  ? -30.029 40.358  -36.257 1.00 67.48 ? 153 GLU G OE1 1 
ATOM 6376 O OE2 . GLU G 1 13  ? -30.515 42.345  -35.456 1.00 67.09 ? 153 GLU G OE2 1 
ATOM 6377 N N   . ASN G 1 14  ? -28.617 38.129  -30.287 1.00 56.04 ? 154 ASN G N   1 
ATOM 6378 C CA  . ASN G 1 14  ? -29.210 37.129  -29.418 1.00 54.64 ? 154 ASN G CA  1 
ATOM 6379 C C   . ASN G 1 14  ? -28.616 37.085  -28.021 1.00 53.80 ? 154 ASN G C   1 
ATOM 6380 O O   . ASN G 1 14  ? -27.632 37.759  -27.719 1.00 54.16 ? 154 ASN G O   1 
ATOM 6381 C CB  . ASN G 1 14  ? -29.088 35.747  -30.056 1.00 55.82 ? 154 ASN G CB  1 
ATOM 6382 C CG  . ASN G 1 14  ? -29.723 35.682  -31.425 1.00 57.01 ? 154 ASN G CG  1 
ATOM 6383 O OD1 . ASN G 1 14  ? -30.873 36.082  -31.606 1.00 57.87 ? 154 ASN G OD1 1 
ATOM 6384 N ND2 . ASN G 1 14  ? -28.981 35.169  -32.399 1.00 57.04 ? 154 ASN G ND2 1 
ATOM 6385 N N   . CYS G 1 15  ? -29.241 36.274  -27.176 1.00 51.44 ? 155 CYS G N   1 
ATOM 6386 C CA  . CYS G 1 15  ? -28.813 36.080  -25.803 1.00 49.94 ? 155 CYS G CA  1 
ATOM 6387 C C   . CYS G 1 15  ? -28.623 34.586  -25.619 1.00 49.15 ? 155 CYS G C   1 
ATOM 6388 O O   . CYS G 1 15  ? -29.360 33.793  -26.197 1.00 50.01 ? 155 CYS G O   1 
ATOM 6389 C CB  . CYS G 1 15  ? -29.888 36.564  -24.835 1.00 50.78 ? 155 CYS G CB  1 
ATOM 6390 S SG  . CYS G 1 15  ? -30.378 38.308  -25.017 1.00 53.48 ? 155 CYS G SG  1 
ATOM 6391 N N   . TYR G 1 16  ? -27.645 34.195  -24.812 1.00 47.83 ? 156 TYR G N   1 
ATOM 6392 C CA  . TYR G 1 16  ? -27.396 32.778  -24.590 1.00 45.99 ? 156 TYR G CA  1 
ATOM 6393 C C   . TYR G 1 16  ? -27.313 32.410  -23.122 1.00 45.49 ? 156 TYR G C   1 
ATOM 6394 O O   . TYR G 1 16  ? -26.878 33.203  -22.289 1.00 45.05 ? 156 TYR G O   1 
ATOM 6395 C CB  . TYR G 1 16  ? -26.099 32.343  -25.275 1.00 47.01 ? 156 TYR G CB  1 
ATOM 6396 C CG  . TYR G 1 16  ? -26.042 32.649  -26.752 1.00 47.89 ? 156 TYR G CG  1 
ATOM 6397 C CD1 . TYR G 1 16  ? -25.923 33.960  -27.205 1.00 47.40 ? 156 TYR G CD1 1 
ATOM 6398 C CD2 . TYR G 1 16  ? -26.118 31.629  -27.698 1.00 48.11 ? 156 TYR G CD2 1 
ATOM 6399 C CE1 . TYR G 1 16  ? -25.881 34.250  -28.558 1.00 48.05 ? 156 TYR G CE1 1 
ATOM 6400 C CE2 . TYR G 1 16  ? -26.077 31.908  -29.055 1.00 48.65 ? 156 TYR G CE2 1 
ATOM 6401 C CZ  . TYR G 1 16  ? -25.958 33.222  -29.479 1.00 48.50 ? 156 TYR G CZ  1 
ATOM 6402 O OH  . TYR G 1 16  ? -25.905 33.509  -30.824 1.00 49.76 ? 156 TYR G OH  1 
ATOM 6403 N N   . LEU G 1 17  ? -27.739 31.192  -22.818 1.00 45.09 ? 157 LEU G N   1 
ATOM 6404 C CA  . LEU G 1 17  ? -27.699 30.677  -21.462 1.00 44.68 ? 157 LEU G CA  1 
ATOM 6405 C C   . LEU G 1 17  ? -27.150 29.271  -21.546 1.00 46.07 ? 157 LEU G C   1 
ATOM 6406 O O   . LEU G 1 17  ? -27.502 28.517  -22.449 1.00 44.47 ? 157 LEU G O   1 
ATOM 6407 C CB  . LEU G 1 17  ? -29.092 30.621  -20.848 1.00 44.69 ? 157 LEU G CB  1 
ATOM 6408 C CG  . LEU G 1 17  ? -29.072 30.171  -19.384 1.00 45.23 ? 157 LEU G CG  1 
ATOM 6409 C CD1 . LEU G 1 17  ? -28.658 31.339  -18.503 1.00 44.54 ? 157 LEU G CD1 1 
ATOM 6410 C CD2 . LEU G 1 17  ? -30.439 29.669  -18.971 1.00 43.48 ? 157 LEU G CD2 1 
ATOM 6411 N N   . PHE G 1 18  ? -26.283 28.921  -20.606 1.00 48.78 ? 158 PHE G N   1 
ATOM 6412 C CA  . PHE G 1 18  ? -25.693 27.591  -20.584 1.00 50.97 ? 158 PHE G CA  1 
ATOM 6413 C C   . PHE G 1 18  ? -26.440 26.720  -19.594 1.00 51.96 ? 158 PHE G C   1 
ATOM 6414 O O   . PHE G 1 18  ? -26.681 27.121  -18.457 1.00 52.31 ? 158 PHE G O   1 
ATOM 6415 C CB  . PHE G 1 18  ? -24.214 27.679  -20.214 1.00 51.60 ? 158 PHE G CB  1 
ATOM 6416 C CG  . PHE G 1 18  ? -23.325 28.094  -21.359 1.00 54.10 ? 158 PHE G CG  1 
ATOM 6417 C CD1 . PHE G 1 18  ? -23.760 29.022  -22.310 1.00 54.99 ? 158 PHE G CD1 1 
ATOM 6418 C CD2 . PHE G 1 18  ? -22.044 27.567  -21.478 1.00 54.43 ? 158 PHE G CD2 1 
ATOM 6419 C CE1 . PHE G 1 18  ? -22.927 29.413  -23.367 1.00 54.85 ? 158 PHE G CE1 1 
ATOM 6420 C CE2 . PHE G 1 18  ? -21.208 27.952  -22.527 1.00 54.54 ? 158 PHE G CE2 1 
ATOM 6421 C CZ  . PHE G 1 18  ? -21.650 28.878  -23.473 1.00 54.70 ? 158 PHE G CZ  1 
ATOM 6422 N N   . SER G 1 19  ? -26.817 25.528  -20.042 1.00 53.95 ? 159 SER G N   1 
ATOM 6423 C CA  . SER G 1 19  ? -27.557 24.590  -19.212 1.00 56.32 ? 159 SER G CA  1 
ATOM 6424 C C   . SER G 1 19  ? -26.940 24.489  -17.823 1.00 57.95 ? 159 SER G C   1 
ATOM 6425 O O   . SER G 1 19  ? -25.730 24.652  -17.653 1.00 58.77 ? 159 SER G O   1 
ATOM 6426 C CB  . SER G 1 19  ? -27.579 23.212  -19.877 1.00 57.32 ? 159 SER G CB  1 
ATOM 6427 O OG  . SER G 1 19  ? -28.511 22.353  -19.247 1.00 59.95 ? 159 SER G OG  1 
ATOM 6428 N N   . SER G 1 20  ? -27.782 24.233  -16.829 1.00 59.61 ? 160 SER G N   1 
ATOM 6429 C CA  . SER G 1 20  ? -27.325 24.102  -15.452 1.00 61.67 ? 160 SER G CA  1 
ATOM 6430 C C   . SER G 1 20  ? -27.061 22.630  -15.160 1.00 62.61 ? 160 SER G C   1 
ATOM 6431 O O   . SER G 1 20  ? -26.114 22.281  -14.451 1.00 61.50 ? 160 SER G O   1 
ATOM 6432 C CB  . SER G 1 20  ? -28.389 24.638  -14.492 1.00 61.43 ? 160 SER G CB  1 
ATOM 6433 O OG  . SER G 1 20  ? -29.613 23.940  -14.653 1.00 62.24 ? 160 SER G OG  1 
ATOM 6434 N N   . GLY G 1 21  ? -27.909 21.773  -15.722 1.00 63.81 ? 161 GLY G N   1 
ATOM 6435 C CA  . GLY G 1 21  ? -27.768 20.343  -15.527 1.00 66.21 ? 161 GLY G CA  1 
ATOM 6436 C C   . GLY G 1 21  ? -27.611 19.606  -16.842 1.00 67.39 ? 161 GLY G C   1 
ATOM 6437 O O   . GLY G 1 21  ? -27.725 20.201  -17.913 1.00 68.90 ? 161 GLY G O   1 
ATOM 6438 N N   . SER G 1 22  ? -27.360 18.304  -16.762 1.00 67.70 ? 162 SER G N   1 
ATOM 6439 C CA  . SER G 1 22  ? -27.169 17.479  -17.948 1.00 67.85 ? 162 SER G CA  1 
ATOM 6440 C C   . SER G 1 22  ? -28.329 16.532  -18.226 1.00 67.79 ? 162 SER G C   1 
ATOM 6441 O O   . SER G 1 22  ? -28.519 15.547  -17.513 1.00 69.23 ? 162 SER G O   1 
ATOM 6442 C CB  . SER G 1 22  ? -25.884 16.661  -17.810 1.00 67.81 ? 162 SER G CB  1 
ATOM 6443 O OG  . SER G 1 22  ? -25.758 15.730  -18.868 1.00 68.65 ? 162 SER G OG  1 
ATOM 6444 N N   . PHE G 1 23  ? -29.092 16.829  -19.274 1.00 66.80 ? 163 PHE G N   1 
ATOM 6445 C CA  . PHE G 1 23  ? -30.225 15.994  -19.661 1.00 66.13 ? 163 PHE G CA  1 
ATOM 6446 C C   . PHE G 1 23  ? -30.184 15.733  -21.169 1.00 65.55 ? 163 PHE G C   1 
ATOM 6447 O O   . PHE G 1 23  ? -29.332 16.281  -21.871 1.00 66.54 ? 163 PHE G O   1 
ATOM 6448 C CB  . PHE G 1 23  ? -31.543 16.671  -19.273 1.00 66.59 ? 163 PHE G CB  1 
ATOM 6449 C CG  . PHE G 1 23  ? -31.609 17.088  -17.826 1.00 65.67 ? 163 PHE G CG  1 
ATOM 6450 C CD1 . PHE G 1 23  ? -31.112 18.324  -17.418 1.00 64.86 ? 163 PHE G CD1 1 
ATOM 6451 C CD2 . PHE G 1 23  ? -32.158 16.238  -16.868 1.00 65.44 ? 163 PHE G CD2 1 
ATOM 6452 C CE1 . PHE G 1 23  ? -31.161 18.705  -16.077 1.00 65.27 ? 163 PHE G CE1 1 
ATOM 6453 C CE2 . PHE G 1 23  ? -32.212 16.608  -15.523 1.00 64.44 ? 163 PHE G CE2 1 
ATOM 6454 C CZ  . PHE G 1 23  ? -31.714 17.844  -15.128 1.00 65.04 ? 163 PHE G CZ  1 
ATOM 6455 N N   . ASN G 1 24  ? -31.103 14.905  -21.662 1.00 64.05 ? 164 ASN G N   1 
ATOM 6456 C CA  . ASN G 1 24  ? -31.150 14.555  -23.084 1.00 62.69 ? 164 ASN G CA  1 
ATOM 6457 C C   . ASN G 1 24  ? -31.634 15.691  -23.985 1.00 60.53 ? 164 ASN G C   1 
ATOM 6458 O O   . ASN G 1 24  ? -32.023 16.752  -23.499 1.00 60.99 ? 164 ASN G O   1 
ATOM 6459 C CB  . ASN G 1 24  ? -32.029 13.317  -23.285 1.00 64.19 ? 164 ASN G CB  1 
ATOM 6460 C CG  . ASN G 1 24  ? -33.478 13.570  -22.938 1.00 65.17 ? 164 ASN G CG  1 
ATOM 6461 O OD1 . ASN G 1 24  ? -34.195 14.241  -23.679 1.00 65.17 ? 164 ASN G OD1 1 
ATOM 6462 N ND2 . ASN G 1 24  ? -33.917 13.041  -21.800 1.00 66.33 ? 164 ASN G ND2 1 
ATOM 6463 N N   . TRP G 1 25  ? -31.613 15.460  -25.297 1.00 57.39 ? 165 TRP G N   1 
ATOM 6464 C CA  . TRP G 1 25  ? -32.026 16.475  -26.264 1.00 55.03 ? 165 TRP G CA  1 
ATOM 6465 C C   . TRP G 1 25  ? -33.447 16.977  -26.044 1.00 55.98 ? 165 TRP G C   1 
ATOM 6466 O O   . TRP G 1 25  ? -33.687 18.185  -26.022 1.00 56.81 ? 165 TRP G O   1 
ATOM 6467 C CB  . TRP G 1 25  ? -31.902 15.944  -27.694 1.00 50.86 ? 165 TRP G CB  1 
ATOM 6468 C CG  . TRP G 1 25  ? -31.712 17.039  -28.702 1.00 47.33 ? 165 TRP G CG  1 
ATOM 6469 C CD1 . TRP G 1 25  ? -30.592 17.798  -28.880 1.00 45.58 ? 165 TRP G CD1 1 
ATOM 6470 C CD2 . TRP G 1 25  ? -32.684 17.537  -29.637 1.00 46.53 ? 165 TRP G CD2 1 
ATOM 6471 N NE1 . TRP G 1 25  ? -30.802 18.738  -29.861 1.00 44.63 ? 165 TRP G NE1 1 
ATOM 6472 C CE2 . TRP G 1 25  ? -32.075 18.602  -30.342 1.00 45.08 ? 165 TRP G CE2 1 
ATOM 6473 C CE3 . TRP G 1 25  ? -34.007 17.188  -29.945 1.00 44.43 ? 165 TRP G CE3 1 
ATOM 6474 C CZ2 . TRP G 1 25  ? -32.747 19.323  -31.339 1.00 43.75 ? 165 TRP G CZ2 1 
ATOM 6475 C CZ3 . TRP G 1 25  ? -34.673 17.905  -30.937 1.00 42.57 ? 165 TRP G CZ3 1 
ATOM 6476 C CH2 . TRP G 1 25  ? -34.039 18.961  -31.621 1.00 43.22 ? 165 TRP G CH2 1 
ATOM 6477 N N   . GLU G 1 26  ? -34.388 16.051  -25.887 1.00 57.10 ? 166 GLU G N   1 
ATOM 6478 C CA  . GLU G 1 26  ? -35.786 16.415  -25.674 1.00 58.43 ? 166 GLU G CA  1 
ATOM 6479 C C   . GLU G 1 26  ? -35.980 17.284  -24.436 1.00 57.79 ? 166 GLU G C   1 
ATOM 6480 O O   . GLU G 1 26  ? -36.348 18.452  -24.549 1.00 57.34 ? 166 GLU G O   1 
ATOM 6481 C CB  . GLU G 1 26  ? -36.657 15.158  -25.564 1.00 61.67 ? 166 GLU G CB  1 
ATOM 6482 C CG  . GLU G 1 26  ? -38.147 15.441  -25.362 1.00 63.91 ? 166 GLU G CG  1 
ATOM 6483 C CD  . GLU G 1 26  ? -39.007 14.195  -25.506 1.00 65.27 ? 166 GLU G CD  1 
ATOM 6484 O OE1 . GLU G 1 26  ? -38.704 13.181  -24.842 1.00 66.36 ? 166 GLU G OE1 1 
ATOM 6485 O OE2 . GLU G 1 26  ? -39.988 14.232  -26.280 1.00 64.64 ? 166 GLU G OE2 1 
ATOM 6486 N N   . LYS G 1 27  ? -35.737 16.715  -23.258 1.00 57.38 ? 167 LYS G N   1 
ATOM 6487 C CA  . LYS G 1 27  ? -35.885 17.460  -22.010 1.00 56.84 ? 167 LYS G CA  1 
ATOM 6488 C C   . LYS G 1 27  ? -35.200 18.817  -22.124 1.00 57.14 ? 167 LYS G C   1 
ATOM 6489 O O   . LYS G 1 27  ? -35.771 19.841  -21.751 1.00 57.26 ? 167 LYS G O   1 
ATOM 6490 C CB  . LYS G 1 27  ? -35.279 16.677  -20.837 1.00 55.22 ? 167 LYS G CB  1 
ATOM 6491 C CG  . LYS G 1 27  ? -36.037 15.414  -20.457 1.00 53.38 ? 167 LYS G CG  1 
ATOM 6492 C CD  . LYS G 1 27  ? -37.402 15.729  -19.863 1.00 51.15 ? 167 LYS G CD  1 
ATOM 6493 C CE  . LYS G 1 27  ? -38.114 14.460  -19.424 1.00 49.24 ? 167 LYS G CE  1 
ATOM 6494 N NZ  . LYS G 1 27  ? -39.436 14.753  -18.804 1.00 46.04 ? 167 LYS G NZ  1 
ATOM 6495 N N   . SER G 1 28  ? -33.978 18.820  -22.649 1.00 58.21 ? 168 SER G N   1 
ATOM 6496 C CA  . SER G 1 28  ? -33.221 20.058  -22.802 1.00 58.89 ? 168 SER G CA  1 
ATOM 6497 C C   . SER G 1 28  ? -33.918 21.049  -23.722 1.00 59.01 ? 168 SER G C   1 
ATOM 6498 O O   . SER G 1 28  ? -33.872 22.257  -23.484 1.00 59.05 ? 168 SER G O   1 
ATOM 6499 C CB  . SER G 1 28  ? -31.809 19.771  -23.330 1.00 59.49 ? 168 SER G CB  1 
ATOM 6500 O OG  . SER G 1 28  ? -30.988 19.196  -22.325 1.00 57.04 ? 168 SER G OG  1 
ATOM 6501 N N   . GLN G 1 29  ? -34.558 20.541  -24.772 1.00 59.39 ? 169 GLN G N   1 
ATOM 6502 C CA  . GLN G 1 29  ? -35.265 21.404  -25.712 1.00 60.76 ? 169 GLN G CA  1 
ATOM 6503 C C   . GLN G 1 29  ? -36.477 22.041  -25.040 1.00 61.52 ? 169 GLN G C   1 
ATOM 6504 O O   . GLN G 1 29  ? -36.792 23.208  -25.275 1.00 60.82 ? 169 GLN G O   1 
ATOM 6505 C CB  . GLN G 1 29  ? -35.717 20.607  -26.935 1.00 60.63 ? 169 GLN G CB  1 
ATOM 6506 C CG  . GLN G 1 29  ? -36.555 21.418  -27.906 1.00 61.19 ? 169 GLN G CG  1 
ATOM 6507 C CD  . GLN G 1 29  ? -36.994 20.621  -29.114 1.00 60.75 ? 169 GLN G CD  1 
ATOM 6508 O OE1 . GLN G 1 29  ? -36.172 20.193  -29.918 1.00 61.56 ? 169 GLN G OE1 1 
ATOM 6509 N NE2 . GLN G 1 29  ? -38.298 20.419  -29.249 1.00 60.25 ? 169 GLN G NE2 1 
ATOM 6510 N N   . GLU G 1 30  ? -37.161 21.266  -24.204 1.00 62.73 ? 170 GLU G N   1 
ATOM 6511 C CA  . GLU G 1 30  ? -38.323 21.772  -23.488 1.00 64.40 ? 170 GLU G CA  1 
ATOM 6512 C C   . GLU G 1 30  ? -37.851 22.828  -22.493 1.00 64.16 ? 170 GLU G C   1 
ATOM 6513 O O   . GLU G 1 30  ? -38.509 23.854  -22.306 1.00 64.43 ? 170 GLU G O   1 
ATOM 6514 C CB  . GLU G 1 30  ? -39.037 20.633  -22.750 1.00 66.50 ? 170 GLU G CB  1 
ATOM 6515 C CG  . GLU G 1 30  ? -39.550 19.524  -23.663 1.00 70.28 ? 170 GLU G CG  1 
ATOM 6516 C CD  . GLU G 1 30  ? -40.318 18.453  -22.909 1.00 72.07 ? 170 GLU G CD  1 
ATOM 6517 O OE1 . GLU G 1 30  ? -39.728 17.819  -22.009 1.00 72.84 ? 170 GLU G OE1 1 
ATOM 6518 O OE2 . GLU G 1 30  ? -41.512 18.245  -23.217 1.00 73.65 ? 170 GLU G OE2 1 
ATOM 6519 N N   . LYS G 1 31  ? -36.703 22.567  -21.868 1.00 63.40 ? 171 LYS G N   1 
ATOM 6520 C CA  . LYS G 1 31  ? -36.102 23.479  -20.894 1.00 61.74 ? 171 LYS G CA  1 
ATOM 6521 C C   . LYS G 1 31  ? -35.738 24.824  -21.509 1.00 61.30 ? 171 LYS G C   1 
ATOM 6522 O O   . LYS G 1 31  ? -35.899 25.869  -20.878 1.00 61.72 ? 171 LYS G O   1 
ATOM 6523 C CB  . LYS G 1 31  ? -34.846 22.855  -20.291 1.00 61.42 ? 171 LYS G CB  1 
ATOM 6524 C CG  . LYS G 1 31  ? -35.041 22.248  -18.917 1.00 63.32 ? 171 LYS G CG  1 
ATOM 6525 C CD  . LYS G 1 31  ? -36.080 21.139  -18.915 1.00 63.15 ? 171 LYS G CD  1 
ATOM 6526 C CE  . LYS G 1 31  ? -36.029 20.369  -17.604 1.00 63.92 ? 171 LYS G CE  1 
ATOM 6527 N NZ  . LYS G 1 31  ? -34.680 19.765  -17.376 1.00 63.14 ? 171 LYS G NZ  1 
ATOM 6528 N N   . CYS G 1 32  ? -35.235 24.790  -22.740 1.00 59.78 ? 172 CYS G N   1 
ATOM 6529 C CA  . CYS G 1 32  ? -34.853 26.007  -23.442 1.00 58.32 ? 172 CYS G CA  1 
ATOM 6530 C C   . CYS G 1 32  ? -36.058 26.869  -23.768 1.00 57.26 ? 172 CYS G C   1 
ATOM 6531 O O   . CYS G 1 32  ? -35.965 28.093  -23.818 1.00 56.57 ? 172 CYS G O   1 
ATOM 6532 C CB  . CYS G 1 32  ? -34.125 25.668  -24.736 1.00 57.58 ? 172 CYS G CB  1 
ATOM 6533 S SG  . CYS G 1 32  ? -32.349 25.336  -24.538 1.00 59.51 ? 172 CYS G SG  1 
ATOM 6534 N N   . LEU G 1 33  ? -37.192 26.219  -23.990 1.00 57.14 ? 173 LEU G N   1 
ATOM 6535 C CA  . LEU G 1 33  ? -38.417 26.923  -24.326 1.00 56.76 ? 173 LEU G CA  1 
ATOM 6536 C C   . LEU G 1 33  ? -39.160 27.394  -23.077 1.00 56.01 ? 173 LEU G C   1 
ATOM 6537 O O   . LEU G 1 33  ? -39.935 28.349  -23.131 1.00 54.72 ? 173 LEU G O   1 
ATOM 6538 C CB  . LEU G 1 33  ? -39.300 26.017  -25.189 1.00 56.35 ? 173 LEU G CB  1 
ATOM 6539 C CG  . LEU G 1 33  ? -40.610 26.562  -25.758 1.00 57.09 ? 173 LEU G CG  1 
ATOM 6540 C CD1 . LEU G 1 33  ? -40.937 25.813  -27.042 1.00 57.90 ? 173 LEU G CD1 1 
ATOM 6541 C CD2 . LEU G 1 33  ? -41.731 26.421  -24.732 1.00 56.03 ? 173 LEU G CD2 1 
ATOM 6542 N N   . SER G 1 34  ? -38.916 26.730  -21.950 1.00 55.10 ? 174 SER G N   1 
ATOM 6543 C CA  . SER G 1 34  ? -39.562 27.114  -20.702 1.00 54.61 ? 174 SER G CA  1 
ATOM 6544 C C   . SER G 1 34  ? -38.959 28.443  -20.258 1.00 55.13 ? 174 SER G C   1 
ATOM 6545 O O   . SER G 1 34  ? -39.586 29.219  -19.535 1.00 55.38 ? 174 SER G O   1 
ATOM 6546 C CB  . SER G 1 34  ? -39.342 26.046  -19.630 1.00 53.27 ? 174 SER G CB  1 
ATOM 6547 O OG  . SER G 1 34  ? -37.981 25.974  -19.254 1.00 52.82 ? 174 SER G OG  1 
ATOM 6548 N N   . LEU G 1 35  ? -37.727 28.694  -20.693 1.00 54.85 ? 175 LEU G N   1 
ATOM 6549 C CA  . LEU G 1 35  ? -37.045 29.943  -20.379 1.00 53.87 ? 175 LEU G CA  1 
ATOM 6550 C C   . LEU G 1 35  ? -37.360 30.910  -21.508 1.00 53.62 ? 175 LEU G C   1 
ATOM 6551 O O   . LEU G 1 35  ? -36.638 31.880  -21.741 1.00 52.55 ? 175 LEU G O   1 
ATOM 6552 C CB  . LEU G 1 35  ? -35.534 29.732  -20.279 1.00 52.36 ? 175 LEU G CB  1 
ATOM 6553 C CG  . LEU G 1 35  ? -35.026 29.017  -19.029 1.00 50.88 ? 175 LEU G CG  1 
ATOM 6554 C CD1 . LEU G 1 35  ? -33.533 28.809  -19.147 1.00 50.82 ? 175 LEU G CD1 1 
ATOM 6555 C CD2 . LEU G 1 35  ? -35.352 29.839  -17.797 1.00 49.65 ? 175 LEU G CD2 1 
ATOM 6556 N N   . ASP G 1 36  ? -38.444 30.620  -22.218 1.00 53.83 ? 176 ASP G N   1 
ATOM 6557 C CA  . ASP G 1 36  ? -38.882 31.459  -23.320 1.00 55.82 ? 176 ASP G CA  1 
ATOM 6558 C C   . ASP G 1 36  ? -37.807 31.567  -24.402 1.00 55.65 ? 176 ASP G C   1 
ATOM 6559 O O   . ASP G 1 36  ? -37.547 32.651  -24.925 1.00 55.11 ? 176 ASP G O   1 
ATOM 6560 C CB  . ASP G 1 36  ? -39.233 32.848  -22.785 1.00 59.04 ? 176 ASP G CB  1 
ATOM 6561 C CG  . ASP G 1 36  ? -39.971 33.690  -23.797 1.00 61.32 ? 176 ASP G CG  1 
ATOM 6562 O OD1 . ASP G 1 36  ? -41.053 33.251  -24.242 1.00 61.76 ? 176 ASP G OD1 1 
ATOM 6563 O OD2 . ASP G 1 36  ? -39.471 34.784  -24.146 1.00 62.35 ? 176 ASP G OD2 1 
ATOM 6564 N N   . ALA G 1 37  ? -37.188 30.437  -24.736 1.00 55.53 ? 177 ALA G N   1 
ATOM 6565 C CA  . ALA G 1 37  ? -36.141 30.413  -25.754 1.00 54.63 ? 177 ALA G CA  1 
ATOM 6566 C C   . ALA G 1 37  ? -36.076 29.087  -26.503 1.00 53.66 ? 177 ALA G C   1 
ATOM 6567 O O   . ALA G 1 37  ? -36.945 28.228  -26.351 1.00 53.65 ? 177 ALA G O   1 
ATOM 6568 C CB  . ALA G 1 37  ? -34.790 30.711  -25.116 1.00 56.32 ? 177 ALA G CB  1 
ATOM 6569 N N   . LYS G 1 38  ? -35.032 28.929  -27.308 1.00 51.87 ? 178 LYS G N   1 
ATOM 6570 C CA  . LYS G 1 38  ? -34.843 27.717  -28.093 1.00 51.42 ? 178 LYS G CA  1 
ATOM 6571 C C   . LYS G 1 38  ? -33.420 27.207  -27.941 1.00 51.87 ? 178 LYS G C   1 
ATOM 6572 O O   . LYS G 1 38  ? -32.601 27.833  -27.270 1.00 52.66 ? 178 LYS G O   1 
ATOM 6573 C CB  . LYS G 1 38  ? -35.121 28.003  -29.570 1.00 50.24 ? 178 LYS G CB  1 
ATOM 6574 C CG  . LYS G 1 38  ? -34.287 29.140  -30.147 1.00 46.75 ? 178 LYS G CG  1 
ATOM 6575 C CD  . LYS G 1 38  ? -34.547 29.332  -31.631 1.00 44.51 ? 178 LYS G CD  1 
ATOM 6576 C CE  . LYS G 1 38  ? -33.709 30.468  -32.194 1.00 44.56 ? 178 LYS G CE  1 
ATOM 6577 N NZ  . LYS G 1 38  ? -33.778 30.532  -33.679 1.00 46.39 ? 178 LYS G NZ  1 
ATOM 6578 N N   . LEU G 1 39  ? -33.131 26.070  -28.567 1.00 51.23 ? 179 LEU G N   1 
ATOM 6579 C CA  . LEU G 1 39  ? -31.794 25.496  -28.510 1.00 50.55 ? 179 LEU G CA  1 
ATOM 6580 C C   . LEU G 1 39  ? -30.834 26.286  -29.391 1.00 49.96 ? 179 LEU G C   1 
ATOM 6581 O O   . LEU G 1 39  ? -31.240 27.213  -30.094 1.00 50.71 ? 179 LEU G O   1 
ATOM 6582 C CB  . LEU G 1 39  ? -31.827 24.031  -28.947 1.00 51.48 ? 179 LEU G CB  1 
ATOM 6583 C CG  . LEU G 1 39  ? -32.231 23.049  -27.845 1.00 52.27 ? 179 LEU G CG  1 
ATOM 6584 C CD1 . LEU G 1 39  ? -32.618 21.711  -28.446 1.00 52.77 ? 179 LEU G CD1 1 
ATOM 6585 C CD2 . LEU G 1 39  ? -31.075 22.894  -26.866 1.00 51.90 ? 179 LEU G CD2 1 
ATOM 6586 N N   . LEU G 1 40  ? -29.561 25.916  -29.351 1.00 48.70 ? 180 LEU G N   1 
ATOM 6587 C CA  . LEU G 1 40  ? -28.550 26.603  -30.137 1.00 48.66 ? 180 LEU G CA  1 
ATOM 6588 C C   . LEU G 1 40  ? -28.703 26.406  -31.641 1.00 49.45 ? 180 LEU G C   1 
ATOM 6589 O O   . LEU G 1 40  ? -28.731 25.279  -32.132 1.00 48.51 ? 180 LEU G O   1 
ATOM 6590 C CB  . LEU G 1 40  ? -27.152 26.147  -29.711 1.00 47.54 ? 180 LEU G CB  1 
ATOM 6591 C CG  . LEU G 1 40  ? -25.983 26.709  -30.525 1.00 45.33 ? 180 LEU G CG  1 
ATOM 6592 C CD1 . LEU G 1 40  ? -26.082 28.221  -30.586 1.00 45.65 ? 180 LEU G CD1 1 
ATOM 6593 C CD2 . LEU G 1 40  ? -24.666 26.283  -29.899 1.00 44.95 ? 180 LEU G CD2 1 
ATOM 6594 N N   . LYS G 1 41  ? -28.813 27.518  -32.362 1.00 50.38 ? 181 LYS G N   1 
ATOM 6595 C CA  . LYS G 1 41  ? -28.919 27.492  -33.814 1.00 51.07 ? 181 LYS G CA  1 
ATOM 6596 C C   . LYS G 1 41  ? -27.772 28.328  -34.364 1.00 50.93 ? 181 LYS G C   1 
ATOM 6597 O O   . LYS G 1 41  ? -27.633 29.503  -34.027 1.00 49.79 ? 181 LYS G O   1 
ATOM 6598 C CB  . LYS G 1 41  ? -30.246 28.083  -34.297 1.00 52.11 ? 181 LYS G CB  1 
ATOM 6599 C CG  . LYS G 1 41  ? -30.314 28.166  -35.822 1.00 52.70 ? 181 LYS G CG  1 
ATOM 6600 C CD  . LYS G 1 41  ? -31.603 28.773  -36.348 1.00 53.29 ? 181 LYS G CD  1 
ATOM 6601 C CE  . LYS G 1 41  ? -31.546 28.863  -37.872 1.00 54.28 ? 181 LYS G CE  1 
ATOM 6602 N NZ  . LYS G 1 41  ? -32.799 29.371  -38.497 1.00 52.99 ? 181 LYS G NZ  1 
ATOM 6603 N N   . ILE G 1 42  ? -26.951 27.717  -35.209 1.00 51.85 ? 182 ILE G N   1 
ATOM 6604 C CA  . ILE G 1 42  ? -25.814 28.414  -35.787 1.00 53.25 ? 182 ILE G CA  1 
ATOM 6605 C C   . ILE G 1 42  ? -26.031 28.785  -37.250 1.00 54.46 ? 182 ILE G C   1 
ATOM 6606 O O   . ILE G 1 42  ? -26.141 27.922  -38.122 1.00 54.28 ? 182 ILE G O   1 
ATOM 6607 C CB  . ILE G 1 42  ? -24.538 27.571  -35.632 1.00 52.44 ? 182 ILE G CB  1 
ATOM 6608 C CG1 . ILE G 1 42  ? -24.145 27.534  -34.154 1.00 52.69 ? 182 ILE G CG1 1 
ATOM 6609 C CG2 . ILE G 1 42  ? -23.418 28.143  -36.483 1.00 50.20 ? 182 ILE G CG2 1 
ATOM 6610 C CD1 . ILE G 1 42  ? -22.990 26.627  -33.848 1.00 54.71 ? 182 ILE G CD1 1 
ATOM 6611 N N   . ASN G 1 43  ? -26.084 30.088  -37.502 1.00 56.03 ? 183 ASN G N   1 
ATOM 6612 C CA  . ASN G 1 43  ? -26.301 30.620  -38.839 1.00 57.95 ? 183 ASN G CA  1 
ATOM 6613 C C   . ASN G 1 43  ? -24.985 30.956  -39.535 1.00 58.44 ? 183 ASN G C   1 
ATOM 6614 O O   . ASN G 1 43  ? -24.728 30.504  -40.649 1.00 58.87 ? 183 ASN G O   1 
ATOM 6615 C CB  . ASN G 1 43  ? -27.183 31.868  -38.749 1.00 58.42 ? 183 ASN G CB  1 
ATOM 6616 C CG  . ASN G 1 43  ? -28.509 31.593  -38.062 1.00 59.42 ? 183 ASN G CG  1 
ATOM 6617 O OD1 . ASN G 1 43  ? -29.193 32.512  -37.613 1.00 60.49 ? 183 ASN G OD1 1 
ATOM 6618 N ND2 . ASN G 1 43  ? -28.881 30.318  -37.982 1.00 58.87 ? 183 ASN G ND2 1 
ATOM 6619 N N   . SER G 1 44  ? -24.155 31.753  -38.873 1.00 58.51 ? 184 SER G N   1 
ATOM 6620 C CA  . SER G 1 44  ? -22.871 32.146  -39.435 1.00 58.18 ? 184 SER G CA  1 
ATOM 6621 C C   . SER G 1 44  ? -21.763 31.294  -38.845 1.00 57.63 ? 184 SER G C   1 
ATOM 6622 O O   . SER G 1 44  ? -22.021 30.392  -38.055 1.00 57.47 ? 184 SER G O   1 
ATOM 6623 C CB  . SER G 1 44  ? -22.601 33.626  -39.144 1.00 58.83 ? 184 SER G CB  1 
ATOM 6624 O OG  . SER G 1 44  ? -22.669 33.901  -37.754 1.00 57.87 ? 184 SER G OG  1 
ATOM 6625 N N   . THR G 1 45  ? -20.529 31.579  -39.237 1.00 58.23 ? 185 THR G N   1 
ATOM 6626 C CA  . THR G 1 45  ? -19.387 30.836  -38.724 1.00 58.60 ? 185 THR G CA  1 
ATOM 6627 C C   . THR G 1 45  ? -18.904 31.540  -37.465 1.00 58.55 ? 185 THR G C   1 
ATOM 6628 O O   . THR G 1 45  ? -18.286 30.929  -36.592 1.00 58.96 ? 185 THR G O   1 
ATOM 6629 C CB  . THR G 1 45  ? -18.237 30.807  -39.743 1.00 58.67 ? 185 THR G CB  1 
ATOM 6630 O OG1 . THR G 1 45  ? -18.727 30.332  -41.002 1.00 60.74 ? 185 THR G OG1 1 
ATOM 6631 C CG2 . THR G 1 45  ? -17.124 29.892  -39.260 1.00 57.16 ? 185 THR G CG2 1 
ATOM 6632 N N   . ALA G 1 46  ? -19.203 32.834  -37.383 1.00 57.55 ? 186 ALA G N   1 
ATOM 6633 C CA  . ALA G 1 46  ? -18.813 33.656  -36.247 1.00 56.28 ? 186 ALA G CA  1 
ATOM 6634 C C   . ALA G 1 46  ? -19.596 33.277  -34.999 1.00 56.35 ? 186 ALA G C   1 
ATOM 6635 O O   . ALA G 1 46  ? -19.213 33.637  -33.887 1.00 57.04 ? 186 ALA G O   1 
ATOM 6636 C CB  . ALA G 1 46  ? -19.031 35.124  -36.569 1.00 54.20 ? 186 ALA G CB  1 
ATOM 6637 N N   . ASP G 1 47  ? -20.696 32.554  -35.186 1.00 55.90 ? 187 ASP G N   1 
ATOM 6638 C CA  . ASP G 1 47  ? -21.516 32.132  -34.059 1.00 54.70 ? 187 ASP G CA  1 
ATOM 6639 C C   . ASP G 1 47  ? -20.930 30.899  -33.391 1.00 53.78 ? 187 ASP G C   1 
ATOM 6640 O O   . ASP G 1 47  ? -20.917 30.800  -32.166 1.00 54.56 ? 187 ASP G O   1 
ATOM 6641 C CB  . ASP G 1 47  ? -22.949 31.837  -34.508 1.00 55.15 ? 187 ASP G CB  1 
ATOM 6642 C CG  . ASP G 1 47  ? -23.658 33.067  -35.027 1.00 55.67 ? 187 ASP G CG  1 
ATOM 6643 O OD1 . ASP G 1 47  ? -23.514 34.141  -34.407 1.00 55.24 ? 187 ASP G OD1 1 
ATOM 6644 O OD2 . ASP G 1 47  ? -24.367 32.956  -36.049 1.00 57.49 ? 187 ASP G OD2 1 
ATOM 6645 N N   . LEU G 1 48  ? -20.448 29.960  -34.197 1.00 52.48 ? 188 LEU G N   1 
ATOM 6646 C CA  . LEU G 1 48  ? -19.863 28.738  -33.660 1.00 52.25 ? 188 LEU G CA  1 
ATOM 6647 C C   . LEU G 1 48  ? -18.528 29.017  -32.987 1.00 52.16 ? 188 LEU G C   1 
ATOM 6648 O O   . LEU G 1 48  ? -18.145 28.331  -32.040 1.00 50.72 ? 188 LEU G O   1 
ATOM 6649 C CB  . LEU G 1 48  ? -19.672 27.702  -34.768 1.00 51.70 ? 188 LEU G CB  1 
ATOM 6650 C CG  . LEU G 1 48  ? -19.011 26.391  -34.331 1.00 50.85 ? 188 LEU G CG  1 
ATOM 6651 C CD1 . LEU G 1 48  ? -19.779 25.781  -33.173 1.00 50.73 ? 188 LEU G CD1 1 
ATOM 6652 C CD2 . LEU G 1 48  ? -18.964 25.433  -35.501 1.00 52.10 ? 188 LEU G CD2 1 
ATOM 6653 N N   . ASP G 1 49  ? -17.814 30.022  -33.480 1.00 52.68 ? 189 ASP G N   1 
ATOM 6654 C CA  . ASP G 1 49  ? -16.532 30.369  -32.892 1.00 54.32 ? 189 ASP G CA  1 
ATOM 6655 C C   . ASP G 1 49  ? -16.745 31.157  -31.612 1.00 54.62 ? 189 ASP G C   1 
ATOM 6656 O O   . ASP G 1 49  ? -15.874 31.193  -30.746 1.00 56.02 ? 189 ASP G O   1 
ATOM 6657 C CB  . ASP G 1 49  ? -15.680 31.165  -33.877 1.00 56.53 ? 189 ASP G CB  1 
ATOM 6658 C CG  . ASP G 1 49  ? -15.116 30.295  -34.979 1.00 59.48 ? 189 ASP G CG  1 
ATOM 6659 O OD1 . ASP G 1 49  ? -14.671 29.167  -34.669 1.00 60.57 ? 189 ASP G OD1 1 
ATOM 6660 O OD2 . ASP G 1 49  ? -15.108 30.738  -36.148 1.00 61.39 ? 189 ASP G OD2 1 
ATOM 6661 N N   . PHE G 1 50  ? -17.904 31.795  -31.498 1.00 53.89 ? 190 PHE G N   1 
ATOM 6662 C CA  . PHE G 1 50  ? -18.230 32.542  -30.293 1.00 53.39 ? 190 PHE G CA  1 
ATOM 6663 C C   . PHE G 1 50  ? -18.646 31.524  -29.240 1.00 52.79 ? 190 PHE G C   1 
ATOM 6664 O O   . PHE G 1 50  ? -18.295 31.636  -28.064 1.00 53.92 ? 190 PHE G O   1 
ATOM 6665 C CB  . PHE G 1 50  ? -19.394 33.500  -30.536 1.00 53.71 ? 190 PHE G CB  1 
ATOM 6666 C CG  . PHE G 1 50  ? -20.199 33.783  -29.301 1.00 54.76 ? 190 PHE G CG  1 
ATOM 6667 C CD1 . PHE G 1 50  ? -19.619 34.422  -28.209 1.00 55.34 ? 190 PHE G CD1 1 
ATOM 6668 C CD2 . PHE G 1 50  ? -21.518 33.359  -29.204 1.00 55.58 ? 190 PHE G CD2 1 
ATOM 6669 C CE1 . PHE G 1 50  ? -20.343 34.634  -27.039 1.00 55.49 ? 190 PHE G CE1 1 
ATOM 6670 C CE2 . PHE G 1 50  ? -22.251 33.567  -28.039 1.00 55.57 ? 190 PHE G CE2 1 
ATOM 6671 C CZ  . PHE G 1 50  ? -21.661 34.202  -26.955 1.00 55.41 ? 190 PHE G CZ  1 
ATOM 6672 N N   . ILE G 1 51  ? -19.413 30.536  -29.683 1.00 51.49 ? 191 ILE G N   1 
ATOM 6673 C CA  . ILE G 1 51  ? -19.896 29.476  -28.815 1.00 50.93 ? 191 ILE G CA  1 
ATOM 6674 C C   . ILE G 1 51  ? -18.745 28.550  -28.430 1.00 52.14 ? 191 ILE G C   1 
ATOM 6675 O O   . ILE G 1 51  ? -18.696 28.024  -27.318 1.00 52.18 ? 191 ILE G O   1 
ATOM 6676 C CB  . ILE G 1 51  ? -20.990 28.643  -29.523 1.00 49.15 ? 191 ILE G CB  1 
ATOM 6677 C CG1 . ILE G 1 51  ? -22.207 29.522  -29.818 1.00 47.63 ? 191 ILE G CG1 1 
ATOM 6678 C CG2 . ILE G 1 51  ? -21.384 27.453  -28.665 1.00 47.78 ? 191 ILE G CG2 1 
ATOM 6679 C CD1 . ILE G 1 51  ? -22.857 30.108  -28.587 1.00 46.20 ? 191 ILE G CD1 1 
ATOM 6680 N N   . GLN G 1 52  ? -17.815 28.361  -29.358 1.00 53.74 ? 192 GLN G N   1 
ATOM 6681 C CA  . GLN G 1 52  ? -16.678 27.484  -29.124 1.00 55.29 ? 192 GLN G CA  1 
ATOM 6682 C C   . GLN G 1 52  ? -15.796 27.983  -27.985 1.00 54.87 ? 192 GLN G C   1 
ATOM 6683 O O   . GLN G 1 52  ? -15.359 27.207  -27.134 1.00 54.26 ? 192 GLN G O   1 
ATOM 6684 C CB  . GLN G 1 52  ? -15.852 27.353  -30.404 1.00 57.12 ? 192 GLN G CB  1 
ATOM 6685 C CG  . GLN G 1 52  ? -15.271 25.979  -30.579 1.00 61.15 ? 192 GLN G CG  1 
ATOM 6686 C CD  . GLN G 1 52  ? -16.338 24.918  -30.462 1.00 63.37 ? 192 GLN G CD  1 
ATOM 6687 O OE1 . GLN G 1 52  ? -17.281 24.887  -31.248 1.00 64.91 ? 192 GLN G OE1 1 
ATOM 6688 N NE2 . GLN G 1 52  ? -16.203 24.047  -29.469 1.00 65.52 ? 192 GLN G NE2 1 
ATOM 6689 N N   . GLN G 1 53  ? -15.535 29.283  -27.974 1.00 54.67 ? 193 GLN G N   1 
