data_1YUI
# 
_entry.id   1YUI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1YUI         
WWPDB D_1000177448 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1YUJ 
_pdbx_database_related.details        'ENSEMBLE OF 50 STRUCTURES' 
_pdbx_database_related.content_type   ensemble 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YUI 
_pdbx_database_status.recvd_initial_deposition_date   1996-12-31 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clore, G.M.'      1 
'Omichinski, J.G.' 2 
'Gronenborn, A.M.' 3 
# 
_citation.id                        primary 
_citation.title                     'The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            4 
_citation.page_first                122 
_citation.page_last                 132 
_citation.year                      1997 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9033593 
_citation.pdbx_database_id_DOI      10.1038/nsb0297-122 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Omichinski, J.G.' 1 
primary 'Pedone, P.V.'     2 
primary 'Felsenfeld, G.'   3 
primary 'Gronenborn, A.M.' 4 
primary 'Clore, G.M.'      5 
# 
_cell.entry_id           1YUI 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1YUI 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
;
3383.224 1 ? ? ?                                        ? 
2 polymer     syn 
;DNA (5'-D(*GP*TP*AP*CP*TP*CP*TP*CP*GP*GP*C)-3')
;
3325.172 1 ? ? ?                                        ? 
3 polymer     nat GAGA-FACTOR                                       6202.233 1 ? ? 'DNA BINDING DOMAIN, RESIDUES 310 - 372' ? 
4 non-polymer syn 'ZINC ION'                                        65.409   1 ? ? ?                                        ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)(DA)(DG)(DA)(DG)(DT)(DA)(DC)'         GCCGAGAGTAC B ? 
2 polydeoxyribonucleotide no no '(DG)(DT)(DA)(DC)(DT)(DC)(DT)(DC)(DG)(DG)(DC)'         GTACTCTCGGC C ? 
3 'polypeptide(L)'        no no PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV 
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DG  n 
1 2  DC  n 
1 3  DC  n 
1 4  DG  n 
1 5  DA  n 
1 6  DG  n 
1 7  DA  n 
1 8  DG  n 
1 9  DT  n 
1 10 DA  n 
1 11 DC  n 
2 1  DG  n 
2 2  DT  n 
2 3  DA  n 
2 4  DC  n 
2 5  DT  n 
2 6  DC  n 
2 7  DT  n 
2 8  DC  n 
2 9  DG  n 
2 10 DG  n 
2 11 DC  n 
3 1  PRO n 
3 2  LYS n 
3 3  ALA n 
3 4  LYS n 
3 5  ARG n 
3 6  ALA n 
3 7  LYS n 
3 8  HIS n 
3 9  PRO n 
3 10 PRO n 
3 11 GLY n 
3 12 THR n 
3 13 GLU n 
3 14 LYS n 
3 15 PRO n 
3 16 ARG n 
3 17 SER n 
3 18 ARG n 
3 19 SER n 
3 20 GLN n 
3 21 SER n 
3 22 GLU n 
3 23 GLN n 
3 24 PRO n 
3 25 ALA n 
3 26 THR n 
3 27 CYS n 
3 28 PRO n 
3 29 ILE n 
3 30 CYS n 
3 31 TYR n 
3 32 ALA n 
3 33 VAL n 
3 34 ILE n 
3 35 ARG n 
3 36 GLN n 
3 37 SER n 
3 38 ARG n 
3 39 ASN n 
3 40 LEU n 
3 41 ARG n 
3 42 ARG n 
3 43 HIS n 
3 44 LEU n 
3 45 GLU n 
3 46 LEU n 
3 47 ARG n 
3 48 HIS n 
3 49 PHE n 
3 50 ALA n 
3 51 LYS n 
3 52 PRO n 
3 53 GLY n 
3 54 VAL n 
# 
_entity_src_nat.entity_id                  3 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'fruit fly' 
_entity_src_nat.pdbx_organism_scientific   'Drosophila melanogaster' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7227 
_entity_src_nat.genus                      Drosophila 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP GAGA_DROME Q08605 3 319 ? ? 
2 PDB 1YUI       1YUI   1 ?   ? ? 
3 PDB 1YUI       1YUI   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1YUI A 1 ? 54 ? Q08605 319 ? 372 ? 10  63  
2 2 1YUI B 1 ? 11 ? 1YUI   101 ? 111 ? 101 111 
3 3 1YUI C 1 ? 11 ? 1YUI   112 ? 122 ? 112 122 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            'TRIPLE RESONANCE' 
_pdbx_nmr_exptl.solution_id     1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303.50 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.00 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
1 AMX500 Bruker 500 
2 AMX600 Bruker 600 
# 
_pdbx_nmr_refine.entry_id           1YUI 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;THE 3D STRUCTURE OF THE GAGA FACTOR/DNA COMPLEX WAS SOLVED          
BY MULTI-DIMENSIONAL HETERONUCLEAR-EDITED AND -FILTERED             
NMR AND IS BASED ON 1475 EXPERIMENTAL NMR RESTRAINTS:               
(A) INTRAPROTEIN: 188 SEQUENTIAL (|I- J|=1), 134 MEDIUM             
RANGE (1 < |I-J| <=5) AND 95 LONG RANGE (|I-J| >5)                  
INTERRESIDUES AND 275 INTRARESIDUE APPROXIMATE INTERPROTON          
DISTANCE RESTRAINTS; 140 TORSION ANGLE RESTRAINTS; 33               
THREE-BOND HN-HA COUPLING CONSTANT RESTRAINTS; AND 94               
(48 CALPHA AND 46 CBETA) 13C SHIFT RESTRAINTS.  (NUMBERS            
OF RESIDUES 10 - 61)                                                
(B) INTRA-DNA: 124 INTRARESIDUE, 112 SEQUENTIAL                     
INTRASTRAND, 21 INTERSTRAND INTERPROTON DISTANCE                    
RESTRAINTS; 102 TORSION ANGLE RESTRAINTS (FOR ALPHA, BETA,          
GAMMA, DELTA, EPSILON AND AND ZETA BACKBONE TORSION                 
ANGLES).                                                            
(C) INTERMOLECULAR: 75 INTERPROTON DISTANCE RESTRAINTS.             
THE EXPERIMENTAL NMR RESTRAINTS ARE SUPPLEMENTED BY                 
HYDROGEN BONDING RESTRAINTS: 24 DISTANCES FOR 12 BACKBONE           
HYDROGEN BONDS WITHIN THE PROTEIN, 58 DISTANCES FOR                 
WATSON-CRICK BASE-PAIRING WITHIN THE DNA, AND 10 AMBIGUOUS          
DISTANCE RESTRAINTS BETWEEN THE PROTEIN AND THE DNA.  THE           
RESTRAINTS HAVE BEEN DEPOSITED.                                     

THE STRUCTURES WERE CALCULATED USING THE SIMULATED
ANNEALING PROTOCOL OF NILGES ET AL. (1988) FEBS LETT. 229,
129-136 USING THE PROGRAM X-PLOR 3.1 (BRUNGER) MODIFIED
TO INCORPORATE COUPLING CONSTANT (GARRETT ET AL. (1984) J.
MAGN. RESON. SERIES B 104, 99-103) AND CARBON CHEMICAL
SHIFT (KUSZEWSKI ET AL. (1995) J. MAGN. RESON. SERIES B
106, 92-96) RESTRAINTS, AND A CONFORMATIONAL DATABASE
POTENTIAL (KUSZEWSKI ET AL.(1996) PROTEIN SCI. 5, 1067-1080

THE RESTRAINED REGULARIZED MEAN STRUCTURE IS PRESENTED IN
THIS ENTRY AND 50 STRUCTURES ARE PRESENTED IN ENTRY 1YUJ.