ATOM 6690 C CA  . GLN G 1 53  ? -14.705 29.880  -26.941 1.00 55.26 ? 193 GLN G CA  1 
ATOM 6691 C C   . GLN G 1 53  ? -15.532 30.046  -25.676 1.00 54.40 ? 193 GLN G C   1 
ATOM 6692 O O   . GLN G 1 53  ? -14.988 30.160  -24.580 1.00 55.65 ? 193 GLN G O   1 
ATOM 6693 C CB  . GLN G 1 53  ? -14.193 31.244  -27.403 1.00 57.76 ? 193 GLN G CB  1 
ATOM 6694 C CG  . GLN G 1 53  ? -13.189 31.882  -26.459 1.00 62.82 ? 193 GLN G CG  1 
ATOM 6695 C CD  . GLN G 1 53  ? -13.013 33.368  -26.718 1.00 67.74 ? 193 GLN G CD  1 
ATOM 6696 O OE1 . GLN G 1 53  ? -12.691 33.787  -27.834 1.00 69.22 ? 193 GLN G OE1 1 
ATOM 6697 N NE2 . GLN G 1 53  ? -13.226 34.177  -25.684 1.00 69.29 ? 193 GLN G NE2 1 
ATOM 6698 N N   . ALA G 1 54  ? -16.852 30.058  -25.836 1.00 52.84 ? 194 ALA G N   1 
ATOM 6699 C CA  . ALA G 1 54  ? -17.759 30.215  -24.706 1.00 50.82 ? 194 ALA G CA  1 
ATOM 6700 C C   . ALA G 1 54  ? -17.874 28.925  -23.901 1.00 50.05 ? 194 ALA G C   1 
ATOM 6701 O O   . ALA G 1 54  ? -18.375 28.931  -22.776 1.00 50.66 ? 194 ALA G O   1 
ATOM 6702 C CB  . ALA G 1 54  ? -19.134 30.656  -25.195 1.00 49.74 ? 194 ALA G CB  1 
ATOM 6703 N N   . ILE G 1 55  ? -17.413 27.822  -24.483 1.00 48.19 ? 195 ILE G N   1 
ATOM 6704 C CA  . ILE G 1 55  ? -17.454 26.530  -23.812 1.00 49.01 ? 195 ILE G CA  1 
ATOM 6705 C C   . ILE G 1 55  ? -16.063 25.904  -23.740 1.00 49.29 ? 195 ILE G C   1 
ATOM 6706 O O   . ILE G 1 55  ? -15.889 24.835  -23.161 1.00 49.40 ? 195 ILE G O   1 
ATOM 6707 C CB  . ILE G 1 55  ? -18.400 25.541  -24.533 1.00 49.21 ? 195 ILE G CB  1 
ATOM 6708 C CG1 . ILE G 1 55  ? -17.873 25.222  -25.932 1.00 49.84 ? 195 ILE G CG1 1 
ATOM 6709 C CG2 . ILE G 1 55  ? -19.779 26.141  -24.654 1.00 50.45 ? 195 ILE G CG2 1 
ATOM 6710 C CD1 . ILE G 1 55  ? -18.666 24.149  -26.654 1.00 47.34 ? 195 ILE G CD1 1 
ATOM 6711 N N   . SER G 1 56  ? -15.076 26.572  -24.329 1.00 49.51 ? 196 SER G N   1 
ATOM 6712 C CA  . SER G 1 56  ? -13.703 26.072  -24.330 1.00 50.31 ? 196 SER G CA  1 
ATOM 6713 C C   . SER G 1 56  ? -13.268 25.547  -22.960 1.00 51.39 ? 196 SER G C   1 
ATOM 6714 O O   . SER G 1 56  ? -12.915 24.375  -22.804 1.00 49.90 ? 196 SER G O   1 
ATOM 6715 C CB  . SER G 1 56  ? -12.742 27.178  -24.784 1.00 48.47 ? 196 SER G CB  1 
ATOM 6716 O OG  . SER G 1 56  ? -12.797 28.298  -23.919 1.00 46.43 ? 196 SER G OG  1 
ATOM 6717 N N   . TYR G 1 57  ? -13.301 26.424  -21.965 1.00 54.02 ? 197 TYR G N   1 
ATOM 6718 C CA  . TYR G 1 57  ? -12.904 26.049  -20.617 1.00 56.83 ? 197 TYR G CA  1 
ATOM 6719 C C   . TYR G 1 57  ? -13.784 24.951  -20.036 1.00 57.72 ? 197 TYR G C   1 
ATOM 6720 O O   . TYR G 1 57  ? -13.674 24.621  -18.855 1.00 59.11 ? 197 TYR G O   1 
ATOM 6721 C CB  . TYR G 1 57  ? -12.915 27.281  -19.703 1.00 58.22 ? 197 TYR G CB  1 
ATOM 6722 C CG  . TYR G 1 57  ? -13.972 28.300  -20.052 1.00 61.18 ? 197 TYR G CG  1 
ATOM 6723 C CD1 . TYR G 1 57  ? -15.330 28.006  -19.919 1.00 63.98 ? 197 TYR G CD1 1 
ATOM 6724 C CD2 . TYR G 1 57  ? -13.615 29.554  -20.546 1.00 63.14 ? 197 TYR G CD2 1 
ATOM 6725 C CE1 . TYR G 1 57  ? -16.312 28.939  -20.274 1.00 66.26 ? 197 TYR G CE1 1 
ATOM 6726 C CE2 . TYR G 1 57  ? -14.584 30.494  -20.905 1.00 66.36 ? 197 TYR G CE2 1 
ATOM 6727 C CZ  . TYR G 1 57  ? -15.932 30.181  -20.768 1.00 67.99 ? 197 TYR G CZ  1 
ATOM 6728 O OH  . TYR G 1 57  ? -16.895 31.100  -21.134 1.00 69.61 ? 197 TYR G OH  1 
ATOM 6729 N N   . SER G 1 58  ? -14.645 24.375  -20.868 1.00 57.57 ? 198 SER G N   1 
ATOM 6730 C CA  . SER G 1 58  ? -15.532 23.313  -20.412 1.00 58.97 ? 198 SER G CA  1 
ATOM 6731 C C   . SER G 1 58  ? -15.084 21.917  -20.821 1.00 58.92 ? 198 SER G C   1 
ATOM 6732 O O   . SER G 1 58  ? -14.323 21.737  -21.774 1.00 57.50 ? 198 SER G O   1 
ATOM 6733 C CB  . SER G 1 58  ? -16.956 23.544  -20.920 1.00 60.29 ? 198 SER G CB  1 
ATOM 6734 O OG  . SER G 1 58  ? -17.780 22.426  -20.631 1.00 60.64 ? 198 SER G OG  1 
ATOM 6735 N N   . SER G 1 59  ? -15.578 20.932  -20.080 1.00 60.44 ? 199 SER G N   1 
ATOM 6736 C CA  . SER G 1 59  ? -15.264 19.531  -20.321 1.00 63.30 ? 199 SER G CA  1 
ATOM 6737 C C   . SER G 1 59  ? -16.462 18.817  -20.944 1.00 63.70 ? 199 SER G C   1 
ATOM 6738 O O   . SER G 1 59  ? -16.324 18.099  -21.937 1.00 63.79 ? 199 SER G O   1 
ATOM 6739 C CB  . SER G 1 59  ? -14.886 18.847  -19.002 1.00 63.62 ? 199 SER G CB  1 
ATOM 6740 O OG  . SER G 1 59  ? -14.630 17.468  -19.200 1.00 64.76 ? 199 SER G OG  1 
ATOM 6741 N N   . PHE G 1 60  ? -17.637 19.034  -20.363 1.00 63.44 ? 200 PHE G N   1 
ATOM 6742 C CA  . PHE G 1 60  ? -18.866 18.404  -20.833 1.00 62.73 ? 200 PHE G CA  1 
ATOM 6743 C C   . PHE G 1 60  ? -19.326 18.777  -22.242 1.00 61.52 ? 200 PHE G C   1 
ATOM 6744 O O   . PHE G 1 60  ? -19.016 19.856  -22.755 1.00 61.36 ? 200 PHE G O   1 
ATOM 6745 C CB  . PHE G 1 60  ? -20.000 18.700  -19.858 1.00 63.90 ? 200 PHE G CB  1 
ATOM 6746 C CG  . PHE G 1 60  ? -19.806 18.094  -18.507 1.00 65.34 ? 200 PHE G CG  1 
ATOM 6747 C CD1 . PHE G 1 60  ? -18.870 18.614  -17.620 1.00 65.25 ? 200 PHE G CD1 1 
ATOM 6748 C CD2 . PHE G 1 60  ? -20.568 17.000  -18.116 1.00 66.91 ? 200 PHE G CD2 1 
ATOM 6749 C CE1 . PHE G 1 60  ? -18.699 18.054  -16.360 1.00 65.73 ? 200 PHE G CE1 1 
ATOM 6750 C CE2 . PHE G 1 60  ? -20.405 16.432  -16.857 1.00 67.68 ? 200 PHE G CE2 1 
ATOM 6751 C CZ  . PHE G 1 60  ? -19.467 16.962  -15.978 1.00 66.65 ? 200 PHE G CZ  1 
ATOM 6752 N N   . PRO G 1 61  ? -20.085 17.873  -22.884 1.00 59.69 ? 201 PRO G N   1 
ATOM 6753 C CA  . PRO G 1 61  ? -20.617 18.073  -24.233 1.00 59.11 ? 201 PRO G CA  1 
ATOM 6754 C C   . PRO G 1 61  ? -21.858 18.960  -24.167 1.00 59.12 ? 201 PRO G C   1 
ATOM 6755 O O   . PRO G 1 61  ? -22.624 18.895  -23.203 1.00 58.52 ? 201 PRO G O   1 
ATOM 6756 C CB  . PRO G 1 61  ? -20.943 16.655  -24.676 1.00 59.04 ? 201 PRO G CB  1 
ATOM 6757 C CG  . PRO G 1 61  ? -21.408 16.028  -23.400 1.00 58.44 ? 201 PRO G CG  1 
ATOM 6758 C CD  . PRO G 1 61  ? -20.363 16.503  -22.416 1.00 58.50 ? 201 PRO G CD  1 
ATOM 6759 N N   . PHE G 1 62  ? -22.057 19.784  -25.190 1.00 59.36 ? 202 PHE G N   1 
ATOM 6760 C CA  . PHE G 1 62  ? -23.202 20.684  -25.219 1.00 58.63 ? 202 PHE G CA  1 
ATOM 6761 C C   . PHE G 1 62  ? -24.176 20.459  -26.367 1.00 59.09 ? 202 PHE G C   1 
ATOM 6762 O O   . PHE G 1 62  ? -23.858 20.689  -27.535 1.00 58.75 ? 202 PHE G O   1 
ATOM 6763 C CB  . PHE G 1 62  ? -22.726 22.136  -25.239 1.00 58.10 ? 202 PHE G CB  1 
ATOM 6764 C CG  . PHE G 1 62  ? -22.299 22.647  -23.897 1.00 57.36 ? 202 PHE G CG  1 
ATOM 6765 C CD1 . PHE G 1 62  ? -21.334 21.975  -23.154 1.00 57.32 ? 202 PHE G CD1 1 
ATOM 6766 C CD2 . PHE G 1 62  ? -22.863 23.801  -23.376 1.00 57.08 ? 202 PHE G CD2 1 
ATOM 6767 C CE1 . PHE G 1 62  ? -20.937 22.446  -21.911 1.00 56.85 ? 202 PHE G CE1 1 
ATOM 6768 C CE2 . PHE G 1 62  ? -22.473 24.281  -22.134 1.00 57.69 ? 202 PHE G CE2 1 
ATOM 6769 C CZ  . PHE G 1 62  ? -21.508 23.602  -21.400 1.00 57.90 ? 202 PHE G CZ  1 
ATOM 6770 N N   . TRP G 1 63  ? -25.372 20.011  -26.005 1.00 59.12 ? 203 TRP G N   1 
ATOM 6771 C CA  . TRP G 1 63  ? -26.445 19.760  -26.951 1.00 59.05 ? 203 TRP G CA  1 
ATOM 6772 C C   . TRP G 1 63  ? -26.762 21.007  -27.774 1.00 59.62 ? 203 TRP G C   1 
ATOM 6773 O O   . TRP G 1 63  ? -26.821 22.114  -27.234 1.00 60.59 ? 203 TRP G O   1 
ATOM 6774 C CB  . TRP G 1 63  ? -27.702 19.352  -26.186 1.00 58.93 ? 203 TRP G CB  1 
ATOM 6775 C CG  . TRP G 1 63  ? -27.877 17.888  -26.007 1.00 59.15 ? 203 TRP G CG  1 
ATOM 6776 C CD1 . TRP G 1 63  ? -28.438 17.255  -24.935 1.00 59.19 ? 203 TRP G CD1 1 
ATOM 6777 C CD2 . TRP G 1 63  ? -27.563 16.868  -26.957 1.00 58.83 ? 203 TRP G CD2 1 
ATOM 6778 N NE1 . TRP G 1 63  ? -28.494 15.901  -25.160 1.00 59.23 ? 203 TRP G NE1 1 
ATOM 6779 C CE2 . TRP G 1 63  ? -27.964 15.637  -26.394 1.00 58.97 ? 203 TRP G CE2 1 
ATOM 6780 C CE3 . TRP G 1 63  ? -26.983 16.874  -28.230 1.00 58.04 ? 203 TRP G CE3 1 
ATOM 6781 C CZ2 . TRP G 1 63  ? -27.802 14.425  -27.062 1.00 58.51 ? 203 TRP G CZ2 1 
ATOM 6782 C CZ3 . TRP G 1 63  ? -26.823 15.673  -28.892 1.00 58.50 ? 203 TRP G CZ3 1 
ATOM 6783 C CH2 . TRP G 1 63  ? -27.231 14.462  -28.307 1.00 59.32 ? 203 TRP G CH2 1 
ATOM 6784 N N   . MET G 1 64  ? -26.953 20.833  -29.079 1.00 58.92 ? 204 MET G N   1 
ATOM 6785 C CA  . MET G 1 64  ? -27.324 21.954  -29.934 1.00 59.01 ? 204 MET G CA  1 
ATOM 6786 C C   . MET G 1 64  ? -28.594 21.555  -30.684 1.00 59.11 ? 204 MET G C   1 
ATOM 6787 O O   . MET G 1 64  ? -28.869 20.370  -30.867 1.00 59.00 ? 204 MET G O   1 
ATOM 6788 C CB  . MET G 1 64  ? -26.199 22.336  -30.911 1.00 58.54 ? 204 MET G CB  1 
ATOM 6789 C CG  . MET G 1 64  ? -25.910 21.357  -32.035 1.00 58.68 ? 204 MET G CG  1 
ATOM 6790 S SD  . MET G 1 64  ? -25.048 22.189  -33.400 1.00 59.17 ? 204 MET G SD  1 
ATOM 6791 C CE  . MET G 1 64  ? -23.439 22.495  -32.674 1.00 58.67 ? 204 MET G CE  1 
ATOM 6792 N N   . GLY G 1 65  ? -29.370 22.548  -31.105 1.00 59.44 ? 205 GLY G N   1 
ATOM 6793 C CA  . GLY G 1 65  ? -30.625 22.283  -31.789 1.00 59.13 ? 205 GLY G CA  1 
ATOM 6794 C C   . GLY G 1 65  ? -30.632 21.602  -33.148 1.00 58.86 ? 205 GLY G C   1 
ATOM 6795 O O   . GLY G 1 65  ? -31.672 21.588  -33.807 1.00 59.83 ? 205 GLY G O   1 
ATOM 6796 N N   . LEU G 1 66  ? -29.510 21.034  -33.581 1.00 57.83 ? 206 LEU G N   1 
ATOM 6797 C CA  . LEU G 1 66  ? -29.460 20.358  -34.879 1.00 57.31 ? 206 LEU G CA  1 
ATOM 6798 C C   . LEU G 1 66  ? -29.650 18.848  -34.691 1.00 57.99 ? 206 LEU G C   1 
ATOM 6799 O O   . LEU G 1 66  ? -29.104 18.271  -33.752 1.00 57.50 ? 206 LEU G O   1 
ATOM 6800 C CB  . LEU G 1 66  ? -28.117 20.633  -35.555 1.00 55.11 ? 206 LEU G CB  1 
ATOM 6801 C CG  . LEU G 1 66  ? -28.072 20.491  -37.075 1.00 54.34 ? 206 LEU G CG  1 
ATOM 6802 C CD1 . LEU G 1 66  ? -28.853 21.630  -37.704 1.00 53.40 ? 206 LEU G CD1 1 
ATOM 6803 C CD2 . LEU G 1 66  ? -26.632 20.517  -37.556 1.00 55.76 ? 206 LEU G CD2 1 
ATOM 6804 N N   . SER G 1 67  ? -30.423 18.206  -35.569 1.00 60.01 ? 207 SER G N   1 
ATOM 6805 C CA  . SER G 1 67  ? -30.653 16.761  -35.444 1.00 61.94 ? 207 SER G CA  1 
ATOM 6806 C C   . SER G 1 67  ? -31.388 16.087  -36.610 1.00 62.64 ? 207 SER G C   1 
ATOM 6807 O O   . SER G 1 67  ? -31.763 16.732  -37.592 1.00 61.78 ? 207 SER G O   1 
ATOM 6808 C CB  . SER G 1 67  ? -31.424 16.468  -34.152 1.00 61.66 ? 207 SER G CB  1 
ATOM 6809 O OG  . SER G 1 67  ? -32.735 17.006  -34.213 1.00 60.61 ? 207 SER G OG  1 
ATOM 6810 N N   . ARG G 1 68  ? -31.580 14.774  -36.474 1.00 63.71 ? 208 ARG G N   1 
ATOM 6811 C CA  . ARG G 1 68  ? -32.274 13.950  -37.465 1.00 64.72 ? 208 ARG G CA  1 
ATOM 6812 C C   . ARG G 1 68  ? -32.497 12.545  -36.888 1.00 65.60 ? 208 ARG G C   1 
ATOM 6813 O O   . ARG G 1 68  ? -31.977 12.225  -35.820 1.00 65.10 ? 208 ARG G O   1 
ATOM 6814 C CB  . ARG G 1 68  ? -31.460 13.867  -38.759 1.00 64.30 ? 208 ARG G CB  1 
ATOM 6815 C CG  . ARG G 1 68  ? -30.199 13.029  -38.660 1.00 66.31 ? 208 ARG G CG  1 
ATOM 6816 C CD  . ARG G 1 68  ? -29.389 13.125  -39.946 1.00 68.28 ? 208 ARG G CD  1 
ATOM 6817 N NE  . ARG G 1 68  ? -28.204 12.271  -39.937 1.00 66.89 ? 208 ARG G NE  1 
ATOM 6818 C CZ  . ARG G 1 68  ? -27.279 12.273  -40.893 1.00 65.64 ? 208 ARG G CZ  1 
ATOM 6819 N NH1 . ARG G 1 68  ? -27.400 13.085  -41.935 1.00 64.13 ? 208 ARG G NH1 1 
ATOM 6820 N NH2 . ARG G 1 68  ? -26.230 11.466  -40.805 1.00 64.65 ? 208 ARG G NH2 1 
ATOM 6821 N N   . ARG G 1 69  ? -33.268 11.711  -37.589 1.00 67.03 ? 209 ARG G N   1 
ATOM 6822 C CA  . ARG G 1 69  ? -33.560 10.349  -37.123 1.00 67.47 ? 209 ARG G CA  1 
ATOM 6823 C C   . ARG G 1 69  ? -32.574 9.288   -37.623 1.00 69.55 ? 209 ARG G C   1 
ATOM 6824 O O   . ARG G 1 69  ? -32.133 8.425   -36.858 1.00 69.50 ? 209 ARG G O   1 
ATOM 6825 C CB  . ARG G 1 69  ? -34.986 9.959   -37.519 1.00 64.70 ? 209 ARG G CB  1 
ATOM 6826 C CG  . ARG G 1 69  ? -36.061 10.742  -36.784 1.00 60.64 ? 209 ARG G CG  1 
ATOM 6827 C CD  . ARG G 1 69  ? -37.452 10.468  -37.338 1.00 58.87 ? 209 ARG G CD  1 
ATOM 6828 N NE  . ARG G 1 69  ? -37.827 9.056   -37.287 1.00 58.53 ? 209 ARG G NE  1 
ATOM 6829 C CZ  . ARG G 1 69  ? -37.818 8.312   -36.183 1.00 58.93 ? 209 ARG G CZ  1 
ATOM 6830 N NH1 . ARG G 1 69  ? -37.447 8.838   -35.023 1.00 57.26 ? 209 ARG G NH1 1 
ATOM 6831 N NH2 . ARG G 1 69  ? -38.190 7.040   -36.237 1.00 58.64 ? 209 ARG G NH2 1 
ATOM 6832 N N   . ASN G 1 70  ? -32.241 9.345   -38.908 1.00 71.92 ? 210 ASN G N   1 
ATOM 6833 C CA  . ASN G 1 70  ? -31.292 8.407   -39.503 1.00 74.22 ? 210 ASN G CA  1 
ATOM 6834 C C   . ASN G 1 70  ? -30.591 9.102   -40.664 1.00 75.19 ? 210 ASN G C   1 
ATOM 6835 O O   . ASN G 1 70  ? -31.131 10.056  -41.234 1.00 75.95 ? 210 ASN G O   1 
ATOM 6836 C CB  . ASN G 1 70  ? -32.007 7.132   -39.980 1.00 74.76 ? 210 ASN G CB  1 
ATOM 6837 C CG  . ASN G 1 70  ? -33.260 7.421   -40.781 1.00 75.74 ? 210 ASN G CG  1 
ATOM 6838 O OD1 . ASN G 1 70  ? -33.210 8.086   -41.815 1.00 75.51 ? 210 ASN G OD1 1 
ATOM 6839 N ND2 . ASN G 1 70  ? -34.396 6.913   -40.308 1.00 73.98 ? 210 ASN G ND2 1 
ATOM 6840 N N   . PRO G 1 71  ? -29.372 8.649   -41.018 1.00 75.17 ? 211 PRO G N   1 
ATOM 6841 C CA  . PRO G 1 71  ? -28.573 9.217   -42.110 1.00 74.40 ? 211 PRO G CA  1 
ATOM 6842 C C   . PRO G 1 71  ? -29.333 9.556   -43.387 1.00 73.93 ? 211 PRO G C   1 
ATOM 6843 O O   . PRO G 1 71  ? -28.743 10.026  -44.354 1.00 72.44 ? 211 PRO G O   1 
ATOM 6844 C CB  . PRO G 1 71  ? -27.499 8.159   -42.324 1.00 74.96 ? 211 PRO G CB  1 
ATOM 6845 C CG  . PRO G 1 71  ? -27.223 7.724   -40.919 1.00 73.99 ? 211 PRO G CG  1 
ATOM 6846 C CD  . PRO G 1 71  ? -28.627 7.564   -40.350 1.00 74.85 ? 211 PRO G CD  1 
ATOM 6847 N N   . SER G 1 72  ? -30.638 9.313   -43.388 1.00 75.52 ? 212 SER G N   1 
ATOM 6848 C CA  . SER G 1 72  ? -31.475 9.623   -44.537 1.00 77.23 ? 212 SER G CA  1 
ATOM 6849 C C   . SER G 1 72  ? -31.911 11.079  -44.427 1.00 78.94 ? 212 SER G C   1 
ATOM 6850 O O   . SER G 1 72  ? -31.781 11.851  -45.379 1.00 79.59 ? 212 SER G O   1 
ATOM 6851 C CB  . SER G 1 72  ? -32.708 8.718   -44.561 1.00 76.64 ? 212 SER G CB  1 
ATOM 6852 O OG  . SER G 1 72  ? -33.578 9.079   -45.619 1.00 76.37 ? 212 SER G OG  1 
ATOM 6853 N N   . TYR G 1 73  ? -32.425 11.444  -43.256 1.00 80.17 ? 213 TYR G N   1 
ATOM 6854 C CA  . TYR G 1 73  ? -32.873 12.809  -43.004 1.00 81.49 ? 213 TYR G CA  1 
ATOM 6855 C C   . TYR G 1 73  ? -31.677 13.753  -43.057 1.00 81.41 ? 213 TYR G C   1 
ATOM 6856 O O   . TYR G 1 73  ? -30.589 13.412  -42.591 1.00 81.79 ? 213 TYR G O   1 
ATOM 6857 C CB  . TYR G 1 73  ? -33.499 12.926  -41.611 1.00 83.70 ? 213 TYR G CB  1 
ATOM 6858 C CG  . TYR G 1 73  ? -34.706 12.050  -41.352 1.00 85.81 ? 213 TYR G CG  1 
ATOM 6859 C CD1 . TYR G 1 73  ? -34.604 10.660  -41.366 1.00 85.97 ? 213 TYR G CD1 1 
ATOM 6860 C CD2 . TYR G 1 73  ? -35.945 12.618  -41.047 1.00 86.09 ? 213 TYR G CD2 1 
ATOM 6861 C CE1 . TYR G 1 73  ? -35.709 9.854   -41.079 1.00 86.53 ? 213 TYR G CE1 1 
ATOM 6862 C CE2 . TYR G 1 73  ? -37.053 11.824  -40.760 1.00 86.14 ? 213 TYR G CE2 1 
ATOM 6863 C CZ  . TYR G 1 73  ? -36.928 10.443  -40.774 1.00 86.13 ? 213 TYR G CZ  1 
ATOM 6864 O OH  . TYR G 1 73  ? -38.015 9.656   -40.465 1.00 85.91 ? 213 TYR G OH  1 
ATOM 6865 N N   . PRO G 1 74  ? -31.857 14.956  -43.625 1.00 80.68 ? 214 PRO G N   1 
ATOM 6866 C CA  . PRO G 1 74  ? -30.719 15.878  -43.674 1.00 79.07 ? 214 PRO G CA  1 
ATOM 6867 C C   . PRO G 1 74  ? -30.486 16.410  -42.260 1.00 77.09 ? 214 PRO G C   1 
ATOM 6868 O O   . PRO G 1 74  ? -30.844 15.759  -41.276 1.00 76.61 ? 214 PRO G O   1 
ATOM 6869 C CB  . PRO G 1 74  ? -31.204 16.965  -44.630 1.00 79.37 ? 214 PRO G CB  1 
ATOM 6870 C CG  . PRO G 1 74  ? -32.672 17.031  -44.325 1.00 79.91 ? 214 PRO G CG  1 
ATOM 6871 C CD  . PRO G 1 74  ? -33.051 15.558  -44.247 1.00 81.03 ? 214 PRO G CD  1 
ATOM 6872 N N   . TRP G 1 75  ? -29.879 17.585  -42.160 1.00 74.69 ? 215 TRP G N   1 
ATOM 6873 C CA  . TRP G 1 75  ? -29.644 18.200  -40.861 1.00 71.70 ? 215 TRP G CA  1 
ATOM 6874 C C   . TRP G 1 75  ? -30.469 19.477  -40.822 1.00 70.96 ? 215 TRP G C   1 
ATOM 6875 O O   . TRP G 1 75  ? -30.244 20.398  -41.608 1.00 70.22 ? 215 TRP G O   1 
ATOM 6876 C CB  . TRP G 1 75  ? -28.161 18.527  -40.662 1.00 69.56 ? 215 TRP G CB  1 
ATOM 6877 C CG  . TRP G 1 75  ? -27.283 17.323  -40.459 1.00 67.42 ? 215 TRP G CG  1 
ATOM 6878 C CD1 . TRP G 1 75  ? -26.285 16.888  -41.283 1.00 67.16 ? 215 TRP G CD1 1 
ATOM 6879 C CD2 . TRP G 1 75  ? -27.314 16.411  -39.352 1.00 65.07 ? 215 TRP G CD2 1 
ATOM 6880 N NE1 . TRP G 1 75  ? -25.691 15.764  -40.758 1.00 65.89 ? 215 TRP G NE1 1 
ATOM 6881 C CE2 . TRP G 1 75  ? -26.303 15.450  -39.573 1.00 64.38 ? 215 TRP G CE2 1 
ATOM 6882 C CE3 . TRP G 1 75  ? -28.097 16.312  -38.195 1.00 63.11 ? 215 TRP G CE3 1 
ATOM 6883 C CZ2 . TRP G 1 75  ? -26.054 14.404  -38.681 1.00 63.07 ? 215 TRP G CZ2 1 
ATOM 6884 C CZ3 . TRP G 1 75  ? -27.849 15.273  -37.309 1.00 62.26 ? 215 TRP G CZ3 1 
ATOM 6885 C CH2 . TRP G 1 75  ? -26.836 14.333  -37.558 1.00 62.49 ? 215 TRP G CH2 1 
ATOM 6886 N N   . LEU G 1 76  ? -31.436 19.521  -39.914 1.00 70.79 ? 216 LEU G N   1 
ATOM 6887 C CA  . LEU G 1 76  ? -32.299 20.687  -39.786 1.00 70.67 ? 216 LEU G CA  1 
ATOM 6888 C C   . LEU G 1 76  ? -32.313 21.180  -38.350 1.00 69.07 ? 216 LEU G C   1 
ATOM 6889 O O   . LEU G 1 76  ? -32.111 20.404  -37.418 1.00 67.95 ? 216 LEU G O   1 
ATOM 6890 C CB  . LEU G 1 76  ? -33.724 20.332  -40.217 1.00 72.37 ? 216 LEU G CB  1 
ATOM 6891 C CG  . LEU G 1 76  ? -33.863 19.637  -41.574 1.00 73.68 ? 216 LEU G CG  1 
ATOM 6892 C CD1 . LEU G 1 76  ? -35.323 19.304  -41.826 1.00 74.32 ? 216 LEU G CD1 1 
ATOM 6893 C CD2 . LEU G 1 76  ? -33.315 20.532  -42.678 1.00 74.63 ? 216 LEU G CD2 1 
ATOM 6894 N N   . TRP G 1 77  ? -32.548 22.474  -38.172 1.00 67.96 ? 217 TRP G N   1 
ATOM 6895 C CA  . TRP G 1 77  ? -32.602 23.037  -36.835 1.00 68.16 ? 217 TRP G CA  1 
ATOM 6896 C C   . TRP G 1 77  ? -33.958 22.709  -36.221 1.00 67.91 ? 217 TRP G C   1 
ATOM 6897 O O   . TRP G 1 77  ? -34.829 22.146  -36.883 1.00 68.46 ? 217 TRP G O   1 
ATOM 6898 C CB  . TRP G 1 77  ? -32.379 24.549  -36.881 1.00 68.90 ? 217 TRP G CB  1 
ATOM 6899 C CG  . TRP G 1 77  ? -31.056 24.920  -37.486 1.00 70.37 ? 217 TRP G CG  1 
ATOM 6900 C CD1 . TRP G 1 77  ? -30.837 25.407  -38.742 1.00 70.55 ? 217 TRP G CD1 1 
ATOM 6901 C CD2 . TRP G 1 77  ? -29.765 24.802  -36.871 1.00 70.29 ? 217 TRP G CD2 1 
ATOM 6902 N NE1 . TRP G 1 77  ? -29.492 25.599  -38.949 1.00 70.42 ? 217 TRP G NE1 1 
ATOM 6903 C CE2 . TRP G 1 77  ? -28.811 25.234  -37.819 1.00 70.32 ? 217 TRP G CE2 1 
ATOM 6904 C CE3 . TRP G 1 77  ? -29.321 24.369  -35.615 1.00 70.46 ? 217 TRP G CE3 1 
ATOM 6905 C CZ2 . TRP G 1 77  ? -27.439 25.251  -37.547 1.00 70.62 ? 217 TRP G CZ2 1 
ATOM 6906 C CZ3 . TRP G 1 77  ? -27.954 24.386  -35.345 1.00 70.19 ? 217 TRP G CZ3 1 
ATOM 6907 C CH2 . TRP G 1 77  ? -27.031 24.823  -36.309 1.00 70.12 ? 217 TRP G CH2 1 
ATOM 6908 N N   . GLU G 1 78  ? -34.134 23.058  -34.953 1.00 67.32 ? 218 GLU G N   1 
ATOM 6909 C CA  . GLU G 1 78  ? -35.376 22.772  -34.250 1.00 65.21 ? 218 GLU G CA  1 
ATOM 6910 C C   . GLU G 1 78  ? -36.602 23.276  -35.004 1.00 63.50 ? 218 GLU G C   1 
ATOM 6911 O O   . GLU G 1 78  ? -37.626 22.600  -35.047 1.00 62.74 ? 218 GLU G O   1 
ATOM 6912 C CB  . GLU G 1 78  ? -35.333 23.385  -32.849 1.00 66.28 ? 218 GLU G CB  1 
ATOM 6913 C CG  . GLU G 1 78  ? -36.214 22.680  -31.832 1.00 65.78 ? 218 GLU G CG  1 
ATOM 6914 C CD  . GLU G 1 78  ? -36.066 23.263  -30.443 1.00 66.11 ? 218 GLU G CD  1 
ATOM 6915 O OE1 . GLU G 1 78  ? -34.929 23.291  -29.925 1.00 64.99 ? 218 GLU G OE1 1 
ATOM 6916 O OE2 . GLU G 1 78  ? -37.089 23.692  -29.869 1.00 66.73 ? 218 GLU G OE2 1 
ATOM 6917 N N   . ASP G 1 79  ? -36.497 24.459  -35.600 1.00 62.45 ? 219 ASP G N   1 
ATOM 6918 C CA  . ASP G 1 79  ? -37.615 25.029  -36.347 1.00 61.61 ? 219 ASP G CA  1 
ATOM 6919 C C   . ASP G 1 79  ? -37.867 24.270  -37.645 1.00 61.95 ? 219 ASP G C   1 
ATOM 6920 O O   . ASP G 1 79  ? -38.928 24.404  -38.259 1.00 62.96 ? 219 ASP G O   1 
ATOM 6921 C CB  . ASP G 1 79  ? -37.359 26.509  -36.661 1.00 60.53 ? 219 ASP G CB  1 
ATOM 6922 C CG  . ASP G 1 79  ? -36.048 26.737  -37.391 1.00 58.95 ? 219 ASP G CG  1 
ATOM 6923 O OD1 . ASP G 1 79  ? -35.721 25.941  -38.293 1.00 57.37 ? 219 ASP G OD1 1 
ATOM 6924 O OD2 . ASP G 1 79  ? -35.350 27.721  -37.070 1.00 57.67 ? 219 ASP G OD2 1 
ATOM 6925 N N   . GLY G 1 80  ? -36.887 23.475  -38.062 1.00 61.29 ? 220 GLY G N   1 
ATOM 6926 C CA  . GLY G 1 80  ? -37.035 22.708  -39.284 1.00 60.35 ? 220 GLY G CA  1 
ATOM 6927 C C   . GLY G 1 80  ? -36.346 23.344  -40.475 1.00 59.42 ? 220 GLY G C   1 
ATOM 6928 O O   . GLY G 1 80  ? -36.553 22.924  -41.615 1.00 58.73 ? 220 GLY G O   1 
ATOM 6929 N N   . SER G 1 81  ? -35.531 24.361  -40.215 1.00 58.64 ? 221 SER G N   1 
ATOM 6930 C CA  . SER G 1 81  ? -34.808 25.049  -41.277 1.00 59.20 ? 221 SER G CA  1 
ATOM 6931 C C   . SER G 1 81  ? -33.532 24.284  -41.614 1.00 58.72 ? 221 SER G C   1 
ATOM 6932 O O   . SER G 1 81  ? -32.971 23.589  -40.765 1.00 58.62 ? 221 SER G O   1 
ATOM 6933 C CB  . SER G 1 81  ? -34.458 26.478  -40.847 1.00 60.08 ? 221 SER G CB  1 
ATOM 6934 O OG  . SER G 1 81  ? -33.659 26.484  -39.676 1.00 60.80 ? 221 SER G OG  1 
ATOM 6935 N N   . PRO G 1 82  ? -33.061 24.401  -42.864 1.00 58.10 ? 222 PRO G N   1 
ATOM 6936 C CA  . PRO G 1 82  ? -31.846 23.720  -43.324 1.00 58.48 ? 222 PRO G CA  1 
ATOM 6937 C C   . PRO G 1 82  ? -30.556 24.220  -42.675 1.00 58.61 ? 222 PRO G C   1 
ATOM 6938 O O   . PRO G 1 82  ? -30.502 25.326  -42.135 1.00 58.14 ? 222 PRO G O   1 
ATOM 6939 C CB  . PRO G 1 82  ? -31.868 23.969  -44.829 1.00 58.74 ? 222 PRO G CB  1 
ATOM 6940 C CG  . PRO G 1 82  ? -32.524 25.315  -44.928 1.00 58.71 ? 222 PRO G CG  1 
ATOM 6941 C CD  . PRO G 1 82  ? -33.669 25.181  -43.955 1.00 57.24 ? 222 PRO G CD  1 
ATOM 6942 N N   . LEU G 1 83  ? -29.522 23.388  -42.735 1.00 58.57 ? 223 LEU G N   1 
ATOM 6943 C CA  . LEU G 1 83  ? -28.218 23.722  -42.178 1.00 58.34 ? 223 LEU G CA  1 
ATOM 6944 C C   . LEU G 1 83  ? -27.384 24.478  -43.206 1.00 59.36 ? 223 LEU G C   1 
ATOM 6945 O O   . LEU G 1 83  ? -26.785 23.866  -44.091 1.00 59.20 ? 223 LEU G O   1 
ATOM 6946 C CB  . LEU G 1 83  ? -27.491 22.442  -41.763 1.00 57.60 ? 223 LEU G CB  1 
ATOM 6947 C CG  . LEU G 1 83  ? -25.959 22.447  -41.749 1.00 58.16 ? 223 LEU G CG  1 
ATOM 6948 C CD1 . LEU G 1 83  ? -25.432 23.548  -40.842 1.00 59.98 ? 223 LEU G CD1 1 
ATOM 6949 C CD2 . LEU G 1 83  ? -25.466 21.090  -41.289 1.00 58.17 ? 223 LEU G CD2 1 
ATOM 6950 N N   . MET G 1 84  ? -27.348 25.804  -43.091 1.00 60.54 ? 224 MET G N   1 
ATOM 6951 C CA  . MET G 1 84  ? -26.580 26.617  -44.026 1.00 62.63 ? 224 MET G CA  1 
ATOM 6952 C C   . MET G 1 84  ? -25.217 25.990  -44.311 1.00 64.18 ? 224 MET G C   1 
ATOM 6953 O O   . MET G 1 84  ? -24.562 25.453  -43.414 1.00 63.78 ? 224 MET G O   1 
ATOM 6954 C CB  . MET G 1 84  ? -26.416 28.046  -43.496 1.00 62.70 ? 224 MET G CB  1 
ATOM 6955 C CG  . MET G 1 84  ? -27.642 28.931  -43.726 1.00 62.82 ? 224 MET G CG  1 
ATOM 6956 S SD  . MET G 1 84  ? -27.441 30.642  -43.157 1.00 63.56 ? 224 MET G SD  1 
ATOM 6957 C CE  . MET G 1 84  ? -26.393 31.320  -44.452 1.00 62.37 ? 224 MET G CE  1 
ATOM 6958 N N   . PRO G 1 85  ? -24.780 26.046  -45.581 1.00 65.53 ? 225 PRO G N   1 
ATOM 6959 C CA  . PRO G 1 85  ? -23.512 25.502  -46.076 1.00 65.38 ? 225 PRO G CA  1 
ATOM 6960 C C   . PRO G 1 85  ? -22.246 26.227  -45.641 1.00 65.56 ? 225 PRO G C   1 
ATOM 6961 O O   . PRO G 1 85  ? -22.221 27.454  -45.517 1.00 64.67 ? 225 PRO G O   1 
ATOM 6962 C CB  . PRO G 1 85  ? -23.698 25.547  -47.585 1.00 64.63 ? 225 PRO G CB  1 
ATOM 6963 C CG  . PRO G 1 85  ? -24.478 26.808  -47.763 1.00 65.57 ? 225 PRO G CG  1 
ATOM 6964 C CD  . PRO G 1 85  ? -25.526 26.693  -46.676 1.00 65.17 ? 225 PRO G CD  1 
ATOM 6965 N N   . HIS G 1 86  ? -21.195 25.441  -45.420 1.00 66.34 ? 226 HIS G N   1 
ATOM 6966 C CA  . HIS G 1 86  ? -19.888 25.954  -45.022 1.00 66.56 ? 226 HIS G CA  1 
ATOM 6967 C C   . HIS G 1 86  ? -19.896 26.716  -43.701 1.00 65.99 ? 226 HIS G C   1 
ATOM 6968 O O   . HIS G 1 86  ? -19.668 27.925  -43.661 1.00 66.50 ? 226 HIS G O   1 
ATOM 6969 C CB  . HIS G 1 86  ? -19.311 26.836  -46.139 1.00 68.05 ? 226 HIS G CB  1 
ATOM 6970 C CG  . HIS G 1 86  ? -19.003 26.087  -47.401 1.00 69.40 ? 226 HIS G CG  1 
ATOM 6971 N ND1 . HIS G 1 86  ? -17.930 25.227  -47.514 1.00 68.93 ? 226 HIS G ND1 1 
ATOM 6972 C CD2 . HIS G 1 86  ? -19.648 26.041  -48.591 1.00 69.22 ? 226 HIS G CD2 1 
ATOM 6973 C CE1 . HIS G 1 86  ? -17.929 24.683  -48.718 1.00 68.55 ? 226 HIS G CE1 1 
ATOM 6974 N NE2 . HIS G 1 86  ? -18.961 25.160  -49.391 1.00 69.74 ? 226 HIS G NE2 1 
ATOM 6975 N N   . LEU G 1 87  ? -20.158 25.988  -42.621 1.00 64.39 ? 227 LEU G N   1 
ATOM 6976 C CA  . LEU G 1 87  ? -20.177 26.555  -41.281 1.00 61.78 ? 227 LEU G CA  1 
ATOM 6977 C C   . LEU G 1 87  ? -19.323 25.647  -40.401 1.00 60.28 ? 227 LEU G C   1 
ATOM 6978 O O   . LEU G 1 87  ? -18.444 26.111  -39.670 1.00 60.62 ? 227 LEU G O   1 
ATOM 6979 C CB  . LEU G 1 87  ? -21.606 26.602  -40.741 1.00 63.36 ? 227 LEU G CB  1 
ATOM 6980 C CG  . LEU G 1 87  ? -22.652 27.392  -41.528 1.00 63.15 ? 227 LEU G CG  1 
ATOM 6981 C CD1 . LEU G 1 87  ? -23.986 27.329  -40.797 1.00 62.76 ? 227 LEU G CD1 1 
ATOM 6982 C CD2 . LEU G 1 87  ? -22.196 28.831  -41.683 1.00 64.13 ? 227 LEU G CD2 1 
ATOM 6983 N N   . PHE G 1 88  ? -19.592 24.347  -40.489 1.00 57.01 ? 228 PHE G N   1 
ATOM 6984 C CA  . PHE G 1 88  ? -18.865 23.336  -39.731 1.00 55.45 ? 228 PHE G CA  1 
ATOM 6985 C C   . PHE G 1 88  ? -19.214 21.965  -40.297 1.00 56.09 ? 228 PHE G C   1 
ATOM 6986 O O   . PHE G 1 88  ? -20.066 21.856  -41.175 1.00 56.87 ? 228 PHE G O   1 
ATOM 6987 C CB  . PHE G 1 88  ? -19.240 23.415  -38.250 1.00 53.42 ? 228 PHE G CB  1 
ATOM 6988 C CG  . PHE G 1 88  ? -20.660 23.029  -37.960 1.00 51.31 ? 228 PHE G CG  1 
ATOM 6989 C CD1 . PHE G 1 88  ? -21.014 21.691  -37.823 1.00 49.96 ? 228 PHE G CD1 1 
ATOM 6990 C CD2 . PHE G 1 88  ? -21.648 24.002  -37.828 1.00 49.05 ? 228 PHE G CD2 1 
ATOM 6991 C CE1 . PHE G 1 88  ? -22.329 21.326  -37.560 1.00 49.65 ? 228 PHE G CE1 1 
ATOM 6992 C CE2 . PHE G 1 88  ? -22.965 23.648  -37.565 1.00 48.49 ? 228 PHE G CE2 1 
ATOM 6993 C CZ  . PHE G 1 88  ? -23.307 22.305  -37.430 1.00 48.98 ? 228 PHE G CZ  1 
ATOM 6994 N N   . ARG G 1 89  ? -18.564 20.921  -39.792 1.00 56.63 ? 229 ARG G N   1 
ATOM 6995 C CA  . ARG G 1 89  ? -18.808 19.566  -40.276 1.00 58.10 ? 229 ARG G CA  1 
ATOM 6996 C C   . ARG G 1 89  ? -19.304 18.624  -39.185 1.00 58.55 ? 229 ARG G C   1 
ATOM 6997 O O   . ARG G 1 89  ? -18.538 18.236  -38.305 1.00 60.00 ? 229 ARG G O   1 
ATOM 6998 C CB  . ARG G 1 89  ? -17.524 18.978  -40.861 1.00 60.00 ? 229 ARG G CB  1 
ATOM 6999 C CG  . ARG G 1 89  ? -16.909 19.748  -42.014 1.00 63.73 ? 229 ARG G CG  1 
ATOM 7000 C CD  . ARG G 1 89  ? -15.743 18.952  -42.578 1.00 66.53 ? 229 ARG G CD  1 
ATOM 7001 N NE  . ARG G 1 89  ? -15.623 19.084  -44.027 1.00 70.16 ? 229 ARG G NE  1 
ATOM 7002 C CZ  . ARG G 1 89  ? -15.116 18.141  -44.818 1.00 72.72 ? 229 ARG G CZ  1 
ATOM 7003 N NH1 . ARG G 1 89  ? -14.684 16.996  -44.299 1.00 73.04 ? 229 ARG G NH1 1 
ATOM 7004 N NH2 . ARG G 1 89  ? -15.042 18.336  -46.128 1.00 74.71 ? 229 ARG G NH2 1 
ATOM 7005 N N   . VAL G 1 90  ? -20.575 18.238  -39.248 1.00 58.71 ? 230 VAL G N   1 
ATOM 7006 C CA  . VAL G 1 90  ? -21.127 17.328  -38.247 1.00 58.88 ? 230 VAL G CA  1 
ATOM 7007 C C   . VAL G 1 90  ? -20.389 15.998  -38.275 1.00 59.15 ? 230 VAL G C   1 
ATOM 7008 O O   . VAL G 1 90  ? -20.788 15.072  -38.978 1.00 60.07 ? 230 VAL G O   1 
ATOM 7009 C CB  . VAL G 1 90  ? -22.629 17.043  -38.482 1.00 58.08 ? 230 VAL G CB  1 
ATOM 7010 C CG1 . VAL G 1 90  ? -23.125 16.009  -37.478 1.00 57.36 ? 230 VAL G CG1 1 
ATOM 7011 C CG2 . VAL G 1 90  ? -23.434 18.322  -38.349 1.00 58.94 ? 230 VAL G CG2 1 
ATOM 7012 N N   . ARG G 1 91  ? -19.309 15.905  -37.512 1.00 59.38 ? 231 ARG G N   1 
ATOM 7013 C CA  . ARG G 1 91  ? -18.535 14.676  -37.452 1.00 60.64 ? 231 ARG G CA  1 
ATOM 7014 C C   . ARG G 1 91  ? -19.302 13.676  -36.598 1.00 61.68 ? 231 ARG G C   1 
ATOM 7015 O O   . ARG G 1 91  ? -20.527 13.735  -36.509 1.00 61.55 ? 231 ARG G O   1 
ATOM 7016 C CB  . ARG G 1 91  ? -17.172 14.950  -36.826 1.00 60.98 ? 231 ARG G CB  1 
ATOM 7017 C CG  . ARG G 1 91  ? -16.514 16.210  -37.338 1.00 59.51 ? 231 ARG G CG  1 
ATOM 7018 C CD  . ARG G 1 91  ? -15.223 16.464  -36.602 1.00 60.19 ? 231 ARG G CD  1 
ATOM 7019 N NE  . ARG G 1 91  ? -14.648 17.759  -36.946 1.00 60.68 ? 231 ARG G NE  1 
ATOM 7020 C CZ  . ARG G 1 91  ? -13.462 18.177  -36.521 1.00 61.50 ? 231 ARG G CZ  1 
ATOM 7021 N NH1 . ARG G 1 91  ? -12.729 17.398  -35.734 1.00 61.58 ? 231 ARG G NH1 1 
ATOM 7022 N NH2 . ARG G 1 91  ? -13.004 19.367  -36.887 1.00 61.86 ? 231 ARG G NH2 1 
ATOM 7023 N N   . GLY G 1 92  ? -18.579 12.763  -35.962 1.00 62.90 ? 232 GLY G N   1 
ATOM 7024 C CA  . GLY G 1 92  ? -19.233 11.776  -35.129 1.00 66.19 ? 232 GLY G CA  1 
ATOM 7025 C C   . GLY G 1 92  ? -19.815 10.647  -35.954 1.00 68.73 ? 232 GLY G C   1 
ATOM 7026 O O   . GLY G 1 92  ? -19.353 10.377  -37.062 1.00 69.35 ? 232 GLY G O   1 
ATOM 7027 N N   . ALA G 1 93  ? -20.843 9.996   -35.418 1.00 70.95 ? 233 ALA G N   1 
ATOM 7028 C CA  . ALA G 1 93  ? -21.487 8.874   -36.094 1.00 72.85 ? 233 ALA G CA  1 
ATOM 7029 C C   . ALA G 1 93  ? -22.660 9.274   -36.987 1.00 73.99 ? 233 ALA G C   1 
ATOM 7030 O O   . ALA G 1 93  ? -23.819 9.028   -36.651 1.00 72.77 ? 233 ALA G O   1 
ATOM 7031 C CB  . ALA G 1 93  ? -21.950 7.866   -35.063 1.00 73.15 ? 233 ALA G CB  1 
ATOM 7032 N N   . VAL G 1 94  ? -22.352 9.872   -38.133 1.00 76.39 ? 234 VAL G N   1 
ATOM 7033 C CA  . VAL G 1 94  ? -23.383 10.300  -39.074 1.00 79.15 ? 234 VAL G CA  1 
ATOM 7034 C C   . VAL G 1 94  ? -23.933 9.146   -39.914 1.00 80.84 ? 234 VAL G C   1 
ATOM 7035 O O   . VAL G 1 94  ? -24.707 9.364   -40.851 1.00 81.38 ? 234 VAL G O   1 
ATOM 7036 C CB  . VAL G 1 94  ? -22.848 11.389  -40.032 1.00 79.35 ? 234 VAL G CB  1 
ATOM 7037 C CG1 . VAL G 1 94  ? -22.498 12.641  -39.250 1.00 78.88 ? 234 VAL G CG1 1 
ATOM 7038 C CG2 . VAL G 1 94  ? -21.628 10.872  -40.782 1.00 79.34 ? 234 VAL G CG2 1 
ATOM 7039 N N   . SER G 1 95  ? -23.540 7.920   -39.576 1.00 81.89 ? 235 SER G N   1 
ATOM 7040 C CA  . SER G 1 95  ? -24.000 6.749   -40.315 1.00 81.34 ? 235 SER G CA  1 
ATOM 7041 C C   . SER G 1 95  ? -24.976 5.893   -39.514 1.00 81.35 ? 235 SER G C   1 
ATOM 7042 O O   . SER G 1 95  ? -25.819 5.208   -40.089 1.00 81.52 ? 235 SER G O   1 
ATOM 7043 C CB  . SER G 1 95  ? -22.806 5.893   -40.748 1.00 80.70 ? 235 SER G CB  1 
ATOM 7044 O OG  . SER G 1 95  ? -21.956 6.606   -41.630 1.00 78.80 ? 235 SER G OG  1 
ATOM 7045 N N   . GLN G 1 96  ? -24.861 5.939   -38.190 1.00 81.46 ? 236 GLN G N   1 
ATOM 7046 C CA  . GLN G 1 96  ? -25.729 5.160   -37.312 1.00 81.89 ? 236 GLN G CA  1 
ATOM 7047 C C   . GLN G 1 96  ? -27.149 5.721   -37.208 1.00 81.84 ? 236 GLN G C   1 
ATOM 7048 O O   . GLN G 1 96  ? -27.404 6.882   -37.541 1.00 82.01 ? 236 GLN G O   1 
ATOM 7049 C CB  . GLN G 1 96  ? -25.118 5.081   -35.912 1.00 82.26 ? 236 GLN G CB  1 
ATOM 7050 C CG  . GLN G 1 96  ? -23.770 4.387   -35.855 1.00 83.97 ? 236 GLN G CG  1 
ATOM 7051 C CD  . GLN G 1 96  ? -23.163 4.419   -34.463 1.00 85.66 ? 236 GLN G CD  1 
ATOM 7052 O OE1 . GLN G 1 96  ? -22.895 5.487   -33.916 1.00 86.25 ? 236 GLN G OE1 1 
ATOM 7053 N NE2 . GLN G 1 96  ? -22.948 3.244   -33.883 1.00 86.96 ? 236 GLN G NE2 1 
ATOM 7054 N N   . THR G 1 97  ? -28.067 4.881   -36.734 1.00 81.40 ? 237 THR G N   1 
ATOM 7055 C CA  . THR G 1 97  ? -29.466 5.264   -36.569 1.00 80.24 ? 237 THR G CA  1 
ATOM 7056 C C   . THR G 1 97  ? -30.083 4.658   -35.311 1.00 79.69 ? 237 THR G C   1 
ATOM 7057 O O   . THR G 1 97  ? -30.323 3.450   -35.247 1.00 78.50 ? 237 THR G O   1 
ATOM 7058 C CB  . THR G 1 97  ? -30.313 4.820   -37.770 1.00 79.85 ? 237 THR G CB  1 
ATOM 7059 O OG1 . THR G 1 97  ? -29.922 5.561   -38.931 1.00 78.44 ? 237 THR G OG1 1 
ATOM 7060 C CG2 . THR G 1 97  ? -31.789 5.051   -37.490 1.00 79.63 ? 237 THR G CG2 1 
ATOM 7061 N N   . TYR G 1 98  ? -30.345 5.506   -34.321 1.00 79.06 ? 238 TYR G N   1 
ATOM 7062 C CA  . TYR G 1 98  ? -30.942 5.060   -33.067 1.00 77.85 ? 238 TYR G CA  1 
ATOM 7063 C C   . TYR G 1 98  ? -32.433 5.390   -33.074 1.00 76.82 ? 238 TYR G C   1 
ATOM 7064 O O   . TYR G 1 98  ? -32.906 6.137   -33.934 1.00 76.06 ? 238 TYR G O   1 
ATOM 7065 C CB  . TYR G 1 98  ? -30.279 5.760   -31.876 1.00 77.92 ? 238 TYR G CB  1 
ATOM 7066 C CG  . TYR G 1 98  ? -28.766 5.735   -31.875 1.00 78.12 ? 238 TYR G CG  1 
ATOM 7067 C CD1 . TYR G 1 98  ? -28.034 6.533   -32.756 1.00 78.28 ? 238 TYR G CD1 1 
ATOM 7068 C CD2 . TYR G 1 98  ? -28.064 4.940   -30.969 1.00 77.79 ? 238 TYR G CD2 1 
ATOM 7069 C CE1 . TYR G 1 98  ? -26.639 6.544   -32.728 1.00 77.79 ? 238 TYR G CE1 1 
ATOM 7070 C CE2 . TYR G 1 98  ? -26.672 4.944   -30.935 1.00 77.20 ? 238 TYR G CE2 1 
ATOM 7071 C CZ  . TYR G 1 98  ? -25.967 5.749   -31.814 1.00 77.36 ? 238 TYR G CZ  1 
ATOM 7072 O OH  . TYR G 1 98  ? -24.594 5.771   -31.768 1.00 76.93 ? 238 TYR G OH  1 
ATOM 7073 N N   . PRO G 1 99  ? -33.195 4.835   -32.113 1.00 75.88 ? 239 PRO G N   1 
ATOM 7074 C CA  . PRO G 1 99  ? -34.636 5.086   -32.026 1.00 75.58 ? 239 PRO G CA  1 
ATOM 7075 C C   . PRO G 1 99  ? -34.995 6.568   -32.111 1.00 75.94 ? 239 PRO G C   1 
ATOM 7076 O O   . PRO G 1 99  ? -35.650 7.004   -33.063 1.00 75.29 ? 239 PRO G O   1 
ATOM 7077 C CB  . PRO G 1 99  ? -35.004 4.478   -30.679 1.00 73.94 ? 239 PRO G CB  1 
ATOM 7078 C CG  . PRO G 1 99  ? -34.102 3.309   -30.607 1.00 74.41 ? 239 PRO G CG  1 
ATOM 7079 C CD  . PRO G 1 99  ? -32.776 3.874   -31.077 1.00 74.98 ? 239 PRO G CD  1 
ATOM 7080 N N   . SER G 1 100 ? -34.559 7.333   -31.112 1.00 75.78 ? 240 SER G N   1 
ATOM 7081 C CA  . SER G 1 100 ? -34.831 8.766   -31.062 1.00 75.08 ? 240 SER G CA  1 
ATOM 7082 C C   . SER G 1 100 ? -34.158 9.519   -32.206 1.00 75.03 ? 240 SER G C   1 
ATOM 7083 O O   . SER G 1 100 ? -34.630 10.573  -32.626 1.00 74.09 ? 240 SER G O   1 
ATOM 7084 C CB  . SER G 1 100 ? -34.369 9.342   -29.724 1.00 74.01 ? 240 SER G CB  1 
ATOM 7085 O OG  . SER G 1 100 ? -35.063 8.734   -28.649 1.00 73.50 ? 240 SER G OG  1 
ATOM 7086 N N   . GLY G 1 101 ? -33.056 8.974   -32.710 1.00 75.91 ? 241 GLY G N   1 
ATOM 7087 C CA  . GLY G 1 101 ? -32.352 9.619   -33.803 1.00 76.91 ? 241 GLY G CA  1 
ATOM 7088 C C   . GLY G 1 101 ? -31.006 10.181  -33.390 1.00 77.61 ? 241 GLY G C   1 
ATOM 7089 O O   . GLY G 1 101 ? -30.564 10.001  -32.252 1.00 77.68 ? 241 GLY G O   1 
ATOM 7090 N N   . THR G 1 102 ? -30.349 10.865  -34.321 1.00 77.72 ? 242 THR G N   1 
ATOM 7091 C CA  . THR G 1 102 ? -29.048 11.460  -34.053 1.00 77.96 ? 242 THR G CA  1 
ATOM 7092 C C   . THR G 1 102 ? -29.184 12.955  -33.771 1.00 76.89 ? 242 THR G C   1 
ATOM 7093 O O   . THR G 1 102 ? -29.768 13.706  -34.556 1.00 76.40 ? 242 THR G O   1 
ATOM 7094 C CB  . THR G 1 102 ? -28.086 11.264  -35.244 1.00 79.59 ? 242 THR G CB  1 
ATOM 7095 O OG1 . THR G 1 102 ? -28.493 12.100  -36.335 1.00 80.96 ? 242 THR G OG1 1 
ATOM 7096 C CG2 . THR G 1 102 ? -28.094 9.805   -35.694 1.00 79.94 ? 242 THR G CG2 1 
ATOM 7097 N N   . CYS G 1 103 ? -28.644 13.377  -32.635 1.00 75.23 ? 243 CYS G N   1 
ATOM 7098 C CA  . CYS G 1 103 ? -28.690 14.774  -32.240 1.00 72.37 ? 243 CYS G CA  1 
ATOM 7099 C C   . CYS G 1 103 ? -27.271 15.298  -32.100 1.00 70.17 ? 243 CYS G C   1 
ATOM 7100 O O   . CYS G 1 103 ? -26.410 14.637  -31.525 1.00 69.39 ? 243 CYS G O   1 
ATOM 7101 C CB  . CYS G 1 103 ? -29.457 14.916  -30.925 1.00 73.07 ? 243 CYS G CB  1 
ATOM 7102 S SG  . CYS G 1 103 ? -31.249 14.643  -31.124 1.00 74.27 ? 243 CYS G SG  1 
ATOM 7103 N N   . ALA G 1 104 ? -27.035 16.488  -32.640 1.00 68.54 ? 244 ALA G N   1 
ATOM 7104 C CA  . ALA G 1 104 ? -25.715 17.101  -32.603 1.00 66.24 ? 244 ALA G CA  1 
ATOM 7105 C C   . ALA G 1 104 ? -25.415 17.811  -31.295 1.00 64.07 ? 244 ALA G C   1 
ATOM 7106 O O   . ALA G 1 104 ? -26.314 18.288  -30.606 1.00 63.70 ? 244 ALA G O   1 
ATOM 7107 C CB  . ALA G 1 104 ? -25.560 18.080  -33.766 1.00 65.00 ? 244 ALA G CB  1 
ATOM 7108 N N   . TYR G 1 105 ? -24.132 17.864  -30.964 1.00 62.21 ? 245 TYR G N   1 
ATOM 7109 C CA  . TYR G 1 105 ? -23.669 18.532  -29.764 1.00 60.36 ? 245 TYR G CA  1 
ATOM 7110 C C   . TYR G 1 105 ? -22.240 18.971  -30.033 1.00 59.07 ? 245 TYR G C   1 
ATOM 7111 O O   . TYR G 1 105 ? -21.516 18.332  -30.794 1.00 59.25 ? 245 TYR G O   1 
ATOM 7112 C CB  . TYR G 1 105 ? -23.735 17.592  -28.553 1.00 59.76 ? 245 TYR G CB  1 
ATOM 7113 C CG  . TYR G 1 105 ? -22.691 16.502  -28.536 1.00 58.97 ? 245 TYR G CG  1 
ATOM 7114 C CD1 . TYR G 1 105 ? -21.364 16.784  -28.211 1.00 58.59 ? 245 TYR G CD1 1 
ATOM 7115 C CD2 . TYR G 1 105 ? -23.028 15.187  -28.846 1.00 59.39 ? 245 TYR G CD2 1 
ATOM 7116 C CE1 . TYR G 1 105 ? -20.401 15.783  -28.194 1.00 57.63 ? 245 TYR G CE1 1 
ATOM 7117 C CE2 . TYR G 1 105 ? -22.071 14.177  -28.831 1.00 58.02 ? 245 TYR G CE2 1 
ATOM 7118 C CZ  . TYR G 1 105 ? -20.762 14.483  -28.505 1.00 56.79 ? 245 TYR G CZ  1 
ATOM 7119 O OH  . TYR G 1 105 ? -19.819 13.485  -28.491 1.00 55.78 ? 245 TYR G OH  1 
ATOM 7120 N N   . ILE G 1 106 ? -21.842 20.068  -29.407 1.00 58.05 ? 246 ILE G N   1 
ATOM 7121 C CA  . ILE G 1 106 ? -20.508 20.609  -29.583 1.00 56.28 ? 246 ILE G CA  1 
ATOM 7122 C C   . ILE G 1 106 ? -19.608 20.219  -28.409 1.00 55.30 ? 246 ILE G C   1 
ATOM 7123 O O   . ILE G 1 106 ? -20.051 20.176  -27.263 1.00 54.65 ? 246 ILE G O   1 
ATOM 7124 C CB  . ILE G 1 106 ? -20.585 22.148  -29.715 1.00 57.20 ? 246 ILE G CB  1 
ATOM 7125 C CG1 . ILE G 1 106 ? -19.201 22.728  -29.996 1.00 57.55 ? 246 ILE G CG1 1 
ATOM 7126 C CG2 . ILE G 1 106 ? -21.219 22.744  -28.475 1.00 58.16 ? 246 ILE G CG2 1 
ATOM 7127 C CD1 . ILE G 1 106 ? -18.782 22.593  -31.442 1.00 59.14 ? 246 ILE G CD1 1 
ATOM 7128 N N   . GLN G 1 107 ? -18.345 19.922  -28.704 1.00 54.98 ? 247 GLN G N   1 
ATOM 7129 C CA  . GLN G 1 107 ? -17.377 19.538  -27.679 1.00 53.80 ? 247 GLN G CA  1 
ATOM 7130 C C   . GLN G 1 107 ? -15.970 19.454  -28.248 1.00 53.81 ? 247 GLN G C   1 
ATOM 7131 O O   . GLN G 1 107 ? -15.770 18.956  -29.354 1.00 53.56 ? 247 GLN G O   1 
ATOM 7132 C CB  . GLN G 1 107 ? -17.755 18.189  -27.059 1.00 52.79 ? 247 GLN G CB  1 
ATOM 7133 C CG  . GLN G 1 107 ? -16.724 17.651  -26.070 1.00 51.47 ? 247 GLN G CG  1 
ATOM 7134 C CD  . GLN G 1 107 ? -17.244 16.484  -25.248 1.00 51.90 ? 247 GLN G CD  1 
ATOM 7135 O OE1 . GLN G 1 107 ? -17.557 15.418  -25.780 1.00 50.93 ? 247 GLN G OE1 1 
ATOM 7136 N NE2 . GLN G 1 107 ? -17.339 16.686  -23.938 1.00 51.30 ? 247 GLN G NE2 1 
ATOM 7137 N N   . ARG G 1 108 ? -14.999 19.938  -27.478 1.00 55.24 ? 248 ARG G N   1 
ATOM 7138 C CA  . ARG G 1 108 ? -13.595 19.936  -27.888 1.00 56.19 ? 248 ARG G CA  1 
ATOM 7139 C C   . ARG G 1 108 ? -13.345 20.726  -29.171 1.00 55.44 ? 248 ARG G C   1 
ATOM 7140 O O   . ARG G 1 108 ? -12.345 20.515  -29.858 1.00 53.13 ? 248 ARG G O   1 
ATOM 7141 C CB  . ARG G 1 108 ? -13.087 18.499  -28.050 1.00 57.95 ? 248 ARG G CB  1 
ATOM 7142 C CG  . ARG G 1 108 ? -12.904 17.775  -26.729 1.00 61.58 ? 248 ARG G CG  1 
ATOM 7143 C CD  . ARG G 1 108 ? -12.051 18.611  -25.778 1.00 66.23 ? 248 ARG G CD  1 
ATOM 7144 N NE  . ARG G 1 108 ? -11.934 18.009  -24.452 1.00 69.29 ? 248 ARG G NE  1 
ATOM 7145 C CZ  . ARG G 1 108 ? -11.365 18.600  -23.404 1.00 70.11 ? 248 ARG G CZ  1 
ATOM 7146 N NH1 . ARG G 1 108 ? -10.850 19.820  -23.518 1.00 70.28 ? 248 ARG G NH1 1 
ATOM 7147 N NH2 . ARG G 1 108 ? -11.314 17.972  -22.237 1.00 70.22 ? 248 ARG G NH2 1 
ATOM 7148 N N   . GLY G 1 109 ? -14.256 21.645  -29.478 1.00 56.47 ? 249 GLY G N   1 
ATOM 7149 C CA  . GLY G 1 109 ? -14.123 22.457  -30.672 1.00 57.30 ? 249 GLY G CA  1 
ATOM 7150 C C   . GLY G 1 109 ? -14.690 21.804  -31.919 1.00 59.10 ? 249 GLY G C   1 
ATOM 7151 O O   . GLY G 1 109 ? -14.382 22.211  -33.038 1.00 59.70 ? 249 GLY G O   1 
ATOM 7152 N N   . ALA G 1 110 ? -15.524 20.787  -31.741 1.00 59.42 ? 250 ALA G N   1 
ATOM 7153 C CA  . ALA G 1 110 ? -16.098 20.111  -32.891 1.00 60.41 ? 250 ALA G CA  1 
ATOM 7154 C C   . ALA G 1 110 ? -17.485 19.564  -32.600 1.00 61.78 ? 250 ALA G C   1 
ATOM 7155 O O   . ALA G 1 110 ? -17.806 19.218  -31.463 1.00 62.87 ? 250 ALA G O   1 
ATOM 7156 C CB  . ALA G 1 110 ? -15.177 18.992  -33.345 1.00 60.01 ? 250 ALA G CB  1 
ATOM 7157 N N   . VAL G 1 111 ? -18.301 19.491  -33.647 1.00 62.54 ? 251 VAL G N   1 
ATOM 7158 C CA  . VAL G 1 111 ? -19.667 18.993  -33.548 1.00 62.52 ? 251 VAL G CA  1 
ATOM 7159 C C   . VAL G 1 111 ? -19.710 17.488  -33.811 1.00 63.82 ? 251 VAL G C   1 
ATOM 7160 O O   . VAL G 1 111 ? -19.066 16.999  -34.740 1.00 64.28 ? 251 VAL G O   1 
ATOM 7161 C CB  . VAL G 1 111 ? -20.574 19.692  -34.579 1.00 61.60 ? 251 VAL G CB  1 
ATOM 7162 C CG1 . VAL G 1 111 ? -22.012 19.242  -34.396 1.00 61.02 ? 251 VAL G CG1 1 
ATOM 7163 C CG2 . VAL G 1 111 ? -20.451 21.202  -34.440 1.00 60.44 ? 251 VAL G CG2 1 
ATOM 7164 N N   . TYR G 1 112 ? -20.466 16.755  -32.996 1.00 64.62 ? 252 TYR G N   1 
ATOM 7165 C CA  . TYR G 1 112 ? -20.581 15.307  -33.163 1.00 65.67 ? 252 TYR G CA  1 
ATOM 7166 C C   . TYR G 1 112 ? -22.033 14.832  -33.090 1.00 66.38 ? 252 TYR G C   1 
ATOM 7167 O O   . TYR G 1 112 ? -22.858 15.439  -32.409 1.00 66.15 ? 252 TYR G O   1 
ATOM 7168 C CB  . TYR G 1 112 ? -19.783 14.565  -32.087 1.00 65.39 ? 252 TYR G CB  1 
ATOM 7169 C CG  . TYR G 1 112 ? -18.329 14.958  -31.957 1.00 66.87 ? 252 TYR G CG  1 
ATOM 7170 C CD1 . TYR G 1 112 ? -17.956 16.105  -31.257 1.00 67.15 ? 252 TYR G CD1 1 
ATOM 7171 C CD2 . TYR G 1 112 ? -17.320 14.161  -32.499 1.00 67.54 ? 252 TYR G CD2 1 
ATOM 7172 C CE1 . TYR G 1 112 ? -16.610 16.446  -31.093 1.00 68.09 ? 252 TYR G CE1 1 
ATOM 7173 C CE2 . TYR G 1 112 ? -15.972 14.494  -32.344 1.00 67.82 ? 252 TYR G CE2 1 
ATOM 7174 C CZ  . TYR G 1 112 ? -15.625 15.636  -31.640 1.00 68.16 ? 252 TYR G CZ  1 
ATOM 7175 O OH  . TYR G 1 112 ? -14.296 15.966  -31.480 1.00 67.78 ? 252 TYR G OH  1 
ATOM 7176 N N   . ALA G 1 113 ? -22.331 13.738  -33.789 1.00 67.05 ? 253 ALA G N   1 
ATOM 7177 C CA  . ALA G 1 113 ? -23.673 13.157  -33.791 1.00 67.34 ? 253 ALA G CA  1 
ATOM 7178 C C   . ALA G 1 113 ? -23.761 12.191  -32.614 1.00 67.29 ? 253 ALA G C   1 
ATOM 7179 O O   . ALA G 1 113 ? -22.735 11.713  -32.129 1.00 66.71 ? 253 ALA G O   1 
ATOM 7180 C CB  . ALA G 1 113 ? -23.930 12.418  -35.102 1.00 67.35 ? 253 ALA G CB  1 
ATOM 7181 N N   . GLU G 1 114 ? -24.975 11.898  -32.154 1.00 67.60 ? 254 GLU G N   1 
ATOM 7182 C CA  . GLU G 1 114 ? -25.136 11.001  -31.011 1.00 68.97 ? 254 GLU G CA  1 
ATOM 7183 C C   . GLU G 1 114 ? -26.598 10.680  -30.710 1.00 68.57 ? 254 GLU G C   1 
ATOM 7184 O O   . GLU G 1 114 ? -27.509 11.337  -31.216 1.00 68.15 ? 254 GLU G O   1 
ATOM 7185 C CB  . GLU G 1 114 ? -24.481 11.634  -29.771 1.00 70.23 ? 254 GLU G CB  1 
ATOM 7186 C CG  . GLU G 1 114 ? -24.632 10.847  -28.470 1.00 71.98 ? 254 GLU G CG  1 
ATOM 7187 C CD  . GLU G 1 114 ? -23.823 9.564   -28.453 1.00 73.28 ? 254 GLU G CD  1 
ATOM 7188 O OE1 . GLU G 1 114 ? -24.424 8.475   -28.310 1.00 74.38 ? 254 GLU G OE1 1 
ATOM 7189 O OE2 . GLU G 1 114 ? -22.583 9.650   -28.580 1.00 71.87 ? 254 GLU G OE2 1 
ATOM 7190 N N   . ASN G 1 115 ? -26.804 9.659   -29.881 1.00 67.87 ? 255 ASN G N   1 
ATOM 7191 C CA  . ASN G 1 115 ? -28.138 9.236   -29.477 1.00 67.89 ? 255 ASN G CA  1 
ATOM 7192 C C   . ASN G 1 115 ? -28.773 10.335  -28.629 1.00 68.72 ? 255 ASN G C   1 
ATOM 7193 O O   . ASN G 1 115 ? -28.241 10.707  -27.582 1.00 69.24 ? 255 ASN G O   1 
ATOM 7194 C CB  . ASN G 1 115 ? -28.056 7.938   -28.669 1.00 67.05 ? 255 ASN G CB  1 
ATOM 7195 C CG  . ASN G 1 115 ? -29.422 7.416   -28.269 1.00 66.08 ? 255 ASN G CG  1 
ATOM 7196 O OD1 . ASN G 1 115 ? -30.224 8.143   -27.691 1.00 66.05 ? 255 ASN G OD1 1 
ATOM 7197 N ND2 . ASN G 1 115 ? -29.693 6.152   -28.577 1.00 64.42 ? 255 ASN G ND2 1 
ATOM 7198 N N   . CYS G 1 116 ? -29.918 10.837  -29.082 1.00 69.52 ? 256 CYS G N   1 
ATOM 7199 C CA  . CYS G 1 116 ? -30.634 11.912  -28.399 1.00 69.98 ? 256 CYS G CA  1 
ATOM 7200 C C   . CYS G 1 116 ? -31.090 11.603  -26.973 1.00 70.12 ? 256 CYS G C   1 
ATOM 7201 O O   . CYS G 1 116 ? -31.479 12.512  -26.240 1.00 70.17 ? 256 CYS G O   1 
ATOM 7202 C CB  . CYS G 1 116 ? -31.848 12.332  -29.226 1.00 69.96 ? 256 CYS G CB  1 
ATOM 7203 S SG  . CYS G 1 116 ? -31.495 12.632  -30.988 1.00 71.65 ? 256 CYS G SG  1 
ATOM 7204 N N   . ILE G 1 117 ? -31.054 10.337  -26.571 1.00 70.21 ? 257 ILE G N   1 
ATOM 7205 C CA  . ILE G 1 117 ? -31.484 9.988   -25.220 1.00 70.81 ? 257 ILE G CA  1 
ATOM 7206 C C   . ILE G 1 117 ? -30.355 10.186  -24.214 1.00 71.12 ? 257 ILE G C   1 
ATOM 7207 O O   . ILE G 1 117 ? -30.599 10.398  -23.024 1.00 70.43 ? 257 ILE G O   1 
ATOM 7208 C CB  . ILE G 1 117 ? -31.976 8.527   -25.137 1.00 71.07 ? 257 ILE G CB  1 
ATOM 7209 C CG1 . ILE G 1 117 ? -30.789 7.562   -25.199 1.00 71.90 ? 257 ILE G CG1 1 
ATOM 7210 C CG2 . ILE G 1 117 ? -32.956 8.253   -26.262 1.00 70.17 ? 257 ILE G CG2 1 
ATOM 7211 C CD1 . ILE G 1 117 ? -31.184 6.100   -25.294 1.00 72.14 ? 257 ILE G CD1 1 
ATOM 7212 N N   . LEU G 1 118 ? -29.119 10.118  -24.697 1.00 71.54 ? 258 LEU G N   1 
ATOM 7213 C CA  . LEU G 1 118 ? -27.957 10.295  -23.834 1.00 71.51 ? 258 LEU G CA  1 
ATOM 7214 C C   . LEU G 1 118 ? -27.874 11.728  -23.304 1.00 70.22 ? 258 LEU G C   1 
ATOM 7215 O O   . LEU G 1 118 ? -27.836 12.689  -24.075 1.00 69.99 ? 258 LEU G O   1 
ATOM 7216 C CB  . LEU G 1 118 ? -26.677 9.924   -24.594 1.00 72.22 ? 258 LEU G CB  1 
ATOM 7217 C CG  . LEU G 1 118 ? -25.338 10.129  -23.875 1.00 72.77 ? 258 LEU G CG  1 
ATOM 7218 C CD1 . LEU G 1 118 ? -25.451 9.783   -22.390 1.00 71.98 ? 258 LEU G CD1 1 
ATOM 7219 C CD2 . LEU G 1 118 ? -24.282 9.271   -24.556 1.00 71.33 ? 258 LEU G CD2 1 
ATOM 7220 N N   . ALA G 1 119 ? -27.844 11.855  -21.979 1.00 68.30 ? 259 ALA G N   1 
ATOM 7221 C CA  . ALA G 1 119 ? -27.788 13.154  -21.316 1.00 67.66 ? 259 ALA G CA  1 
ATOM 7222 C C   . ALA G 1 119 ? -26.530 13.965  -21.606 1.00 67.51 ? 259 ALA G C   1 
ATOM 7223 O O   . ALA G 1 119 ? -25.470 13.416  -21.905 1.00 67.80 ? 259 ALA G O   1 
ATOM 7224 C CB  . ALA G 1 119 ? -27.944 12.970  -19.813 1.00 67.10 ? 259 ALA G CB  1 
ATOM 7225 N N   . ALA G 1 120 ? -26.666 15.282  -21.500 1.00 67.29 ? 260 ALA G N   1 
ATOM 7226 C CA  . ALA G 1 120 ? -25.571 16.215  -21.735 1.00 66.57 ? 260 ALA G CA  1 
ATOM 7227 C C   . ALA G 1 120 ? -26.094 17.627  -21.508 1.00 66.25 ? 260 ALA G C   1 
ATOM 7228 O O   . ALA G 1 120 ? -27.304 17.841  -21.414 1.00 66.25 ? 260 ALA G O   1 
ATOM 7229 C CB  . ALA G 1 120 ? -25.054 16.071  -23.157 1.00 65.90 ? 260 ALA G CB  1 
ATOM 7230 N N   . PHE G 1 121 ? -25.188 18.592  -21.413 1.00 65.58 ? 261 PHE G N   1 
ATOM 7231 C CA  . PHE G 1 121 ? -25.599 19.971  -21.202 1.00 65.03 ? 261 PHE G CA  1 
ATOM 7232 C C   . PHE G 1 121 ? -26.015 20.598  -22.518 1.00 63.35 ? 261 PHE G C   1 
ATOM 7233 O O   . PHE G 1 121 ? -26.058 19.926  -23.549 1.00 63.26 ? 261 PHE G O   1 
ATOM 7234 C CB  . PHE G 1 121 ? -24.464 20.775  -20.569 1.00 67.09 ? 261 PHE G CB  1 
ATOM 7235 C CG  . PHE G 1 121 ? -24.123 20.329  -19.182 1.00 70.10 ? 261 PHE G CG  1 
ATOM 7236 C CD1 . PHE G 1 121 ? -23.539 19.085  -18.961 1.00 71.36 ? 261 PHE G CD1 1 
ATOM 7237 C CD2 . PHE G 1 121 ? -24.424 21.132  -18.088 1.00 71.17 ? 261 PHE G CD2 1 
ATOM 7238 C CE1 . PHE G 1 121 ? -23.267 18.647  -17.669 1.00 72.42 ? 261 PHE G CE1 1 
ATOM 7239 C CE2 . PHE G 1 121 ? -24.155 20.702  -16.792 1.00 72.20 ? 261 PHE G CE2 1 
ATOM 7240 C CZ  . PHE G 1 121 ? -23.575 19.457  -16.583 1.00 72.40 ? 261 PHE G CZ  1 
ATOM 7241 N N   . SER G 1 122 ? -26.318 21.888  -22.484 1.00 60.97 ? 262 SER G N   1 
ATOM 7242 C CA  . SER G 1 122 ? -26.738 22.573  -23.690 1.00 59.00 ? 262 SER G CA  1 
ATOM 7243 C C   . SER G 1 122 ? -26.638 24.085  -23.589 1.00 56.43 ? 262 SER G C   1 
ATOM 7244 O O   . SER G 1 122 ? -26.132 24.626  -22.614 1.00 55.30 ? 262 SER G O   1 
ATOM 7245 C CB  . SER G 1 122 ? -28.175 22.171  -24.029 1.00 60.04 ? 262 SER G CB  1 
ATOM 7246 O OG  . SER G 1 122 ? -28.983 22.153  -22.862 1.00 61.76 ? 262 SER G OG  1 
ATOM 7247 N N   . ILE G 1 123 ? -27.118 24.754  -24.626 1.00 55.37 ? 263 ILE G N   1 
ATOM 7248 C CA  . ILE G 1 123 ? -27.122 26.206  -24.687 1.00 55.30 ? 263 ILE G CA  1 
ATOM 7249 C C   . ILE G 1 123 ? -28.470 26.596  -25.261 1.00 54.84 ? 263 ILE G C   1 
ATOM 7250 O O   . ILE G 1 123 ? -28.946 25.969  -26.203 1.00 55.71 ? 263 ILE G O   1 
ATOM 7251 C CB  . ILE G 1 123 ? -26.040 26.754  -25.643 1.00 55.82 ? 263 ILE G CB  1 
ATOM 7252 C CG1 . ILE G 1 123 ? -24.665 26.204  -25.267 1.00 56.24 ? 263 ILE G CG1 1 
ATOM 7253 C CG2 . ILE G 1 123 ? -26.033 28.277  -25.592 1.00 54.81 ? 263 ILE G CG2 1 
ATOM 7254 C CD1 . ILE G 1 123 ? -23.579 26.605  -26.241 1.00 56.36 ? 263 ILE G CD1 1 
ATOM 7255 N N   . CYS G 1 124 ? -29.092 27.619  -24.691 1.00 54.41 ? 264 CYS G N   1 
ATOM 7256 C CA  . CYS G 1 124 ? -30.375 28.086  -25.188 1.00 53.69 ? 264 CYS G CA  1 
ATOM 7257 C C   . CYS G 1 124 ? -30.134 29.468  -25.770 1.00 53.50 ? 264 CYS G C   1 
ATOM 7258 O O   . CYS G 1 124 ? -29.216 30.164  -25.340 1.00 54.01 ? 264 CYS G O   1 
ATOM 7259 C CB  . CYS G 1 124 ? -31.396 28.190  -24.054 1.00 54.85 ? 264 CYS G CB  1 
ATOM 7260 S SG  . CYS G 1 124 ? -31.750 26.663  -23.122 1.00 56.56 ? 264 CYS G SG  1 
ATOM 7261 N N   . GLN G 1 125 ? -30.941 29.870  -26.748 1.00 52.85 ? 265 GLN G N   1 
ATOM 7262 C CA  . GLN G 1 125 ? -30.775 31.194  -27.335 1.00 52.50 ? 265 GLN G CA  1 
ATOM 7263 C C   . GLN G 1 125 ? -32.110 31.845  -27.666 1.00 53.24 ? 265 GLN G C   1 
ATOM 7264 O O   . GLN G 1 125 ? -33.090 31.162  -27.974 1.00 53.28 ? 265 GLN G O   1 
ATOM 7265 C CB  . GLN G 1 125 ? -29.892 31.129  -28.587 1.00 51.68 ? 265 GLN G CB  1 
ATOM 7266 C CG  . GLN G 1 125 ? -30.571 30.669  -29.860 1.00 49.60 ? 265 GLN G CG  1 
ATOM 7267 C CD  . GLN G 1 125 ? -29.596 30.587  -31.020 1.00 49.72 ? 265 GLN G CD  1 
ATOM 7268 O OE1 . GLN G 1 125 ? -28.725 29.718  -31.053 1.00 49.97 ? 265 GLN G OE1 1 
ATOM 7269 N NE2 . GLN G 1 125 ? -29.727 31.504  -31.971 1.00 49.91 ? 265 GLN G NE2 1 
ATOM 7270 N N   . LYS G 1 126 ? -32.137 33.172  -27.587 1.00 52.83 ? 266 LYS G N   1 
ATOM 7271 C CA  . LYS G 1 126 ? -33.343 33.939  -27.859 1.00 52.70 ? 266 LYS G CA  1 
ATOM 7272 C C   . LYS G 1 126 ? -32.974 35.340  -28.333 1.00 53.78 ? 266 LYS G C   1 
ATOM 7273 O O   . LYS G 1 126 ? -31.866 35.811  -28.090 1.00 55.19 ? 266 LYS G O   1 
ATOM 7274 C CB  . LYS G 1 126 ? -34.203 34.012  -26.595 1.00 51.27 ? 266 LYS G CB  1 
ATOM 7275 C CG  . LYS G 1 126 ? -33.463 34.515  -25.367 1.00 51.58 ? 266 LYS G CG  1 
ATOM 7276 C CD  . LYS G 1 126 ? -34.324 34.422  -24.110 1.00 52.52 ? 266 LYS G CD  1 
ATOM 7277 C CE  . LYS G 1 126 ? -35.597 35.254  -24.218 1.00 53.18 ? 266 LYS G CE  1 
ATOM 7278 N NZ  . LYS G 1 126 ? -36.461 35.099  -23.012 1.00 52.85 ? 266 LYS G NZ  1 
ATOM 7279 N N   . LYS G 1 127 ? -33.906 36.000  -29.010 1.00 54.48 ? 267 LYS G N   1 
ATOM 7280 C CA  . LYS G 1 127 ? -33.677 37.343  -29.534 1.00 55.30 ? 267 LYS G CA  1 
ATOM 7281 C C   . LYS G 1 127 ? -33.226 38.320  -28.455 1.00 54.99 ? 267 LYS G C   1 
ATOM 7282 O O   . LYS G 1 127 ? -33.628 38.210  -27.300 1.00 53.58 ? 267 LYS G O   1 
ATOM 7283 C CB  . LYS G 1 127 ? -34.957 37.882  -30.165 1.00 57.53 ? 267 LYS G CB  1 
ATOM 7284 C CG  . LYS G 1 127 ? -35.596 36.975  -31.199 1.00 61.85 ? 267 LYS G CG  1 
ATOM 7285 C CD  . LYS G 1 127 ? -37.087 37.273  -31.292 1.00 63.48 ? 267 LYS G CD  1 
ATOM 7286 C CE  . LYS G 1 127 ? -37.760 37.014  -29.944 1.00 62.76 ? 267 LYS G CE  1 
ATOM 7287 N NZ  . LYS G 1 127 ? -39.184 37.434  -29.911 1.00 61.39 ? 267 LYS G NZ  1 
ATOM 7288 N N   . ALA G 1 128 ? -32.398 39.282  -28.846 1.00 55.63 ? 268 ALA G N   1 
ATOM 7289 C CA  . ALA G 1 128 ? -31.912 40.299  -27.920 1.00 57.30 ? 268 ALA G CA  1 
ATOM 7290 C C   . ALA G 1 128 ? -32.654 41.605  -28.207 1.00 57.93 ? 268 ALA G C   1 
ATOM 7291 O O   . ALA G 1 128 ? -32.742 42.028  -29.359 1.00 59.34 ? 268 ALA G O   1 
ATOM 7292 C CB  . ALA G 1 128 ? -30.406 40.493  -28.101 1.00 58.17 ? 268 ALA G CB  1 
ATOM 7293 N N   . ASN G 1 129 ? -33.188 42.241  -27.168 1.00 57.65 ? 269 ASN G N   1 
ATOM 7294 C CA  . ASN G 1 129 ? -33.923 43.491  -27.346 1.00 59.65 ? 269 ASN G CA  1 
ATOM 7295 C C   . ASN G 1 129 ? -33.011 44.656  -27.743 1.00 61.22 ? 269 ASN G C   1 
ATOM 7296 O O   . ASN G 1 129 ? -32.207 45.127  -26.939 1.00 61.05 ? 269 ASN G O   1 
ATOM 7297 C CB  . ASN G 1 129 ? -34.680 43.830  -26.064 1.00 59.53 ? 269 ASN G CB  1 
ATOM 7298 C CG  . ASN G 1 129 ? -35.613 42.716  -25.631 1.00 61.31 ? 269 ASN G CG  1 
ATOM 7299 O OD1 . ASN G 1 129 ? -36.400 42.205  -26.428 1.00 61.61 ? 269 ASN G OD1 1 
ATOM 7300 N ND2 . ASN G 1 129 ? -35.534 42.336  -24.360 1.00 62.60 ? 269 ASN G ND2 1 
ATOM 7301 N N   . LEU G 1 130 ? -33.152 45.124  -28.983 1.00 63.38 ? 270 LEU G N   1 
ATOM 7302 C CA  . LEU G 1 130 ? -32.329 46.223  -29.492 1.00 66.26 ? 270 LEU G CA  1 
ATOM 7303 C C   . LEU G 1 130 ? -33.122 47.429  -30.021 1.00 68.21 ? 270 LEU G C   1 
ATOM 7304 O O   . LEU G 1 130 ? -34.352 47.469  -29.938 1.00 68.05 ? 270 LEU G O   1 
ATOM 7305 C CB  . LEU G 1 130 ? -31.408 45.702  -30.603 1.00 65.71 ? 270 LEU G CB  1 
ATOM 7306 C CG  . LEU G 1 130 ? -30.439 44.563  -30.272 1.00 64.31 ? 270 LEU G CG  1 
ATOM 7307 C CD1 . LEU G 1 130 ? -29.752 44.089  -31.546 1.00 62.67 ? 270 LEU G CD1 1 
ATOM 7308 C CD2 . LEU G 1 130 ? -29.418 45.037  -29.255 1.00 64.32 ? 270 LEU G CD2 1 
ATOM 7309 N N   . ARG G 1 131 ? -32.395 48.405  -30.566 1.00 70.28 ? 271 ARG G N   1 
ATOM 7310 C CA  . ARG G 1 131 ? -32.984 49.620  -31.124 1.00 72.56 ? 271 ARG G CA  1 
ATOM 7311 C C   . ARG G 1 131 ? -33.724 49.364  -32.435 1.00 73.97 ? 271 ARG G C   1 
ATOM 7312 O O   . ARG G 1 131 ? -34.942 49.542  -32.516 1.00 74.41 ? 271 ARG G O   1 
ATOM 7313 C CB  . ARG G 1 131 ? -31.893 50.681  -31.337 1.00 72.89 ? 271 ARG G CB  1 
ATOM 7314 C CG  . ARG G 1 131 ? -32.152 51.654  -32.494 1.00 75.47 ? 271 ARG G CG  1 
ATOM 7315 C CD  . ARG G 1 131 ? -31.399 51.227  -33.760 1.00 75.65 ? 271 ARG G CD  1 
ATOM 7316 N NE  . ARG G 1 131 ? -31.844 51.934  -34.962 1.00 75.32 ? 271 ARG G NE  1 
ATOM 7317 C CZ  . ARG G 1 131 ? -31.421 51.657  -36.194 1.00 75.01 ? 271 ARG G CZ  1 