IN THE RESTRAINED REGULARIZED MEAN COORDINATES THE LAST
COLUMN REPRESENTS THE AVERAGE RMS DIFFERENCE BETWEEN THE
INDIVIDUAL SIMULATED ANNEALING STRUCTURES AND THE MEAN
COORDINATE POSITIONS.  THE LAST COLUMN IN THE INDIVIDUAL SA
STRUCTURES HAS NO MEANING.  BEST FITTING TO GENERATE THE
AVERAGE STRUCTURE IS WITH RESPECT TO RESIDUES 14 - 58 OF
THE PROTEIN AND BASE PAIRS 1 - 11 OF THE DNA (RESIDUES 10 -
13 AND 59 - 61 ARE DISORDERED IN SOLUTION).  RESIDUE 10
CORRESPONDS TO RESIDUE 319 OF THE NATURAL SEQUENCE.  NOTE
THE OCCUPANCY FIELD HAS NO MEANING.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1YUI 
_pdbx_nmr_details.text       
;TRIPLE RESONANCE FOR ASSIGNMENT OF PROTEIN 12C- FILTERED NOE, 12C-FILTERED HOHAHA AND 1H-1H NOE FOR DNA. QUANTITATIVE J CORRELATION FOR COUPLING CONSTANTS 3D 15N- SEPARATED, 3D 13C-SEPARATED, 3D 12C-FILTERED 3D 13C- SEPARATED/12C-FILTERED, AND 2D 1H-1H NOE EXPERIMENTS.
;
# 
_pdbx_nmr_ensemble.entry_id                             1YUI 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         'REGULARIZED MEAN STRUCTURE' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' 'X-PLOR (SEE ABOVE)' ? ? 1 
refinement           'X-PLOR (SEE ABOVE)' ? ? 2 
# 
_exptl.entry_id          1YUI 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1YUI 
_struct.title                     'SOLUTION NMR STRUCTURE OF THE GAGA FACTOR/DNA COMPLEX, REGULARIZED MEAN STRUCTURE' 
_struct.pdbx_descriptor           'GAGA-FACTOR/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YUI 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            'COMPLEX (DNA-BINDING PROTEIN-DNA), CHROMATIN REMODELING, DNA BINDING PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG C 16 ? SER C 19 ? ARG A 25 SER A 28 1 ? 4  
HELX_P HELX_P2 2 SER C 37 ? ARG C 47 ? SER A 46 ARG A 56 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 27 SG  ? ? A ZN 64  A CYS 36  1_555 ? ? ? ? ? ? ?            2.299 ? 
metalc2  metalc ? ? D ZN .  ZN ? ? ? 1_555 C CYS 30 SG  ? ? A ZN 64  A CYS 39  1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc3  metalc ? ? D ZN .  ZN ? ? ? 1_555 C HIS 43 NE2 ? ? A ZN 64  A HIS 52  1_555 ? ? ? ? ? ? ?            2.000 ? 
metalc4  metalc ? ? D ZN .  ZN ? ? ? 1_555 C HIS 48 NE2 ? ? A ZN 64  A HIS 57  1_555 ? ? ? ? ? ? ?            2.012 ? 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC  11 N3  ? ? B DG 101 C DC  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC  11 O2  ? ? B DG 101 C DC  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC  11 N4  ? ? B DG 101 C DC  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG  10 N1  ? ? B DC 102 C DG  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG  10 O6  ? ? B DC 102 C DG  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG  10 N2  ? ? B DC 102 C DG  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC 3  N3 ? ? ? 1_555 B DG  9  N1  ? ? B DC 103 C DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC 3  N4 ? ? ? 1_555 B DG  9  O6  ? ? B DC 103 C DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC 3  O2 ? ? ? 1_555 B DG  9  N2  ? ? B DC 103 C DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC  8  N3  ? ? B DG 104 C DC  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC  8  O2  ? ? B DG 104 C DC  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC  8  N4  ? ? B DG 104 C DC  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT  7  N3  ? ? B DA 105 C DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT  7  O4  ? ? B DA 105 C DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC  6  N3  ? ? B DG 106 C DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC  6  O2  ? ? B DG 106 C DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC  6  N4  ? ? B DG 106 C DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT  5  N3  ? ? B DA 107 C DT  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT  5  O4  ? ? B DA 107 C DT  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC  4  N3  ? ? B DG 108 C DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC  4  O2  ? ? B DG 108 C DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC  4  N4  ? ? B DG 108 C DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA  3  N1  ? ? B DT 109 C DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA  3  N6  ? ? B DT 109 C DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT  2  N3  ? ? B DA 110 C DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT  2  O4  ? ? B DA 110 C DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DC 11 N3 ? ? ? 1_555 B DG  1  N1  ? ? B DC 111 C DG  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DC 11 N4 ? ? ? 1_555 B DG  1  O6  ? ? B DC 111 C DG  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG  1  N2  ? ? B DC 111 C DG  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA C 25 ? THR C 26 ? ALA A 34 THR A 35 