ATOM 7318 N NH1 . ARG G 1 131 ? -30.539 50.687  -36.394 1.00 74.52 ? 271 ARG G NH1 1 
ATOM 7319 N NH2 . ARG G 1 131 ? -31.882 52.342  -37.232 1.00 72.84 ? 271 ARG G NH2 1 
ATOM 7320 N N   . ALA G 1 132 ? -32.986 48.948  -33.460 1.00 74.65 ? 272 ALA G N   1 
ATOM 7321 C CA  . ALA G 1 132 ? -33.574 48.676  -34.766 1.00 75.17 ? 272 ALA G CA  1 
ATOM 7322 C C   . ALA G 1 132 ? -32.581 47.948  -35.671 1.00 75.92 ? 272 ALA G C   1 
ATOM 7323 O O   . ALA G 1 132 ? -32.864 46.784  -36.029 1.00 76.39 ? 272 ALA G O   1 
ATOM 7324 C CB  . ALA G 1 132 ? -34.019 49.980  -35.416 1.00 73.58 ? 272 ALA G CB  1 
ATOM 7325 O OXT . ALA G 1 132 ? -31.530 48.538  -36.005 1.00 75.99 ? 272 ALA G OXT 1 
ATOM 7326 N N   . ALA H 1 2   ? -27.950 49.260  -21.760 1.00 48.23 ? 142 ALA H N   1 
ATOM 7327 C CA  . ALA H 1 2   ? -26.897 48.206  -21.864 1.00 48.84 ? 142 ALA H CA  1 
ATOM 7328 C C   . ALA H 1 2   ? -26.091 48.120  -20.573 1.00 49.23 ? 142 ALA H C   1 
ATOM 7329 O O   . ALA H 1 2   ? -25.280 49.000  -20.277 1.00 49.40 ? 142 ALA H O   1 
ATOM 7330 C CB  . ALA H 1 2   ? -25.972 48.509  -23.032 1.00 46.75 ? 142 ALA H CB  1 
ATOM 7331 N N   . PRO H 1 3   ? -26.320 47.068  -19.773 1.00 49.17 ? 143 PRO H N   1 
ATOM 7332 C CA  . PRO H 1 3   ? -25.554 46.964  -18.530 1.00 49.23 ? 143 PRO H CA  1 
ATOM 7333 C C   . PRO H 1 3   ? -24.134 46.484  -18.801 1.00 49.29 ? 143 PRO H C   1 
ATOM 7334 O O   . PRO H 1 3   ? -23.167 47.053  -18.295 1.00 49.34 ? 143 PRO H O   1 
ATOM 7335 C CB  . PRO H 1 3   ? -26.355 45.949  -17.706 1.00 49.47 ? 143 PRO H CB  1 
ATOM 7336 C CG  . PRO H 1 3   ? -27.749 46.074  -18.252 1.00 48.20 ? 143 PRO H CG  1 
ATOM 7337 C CD  . PRO H 1 3   ? -27.492 46.177  -19.734 1.00 48.58 ? 143 PRO H CD  1 
ATOM 7338 N N   . CYS H 1 4   ? -24.018 45.447  -19.625 1.00 49.44 ? 144 CYS H N   1 
ATOM 7339 C CA  . CYS H 1 4   ? -22.721 44.865  -19.930 1.00 50.37 ? 144 CYS H CA  1 
ATOM 7340 C C   . CYS H 1 4   ? -22.388 44.778  -21.409 1.00 50.51 ? 144 CYS H C   1 
ATOM 7341 O O   . CYS H 1 4   ? -23.277 44.801  -22.261 1.00 51.88 ? 144 CYS H O   1 
ATOM 7342 C CB  . CYS H 1 4   ? -22.651 43.469  -19.326 1.00 52.43 ? 144 CYS H CB  1 
ATOM 7343 S SG  . CYS H 1 4   ? -22.969 43.437  -17.539 1.00 56.81 ? 144 CYS H SG  1 
ATOM 7344 N N   . PRO H 1 5   ? -21.088 44.671  -21.731 1.00 49.78 ? 145 PRO H N   1 
ATOM 7345 C CA  . PRO H 1 5   ? -20.644 44.575  -23.123 1.00 49.09 ? 145 PRO H CA  1 
ATOM 7346 C C   . PRO H 1 5   ? -20.982 43.179  -23.622 1.00 48.78 ? 145 PRO H C   1 
ATOM 7347 O O   . PRO H 1 5   ? -21.196 42.270  -22.819 1.00 48.31 ? 145 PRO H O   1 
ATOM 7348 C CB  . PRO H 1 5   ? -19.131 44.784  -23.025 1.00 48.38 ? 145 PRO H CB  1 
ATOM 7349 C CG  . PRO H 1 5   ? -18.934 45.464  -21.704 1.00 47.50 ? 145 PRO H CG  1 
ATOM 7350 C CD  . PRO H 1 5   ? -19.929 44.766  -20.831 1.00 49.20 ? 145 PRO H CD  1 
ATOM 7351 N N   . GLN H 1 6   ? -21.030 43.000  -24.936 1.00 47.86 ? 146 GLN H N   1 
ATOM 7352 C CA  . GLN H 1 6   ? -21.340 41.687  -25.476 1.00 47.68 ? 146 GLN H CA  1 
ATOM 7353 C C   . GLN H 1 6   ? -20.300 40.686  -24.996 1.00 47.62 ? 146 GLN H C   1 
ATOM 7354 O O   . GLN H 1 6   ? -19.203 41.069  -24.588 1.00 47.05 ? 146 GLN H O   1 
ATOM 7355 C CB  . GLN H 1 6   ? -21.342 41.711  -27.003 1.00 47.81 ? 146 GLN H CB  1 
ATOM 7356 C CG  . GLN H 1 6   ? -22.275 42.729  -27.622 1.00 49.21 ? 146 GLN H CG  1 
ATOM 7357 C CD  . GLN H 1 6   ? -22.467 42.497  -29.109 1.00 51.14 ? 146 GLN H CD  1 
ATOM 7358 O OE1 . GLN H 1 6   ? -23.029 43.334  -29.811 1.00 53.05 ? 146 GLN H OE1 1 
ATOM 7359 N NE2 . GLN H 1 6   ? -22.006 41.348  -29.595 1.00 51.97 ? 146 GLN H NE2 1 
ATOM 7360 N N   . ASP H 1 7   ? -20.654 39.405  -25.045 1.00 48.09 ? 147 ASP H N   1 
ATOM 7361 C CA  . ASP H 1 7   ? -19.759 38.332  -24.631 1.00 47.50 ? 147 ASP H CA  1 
ATOM 7362 C C   . ASP H 1 7   ? -19.486 38.319  -23.129 1.00 46.79 ? 147 ASP H C   1 
ATOM 7363 O O   . ASP H 1 7   ? -18.830 37.415  -22.622 1.00 45.88 ? 147 ASP H O   1 
ATOM 7364 C CB  . ASP H 1 7   ? -18.451 38.424  -25.421 1.00 47.34 ? 147 ASP H CB  1 
ATOM 7365 C CG  . ASP H 1 7   ? -18.655 38.162  -26.901 1.00 46.99 ? 147 ASP H CG  1 
ATOM 7366 O OD1 . ASP H 1 7   ? -19.577 38.764  -27.491 1.00 47.23 ? 147 ASP H OD1 1 
ATOM 7367 O OD2 . ASP H 1 7   ? -17.899 37.354  -27.478 1.00 47.33 ? 147 ASP H OD2 1 
ATOM 7368 N N   . TRP H 1 8   ? -19.987 39.326  -22.422 1.00 47.26 ? 148 TRP H N   1 
ATOM 7369 C CA  . TRP H 1 8   ? -19.825 39.391  -20.972 1.00 47.55 ? 148 TRP H CA  1 
ATOM 7370 C C   . TRP H 1 8   ? -21.125 38.893  -20.353 1.00 46.44 ? 148 TRP H C   1 
ATOM 7371 O O   . TRP H 1 8   ? -22.135 38.776  -21.041 1.00 46.25 ? 148 TRP H O   1 
ATOM 7372 C CB  . TRP H 1 8   ? -19.563 40.826  -20.496 1.00 49.17 ? 148 TRP H CB  1 
ATOM 7373 C CG  . TRP H 1 8   ? -18.188 41.367  -20.793 1.00 50.37 ? 148 TRP H CG  1 
ATOM 7374 C CD1 . TRP H 1 8   ? -17.629 41.558  -22.022 1.00 51.05 ? 148 TRP H CD1 1 
ATOM 7375 C CD2 . TRP H 1 8   ? -17.232 41.850  -19.841 1.00 50.52 ? 148 TRP H CD2 1 
ATOM 7376 N NE1 . TRP H 1 8   ? -16.390 42.136  -21.898 1.00 50.53 ? 148 TRP H NE1 1 
ATOM 7377 C CE2 . TRP H 1 8   ? -16.121 42.326  -20.569 1.00 49.68 ? 148 TRP H CE2 1 
ATOM 7378 C CE3 . TRP H 1 8   ? -17.208 41.927  -18.441 1.00 51.88 ? 148 TRP H CE3 1 
ATOM 7379 C CZ2 . TRP H 1 8   ? -14.999 42.876  -19.949 1.00 49.64 ? 148 TRP H CZ2 1 
ATOM 7380 C CZ3 . TRP H 1 8   ? -16.090 42.474  -17.822 1.00 51.37 ? 148 TRP H CZ3 1 
ATOM 7381 C CH2 . TRP H 1 8   ? -15.001 42.941  -18.579 1.00 51.06 ? 148 TRP H CH2 1 
ATOM 7382 N N   . ILE H 1 9   ? -21.101 38.602  -19.057 1.00 45.88 ? 149 ILE H N   1 
ATOM 7383 C CA  . ILE H 1 9   ? -22.290 38.121  -18.364 1.00 45.55 ? 149 ILE H CA  1 
ATOM 7384 C C   . ILE H 1 9   ? -22.762 39.123  -17.322 1.00 47.39 ? 149 ILE H C   1 
ATOM 7385 O O   . ILE H 1 9   ? -22.054 39.401  -16.356 1.00 49.11 ? 149 ILE H O   1 
ATOM 7386 C CB  . ILE H 1 9   ? -22.027 36.795  -17.629 1.00 43.30 ? 149 ILE H CB  1 
ATOM 7387 C CG1 . ILE H 1 9   ? -21.478 35.751  -18.598 1.00 41.68 ? 149 ILE H CG1 1 
ATOM 7388 C CG2 . ILE H 1 9   ? -23.315 36.295  -16.998 1.00 43.22 ? 149 ILE H CG2 1 
ATOM 7389 C CD1 . ILE H 1 9   ? -20.930 34.519  -17.909 1.00 41.89 ? 149 ILE H CD1 1 
ATOM 7390 N N   . TRP H 1 10  ? -23.955 39.671  -17.516 1.00 49.19 ? 150 TRP H N   1 
ATOM 7391 C CA  . TRP H 1 10  ? -24.493 40.616  -16.552 1.00 51.20 ? 150 TRP H CA  1 
ATOM 7392 C C   . TRP H 1 10  ? -25.122 39.829  -15.412 1.00 51.59 ? 150 TRP H C   1 
ATOM 7393 O O   . TRP H 1 10  ? -25.894 38.898  -15.641 1.00 51.58 ? 150 TRP H O   1 
ATOM 7394 C CB  . TRP H 1 10  ? -25.540 41.527  -17.200 1.00 53.13 ? 150 TRP H CB  1 
ATOM 7395 C CG  . TRP H 1 10  ? -26.307 42.348  -16.207 1.00 55.38 ? 150 TRP H CG  1 
ATOM 7396 C CD1 . TRP H 1 10  ? -25.807 42.979  -15.104 1.00 56.30 ? 150 TRP H CD1 1 
ATOM 7397 C CD2 . TRP H 1 10  ? -27.715 42.612  -16.214 1.00 56.18 ? 150 TRP H CD2 1 
ATOM 7398 N NE1 . TRP H 1 10  ? -26.816 43.614  -14.422 1.00 56.79 ? 150 TRP H NE1 1 
ATOM 7399 C CE2 . TRP H 1 10  ? -27.998 43.405  -15.082 1.00 56.44 ? 150 TRP H CE2 1 
ATOM 7400 C CE3 . TRP H 1 10  ? -28.766 42.252  -17.068 1.00 56.54 ? 150 TRP H CE3 1 
ATOM 7401 C CZ2 . TRP H 1 10  ? -29.289 43.846  -14.779 1.00 55.30 ? 150 TRP H CZ2 1 
ATOM 7402 C CZ3 . TRP H 1 10  ? -30.050 42.690  -16.767 1.00 56.22 ? 150 TRP H CZ3 1 
ATOM 7403 C CH2 . TRP H 1 10  ? -30.299 43.479  -15.630 1.00 55.35 ? 150 TRP H CH2 1 
ATOM 7404 N N   . HIS H 1 11  ? -24.765 40.201  -14.187 1.00 51.53 ? 151 HIS H N   1 
ATOM 7405 C CA  . HIS H 1 11  ? -25.284 39.551  -12.990 1.00 51.00 ? 151 HIS H CA  1 
ATOM 7406 C C   . HIS H 1 11  ? -25.342 40.555  -11.851 1.00 51.51 ? 151 HIS H C   1 
ATOM 7407 O O   . HIS H 1 11  ? -24.308 41.031  -11.383 1.00 52.27 ? 151 HIS H O   1 
ATOM 7408 C CB  . HIS H 1 11  ? -24.388 38.390  -12.574 1.00 48.92 ? 151 HIS H CB  1 
ATOM 7409 C CG  . HIS H 1 11  ? -24.727 37.831  -11.230 1.00 47.88 ? 151 HIS H CG  1 
ATOM 7410 N ND1 . HIS H 1 11  ? -25.855 37.073  -11.001 1.00 47.32 ? 151 HIS H ND1 1 
ATOM 7411 C CD2 . HIS H 1 11  ? -24.112 37.959  -10.031 1.00 48.03 ? 151 HIS H CD2 1 
ATOM 7412 C CE1 . HIS H 1 11  ? -25.920 36.758  -9.720  1.00 46.17 ? 151 HIS H CE1 1 
ATOM 7413 N NE2 . HIS H 1 11  ? -24.874 37.285  -9.109  1.00 47.51 ? 151 HIS H NE2 1 
ATOM 7414 N N   . GLY H 1 12  ? -26.552 40.871  -11.404 1.00 51.37 ? 152 GLY H N   1 
ATOM 7415 C CA  . GLY H 1 12  ? -26.704 41.827  -10.326 1.00 51.79 ? 152 GLY H CA  1 
ATOM 7416 C C   . GLY H 1 12  ? -26.223 43.213  -10.711 1.00 52.07 ? 152 GLY H C   1 
ATOM 7417 O O   . GLY H 1 12  ? -26.756 43.832  -11.629 1.00 53.01 ? 152 GLY H O   1 
ATOM 7418 N N   . GLU H 1 13  ? -25.201 43.698  -10.017 1.00 52.91 ? 153 GLU H N   1 
ATOM 7419 C CA  . GLU H 1 13  ? -24.661 45.025  -10.283 1.00 53.93 ? 153 GLU H CA  1 
ATOM 7420 C C   . GLU H 1 13  ? -23.426 45.029  -11.172 1.00 54.50 ? 153 GLU H C   1 
ATOM 7421 O O   . GLU H 1 13  ? -23.020 46.086  -11.652 1.00 55.57 ? 153 GLU H O   1 
ATOM 7422 C CB  . GLU H 1 13  ? -24.294 45.726  -8.974  1.00 55.29 ? 153 GLU H CB  1 
ATOM 7423 C CG  . GLU H 1 13  ? -25.428 45.914  -7.987  1.00 58.55 ? 153 GLU H CG  1 
ATOM 7424 C CD  . GLU H 1 13  ? -24.989 46.714  -6.774  1.00 59.61 ? 153 GLU H CD  1 
ATOM 7425 O OE1 . GLU H 1 13  ? -24.121 46.223  -6.025  1.00 59.10 ? 153 GLU H OE1 1 
ATOM 7426 O OE2 . GLU H 1 13  ? -25.503 47.836  -6.575  1.00 61.48 ? 153 GLU H OE2 1 
ATOM 7427 N N   . ASN H 1 14  ? -22.823 43.865  -11.394 1.00 54.57 ? 154 ASN H N   1 
ATOM 7428 C CA  . ASN H 1 14  ? -21.608 43.808  -12.199 1.00 54.15 ? 154 ASN H CA  1 
ATOM 7429 C C   . ASN H 1 14  ? -21.660 43.023  -13.505 1.00 54.59 ? 154 ASN H C   1 
ATOM 7430 O O   . ASN H 1 14  ? -22.663 42.386  -13.839 1.00 54.14 ? 154 ASN H O   1 
ATOM 7431 C CB  . ASN H 1 14  ? -20.458 43.275  -11.347 1.00 53.95 ? 154 ASN H CB  1 
ATOM 7432 C CG  . ASN H 1 14  ? -20.250 44.081  -10.085 1.00 54.90 ? 154 ASN H CG  1 
ATOM 7433 O OD1 . ASN H 1 14  ? -19.985 45.280  -10.135 1.00 55.07 ? 154 ASN H OD1 1 
ATOM 7434 N ND2 . ASN H 1 14  ? -20.371 43.423  -8.939  1.00 55.62 ? 154 ASN H ND2 1 
ATOM 7435 N N   . CYS H 1 15  ? -20.545 43.088  -14.232 1.00 53.92 ? 155 CYS H N   1 
ATOM 7436 C CA  . CYS H 1 15  ? -20.370 42.416  -15.514 1.00 53.28 ? 155 CYS H CA  1 
ATOM 7437 C C   . CYS H 1 15  ? -19.177 41.480  -15.448 1.00 53.48 ? 155 CYS H C   1 
ATOM 7438 O O   . CYS H 1 15  ? -18.071 41.903  -15.106 1.00 55.42 ? 155 CYS H O   1 
ATOM 7439 C CB  . CYS H 1 15  ? -20.120 43.441  -16.606 1.00 53.23 ? 155 CYS H CB  1 
ATOM 7440 S SG  . CYS H 1 15  ? -21.485 44.610  -16.806 1.00 55.66 ? 155 CYS H SG  1 
ATOM 7441 N N   . TYR H 1 16  ? -19.387 40.217  -15.796 1.00 51.14 ? 156 TYR H N   1 
ATOM 7442 C CA  . TYR H 1 16  ? -18.298 39.258  -15.744 1.00 49.06 ? 156 TYR H CA  1 
ATOM 7443 C C   . TYR H 1 16  ? -17.841 38.765  -17.102 1.00 49.07 ? 156 TYR H C   1 
ATOM 7444 O O   . TYR H 1 16  ? -18.617 38.699  -18.054 1.00 50.89 ? 156 TYR H O   1 
ATOM 7445 C CB  . TYR H 1 16  ? -18.688 38.079  -14.858 1.00 46.27 ? 156 TYR H CB  1 
ATOM 7446 C CG  . TYR H 1 16  ? -19.162 38.526  -13.504 1.00 43.92 ? 156 TYR H CG  1 
ATOM 7447 C CD1 . TYR H 1 16  ? -20.487 38.890  -13.303 1.00 43.69 ? 156 TYR H CD1 1 
ATOM 7448 C CD2 . TYR H 1 16  ? -18.271 38.666  -12.444 1.00 43.16 ? 156 TYR H CD2 1 
ATOM 7449 C CE1 . TYR H 1 16  ? -20.917 39.388  -12.080 1.00 43.65 ? 156 TYR H CE1 1 
ATOM 7450 C CE2 . TYR H 1 16  ? -18.689 39.166  -11.218 1.00 42.30 ? 156 TYR H CE2 1 
ATOM 7451 C CZ  . TYR H 1 16  ? -20.012 39.526  -11.044 1.00 42.20 ? 156 TYR H CZ  1 
ATOM 7452 O OH  . TYR H 1 16  ? -20.429 40.039  -9.840  1.00 42.48 ? 156 TYR H OH  1 
ATOM 7453 N N   . LEU H 1 17  ? -16.563 38.422  -17.179 1.00 47.43 ? 157 LEU H N   1 
ATOM 7454 C CA  . LEU H 1 17  ? -15.979 37.933  -18.409 1.00 47.10 ? 157 LEU H CA  1 
ATOM 7455 C C   . LEU H 1 17  ? -15.025 36.803  -18.085 1.00 49.32 ? 157 LEU H C   1 
ATOM 7456 O O   . LEU H 1 17  ? -14.219 36.910  -17.162 1.00 49.41 ? 157 LEU H O   1 
ATOM 7457 C CB  . LEU H 1 17  ? -15.209 39.055  -19.109 1.00 46.03 ? 157 LEU H CB  1 
ATOM 7458 C CG  . LEU H 1 17  ? -14.605 38.721  -20.475 1.00 42.49 ? 157 LEU H CG  1 
ATOM 7459 C CD1 . LEU H 1 17  ? -15.722 38.512  -21.473 1.00 42.04 ? 157 LEU H CD1 1 
ATOM 7460 C CD2 . LEU H 1 17  ? -13.698 39.843  -20.936 1.00 39.91 ? 157 LEU H CD2 1 
ATOM 7461 N N   . PHE H 1 18  ? -15.127 35.715  -18.839 1.00 51.69 ? 158 PHE H N   1 
ATOM 7462 C CA  . PHE H 1 18  ? -14.241 34.576  -18.656 1.00 53.73 ? 158 PHE H CA  1 
ATOM 7463 C C   . PHE H 1 18  ? -13.111 34.726  -19.666 1.00 54.66 ? 158 PHE H C   1 
ATOM 7464 O O   . PHE H 1 18  ? -13.344 34.799  -20.874 1.00 53.65 ? 158 PHE H O   1 
ATOM 7465 C CB  . PHE H 1 18  ? -14.996 33.272  -18.884 1.00 55.19 ? 158 PHE H CB  1 
ATOM 7466 C CG  . PHE H 1 18  ? -15.863 32.866  -17.728 1.00 56.52 ? 158 PHE H CG  1 
ATOM 7467 C CD1 . PHE H 1 18  ? -16.843 33.725  -17.222 1.00 56.51 ? 158 PHE H CD1 1 
ATOM 7468 C CD2 . PHE H 1 18  ? -15.699 31.618  -17.142 1.00 56.73 ? 158 PHE H CD2 1 
ATOM 7469 C CE1 . PHE H 1 18  ? -17.647 33.337  -16.141 1.00 57.07 ? 158 PHE H CE1 1 
ATOM 7470 C CE2 . PHE H 1 18  ? -16.490 31.222  -16.070 1.00 57.25 ? 158 PHE H CE2 1 
ATOM 7471 C CZ  . PHE H 1 18  ? -17.467 32.081  -15.565 1.00 57.54 ? 158 PHE H CZ  1 
ATOM 7472 N N   . SER H 1 19  ? -11.887 34.785  -19.158 1.00 56.46 ? 159 SER H N   1 
ATOM 7473 C CA  . SER H 1 19  ? -10.715 34.964  -20.000 1.00 58.72 ? 159 SER H CA  1 
ATOM 7474 C C   . SER H 1 19  ? -10.523 33.889  -21.060 1.00 60.62 ? 159 SER H C   1 
ATOM 7475 O O   . SER H 1 19  ? -11.065 32.782  -20.968 1.00 60.54 ? 159 SER H O   1 
ATOM 7476 C CB  . SER H 1 19  ? -9.456  35.036  -19.136 1.00 58.36 ? 159 SER H CB  1 
ATOM 7477 O OG  . SER H 1 19  ? -9.160  33.775  -18.563 1.00 58.15 ? 159 SER H OG  1 
ATOM 7478 N N   . SER H 1 20  ? -9.729  34.241  -22.067 1.00 61.87 ? 160 SER H N   1 
ATOM 7479 C CA  . SER H 1 20  ? -9.409  33.344  -23.165 1.00 62.10 ? 160 SER H CA  1 
ATOM 7480 C C   . SER H 1 20  ? -8.132  32.585  -22.803 1.00 61.49 ? 160 SER H C   1 
ATOM 7481 O O   . SER H 1 20  ? -8.175  31.450  -22.327 1.00 59.68 ? 160 SER H O   1 
ATOM 7482 C CB  . SER H 1 20  ? -9.175  34.147  -24.450 1.00 62.26 ? 160 SER H CB  1 
ATOM 7483 O OG  . SER H 1 20  ? -10.178 35.130  -24.638 1.00 62.45 ? 160 SER H OG  1 
ATOM 7484 N N   . GLY H 1 21  ? -6.996  33.242  -23.016 1.00 61.40 ? 161 GLY H N   1 
ATOM 7485 C CA  . GLY H 1 21  ? -5.714  32.631  -22.731 1.00 60.20 ? 161 GLY H CA  1 
ATOM 7486 C C   . GLY H 1 21  ? -5.551  32.120  -21.317 1.00 59.86 ? 161 GLY H C   1 
ATOM 7487 O O   . GLY H 1 21  ? -6.440  32.258  -20.479 1.00 59.26 ? 161 GLY H O   1 
ATOM 7488 N N   . SER H 1 22  ? -4.397  31.513  -21.070 1.00 59.94 ? 162 SER H N   1 
ATOM 7489 C CA  . SER H 1 22  ? -4.050  30.959  -19.769 1.00 59.11 ? 162 SER H CA  1 
ATOM 7490 C C   . SER H 1 22  ? -2.687  31.536  -19.404 1.00 58.56 ? 162 SER H C   1 
ATOM 7491 O O   . SER H 1 22  ? -1.651  31.021  -19.826 1.00 57.74 ? 162 SER H O   1 
ATOM 7492 C CB  . SER H 1 22  ? -3.971  29.433  -19.854 1.00 58.75 ? 162 SER H CB  1 
ATOM 7493 O OG  . SER H 1 22  ? -3.589  28.869  -18.612 1.00 59.51 ? 162 SER H OG  1 
ATOM 7494 N N   . PHE H 1 23  ? -2.691  32.612  -18.624 1.00 57.46 ? 163 PHE H N   1 
ATOM 7495 C CA  . PHE H 1 23  ? -1.449  33.263  -18.240 1.00 56.06 ? 163 PHE H CA  1 
ATOM 7496 C C   . PHE H 1 23  ? -1.217  33.227  -16.740 1.00 54.16 ? 163 PHE H C   1 
ATOM 7497 O O   . PHE H 1 23  ? -1.933  32.552  -16.004 1.00 53.42 ? 163 PHE H O   1 
ATOM 7498 C CB  . PHE H 1 23  ? -1.467  34.716  -18.714 1.00 57.09 ? 163 PHE H CB  1 
ATOM 7499 C CG  . PHE H 1 23  ? -1.913  34.882  -20.137 1.00 58.70 ? 163 PHE H CG  1 
ATOM 7500 C CD1 . PHE H 1 23  ? -3.236  34.641  -20.499 1.00 59.36 ? 163 PHE H CD1 1 
ATOM 7501 C CD2 . PHE H 1 23  ? -1.011  35.272  -21.120 1.00 58.51 ? 163 PHE H CD2 1 
ATOM 7502 C CE1 . PHE H 1 23  ? -3.652  34.784  -21.818 1.00 59.26 ? 163 PHE H CE1 1 
ATOM 7503 C CE2 . PHE H 1 23  ? -1.419  35.418  -22.442 1.00 59.40 ? 163 PHE H CE2 1 
ATOM 7504 C CZ  . PHE H 1 23  ? -2.743  35.174  -22.791 1.00 59.74 ? 163 PHE H CZ  1 
ATOM 7505 N N   . ASN H 1 24  ? -0.196  33.952  -16.300 1.00 52.09 ? 164 ASN H N   1 
ATOM 7506 C CA  . ASN H 1 24  ? 0.128   34.039  -14.888 1.00 50.50 ? 164 ASN H CA  1 
ATOM 7507 C C   . ASN H 1 24  ? -0.814  35.080  -14.305 1.00 50.16 ? 164 ASN H C   1 
ATOM 7508 O O   . ASN H 1 24  ? -1.605  35.679  -15.033 1.00 49.75 ? 164 ASN H O   1 
ATOM 7509 C CB  . ASN H 1 24  ? 1.588   34.464  -14.695 1.00 50.41 ? 164 ASN H CB  1 
ATOM 7510 C CG  . ASN H 1 24  ? 1.907   35.791  -15.358 1.00 50.76 ? 164 ASN H CG  1 
ATOM 7511 O OD1 . ASN H 1 24  ? 1.396   36.840  -14.960 1.00 50.36 ? 164 ASN H OD1 1 
ATOM 7512 N ND2 . ASN H 1 24  ? 2.756   35.751  -16.378 1.00 50.98 ? 164 ASN H ND2 1 
ATOM 7513 N N   . TRP H 1 25  ? -0.729  35.303  -12.999 1.00 49.86 ? 165 TRP H N   1 
ATOM 7514 C CA  . TRP H 1 25  ? -1.605  36.261  -12.345 1.00 49.56 ? 165 TRP H CA  1 
ATOM 7515 C C   . TRP H 1 25  ? -1.410  37.681  -12.860 1.00 50.63 ? 165 TRP H C   1 
ATOM 7516 O O   . TRP H 1 25  ? -2.378  38.360  -13.202 1.00 50.26 ? 165 TRP H O   1 
ATOM 7517 C CB  . TRP H 1 25  ? -1.385  36.239  -10.833 1.00 47.77 ? 165 TRP H CB  1 
ATOM 7518 C CG  . TRP H 1 25  ? -2.564  36.757  -10.064 1.00 46.40 ? 165 TRP H CG  1 
ATOM 7519 C CD1 . TRP H 1 25  ? -3.711  36.077  -9.760  1.00 45.00 ? 165 TRP H CD1 1 
ATOM 7520 C CD2 . TRP H 1 25  ? -2.716  38.067  -9.507  1.00 44.96 ? 165 TRP H CD2 1 
ATOM 7521 N NE1 . TRP H 1 25  ? -4.565  36.883  -9.046  1.00 44.07 ? 165 TRP H NE1 1 
ATOM 7522 C CE2 . TRP H 1 25  ? -3.979  38.111  -8.877  1.00 44.09 ? 165 TRP H CE2 1 
ATOM 7523 C CE3 . TRP H 1 25  ? -1.908  39.212  -9.482  1.00 44.28 ? 165 TRP H CE3 1 
ATOM 7524 C CZ2 . TRP H 1 25  ? -4.451  39.253  -8.225  1.00 43.37 ? 165 TRP H CZ2 1 
ATOM 7525 C CZ3 . TRP H 1 25  ? -2.376  40.346  -8.834  1.00 43.28 ? 165 TRP H CZ3 1 
ATOM 7526 C CH2 . TRP H 1 25  ? -3.638  40.358  -8.215  1.00 43.90 ? 165 TRP H CH2 1 
ATOM 7527 N N   . GLU H 1 26  ? -0.159  38.128  -12.913 1.00 52.67 ? 166 GLU H N   1 
ATOM 7528 C CA  . GLU H 1 26  ? 0.142   39.476  -13.379 1.00 53.61 ? 166 GLU H CA  1 
ATOM 7529 C C   . GLU H 1 26  ? -0.459  39.760  -14.753 1.00 53.68 ? 166 GLU H C   1 
ATOM 7530 O O   . GLU H 1 26  ? -1.153  40.765  -14.937 1.00 52.40 ? 166 GLU H O   1 
ATOM 7531 C CB  . GLU H 1 26  ? 1.654   39.708  -13.413 1.00 53.90 ? 166 GLU H CB  1 
ATOM 7532 C CG  . GLU H 1 26  ? 2.043   41.074  -13.963 1.00 56.34 ? 166 GLU H CG  1 
ATOM 7533 C CD  . GLU H 1 26  ? 3.459   41.467  -13.612 1.00 57.44 ? 166 GLU H CD  1 
ATOM 7534 O OE1 . GLU H 1 26  ? 4.383   40.666  -13.869 1.00 59.48 ? 166 GLU H OE1 1 
ATOM 7535 O OE2 . GLU H 1 26  ? 3.645   42.582  -13.080 1.00 57.57 ? 166 GLU H OE2 1 
ATOM 7536 N N   . LYS H 1 27  ? -0.191  38.880  -15.715 1.00 53.17 ? 167 LYS H N   1 
ATOM 7537 C CA  . LYS H 1 27  ? -0.724  39.053  -17.060 1.00 53.63 ? 167 LYS H CA  1 
ATOM 7538 C C   . LYS H 1 27  ? -2.245  39.061  -16.996 1.00 54.18 ? 167 LYS H C   1 
ATOM 7539 O O   . LYS H 1 27  ? -2.889  39.978  -17.503 1.00 54.63 ? 167 LYS H O   1 
ATOM 7540 C CB  . LYS H 1 27  ? -0.252  37.923  -17.969 1.00 54.31 ? 167 LYS H CB  1 
ATOM 7541 C CG  . LYS H 1 27  ? 1.252   37.857  -18.144 1.00 56.18 ? 167 LYS H CG  1 
ATOM 7542 C CD  . LYS H 1 27  ? 1.778   39.058  -18.909 1.00 58.07 ? 167 LYS H CD  1 
ATOM 7543 C CE  . LYS H 1 27  ? 3.285   38.962  -19.101 1.00 58.61 ? 167 LYS H CE  1 
ATOM 7544 N NZ  . LYS H 1 27  ? 3.815   40.066  -19.951 1.00 59.47 ? 167 LYS H NZ  1 
ATOM 7545 N N   . SER H 1 28  ? -2.812  38.037  -16.363 1.00 53.73 ? 168 SER H N   1 
ATOM 7546 C CA  . SER H 1 28  ? -4.259  37.925  -16.217 1.00 51.91 ? 168 SER H CA  1 
ATOM 7547 C C   . SER H 1 28  ? -4.841  39.218  -15.656 1.00 51.39 ? 168 SER H C   1 
ATOM 7548 O O   . SER H 1 28  ? -5.992  39.565  -15.924 1.00 51.64 ? 168 SER H O   1 
ATOM 7549 C CB  . SER H 1 28  ? -4.604  36.764  -15.283 1.00 51.22 ? 168 SER H CB  1 
ATOM 7550 O OG  . SER H 1 28  ? -4.151  35.530  -15.809 1.00 50.26 ? 168 SER H OG  1 
ATOM 7551 N N   . GLN H 1 29  ? -4.031  39.925  -14.876 1.00 51.49 ? 169 GLN H N   1 
ATOM 7552 C CA  . GLN H 1 29  ? -4.438  41.182  -14.260 1.00 50.87 ? 169 GLN H CA  1 
ATOM 7553 C C   . GLN H 1 29  ? -4.451  42.308  -15.287 1.00 51.04 ? 169 GLN H C   1 
ATOM 7554 O O   . GLN H 1 29  ? -5.369  43.127  -15.315 1.00 49.66 ? 169 GLN H O   1 
ATOM 7555 C CB  . GLN H 1 29  ? -3.490  41.518  -13.108 1.00 49.14 ? 169 GLN H CB  1 
ATOM 7556 C CG  . GLN H 1 29  ? -3.719  42.868  -12.474 1.00 47.20 ? 169 GLN H CG  1 
ATOM 7557 C CD  . GLN H 1 29  ? -2.925  43.032  -11.201 1.00 46.52 ? 169 GLN H CD  1 
ATOM 7558 O OE1 . GLN H 1 29  ? -1.714  42.840  -11.188 1.00 47.42 ? 169 GLN H OE1 1 
ATOM 7559 N NE2 . GLN H 1 29  ? -3.605  43.390  -10.120 1.00 46.01 ? 169 GLN H NE2 1 
ATOM 7560 N N   . GLU H 1 30  ? -3.424  42.343  -16.129 1.00 51.51 ? 170 GLU H N   1 
ATOM 7561 C CA  . GLU H 1 30  ? -3.327  43.348  -17.178 1.00 51.77 ? 170 GLU H CA  1 
ATOM 7562 C C   . GLU H 1 30  ? -4.523  43.161  -18.100 1.00 51.15 ? 170 GLU H C   1 
ATOM 7563 O O   . GLU H 1 30  ? -5.245  44.110  -18.405 1.00 52.25 ? 170 GLU H O   1 
ATOM 7564 C CB  . GLU H 1 30  ? -2.042  43.150  -17.981 1.00 53.07 ? 170 GLU H CB  1 
ATOM 7565 C CG  . GLU H 1 30  ? -0.767  43.261  -17.169 1.00 55.18 ? 170 GLU H CG  1 
ATOM 7566 C CD  . GLU H 1 30  ? 0.446   42.750  -17.927 1.00 56.96 ? 170 GLU H CD  1 
ATOM 7567 O OE1 . GLU H 1 30  ? 0.601   43.116  -19.110 1.00 58.31 ? 170 GLU H OE1 1 
ATOM 7568 O OE2 . GLU H 1 30  ? 1.249   41.989  -17.343 1.00 57.16 ? 170 GLU H OE2 1 
ATOM 7569 N N   . LYS H 1 31  ? -4.718  41.919  -18.536 1.00 48.93 ? 171 LYS H N   1 
ATOM 7570 C CA  . LYS H 1 31  ? -5.812  41.558  -19.426 1.00 46.81 ? 171 LYS H CA  1 
ATOM 7571 C C   . LYS H 1 31  ? -7.132  42.176  -18.982 1.00 46.29 ? 171 LYS H C   1 
ATOM 7572 O O   . LYS H 1 31  ? -7.816  42.821  -19.776 1.00 46.30 ? 171 LYS H O   1 
ATOM 7573 C CB  . LYS H 1 31  ? -5.943  40.040  -19.489 1.00 48.18 ? 171 LYS H CB  1 
ATOM 7574 C CG  . LYS H 1 31  ? -4.712  39.331  -20.042 1.00 50.59 ? 171 LYS H CG  1 
ATOM 7575 C CD  . LYS H 1 31  ? -4.467  39.671  -21.507 1.00 53.03 ? 171 LYS H CD  1 
ATOM 7576 C CE  . LYS H 1 31  ? -3.508  38.676  -22.153 1.00 54.18 ? 171 LYS H CE  1 
ATOM 7577 N NZ  . LYS H 1 31  ? -3.318  38.938  -23.608 1.00 57.05 ? 171 LYS H NZ  1 
ATOM 7578 N N   . CYS H 1 32  ? -7.495  41.975  -17.720 1.00 45.23 ? 172 CYS H N   1 
ATOM 7579 C CA  . CYS H 1 32  ? -8.731  42.549  -17.204 1.00 46.61 ? 172 CYS H CA  1 
ATOM 7580 C C   . CYS H 1 32  ? -8.661  44.062  -17.306 1.00 46.72 ? 172 CYS H C   1 
ATOM 7581 O O   . CYS H 1 32  ? -9.574  44.710  -17.815 1.00 47.50 ? 172 CYS H O   1 
ATOM 7582 C CB  . CYS H 1 32  ? -8.943  42.168  -15.740 1.00 45.02 ? 172 CYS H CB  1 
ATOM 7583 S SG  . CYS H 1 32  ? -9.420  40.438  -15.466 1.00 45.07 ? 172 CYS H SG  1 
ATOM 7584 N N   . LEU H 1 33  ? -7.560  44.612  -16.812 1.00 47.12 ? 173 LEU H N   1 
ATOM 7585 C CA  . LEU H 1 33  ? -7.334  46.045  -16.823 1.00 47.11 ? 173 LEU H CA  1 
ATOM 7586 C C   . LEU H 1 33  ? -7.589  46.619  -18.212 1.00 48.00 ? 173 LEU H C   1 
ATOM 7587 O O   . LEU H 1 33  ? -8.404  47.525  -18.373 1.00 47.34 ? 173 LEU H O   1 
ATOM 7588 C CB  . LEU H 1 33  ? -5.896  46.341  -16.402 1.00 46.48 ? 173 LEU H CB  1 
ATOM 7589 C CG  . LEU H 1 33  ? -5.559  47.765  -15.969 1.00 45.98 ? 173 LEU H CG  1 
ATOM 7590 C CD1 . LEU H 1 33  ? -6.091  48.003  -14.561 1.00 43.95 ? 173 LEU H CD1 1 
ATOM 7591 C CD2 . LEU H 1 33  ? -4.052  47.957  -16.005 1.00 45.35 ? 173 LEU H CD2 1 
ATOM 7592 N N   . SER H 1 34  ? -6.898  46.080  -19.214 1.00 48.75 ? 174 SER H N   1 
ATOM 7593 C CA  . SER H 1 34  ? -7.041  46.563  -20.584 1.00 50.24 ? 174 SER H CA  1 
ATOM 7594 C C   . SER H 1 34  ? -8.509  46.704  -20.966 1.00 50.05 ? 174 SER H C   1 
ATOM 7595 O O   . SER H 1 34  ? -8.885  47.614  -21.704 1.00 49.84 ? 174 SER H O   1 
ATOM 7596 C CB  . SER H 1 34  ? -6.339  45.618  -21.571 1.00 51.05 ? 174 SER H CB  1 
ATOM 7597 O OG  . SER H 1 34  ? -7.230  44.649  -22.100 1.00 52.03 ? 174 SER H OG  1 
ATOM 7598 N N   . LEU H 1 35  ? -9.335  45.800  -20.450 1.00 49.72 ? 175 LEU H N   1 
ATOM 7599 C CA  . LEU H 1 35  ? -10.761 45.816  -20.735 1.00 49.44 ? 175 LEU H CA  1 
ATOM 7600 C C   . LEU H 1 35  ? -11.513 46.625  -19.689 1.00 49.42 ? 175 LEU H C   1 
ATOM 7601 O O   . LEU H 1 35  ? -12.637 46.287  -19.315 1.00 48.66 ? 175 LEU H O   1 
ATOM 7602 C CB  . LEU H 1 35  ? -11.298 44.383  -20.787 1.00 49.97 ? 175 LEU H CB  1 
ATOM 7603 C CG  . LEU H 1 35  ? -10.729 43.523  -21.921 1.00 49.66 ? 175 LEU H CG  1 
ATOM 7604 C CD1 . LEU H 1 35  ? -11.214 42.095  -21.780 1.00 48.99 ? 175 LEU H CD1 1 
ATOM 7605 C CD2 . LEU H 1 35  ? -11.149 44.105  -23.264 1.00 49.34 ? 175 LEU H CD2 1 
ATOM 7606 N N   . ASP H 1 36  ? -10.878 47.697  -19.227 1.00 49.98 ? 176 ASP H N   1 
ATOM 7607 C CA  . ASP H 1 36  ? -11.456 48.588  -18.228 1.00 50.62 ? 176 ASP H CA  1 
ATOM 7608 C C   . ASP H 1 36  ? -12.229 47.827  -17.154 1.00 49.86 ? 176 ASP H C   1 
ATOM 7609 O O   . ASP H 1 36  ? -13.394 48.114  -16.883 1.00 49.08 ? 176 ASP H O   1 
ATOM 7610 C CB  . ASP H 1 36  ? -12.361 49.617  -18.913 1.00 52.22 ? 176 ASP H CB  1 
ATOM 7611 C CG  . ASP H 1 36  ? -12.811 50.725  -17.972 1.00 56.15 ? 176 ASP H CG  1 
ATOM 7612 O OD1 . ASP H 1 36  ? -13.166 51.816  -18.471 1.00 57.91 ? 176 ASP H OD1 1 
ATOM 7613 O OD2 . ASP H 1 36  ? -12.819 50.508  -16.738 1.00 56.24 ? 176 ASP H OD2 1 
ATOM 7614 N N   . ALA H 1 37  ? -11.562 46.854  -16.542 1.00 49.77 ? 177 ALA H N   1 
ATOM 7615 C CA  . ALA H 1 37  ? -12.166 46.045  -15.492 1.00 48.73 ? 177 ALA H CA  1 
ATOM 7616 C C   . ALA H 1 37  ? -11.088 45.538  -14.540 1.00 47.62 ? 177 ALA H C   1 
ATOM 7617 O O   . ALA H 1 37  ? -9.913  45.882  -14.676 1.00 47.40 ? 177 ALA H O   1 
ATOM 7618 C CB  . ALA H 1 37  ? -12.917 44.869  -16.105 1.00 50.47 ? 177 ALA H CB  1 
ATOM 7619 N N   . LYS H 1 38  ? -11.497 44.713  -13.581 1.00 45.46 ? 178 LYS H N   1 
ATOM 7620 C CA  . LYS H 1 38  ? -10.576 44.150  -12.601 1.00 42.58 ? 178 LYS H CA  1 
ATOM 7621 C C   . LYS H 1 38  ? -10.789 42.641  -12.489 1.00 42.28 ? 178 LYS H C   1 
ATOM 7622 O O   . LYS H 1 38  ? -11.730 42.097  -13.060 1.00 43.26 ? 178 LYS H O   1 
ATOM 7623 C CB  . LYS H 1 38  ? -10.825 44.793  -11.242 1.00 39.20 ? 178 LYS H CB  1 
ATOM 7624 C CG  . LYS H 1 38  ? -12.231 44.551  -10.727 1.00 37.01 ? 178 LYS H CG  1 
ATOM 7625 C CD  . LYS H 1 38  ? -12.466 45.242  -9.399  1.00 35.27 ? 178 LYS H CD  1 
ATOM 7626 C CE  . LYS H 1 38  ? -13.864 44.967  -8.868  1.00 31.71 ? 178 LYS H CE  1 
ATOM 7627 N NZ  . LYS H 1 38  ? -14.091 45.633  -7.559  1.00 28.90 ? 178 LYS H NZ  1 
ATOM 7628 N N   . LEU H 1 39  ? -9.910  41.966  -11.756 1.00 41.51 ? 179 LEU H N   1 
ATOM 7629 C CA  . LEU H 1 39  ? -10.049 40.531  -11.559 1.00 39.65 ? 179 LEU H CA  1 
ATOM 7630 C C   . LEU H 1 39  ? -11.182 40.255  -10.568 1.00 39.67 ? 179 LEU H C   1 
ATOM 7631 O O   . LEU H 1 39  ? -11.457 41.056  -9.674  1.00 39.64 ? 179 LEU H O   1 
ATOM 7632 C CB  . LEU H 1 39  ? -8.737  39.929  -11.051 1.00 39.53 ? 179 LEU H CB  1 
ATOM 7633 C CG  . LEU H 1 39  ? -7.720  39.517  -12.123 1.00 40.31 ? 179 LEU H CG  1 
ATOM 7634 C CD1 . LEU H 1 39  ? -6.392  39.158  -11.472 1.00 38.24 ? 179 LEU H CD1 1 
ATOM 7635 C CD2 . LEU H 1 39  ? -8.269  38.335  -12.919 1.00 39.84 ? 179 LEU H CD2 1 
ATOM 7636 N N   . LEU H 1 40  ? -11.838 39.115  -10.748 1.00 40.10 ? 180 LEU H N   1 
ATOM 7637 C CA  . LEU H 1 40  ? -12.964 38.701  -9.915  1.00 39.39 ? 180 LEU H CA  1 
ATOM 7638 C C   . LEU H 1 40  ? -12.810 38.976  -8.426  1.00 40.77 ? 180 LEU H C   1 
ATOM 7639 O O   . LEU H 1 40  ? -11.840 38.540  -7.804  1.00 42.24 ? 180 LEU H O   1 
ATOM 7640 C CB  . LEU H 1 40  ? -13.235 37.207  -10.115 1.00 36.56 ? 180 LEU H CB  1 
ATOM 7641 C CG  . LEU H 1 40  ? -14.159 36.540  -9.093  1.00 34.98 ? 180 LEU H CG  1 
ATOM 7642 C CD1 . LEU H 1 40  ? -15.523 37.188  -9.142  1.00 33.94 ? 180 LEU H CD1 1 
ATOM 7643 C CD2 . LEU H 1 40  ? -14.263 35.054  -9.383  1.00 34.60 ? 180 LEU H CD2 1 
ATOM 7644 N N   . LYS H 1 41  ? -13.775 39.699  -7.860  1.00 41.07 ? 181 LYS H N   1 
ATOM 7645 C CA  . LYS H 1 41  ? -13.776 39.995  -6.432  1.00 41.48 ? 181 LYS H CA  1 
ATOM 7646 C C   . LYS H 1 41  ? -15.039 39.461  -5.769  1.00 41.27 ? 181 LYS H C   1 
ATOM 7647 O O   . LYS H 1 41  ? -16.111 40.054  -5.887  1.00 41.30 ? 181 LYS H O   1 
ATOM 7648 C CB  . LYS H 1 41  ? -13.688 41.498  -6.160  1.00 42.62 ? 181 LYS H CB  1 
ATOM 7649 C CG  . LYS H 1 41  ? -13.924 41.810  -4.678  1.00 44.66 ? 181 LYS H CG  1 
ATOM 7650 C CD  . LYS H 1 41  ? -13.691 43.262  -4.292  1.00 45.95 ? 181 LYS H CD  1 
ATOM 7651 C CE  . LYS H 1 41  ? -13.906 43.437  -2.786  1.00 47.00 ? 181 LYS H CE  1 
ATOM 7652 N NZ  . LYS H 1 41  ? -13.622 44.812  -2.283  1.00 47.75 ? 181 LYS H NZ  1 
ATOM 7653 N N   . ILE H 1 42  ? -14.904 38.344  -5.066  1.00 40.99 ? 182 ILE H N   1 
ATOM 7654 C CA  . ILE H 1 42  ? -16.030 37.726  -4.381  1.00 41.60 ? 182 ILE H CA  1 
ATOM 7655 C C   . ILE H 1 42  ? -16.243 38.409  -3.041  1.00 43.29 ? 182 ILE H C   1 
ATOM 7656 O O   . ILE H 1 42  ? -15.449 38.232  -2.117  1.00 44.04 ? 182 ILE H O   1 
ATOM 7657 C CB  . ILE H 1 42  ? -15.772 36.226  -4.159  1.00 41.09 ? 182 ILE H CB  1 
ATOM 7658 C CG1 . ILE H 1 42  ? -15.715 35.516  -5.514  1.00 40.46 ? 182 ILE H CG1 1 
ATOM 7659 C CG2 . ILE H 1 42  ? -16.854 35.633  -3.273  1.00 40.07 ? 182 ILE H CG2 1 
ATOM 7660 C CD1 . ILE H 1 42  ? -15.429 34.035  -5.429  1.00 40.65 ? 182 ILE H CD1 1 
ATOM 7661 N N   . ASN H 1 43  ? -17.320 39.181  -2.935  1.00 45.01 ? 183 ASN H N   1 
ATOM 7662 C CA  . ASN H 1 43  ? -17.606 39.909  -1.704  1.00 46.33 ? 183 ASN H CA  1 
ATOM 7663 C C   . ASN H 1 43  ? -18.689 39.267  -0.844  1.00 45.57 ? 183 ASN H C   1 
ATOM 7664 O O   . ASN H 1 43  ? -18.847 39.619  0.323   1.00 45.28 ? 183 ASN H O   1 
ATOM 7665 C CB  . ASN H 1 43  ? -18.012 41.352  -2.028  1.00 48.75 ? 183 ASN H CB  1 
ATOM 7666 C CG  . ASN H 1 43  ? -17.913 42.274  -0.820  1.00 51.96 ? 183 ASN H CG  1 
ATOM 7667 O OD1 . ASN H 1 43  ? -18.491 43.363  -0.802  1.00 52.95 ? 183 ASN H OD1 1 
ATOM 7668 N ND2 . ASN H 1 43  ? -17.166 41.843  0.191   1.00 52.93 ? 183 ASN H ND2 1 
ATOM 7669 N N   . SER H 1 44  ? -19.431 38.323  -1.409  1.00 45.46 ? 184 SER H N   1 
ATOM 7670 C CA  . SER H 1 44  ? -20.491 37.682  -0.646  1.00 45.71 ? 184 SER H CA  1 
ATOM 7671 C C   . SER H 1 44  ? -20.721 36.219  -0.987  1.00 46.04 ? 184 SER H C   1 
ATOM 7672 O O   . SER H 1 44  ? -20.153 35.683  -1.937  1.00 45.55 ? 184 SER H O   1 
ATOM 7673 C CB  . SER H 1 44  ? -21.805 38.436  -0.840  1.00 45.89 ? 184 SER H CB  1 
ATOM 7674 O OG  . SER H 1 44  ? -22.285 38.279  -2.163  1.00 45.98 ? 184 SER H OG  1 
ATOM 7675 N N   . THR H 1 45  ? -21.570 35.584  -0.187  1.00 46.54 ? 185 THR H N   1 
ATOM 7676 C CA  . THR H 1 45  ? -21.924 34.189  -0.381  1.00 46.61 ? 185 THR H CA  1 
ATOM 7677 C C   . THR H 1 45  ? -22.708 34.085  -1.684  1.00 46.60 ? 185 THR H C   1 
ATOM 7678 O O   . THR H 1 45  ? -22.686 33.056  -2.357  1.00 47.15 ? 185 THR H O   1 
ATOM 7679 C CB  . THR H 1 45  ? -22.803 33.682  0.778   1.00 46.92 ? 185 THR H CB  1 
ATOM 7680 O OG1 . THR H 1 45  ? -23.952 34.530  0.918   1.00 46.73 ? 185 THR H OG1 1 
ATOM 7681 C CG2 . THR H 1 45  ? -22.015 33.683  2.077   1.00 44.67 ? 185 THR H CG2 1 
ATOM 7682 N N   . ALA H 1 46  ? -23.392 35.171  -2.031  1.00 46.18 ? 186 ALA H N   1 
ATOM 7683 C CA  . ALA H 1 46  ? -24.195 35.234  -3.246  1.00 46.13 ? 186 ALA H CA  1 
ATOM 7684 C C   . ALA H 1 46  ? -23.326 35.234  -4.502  1.00 45.58 ? 186 ALA H C   1 
ATOM 7685 O O   . ALA H 1 46  ? -23.691 34.638  -5.515  1.00 46.47 ? 186 ALA H O   1 
ATOM 7686 C CB  . ALA H 1 46  ? -25.079 36.477  -3.217  1.00 46.40 ? 186 ALA H CB  1 
ATOM 7687 N N   . ASP H 1 47  ? -22.183 35.909  -4.438  1.00 44.66 ? 187 ASP H N   1 
ATOM 7688 C CA  . ASP H 1 47  ? -21.268 35.961  -5.575  1.00 43.84 ? 187 ASP H CA  1 
ATOM 7689 C C   . ASP H 1 47  ? -20.610 34.597  -5.709  1.00 42.84 ? 187 ASP H C   1 
ATOM 7690 O O   . ASP H 1 47  ? -20.476 34.053  -6.806  1.00 43.02 ? 187 ASP H O   1 
ATOM 7691 C CB  . ASP H 1 47  ? -20.181 37.012  -5.347  1.00 45.79 ? 187 ASP H CB  1 
ATOM 7692 C CG  . ASP H 1 47  ? -20.744 38.387  -5.060  1.00 48.08 ? 187 ASP H CG  1 
ATOM 7693 O OD1 . ASP H 1 47  ? -21.480 38.925  -5.911  1.00 50.37 ? 187 ASP H OD1 1 
ATOM 7694 O OD2 . ASP H 1 47  ? -20.443 38.932  -3.980  1.00 49.95 ? 187 ASP H OD2 1 
ATOM 7695 N N   . LEU H 1 48  ? -20.194 34.054  -4.571  1.00 41.99 ? 188 LEU H N   1 
ATOM 7696 C CA  . LEU H 1 48  ? -19.546 32.755  -4.534  1.00 40.91 ? 188 LEU H CA  1 
ATOM 7697 C C   . LEU H 1 48  ? -20.447 31.710  -5.172  1.00 41.44 ? 188 LEU H C   1 
ATOM 7698 O O   . LEU H 1 48  ? -19.967 30.768  -5.795  1.00 41.22 ? 188 LEU H O   1 
ATOM 7699 C CB  . LEU H 1 48  ? -19.232 32.372  -3.089  1.00 38.50 ? 188 LEU H CB  1 
ATOM 7700 C CG  . LEU H 1 48  ? -18.470 31.069  -2.851  1.00 36.22 ? 188 LEU H CG  1 
ATOM 7701 C CD1 . LEU H 1 48  ? -17.172 31.078  -3.639  1.00 32.81 ? 188 LEU H CD1 1 
ATOM 7702 C CD2 . LEU H 1 48  ? -18.203 30.909  -1.360  1.00 34.74 ? 188 LEU H CD2 1 
ATOM 7703 N N   . ASP H 1 49  ? -21.757 31.878  -5.019  1.00 42.67 ? 189 ASP H N   1 
ATOM 7704 C CA  . ASP H 1 49  ? -22.702 30.937  -5.604  1.00 43.37 ? 189 ASP H CA  1 
ATOM 7705 C C   . ASP H 1 49  ? -22.762 31.163  -7.107  1.00 43.13 ? 189 ASP H C   1 
ATOM 7706 O O   . ASP H 1 49  ? -22.550 30.240  -7.888  1.00 44.33 ? 189 ASP H O   1 
ATOM 7707 C CB  . ASP H 1 49  ? -24.095 31.107  -4.991  1.00 43.46 ? 189 ASP H CB  1 
ATOM 7708 C CG  . ASP H 1 49  ? -24.127 30.771  -3.509  1.00 44.91 ? 189 ASP H CG  1 
ATOM 7709 O OD1 . ASP H 1 49  ? -23.373 29.869  -3.082  1.00 45.25 ? 189 ASP H OD1 1 
ATOM 7710 O OD2 . ASP H 1 49  ? -24.916 31.400  -2.771  1.00 46.29 ? 189 ASP H OD2 1 
ATOM 7711 N N   . PHE H 1 50  ? -23.042 32.397  -7.507  1.00 42.33 ? 190 PHE H N   1 
ATOM 7712 C CA  . PHE H 1 50  ? -23.115 32.741  -8.921  1.00 43.21 ? 190 PHE H CA  1 
ATOM 7713 C C   . PHE H 1 50  ? -21.903 32.228  -9.709  1.00 44.93 ? 190 PHE H C   1 
ATOM 7714 O O   . PHE H 1 50  ? -22.057 31.529  -10.714 1.00 45.03 ? 190 PHE H O   1 
ATOM 7715 C CB  . PHE H 1 50  ? -23.220 34.258  -9.085  1.00 40.63 ? 190 PHE H CB  1 
ATOM 7716 C CG  . PHE H 1 50  ? -22.797 34.746  -10.437 1.00 39.74 ? 190 PHE H CG  1 
ATOM 7717 C CD1 . PHE H 1 50  ? -23.602 34.542  -11.550 1.00 37.98 ? 190 PHE H CD1 1 
ATOM 7718 C CD2 . PHE H 1 50  ? -21.567 35.374  -10.603 1.00 38.89 ? 190 PHE H CD2 1 
ATOM 7719 C CE1 . PHE H 1 50  ? -23.188 34.957  -12.811 1.00 37.82 ? 190 PHE H CE1 1 
ATOM 7720 C CE2 . PHE H 1 50  ? -21.144 35.791  -11.860 1.00 38.93 ? 190 PHE H CE2 1 
ATOM 7721 C CZ  . PHE H 1 50  ? -21.958 35.582  -12.966 1.00 37.61 ? 190 PHE H CZ  1 
ATOM 7722 N N   . ILE H 1 51  ? -20.704 32.588  -9.256  1.00 45.87 ? 191 ILE H N   1 
ATOM 7723 C CA  . ILE H 1 51  ? -19.471 32.171  -9.925  1.00 46.08 ? 191 ILE H CA  1 
ATOM 7724 C C   . ILE H 1 51  ? -19.335 30.646  -9.976  1.00 46.83 ? 191 ILE H C   1 
ATOM 7725 O O   . ILE H 1 51  ? -19.009 30.078  -11.023 1.00 45.20 ? 191 ILE H O   1 
ATOM 7726 C CB  . ILE H 1 51  ? -18.219 32.768  -9.217  1.00 44.57 ? 191 ILE H CB  1 
ATOM 7727 C CG1 . ILE H 1 51  ? -18.072 34.254  -9.558  1.00 42.16 ? 191 ILE H CG1 1 
ATOM 7728 C CG2 . ILE H 1 51  ? -16.965 32.005  -9.631  1.00 43.72 ? 191 ILE H CG2 1 
ATOM 7729 C CD1 . ILE H 1 51  ? -17.559 34.514  -10.953 1.00 42.59 ? 191 ILE H CD1 1 
ATOM 7730 N N   . GLN H 1 52  ? -19.580 29.990  -8.844  1.00 47.63 ? 192 GLN H N   1 
ATOM 7731 C CA  . GLN H 1 52  ? -19.477 28.540  -8.766  1.00 48.36 ? 192 GLN H CA  1 
ATOM 7732 C C   . GLN H 1 52  ? -20.368 27.922  -9.834  1.00 48.74 ? 192 GLN H C   1 
ATOM 7733 O O   . GLN H 1 52  ? -19.971 26.988  -10.526 1.00 47.86 ? 192 GLN H O   1 
ATOM 7734 C CB  . GLN H 1 52  ? -19.875 28.070  -7.361  1.00 49.69 ? 192 GLN H CB  1 
ATOM 7735 C CG  . GLN H 1 52  ? -21.140 27.225  -7.262  1.00 53.02 ? 192 GLN H CG  1 
ATOM 7736 C CD  . GLN H 1 52  ? -20.931 25.795  -7.724  1.00 53.47 ? 192 GLN H CD  1 
ATOM 7737 O OE1 . GLN H 1 52  ? -19.958 25.146  -7.342  1.00 53.52 ? 192 GLN H OE1 1 
ATOM 7738 N NE2 . GLN H 1 52  ? -21.852 25.293  -8.538  1.00 54.53 ? 192 GLN H NE2 1 
ATOM 7739 N N   . GLN H 1 53  ? -21.570 28.462  -9.976  1.00 50.61 ? 193 GLN H N   1 
ATOM 7740 C CA  . GLN H 1 53  ? -22.507 27.973  -10.973 1.00 53.32 ? 193 GLN H CA  1 
ATOM 7741 C C   . GLN H 1 53  ? -21.899 28.165  -12.357 1.00 53.96 ? 193 GLN H C   1 
ATOM 7742 O O   . GLN H 1 53  ? -21.713 27.205  -13.103 1.00 55.40 ? 193 GLN H O   1 
ATOM 7743 C CB  . GLN H 1 53  ? -23.833 28.733  -10.851 1.00 55.03 ? 193 GLN H CB  1 
ATOM 7744 C CG  . GLN H 1 53  ? -24.760 28.647  -12.057 1.00 60.57 ? 193 GLN H CG  1 
ATOM 7745 C CD  . GLN H 1 53  ? -24.569 29.804  -13.033 1.00 65.16 ? 193 GLN H CD  1 
ATOM 7746 O OE1 . GLN H 1 53  ? -24.493 30.967  -12.625 1.00 66.91 ? 193 GLN H OE1 1 
ATOM 7747 N NE2 . GLN H 1 53  ? -24.508 29.493  -14.327 1.00 65.36 ? 193 GLN H NE2 1 
ATOM 7748 N N   . ALA H 1 54  ? -21.567 29.412  -12.673 1.00 53.82 ? 194 ALA H N   1 
ATOM 7749 C CA  . ALA H 1 54  ? -20.988 29.776  -13.960 1.00 53.69 ? 194 ALA H CA  1 
ATOM 7750 C C   . ALA H 1 54  ? -19.833 28.889  -14.424 1.00 54.09 ? 194 ALA H C   1 
ATOM 7751 O O   . ALA H 1 54  ? -19.560 28.807  -15.621 1.00 54.68 ? 194 ALA H O   1 
ATOM 7752 C CB  . ALA H 1 54  ? -20.535 31.231  -13.919 1.00 53.38 ? 194 ALA H CB  1 
ATOM 7753 N N   . ILE H 1 55  ? -19.156 28.224  -13.494 1.00 54.11 ? 195 ILE H N   1 
ATOM 7754 C CA  . ILE H 1 55  ? -18.032 27.371  -13.865 1.00 54.34 ? 195 ILE H CA  1 
ATOM 7755 C C   . ILE H 1 55  ? -18.219 25.906  -13.492 1.00 54.79 ? 195 ILE H C   1 
ATOM 7756 O O   . ILE H 1 55  ? -17.272 25.122  -13.544 1.00 54.90 ? 195 ILE H O   1 
ATOM 7757 C CB  . ILE H 1 55  ? -16.727 27.863  -13.218 1.00 53.81 ? 195 ILE H CB  1 
ATOM 7758 C CG1 . ILE H 1 55  ? -16.827 27.768  -11.694 1.00 54.83 ? 195 ILE H CG1 1 
ATOM 7759 C CG2 . ILE H 1 55  ? -16.465 29.294  -13.616 1.00 54.25 ? 195 ILE H CG2 1 
ATOM 7760 C CD1 . ILE H 1 55  ? -15.562 28.191  -10.965 1.00 52.97 ? 195 ILE H CD1 1 
ATOM 7761 N N   . SER H 1 56  ? -19.437 25.536  -13.119 1.00 54.69 ? 196 SER H N   1 
ATOM 7762 C CA  . SER H 1 56  ? -19.724 24.160  -12.738 1.00 55.53 ? 196 SER H CA  1 
ATOM 7763 C C   . SER H 1 56  ? -19.162 23.146  -13.735 1.00 55.83 ? 196 SER H C   1 
ATOM 7764 O O   . SER H 1 56  ? -18.569 22.140  -13.344 1.00 55.69 ? 196 SER H O   1 
ATOM 7765 C CB  . SER H 1 56  ? -21.236 23.967  -12.594 1.00 55.17 ? 196 SER H CB  1 
ATOM 7766 O OG  . SER H 1 56  ? -21.923 24.452  -13.733 1.00 55.62 ? 196 SER H OG  1 
ATOM 7767 N N   . TYR H 1 57  ? -19.347 23.417  -15.023 1.00 56.76 ? 197 TYR H N   1 
ATOM 7768 C CA  . TYR H 1 57  ? -18.867 22.523  -16.071 1.00 56.62 ? 197 TYR H CA  1 
ATOM 7769 C C   . TYR H 1 57  ? -17.458 22.870  -16.516 1.00 56.53 ? 197 TYR H C   1 
ATOM 7770 O O   . TYR H 1 57  ? -17.181 22.986  -17.707 1.00 57.54 ? 197 TYR H O   1 
ATOM 7771 C CB  . TYR H 1 57  ? -19.822 22.564  -17.266 1.00 57.13 ? 197 TYR H CB  1 
ATOM 7772 C CG  . TYR H 1 57  ? -20.372 23.942  -17.530 1.00 58.57 ? 197 TYR H CG  1 
ATOM 7773 C CD1 . TYR H 1 57  ? -19.533 24.979  -17.932 1.00 59.83 ? 197 TYR H CD1 1 
ATOM 7774 C CD2 . TYR H 1 57  ? -21.724 24.223  -17.333 1.00 58.79 ? 197 TYR H CD2 1 
ATOM 7775 C CE1 . TYR H 1 57  ? -20.023 26.263  -18.128 1.00 62.66 ? 197 TYR H CE1 1 
ATOM 7776 C CE2 . TYR H 1 57  ? -22.228 25.504  -17.524 1.00 60.86 ? 197 TYR H CE2 1 
ATOM 7777 C CZ  . TYR H 1 57  ? -21.372 26.523  -17.921 1.00 63.27 ? 197 TYR H CZ  1 
ATOM 7778 O OH  . TYR H 1 57  ? -21.858 27.801  -18.105 1.00 63.66 ? 197 TYR H OH  1 
ATOM 7779 N N   . SER H 1 58  ? -16.569 23.035  -15.544 1.00 56.50 ? 198 SER H N   1 
ATOM 7780 C CA  . SER H 1 58  ? -15.176 23.353  -15.825 1.00 56.36 ? 198 SER H CA  1 
ATOM 7781 C C   . SER H 1 58  ? -14.275 23.003  -14.651 1.00 55.98 ? 198 SER H C   1 
ATOM 7782 O O   . SER H 1 58  ? -14.420 23.546  -13.556 1.00 55.73 ? 198 SER H O   1 
ATOM 7783 C CB  . SER H 1 58  ? -15.014 24.836  -16.154 1.00 56.66 ? 198 SER H CB  1 
ATOM 7784 O OG  . SER H 1 58  ? -13.643 25.163  -16.308 1.00 56.28 ? 198 SER H OG  1 
ATOM 7785 N N   . SER H 1 59  ? -13.344 22.087  -14.885 1.00 56.04 ? 199 SER H N   1 
ATOM 7786 C CA  . SER H 1 59  ? -12.411 21.675  -13.849 1.00 56.63 ? 199 SER H CA  1 
ATOM 7787 C C   . SER H 1 59  ? -11.195 22.594  -13.893 1.00 56.19 ? 199 SER H C   1 
ATOM 7788 O O   . SER H 1 59  ? -10.304 22.509  -13.051 1.00 56.22 ? 199 SER H O   1 
ATOM 7789 C CB  . SER H 1 59  ? -11.991 20.222  -14.070 1.00 57.16 ? 199 SER H CB  1 
ATOM 7790 O OG  . SER H 1 59  ? -11.505 20.033  -15.387 1.00 58.96 ? 199 SER H OG  1 
ATOM 7791 N N   . PHE H 1 60  ? -11.175 23.478  -14.887 1.00 55.36 ? 200 PHE H N   1 
ATOM 7792 C CA  . PHE H 1 60  ? -10.085 24.431  -15.055 1.00 54.95 ? 200 PHE H CA  1 
ATOM 7793 C C   . PHE H 1 60  ? -10.084 25.461  -13.925 1.00 52.74 ? 200 PHE H C   1 
ATOM 7794 O O   . PHE H 1 60  ? -11.140 25.905  -13.477 1.00 53.49 ? 200 PHE H O   1 
ATOM 7795 C CB  . PHE H 1 60  ? -10.226 25.160  -16.396 1.00 56.66 ? 200 PHE H CB  1 
ATOM 7796 C CG  . PHE H 1 60  ? -9.967  24.291  -17.599 1.00 58.80 ? 200 PHE H CG  1 
ATOM 7797 C CD1 . PHE H 1 60  ? -10.360 24.714  -18.863 1.00 58.44 ? 200 PHE H CD1 1 
ATOM 7798 C CD2 . PHE H 1 60  ? -9.299  23.070  -17.479 1.00 60.00 ? 200 PHE H CD2 1 
ATOM 7799 C CE1 . PHE H 1 60  ? -10.112 23.928  -19.992 1.00 60.26 ? 200 PHE H CE1 1 
ATOM 7800 C CE2 . PHE H 1 60  ? -9.044  22.274  -18.603 1.00 60.27 ? 200 PHE H CE2 1 
ATOM 7801 C CZ  . PHE H 1 60  ? -9.444  22.710  -19.862 1.00 60.19 ? 200 PHE H CZ  1 
ATOM 7802 N N   . PRO H 1 61  ? -8.895  25.851  -13.447 1.00 49.63 ? 201 PRO H N   1 
ATOM 7803 C CA  . PRO H 1 61  ? -8.807  26.837  -12.369 1.00 47.49 ? 201 PRO H CA  1 
ATOM 7804 C C   . PRO H 1 61  ? -8.849  28.263  -12.918 1.00 46.12 ? 201 PRO H C   1 
ATOM 7805 O O   . PRO H 1 61  ? -8.268  28.541  -13.968 1.00 46.80 ? 201 PRO H O   1 
ATOM 7806 C CB  . PRO H 1 61  ? -7.471  26.505  -11.724 1.00 47.51 ? 201 PRO H CB  1 
ATOM 7807 C CG  . PRO H 1 61  ? -6.642  26.122  -12.901 1.00 47.96 ? 201 PRO H CG  1 
ATOM 7808 C CD  . PRO H 1 61  ? -7.577  25.243  -13.709 1.00 48.74 ? 201 PRO H CD  1 
ATOM 7809 N N   . PHE H 1 62  ? -9.544  29.157  -12.216 1.00 44.32 ? 202 PHE H N   1 
ATOM 7810 C CA  . PHE H 1 62  ? -9.647  30.556  -12.634 1.00 41.26 ? 202 PHE H CA  1 
ATOM 7811 C C   . PHE H 1 62  ? -9.103  31.507  -11.569 1.00 40.53 ? 202 PHE H C   1 
ATOM 7812 O O   . PHE H 1 62  ? -9.541  31.472  -10.418 1.00 41.59 ? 202 PHE H O   1 
ATOM 7813 C CB  . PHE H 1 62  ? -11.102 30.942  -12.919 1.00 38.27 ? 202 PHE H CB  1 
ATOM 7814 C CG  . PHE H 1 62  ? -11.732 30.183  -14.051 1.00 35.54 ? 202 PHE H CG  1 
ATOM 7815 C CD1 . PHE H 1 62  ? -12.078 28.844  -13.907 1.00 34.85 ? 202 PHE H CD1 1 
ATOM 7816 C CD2 . PHE H 1 62  ? -12.021 30.823  -15.250 1.00 33.69 ? 202 PHE H CD2 1 
ATOM 7817 C CE1 . PHE H 1 62  ? -12.709 28.156  -14.941 1.00 34.88 ? 202 PHE H CE1 1 
ATOM 7818 C CE2 . PHE H 1 62  ? -12.648 30.146  -16.288 1.00 32.40 ? 202 PHE H CE2 1 
ATOM 7819 C CZ  . PHE H 1 62  ? -12.995 28.810  -16.134 1.00 34.28 ? 202 PHE H CZ  1 
ATOM 7820 N N   . TRP H 1 63  ? -8.153  32.357  -11.953 1.00 39.19 ? 203 TRP H N   1 
ATOM 7821 C CA  . TRP H 1 63  ? -7.579  33.325  -11.024 1.00 38.68 ? 203 TRP H CA  1 
ATOM 7822 C C   . TRP H 1 63  ? -8.643  34.339  -10.620 1.00 39.15 ? 203 TRP H C   1 
ATOM 7823 O O   . TRP H 1 63  ? -9.624  34.553  -11.338 1.00 37.80 ? 203 TRP H O   1 
ATOM 7824 C CB  . TRP H 1 63  ? -6.448  34.121  -11.675 1.00 39.40 ? 203 TRP H CB  1 
ATOM 7825 C CG  . TRP H 1 63  ? -5.141  33.429  -11.896 1.00 40.75 ? 203 TRP H CG  1 
ATOM 7826 C CD1 . TRP H 1 63  ? -4.441  33.380  -13.068 1.00 40.34 ? 203 TRP H CD1 1 
ATOM 7827 C CD2 . TRP H 1 63  ? -4.306  32.812  -10.907 1.00 41.18 ? 203 TRP H CD2 1 
ATOM 7828 N NE1 . TRP H 1 63  ? -3.223  32.784  -12.871 1.00 41.87 ? 203 TRP H NE1 1 
ATOM 7829 C CE2 . TRP H 1 63  ? -3.110  32.426  -11.553 1.00 41.18 ? 203 TRP H CE2 1 
ATOM 7830 C CE3 . TRP H 1 63  ? -4.445  32.555  -9.538  1.00 40.55 ? 203 TRP H CE3 1 
ATOM 7831 C CZ2 . TRP H 1 63  ? -2.063  31.792  -10.880 1.00 40.34 ? 203 TRP H CZ2 1 
ATOM 7832 C CZ3 . TRP H 1 63  ? -3.402  31.924  -8.869  1.00 40.96 ? 203 TRP H CZ3 1 
ATOM 7833 C CH2 . TRP H 1 63  ? -2.225  31.553  -9.542  1.00 40.33 ? 203 TRP H CH2 1 
ATOM 7834 N N   . MET H 1 64  ? -8.431  34.961  -9.464  1.00 39.06 ? 204 MET H N   1 
ATOM 7835 C CA  . MET H 1 64  ? -9.304  36.013  -8.962  1.00 38.83 ? 204 MET H CA  1 
ATOM 7836 C C   . MET H 1 64  ? -8.396  37.126  -8.449  1.00 38.18 ? 204 MET H C   1 
ATOM 7837 O O   . MET H 1 64  ? -7.175  36.986  -8.472  1.00 37.76 ? 204 MET H O   1 
ATOM 7838 C CB  . MET H 1 64  ? -10.234 35.506  -7.854  1.00 39.12 ? 204 MET H CB  1 
ATOM 7839 C CG  . MET H 1 64  ? -9.632  34.540  -6.865  1.00 40.93 ? 204 MET H CG  1 
ATOM 7840 S SD  . MET H 1 64  ? -10.839 34.163  -5.573  1.00 41.94 ? 204 MET H SD  1 
ATOM 7841 C CE  . MET H 1 64  ? -12.206 33.559  -6.540  1.00 41.00 ? 204 MET H CE  1 
ATOM 7842 N N   . GLY H 1 65  ? -8.978  38.227  -7.993  1.00 38.22 ? 205 GLY H N   1 
ATOM 7843 C CA  . GLY H 1 65  ? -8.167  39.340  -7.526  1.00 37.45 ? 205 GLY H CA  1 
ATOM 7844 C C   . GLY H 1 65  ? -7.667  39.318  -6.094  1.00 36.93 ? 205 GLY H C   1 
ATOM 7845 O O   . GLY H 1 65  ? -7.384  40.373  -5.531  1.00 38.14 ? 205 GLY H O   1 
ATOM 7846 N N   . LEU H 1 66  ? -7.547  38.137  -5.499  1.00 36.00 ? 206 LEU H N   1 
ATOM 7847 C CA  . LEU H 1 66  ? -7.069  38.035  -4.122  1.00 35.28 ? 206 LEU H CA  1 
ATOM 7848 C C   . LEU H 1 66  ? -5.643  37.496  -4.091  1.00 35.68 ? 206 LEU H C   1 
ATOM 7849 O O   . LEU H 1 66  ? -5.345  36.483  -4.724  1.00 36.00 ? 206 LEU H O   1 
ATOM 7850 C CB  . LEU H 1 66  ? -7.975  37.104  -3.316  1.00 34.17 ? 206 LEU H CB  1 
ATOM 7851 C CG  . LEU H 1 66  ? -7.769  37.128  -1.803  1.00 32.34 ? 206 LEU H CG  1 
ATOM 7852 C CD1 . LEU H 1 66  ? -8.612  38.241  -1.201  1.00 32.79 ? 206 LEU H CD1 1 
ATOM 7853 C CD2 . LEU H 1 66  ? -8.170  35.795  -1.212  1.00 30.90 ? 206 LEU H CD2 1 
ATOM 7854 N N   . SER H 1 67  ? -4.762  38.167  -3.355  1.00 35.94 ? 207 SER H N   1 
ATOM 7855 C CA  . SER H 1 67  ? -3.375  37.720  -3.269  1.00 36.57 ? 207 SER H CA  1 
ATOM 7856 C C   . SER H 1 67  ? -2.626  38.291  -2.069  1.00 37.15 ? 207 SER H C   1 
ATOM 7857 O O   . SER H 1 67  ? -3.193  39.015  -1.251  1.00 37.66 ? 207 SER H O   1 
ATOM 7858 C CB  . SER H 1 67  ? -2.626  38.097  -4.545  1.00 35.76 ? 207 SER H CB  1 
ATOM 7859 O OG  . SER H 1 67  ? -2.556  39.504  -4.679  1.00 37.30 ? 207 SER H OG  1 
ATOM 7860 N N   . ARG H 1 68  ? -1.347  37.939  -1.972  1.00 37.43 ? 208 ARG H N   1 
ATOM 7861 C CA  . ARG H 1 68  ? -0.475  38.414  -0.901  1.00 38.24 ? 208 ARG H CA  1 
ATOM 7862 C C   . ARG H 1 68  ? 0.952   37.966  -1.202  1.00 38.49 ? 208 ARG H C   1 
ATOM 7863 O O   . ARG H 1 68  ? 1.158   36.874  -1.740  1.00 37.32 ? 208 ARG H O   1 
ATOM 7864 C CB  . ARG H 1 68  ? -0.911  37.857  0.458   1.00 39.56 ? 208 ARG H CB  1 
ATOM 7865 C CG  . ARG H 1 68  ? -0.621  36.376  0.670   1.00 42.05 ? 208 ARG H CG  1 
ATOM 7866 C CD  . ARG H 1 68  ? -0.916  35.974  2.112   1.00 43.86 ? 208 ARG H CD  1 
ATOM 7867 N NE  . ARG H 1 68  ? -0.879  34.529  2.318   1.00 45.02 ? 208 ARG H NE  1 
ATOM 7868 C CZ  . ARG H 1 68  ? -1.329  33.920  3.412   1.00 45.03 ? 208 ARG H CZ  1 
ATOM 7869 N NH1 . ARG H 1 68  ? -1.849  34.627  4.408   1.00 42.08 ? 208 ARG H NH1 1 
ATOM 7870 N NH2 . ARG H 1 68  ? -1.279  32.598  3.501   1.00 47.14 ? 208 ARG H NH2 1 
ATOM 7871 N N   . ARG H 1 69  ? 1.927   38.809  -0.855  1.00 38.34 ? 209 ARG H N   1 
ATOM 7872 C CA  . ARG H 1 69  ? 3.336   38.502  -1.099  1.00 37.80 ? 209 ARG H CA  1 
ATOM 7873 C C   . ARG H 1 69  ? 3.796   37.248  -0.376  1.00 37.35 ? 209 ARG H C   1 
ATOM 7874 O O   . ARG H 1 69  ? 4.415   36.369  -0.977  1.00 38.72 ? 209 ARG H O   1 
ATOM 7875 C CB  . ARG H 1 69  ? 4.216   39.677  -0.683  1.00 37.87 ? 209 ARG H CB  1 
ATOM 7876 C CG  . ARG H 1 69  ? 4.075   40.894  -1.575  1.00 39.13 ? 209 ARG H CG  1 
ATOM 7877 C CD  . ARG H 1 69  ? 4.980   42.000  -1.089  1.00 39.81 ? 209 ARG H CD  1 
ATOM 7878 N NE  . ARG H 1 69  ? 6.368   41.560  -1.020  1.00 38.08 ? 209 ARG H NE  1 
ATOM 7879 C CZ  . ARG H 1 69  ? 7.140   41.363  -2.079  1.00 37.89 ? 209 ARG H CZ  1 
ATOM 7880 N NH1 . ARG H 1 69  ? 6.660   41.570  -3.296  1.00 38.19 ? 209 ARG H NH1 1 
ATOM 7881 N NH2 . ARG H 1 69  ? 8.393   40.964  -1.921  1.00 37.58 ? 209 ARG H NH2 1 
ATOM 7882 N N   . ASN H 1 70  ? 3.494   37.167  0.914   1.00 36.74 ? 210 ASN H N   1 
ATOM 7883 C CA  . ASN H 1 70  ? 3.871   36.012  1.712   1.00 36.25 ? 210 ASN H CA  1 
ATOM 7884 C C   . ASN H 1 70  ? 2.922   35.873  2.901   1.00 35.89 ? 210 ASN H C   1 
ATOM 7885 O O   . ASN H 1 70  ? 2.111   36.763  3.171   1.00 33.24 ? 210 ASN H O   1 
ATOM 7886 C CB  . ASN H 1 70  ? 5.318   36.155  2.190   1.00 37.48 ? 210 ASN H CB  1 
ATOM 7887 C CG  . ASN H 1 70  ? 5.487   37.255  3.212   1.00 39.25 ? 210 ASN H CG  1 
ATOM 7888 O OD1 . ASN H 1 70  ? 5.145   37.083  4.378   1.00 40.91 ? 210 ASN H OD1 1 
ATOM 7889 N ND2 . ASN H 1 70  ? 6.007   38.397  2.778   1.00 38.75 ? 210 ASN H ND2 1 
ATOM 7890 N N   . PRO H 1 71  ? 3.010   34.746  3.623   1.00 36.01 ? 211 PRO H N   1 
ATOM 7891 C CA  . PRO H 1 71  ? 2.174   34.451  4.789   1.00 35.74 ? 211 PRO H CA  1 
ATOM 7892 C C   . PRO H 1 71  ? 2.057   35.529  5.862   1.00 36.48 ? 211 PRO H C   1 
ATOM 7893 O O   . PRO H 1 71  ? 1.106   35.523  6.640   1.00 35.28 ? 211 PRO H O   1 
ATOM 7894 C CB  . PRO H 1 71  ? 2.791   33.169  5.321   1.00 35.10 ? 211 PRO H CB  1 
ATOM 7895 C CG  . PRO H 1 71  ? 3.180   32.470  4.067   1.00 35.28 ? 211 PRO H CG  1 
ATOM 7896 C CD  . PRO H 1 71  ? 3.850   33.581  3.289   1.00 36.42 ? 211 PRO H CD  1 
ATOM 7897 N N   . SER H 1 72  ? 3.013   36.449  5.918   1.00 37.92 ? 212 SER H N   1 
ATOM 7898 C CA  . SER H 1 72  ? 2.950   37.502  6.924   1.00 38.41 ? 212 SER H CA  1 
ATOM 7899 C C   . SER H 1 72  ? 2.025   38.639  6.491   1.00 39.35 ? 212 SER H C   1 
ATOM 7900 O O   . SER H 1 72  ? 1.812   39.590  7.237   1.00 37.69 ? 212 SER H O   1 
ATOM 7901 C CB  . SER H 1 72  ? 4.349   38.047  7.223   1.00 38.27 ? 212 SER H CB  1 
ATOM 7902 O OG  . SER H 1 72  ? 4.924   38.654  6.082   1.00 38.66 ? 212 SER H OG  1 
ATOM 7903 N N   . TYR H 1 73  ? 1.478   38.536  5.282   1.00 41.48 ? 213 TYR H N   1 
ATOM 7904 C CA  . TYR H 1 73  ? 0.563   39.553  4.766   1.00 42.42 ? 213 TYR H CA  1 
ATOM 7905 C C   . TYR H 1 73  ? -0.862  39.019  4.711   1.00 43.12 ? 213 TYR H C   1 
ATOM 7906 O O   . TYR H 1 73  ? -1.097  37.897  4.257   1.00 43.76 ? 213 TYR H O   1 
ATOM 7907 C CB  . TYR H 1 73  ? 0.943   39.975  3.350   1.00 42.34 ? 213 TYR H CB  1 
ATOM 7908 C CG  . TYR H 1 73  ? 2.180   40.819  3.223   1.00 43.62 ? 213 TYR H CG  1 
ATOM 7909 C CD1 . TYR H 1 73  ? 3.399   40.250  2.866   1.00 44.73 ? 213 TYR H CD1 1 
ATOM 7910 C CD2 . TYR H 1 73  ? 2.118   42.204  3.382   1.00 43.67 ? 213 TYR H CD2 1 
ATOM 7911 C CE1 . TYR H 1 73  ? 4.525   41.041  2.659   1.00 47.01 ? 213 TYR H CE1 1 
ATOM 7912 C CE2 . TYR H 1 73  ? 3.236   43.003  3.180   1.00 44.30 ? 213 TYR H CE2 1 
ATOM 7913 C CZ  . TYR H 1 73  ? 4.436   42.417  2.816   1.00 46.80 ? 213 TYR H CZ  1 
ATOM 7914 O OH  . TYR H 1 73  ? 5.545   43.203  2.596   1.00 48.69 ? 213 TYR H OH  1 
ATOM 7915 N N   . PRO H 1 74  ? -1.838  39.816  5.165   1.00 42.40 ? 214 PRO H N   1 
ATOM 7916 C CA  . PRO H 1 74  ? -3.222  39.339  5.120   1.00 42.58 ? 214 PRO H CA  1 
ATOM 7917 C C   . PRO H 1 74  ? -3.682  39.315  3.665   1.00 43.11 ? 214 PRO H C   1 
ATOM 7918 O O   . PRO H 1 74  ? -3.230  40.134  2.864   1.00 44.08 ? 214 PRO H O   1 
ATOM 7919 C CB  . PRO H 1 74  ? -3.965  40.387  5.942   1.00 41.56 ? 214 PRO H CB  1 
ATOM 7920 C CG  . PRO H 1 74  ? -3.206  41.640  5.621   1.00 41.66 ? 214 PRO H CG  1 
ATOM 7921 C CD  . PRO H 1 74  ? -1.767  41.178  5.722   1.00 41.56 ? 214 PRO H CD  1 
ATOM 7922 N N   . TRP H 1 75  ? -4.558  38.377  3.312   1.00 42.57 ? 215 TRP H N   1 
ATOM 7923 C CA  . TRP H 1 75  ? -5.049  38.324  1.939   1.00 41.93 ? 215 TRP H CA  1 
ATOM 7924 C C   . TRP H 1 75  ? -5.859  39.592  1.681   1.00 42.47 ? 215 TRP H C   1 
ATOM 7925 O O   . TRP H 1 75  ? -6.632  40.030  2.538   1.00 43.13 ? 215 TRP H O   1 
ATOM 7926 C CB  . TRP H 1 75  ? -5.968  37.117  1.705   1.00 40.23 ? 215 TRP H CB  1 
ATOM 7927 C CG  . TRP H 1 75  ? -5.330  35.764  1.800   1.00 37.73 ? 215 TRP H CG  1 
ATOM 7928 C CD1 . TRP H 1 75  ? -5.432  34.883  2.838   1.00 37.42 ? 215 TRP H CD1 1 
ATOM 7929 C CD2 . TRP H 1 75  ? -4.551  35.108  0.793   1.00 36.01 ? 215 TRP H CD2 1 
ATOM 7930 N NE1 . TRP H 1 75  ? -4.771  33.715  2.538   1.00 36.65 ? 215 TRP H NE1 1 
ATOM 7931 C CE2 . TRP H 1 75  ? -4.220  33.827  1.291   1.00 36.26 ? 215 TRP H CE2 1 
ATOM 7932 C CE3 . TRP H 1 75  ? -4.102  35.478  -0.479  1.00 35.70 ? 215 TRP H CE3 1 
ATOM 7933 C CZ2 . TRP H 1 75  ? -3.462  32.909  0.555   1.00 36.32 ? 215 TRP H CZ2 1 
ATOM 7934 C CZ3 . TRP H 1 75  ? -3.347  34.563  -1.214  1.00 36.97 ? 215 TRP H CZ3 1 
ATOM 7935 C CH2 . TRP H 1 75  ? -3.035  33.294  -0.691  1.00 36.92 ? 215 TRP H CH2 1 
ATOM 7936 N N   . LEU H 1 76  ? -5.678  40.179  0.503   1.00 42.15 ? 216 LEU H N   1 
ATOM 7937 C CA  . LEU H 1 76  ? -6.420  41.377  0.129   1.00 43.51 ? 216 LEU H CA  1 
ATOM 7938 C C   . LEU H 1 76  ? -6.719  41.297  -1.362  1.00 44.97 ? 216 LEU H C   1 
ATOM 7939 O O   . LEU H 1 76  ? -6.064  40.547  -2.091  1.00 45.60 ? 216 LEU H O   1 
ATOM 7940 C CB  . LEU H 1 76  ? -5.602  42.640  0.423   1.00 42.86 ? 216 LEU H CB  1 
ATOM 7941 C CG  . LEU H 1 76  ? -5.179  42.922  1.867   1.00 41.43 ? 216 LEU H CG  1 
ATOM 7942 C CD1 . LEU H 1 76  ? -4.377  44.213  1.911   1.00 39.26 ? 216 LEU H CD1 1 
ATOM 7943 C CD2 . LEU H 1 76  ? -6.403  43.028  2.761   1.00 41.67 ? 216 LEU H CD2 1 
ATOM 7944 N N   . TRP H 1 77  ? -7.708  42.057  -1.820  1.00 45.08 ? 217 TRP H N   1 
ATOM 7945 C CA  . TRP H 1 77  ? -8.042  42.046  -3.234  1.00 45.51 ? 217 TRP H CA  1 
ATOM 7946 C C   . TRP H 1 77  ? -7.078  42.956  -3.975  1.00 46.92 ? 217 TRP H C   1 