A 2 VAL C 33 ? ILE C 34 ? VAL A 42 ILE A 43 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ALA 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    25 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ALA 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     34 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    34 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     43 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 64' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS C 27 ? CYS A 36 . ? 1_555 ? 
2 AC1 4 CYS C 30 ? CYS A 39 . ? 1_555 ? 
3 AC1 4 HIS C 43 ? HIS A 52 . ? 1_555 ? 
4 AC1 4 HIS C 48 ? HIS A 57 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1YUI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1YUI 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'"  . DG  A 1 1  ? -21.518 12.795  27.858 1.00 1.05 ? 101 DG  B "O5'"  1 
ATOM   2    C  "C5'"  . DG  A 1 1  ? -21.490 13.212  29.225 1.00 1.01 ? 101 DG  B "C5'"  1 
ATOM   3    C  "C4'"  . DG  A 1 1  ? -20.493 12.388  30.045 1.00 0.85 ? 101 DG  B "C4'"  1 
ATOM   4    O  "O4'"  . DG  A 1 1  ? -20.968 11.031  30.192 1.00 0.84 ? 101 DG  B "O4'"  1 
ATOM   5    C  "C3'"  . DG  A 1 1  ? -19.104 12.345  29.394 1.00 0.72 ? 101 DG  B "C3'"  1 
ATOM   6    O  "O3'"  . DG  A 1 1  ? -18.131 12.971  30.234 1.00 0.70 ? 101 DG  B "O3'"  1 
ATOM   7    C  "C2'"  . DG  A 1 1  ? -18.783 10.876  29.207 1.00 0.63 ? 101 DG  B "C2'"  1 
ATOM   8    C  "C1'"  . DG  A 1 1  ? -19.995 10.089  29.696 1.00 0.70 ? 101 DG  B "C1'"  1 
ATOM   9    N  N9     . DG  A 1 1  ? -20.571 9.283   28.600 1.00 0.69 ? 101 DG  B N9     1 
ATOM   10   C  C8     . DG  A 1 1  ? -21.162 9.704   27.443 1.00 0.73 ? 101 DG  B C8     1 
ATOM   11   N  N7     . DG  A 1 1  ? -21.581 8.756   26.660 1.00 0.73 ? 101 DG  B N7     1 
ATOM   12   C  C5     . DG  A 1 1  ? -21.241 7.596   27.354 1.00 0.68 ? 101 DG  B C5     1 
ATOM   13   C  C6     . DG  A 1 1  ? -21.444 6.233   27.004 1.00 0.67 ? 101 DG  B C6     1 
ATOM   14   O  O6     . DG  A 1 1  ? -21.974 5.777   25.993 1.00 0.70 ? 101 DG  B O6     1 
ATOM   15   N  N1     . DG  A 1 1  ? -20.952 5.378   27.981 1.00 0.65 ? 101 DG  B N1     1 
ATOM   16   C  C2     . DG  A 1 1  ? -20.341 5.779   29.151 1.00 0.64 ? 101 DG  B C2     1 
ATOM   17   N  N2     . DG  A 1 1  ? -19.934 4.807   29.968 1.00 0.66 ? 101 DG  B N2     1 
ATOM   18   N  N3     . DG  A 1 1  ? -20.149 7.059   29.484 1.00 0.65 ? 101 DG  B N3     1 
ATOM   19   C  C4     . DG  A 1 1  ? -20.622 7.910   28.543 1.00 0.66 ? 101 DG  B C4     1 
ATOM   20   H  "H5'"  . DG  A 1 1  ? -22.486 13.094  29.653 1.00 1.13 ? 101 DG  B "H5'"  1 
ATOM   21   H  "H5''" . DG  A 1 1  ? -21.205 14.263  29.270 1.00 1.09 ? 101 DG  B "H5''" 1 
ATOM   22   H  "H4'"  . DG  A 1 1  ? -20.401 12.835  31.035 1.00 0.89 ? 101 DG  B "H4'"  1 
ATOM   23   H  "H3'"  . DG  A 1 1  ? -19.117 12.849  28.422 1.00 0.78 ? 101 DG  B "H3'"  1 
ATOM   24   H  "H2'"  . DG  A 1 1  ? -18.599 10.657  28.152 1.00 0.62 ? 101 DG  B "H2'"  1 
ATOM   25   H  "H2''" . DG  A 1 1  ? -17.901 10.618  29.795 1.00 0.58 ? 101 DG  B "H2''" 1 
ATOM   26   H  "H1'"  . DG  A 1 1  ? -19.698 9.423   30.509 1.00 0.70 ? 101 DG  B "H1'"  1 
ATOM   27   H  H8     . DG  A 1 1  ? -21.273 10.759  27.194 1.00 0.77 ? 101 DG  B H8     1 
ATOM   28   H  H1     . DG  A 1 1  ? -21.061 4.390   27.801 1.00 0.65 ? 101 DG  B H1     1 
ATOM   29   H  H21    . DG  A 1 1  ? -20.081 3.841   29.715 1.00 0.67 ? 101 DG  B H21    1 
ATOM   30   H  H22    . DG  A 1 1  ? -19.480 5.038   30.840 1.00 0.68 ? 101 DG  B H22    1 
ATOM   31   P  P      . DC  A 1 2  ? -16.639 13.243  29.694 1.00 0.64 ? 102 DC  B P      1 
ATOM   32   O  OP1    . DC  A 1 2  ? -16.094 14.418  30.411 1.00 0.68 ? 102 DC  B OP1    1 
ATOM   33   O  OP2    . DC  A 1 2  ? -16.673 13.233  28.214 1.00 0.69 ? 102 DC  B OP2    1 
ATOM   34   O  "O5'"  . DC  A 1 2  ? -15.841 11.936  30.189 1.00 0.57 ? 102 DC  B "O5'"  1 
ATOM   35   C  "C5'"  . DC  A 1 2  ? -15.613 11.711  31.582 1.00 0.57 ? 102 DC  B "C5'"  1 
ATOM   36   C  "C4'"  . DC  A 1 2  ? -15.221 10.257  31.863 1.00 0.51 ? 102 DC  B "C4'"  1 
ATOM   37   O  "O4'"  . DC  A 1 2  ? -16.133 9.356   31.198 1.00 0.50 ? 102 DC  B "O4'"  1 
ATOM   38   C  "C3'"  . DC  A 1 2  ? -13.798 9.937   31.387 1.00 0.47 ? 102 DC  B "C3'"  1 
ATOM   39   O  "O3'"  . DC  A 1 2  ? -12.948 9.638   32.498 1.00 0.50 ? 102 DC  B "O3'"  1 
ATOM   40   C  "C2'"  . DC  A 1 2  ? -13.931 8.732   30.478 1.00 0.43 ? 102 DC  B "C2'"  1 
ATOM   41   C  "C1'"  . DC  A 1 2  ? -15.412 8.376   30.422 1.00 0.43 ? 102 DC  B "C1'"  1 
ATOM   42   N  N1     . DC  A 1 2  ? -15.893 8.373   29.014 1.00 0.41 ? 102 DC  B N1     1 
ATOM   43   C  C2     . DC  A 1 2  ? -16.238 7.154   28.438 1.00 0.41 ? 102 DC  B C2     1 
ATOM   44   O  O2     . DC  A 1 2  ? -16.137 6.117   29.090 1.00 0.43 ? 102 DC  B O2     1 
ATOM   45   N  N3     . DC  A 1 2  ? -16.683 7.148   27.153 1.00 0.41 ? 102 DC  B N3     1 
ATOM   46   C  C4     . DC  A 1 2  ? -16.788 8.286   26.456 1.00 0.42 ? 102 DC  B C4     1 
ATOM   47   N  N4     . DC  A 1 2  ? -17.230 8.244   25.198 1.00 0.46 ? 102 DC  B N4     1 
ATOM   48   C  C5     . DC  A 1 2  ? -16.435 9.543   27.040 1.00 0.44 ? 102 DC  B C5     1 
ATOM   49   C  C6     . DC  A 1 2  ? -15.994 9.540   28.314 1.00 0.43 ? 102 DC  B C6     1 