ATOM 7947 O O   . TRP H 1 77  ? -5.959  43.179  -3.514  1.00 47.84 ? 217 TRP H O   1 
ATOM 7948 C CB  . TRP H 1 77  ? -9.488  42.492  -3.439  1.00 44.21 ? 217 TRP H CB  1 
ATOM 7949 C CG  . TRP H 1 77  ? -10.447 41.542  -2.798  1.00 43.28 ? 217 TRP H CG  1 
ATOM 7950 C CD1 . TRP H 1 77  ? -11.052 41.678  -1.581  1.00 42.28 ? 217 TRP H CD1 1 
ATOM 7951 C CD2 . TRP H 1 77  ? -10.846 40.260  -3.302  1.00 41.32 ? 217 TRP H CD2 1 
ATOM 7952 N NE1 . TRP H 1 77  ? -11.800 40.560  -1.296  1.00 41.80 ? 217 TRP H NE1 1 
ATOM 7953 C CE2 . TRP H 1 77  ? -11.692 39.675  -2.337  1.00 40.85 ? 217 TRP H CE2 1 
ATOM 7954 C CE3 . TRP H 1 77  ? -10.572 39.552  -4.478  1.00 39.82 ? 217 TRP H CE3 1 
ATOM 7955 C CZ2 . TRP H 1 77  ? -12.263 38.409  -2.509  1.00 40.43 ? 217 TRP H CZ2 1 
ATOM 7956 C CZ3 . TRP H 1 77  ? -11.140 38.297  -4.650  1.00 39.29 ? 217 TRP H CZ3 1 
ATOM 7957 C CH2 . TRP H 1 77  ? -11.978 37.739  -3.670  1.00 40.27 ? 217 TRP H CH2 1 
ATOM 7958 N N   . GLU H 1 78  ? -7.486  43.468  -5.128  1.00 48.00 ? 218 GLU H N   1 
ATOM 7959 C CA  . GLU H 1 78  ? -6.609  44.359  -5.870  1.00 48.59 ? 218 GLU H CA  1 
ATOM 7960 C C   . GLU H 1 78  ? -6.787  45.774  -5.331  1.00 49.29 ? 218 GLU H C   1 
ATOM 7961 O O   . GLU H 1 78  ? -5.825  46.541  -5.237  1.00 48.78 ? 218 GLU H O   1 
ATOM 7962 C CB  . GLU H 1 78  ? -6.927  44.301  -7.366  1.00 48.90 ? 218 GLU H CB  1 
ATOM 7963 C CG  . GLU H 1 78  ? -6.526  42.982  -8.018  1.00 51.07 ? 218 GLU H CG  1 
ATOM 7964 C CD  . GLU H 1 78  ? -6.894  42.905  -9.493  1.00 52.54 ? 218 GLU H CD  1 
ATOM 7965 O OE1 . GLU H 1 78  ? -8.091  43.023  -9.828  1.00 51.62 ? 218 GLU H OE1 1 
ATOM 7966 O OE2 . GLU H 1 78  ? -5.981  42.720  -10.321 1.00 54.17 ? 218 GLU H OE2 1 
ATOM 7967 N N   . ASP H 1 79  ? -8.019  46.106  -4.959  1.00 49.55 ? 219 ASP H N   1 
ATOM 7968 C CA  . ASP H 1 79  ? -8.324  47.425  -4.422  1.00 49.35 ? 219 ASP H CA  1 
ATOM 7969 C C   . ASP H 1 79  ? -7.784  47.592  -3.003  1.00 49.17 ? 219 ASP H C   1 
ATOM 7970 O O   . ASP H 1 79  ? -7.964  48.641  -2.383  1.00 49.05 ? 219 ASP H O   1 
ATOM 7971 C CB  . ASP H 1 79  ? -9.833  47.657  -4.429  1.00 51.13 ? 219 ASP H CB  1 
ATOM 7972 C CG  . ASP H 1 79  ? -10.598 46.524  -3.775  1.00 53.95 ? 219 ASP H CG  1 
ATOM 7973 O OD1 . ASP H 1 79  ? -10.243 46.145  -2.640  1.00 52.20 ? 219 ASP H OD1 1 
ATOM 7974 O OD2 . ASP H 1 79  ? -11.557 46.018  -4.397  1.00 55.78 ? 219 ASP H OD2 1 
ATOM 7975 N N   . GLY H 1 80  ? -7.131  46.553  -2.490  1.00 48.61 ? 220 GLY H N   1 
ATOM 7976 C CA  . GLY H 1 80  ? -6.562  46.619  -1.155  1.00 46.97 ? 220 GLY H CA  1 
ATOM 7977 C C   . GLY H 1 80  ? -7.514  46.326  -0.009  1.00 47.18 ? 220 GLY H C   1 
ATOM 7978 O O   . GLY H 1 80  ? -7.134  46.448  1.157   1.00 48.08 ? 220 GLY H O   1 
ATOM 7979 N N   . SER H 1 81  ? -8.749  45.942  -0.324  1.00 46.21 ? 221 SER H N   1 
ATOM 7980 C CA  . SER H 1 81  ? -9.735  45.632  0.706   1.00 45.04 ? 221 SER H CA  1 
ATOM 7981 C C   . SER H 1 81  ? -9.506  44.229  1.265   1.00 45.12 ? 221 SER H C   1 
ATOM 7982 O O   . SER H 1 81  ? -8.935  43.369  0.595   1.00 45.51 ? 221 SER H O   1 
ATOM 7983 C CB  . SER H 1 81  ? -11.145 45.745  0.131   1.00 46.52 ? 221 SER H CB  1 
ATOM 7984 O OG  . SER H 1 81  ? -11.318 44.871  -0.970  1.00 48.94 ? 221 SER H OG  1 
ATOM 7985 N N   . PRO H 1 82  ? -9.958  43.977  2.504   1.00 44.85 ? 222 PRO H N   1 
ATOM 7986 C CA  . PRO H 1 82  ? -9.801  42.678  3.166   1.00 44.96 ? 222 PRO H CA  1 
ATOM 7987 C C   . PRO H 1 82  ? -10.753 41.602  2.671   1.00 45.30 ? 222 PRO H C   1 
ATOM 7988 O O   . PRO H 1 82  ? -11.652 41.864  1.874   1.00 45.22 ? 222 PRO H O   1 
ATOM 7989 C CB  . PRO H 1 82  ? -10.058 43.016  4.623   1.00 44.10 ? 222 PRO H CB  1 
ATOM 7990 C CG  . PRO H 1 82  ? -11.160 44.002  4.505   1.00 43.78 ? 222 PRO H CG  1 
ATOM 7991 C CD  . PRO H 1 82  ? -10.674 44.915  3.387   1.00 44.34 ? 222 PRO H CD  1 
ATOM 7992 N N   . LEU H 1 83  ? -10.548 40.388  3.166   1.00 46.10 ? 223 LEU H N   1 
ATOM 7993 C CA  . LEU H 1 83  ? -11.389 39.258  2.807   1.00 48.14 ? 223 LEU H CA  1 
ATOM 7994 C C   . LEU H 1 83  ? -12.516 39.152  3.832   1.00 49.82 ? 223 LEU H C   1 
ATOM 7995 O O   . LEU H 1 83  ? -12.267 39.121  5.039   1.00 50.45 ? 223 LEU H O   1 
ATOM 7996 C CB  . LEU H 1 83  ? -10.565 37.968  2.810   1.00 47.16 ? 223 LEU H CB  1 
ATOM 7997 C CG  . LEU H 1 83  ? -11.267 36.699  2.333   1.00 45.54 ? 223 LEU H CG  1 
ATOM 7998 C CD1 . LEU H 1 83  ? -11.679 36.880  0.891   1.00 45.90 ? 223 LEU H CD1 1 
ATOM 7999 C CD2 . LEU H 1 83  ? -10.344 35.504  2.475   1.00 45.17 ? 223 LEU H CD2 1 
ATOM 8000 N N   . MET H 1 84  ? -13.755 39.112  3.353   1.00 51.17 ? 224 MET H N   1 
ATOM 8001 C CA  . MET H 1 84  ? -14.904 39.006  4.243   1.00 52.87 ? 224 MET H CA  1 
ATOM 8002 C C   . MET H 1 84  ? -14.798 37.756  5.098   1.00 53.09 ? 224 MET H C   1 
ATOM 8003 O O   . MET H 1 84  ? -14.710 36.647  4.579   1.00 53.59 ? 224 MET H O   1 
ATOM 8004 C CB  . MET H 1 84  ? -16.203 38.945  3.440   1.00 54.82 ? 224 MET H CB  1 
ATOM 8005 C CG  . MET H 1 84  ? -16.806 40.289  3.100   1.00 57.60 ? 224 MET H CG  1 
ATOM 8006 S SD  . MET H 1 84  ? -17.343 41.168  4.575   1.00 59.37 ? 224 MET H SD  1 
ATOM 8007 C CE  . MET H 1 84  ? -15.986 42.287  4.794   1.00 60.11 ? 224 MET H CE  1 
ATOM 8008 N N   . PRO H 1 85  ? -14.803 37.914  6.426   1.00 53.28 ? 225 PRO H N   1 
ATOM 8009 C CA  . PRO H 1 85  ? -14.705 36.708  7.244   1.00 53.65 ? 225 PRO H CA  1 
ATOM 8010 C C   . PRO H 1 85  ? -15.910 35.810  7.007   1.00 53.90 ? 225 PRO H C   1 
ATOM 8011 O O   . PRO H 1 85  ? -17.043 36.285  6.939   1.00 54.24 ? 225 PRO H O   1 
ATOM 8012 C CB  . PRO H 1 85  ? -14.649 37.261  8.667   1.00 53.39 ? 225 PRO H CB  1 
ATOM 8013 C CG  . PRO H 1 85  ? -15.450 38.520  8.564   1.00 53.58 ? 225 PRO H CG  1 
ATOM 8014 C CD  . PRO H 1 85  ? -14.952 39.112  7.269   1.00 53.37 ? 225 PRO H CD  1 
ATOM 8015 N N   . HIS H 1 86  ? -15.649 34.517  6.853   1.00 54.19 ? 226 HIS H N   1 
ATOM 8016 C CA  . HIS H 1 86  ? -16.689 33.520  6.636   1.00 55.09 ? 226 HIS H CA  1 
ATOM 8017 C C   . HIS H 1 86  ? -17.294 33.446  5.235   1.00 54.26 ? 226 HIS H C   1 
ATOM 8018 O O   . HIS H 1 86  ? -18.476 33.139  5.080   1.00 54.61 ? 226 HIS H O   1 
ATOM 8019 C CB  . HIS H 1 86  ? -17.801 33.704  7.666   1.00 57.16 ? 226 HIS H CB  1 
ATOM 8020 C CG  . HIS H 1 86  ? -17.323 33.608  9.078   1.00 62.11 ? 226 HIS H CG  1 
ATOM 8021 N ND1 . HIS H 1 86  ? -16.707 32.480  9.579   1.00 63.32 ? 226 HIS H ND1 1 
ATOM 8022 C CD2 . HIS H 1 86  ? -17.352 34.504  10.094  1.00 64.17 ? 226 HIS H CD2 1 
ATOM 8023 C CE1 . HIS H 1 86  ? -16.377 32.686  10.842  1.00 64.12 ? 226 HIS H CE1 1 
ATOM 8024 N NE2 . HIS H 1 86  ? -16.758 33.905  11.178  1.00 65.88 ? 226 HIS H NE2 1 
ATOM 8025 N N   . LEU H 1 87  ? -16.494 33.733  4.216   1.00 52.47 ? 227 LEU H N   1 
ATOM 8026 C CA  . LEU H 1 87  ? -16.969 33.629  2.841   1.00 51.19 ? 227 LEU H CA  1 
ATOM 8027 C C   . LEU H 1 87  ? -16.497 32.268  2.356   1.00 49.59 ? 227 LEU H C   1 
ATOM 8028 O O   . LEU H 1 87  ? -17.296 31.385  2.033   1.00 50.22 ? 227 LEU H O   1 
ATOM 8029 C CB  . LEU H 1 87  ? -16.353 34.706  1.943   1.00 52.87 ? 227 LEU H CB  1 
ATOM 8030 C CG  . LEU H 1 87  ? -16.897 36.134  1.963   1.00 54.65 ? 227 LEU H CG  1 
ATOM 8031 C CD1 . LEU H 1 87  ? -16.279 36.903  0.802   1.00 54.40 ? 227 LEU H CD1 1 
ATOM 8032 C CD2 . LEU H 1 87  ? -18.414 36.131  1.837   1.00 55.86 ? 227 LEU H CD2 1 
ATOM 8033 N N   . PHE H 1 88  ? -15.178 32.109  2.323   1.00 45.92 ? 228 PHE H N   1 
ATOM 8034 C CA  . PHE H 1 88  ? -14.566 30.872  1.883   1.00 43.09 ? 228 PHE H CA  1 
ATOM 8035 C C   . PHE H 1 88  ? -13.244 30.628  2.590   1.00 42.18 ? 228 PHE H C   1 
ATOM 8036 O O   . PHE H 1 88  ? -12.644 31.542  3.149   1.00 42.71 ? 228 PHE H O   1 
ATOM 8037 C CB  . PHE H 1 88  ? -14.354 30.902  0.363   1.00 41.93 ? 228 PHE H CB  1 
ATOM 8038 C CG  . PHE H 1 88  ? -13.567 32.095  -0.128  1.00 40.48 ? 228 PHE H CG  1 
ATOM 8039 C CD1 . PHE H 1 88  ? -12.196 32.201  0.115   1.00 39.91 ? 228 PHE H CD1 1 
ATOM 8040 C CD2 . PHE H 1 88  ? -14.198 33.110  -0.838  1.00 38.16 ? 228 PHE H CD2 1 
ATOM 8041 C CE1 . PHE H 1 88  ? -11.470 33.300  -0.343  1.00 37.39 ? 228 PHE H CE1 1 
ATOM 8042 C CE2 . PHE H 1 88  ? -13.483 34.208  -1.298  1.00 37.24 ? 228 PHE H CE2 1 
ATOM 8043 C CZ  . PHE H 1 88  ? -12.116 34.303  -1.050  1.00 37.26 ? 228 PHE H CZ  1 
ATOM 8044 N N   . ARG H 1 89  ? -12.803 29.378  2.570   1.00 42.84 ? 229 ARG H N   1 
ATOM 8045 C CA  . ARG H 1 89  ? -11.544 28.991  3.188   1.00 44.17 ? 229 ARG H CA  1 
ATOM 8046 C C   . ARG H 1 89  ? -10.506 28.861  2.084   1.00 43.63 ? 229 ARG H C   1 
ATOM 8047 O O   . ARG H 1 89  ? -10.718 28.139  1.107   1.00 44.73 ? 229 ARG H O   1 
ATOM 8048 C CB  . ARG H 1 89  ? -11.698 27.644  3.893   1.00 47.15 ? 229 ARG H CB  1 
ATOM 8049 C CG  . ARG H 1 89  ? -10.471 27.173  4.662   1.00 50.16 ? 229 ARG H CG  1 
ATOM 8050 C CD  . ARG H 1 89  ? -10.619 25.698  5.002   1.00 54.71 ? 229 ARG H CD  1 
ATOM 8051 N NE  . ARG H 1 89  ? -11.902 25.414  5.645   1.00 58.68 ? 229 ARG H NE  1 
ATOM 8052 C CZ  . ARG H 1 89  ? -12.450 24.205  5.724   1.00 59.30 ? 229 ARG H CZ  1 
ATOM 8053 N NH1 . ARG H 1 89  ? -11.830 23.156  5.198   1.00 59.47 ? 229 ARG H NH1 1 
ATOM 8054 N NH2 . ARG H 1 89  ? -13.623 24.046  6.324   1.00 60.01 ? 229 ARG H NH2 1 
ATOM 8055 N N   . VAL H 1 90  ? -9.394  29.569  2.223   1.00 41.78 ? 230 VAL H N   1 
ATOM 8056 C CA  . VAL H 1 90  ? -8.348  29.481  1.225   1.00 40.15 ? 230 VAL H CA  1 
ATOM 8057 C C   . VAL H 1 90  ? -7.574  28.205  1.492   1.00 40.31 ? 230 VAL H C   1 
ATOM 8058 O O   . VAL H 1 90  ? -7.220  27.914  2.633   1.00 40.68 ? 230 VAL H O   1 
ATOM 8059 C CB  . VAL H 1 90  ? -7.389  30.669  1.303   1.00 40.22 ? 230 VAL H CB  1 
ATOM 8060 C CG1 . VAL H 1 90  ? -6.247  30.473  0.318   1.00 41.54 ? 230 VAL H CG1 1 
ATOM 8061 C CG2 . VAL H 1 90  ? -8.136  31.951  0.998   1.00 39.91 ? 230 VAL H CG2 1 
ATOM 8062 N N   . ARG H 1 91  ? -7.324  27.441  0.437   1.00 40.53 ? 231 ARG H N   1 
ATOM 8063 C CA  . ARG H 1 91  ? -6.602  26.184  0.557   1.00 40.18 ? 231 ARG H CA  1 
ATOM 8064 C C   . ARG H 1 91  ? -5.265  26.247  -0.170  1.00 40.19 ? 231 ARG H C   1 
ATOM 8065 O O   . ARG H 1 91  ? -4.785  27.323  -0.522  1.00 41.49 ? 231 ARG H O   1 
ATOM 8066 C CB  . ARG H 1 91  ? -7.439  25.049  -0.028  1.00 41.01 ? 231 ARG H CB  1 
ATOM 8067 C CG  . ARG H 1 91  ? -8.801  24.855  0.625   1.00 41.29 ? 231 ARG H CG  1 
ATOM 8068 C CD  . ARG H 1 91  ? -9.490  23.635  0.042   1.00 43.03 ? 231 ARG H CD  1 
ATOM 8069 N NE  . ARG H 1 91  ? -10.546 23.106  0.900   1.00 43.65 ? 231 ARG H NE  1 
ATOM 8070 C CZ  . ARG H 1 91  ? -11.726 23.685  1.081   1.00 44.31 ? 231 ARG H CZ  1 
ATOM 8071 N NH1 . ARG H 1 91  ? -12.012 24.824  0.461   1.00 46.14 ? 231 ARG H NH1 1 
ATOM 8072 N NH2 . ARG H 1 91  ? -12.621 23.119  1.876   1.00 44.69 ? 231 ARG H NH2 1 
ATOM 8073 N N   . GLY H 1 92  ? -4.661  25.085  -0.382  1.00 38.74 ? 232 GLY H N   1 
ATOM 8074 C CA  . GLY H 1 92  ? -3.398  25.034  -1.088  1.00 39.72 ? 232 GLY H CA  1 
ATOM 8075 C C   . GLY H 1 92  ? -2.203  25.580  -0.336  1.00 40.27 ? 232 GLY H C   1 
ATOM 8076 O O   . GLY H 1 92  ? -2.191  25.606  0.894   1.00 40.30 ? 232 GLY H O   1 
ATOM 8077 N N   . ALA H 1 93  ? -1.199  26.018  -1.092  1.00 40.09 ? 233 ALA H N   1 
ATOM 8078 C CA  . ALA H 1 93  ? 0.036   26.563  -0.542  1.00 40.49 ? 233 ALA H CA  1 
ATOM 8079 C C   . ALA H 1 93  ? -0.164  27.882  0.194   1.00 41.61 ? 233 ALA H C   1 
ATOM 8080 O O   . ALA H 1 93  ? 0.224   28.944  -0.299  1.00 43.12 ? 233 ALA H O   1 
ATOM 8081 C CB  . ALA H 1 93  ? 1.038   26.754  -1.653  1.00 40.14 ? 233 ALA H CB  1 
ATOM 8082 N N   . VAL H 1 94  ? -0.746  27.808  1.385   1.00 41.44 ? 234 VAL H N   1 
ATOM 8083 C CA  . VAL H 1 94  ? -1.000  28.998  2.185   1.00 41.21 ? 234 VAL H CA  1 
ATOM 8084 C C   . VAL H 1 94  ? 0.111   29.304  3.189   1.00 41.48 ? 234 VAL H C   1 
ATOM 8085 O O   . VAL H 1 94  ? -0.069  30.132  4.082   1.00 41.06 ? 234 VAL H O   1 
ATOM 8086 C CB  . VAL H 1 94  ? -2.328  28.863  2.954   1.00 40.96 ? 234 VAL H CB  1 
ATOM 8087 C CG1 . VAL H 1 94  ? -3.493  28.844  1.981   1.00 40.12 ? 234 VAL H CG1 1 
ATOM 8088 C CG2 . VAL H 1 94  ? -2.317  27.588  3.783   1.00 40.93 ? 234 VAL H CG2 1 
ATOM 8089 N N   . SER H 1 95  ? 1.257   28.642  3.046   1.00 41.11 ? 235 SER H N   1 
ATOM 8090 C CA  . SER H 1 95  ? 2.366   28.866  3.967   1.00 39.90 ? 235 SER H CA  1 
ATOM 8091 C C   . SER H 1 95  ? 3.705   29.005  3.252   1.00 41.25 ? 235 SER H C   1 
ATOM 8092 O O   . SER H 1 95  ? 4.722   29.330  3.869   1.00 41.86 ? 235 SER H O   1 
ATOM 8093 C CB  . SER H 1 95  ? 2.438   27.729  4.984   1.00 37.06 ? 235 SER H CB  1 
ATOM 8094 O OG  . SER H 1 95  ? 2.667   26.494  4.336   1.00 35.15 ? 235 SER H OG  1 
ATOM 8095 N N   . GLN H 1 96  ? 3.713   28.755  1.950   1.00 41.14 ? 236 GLN H N   1 
ATOM 8096 C CA  . GLN H 1 96  ? 4.946   28.890  1.194   1.00 42.20 ? 236 GLN H CA  1 
ATOM 8097 C C   . GLN H 1 96  ? 5.137   30.356  0.824   1.00 43.15 ? 236 GLN H C   1 
ATOM 8098 O O   . GLN H 1 96  ? 4.258   31.188  1.062   1.00 42.66 ? 236 GLN H O   1 
ATOM 8099 C CB  . GLN H 1 96  ? 4.903   28.044  -0.081  1.00 42.64 ? 236 GLN H CB  1 
ATOM 8100 C CG  . GLN H 1 96  ? 4.837   26.545  0.158   1.00 44.53 ? 236 GLN H CG  1 
ATOM 8101 C CD  . GLN H 1 96  ? 3.424   26.035  0.385   1.00 46.51 ? 236 GLN H CD  1 
ATOM 8102 O OE1 . GLN H 1 96  ? 2.689   26.541  1.236   1.00 47.81 ? 236 GLN H OE1 1 
ATOM 8103 N NE2 . GLN H 1 96  ? 3.040   25.017  -0.375  1.00 46.27 ? 236 GLN H NE2 1 
ATOM 8104 N N   . THR H 1 97  ? 6.295   30.667  0.253   1.00 43.36 ? 237 THR H N   1 
ATOM 8105 C CA  . THR H 1 97  ? 6.607   32.027  -0.168  1.00 43.09 ? 237 THR H CA  1 
ATOM 8106 C C   . THR H 1 97  ? 7.217   31.915  -1.556  1.00 43.30 ? 237 THR H C   1 
ATOM 8107 O O   . THR H 1 97  ? 8.161   31.156  -1.758  1.00 43.75 ? 237 THR H O   1 
ATOM 8108 C CB  . THR H 1 97  ? 7.642   32.704  0.764   1.00 41.55 ? 237 THR H CB  1 
ATOM 8109 O OG1 . THR H 1 97  ? 7.181   32.665  2.120   1.00 42.24 ? 237 THR H OG1 1 
ATOM 8110 C CG2 . THR H 1 97  ? 7.847   34.154  0.359   1.00 39.85 ? 237 THR H CG2 1 
ATOM 8111 N N   . TYR H 1 98  ? 6.684   32.662  -2.514  1.00 42.99 ? 238 TYR H N   1 
ATOM 8112 C CA  . TYR H 1 98  ? 7.215   32.598  -3.866  1.00 42.85 ? 238 TYR H CA  1 
ATOM 8113 C C   . TYR H 1 98  ? 7.723   33.950  -4.321  1.00 43.67 ? 238 TYR H C   1 
ATOM 8114 O O   . TYR H 1 98  ? 7.211   34.988  -3.904  1.00 42.93 ? 238 TYR H O   1 
ATOM 8115 C CB  . TYR H 1 98  ? 6.141   32.113  -4.837  1.00 43.74 ? 238 TYR H CB  1 
ATOM 8116 C CG  . TYR H 1 98  ? 5.432   30.861  -4.381  1.00 46.08 ? 238 TYR H CG  1 
ATOM 8117 C CD1 . TYR H 1 98  ? 4.134   30.918  -3.873  1.00 45.54 ? 238 TYR H CD1 1 
ATOM 8118 C CD2 . TYR H 1 98  ? 6.065   29.618  -4.435  1.00 45.81 ? 238 TYR H CD2 1 
ATOM 8119 C CE1 . TYR H 1 98  ? 3.484   29.768  -3.429  1.00 44.48 ? 238 TYR H CE1 1 
ATOM 8120 C CE2 . TYR H 1 98  ? 5.424   28.465  -3.993  1.00 44.66 ? 238 TYR H CE2 1 
ATOM 8121 C CZ  . TYR H 1 98  ? 4.136   28.549  -3.492  1.00 44.31 ? 238 TYR H CZ  1 
ATOM 8122 O OH  . TYR H 1 98  ? 3.499   27.414  -3.059  1.00 44.28 ? 238 TYR H OH  1 
ATOM 8123 N N   . PRO H 1 99  ? 8.749   33.956  -5.185  1.00 45.07 ? 239 PRO H N   1 
ATOM 8124 C CA  . PRO H 1 99  ? 9.299   35.217  -5.680  1.00 45.43 ? 239 PRO H CA  1 
ATOM 8125 C C   . PRO H 1 99  ? 8.178   36.114  -6.198  1.00 45.79 ? 239 PRO H C   1 
ATOM 8126 O O   . PRO H 1 99  ? 8.090   37.290  -5.841  1.00 46.65 ? 239 PRO H O   1 
ATOM 8127 C CB  . PRO H 1 99  ? 10.245  34.761  -6.787  1.00 44.02 ? 239 PRO H CB  1 
ATOM 8128 C CG  . PRO H 1 99  ? 10.757  33.471  -6.256  1.00 44.62 ? 239 PRO H CG  1 
ATOM 8129 C CD  . PRO H 1 99  ? 9.496   32.810  -5.735  1.00 45.38 ? 239 PRO H CD  1 
ATOM 8130 N N   . SER H 1 100 ? 7.315   35.540  -7.028  1.00 45.07 ? 240 SER H N   1 
ATOM 8131 C CA  . SER H 1 100 ? 6.200   36.277  -7.603  1.00 45.22 ? 240 SER H CA  1 
ATOM 8132 C C   . SER H 1 100 ? 5.055   36.482  -6.617  1.00 44.48 ? 240 SER H C   1 
ATOM 8133 O O   . SER H 1 100 ? 4.139   37.255  -6.879  1.00 43.98 ? 240 SER H O   1 
ATOM 8134 C CB  . SER H 1 100 ? 5.683   35.544  -8.839  1.00 46.60 ? 240 SER H CB  1 
ATOM 8135 O OG  . SER H 1 100 ? 5.413   34.184  -8.543  1.00 48.70 ? 240 SER H OG  1 
ATOM 8136 N N   . GLY H 1 101 ? 5.111   35.790  -5.485  1.00 44.29 ? 241 GLY H N   1 
ATOM 8137 C CA  . GLY H 1 101 ? 4.062   35.917  -4.488  1.00 43.16 ? 241 GLY H CA  1 
ATOM 8138 C C   . GLY H 1 101 ? 3.049   34.794  -4.599  1.00 42.77 ? 241 GLY H C   1 
ATOM 8139 O O   . GLY H 1 101 ? 3.156   33.948  -5.484  1.00 44.16 ? 241 GLY H O   1 
ATOM 8140 N N   . THR H 1 102 ? 2.064   34.780  -3.708  1.00 41.40 ? 242 THR H N   1 
ATOM 8141 C CA  . THR H 1 102 ? 1.042   33.743  -3.731  1.00 40.47 ? 242 THR H CA  1 
ATOM 8142 C C   . THR H 1 102 ? -0.315  34.327  -4.103  1.00 38.23 ? 242 THR H C   1 
ATOM 8143 O O   . THR H 1 102 ? -0.766  35.299  -3.503  1.00 37.33 ? 242 THR H O   1 
ATOM 8144 C CB  . THR H 1 102 ? 0.936   33.050  -2.367  1.00 42.70 ? 242 THR H CB  1 
ATOM 8145 O OG1 . THR H 1 102 ? 2.253   32.738  -1.894  1.00 46.18 ? 242 THR H OG1 1 
ATOM 8146 C CG2 . THR H 1 102 ? 0.129   31.760  -2.487  1.00 43.50 ? 242 THR H CG2 1 
ATOM 8147 N N   . CYS H 1 103 ? -0.961  33.721  -5.096  1.00 37.50 ? 243 CYS H N   1 
ATOM 8148 C CA  . CYS H 1 103 ? -2.258  34.184  -5.580  1.00 36.78 ? 243 CYS H CA  1 
ATOM 8149 C C   . CYS H 1 103 ? -3.378  33.164  -5.381  1.00 34.77 ? 243 CYS H C   1 
ATOM 8150 O O   . CYS H 1 103 ? -3.124  31.973  -5.224  1.00 32.70 ? 243 CYS H O   1 
ATOM 8151 C CB  . CYS H 1 103 ? -2.131  34.578  -7.058  1.00 37.88 ? 243 CYS H CB  1 
ATOM 8152 S SG  . CYS H 1 103 ? -1.030  36.017  -7.274  1.00 38.37 ? 243 CYS H SG  1 
ATOM 8153 N N   . ALA H 1 104 ? -4.619  33.642  -5.393  1.00 33.74 ? 244 ALA H N   1 
ATOM 8154 C CA  . ALA H 1 104 ? -5.780  32.785  -5.178  1.00 32.85 ? 244 ALA H CA  1 
ATOM 8155 C C   . ALA H 1 104 ? -6.609  32.531  -6.420  1.00 32.76 ? 244 ALA H C   1 
ATOM 8156 O O   . ALA H 1 104 ? -6.768  33.412  -7.260  1.00 33.97 ? 244 ALA H O   1 
ATOM 8157 C CB  . ALA H 1 104 ? -6.665  33.386  -4.095  1.00 32.49 ? 244 ALA H CB  1 
ATOM 8158 N N   . TYR H 1 105 ? -7.146  31.318  -6.524  1.00 33.07 ? 245 TYR H N   1 
ATOM 8159 C CA  . TYR H 1 105 ? -7.981  30.948  -7.658  1.00 33.53 ? 245 TYR H CA  1 
ATOM 8160 C C   . TYR H 1 105 ? -9.184  30.125  -7.224  1.00 34.28 ? 245 TYR H C   1 
ATOM 8161 O O   . TYR H 1 105 ? -9.104  29.327  -6.297  1.00 34.12 ? 245 TYR H O   1 
ATOM 8162 C CB  . TYR H 1 105 ? -7.166  30.179  -8.716  1.00 33.42 ? 245 TYR H CB  1 
ATOM 8163 C CG  . TYR H 1 105 ? -6.697  28.783  -8.333  1.00 32.91 ? 245 TYR H CG  1 
ATOM 8164 C CD1 . TYR H 1 105 ? -7.600  27.727  -8.185  1.00 33.93 ? 245 TYR H CD1 1 
ATOM 8165 C CD2 . TYR H 1 105 ? -5.341  28.510  -8.166  1.00 31.21 ? 245 TYR H CD2 1 
ATOM 8166 C CE1 . TYR H 1 105 ? -7.161  26.439  -7.886  1.00 33.43 ? 245 TYR H CE1 1 
ATOM 8167 C CE2 . TYR H 1 105 ? -4.893  27.228  -7.867  1.00 32.59 ? 245 TYR H CE2 1 
ATOM 8168 C CZ  . TYR H 1 105 ? -5.807  26.197  -7.730  1.00 33.66 ? 245 TYR H CZ  1 
ATOM 8169 O OH  . TYR H 1 105 ? -5.363  24.925  -7.447  1.00 32.20 ? 245 TYR H OH  1 
ATOM 8170 N N   . ILE H 1 106 ? -10.304 30.339  -7.900  1.00 35.91 ? 246 ILE H N   1 
ATOM 8171 C CA  . ILE H 1 106 ? -11.531 29.620  -7.606  1.00 37.04 ? 246 ILE H CA  1 
ATOM 8172 C C   . ILE H 1 106 ? -11.522 28.373  -8.483  1.00 38.80 ? 246 ILE H C   1 
ATOM 8173 O O   . ILE H 1 106 ? -11.088 28.422  -9.636  1.00 38.70 ? 246 ILE H O   1 
ATOM 8174 C CB  . ILE H 1 106 ? -12.767 30.504  -7.925  1.00 36.70 ? 246 ILE H CB  1 
ATOM 8175 C CG1 . ILE H 1 106 ? -14.058 29.774  -7.558  1.00 36.14 ? 246 ILE H CG1 1 
ATOM 8176 C CG2 . ILE H 1 106 ? -12.756 30.908  -9.390  1.00 36.45 ? 246 ILE H CG2 1 
ATOM 8177 C CD1 . ILE H 1 106 ? -14.231 29.558  -6.081  1.00 36.03 ? 246 ILE H CD1 1 
ATOM 8178 N N   . GLN H 1 107 ? -11.977 27.253  -7.932  1.00 40.42 ? 247 GLN H N   1 
ATOM 8179 C CA  . GLN H 1 107 ? -12.001 25.998  -8.673  1.00 42.31 ? 247 GLN H CA  1 
ATOM 8180 C C   . GLN H 1 107 ? -12.790 24.949  -7.921  1.00 43.29 ? 247 GLN H C   1 
ATOM 8181 O O   . GLN H 1 107 ? -12.498 24.660  -6.761  1.00 43.73 ? 247 GLN H O   1 
ATOM 8182 C CB  . GLN H 1 107 ? -10.580 25.489  -8.896  1.00 44.27 ? 247 GLN H CB  1 
ATOM 8183 C CG  . GLN H 1 107 ? -10.509 24.083  -9.458  1.00 46.84 ? 247 GLN H CG  1 
ATOM 8184 C CD  . GLN H 1 107 ? -9.084  23.626  -9.686  1.00 49.61 ? 247 GLN H CD  1 
ATOM 8185 O OE1 . GLN H 1 107 ? -8.298  23.503  -8.743  1.00 52.91 ? 247 GLN H OE1 1 
ATOM 8186 N NE2 . GLN H 1 107 ? -8.740  23.377  -10.943 1.00 49.21 ? 247 GLN H NE2 1 
ATOM 8187 N N   . ARG H 1 108 ? -13.775 24.368  -8.598  1.00 44.90 ? 248 ARG H N   1 
ATOM 8188 C CA  . ARG H 1 108 ? -14.627 23.356  -7.993  1.00 45.83 ? 248 ARG H CA  1 
ATOM 8189 C C   . ARG H 1 108 ? -15.445 24.039  -6.908  1.00 45.96 ? 248 ARG H C   1 
ATOM 8190 O O   . ARG H 1 108 ? -15.952 23.390  -5.990  1.00 44.82 ? 248 ARG H O   1 
ATOM 8191 C CB  . ARG H 1 108 ? -13.784 22.227  -7.385  1.00 49.00 ? 248 ARG H CB  1 
ATOM 8192 C CG  . ARG H 1 108 ? -12.923 21.470  -8.388  1.00 53.10 ? 248 ARG H CG  1 
ATOM 8193 C CD  . ARG H 1 108 ? -13.768 20.926  -9.534  1.00 57.67 ? 248 ARG H CD  1 
ATOM 8194 N NE  . ARG H 1 108 ? -13.034 19.989  -10.383 1.00 61.39 ? 248 ARG H NE  1 
ATOM 8195 C CZ  . ARG H 1 108 ? -12.600 18.798  -9.980  1.00 62.61 ? 248 ARG H CZ  1 
ATOM 8196 N NH1 . ARG H 1 108 ? -12.822 18.392  -8.735  1.00 62.10 ? 248 ARG H NH1 1 
ATOM 8197 N NH2 . ARG H 1 108 ? -11.952 18.005  -10.825 1.00 63.14 ? 248 ARG H NH2 1 
ATOM 8198 N N   . GLY H 1 109 ? -15.556 25.362  -7.023  1.00 46.19 ? 249 GLY H N   1 
ATOM 8199 C CA  . GLY H 1 109 ? -16.319 26.139  -6.061  1.00 46.68 ? 249 GLY H CA  1 
ATOM 8200 C C   . GLY H 1 109 ? -15.585 26.465  -4.771  1.00 46.23 ? 249 GLY H C   1 
ATOM 8201 O O   . GLY H 1 109 ? -16.189 26.949  -3.811  1.00 46.64 ? 249 GLY H O   1 
ATOM 8202 N N   . ALA H 1 110 ? -14.285 26.195  -4.739  1.00 44.89 ? 250 ALA H N   1 
ATOM 8203 C CA  . ALA H 1 110 ? -13.483 26.477  -3.556  1.00 44.05 ? 250 ALA H CA  1 
ATOM 8204 C C   . ALA H 1 110 ? -12.252 27.282  -3.961  1.00 43.64 ? 250 ALA H C   1 
ATOM 8205 O O   . ALA H 1 110 ? -11.904 27.335  -5.143  1.00 44.74 ? 250 ALA H O   1 
ATOM 8206 C CB  . ALA H 1 110 ? -13.070 25.170  -2.878  1.00 43.90 ? 250 ALA H CB  1 
ATOM 8207 N N   . VAL H 1 111 ? -11.600 27.909  -2.986  1.00 41.90 ? 251 VAL H N   1 
ATOM 8208 C CA  . VAL H 1 111 ? -10.411 28.708  -3.263  1.00 40.47 ? 251 VAL H CA  1 
ATOM 8209 C C   . VAL H 1 111 ? -9.103  28.042  -2.827  1.00 40.62 ? 251 VAL H C   1 
ATOM 8210 O O   . VAL H 1 111 ? -9.044  27.373  -1.797  1.00 40.85 ? 251 VAL H O   1 
ATOM 8211 C CB  . VAL H 1 111 ? -10.512 30.083  -2.591  1.00 40.12 ? 251 VAL H CB  1 
ATOM 8212 C CG1 . VAL H 1 111 ? -9.246  30.880  -2.850  1.00 40.93 ? 251 VAL H CG1 1 
ATOM 8213 C CG2 . VAL H 1 111 ? -11.727 30.824  -3.122  1.00 39.15 ? 251 VAL H CG2 1 
ATOM 8214 N N   . TYR H 1 112 ? -8.057  28.231  -3.631  1.00 41.53 ? 252 TYR H N   1 
ATOM 8215 C CA  . TYR H 1 112 ? -6.738  27.659  -3.357  1.00 42.08 ? 252 TYR H CA  1 
ATOM 8216 C C   . TYR H 1 112 ? -5.644  28.713  -3.540  1.00 42.28 ? 252 TYR H C   1 
ATOM 8217 O O   . TYR H 1 112 ? -5.783  29.622  -4.353  1.00 43.04 ? 252 TYR H O   1 
ATOM 8218 C CB  . TYR H 1 112 ? -6.446  26.486  -4.302  1.00 40.26 ? 252 TYR H CB  1 
ATOM 8219 C CG  . TYR H 1 112 ? -7.540  25.447  -4.381  1.00 40.37 ? 252 TYR H CG  1 
ATOM 8220 C CD1 . TYR H 1 112 ? -8.730  25.707  -5.061  1.00 40.48 ? 252 TYR H CD1 1 
ATOM 8221 C CD2 . TYR H 1 112 ? -7.388  24.200  -3.776  1.00 40.88 ? 252 TYR H CD2 1 
ATOM 8222 C CE1 . TYR H 1 112 ? -9.745  24.751  -5.138  1.00 42.20 ? 252 TYR H CE1 1 
ATOM 8223 C CE2 . TYR H 1 112 ? -8.396  23.234  -3.845  1.00 43.35 ? 252 TYR H CE2 1 
ATOM 8224 C CZ  . TYR H 1 112 ? -9.572  23.515  -4.527  1.00 43.66 ? 252 TYR H CZ  1 
ATOM 8225 O OH  . TYR H 1 112 ? -10.565 22.562  -4.590  1.00 43.63 ? 252 TYR H OH  1 
ATOM 8226 N N   . ALA H 1 113 ? -4.560  28.580  -2.781  1.00 41.95 ? 253 ALA H N   1 
ATOM 8227 C CA  . ALA H 1 113 ? -3.436  29.506  -2.864  1.00 41.37 ? 253 ALA H CA  1 
ATOM 8228 C C   . ALA H 1 113 ? -2.366  28.863  -3.727  1.00 41.92 ? 253 ALA H C   1 
ATOM 8229 O O   . ALA H 1 113 ? -1.817  27.824  -3.374  1.00 42.56 ? 253 ALA H O   1 
ATOM 8230 C CB  . ALA H 1 113 ? -2.883  29.797  -1.472  1.00 40.83 ? 253 ALA H CB  1 
ATOM 8231 N N   . GLU H 1 114 ? -2.068  29.491  -4.857  1.00 42.83 ? 254 GLU H N   1 
ATOM 8232 C CA  . GLU H 1 114 ? -1.080  28.964  -5.788  1.00 43.62 ? 254 GLU H CA  1 
ATOM 8233 C C   . GLU H 1 114 ? -0.020  30.000  -6.146  1.00 43.40 ? 254 GLU H C   1 
ATOM 8234 O O   . GLU H 1 114 ? -0.210  31.198  -5.937  1.00 43.93 ? 254 GLU H O   1 
ATOM 8235 C CB  . GLU H 1 114 ? -1.792  28.495  -7.060  1.00 44.26 ? 254 GLU H CB  1 
ATOM 8236 C CG  . GLU H 1 114 ? -0.919  27.787  -8.084  1.00 48.16 ? 254 GLU H CG  1 
ATOM 8237 C CD  . GLU H 1 114 ? -0.392  26.452  -7.594  1.00 49.39 ? 254 GLU H CD  1 
ATOM 8238 O OE1 . GLU H 1 114 ? 0.494   26.445  -6.713  1.00 51.88 ? 254 GLU H OE1 1 
ATOM 8239 O OE2 . GLU H 1 114 ? -0.867  25.407  -8.088  1.00 49.81 ? 254 GLU H OE2 1 
ATOM 8240 N N   . ASN H 1 115 ? 1.101   29.522  -6.677  1.00 42.92 ? 255 ASN H N   1 
ATOM 8241 C CA  . ASN H 1 115 ? 2.197   30.384  -7.103  1.00 43.28 ? 255 ASN H CA  1 
ATOM 8242 C C   . ASN H 1 115 ? 1.655   31.241  -8.253  1.00 43.57 ? 255 ASN H C   1 
ATOM 8243 O O   . ASN H 1 115 ? 1.063   30.710  -9.200  1.00 43.44 ? 255 ASN H O   1 
ATOM 8244 C CB  . ASN H 1 115 ? 3.354   29.521  -7.599  1.00 44.57 ? 255 ASN H CB  1 
ATOM 8245 C CG  . ASN H 1 115 ? 4.644   30.292  -7.732  1.00 44.52 ? 255 ASN H CG  1 
ATOM 8246 O OD1 . ASN H 1 115 ? 4.651   31.459  -8.126  1.00 45.18 ? 255 ASN H OD1 1 
ATOM 8247 N ND2 . ASN H 1 115 ? 5.754   29.634  -7.418  1.00 44.93 ? 255 ASN H ND2 1 
ATOM 8248 N N   . CYS H 1 116 ? 1.864   32.554  -8.178  1.00 42.43 ? 256 CYS H N   1 
ATOM 8249 C CA  . CYS H 1 116 ? 1.355   33.458  -9.203  1.00 43.02 ? 256 CYS H CA  1 
ATOM 8250 C C   . CYS H 1 116 ? 2.027   33.365  -10.569 1.00 43.92 ? 256 CYS H C   1 
ATOM 8251 O O   . CYS H 1 116 ? 1.555   33.982  -11.520 1.00 45.47 ? 256 CYS H O   1 
ATOM 8252 C CB  . CYS H 1 116 ? 1.437   34.906  -8.732  1.00 41.90 ? 256 CYS H CB  1 
ATOM 8253 S SG  . CYS H 1 116 ? 0.835   35.245  -7.047  1.00 44.67 ? 256 CYS H SG  1 
ATOM 8254 N N   . ILE H 1 117 ? 3.123   32.619  -10.683 1.00 44.43 ? 257 ILE H N   1 
ATOM 8255 C CA  . ILE H 1 117 ? 3.795   32.495  -11.975 1.00 46.05 ? 257 ILE H CA  1 
ATOM 8256 C C   . ILE H 1 117 ? 3.230   31.358  -12.814 1.00 47.07 ? 257 ILE H C   1 
ATOM 8257 O O   . ILE H 1 117 ? 3.678   31.119  -13.934 1.00 47.95 ? 257 ILE H O   1 
ATOM 8258 C CB  . ILE H 1 117 ? 5.324   32.282  -11.820 1.00 46.67 ? 257 ILE H CB  1 
ATOM 8259 C CG1 . ILE H 1 117 ? 5.615   31.134  -10.852 1.00 48.72 ? 257 ILE H CG1 1 
ATOM 8260 C CG2 . ILE H 1 117 ? 5.976   33.562  -11.344 1.00 45.58 ? 257 ILE H CG2 1 