ATOM   50   H  "H5'"  . DC  A 1 2  ? -16.524 11.945  32.133 1.00 0.64 ? 102 DC  B "H5'"  1 
ATOM   51   H  "H5''" . DC  A 1 2  ? -14.812 12.367  31.923 1.00 0.63 ? 102 DC  B "H5''" 1 
ATOM   52   H  "H4'"  . DC  A 1 2  ? -15.277 10.082  32.938 1.00 0.54 ? 102 DC  B "H4'"  1 
ATOM   53   H  "H3'"  . DC  A 1 2  ? -13.378 10.780  30.829 1.00 0.50 ? 102 DC  B "H3'"  1 
ATOM   54   H  "H2'"  . DC  A 1 2  ? -13.568 8.970   29.475 1.00 0.43 ? 102 DC  B "H2'"  1 
ATOM   55   H  "H2''" . DC  A 1 2  ? -13.358 7.898   30.887 1.00 0.44 ? 102 DC  B "H2''" 1 
ATOM   56   H  "H1'"  . DC  A 1 2  ? -15.568 7.390   30.874 1.00 0.44 ? 102 DC  B "H1'"  1 
ATOM   57   H  H41    . DC  A 1 2  ? -17.481 7.359   24.781 1.00 0.47 ? 102 DC  B H41    1 
ATOM   58   H  H42    . DC  A 1 2  ? -17.312 9.096   24.663 1.00 0.49 ? 102 DC  B H42    1 
ATOM   59   H  H5     . DC  A 1 2  ? -16.517 10.470  26.474 1.00 0.47 ? 102 DC  B H5     1 
ATOM   60   H  H6     . DC  A 1 2  ? -15.714 10.480  28.789 1.00 0.46 ? 102 DC  B H6     1 
ATOM   61   P  P      . DC  A 1 3  ? -11.430 9.155   32.259 1.00 0.52 ? 103 DC  B P      1 
ATOM   62   O  OP1    . DC  A 1 3  ? -10.731 9.168   33.562 1.00 0.63 ? 103 DC  B OP1    1 
ATOM   63   O  OP2    . DC  A 1 3  ? -10.876 9.912   31.114 1.00 0.56 ? 103 DC  B OP2    1 
ATOM   64   O  "O5'"  . DC  A 1 3  ? -11.619 7.621   31.807 1.00 0.46 ? 103 DC  B "O5'"  1 
ATOM   65   C  "C5'"  . DC  A 1 3  ? -11.978 6.627   32.769 1.00 0.44 ? 103 DC  B "C5'"  1 
ATOM   66   C  "C4'"  . DC  A 1 3  ? -12.113 5.240   32.133 1.00 0.37 ? 103 DC  B "C4'"  1 
ATOM   67   O  "O4'"  . DC  A 1 3  ? -13.043 5.278   31.029 1.00 0.37 ? 103 DC  B "O4'"  1 
ATOM   68   C  "C3'"  . DC  A 1 3  ? -10.773 4.707   31.610 1.00 0.35 ? 103 DC  B "C3'"  1 
ATOM   69   O  "O3'"  . DC  A 1 3  ? -10.368 3.552   32.350 1.00 0.37 ? 103 DC  B "O3'"  1 
ATOM   70   C  "C2'"  . DC  A 1 3  ? -11.014 4.350   30.157 1.00 0.32 ? 103 DC  B "C2'"  1 
ATOM   71   C  "C1'"  . DC  A 1 3  ? -12.489 4.614   29.874 1.00 0.32 ? 103 DC  B "C1'"  1 
ATOM   72   N  N1     . DC  A 1 3  ? -12.651 5.458   28.657 1.00 0.31 ? 103 DC  B N1     1 
ATOM   73   C  C2     . DC  A 1 3  ? -13.318 4.913   27.562 1.00 0.31 ? 103 DC  B C2     1 
ATOM   74   O  O2     . DC  A 1 3  ? -13.737 3.759   27.611 1.00 0.33 ? 103 DC  B O2     1 
ATOM   75   N  N3     . DC  A 1 3  ? -13.487 5.686   26.455 1.00 0.31 ? 103 DC  B N3     1 
ATOM   76   C  C4     . DC  A 1 3  ? -13.026 6.941   26.415 1.00 0.34 ? 103 DC  B C4     1 
ATOM   77   N  N4     . DC  A 1 3  ? -13.215 7.672   25.316 1.00 0.37 ? 103 DC  B N4     1 
ATOM   78   C  C5     . DC  A 1 3  ? -12.337 7.508   27.534 1.00 0.37 ? 103 DC  B C5     1 
ATOM   79   C  C6     . DC  A 1 3  ? -12.172 6.736   28.627 1.00 0.35 ? 103 DC  B C6     1 
ATOM   80   H  "H5'"  . DC  A 1 3  ? -12.929 6.902   33.225 1.00 0.52 ? 103 DC  B "H5'"  1 
ATOM   81   H  "H5''" . DC  A 1 3  ? -11.211 6.589   33.543 1.00 0.50 ? 103 DC  B "H5''" 1 
ATOM   82   H  "H4'"  . DC  A 1 3  ? -12.493 4.548   32.885 1.00 0.40 ? 103 DC  B "H4'"  1 
ATOM   83   H  "H3'"  . DC  A 1 3  ? -9.995  5.475   31.682 1.00 0.38 ? 103 DC  B "H3'"  1 
ATOM   84   H  "H2'"  . DC  A 1 3  ? -10.397 4.970   29.504 1.00 0.33 ? 103 DC  B "H2'"  1 
ATOM   85   H  "H2''" . DC  A 1 3  ? -10.779 3.296   29.994 1.00 0.33 ? 103 DC  B "H2''" 1 
ATOM   86   H  "H1'"  . DC  A 1 3  ? -13.009 3.659   29.741 1.00 0.34 ? 103 DC  B "H1'"  1 
ATOM   87   H  H41    . DC  A 1 3  ? -13.695 7.276   24.521 1.00 0.37 ? 103 DC  B H41    1 
ATOM   88   H  H42    . DC  A 1 3  ? -12.874 8.622   25.276 1.00 0.42 ? 103 DC  B H42    1 
ATOM   89   H  H5     . DC  A 1 3  ? -11.957 8.529   27.504 1.00 0.43 ? 103 DC  B H5     1 
ATOM   90   H  H6     . DC  A 1 3  ? -11.645 7.134   29.494 1.00 0.40 ? 103 DC  B H6     1 
ATOM   91   P  P      . DG  A 1 4  ? -8.875  2.967   32.204 1.00 0.36 ? 104 DG  B P      1 
ATOM   92   O  OP1    . DG  A 1 4  ? -8.595  2.115   33.381 1.00 0.46 ? 104 DG  B OP1    1 
ATOM   93   O  OP2    . DG  A 1 4  ? -7.968  4.088   31.872 1.00 0.41 ? 104 DG  B OP2    1 
ATOM   94   O  "O5'"  . DG  A 1 4  ? -8.996  2.015   30.911 1.00 0.42 ? 104 DG  B "O5'"  1 
ATOM   95   C  "C5'"  . DG  A 1 4  ? -9.724  0.786   30.980 1.00 0.37 ? 104 DG  B "C5'"  1 
ATOM   96   C  "C4'"  . DG  A 1 4  ? -9.548  -0.044  29.705 1.00 0.33 ? 104 DG  B "C4'"  1 
ATOM   97   O  "O4'"  . DG  A 1 4  ? -10.312 0.536   28.624 1.00 0.35 ? 104 DG  B "O4'"  1 
ATOM   98   C  "C3'"  . DG  A 1 4  ? -8.079  -0.127  29.266 1.00 0.31 ? 104 DG  B "C3'"  1 
ATOM   99   O  "O3'"  . DG  A 1 4  ? -7.603  -1.475  29.322 1.00 0.35 ? 104 DG  B "O3'"  1 
ATOM   100  C  "C2'"  . DG  A 1 4  ? -8.047  0.385   27.843 1.00 0.30 ? 104 DG  B "C2'"  1 
ATOM   101  C  "C1'"  . DG  A 1 4  ? -9.476  0.768   27.472 1.00 0.32 ? 104 DG  B "C1'"  1 
ATOM   102  N  N9     . DG  A 1 4  ? -9.543  2.183   27.053 1.00 0.31 ? 104 DG  B N9     1 
ATOM   103  C  C8     . DG  A 1 4  ? -9.191  3.304   27.750 1.00 0.32 ? 104 DG  B C8     1 
ATOM   104  N  N7     . DG  A 1 4  ? -9.352  4.424   27.111 1.00 0.33 ? 104 DG  B N7     1 
ATOM   105  C  C5     . DG  A 1 4  ? -9.854  4.018   25.876 1.00 0.31 ? 104 DG  B C5     1 
ATOM   106  C  C6     . DG  A 1 4  ? -10.226 4.793   24.745 1.00 0.33 ? 104 DG  B C6     1 
ATOM   107  O  O6     . DG  A 1 4  ? -10.168 6.011   24.604 1.00 0.35 ? 104 DG  B O6     1 
ATOM   108  N  N1     . DG  A 1 4  ? -10.684 3.994   23.708 1.00 0.33 ? 104 DG  B N1     1 
ATOM   109  C  C2     . DG  A 1 4  ? -10.774 2.618   23.747 1.00 0.33 ? 104 DG  B C2     1 
ATOM   110  N  N2     . DG  A 1 4  ? -11.240 2.025   22.649 1.00 0.36 ? 104 DG  B N2     1 
ATOM   111  N  N3     . DG  A 1 4  ? -10.424 1.885   24.808 1.00 0.32 ? 104 DG  B N3     1 
ATOM   112  C  C4     . DG  A 1 4  ? -9.975  2.647   25.832 1.00 0.31 ? 104 DG  B C4     1 
ATOM   113  H  "H5'"  . DG  A 1 4  ? -10.782 1.007   31.117 1.00 0.51 ? 104 DG  B "H5'"  1 
ATOM   114  H  "H5''" . DG  A 1 4  ? -9.367  0.209   31.832 1.00 0.46 ? 104 DG  B "H5''" 1 
ATOM   115  H  "H4'"  . DG  A 1 4  ? -9.915  -1.053  29.891 1.00 0.35 ? 104 DG  B "H4'"  1 
ATOM   116  H  "H3'"  . DG  A 1 4  ? -7.449  0.503   29.903 1.00 0.33 ? 104 DG  B "H3'"  1 
ATOM   117  H  "H2'"  . DG  A 1 4  ? -7.398  1.260   27.769 1.00 0.31 ? 104 DG  B "H2'"  1 
ATOM   118  H  "H2''" . DG  A 1 4  ? -7.683  -0.403  27.181 1.00 0.34 ? 104 DG  B "H2''" 1 
ATOM   119  H  "H1'"  . DG  A 1 4  ? -9.824  0.137   26.650 1.00 0.36 ? 104 DG  B "H1'"  1 
ATOM   120  H  H8     . DG  A 1 4  ? -8.795  3.261   28.764 1.00 0.34 ? 104 DG  B H8     1 
ATOM   121  H  H1     . DG  A 1 4  ? -10.973 4.479   22.869 1.00 0.34 ? 104 DG  B H1     1 
ATOM   122  H  H21    . DG  A 1 4  ? -11.504 2.581   21.848 1.00 0.38 ? 104 DG  B H21    1 
ATOM   123  H  H22    . DG  A 1 4  ? -11.329 1.020   22.617 1.00 0.39 ? 104 DG  B H22    1 
ATOM   124  P  P      . DA  A 1 5  ? -6.083  -1.820  28.910 1.00 0.39 ? 105 DA  B P      1 
ATOM   125  O  OP1    . DA  A 1 5  ? -5.771  -3.184  29.394 1.00 0.49 ? 105 DA  B OP1    1 
ATOM   126  O  OP2    . DA  A 1 5  ? -5.226  -0.682  29.310 1.00 0.44 ? 105 DA  B OP2    1 
ATOM   127  O  "O5'"  . DA  A 1 5  ? -6.148  -1.860  27.299 1.00 0.37 ? 105 DA  B "O5'"  1 
ATOM   128  C  "C5'"  . DA  A 1 5  ? -6.474  -3.074  26.618 1.00 0.36 ? 105 DA  B "C5'"  1 
ATOM   129  C  "C4'"  . DA  A 1 5  ? -6.770  -2.833  25.130 1.00 0.33 ? 105 DA  B "C4'"  1 
ATOM   130  O  "O4'"  . DA  A 1 5  ? -7.505  -1.599  24.963 1.00 0.35 ? 105 DA  B "O4'"  1 
ATOM   131  C  "C3'"  . DA  A 1 5  ? -5.492  -2.743  24.276 1.00 0.31 ? 105 DA  B "C3'"  1 
ATOM   132  O  "O3'"  . DA  A 1 5  ? -5.410  -3.845  23.363 1.00 0.38 ? 105 DA  B "O3'"  1 
ATOM   133  C  "C2'"  . DA  A 1 5  ? -5.600  -1.431  23.521 1.00 0.33 ? 105 DA  B "C2'"  1 
ATOM   134  C  "C1'"  . DA  A 1 5  ? -6.942  -0.817  23.891 1.00 0.32 ? 105 DA  B "C1'"  1 
ATOM   135  N  N9     . DA  A 1 5  ? -6.775  0.594   24.284 1.00 0.29 ? 105 DA  B N9     1 
ATOM   136  C  C8     . DA  A 1 5  ? -6.217  1.121   25.414 1.00 0.31 ? 105 DA  B C8     1 
ATOM   137  N  N7     . DA  A 1 5  ? -6.212  2.420   25.471 1.00 0.32 ? 105 DA  B N7     1 
ATOM   138  C  C5     . DA  A 1 5  ? -6.818  2.788   24.271 1.00 0.30 ? 105 DA  B C5     1 
ATOM   139  C  C6     . DA  A 1 5  ? -7.120  4.031   23.702 1.00 0.32 ? 105 DA  B C6     1 
ATOM   140  N  N6     . DA  A 1 5  ? -6.855  5.191   24.302 1.00 0.37 ? 105 DA  B N6     1 
ATOM   141  N  N1     . DA  A 1 5  ? -7.717  4.030   22.498 1.00 0.32 ? 105 DA  B N1     1 
ATOM   142  C  C2     . DA  A 1 5  ? -8.002  2.877   21.889 1.00 0.30 ? 105 DA  B C2     1 
ATOM   143  N  N3     . DA  A 1 5  ? -7.761  1.653   22.339 1.00 0.29 ? 105 DA  B N3     1 
ATOM   144  C  C4     . DA  A 1 5  ? -7.161  1.684   23.545 1.00 0.28 ? 105 DA  B C4     1 
ATOM   145  H  "H5'"  . DA  A 1 5  ? -7.354  -3.515  27.087 1.00 0.43 ? 105 DA  B "H5'"  1 
ATOM   146  H  "H5''" . DA  A 1 5  ? -5.640  -3.770  26.711 1.00 0.40 ? 105 DA  B "H5''" 1 
ATOM   147  H  "H4'"  . DA  A 1 5  ? -7.381  -3.656  24.756 1.00 0.39 ? 105 DA  B "H4'"  1 
ATOM   148  H  "H3'"  . DA  A 1 5  ? -4.601  -2.734  24.912 1.00 0.33 ? 105 DA  B "H3'"  1 
ATOM   149  H  "H2'"  . DA  A 1 5  ? -4.792  -0.756  23.814 1.00 0.38 ? 105 DA  B "H2'"  1 
ATOM   150  H  "H2''" . DA  A 1 5  ? -5.554  -1.612  22.446 1.00 0.43 ? 105 DA  B "H2''" 1 
ATOM   151  H  "H1'"  . DA  A 1 5  ? -7.616  -0.867  23.032 1.00 0.37 ? 105 DA  B "H1'"  1 
ATOM   152  H  H8     . DA  A 1 5  ? -5.788  0.500   26.200 1.00 0.34 ? 105 DA  B H8     1 
ATOM   153  H  H61    . DA  A 1 5  ? -7.093  6.061   23.846 1.00 0.39 ? 105 DA  B H61    1 
ATOM   154  H  H62    . DA  A 1 5  ? -6.415  5.201   25.211 1.00 0.39 ? 105 DA  B H62    1 
ATOM   155  H  H2     . DA  A 1 5  ? -8.489  2.950   20.916 1.00 0.32 ? 105 DA  B H2     1 
ATOM   156  P  P      . DG  A 1 6  ? -4.245  -3.902  22.249 1.00 0.43 ? 106 DG  B P      1 
ATOM   157  O  OP1    . DG  A 1 6  ? -3.954  -5.320  21.946 1.00 0.55 ? 106 DG  B OP1    1 
ATOM   158  O  OP2    . DG  A 1 6  ? -3.153  -3.000  22.678 1.00 0.45 ? 106 DG  B OP2    1 
ATOM   159  O  "O5'"  . DG  A 1 6  ? -4.963  -3.246  20.965 1.00 0.42 ? 106 DG  B "O5'"  1 
ATOM   160  C  "C5'"  . DG  A 1 6  ? -5.579  -4.072  19.972 1.00 0.45 ? 106 DG  B "C5'"  1 