ATOM 8261 C CD1 . ILE H 1 117 ? 5.255   29.755  -11.372 1.00 49.34 ? 257 ILE H CD1 1 
ATOM 8262 N N   . LEU H 1 118 ? 2.249   30.653  -12.264 1.00 48.29 ? 258 LEU H N   1 
ATOM 8263 C CA  . LEU H 1 118 ? 1.628   29.544  -12.972 1.00 48.20 ? 258 LEU H CA  1 
ATOM 8264 C C   . LEU H 1 118 ? 0.458   30.039  -13.793 1.00 47.67 ? 258 LEU H C   1 
ATOM 8265 O O   . LEU H 1 118 ? -0.232  30.980  -13.405 1.00 47.24 ? 258 LEU H O   1 
ATOM 8266 C CB  . LEU H 1 118 ? 1.178   28.467  -11.984 1.00 50.25 ? 258 LEU H CB  1 
ATOM 8267 C CG  . LEU H 1 118 ? 2.354   27.661  -11.423 1.00 51.71 ? 258 LEU H CG  1 
ATOM 8268 C CD1 . LEU H 1 118 ? 1.873   26.712  -10.339 1.00 51.60 ? 258 LEU H CD1 1 
ATOM 8269 C CD2 . LEU H 1 118 ? 3.028   26.891  -12.559 1.00 51.15 ? 258 LEU H CD2 1 
ATOM 8270 N N   . ALA H 1 119 ? 0.245   29.400  -14.937 1.00 47.55 ? 259 ALA H N   1 
ATOM 8271 C CA  . ALA H 1 119 ? -0.822  29.794  -15.843 1.00 47.16 ? 259 ALA H CA  1 
ATOM 8272 C C   . ALA H 1 119 ? -2.185  29.176  -15.553 1.00 46.17 ? 259 ALA H C   1 
ATOM 8273 O O   . ALA H 1 119 ? -2.300  28.015  -15.158 1.00 45.08 ? 259 ALA H O   1 
ATOM 8274 C CB  . ALA H 1 119 ? -0.412  29.493  -17.283 1.00 46.94 ? 259 ALA H CB  1 
ATOM 8275 N N   . ALA H 1 120 ? -3.217  29.984  -15.766 1.00 45.13 ? 260 ALA H N   1 
ATOM 8276 C CA  . ALA H 1 120 ? -4.599  29.579  -15.564 1.00 45.67 ? 260 ALA H CA  1 
ATOM 8277 C C   . ALA H 1 120 ? -5.464  30.662  -16.185 1.00 44.78 ? 260 ALA H C   1 
ATOM 8278 O O   . ALA H 1 120 ? -4.977  31.755  -16.472 1.00 44.97 ? 260 ALA H O   1 
ATOM 8279 C CB  . ALA H 1 120 ? -4.903  29.457  -14.075 1.00 45.74 ? 260 ALA H CB  1 
ATOM 8280 N N   . PHE H 1 121 ? -6.738  30.360  -16.409 1.00 42.94 ? 261 PHE H N   1 
ATOM 8281 C CA  . PHE H 1 121 ? -7.640  31.349  -16.973 1.00 41.45 ? 261 PHE H CA  1 
ATOM 8282 C C   . PHE H 1 121 ? -8.024  32.252  -15.817 1.00 40.34 ? 261 PHE H C   1 
ATOM 8283 O O   . PHE H 1 121 ? -7.856  31.879  -14.659 1.00 40.75 ? 261 PHE H O   1 
ATOM 8284 C CB  . PHE H 1 121 ? -8.889  30.684  -17.548 1.00 43.92 ? 261 PHE H CB  1 
ATOM 8285 C CG  . PHE H 1 121 ? -8.593  29.598  -18.538 1.00 46.26 ? 261 PHE H CG  1 
ATOM 8286 C CD1 . PHE H 1 121 ? -8.578  28.269  -18.144 1.00 46.05 ? 261 PHE H CD1 1 
ATOM 8287 C CD2 . PHE H 1 121 ? -8.298  29.910  -19.864 1.00 48.13 ? 261 PHE H CD2 1 
ATOM 8288 C CE1 . PHE H 1 121 ? -8.273  27.265  -19.058 1.00 48.06 ? 261 PHE H CE1 1 
ATOM 8289 C CE2 . PHE H 1 121 ? -7.991  28.913  -20.784 1.00 46.48 ? 261 PHE H CE2 1 
ATOM 8290 C CZ  . PHE H 1 121 ? -7.978  27.590  -20.382 1.00 47.30 ? 261 PHE H CZ  1 
ATOM 8291 N N   . SER H 1 122 ? -8.528  33.440  -16.121 1.00 39.17 ? 262 SER H N   1 
ATOM 8292 C CA  . SER H 1 122 ? -8.928  34.374  -15.083 1.00 36.67 ? 262 SER H CA  1 
ATOM 8293 C C   . SER H 1 122 ? -10.372 34.765  -15.310 1.00 35.22 ? 262 SER H C   1 
ATOM 8294 O O   . SER H 1 122 ? -11.009 34.290  -16.242 1.00 34.50 ? 262 SER H O   1 
ATOM 8295 C CB  . SER H 1 122 ? -8.037  35.621  -15.114 1.00 37.74 ? 262 SER H CB  1 
ATOM 8296 O OG  . SER H 1 122 ? -8.187  36.345  -16.325 1.00 38.17 ? 262 SER H OG  1 
ATOM 8297 N N   . ILE H 1 123 ? -10.886 35.628  -14.446 1.00 35.90 ? 263 ILE H N   1 
ATOM 8298 C CA  . ILE H 1 123 ? -12.260 36.097  -14.556 1.00 35.65 ? 263 ILE H CA  1 
ATOM 8299 C C   . ILE H 1 123 ? -12.320 37.587  -14.237 1.00 35.87 ? 263 ILE H C   1 
ATOM 8300 O O   . ILE H 1 123 ? -12.026 38.001  -13.121 1.00 33.55 ? 263 ILE H O   1 
ATOM 8301 C CB  . ILE H 1 123 ? -13.183 35.321  -13.594 1.00 34.97 ? 263 ILE H CB  1 
ATOM 8302 C CG1 . ILE H 1 123 ? -13.268 33.857  -14.035 1.00 35.41 ? 263 ILE H CG1 1 
ATOM 8303 C CG2 . ILE H 1 123 ? -14.558 35.970  -13.545 1.00 32.54 ? 263 ILE H CG2 1 
ATOM 8304 C CD1 . ILE H 1 123 ? -14.149 32.997  -13.151 1.00 35.84 ? 263 ILE H CD1 1 
ATOM 8305 N N   . CYS H 1 124 ? -12.695 38.390  -15.227 1.00 37.30 ? 264 CYS H N   1 
ATOM 8306 C CA  . CYS H 1 124 ? -12.776 39.831  -15.036 1.00 39.59 ? 264 CYS H CA  1 
ATOM 8307 C C   . CYS H 1 124 ? -14.172 40.296  -14.635 1.00 41.10 ? 264 CYS H C   1 
ATOM 8308 O O   . CYS H 1 124 ? -15.179 39.727  -15.060 1.00 41.81 ? 264 CYS H O   1 
ATOM 8309 C CB  . CYS H 1 124 ? -12.351 40.552  -16.311 1.00 39.60 ? 264 CYS H CB  1 
ATOM 8310 S SG  . CYS H 1 124 ? -10.737 40.038  -16.965 1.00 41.20 ? 264 CYS H SG  1 
ATOM 8311 N N   . GLN H 1 125 ? -14.221 41.348  -13.825 1.00 42.14 ? 265 GLN H N   1 
ATOM 8312 C CA  . GLN H 1 125 ? -15.483 41.901  -13.353 1.00 43.70 ? 265 GLN H CA  1 
ATOM 8313 C C   . GLN H 1 125 ? -15.453 43.423  -13.321 1.00 45.15 ? 265 GLN H C   1 
ATOM 8314 O O   . GLN H 1 125 ? -14.392 44.031  -13.166 1.00 44.74 ? 265 GLN H O   1 
ATOM 8315 C CB  . GLN H 1 125 ? -15.790 41.365  -11.952 1.00 43.89 ? 265 GLN H CB  1 
ATOM 8316 C CG  . GLN H 1 125 ? -16.112 42.435  -10.917 1.00 42.90 ? 265 GLN H CG  1 
ATOM 8317 C CD  . GLN H 1 125 ? -16.297 41.854  -9.539  1.00 42.06 ? 265 GLN H CD  1 
ATOM 8318 O OE1 . GLN H 1 125 ? -15.433 41.135  -9.044  1.00 42.49 ? 265 GLN H OE1 1 
ATOM 8319 N NE2 . GLN H 1 125 ? -17.425 42.162  -8.907  1.00 40.01 ? 265 GLN H NE2 1 
ATOM 8320 N N   . LYS H 1 126 ? -16.627 44.028  -13.472 1.00 46.56 ? 266 LYS H N   1 
ATOM 8321 C CA  . LYS H 1 126 ? -16.753 45.475  -13.433 1.00 48.19 ? 266 LYS H CA  1 
ATOM 8322 C C   . LYS H 1 126 ? -18.190 45.895  -13.170 1.00 49.66 ? 266 LYS H C   1 
ATOM 8323 O O   . LYS H 1 126 ? -19.106 45.076  -13.211 1.00 50.11 ? 266 LYS H O   1 
ATOM 8324 C CB  . LYS H 1 126 ? -16.225 46.102  -14.728 1.00 46.38 ? 266 LYS H CB  1 
ATOM 8325 C CG  . LYS H 1 126 ? -16.924 45.711  -16.009 1.00 46.05 ? 266 LYS H CG  1 
ATOM 8326 C CD  . LYS H 1 126 ? -16.073 46.193  -17.178 1.00 47.52 ? 266 LYS H CD  1 
ATOM 8327 C CE  . LYS H 1 126 ? -16.770 46.126  -18.525 1.00 47.71 ? 266 LYS H CE  1 
ATOM 8328 N NZ  . LYS H 1 126 ? -15.842 46.591  -19.602 1.00 46.48 ? 266 LYS H NZ  1 
ATOM 8329 N N   . LYS H 1 127 ? -18.377 47.176  -12.884 1.00 51.67 ? 267 LYS H N   1 
ATOM 8330 C CA  . LYS H 1 127 ? -19.695 47.714  -12.583 1.00 53.70 ? 267 LYS H CA  1 
ATOM 8331 C C   . LYS H 1 127 ? -20.628 47.695  -13.788 1.00 53.92 ? 267 LYS H C   1 
ATOM 8332 O O   . LYS H 1 127 ? -20.194 47.883  -14.925 1.00 54.26 ? 267 LYS H O   1 
ATOM 8333 C CB  . LYS H 1 127 ? -19.546 49.141  -12.055 1.00 55.27 ? 267 LYS H CB  1 
ATOM 8334 C CG  . LYS H 1 127 ? -18.694 49.227  -10.794 1.00 59.03 ? 267 LYS H CG  1 
ATOM 8335 C CD  . LYS H 1 127 ? -18.393 50.664  -10.403 1.00 61.67 ? 267 LYS H CD  1 
ATOM 8336 C CE  . LYS H 1 127 ? -17.399 51.302  -11.363 1.00 63.35 ? 267 LYS H CE  1 
ATOM 8337 N NZ  . LYS H 1 127 ? -16.077 50.616  -11.310 1.00 63.76 ? 267 LYS H NZ  1 
ATOM 8338 N N   . ALA H 1 128 ? -21.911 47.453  -13.535 1.00 53.08 ? 268 ALA H N   1 
ATOM 8339 C CA  . ALA H 1 128 ? -22.899 47.428  -14.603 1.00 53.11 ? 268 ALA H CA  1 
ATOM 8340 C C   . ALA H 1 128 ? -23.277 48.861  -14.961 1.00 53.06 ? 268 ALA H C   1 
ATOM 8341 O O   . ALA H 1 128 ? -23.009 49.793  -14.202 1.00 53.88 ? 268 ALA H O   1 
ATOM 8342 C CB  . ALA H 1 128 ? -24.133 46.653  -14.165 1.00 52.30 ? 268 ALA H CB  1 
ATOM 8343 N N   . ASN H 1 129 ? -23.900 49.033  -16.118 1.00 52.74 ? 269 ASN H N   1 
ATOM 8344 C CA  . ASN H 1 129 ? -24.310 50.352  -16.572 1.00 52.62 ? 269 ASN H CA  1 
ATOM 8345 C C   . ASN H 1 129 ? -25.831 50.408  -16.597 1.00 52.95 ? 269 ASN H C   1 
ATOM 8346 O O   . ASN H 1 129 ? -26.453 49.931  -17.543 1.00 53.61 ? 269 ASN H O   1 
ATOM 8347 C CB  . ASN H 1 129 ? -23.766 50.609  -17.978 1.00 51.56 ? 269 ASN H CB  1 
ATOM 8348 C CG  . ASN H 1 129 ? -23.961 52.040  -18.424 1.00 51.14 ? 269 ASN H CG  1 
ATOM 8349 O OD1 . ASN H 1 129 ? -24.954 52.679  -18.077 1.00 50.53 ? 269 ASN H OD1 1 
ATOM 8350 N ND2 . ASN H 1 129 ? -23.020 52.549  -19.209 1.00 51.14 ? 269 ASN H ND2 1 
ATOM 8351 N N   . LEU H 1 130 ? -26.430 50.983  -15.560 1.00 53.10 ? 270 LEU H N   1 
ATOM 8352 C CA  . LEU H 1 130 ? -27.884 51.083  -15.499 1.00 53.36 ? 270 LEU H CA  1 
ATOM 8353 C C   . LEU H 1 130 ? -28.356 52.534  -15.583 1.00 54.22 ? 270 LEU H C   1 
ATOM 8354 O O   . LEU H 1 130 ? -29.023 52.978  -14.624 1.00 55.07 ? 270 LEU H O   1 
ATOM 8355 C CB  . LEU H 1 130 ? -28.410 50.452  -14.207 1.00 51.79 ? 270 LEU H CB  1 
ATOM 8356 C CG  . LEU H 1 130 ? -28.018 49.004  -13.915 1.00 50.51 ? 270 LEU H CG  1 
ATOM 8357 C CD1 . LEU H 1 130 ? -26.562 48.935  -13.505 1.00 50.23 ? 270 LEU H CD1 1 
ATOM 8358 C CD2 . LEU H 1 130 ? -28.892 48.469  -12.802 1.00 50.85 ? 270 LEU H CD2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   141 ?   ?   ?   A . n 
A 1 2   ALA 2   142 142 ALA ALA A . n 
A 1 3   PRO 3   143 143 PRO PRO A . n 
A 1 4   CYS 4   144 144 CYS CYS A . n 
A 1 5   PRO 5   145 145 PRO PRO A . n 
A 1 6   GLN 6   146 146 GLN GLN A . n 
A 1 7   ASP 7   147 147 ASP ASP A . n 
A 1 8   TRP 8   148 148 TRP TRP A . n 
A 1 9   ILE 9   149 149 ILE ILE A . n 
A 1 10  TRP 10  150 150 TRP TRP A . n 
A 1 11  HIS 11  151 151 HIS HIS A . n 
A 1 12  GLY 12  152 152 GLY GLY A . n 
A 1 13  GLU 13  153 153 GLU GLU A . n 
A 1 14  ASN 14  154 154 ASN ASN A . n 
A 1 15  CYS 15  155 155 CYS CYS A . n 
A 1 16  TYR 16  156 156 TYR TYR A . n 
A 1 17  LEU 17  157 157 LEU LEU A . n 
A 1 18  PHE 18  158 158 PHE PHE A . n 
A 1 19  SER 19  159 159 SER SER A . n 
A 1 20  SER 20  160 160 SER SER A . n 
A 1 21  GLY 21  161 161 GLY GLY A . n 
A 1 22  SER 22  162 162 SER SER A . n 
A 1 23  PHE 23  163 163 PHE PHE A . n 
A 1 24  ASN 24  164 164 ASN ASN A . n 
A 1 25  TRP 25  165 165 TRP TRP A . n 
A 1 26  GLU 26  166 166 GLU GLU A . n 
A 1 27  LYS 27  167 167 LYS LYS A . n 
A 1 28  SER 28  168 168 SER SER A . n 
A 1 29  GLN 29  169 169 GLN GLN A . n 
A 1 30  GLU 30  170 170 GLU GLU A . n 
A 1 31  LYS 31  171 171 LYS LYS A . n 
A 1 32  CYS 32  172 172 CYS CYS A . n 
A 1 33  LEU 33  173 173 LEU LEU A . n 
A 1 34  SER 34  174 174 SER SER A . n 
A 1 35  LEU 35  175 175 LEU LEU A . n 
A 1 36  ASP 36  176 176 ASP ASP A . n 
A 1 37  ALA 37  177 177 ALA ALA A . n 
A 1 38  LYS 38  178 178 LYS LYS A . n 
A 1 39  LEU 39  179 179 LEU LEU A . n 
A 1 40  LEU 40  180 180 LEU LEU A . n 
A 1 41  LYS 41  181 181 LYS LYS A . n 
A 1 42  ILE 42  182 182 ILE ILE A . n 
A 1 43  ASN 43  183 183 ASN ASN A . n 
A 1 44  SER 44  184 184 SER SER A . n 
A 1 45  THR 45  185 185 THR THR A . n 
A 1 46  ALA 46  186 186 ALA ALA A . n 
A 1 47  ASP 47  187 187 ASP ASP A . n 
A 1 48  LEU 48  188 188 LEU LEU A . n 
A 1 49  ASP 49  189 189 ASP ASP A . n 
A 1 50  PHE 50  190 190 PHE PHE A . n 
A 1 51  ILE 51  191 191 ILE ILE A . n 
A 1 52  GLN 52  192 192 GLN GLN A . n 
A 1 53  GLN 53  193 193 GLN GLN A . n 
A 1 54  ALA 54  194 194 ALA ALA A . n 
A 1 55  ILE 55  195 195 ILE ILE A . n 
A 1 56  SER 56  196 196 SER SER A . n 
A 1 57  TYR 57  197 197 TYR TYR A . n 
A 1 58  SER 58  198 198 SER SER A . n 
A 1 59  SER 59  199 199 SER SER A . n 
A 1 60  PHE 60  200 200 PHE PHE A . n 
A 1 61  PRO 61  201 201 PRO PRO A . n 
A 1 62  PHE 62  202 202 PHE PHE A . n 
A 1 63  TRP 63  203 203 TRP TRP A . n 
A 1 64  MET 64  204 204 MET MET A . n 
A 1 65  GLY 65  205 205 GLY GLY A . n 
A 1 66  LEU 66  206 206 LEU LEU A . n 
A 1 67  SER 67  207 207 SER SER A . n 
A 1 68  ARG 68  208 208 ARG ARG A . n 
A 1 69  ARG 69  209 209 ARG ARG A . n 
A 1 70  ASN 70  210 210 ASN ASN A . n 
A 1 71  PRO 71  211 211 PRO PRO A . n 
A 1 72  SER 72  212 212 SER SER A . n 
A 1 73  TYR 73  213 213 TYR TYR A . n 
A 1 74  PRO 74  214 214 PRO PRO A . n 
A 1 75  TRP 75  215 215 TRP TRP A . n 
A 1 76  LEU 76  216 216 LEU LEU A . n 
A 1 77  TRP 77  217 217 TRP TRP A . n 
A 1 78  GLU 78  218 218 GLU GLU A . n 
A 1 79  ASP 79  219 219 ASP ASP A . n 
A 1 80  GLY 80  220 220 GLY GLY A . n 
A 1 81  SER 81  221 221 SER SER A . n 
A 1 82  PRO 82  222 222 PRO PRO A . n 
A 1 83  LEU 83  223 223 LEU LEU A . n 
A 1 84  MET 84  224 224 MET MET A . n 
A 1 85  PRO 85  225 225 PRO PRO A . n 
A 1 86  HIS 86  226 226 HIS HIS A . n 
A 1 87  LEU 87  227 227 LEU LEU A . n 
A 1 88  PHE 88  228 228 PHE PHE A . n 
A 1 89  ARG 89  229 229 ARG ARG A . n 
A 1 90  VAL 90  230 230 VAL VAL A . n 
A 1 91  ARG 91  231 231 ARG ARG A . n 
A 1 92  GLY 92  232 232 GLY GLY A . n 
A 1 93  ALA 93  233 233 ALA ALA A . n 
A 1 94  VAL 94  234 234 VAL VAL A . n 
A 1 95  SER 95  235 235 SER SER A . n 
A 1 96  GLN 96  236 236 GLN GLN A . n 
A 1 97  THR 97  237 237 THR THR A . n 
A 1 98  TYR 98  238 238 TYR TYR A . n 
A 1 99  PRO 99  239 239 PRO PRO A . n 
A 1 100 SER 100 240 240 SER SER A . n 
A 1 101 GLY 101 241 241 GLY GLY A . n 
A 1 102 THR 102 242 242 THR THR A . n 
A 1 103 CYS 103 243 243 CYS CYS A . n 
A 1 104 ALA 104 244 244 ALA ALA A . n 
A 1 105 TYR 105 245 245 TYR TYR A . n 
A 1 106 ILE 106 246 246 ILE ILE A . n 
A 1 107 GLN 107 247 247 GLN GLN A . n 
A 1 108 ARG 108 248 248 ARG ARG A . n 
A 1 109 GLY 109 249 249 GLY GLY A . n 
A 1 110 ALA 110 250 250 ALA ALA A . n 
A 1 111 VAL 111 251 251 VAL VAL A . n 
A 1 112 TYR 112 252 252 TYR TYR A . n 
A 1 113 ALA 113 253 253 ALA ALA A . n 
A 1 114 GLU 114 254 254 GLU GLU A . n 
A 1 115 ASN 115 255 255 ASN ASN A . n 
A 1 116 CYS 116 256 256 CYS CYS A . n 
A 1 117 ILE 117 257 257 ILE ILE A . n 
A 1 118 LEU 118 258 258 LEU LEU A . n 
A 1 119 ALA 119 259 259 ALA ALA A . n 
A 1 120 ALA 120 260 260 ALA ALA A . n 
A 1 121 PHE 121 261 261 PHE PHE A . n 
A 1 122 SER 122 262 262 SER SER A . n 
A 1 123 ILE 123 263 263 ILE ILE A . n 
A 1 124 CYS 124 264 264 CYS CYS A . n 
A 1 125 GLN 125 265 265 GLN GLN A . n 
A 1 126 LYS 126 266 266 LYS LYS A . n 
A 1 127 LYS 127 267 267 LYS LYS A . n 
A 1 128 ALA 128 268 268 ALA ALA A . n 
A 1 129 ASN 129 269 269 ASN ASN A . n 
A 1 130 LEU 130 270 270 LEU LEU A . n 
A 1 131 ARG 131 271 271 ARG ARG A . n 
A 1 132 ALA 132 272 ?   ?   ?   A . n 
B 1 1   MET 1   141 141 MET MET B . n 
B 1 2   ALA 2   142 142 ALA ALA B . n 
B 1 3   PRO 3   143 143 PRO PRO B . n 
B 1 4   CYS 4   144 144 CYS CYS B . n 
B 1 5   PRO 5   145 145 PRO PRO B . n 
B 1 6   GLN 6   146 146 GLN GLN B . n 
B 1 7   ASP 7   147 147 ASP ASP B . n 
B 1 8   TRP 8   148 148 TRP TRP B . n 
B 1 9   ILE 9   149 149 ILE ILE B . n 
B 1 10  TRP 10  150 150 TRP TRP B . n 
B 1 11  HIS 11  151 151 HIS HIS B . n 
B 1 12  GLY 12  152 152 GLY GLY B . n 
B 1 13  GLU 13  153 153 GLU GLU B . n 
B 1 14  ASN 14  154 154 ASN ASN B . n 
B 1 15  CYS 15  155 155 CYS CYS B . n 
B 1 16  TYR 16  156 156 TYR TYR B . n 
B 1 17  LEU 17  157 157 LEU LEU B . n 
B 1 18  PHE 18  158 158 PHE PHE B . n 
B 1 19  SER 19  159 159 SER SER B . n 
B 1 20  SER 20  160 160 SER SER B . n 
B 1 21  GLY 21  161 161 GLY GLY B . n 
B 1 22  SER 22  162 162 SER SER B . n 
B 1 23  PHE 23  163 163 PHE PHE B . n 
B 1 24  ASN 24  164 164 ASN ASN B . n 
B 1 25  TRP 25  165 165 TRP TRP B . n 
B 1 26  GLU 26  166 166 GLU GLU B . n 
B 1 27  LYS 27  167 167 LYS LYS B . n 
B 1 28  SER 28  168 168 SER SER B . n 
B 1 29  GLN 29  169 169 GLN GLN B . n 
B 1 30  GLU 30  170 170 GLU GLU B . n 
B 1 31  LYS 31  171 171 LYS LYS B . n 
B 1 32  CYS 32  172 172 CYS CYS B . n 
B 1 33  LEU 33  173 173 LEU LEU B . n 
B 1 34  SER 34  174 174 SER SER B . n 
B 1 35  LEU 35  175 175 LEU LEU B . n 
B 1 36  ASP 36  176 176 ASP ASP B . n 
B 1 37  ALA 37  177 177 ALA ALA B . n 
B 1 38  LYS 38  178 178 LYS LYS B . n 
B 1 39  LEU 39  179 179 LEU LEU B . n 
B 1 40  LEU 40  180 180 LEU LEU B . n 
B 1 41  LYS 41  181 181 LYS LYS B . n 
B 1 42  ILE 42  182 182 ILE ILE B . n 
B 1 43  ASN 43  183 183 ASN ASN B . n 
B 1 44  SER 44  184 184 SER SER B . n 
B 1 45  THR 45  185 185 THR THR B . n 
B 1 46  ALA 46  186 186 ALA ALA B . n 
B 1 47  ASP 47  187 187 ASP ASP B . n 
B 1 48  LEU 48  188 188 LEU LEU B . n 
B 1 49  ASP 49  189 189 ASP ASP B . n 
B 1 50  PHE 50  190 190 PHE PHE B . n 
B 1 51  ILE 51  191 191 ILE ILE B . n 
B 1 52  GLN 52  192 192 GLN GLN B . n 
B 1 53  GLN 53  193 193 GLN GLN B . n 
B 1 54  ALA 54  194 194 ALA ALA B . n 
B 1 55  ILE 55  195 195 ILE ILE B . n 
B 1 56  SER 56  196 196 SER SER B . n 
B 1 57  TYR 57  197 197 TYR TYR B . n 
B 1 58  SER 58  198 198 SER SER B . n 
B 1 59  SER 59  199 199 SER SER B . n 
B 1 60  PHE 60  200 200 PHE PHE B . n 
B 1 61  PRO 61  201 201 PRO PRO B . n 
B 1 62  PHE 62  202 202 PHE PHE B . n 
B 1 63  TRP 63  203 203 TRP TRP B . n 
B 1 64  MET 64  204 204 MET MET B . n 
B 1 65  GLY 65  205 205 GLY GLY B . n 
B 1 66  LEU 66  206 206 LEU LEU B . n 
B 1 67  SER 67  207 207 SER SER B . n 
B 1 68  ARG 68  208 208 ARG ARG B . n 
B 1 69  ARG 69  209 209 ARG ARG B . n 
B 1 70  ASN 70  210 210 ASN ASN B . n 
B 1 71  PRO 71  211 211 PRO PRO B . n 
B 1 72  SER 72  212 212 SER SER B . n 
B 1 73  TYR 73  213 213 TYR TYR B . n 
B 1 74  PRO 74  214 214 PRO PRO B . n 
B 1 75  TRP 75  215 215 TRP TRP B . n 
B 1 76  LEU 76  216 216 LEU LEU B . n 
B 1 77  TRP 77  217 217 TRP TRP B . n 
B 1 78  GLU 78  218 218 GLU GLU B . n 
B 1 79  ASP 79  219 219 ASP ASP B . n 
B 1 80  GLY 80  220 220 GLY GLY B . n 
B 1 81  SER 81  221 221 SER SER B . n 
B 1 82  PRO 82  222 222 PRO PRO B . n 
B 1 83  LEU 83  223 223 LEU LEU B . n 
B 1 84  MET 84  224 224 MET MET B . n 
B 1 85  PRO 85  225 225 PRO PRO B . n 
B 1 86  HIS 86  226 226 HIS HIS B . n 
B 1 87  LEU 87  227 227 LEU LEU B . n 
B 1 88  PHE 88  228 228 PHE PHE B . n 
B 1 89  ARG 89  229 229 ARG ARG B . n 
B 1 90  VAL 90  230 230 VAL VAL B . n 
B 1 91  ARG 91  231 231 ARG ARG B . n 
B 1 92  GLY 92  232 232 GLY GLY B . n 
B 1 93  ALA 93  233 233 ALA ALA B . n 
B 1 94  VAL 94  234 234 VAL VAL B . n 
B 1 95  SER 95  235 235 SER SER B . n 
B 1 96  GLN 96  236 236 GLN GLN B . n 
B 1 97  THR 97  237 237 THR THR B . n 
B 1 98  TYR 98  238 238 TYR TYR B . n 
B 1 99  PRO 99  239 239 PRO PRO B . n 
B 1 100 SER 100 240 240 SER SER B . n 
B 1 101 GLY 101 241 241 GLY GLY B . n 
B 1 102 THR 102 242 242 THR THR B . n 
B 1 103 CYS 103 243 243 CYS CYS B . n 
B 1 104 ALA 104 244 244 ALA ALA B . n 
B 1 105 TYR 105 245 245 TYR TYR B . n 
B 1 106 ILE 106 246 246 ILE ILE B . n 
B 1 107 GLN 107 247 247 GLN GLN B . n 
B 1 108 ARG 108 248 248 ARG ARG B . n 
B 1 109 GLY 109 249 249 GLY GLY B . n 
B 1 110 ALA 110 250 250 ALA ALA B . n 
B 1 111 VAL 111 251 251 VAL VAL B . n 
B 1 112 TYR 112 252 252 TYR TYR B . n 
B 1 113 ALA 113 253 253 ALA ALA B . n 
B 1 114 GLU 114 254 254 GLU GLU B . n 
B 1 115 ASN 115 255 255 ASN ASN B . n 
B 1 116 CYS 116 256 256 CYS CYS B . n 
B 1 117 ILE 117 257 257 ILE ILE B . n 
B 1 118 LEU 118 258 258 LEU LEU B . n 
B 1 119 ALA 119 259 259 ALA ALA B . n 
B 1 120 ALA 120 260 260 ALA ALA B . n 
B 1 121 PHE 121 261 261 PHE PHE B . n 
B 1 122 SER 122 262 262 SER SER B . n 
B 1 123 ILE 123 263 263 ILE ILE B . n 
B 1 124 CYS 124 264 264 CYS CYS B . n 
B 1 125 GLN 125 265 265 GLN GLN B . n 
B 1 126 LYS 126 266 266 LYS LYS B . n 
B 1 127 LYS 127 267 267 LYS LYS B . n 
B 1 128 ALA 128 268 268 ALA ALA B . n 
B 1 129 ASN 129 269 269 ASN ASN B . n 
B 1 130 LEU 130 270 270 LEU LEU B . n 
B 1 131 ARG 131 271 271 ARG ARG B . n 
B 1 132 ALA 132 272 272 ALA ALA B . n 
C 1 1   MET 1   141 141 MET MET C . n 
C 1 2   ALA 2   142 142 ALA ALA C . n 
C 1 3   PRO 3   143 143 PRO PRO C . n 
C 1 4   CYS 4   144 144 CYS CYS C . n 
C 1 5   PRO 5   145 145 PRO PRO C . n 
C 1 6   GLN 6   146 146 GLN GLN C . n 
C 1 7   ASP 7   147 147 ASP ASP C . n 
C 1 8   TRP 8   148 148 TRP TRP C . n 
C 1 9   ILE 9   149 149 ILE ILE C . n 
C 1 10  TRP 10  150 150 TRP TRP C . n 
C 1 11  HIS 11  151 151 HIS HIS C . n 
C 1 12  GLY 12  152 152 GLY GLY C . n 
C 1 13  GLU 13  153 153 GLU GLU C . n 
C 1 14  ASN 14  154 154 ASN ASN C . n 
C 1 15  CYS 15  155 155 CYS CYS C . n 
C 1 16  TYR 16  156 156 TYR TYR C . n 
C 1 17  LEU 17  157 157 LEU LEU C . n 
C 1 18  PHE 18  158 158 PHE PHE C . n 
C 1 19  SER 19  159 159 SER SER C . n 
C 1 20  SER 20  160 160 SER SER C . n 
C 1 21  GLY 21  161 161 GLY GLY C . n 
C 1 22  SER 22  162 162 SER SER C . n 
C 1 23  PHE 23  163 163 PHE PHE C . n 
C 1 24  ASN 24  164 164 ASN ASN C . n 
C 1 25  TRP 25  165 165 TRP TRP C . n 
C 1 26  GLU 26  166 166 GLU GLU C . n 
C 1 27  LYS 27  167 167 LYS LYS C . n 
C 1 28  SER 28  168 168 SER SER C . n 
C 1 29  GLN 29  169 169 GLN GLN C . n 
C 1 30  GLU 30  170 170 GLU GLU C . n 
C 1 31  LYS 31  171 171 LYS LYS C . n 
C 1 32  CYS 32  172 172 CYS CYS C . n 
C 1 33  LEU 33  173 173 LEU LEU C . n 
C 1 34  SER 34  174 174 SER SER C . n 
C 1 35  LEU 35  175 175 LEU LEU C . n 
C 1 36  ASP 36  176 176 ASP ASP C . n 
C 1 37  ALA 37  177 177 ALA ALA C . n 
C 1 38  LYS 38  178 178 LYS LYS C . n 
C 1 39  LEU 39  179 179 LEU LEU C . n 
C 1 40  LEU 40  180 180 LEU LEU C . n 
C 1 41  LYS 41  181 181 LYS LYS C . n 
C 1 42  ILE 42  182 182 ILE ILE C . n 
C 1 43  ASN 43  183 183 ASN ASN C . n 
C 1 44  SER 44  184 184 SER SER C . n 
C 1 45  THR 45  185 185 THR THR C . n 
C 1 46  ALA 46  186 186 ALA ALA C . n 
C 1 47  ASP 47  187 187 ASP ASP C . n 
C 1 48  LEU 48  188 188 LEU LEU C . n 
C 1 49  ASP 49  189 189 ASP ASP C . n 
C 1 50  PHE 50  190 190 PHE PHE C . n 
C 1 51  ILE 51  191 191 ILE ILE C . n 
C 1 52  GLN 52  192 192 GLN GLN C . n 
C 1 53  GLN 53  193 193 GLN GLN C . n 
C 1 54  ALA 54  194 194 ALA ALA C . n 
C 1 55  ILE 55  195 195 ILE ILE C . n 
C 1 56  SER 56  196 196 SER SER C . n 
C 1 57  TYR 57  197 197 TYR TYR C . n 
C 1 58  SER 58  198 198 SER SER C . n 
C 1 59  SER 59  199 199 SER SER C . n 
C 1 60  PHE 60  200 200 PHE PHE C . n 
C 1 61  PRO 61  201 201 PRO PRO C . n 
C 1 62  PHE 62  202 202 PHE PHE C . n 
C 1 63  TRP 63  203 203 TRP TRP C . n 
C 1 64  MET 64  204 204 MET MET C . n 
C 1 65  GLY 65  205 205 GLY GLY C . n 
C 1 66  LEU 66  206 206 LEU LEU C . n 
C 1 67  SER 67  207 207 SER SER C . n 
C 1 68  ARG 68  208 208 ARG ARG C . n 
C 1 69  ARG 69  209 209 ARG ARG C . n 
C 1 70  ASN 70  210 210 ASN ASN C . n 
C 1 71  PRO 71  211 211 PRO PRO C . n 
C 1 72  SER 72  212 212 SER SER C . n 
C 1 73  TYR 73  213 213 TYR TYR C . n 
C 1 74  PRO 74  214 214 PRO PRO C . n 
C 1 75  TRP 75  215 215 TRP TRP C . n 
C 1 76  LEU 76  216 216 LEU LEU C . n 
C 1 77  TRP 77  217 217 TRP TRP C . n 
C 1 78  GLU 78  218 218 GLU GLU C . n 
C 1 79  ASP 79  219 219 ASP ASP C . n 
C 1 80  GLY 80  220 220 GLY GLY C . n 
C 1 81  SER 81  221 221 SER SER C . n 
C 1 82  PRO 82  222 222 PRO PRO C . n 
C 1 83  LEU 83  223 223 LEU LEU C . n 
C 1 84  MET 84  224 224 MET MET C . n 
C 1 85  PRO 85  225 225 PRO PRO C . n 
C 1 86  HIS 86  226 226 HIS HIS C . n 
C 1 87  LEU 87  227 227 LEU LEU C . n 
C 1 88  PHE 88  228 228 PHE PHE C . n 
C 1 89  ARG 89  229 229 ARG ARG C . n 
C 1 90  VAL 90  230 230 VAL VAL C . n 
C 1 91  ARG 91  231 231 ARG ARG C . n 
C 1 92  GLY 92  232 232 GLY GLY C . n 
C 1 93  ALA 93  233 233 ALA ALA C . n 
C 1 94  VAL 94  234 234 VAL VAL C . n 
C 1 95  SER 95  235 235 SER SER C . n 
C 1 96  GLN 96  236 236 GLN GLN C . n 
C 1 97  THR 97  237 237 THR THR C . n 
C 1 98  TYR 98  238 238 TYR TYR C . n 
C 1 99  PRO 99  239 239 PRO PRO C . n 
C 1 100 SER 100 240 240 SER SER C . n 
C 1 101 GLY 101 241 241 GLY GLY C . n 
C 1 102 THR 102 242 242 THR THR C . n 
C 1 103 CYS 103 243 243 CYS CYS C . n 
C 1 104 ALA 104 244 244 ALA ALA C . n 
C 1 105 TYR 105 245 245 TYR TYR C . n 
C 1 106 ILE 106 246 246 ILE ILE C . n 
C 1 107 GLN 107 247 247 GLN GLN C . n 
C 1 108 ARG 108 248 248 ARG ARG C . n 
C 1 109 GLY 109 249 249 GLY GLY C . n 
C 1 110 ALA 110 250 250 ALA ALA C . n 
C 1 111 VAL 111 251 251 VAL VAL C . n 
C 1 112 TYR 112 252 252 TYR TYR C . n 
C 1 113 ALA 113 253 253 ALA ALA C . n 
C 1 114 GLU 114 254 254 GLU GLU C . n 
C 1 115 ASN 115 255 255 ASN ASN C . n 
C 1 116 CYS 116 256 256 CYS CYS C . n 
C 1 117 ILE 117 257 257 ILE ILE C . n 
C 1 118 LEU 118 258 258 LEU LEU C . n 
C 1 119 ALA 119 259 259 ALA ALA C . n 
C 1 120 ALA 120 260 260 ALA ALA C . n 
C 1 121 PHE 121 261 261 PHE PHE C . n 
C 1 122 SER 122 262 262 SER SER C . n 
C 1 123 ILE 123 263 263 ILE ILE C . n 
C 1 124 CYS 124 264 264 CYS CYS C . n 
C 1 125 GLN 125 265 265 GLN GLN C . n 
C 1 126 LYS 126 266 266 LYS LYS C . n 
C 1 127 LYS 127 267 267 LYS LYS C . n 
C 1 128 ALA 128 268 268 ALA ALA C . n 
C 1 129 ASN 129 269 269 ASN ASN C . n 
C 1 130 LEU 130 270 270 LEU LEU C . n 
C 1 131 ARG 131 271 271 ARG ARG C . n 
C 1 132 ALA 132 272 272 ALA ALA C . n 
D 1 1   MET 1   141 ?   ?   ?   D . n 
D 1 2   ALA 2   142 142 ALA ALA D . n 
D 1 3   PRO 3   143 143 PRO PRO D . n 
D 1 4   CYS 4   144 144 CYS CYS D . n 
D 1 5   PRO 5   145 145 PRO PRO D . n 
D 1 6   GLN 6   146 146 GLN GLN D . n 
D 1 7   ASP 7   147 147 ASP ASP D . n 
D 1 8   TRP 8   148 148 TRP TRP D . n 
D 1 9   ILE 9   149 149 ILE ILE D . n 
D 1 10  TRP 10  150 150 TRP TRP D . n 
D 1 11  HIS 11  151 151 HIS HIS D . n 
D 1 12  GLY 12  152 152 GLY GLY D . n 
D 1 13  GLU 13  153 153 GLU GLU D . n 
D 1 14  ASN 14  154 154 ASN ASN D . n 
D 1 15  CYS 15  155 155 CYS CYS D . n 
D 1 16  TYR 16  156 156 TYR TYR D . n 
D 1 17  LEU 17  157 157 LEU LEU D . n 
D 1 18  PHE 18  158 158 PHE PHE D . n 
D 1 19  SER 19  159 159 SER SER D . n 
D 1 20  SER 20  160 160 SER SER D . n 
D 1 21  GLY 21  161 161 GLY GLY D . n 
D 1 22  SER 22  162 162 SER SER D . n 
D 1 23  PHE 23  163 163 PHE PHE D . n 
D 1 24  ASN 24  164 164 ASN ASN D . n 
D 1 25  TRP 25  165 165 TRP TRP D . n 
D 1 26  GLU 26  166 166 GLU GLU D . n 
D 1 27  LYS 27  167 167 LYS LYS D . n 
D 1 28  SER 28  168 168 SER SER D . n 
D 1 29  GLN 29  169 169 GLN GLN D . n 
D 1 30  GLU 30  170 170 GLU GLU D . n 
D 1 31  LYS 31  171 171 LYS LYS D . n 
D 1 32  CYS 32  172 172 CYS CYS D . n 
D 1 33  LEU 33  173 173 LEU LEU D . n 
D 1 34  SER 34  174 174 SER SER D . n 
D 1 35  LEU 35  175 175 LEU LEU D . n 
D 1 36  ASP 36  176 176 ASP ASP D . n 
D 1 37  ALA 37  177 177 ALA ALA D . n 
D 1 38  LYS 38  178 178 LYS LYS D . n 
D 1 39  LEU 39  179 179 LEU LEU D . n 
D 1 40  LEU 40  180 180 LEU LEU D . n 
D 1 41  LYS 41  181 181 LYS LYS D . n 
D 1 42  ILE 42  182 182 ILE ILE D . n 
D 1 43  ASN 43  183 183 ASN ASN D . n 
D 1 44  SER 44  184 184 SER SER D . n 
D 1 45  THR 45  185 185 THR THR D . n 
D 1 46  ALA 46  186 186 ALA ALA D . n 
D 1 47  ASP 47  187 187 ASP ASP D . n 
D 1 48  LEU 48  188 188 LEU LEU D . n 
D 1 49  ASP 49  189 189 ASP ASP D . n 
D 1 50  PHE 50  190 190 PHE PHE D . n 
D 1 51  ILE 51  191 191 ILE ILE D . n 
D 1 52  GLN 52  192 192 GLN GLN D . n 
D 1 53  GLN 53  193 193 GLN GLN D . n 
D 1 54  ALA 54  194 194 ALA ALA D . n 
D 1 55  ILE 55  195 195 ILE ILE D . n 
D 1 56  SER 56  196 196 SER SER D . n 
D 1 57  TYR 57  197 197 TYR TYR D . n 
D 1 58  SER 58  198 198 SER SER D . n 
D 1 59  SER 59  199 199 SER SER D . n 
D 1 60  PHE 60  200 200 PHE PHE D . n 
D 1 61  PRO 61  201 201 PRO PRO D . n 
D 1 62  PHE 62  202 202 PHE PHE D . n 
D 1 63  TRP 63  203 203 TRP TRP D . n 
D 1 64  MET 64  204 204 MET MET D . n 
D 1 65  GLY 65  205 205 GLY GLY D . n 
D 1 66  LEU 66  206 206 LEU LEU D . n 
D 1 67  SER 67  207 207 SER SER D . n 
D 1 68  ARG 68  208 208 ARG ARG D . n 
D 1 69  ARG 69  209 209 ARG ARG D . n 
D 1 70  ASN 70  210 210 ASN ASN D . n 
D 1 71  PRO 71  211 211 PRO PRO D . n 
D 1 72  SER 72  212 212 SER SER D . n 
D 1 73  TYR 73  213 213 TYR TYR D . n 
D 1 74  PRO 74  214 214 PRO PRO D . n 
D 1 75  TRP 75  215 215 TRP TRP D . n 
D 1 76  LEU 76  216 216 LEU LEU D . n 
D 1 77  TRP 77  217 217 TRP TRP D . n 
D 1 78  GLU 78  218 218 GLU GLU D . n 
D 1 79  ASP 79  219 219 ASP ASP D . n 
D 1 80  GLY 80  220 220 GLY GLY D . n 