ATOM   161  C  "C4'"  . DG  A 1 6  ? -5.517  -3.423  18.588 1.00 0.42 ? 106 DG  B "C4'"  1 
ATOM   162  O  "O4'"  . DG  A 1 6  ? -5.916  -2.037  18.674 1.00 0.44 ? 106 DG  B "O4'"  1 
ATOM   163  C  "C3'"  . DG  A 1 6  ? -4.106  -3.483  17.986 1.00 0.41 ? 106 DG  B "C3'"  1 
ATOM   164  O  "O3'"  . DG  A 1 6  ? -4.103  -4.223  16.764 1.00 0.46 ? 106 DG  B "O3'"  1 
ATOM   165  C  "C2'"  . DG  A 1 6  ? -3.704  -2.046  17.737 1.00 0.43 ? 106 DG  B "C2'"  1 
ATOM   166  C  "C1'"  . DG  A 1 6  ? -4.860  -1.171  18.212 1.00 0.43 ? 106 DG  B "C1'"  1 
ATOM   167  N  N9     . DG  A 1 6  ? -4.411  -0.275  19.295 1.00 0.44 ? 106 DG  B N9     1 
ATOM   168  C  C8     . DG  A 1 6  ? -3.894  -0.595  20.518 1.00 0.58 ? 106 DG  B C8     1 
ATOM   169  N  N7     . DG  A 1 6  ? -3.532  0.421   21.247 1.00 0.58 ? 106 DG  B N7     1 
ATOM   170  C  C5     . DG  A 1 6  ? -3.838  1.517   20.440 1.00 0.43 ? 106 DG  B C5     1 
ATOM   171  C  C6     . DG  A 1 6  ? -3.671  2.909   20.684 1.00 0.40 ? 106 DG  B C6     1 
ATOM   172  O  O6     . DG  A 1 6  ? -3.176  3.462   21.663 1.00 0.46 ? 106 DG  B O6     1 
ATOM   173  N  N1     . DG  A 1 6  ? -4.114  3.668   19.612 1.00 0.40 ? 106 DG  B N1     1 
ATOM   174  C  C2     . DG  A 1 6  ? -4.647  3.162   18.446 1.00 0.44 ? 106 DG  B C2     1 
ATOM   175  N  N2     . DG  A 1 6  ? -5.022  4.057   17.533 1.00 0.59 ? 106 DG  B N2     1 
ATOM   176  N  N3     . DG  A 1 6  ? -4.803  1.858   18.210 1.00 0.40 ? 106 DG  B N3     1 
ATOM   177  C  C4     . DG  A 1 6  ? -4.380  1.097   19.245 1.00 0.38 ? 106 DG  B C4     1 
ATOM   178  H  "H5'"  . DG  A 1 6  ? -6.622  -4.236  20.242 1.00 0.54 ? 106 DG  B "H5'"  1 
ATOM   179  H  "H5''" . DG  A 1 6  ? -5.063  -5.030  19.938 1.00 0.50 ? 106 DG  B "H5''" 1 
ATOM   180  H  "H4'"  . DG  A 1 6  ? -6.205  -3.946  17.923 1.00 0.47 ? 106 DG  B "H4'"  1 
ATOM   181  H  "H3'"  . DG  A 1 6  ? -3.405  -3.948  18.687 1.00 0.45 ? 106 DG  B "H3'"  1 
ATOM   182  H  "H2'"  . DG  A 1 6  ? -2.800  -1.802  18.300 1.00 0.45 ? 106 DG  B "H2'"  1 
ATOM   183  H  "H2''" . DG  A 1 6  ? -3.524  -1.894  16.670 1.00 0.47 ? 106 DG  B "H2''" 1 
ATOM   184  H  "H1'"  . DG  A 1 6  ? -5.233  -0.568  17.381 1.00 0.48 ? 106 DG  B "H1'"  1 
ATOM   185  H  H8     . DG  A 1 6  ? -3.801  -1.629  20.863 1.00 0.71 ? 106 DG  B H8     1 
ATOM   186  H  H1     . DG  A 1 6  ? -4.031  4.666   19.715 1.00 0.44 ? 106 DG  B H1     1 
ATOM   187  H  H21    . DG  A 1 6  ? -4.903  5.043   17.715 1.00 0.65 ? 106 DG  B H21    1 
ATOM   188  H  H22    . DG  A 1 6  ? -5.425  3.749   16.660 1.00 0.68 ? 106 DG  B H22    1 
ATOM   189  P  P      . DA  A 1 7  ? -2.724  -4.475  15.970 1.00 0.53 ? 107 DA  B P      1 
ATOM   190  O  OP1    . DA  A 1 7  ? -2.944  -5.563  14.992 1.00 0.64 ? 107 DA  B OP1    1 
ATOM   191  O  OP2    . DA  A 1 7  ? -1.632  -4.584  16.963 1.00 0.55 ? 107 DA  B OP2    1 
ATOM   192  O  "O5'"  . DA  A 1 7  ? -2.529  -3.098  15.158 1.00 0.52 ? 107 DA  B "O5'"  1 
ATOM   193  C  "C5'"  . DA  A 1 7  ? -3.415  -2.755  14.089 1.00 0.53 ? 107 DA  B "C5'"  1 
ATOM   194  C  "C4'"  . DA  A 1 7  ? -3.107  -1.366  13.522 1.00 0.48 ? 107 DA  B "C4'"  1 
ATOM   195  O  "O4'"  . DA  A 1 7  ? -3.229  -0.362  14.553 1.00 0.49 ? 107 DA  B "O4'"  1 
ATOM   196  C  "C3'"  . DA  A 1 7  ? -1.693  -1.281  12.932 1.00 0.46 ? 107 DA  B "C3'"  1 
ATOM   197  O  "O3'"  . DA  A 1 7  ? -1.747  -1.055  11.521 1.00 0.51 ? 107 DA  B "O3'"  1 
ATOM   198  C  "C2'"  . DA  A 1 7  ? -1.024  -0.116  13.634 1.00 0.44 ? 107 DA  B "C2'"  1 
ATOM   199  C  "C1'"  . DA  A 1 7  ? -2.045  0.461   14.609 1.00 0.44 ? 107 DA  B "C1'"  1 
ATOM   200  N  N9     . DA  A 1 7  ? -1.497  0.491   15.980 1.00 0.41 ? 107 DA  B N9     1 
ATOM   201  C  C8     . DA  A 1 7  ? -1.062  -0.544  16.756 1.00 0.43 ? 107 DA  B C8     1 
ATOM   202  N  N7     . DA  A 1 7  ? -0.628  -0.205  17.933 1.00 0.42 ? 107 DA  B N7     1 
ATOM   203  C  C5     . DA  A 1 7  ? -0.788  1.179   17.941 1.00 0.40 ? 107 DA  B C5     1 
ATOM   204  C  C6     . DA  A 1 7  ? -0.515  2.159   18.902 1.00 0.43 ? 107 DA  B C6     1 
ATOM   205  N  N6     . DA  A 1 7  ? 0.006   1.883   20.097 1.00 0.45 ? 107 DA  B N6     1 
ATOM   206  N  N1     . DA  A 1 7  ? -0.793  3.434   18.581 1.00 0.52 ? 107 DA  B N1     1 
ATOM   207  C  C2     . DA  A 1 7  ? -1.309  3.730   17.388 1.00 0.56 ? 107 DA  B C2     1 
ATOM   208  N  N3     . DA  A 1 7  ? -1.604  2.881   16.409 1.00 0.51 ? 107 DA  B N3     1 
ATOM   209  C  C4     . DA  A 1 7  ? -1.315  1.611   16.758 1.00 0.42 ? 107 DA  B C4     1 
ATOM   210  H  "H5'"  . DA  A 1 7  ? -4.440  -2.769  14.459 1.00 0.63 ? 107 DA  B "H5'"  1 
ATOM   211  H  "H5''" . DA  A 1 7  ? -3.314  -3.494  13.294 1.00 0.60 ? 107 DA  B "H5''" 1 
ATOM   212  H  "H4'"  . DA  A 1 7  ? -3.827  -1.145  12.733 1.00 0.52 ? 107 DA  B "H4'"  1 
ATOM   213  H  "H3'"  . DA  A 1 7  ? -1.136  -2.203  13.127 1.00 0.48 ? 107 DA  B "H3'"  1 
ATOM   214  H  "H2'"  . DA  A 1 7  ? -0.142  -0.457  14.181 1.00 0.43 ? 107 DA  B "H2'"  1 
ATOM   215  H  "H2''" . DA  A 1 7  ? -0.732  0.637   12.899 1.00 0.48 ? 107 DA  B "H2''" 1 
ATOM   216  H  "H1'"  . DA  A 1 7  ? -2.306  1.478   14.308 1.00 0.48 ? 107 DA  B "H1'"  1 
ATOM   217  H  H8     . DA  A 1 7  ? -1.078  -1.579  16.414 1.00 0.49 ? 107 DA  B H8     1 
ATOM   218  H  H61    . DA  A 1 7  ? 0.184   2.629   20.755 1.00 0.49 ? 107 DA  B H61    1 
ATOM   219  H  H62    . DA  A 1 7  ? 0.223   0.929   20.345 1.00 0.46 ? 107 DA  B H62    1 
ATOM   220  H  H2     . DA  A 1 7  ? -1.514  4.783   17.196 1.00 0.68 ? 107 DA  B H2     1 
ATOM   221  P  P      . DG  A 1 8  ? -0.425  -1.213  10.615 1.00 0.57 ? 108 DG  B P      1 
ATOM   222  O  OP1    . DG  A 1 8  ? -0.845  -1.358  9.204  1.00 0.71 ? 108 DG  B OP1    1 
ATOM   223  O  OP2    . DG  A 1 8  ? 0.442   -2.239  11.237 1.00 0.63 ? 108 DG  B OP2    1 
ATOM   224  O  "O5'"  . DG  A 1 8  ? 0.290   0.219   10.784 1.00 0.59 ? 108 DG  B "O5'"  1 
ATOM   225  C  "C5'"  . DG  A 1 8  ? 0.005   1.286   9.875  1.00 0.54 ? 108 DG  B "C5'"  1 
ATOM   226  C  "C4'"  . DG  A 1 8  ? 0.954   2.470   10.082 1.00 0.49 ? 108 DG  B "C4'"  1 
ATOM   227  O  "O4'"  . DG  A 1 8  ? 0.952   2.870   11.473 1.00 0.49 ? 108 DG  B "O4'"  1 
ATOM   228  C  "C3'"  . DG  A 1 8  ? 2.399   2.130   9.685  1.00 0.47 ? 108 DG  B "C3'"  1 
ATOM   229  O  "O3'"  . DG  A 1 8  ? 2.889   3.067   8.715  1.00 0.52 ? 108 DG  B "O3'"  1 
ATOM   230  C  "C2'"  . DG  A 1 8  ? 3.197   2.216   10.968 1.00 0.43 ? 108 DG  B "C2'"  1 
ATOM   231  C  "C1'"  . DG  A 1 8  ? 2.294   2.872   12.000 1.00 0.43 ? 108 DG  B "C1'"  1 
ATOM   232  N  N9     . DG  A 1 8  ? 2.368   2.158   13.289 1.00 0.44 ? 108 DG  B N9     1 
ATOM   233  C  C8     . DG  A 1 8  ? 2.117   0.845   13.566 1.00 0.49 ? 108 DG  B C8     1 
ATOM   234  N  N7     . DG  A 1 8  ? 2.308   0.497   14.805 1.00 0.57 ? 108 DG  B N7     1 
ATOM   235  C  C5     . DG  A 1 8  ? 2.721   1.684   15.409 1.00 0.55 ? 108 DG  B C5     1 
ATOM   236  C  C6     . DG  A 1 8  ? 3.082   1.945   16.759 1.00 0.64 ? 108 DG  B C6     1 
ATOM   237  O  O6     . DG  A 1 8  ? 3.139   1.162   17.698 1.00 0.75 ? 108 DG  B O6     1 
ATOM   238  N  N1     . DG  A 1 8  ? 3.432   3.273   16.946 1.00 0.63 ? 108 DG  B N1     1 
ATOM   239  C  C2     . DG  A 1 8  ? 3.442   4.235   15.962 1.00 0.56 ? 108 DG  B C2     1 
ATOM   240  N  N2     . DG  A 1 8  ? 3.813   5.458   16.339 1.00 0.61 ? 108 DG  B N2     1 
ATOM   241  N  N3     . DG  A 1 8  ? 3.107   3.996   14.691 1.00 0.49 ? 108 DG  B N3     1 
ATOM   242  C  C4     . DG  A 1 8  ? 2.758   2.705   14.488 1.00 0.48 ? 108 DG  B C4     1 
ATOM   243  H  "H5'"  . DG  A 1 8  ? -1.021  1.621   10.031 1.00 0.64 ? 108 DG  B "H5'"  1 
ATOM   244  H  "H5''" . DG  A 1 8  ? 0.109   0.921   8.853  1.00 0.54 ? 108 DG  B "H5''" 1 
ATOM   245  H  "H4'"  . DG  A 1 8  ? 0.610   3.307   9.475  1.00 0.55 ? 108 DG  B "H4'"  1 
ATOM   246  H  "H3'"  . DG  A 1 8  ? 2.462   1.118   9.272  1.00 0.50 ? 108 DG  B "H3'"  1 
ATOM   247  H  "H2'"  . DG  A 1 8  ? 3.477   1.218   11.309 1.00 0.46 ? 108 DG  B "H2'"  1 
ATOM   248  H  "H2''" . DG  A 1 8  ? 4.090   2.817   10.815 1.00 0.46 ? 108 DG  B "H2''" 1 
ATOM   249  H  "H1'"  . DG  A 1 8  ? 2.613   3.905   12.150 1.00 0.45 ? 108 DG  B "H1'"  1 
ATOM   250  H  H8     . DG  A 1 8  ? 1.780   0.140   12.805 1.00 0.51 ? 108 DG  B H8     1 
ATOM   251  H  H1     . DG  A 1 8  ? 3.696   3.533   17.885 1.00 0.71 ? 108 DG  B H1     1 
ATOM   252  H  H21    . DG  A 1 8  ? 4.065   5.634   17.301 1.00 0.68 ? 108 DG  B H21    1 
ATOM   253  H  H22    . DG  A 1 8  ? 3.842   6.207   15.663 1.00 0.61 ? 108 DG  B H22    1 
ATOM   254  P  P      . DT  A 1 9  ? 4.419   3.013   8.204  1.00 0.57 ? 109 DT  B P      1 
ATOM   255  O  OP1    . DT  A 1 9  ? 4.486   3.656   6.873  1.00 0.71 ? 109 DT  B OP1    1 
ATOM   256  O  OP2    . DT  A 1 9  ? 4.919   1.632   8.383  1.00 0.62 ? 109 DT  B OP2    1 
ATOM   257  O  "O5'"  . DT  A 1 9  ? 5.178   3.966   9.264  1.00 0.48 ? 109 DT  B "O5'"  1 
ATOM   258  C  "C5'"  . DT  A 1 9  ? 4.602   5.218   9.652  1.00 0.47 ? 109 DT  B "C5'"  1 
ATOM   259  C  "C4'"  . DT  A 1 9  ? 5.518   6.010   10.597 1.00 0.43 ? 109 DT  B "C4'"  1 
ATOM   260  O  "O4'"  . DT  A 1 9  ? 5.377   5.544   11.957 1.00 0.40 ? 109 DT  B "O4'"  1 
ATOM   261  C  "C3'"  . DT  A 1 9  ? 6.998   5.903   10.209 1.00 0.45 ? 109 DT  B "C3'"  1 
ATOM   262  O  "O3'"  . DT  A 1 9  ? 7.483   7.164   9.732  1.00 0.51 ? 109 DT  B "O3'"  1 
ATOM   263  C  "C2'"  . DT  A 1 9  ? 7.723   5.488   11.476 1.00 0.43 ? 109 DT  B "C2'"  1 
ATOM   264  C  "C1'"  . DT  A 1 9  ? 6.672   5.386   12.576 1.00 0.40 ? 109 DT  B "C1'"  1 
ATOM   265  N  N1     . DT  A 1 9  ? 6.759   4.072   13.266 1.00 0.38 ? 109 DT  B N1     1 
ATOM   266  C  C2     . DT  A 1 9  ? 7.083   4.052   14.616 1.00 0.40 ? 109 DT  B C2     1 
ATOM   267  O  O2     . DT  A 1 9  ? 7.328   5.080   15.244 1.00 0.45 ? 109 DT  B O2     1 
ATOM   268  N  N3     . DT  A 1 9  ? 7.115   2.807   15.216 1.00 0.40 ? 109 DT  B N3     1 
ATOM   269  C  C4     . DT  A 1 9  ? 6.856   1.597   14.598 1.00 0.40 ? 109 DT  B C4     1 
ATOM   270  O  O4     . DT  A 1 9  ? 6.913   0.545   15.231 1.00 0.44 ? 109 DT  B O4     1 
ATOM   271  C  C5     . DT  A 1 9  ? 6.530   1.712   13.194 1.00 0.40 ? 109 DT  B C5     1 