D 1 81  SER 81  221 221 SER SER D . n 
D 1 82  PRO 82  222 222 PRO PRO D . n 
D 1 83  LEU 83  223 223 LEU LEU D . n 
D 1 84  MET 84  224 224 MET MET D . n 
D 1 85  PRO 85  225 225 PRO PRO D . n 
D 1 86  HIS 86  226 226 HIS HIS D . n 
D 1 87  LEU 87  227 227 LEU LEU D . n 
D 1 88  PHE 88  228 228 PHE PHE D . n 
D 1 89  ARG 89  229 229 ARG ARG D . n 
D 1 90  VAL 90  230 230 VAL VAL D . n 
D 1 91  ARG 91  231 231 ARG ARG D . n 
D 1 92  GLY 92  232 232 GLY GLY D . n 
D 1 93  ALA 93  233 233 ALA ALA D . n 
D 1 94  VAL 94  234 234 VAL VAL D . n 
D 1 95  SER 95  235 235 SER SER D . n 
D 1 96  GLN 96  236 236 GLN GLN D . n 
D 1 97  THR 97  237 237 THR THR D . n 
D 1 98  TYR 98  238 238 TYR TYR D . n 
D 1 99  PRO 99  239 239 PRO PRO D . n 
D 1 100 SER 100 240 240 SER SER D . n 
D 1 101 GLY 101 241 241 GLY GLY D . n 
D 1 102 THR 102 242 242 THR THR D . n 
D 1 103 CYS 103 243 243 CYS CYS D . n 
D 1 104 ALA 104 244 244 ALA ALA D . n 
D 1 105 TYR 105 245 245 TYR TYR D . n 
D 1 106 ILE 106 246 246 ILE ILE D . n 
D 1 107 GLN 107 247 247 GLN GLN D . n 
D 1 108 ARG 108 248 248 ARG ARG D . n 
D 1 109 GLY 109 249 249 GLY GLY D . n 
D 1 110 ALA 110 250 250 ALA ALA D . n 
D 1 111 VAL 111 251 251 VAL VAL D . n 
D 1 112 TYR 112 252 252 TYR TYR D . n 
D 1 113 ALA 113 253 253 ALA ALA D . n 
D 1 114 GLU 114 254 254 GLU GLU D . n 
D 1 115 ASN 115 255 255 ASN ASN D . n 
D 1 116 CYS 116 256 256 CYS CYS D . n 
D 1 117 ILE 117 257 257 ILE ILE D . n 
D 1 118 LEU 118 258 258 LEU LEU D . n 
D 1 119 ALA 119 259 259 ALA ALA D . n 
D 1 120 ALA 120 260 260 ALA ALA D . n 
D 1 121 PHE 121 261 261 PHE PHE D . n 
D 1 122 SER 122 262 262 SER SER D . n 
D 1 123 ILE 123 263 263 ILE ILE D . n 
D 1 124 CYS 124 264 264 CYS CYS D . n 
D 1 125 GLN 125 265 265 GLN GLN D . n 
D 1 126 LYS 126 266 266 LYS LYS D . n 
D 1 127 LYS 127 267 267 LYS LYS D . n 
D 1 128 ALA 128 268 268 ALA ALA D . n 
D 1 129 ASN 129 269 269 ASN ASN D . n 
D 1 130 LEU 130 270 270 LEU LEU D . n 
D 1 131 ARG 131 271 ?   ?   ?   D . n 
D 1 132 ALA 132 272 ?   ?   ?   D . n 
E 1 1   MET 1   141 ?   ?   ?   E . n 
E 1 2   ALA 2   142 142 ALA ALA E . n 
E 1 3   PRO 3   143 143 PRO PRO E . n 
E 1 4   CYS 4   144 144 CYS CYS E . n 
E 1 5   PRO 5   145 145 PRO PRO E . n 
E 1 6   GLN 6   146 146 GLN GLN E . n 
E 1 7   ASP 7   147 147 ASP ASP E . n 
E 1 8   TRP 8   148 148 TRP TRP E . n 
E 1 9   ILE 9   149 149 ILE ILE E . n 
E 1 10  TRP 10  150 150 TRP TRP E . n 
E 1 11  HIS 11  151 151 HIS HIS E . n 
E 1 12  GLY 12  152 152 GLY GLY E . n 
E 1 13  GLU 13  153 153 GLU GLU E . n 
E 1 14  ASN 14  154 154 ASN ASN E . n 
E 1 15  CYS 15  155 155 CYS CYS E . n 
E 1 16  TYR 16  156 156 TYR TYR E . n 
E 1 17  LEU 17  157 157 LEU LEU E . n 
E 1 18  PHE 18  158 158 PHE PHE E . n 
E 1 19  SER 19  159 159 SER SER E . n 
E 1 20  SER 20  160 160 SER SER E . n 
E 1 21  GLY 21  161 161 GLY GLY E . n 
E 1 22  SER 22  162 162 SER SER E . n 
E 1 23  PHE 23  163 163 PHE PHE E . n 
E 1 24  ASN 24  164 164 ASN ASN E . n 
E 1 25  TRP 25  165 165 TRP TRP E . n 
E 1 26  GLU 26  166 166 GLU GLU E . n 
E 1 27  LYS 27  167 167 LYS LYS E . n 
E 1 28  SER 28  168 168 SER SER E . n 
E 1 29  GLN 29  169 169 GLN GLN E . n 
E 1 30  GLU 30  170 170 GLU GLU E . n 
E 1 31  LYS 31  171 171 LYS LYS E . n 
E 1 32  CYS 32  172 172 CYS CYS E . n 
E 1 33  LEU 33  173 173 LEU LEU E . n 
E 1 34  SER 34  174 174 SER SER E . n 
E 1 35  LEU 35  175 175 LEU LEU E . n 
E 1 36  ASP 36  176 176 ASP ASP E . n 
E 1 37  ALA 37  177 177 ALA ALA E . n 
E 1 38  LYS 38  178 178 LYS LYS E . n 
E 1 39  LEU 39  179 179 LEU LEU E . n 
E 1 40  LEU 40  180 180 LEU LEU E . n 
E 1 41  LYS 41  181 181 LYS LYS E . n 
E 1 42  ILE 42  182 182 ILE ILE E . n 
E 1 43  ASN 43  183 183 ASN ASN E . n 
E 1 44  SER 44  184 184 SER SER E . n 
E 1 45  THR 45  185 185 THR THR E . n 
E 1 46  ALA 46  186 186 ALA ALA E . n 
E 1 47  ASP 47  187 187 ASP ASP E . n 
E 1 48  LEU 48  188 188 LEU LEU E . n 
E 1 49  ASP 49  189 189 ASP ASP E . n 
E 1 50  PHE 50  190 190 PHE PHE E . n 
E 1 51  ILE 51  191 191 ILE ILE E . n 
E 1 52  GLN 52  192 192 GLN GLN E . n 
E 1 53  GLN 53  193 193 GLN GLN E . n 
E 1 54  ALA 54  194 194 ALA ALA E . n 
E 1 55  ILE 55  195 195 ILE ILE E . n 
E 1 56  SER 56  196 196 SER SER E . n 
E 1 57  TYR 57  197 197 TYR TYR E . n 
E 1 58  SER 58  198 198 SER SER E . n 
E 1 59  SER 59  199 199 SER SER E . n 
E 1 60  PHE 60  200 200 PHE PHE E . n 
E 1 61  PRO 61  201 201 PRO PRO E . n 
E 1 62  PHE 62  202 202 PHE PHE E . n 
E 1 63  TRP 63  203 203 TRP TRP E . n 
E 1 64  MET 64  204 204 MET MET E . n 
E 1 65  GLY 65  205 205 GLY GLY E . n 
E 1 66  LEU 66  206 206 LEU LEU E . n 
E 1 67  SER 67  207 207 SER SER E . n 
E 1 68  ARG 68  208 208 ARG ARG E . n 
E 1 69  ARG 69  209 209 ARG ARG E . n 
E 1 70  ASN 70  210 210 ASN ASN E . n 
E 1 71  PRO 71  211 211 PRO PRO E . n 
E 1 72  SER 72  212 212 SER SER E . n 
E 1 73  TYR 73  213 213 TYR TYR E . n 
E 1 74  PRO 74  214 214 PRO PRO E . n 
E 1 75  TRP 75  215 215 TRP TRP E . n 
E 1 76  LEU 76  216 216 LEU LEU E . n 
E 1 77  TRP 77  217 217 TRP TRP E . n 
E 1 78  GLU 78  218 218 GLU GLU E . n 
E 1 79  ASP 79  219 219 ASP ASP E . n 
E 1 80  GLY 80  220 220 GLY GLY E . n 
E 1 81  SER 81  221 221 SER SER E . n 
E 1 82  PRO 82  222 222 PRO PRO E . n 
E 1 83  LEU 83  223 223 LEU LEU E . n 
E 1 84  MET 84  224 224 MET MET E . n 
E 1 85  PRO 85  225 225 PRO PRO E . n 
E 1 86  HIS 86  226 226 HIS HIS E . n 
E 1 87  LEU 87  227 227 LEU LEU E . n 
E 1 88  PHE 88  228 228 PHE PHE E . n 
E 1 89  ARG 89  229 229 ARG ARG E . n 
E 1 90  VAL 90  230 230 VAL VAL E . n 
E 1 91  ARG 91  231 231 ARG ARG E . n 
E 1 92  GLY 92  232 232 GLY GLY E . n 
E 1 93  ALA 93  233 233 ALA ALA E . n 
E 1 94  VAL 94  234 234 VAL VAL E . n 
E 1 95  SER 95  235 235 SER SER E . n 
E 1 96  GLN 96  236 236 GLN GLN E . n 
E 1 97  THR 97  237 237 THR THR E . n 
E 1 98  TYR 98  238 238 TYR TYR E . n 
E 1 99  PRO 99  239 239 PRO PRO E . n 
E 1 100 SER 100 240 240 SER SER E . n 
E 1 101 GLY 101 241 241 GLY GLY E . n 
E 1 102 THR 102 242 242 THR THR E . n 
E 1 103 CYS 103 243 243 CYS CYS E . n 
E 1 104 ALA 104 244 244 ALA ALA E . n 
E 1 105 TYR 105 245 245 TYR TYR E . n 
E 1 106 ILE 106 246 246 ILE ILE E . n 
E 1 107 GLN 107 247 247 GLN GLN E . n 
E 1 108 ARG 108 248 248 ARG ARG E . n 
E 1 109 GLY 109 249 249 GLY GLY E . n 
E 1 110 ALA 110 250 250 ALA ALA E . n 
E 1 111 VAL 111 251 251 VAL VAL E . n 
E 1 112 TYR 112 252 252 TYR TYR E . n 
E 1 113 ALA 113 253 253 ALA ALA E . n 
E 1 114 GLU 114 254 254 GLU GLU E . n 
E 1 115 ASN 115 255 255 ASN ASN E . n 
E 1 116 CYS 116 256 256 CYS CYS E . n 
E 1 117 ILE 117 257 257 ILE ILE E . n 
E 1 118 LEU 118 258 258 LEU LEU E . n 
E 1 119 ALA 119 259 259 ALA ALA E . n 
E 1 120 ALA 120 260 260 ALA ALA E . n 
E 1 121 PHE 121 261 261 PHE PHE E . n 
E 1 122 SER 122 262 262 SER SER E . n 
E 1 123 ILE 123 263 263 ILE ILE E . n 
E 1 124 CYS 124 264 264 CYS CYS E . n 
E 1 125 GLN 125 265 265 GLN GLN E . n 
E 1 126 LYS 126 266 266 LYS LYS E . n 
E 1 127 LYS 127 267 267 LYS LYS E . n 
E 1 128 ALA 128 268 268 ALA ALA E . n 
E 1 129 ASN 129 269 269 ASN ASN E . n 
E 1 130 LEU 130 270 270 LEU LEU E . n 
E 1 131 ARG 131 271 ?   ?   ?   E . n 
E 1 132 ALA 132 272 ?   ?   ?   E . n 
F 1 1   MET 1   141 141 MET MET F . n 
F 1 2   ALA 2   142 142 ALA ALA F . n 
F 1 3   PRO 3   143 143 PRO PRO F . n 
F 1 4   CYS 4   144 144 CYS CYS F . n 
F 1 5   PRO 5   145 145 PRO PRO F . n 
F 1 6   GLN 6   146 146 GLN GLN F . n 
F 1 7   ASP 7   147 147 ASP ASP F . n 
F 1 8   TRP 8   148 148 TRP TRP F . n 
F 1 9   ILE 9   149 149 ILE ILE F . n 
F 1 10  TRP 10  150 150 TRP TRP F . n 
F 1 11  HIS 11  151 151 HIS HIS F . n 
F 1 12  GLY 12  152 152 GLY GLY F . n 
F 1 13  GLU 13  153 153 GLU GLU F . n 
F 1 14  ASN 14  154 154 ASN ASN F . n 
F 1 15  CYS 15  155 155 CYS CYS F . n 
F 1 16  TYR 16  156 156 TYR TYR F . n 
F 1 17  LEU 17  157 157 LEU LEU F . n 
F 1 18  PHE 18  158 158 PHE PHE F . n 
F 1 19  SER 19  159 159 SER SER F . n 
F 1 20  SER 20  160 160 SER SER F . n 
F 1 21  GLY 21  161 161 GLY GLY F . n 
F 1 22  SER 22  162 162 SER SER F . n 
F 1 23  PHE 23  163 163 PHE PHE F . n 
F 1 24  ASN 24  164 164 ASN ASN F . n 
F 1 25  TRP 25  165 165 TRP TRP F . n 
F 1 26  GLU 26  166 166 GLU GLU F . n 
F 1 27  LYS 27  167 167 LYS LYS F . n 
F 1 28  SER 28  168 168 SER SER F . n 
F 1 29  GLN 29  169 169 GLN GLN F . n 
F 1 30  GLU 30  170 170 GLU GLU F . n 
F 1 31  LYS 31  171 171 LYS LYS F . n 
F 1 32  CYS 32  172 172 CYS CYS F . n 
F 1 33  LEU 33  173 173 LEU LEU F . n 
F 1 34  SER 34  174 174 SER SER F . n 
F 1 35  LEU 35  175 175 LEU LEU F . n 
F 1 36  ASP 36  176 176 ASP ASP F . n 
F 1 37  ALA 37  177 177 ALA ALA F . n 
F 1 38  LYS 38  178 178 LYS LYS F . n 
F 1 39  LEU 39  179 179 LEU LEU F . n 
F 1 40  LEU 40  180 180 LEU LEU F . n 
F 1 41  LYS 41  181 181 LYS LYS F . n 
F 1 42  ILE 42  182 182 ILE ILE F . n 
F 1 43  ASN 43  183 183 ASN ASN F . n 
F 1 44  SER 44  184 184 SER SER F . n 
F 1 45  THR 45  185 185 THR THR F . n 
F 1 46  ALA 46  186 186 ALA ALA F . n 
F 1 47  ASP 47  187 187 ASP ASP F . n 
F 1 48  LEU 48  188 188 LEU LEU F . n 
F 1 49  ASP 49  189 189 ASP ASP F . n 
F 1 50  PHE 50  190 190 PHE PHE F . n 
F 1 51  ILE 51  191 191 ILE ILE F . n 
F 1 52  GLN 52  192 192 GLN GLN F . n 
F 1 53  GLN 53  193 193 GLN GLN F . n 
F 1 54  ALA 54  194 194 ALA ALA F . n 
F 1 55  ILE 55  195 195 ILE ILE F . n 
F 1 56  SER 56  196 196 SER SER F . n 
F 1 57  TYR 57  197 197 TYR TYR F . n 
F 1 58  SER 58  198 198 SER SER F . n 
F 1 59  SER 59  199 199 SER SER F . n 
F 1 60  PHE 60  200 200 PHE PHE F . n 
F 1 61  PRO 61  201 201 PRO PRO F . n 
F 1 62  PHE 62  202 202 PHE PHE F . n 
F 1 63  TRP 63  203 203 TRP TRP F . n 
F 1 64  MET 64  204 204 MET MET F . n 
F 1 65  GLY 65  205 205 GLY GLY F . n 
F 1 66  LEU 66  206 206 LEU LEU F . n 
F 1 67  SER 67  207 207 SER SER F . n 
F 1 68  ARG 68  208 208 ARG ARG F . n 
F 1 69  ARG 69  209 209 ARG ARG F . n 
F 1 70  ASN 70  210 210 ASN ASN F . n 
F 1 71  PRO 71  211 211 PRO PRO F . n 
F 1 72  SER 72  212 212 SER SER F . n 
F 1 73  TYR 73  213 213 TYR TYR F . n 
F 1 74  PRO 74  214 214 PRO PRO F . n 
F 1 75  TRP 75  215 215 TRP TRP F . n 
F 1 76  LEU 76  216 216 LEU LEU F . n 
F 1 77  TRP 77  217 217 TRP TRP F . n 
F 1 78  GLU 78  218 218 GLU GLU F . n 
F 1 79  ASP 79  219 219 ASP ASP F . n 
F 1 80  GLY 80  220 220 GLY GLY F . n 
F 1 81  SER 81  221 221 SER SER F . n 
F 1 82  PRO 82  222 222 PRO PRO F . n 
F 1 83  LEU 83  223 223 LEU LEU F . n 
F 1 84  MET 84  224 224 MET MET F . n 
F 1 85  PRO 85  225 225 PRO PRO F . n 
F 1 86  HIS 86  226 226 HIS HIS F . n 
F 1 87  LEU 87  227 227 LEU LEU F . n 
F 1 88  PHE 88  228 228 PHE PHE F . n 
F 1 89  ARG 89  229 229 ARG ARG F . n 
F 1 90  VAL 90  230 230 VAL VAL F . n 
F 1 91  ARG 91  231 231 ARG ARG F . n 
F 1 92  GLY 92  232 232 GLY GLY F . n 
F 1 93  ALA 93  233 233 ALA ALA F . n 
F 1 94  VAL 94  234 234 VAL VAL F . n 
F 1 95  SER 95  235 235 SER SER F . n 
F 1 96  GLN 96  236 236 GLN GLN F . n 
F 1 97  THR 97  237 237 THR THR F . n 
F 1 98  TYR 98  238 238 TYR TYR F . n 
F 1 99  PRO 99  239 239 PRO PRO F . n 
F 1 100 SER 100 240 240 SER SER F . n 
F 1 101 GLY 101 241 241 GLY GLY F . n 
F 1 102 THR 102 242 242 THR THR F . n 
F 1 103 CYS 103 243 243 CYS CYS F . n 
F 1 104 ALA 104 244 244 ALA ALA F . n 
F 1 105 TYR 105 245 245 TYR TYR F . n 
F 1 106 ILE 106 246 246 ILE ILE F . n 
F 1 107 GLN 107 247 247 GLN GLN F . n 
F 1 108 ARG 108 248 248 ARG ARG F . n 
F 1 109 GLY 109 249 249 GLY GLY F . n 
F 1 110 ALA 110 250 250 ALA ALA F . n 
F 1 111 VAL 111 251 251 VAL VAL F . n 
F 1 112 TYR 112 252 252 TYR TYR F . n 
F 1 113 ALA 113 253 253 ALA ALA F . n 
F 1 114 GLU 114 254 254 GLU GLU F . n 
F 1 115 ASN 115 255 255 ASN ASN F . n 
F 1 116 CYS 116 256 256 CYS CYS F . n 
F 1 117 ILE 117 257 257 ILE ILE F . n 
F 1 118 LEU 118 258 258 LEU LEU F . n 
F 1 119 ALA 119 259 259 ALA ALA F . n 
F 1 120 ALA 120 260 260 ALA ALA F . n 
F 1 121 PHE 121 261 261 PHE PHE F . n 
F 1 122 SER 122 262 262 SER SER F . n 
F 1 123 ILE 123 263 263 ILE ILE F . n 
F 1 124 CYS 124 264 264 CYS CYS F . n 
F 1 125 GLN 125 265 265 GLN GLN F . n 
F 1 126 LYS 126 266 266 LYS LYS F . n 
F 1 127 LYS 127 267 267 LYS LYS F . n 
F 1 128 ALA 128 268 268 ALA ALA F . n 
F 1 129 ASN 129 269 269 ASN ASN F . n 
F 1 130 LEU 130 270 270 LEU LEU F . n 
F 1 131 ARG 131 271 ?   ?   ?   F . n 
F 1 132 ALA 132 272 ?   ?   ?   F . n 
G 1 1   MET 1   141 141 MET MET G . n 
G 1 2   ALA 2   142 142 ALA ALA G . n 
G 1 3   PRO 3   143 143 PRO PRO G . n 
G 1 4   CYS 4   144 144 CYS CYS G . n 
G 1 5   PRO 5   145 145 PRO PRO G . n 
G 1 6   GLN 6   146 146 GLN GLN G . n 
G 1 7   ASP 7   147 147 ASP ASP G . n 
G 1 8   TRP 8   148 148 TRP TRP G . n 
G 1 9   ILE 9   149 149 ILE ILE G . n 
G 1 10  TRP 10  150 150 TRP TRP G . n 
G 1 11  HIS 11  151 151 HIS HIS G . n 
G 1 12  GLY 12  152 152 GLY GLY G . n 
G 1 13  GLU 13  153 153 GLU GLU G . n 
G 1 14  ASN 14  154 154 ASN ASN G . n 
G 1 15  CYS 15  155 155 CYS CYS G . n 
G 1 16  TYR 16  156 156 TYR TYR G . n 
G 1 17  LEU 17  157 157 LEU LEU G . n 
G 1 18  PHE 18  158 158 PHE PHE G . n 
G 1 19  SER 19  159 159 SER SER G . n 
G 1 20  SER 20  160 160 SER SER G . n 
G 1 21  GLY 21  161 161 GLY GLY G . n 
G 1 22  SER 22  162 162 SER SER G . n 
G 1 23  PHE 23  163 163 PHE PHE G . n 
G 1 24  ASN 24  164 164 ASN ASN G . n 
G 1 25  TRP 25  165 165 TRP TRP G . n 
G 1 26  GLU 26  166 166 GLU GLU G . n 
G 1 27  LYS 27  167 167 LYS LYS G . n 
G 1 28  SER 28  168 168 SER SER G . n 
G 1 29  GLN 29  169 169 GLN GLN G . n 
G 1 30  GLU 30  170 170 GLU GLU G . n 
G 1 31  LYS 31  171 171 LYS LYS G . n 
G 1 32  CYS 32  172 172 CYS CYS G . n 
G 1 33  LEU 33  173 173 LEU LEU G . n 
G 1 34  SER 34  174 174 SER SER G . n 
G 1 35  LEU 35  175 175 LEU LEU G . n 
G 1 36  ASP 36  176 176 ASP ASP G . n 
G 1 37  ALA 37  177 177 ALA ALA G . n 
G 1 38  LYS 38  178 178 LYS LYS G . n 
G 1 39  LEU 39  179 179 LEU LEU G . n 
G 1 40  LEU 40  180 180 LEU LEU G . n 
G 1 41  LYS 41  181 181 LYS LYS G . n 
G 1 42  ILE 42  182 182 ILE ILE G . n 
G 1 43  ASN 43  183 183 ASN ASN G . n 
G 1 44  SER 44  184 184 SER SER G . n 
G 1 45  THR 45  185 185 THR THR G . n 
G 1 46  ALA 46  186 186 ALA ALA G . n 
G 1 47  ASP 47  187 187 ASP ASP G . n 
G 1 48  LEU 48  188 188 LEU LEU G . n 
G 1 49  ASP 49  189 189 ASP ASP G . n 
G 1 50  PHE 50  190 190 PHE PHE G . n 
G 1 51  ILE 51  191 191 ILE ILE G . n 
G 1 52  GLN 52  192 192 GLN GLN G . n 
G 1 53  GLN 53  193 193 GLN GLN G . n 
G 1 54  ALA 54  194 194 ALA ALA G . n 
G 1 55  ILE 55  195 195 ILE ILE G . n 
G 1 56  SER 56  196 196 SER SER G . n 
G 1 57  TYR 57  197 197 TYR TYR G . n 
G 1 58  SER 58  198 198 SER SER G . n 
G 1 59  SER 59  199 199 SER SER G . n 
G 1 60  PHE 60  200 200 PHE PHE G . n 
G 1 61  PRO 61  201 201 PRO PRO G . n 
G 1 62  PHE 62  202 202 PHE PHE G . n 
G 1 63  TRP 63  203 203 TRP TRP G . n 
G 1 64  MET 64  204 204 MET MET G . n 
G 1 65  GLY 65  205 205 GLY GLY G . n 
G 1 66  LEU 66  206 206 LEU LEU G . n 
G 1 67  SER 67  207 207 SER SER G . n 
G 1 68  ARG 68  208 208 ARG ARG G . n 
G 1 69  ARG 69  209 209 ARG ARG G . n 
G 1 70  ASN 70  210 210 ASN ASN G . n 
G 1 71  PRO 71  211 211 PRO PRO G . n 
G 1 72  SER 72  212 212 SER SER G . n 
G 1 73  TYR 73  213 213 TYR TYR G . n 
G 1 74  PRO 74  214 214 PRO PRO G . n 
G 1 75  TRP 75  215 215 TRP TRP G . n 
G 1 76  LEU 76  216 216 LEU LEU G . n 
G 1 77  TRP 77  217 217 TRP TRP G . n 
G 1 78  GLU 78  218 218 GLU GLU G . n 
G 1 79  ASP 79  219 219 ASP ASP G . n 
G 1 80  GLY 80  220 220 GLY GLY G . n 
G 1 81  SER 81  221 221 SER SER G . n 
G 1 82  PRO 82  222 222 PRO PRO G . n 
G 1 83  LEU 83  223 223 LEU LEU G . n 
G 1 84  MET 84  224 224 MET MET G . n 
G 1 85  PRO 85  225 225 PRO PRO G . n 
G 1 86  HIS 86  226 226 HIS HIS G . n 
G 1 87  LEU 87  227 227 LEU LEU G . n 
G 1 88  PHE 88  228 228 PHE PHE G . n 
G 1 89  ARG 89  229 229 ARG ARG G . n 
G 1 90  VAL 90  230 230 VAL VAL G . n 
G 1 91  ARG 91  231 231 ARG ARG G . n 
G 1 92  GLY 92  232 232 GLY GLY G . n 
G 1 93  ALA 93  233 233 ALA ALA G . n 
G 1 94  VAL 94  234 234 VAL VAL G . n 
G 1 95  SER 95  235 235 SER SER G . n 
G 1 96  GLN 96  236 236 GLN GLN G . n 
G 1 97  THR 97  237 237 THR THR G . n 
G 1 98  TYR 98  238 238 TYR TYR G . n 
G 1 99  PRO 99  239 239 PRO PRO G . n 
G 1 100 SER 100 240 240 SER SER G . n 
G 1 101 GLY 101 241 241 GLY GLY G . n 
G 1 102 THR 102 242 242 THR THR G . n 
G 1 103 CYS 103 243 243 CYS CYS G . n 
G 1 104 ALA 104 244 244 ALA ALA G . n 
G 1 105 TYR 105 245 245 TYR TYR G . n 
G 1 106 ILE 106 246 246 ILE ILE G . n 
G 1 107 GLN 107 247 247 GLN GLN G . n 
G 1 108 ARG 108 248 248 ARG ARG G . n 
G 1 109 GLY 109 249 249 GLY GLY G . n 
G 1 110 ALA 110 250 250 ALA ALA G . n 
G 1 111 VAL 111 251 251 VAL VAL G . n 
G 1 112 TYR 112 252 252 TYR TYR G . n 
G 1 113 ALA 113 253 253 ALA ALA G . n 
G 1 114 GLU 114 254 254 GLU GLU G . n 
G 1 115 ASN 115 255 255 ASN ASN G . n 
G 1 116 CYS 116 256 256 CYS CYS G . n 
G 1 117 ILE 117 257 257 ILE ILE G . n 
G 1 118 LEU 118 258 258 LEU LEU G . n 
G 1 119 ALA 119 259 259 ALA ALA G . n 
G 1 120 ALA 120 260 260 ALA ALA G . n 
G 1 121 PHE 121 261 261 PHE PHE G . n 
G 1 122 SER 122 262 262 SER SER G . n 
G 1 123 ILE 123 263 263 ILE ILE G . n 
G 1 124 CYS 124 264 264 CYS CYS G . n 
G 1 125 GLN 125 265 265 GLN GLN G . n 
G 1 126 LYS 126 266 266 LYS LYS G . n 
G 1 127 LYS 127 267 267 LYS LYS G . n 
G 1 128 ALA 128 268 268 ALA ALA G . n 
G 1 129 ASN 129 269 269 ASN ASN G . n 
G 1 130 LEU 130 270 270 LEU LEU G . n 
G 1 131 ARG 131 271 271 ARG ARG G . n 
G 1 132 ALA 132 272 272 ALA ALA G . n 
H 1 1   MET 1   141 ?   ?   ?   H . n 
H 1 2   ALA 2   142 142 ALA ALA H . n 
H 1 3   PRO 3   143 143 PRO PRO H . n 
H 1 4   CYS 4   144 144 CYS CYS H . n 
H 1 5   PRO 5   145 145 PRO PRO H . n 
H 1 6   GLN 6   146 146 GLN GLN H . n 
H 1 7   ASP 7   147 147 ASP ASP H . n 
H 1 8   TRP 8   148 148 TRP TRP H . n 
H 1 9   ILE 9   149 149 ILE ILE H . n 
H 1 10  TRP 10  150 150 TRP TRP H . n 
H 1 11  HIS 11  151 151 HIS HIS H . n 
H 1 12  GLY 12  152 152 GLY GLY H . n 
H 1 13  GLU 13  153 153 GLU GLU H . n 
H 1 14  ASN 14  154 154 ASN ASN H . n 
H 1 15  CYS 15  155 155 CYS CYS H . n 
H 1 16  TYR 16  156 156 TYR TYR H . n 
H 1 17  LEU 17  157 157 LEU LEU H . n 
H 1 18  PHE 18  158 158 PHE PHE H . n 
H 1 19  SER 19  159 159 SER SER H . n 
H 1 20  SER 20  160 160 SER SER H . n 
H 1 21  GLY 21  161 161 GLY GLY H . n 
H 1 22  SER 22  162 162 SER SER H . n 
H 1 23  PHE 23  163 163 PHE PHE H . n 
H 1 24  ASN 24  164 164 ASN ASN H . n 
H 1 25  TRP 25  165 165 TRP TRP H . n 
H 1 26  GLU 26  166 166 GLU GLU H . n 
H 1 27  LYS 27  167 167 LYS LYS H . n 
H 1 28  SER 28  168 168 SER SER H . n 
H 1 29  GLN 29  169 169 GLN GLN H . n 
H 1 30  GLU 30  170 170 GLU GLU H . n 
H 1 31  LYS 31  171 171 LYS LYS H . n 
H 1 32  CYS 32  172 172 CYS CYS H . n 
H 1 33  LEU 33  173 173 LEU LEU H . n 
H 1 34  SER 34  174 174 SER SER H . n 
H 1 35  LEU 35  175 175 LEU LEU H . n 
H 1 36  ASP 36  176 176 ASP ASP H . n 
H 1 37  ALA 37  177 177 ALA ALA H . n 
H 1 38  LYS 38  178 178 LYS LYS H . n 
H 1 39  LEU 39  179 179 LEU LEU H . n 
H 1 40  LEU 40  180 180 LEU LEU H . n 
H 1 41  LYS 41  181 181 LYS LYS H . n 
H 1 42  ILE 42  182 182 ILE ILE H . n 
H 1 43  ASN 43  183 183 ASN ASN H . n 
H 1 44  SER 44  184 184 SER SER H . n 
H 1 45  THR 45  185 185 THR THR H . n 
H 1 46  ALA 46  186 186 ALA ALA H . n 
H 1 47  ASP 47  187 187 ASP ASP H . n 
H 1 48  LEU 48  188 188 LEU LEU H . n 
H 1 49  ASP 49  189 189 ASP ASP H . n 
H 1 50  PHE 50  190 190 PHE PHE H . n 
H 1 51  ILE 51  191 191 ILE ILE H . n 
H 1 52  GLN 52  192 192 GLN GLN H . n 
H 1 53  GLN 53  193 193 GLN GLN H . n 
H 1 54  ALA 54  194 194 ALA ALA H . n 
H 1 55  ILE 55  195 195 ILE ILE H . n 
H 1 56  SER 56  196 196 SER SER H . n 
H 1 57  TYR 57  197 197 TYR TYR H . n 
H 1 58  SER 58  198 198 SER SER H . n 
H 1 59  SER 59  199 199 SER SER H . n 
H 1 60  PHE 60  200 200 PHE PHE H . n 
H 1 61  PRO 61  201 201 PRO PRO H . n 
H 1 62  PHE 62  202 202 PHE PHE H . n 
H 1 63  TRP 63  203 203 TRP TRP H . n 
H 1 64  MET 64  204 204 MET MET H . n 
H 1 65  GLY 65  205 205 GLY GLY H . n 
H 1 66  LEU 66  206 206 LEU LEU H . n 
H 1 67  SER 67  207 207 SER SER H . n 
H 1 68  ARG 68  208 208 ARG ARG H . n 
H 1 69  ARG 69  209 209 ARG ARG H . n 
H 1 70  ASN 70  210 210 ASN ASN H . n 
H 1 71  PRO 71  211 211 PRO PRO H . n 
H 1 72  SER 72  212 212 SER SER H . n 
H 1 73  TYR 73  213 213 TYR TYR H . n 
H 1 74  PRO 74  214 214 PRO PRO H . n 
H 1 75  TRP 75  215 215 TRP TRP H . n 
H 1 76  LEU 76  216 216 LEU LEU H . n 
H 1 77  TRP 77  217 217 TRP TRP H . n 
H 1 78  GLU 78  218 218 GLU GLU H . n 
H 1 79  ASP 79  219 219 ASP ASP H . n 
H 1 80  GLY 80  220 220 GLY GLY H . n 
H 1 81  SER 81  221 221 SER SER H . n 
H 1 82  PRO 82  222 222 PRO PRO H . n 
H 1 83  LEU 83  223 223 LEU LEU H . n 
H 1 84  MET 84  224 224 MET MET H . n 
H 1 85  PRO 85  225 225 PRO PRO H . n 
H 1 86  HIS 86  226 226 HIS HIS H . n 
H 1 87  LEU 87  227 227 LEU LEU H . n 
H 1 88  PHE 88  228 228 PHE PHE H . n 
H 1 89  ARG 89  229 229 ARG ARG H . n 
H 1 90  VAL 90  230 230 VAL VAL H . n 
H 1 91  ARG 91  231 231 ARG ARG H . n 
H 1 92  GLY 92  232 232 GLY GLY H . n 
H 1 93  ALA 93  233 233 ALA ALA H . n 
H 1 94  VAL 94  234 234 VAL VAL H . n 
H 1 95  SER 95  235 235 SER SER H . n 
H 1 96  GLN 96  236 236 GLN GLN H . n 
H 1 97  THR 97  237 237 THR THR H . n 
H 1 98  TYR 98  238 238 TYR TYR H . n 
H 1 99  PRO 99  239 239 PRO PRO H . n 
H 1 100 SER 100 240 240 SER SER H . n 
H 1 101 GLY 101 241 241 GLY GLY H . n 
H 1 102 THR 102 242 242 THR THR H . n 
H 1 103 CYS 103 243 243 CYS CYS H . n 
H 1 104 ALA 104 244 244 ALA ALA H . n 
H 1 105 TYR 105 245 245 TYR TYR H . n 
H 1 106 ILE 106 246 246 ILE ILE H . n 
H 1 107 GLN 107 247 247 GLN GLN H . n 
H 1 108 ARG 108 248 248 ARG ARG H . n 
H 1 109 GLY 109 249 249 GLY GLY H . n 
H 1 110 ALA 110 250 250 ALA ALA H . n 
H 1 111 VAL 111 251 251 VAL VAL H . n 
H 1 112 TYR 112 252 252 TYR TYR H . n 
H 1 113 ALA 113 253 253 ALA ALA H . n 
H 1 114 GLU 114 254 254 GLU GLU H . n 
H 1 115 ASN 115 255 255 ASN ASN H . n 
H 1 116 CYS 116 256 256 CYS CYS H . n 
H 1 117 ILE 117 257 257 ILE ILE H . n 
H 1 118 LEU 118 258 258 LEU LEU H . n 
H 1 119 ALA 119 259 259 ALA ALA H . n 
H 1 120 ALA 120 260 260 ALA ALA H . n 
H 1 121 PHE 121 261 261 PHE PHE H . n 
H 1 122 SER 122 262 262 SER SER H . n 
H 1 123 ILE 123 263 263 ILE ILE H . n 
H 1 124 CYS 124 264 264 CYS CYS H . n 
H 1 125 GLN 125 265 265 GLN GLN H . n 
H 1 126 LYS 126 266 266 LYS LYS H . n 
H 1 127 LYS 127 267 267 LYS LYS H . n 
H 1 128 ALA 128 268 268 ALA ALA H . n 
H 1 129 ASN 129 269 269 ASN ASN H . n 
H 1 130 LEU 130 270 270 LEU LEU H . n 
H 1 131 ARG 131 271 ?   ?   ?   H . n 
H 1 132 ALA 132 272 ?   ?   ?   H . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
4 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B 
2 1 C,D 
3 1 E,F 
4 1 G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1720  ? 
1 MORE         -8    ? 
1 'SSA (A^2)'  13430 ? 
2 'ABSA (A^2)' 1920  ? 
2 MORE         -10   ? 
2 'SSA (A^2)'  12940 ? 
3 'ABSA (A^2)' 1810  ? 
3 MORE         -10   ? 
3 'SSA (A^2)'  12840 ? 
4 'ABSA (A^2)' 1700  ? 
4 MORE         -8    ? 
4 'SSA (A^2)'  13350 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-02-08 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .   ? 1 
SCALEPACK 'data scaling'    .   ? 2 
MOLREP    phasing           .   ? 3 
CNS       refinement        1.1 ? 4 
HKL-2000  'data reduction'  .   ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              270 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              270 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              270 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.39 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            15.09 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 147 ? ? 89.74   -12.34  
2  1 SER A 159 ? ? -39.08  150.30  
3  1 ALA A 177 ? ? -130.62 -158.42 
4  1 PHE A 190 ? ? -59.56  -72.58  
5  1 ASP A 219 ? ? -48.04  -12.48  
6  1 HIS A 226 ? ? 70.07   43.07   
7  1 ARG A 248 ? ? 35.18   55.99   
8  1 ILE A 257 ? ? -86.40  47.18   
9  1 LYS A 267 ? ? -36.64  137.09  
10 1 ALA A 268 ? ? -60.41  -105.41 
11 1 ASN A 269 ? ? 160.46  125.04  
12 1 LEU A 270 ? ? 155.71  86.10   
13 1 ALA B 142 ? ? 66.20   82.72   
14 1 TYR B 197 ? ? -84.78  37.70   
15 1 SER B 199 ? ? -147.80 18.28   
16 1 ARG B 231 ? ? -115.23 -150.70 
17 1 SER B 235 ? ? -116.73 61.08   
18 1 ARG B 248 ? ? 36.31   32.27   
19 1 ASP C 147 ? ? 79.46   -33.39  
20 1 SER C 159 ? ? -33.19  134.00  
21 1 SER C 184 ? ? -173.05 146.07  
22 1 PRO C 211 ? ? -64.73  4.30    
23 1 ASP C 219 ? ? -59.87  -6.86   
24 1 ARG C 231 ? ? -100.53 -151.56 
25 1 ARG C 248 ? ? 51.00   19.77   
26 1 ASP D 147 ? ? 88.97   -11.78  
27 1 SER D 159 ? ? -39.06  148.10  
28 1 LEU D 180 ? ? -39.25  135.20  
29 1 SER D 184 ? ? 173.15  166.17  
30 1 SER D 199 ? ? -142.32 36.43   
31 1 SER D 207 ? ? 178.15  173.05  
32 1 PRO D 211 ? ? -58.96  1.90    
33 1 TRP D 217 ? ? -77.48  -160.54 
34 1 HIS D 226 ? ? 81.04   31.05   
35 1 LEU D 227 ? ? -113.44 -73.25  
36 1 VAL D 234 ? ? -76.73  37.22   
37 1 SER D 235 ? ? -154.15 -32.40  
38 1 PRO D 239 ? ? -56.66  -10.00  
39 1 PHE D 261 ? ? -58.22  -164.07 
40 1 ASP E 147 ? ? 77.36   -26.21  
41 1 SER E 162 ? ? -111.14 71.45   
42 1 ALA E 177 ? ? -130.75 -157.60 
43 1 LEU E 180 ? ? -37.38  128.21  
44 1 SER E 184 ? ? 160.27  148.74  
45 1 TYR E 197 ? ? -97.51  32.76   
46 1 ARG E 208 ? ? 175.89  132.44  
47 1 PRO E 211 ? ? -20.37  -32.28  
48 1 ALA E 233 ? ? -60.07  25.13   
49 1 VAL E 234 ? ? -65.31  19.60   
50 1 SER E 235 ? ? -133.30 -48.12  
51 1 GLN E 247 ? ? -171.03 148.76  
52 1 PRO F 145 ? ? -63.94  -177.55 
53 1 SER F 159 ? ? -37.41  146.69  
54 1 ALA F 177 ? ? -126.80 -167.03 
55 1 SER F 199 ? ? -130.01 -33.42  
56 1 LEU F 227 ? ? -109.19 -63.93  
57 1 ALA F 233 ? ? -75.22  42.79   
58 1 ARG F 248 ? ? 58.44   4.07    
59 1 GLN G 146 ? ? -46.08  159.08  
60 1 ASP G 147 ? ? 74.04   -25.07  
61 1 TYR G 197 ? ? -61.77  8.68    
62 1 PRO G 211 ? ? -42.51  0.32    
63 1 PRO G 214 ? ? -73.00  -155.27 
64 1 HIS G 226 ? ? 60.49   66.91   
65 1 LEU G 227 ? ? -130.86 -49.17  
66 1 VAL G 230 ? ? -61.36  88.28   
67 1 ARG G 231 ? ? -75.64  -152.29 
68 1 GLN G 247 ? ? -171.54 139.24  
69 1 ASP H 147 ? ? 68.26   -5.59   
70 1 SER H 160 ? ? -91.42  -81.29  
71 1 LEU H 175 ? ? -91.83  36.05   
72 1 ASP H 176 ? ? 39.04   53.55   
73 1 TYR H 197 ? ? -90.29  49.16   
74 1 ARG H 208 ? ? -172.63 144.44  
75 1 TRP H 217 ? ? -81.25  -155.61 
76 1 HIS H 226 ? ? 76.87   32.50   
77 1 LEU H 227 ? ? -97.18  -62.55  
78 1 ARG H 231 ? ? -114.71 -165.54 
79 1 ALA H 233 ? ? -66.64  73.90   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 141 ? A MET 1   
2  1 Y 1 A ALA 272 ? A ALA 132 
3  1 Y 1 D MET 141 ? D MET 1   
4  1 Y 1 D ARG 271 ? D ARG 131 
5  1 Y 1 D ALA 272 ? D ALA 132 
6  1 Y 1 E MET 141 ? E MET 1   
7  1 Y 1 E ARG 271 ? E ARG 131 
8  1 Y 1 E ALA 272 ? E ALA 132 
9  1 Y 1 F ARG 271 ? F ARG 131 
10 1 Y 1 F ALA 272 ? F ALA 132 
11 1 Y 1 H MET 141 ? H MET 1   
12 1 Y 1 H ARG 271 ? H ARG 131 
13 1 Y 1 H ALA 272 ? H ALA 132 
#