ATOM   272  C  C7     . DT  A 1 9  ? 6.197   0.444   12.402 1.00 0.46 ? 109 DT  B C7     1 
ATOM   273  C  C6     . DT  A 1 9  ? 6.496   2.918   12.584 1.00 0.38 ? 109 DT  B C6     1 
ATOM   274  H  "H5'"  . DT  A 1 9  ? 3.653   5.030   10.154 1.00 0.51 ? 109 DT  B "H5'"  1 
ATOM   275  H  "H5''" . DT  A 1 9  ? 4.416   5.813   8.757  1.00 0.54 ? 109 DT  B "H5''" 1 
ATOM   276  H  "H4'"  . DT  A 1 9  ? 5.227   7.060   10.561 1.00 0.47 ? 109 DT  B "H4'"  1 
ATOM   277  H  "H3'"  . DT  A 1 9  ? 7.139   5.144   9.433  1.00 0.47 ? 109 DT  B "H3'"  1 
ATOM   278  H  "H2'"  . DT  A 1 9  ? 8.207   4.519   11.338 1.00 0.45 ? 109 DT  B "H2'"  1 
ATOM   279  H  "H2''" . DT  A 1 9  ? 8.471   6.237   11.738 1.00 0.47 ? 109 DT  B "H2''" 1 
ATOM   280  H  "H1'"  . DT  A 1 9  ? 6.816   6.200   13.295 1.00 0.44 ? 109 DT  B "H1'"  1 
ATOM   281  H  H3     . DT  A 1 9  ? 7.351   2.778   16.198 1.00 0.44 ? 109 DT  B H3     1 
ATOM   282  H  H71    . DT  A 1 9  ? 5.774   0.707   11.430 1.00 1.21 ? 109 DT  B H71    1 
ATOM   283  H  H72    . DT  A 1 9  ? 5.471   -0.148  12.960 1.00 1.01 ? 109 DT  B H72    1 
ATOM   284  H  H73    . DT  A 1 9  ? 7.105   -0.141  12.256 1.00 1.17 ? 109 DT  B H73    1 
ATOM   285  H  H6     . DT  A 1 9  ? 6.276   2.973   11.520 1.00 0.40 ? 109 DT  B H6     1 
ATOM   286  P  P      . DA  A 1 10 ? 9.041   7.370   9.382  1.00 0.59 ? 110 DA  B P      1 
ATOM   287  O  OP1    . DA  A 1 10 ? 9.177   8.615   8.594  1.00 0.74 ? 110 DA  B OP1    1 
ATOM   288  O  OP2    . DA  A 1 10 ? 9.569   6.096   8.846  1.00 0.62 ? 110 DA  B OP2    1 
ATOM   289  O  "O5'"  . DA  A 1 10 ? 9.697   7.617   10.832 1.00 0.54 ? 110 DA  B "O5'"  1 
ATOM   290  C  "C5'"  . DA  A 1 10 ? 9.310   8.745   11.625 1.00 0.53 ? 110 DA  B "C5'"  1 
ATOM   291  C  "C4'"  . DA  A 1 10 ? 10.276  8.969   12.793 1.00 0.48 ? 110 DA  B "C4'"  1 
ATOM   292  O  "O4'"  . DA  A 1 10 ? 10.011  8.023   13.854 1.00 0.46 ? 110 DA  B "O4'"  1 
ATOM   293  C  "C3'"  . DA  A 1 10 ? 11.742  8.815   12.367 1.00 0.47 ? 110 DA  B "C3'"  1 
ATOM   294  O  "O3'"  . DA  A 1 10 ? 12.444  10.053  12.511 1.00 0.50 ? 110 DA  B "O3'"  1 
ATOM   295  C  "C2'"  . DA  A 1 10 ? 12.327  7.761   13.282 1.00 0.44 ? 110 DA  B "C2'"  1 
ATOM   296  C  "C1'"  . DA  A 1 10 ? 11.199  7.271   14.181 1.00 0.43 ? 110 DA  B "C1'"  1 
ATOM   297  N  N9     . DA  A 1 10 ? 10.966  5.827   13.985 1.00 0.42 ? 110 DA  B N9     1 
ATOM   298  C  C8     . DA  A 1 10 ? 10.731  5.146   12.826 1.00 0.45 ? 110 DA  B C8     1 
ATOM   299  N  N7     . DA  A 1 10 ? 10.529  3.870   12.969 1.00 0.47 ? 110 DA  B N7     1 
ATOM   300  C  C5     . DA  A 1 10 ? 10.643  3.686   14.346 1.00 0.45 ? 110 DA  B C5     1 
ATOM   301  C  C6     . DA  A 1 10 ? 10.538  2.554   15.163 1.00 0.48 ? 110 DA  B C6     1 
ATOM   302  N  N6     . DA  A 1 10 ? 10.281  1.335   14.689 1.00 0.53 ? 110 DA  B N6     1 
ATOM   303  N  N1     . DA  A 1 10 ? 10.711  2.727   16.484 1.00 0.47 ? 110 DA  B N1     1 
ATOM   304  C  C2     . DA  A 1 10 ? 10.970  3.939   16.976 1.00 0.44 ? 110 DA  B C2     1 
ATOM   305  N  N3     . DA  A 1 10 ? 11.087  5.073   16.292 1.00 0.41 ? 110 DA  B N3     1 
ATOM   306  C  C4     . DA  A 1 10 ? 10.910  4.871   14.971 1.00 0.42 ? 110 DA  B C4     1 
ATOM   307  H  "H5'"  . DA  A 1 10 ? 8.308   8.576   12.019 1.00 0.56 ? 110 DA  B "H5'"  1 
ATOM   308  H  "H5''" . DA  A 1 10 ? 9.300   9.635   10.996 1.00 0.58 ? 110 DA  B "H5''" 1 
ATOM   309  H  "H4'"  . DA  A 1 10 ? 10.128  9.977   13.179 1.00 0.51 ? 110 DA  B "H4'"  1 
ATOM   310  H  "H3'"  . DA  A 1 10 ? 11.810  8.483   11.326 1.00 0.50 ? 110 DA  B "H3'"  1 
ATOM   311  H  "H2'"  . DA  A 1 10 ? 12.726  6.927   12.699 1.00 0.45 ? 110 DA  B "H2'"  1 
ATOM   312  H  "H2''" . DA  A 1 10 ? 13.121  8.202   13.883 1.00 0.44 ? 110 DA  B "H2''" 1 
ATOM   313  H  "H1'"  . DA  A 1 10 ? 11.459  7.450   15.227 1.00 0.42 ? 110 DA  B "H1'"  1 
ATOM   314  H  H8     . DA  A 1 10 ? 10.733  5.635   11.852 1.00 0.47 ? 110 DA  B H8     1 
ATOM   315  H  H61    . DA  A 1 10 ? 10.215  0.550   15.323 1.00 0.56 ? 110 DA  B H61    1 
ATOM   316  H  H62    . DA  A 1 10 ? 10.152  1.195   13.697 1.00 0.55 ? 110 DA  B H62    1 
ATOM   317  H  H2     . DA  A 1 10 ? 11.099  4.008   18.056 1.00 0.45 ? 110 DA  B H2     1 
ATOM   318  P  P      . DC  A 1 11 ? 14.030  10.129  12.241 1.00 0.53 ? 111 DC  B P      1 
ATOM   319  O  OP1    . DC  A 1 11 ? 14.410  11.553  12.111 1.00 0.62 ? 111 DC  B OP1    1 
ATOM   320  O  OP2    . DC  A 1 11 ? 14.362  9.174   11.160 1.00 0.57 ? 111 DC  B OP2    1 
ATOM   321  O  "O5'"  . DC  A 1 11 ? 14.648  9.565   13.618 1.00 0.50 ? 111 DC  B "O5'"  1 
ATOM   322  C  "C5'"  . DC  A 1 11 ? 14.447  10.271  14.845 1.00 0.49 ? 111 DC  B "C5'"  1 
ATOM   323  C  "C4'"  . DC  A 1 11 ? 15.001  9.493   16.043 1.00 0.48 ? 111 DC  B "C4'"  1 
ATOM   324  O  "O4'"  . DC  A 1 11 ? 14.402  8.179   16.116 1.00 0.45 ? 111 DC  B "O4'"  1 
ATOM   325  C  "C3'"  . DC  A 1 11 ? 16.524  9.317   15.966 1.00 0.52 ? 111 DC  B "C3'"  1 
ATOM   326  O  "O3'"  . DC  A 1 11 ? 17.168  10.027  17.027 1.00 0.58 ? 111 DC  B "O3'"  1 
ATOM   327  C  "C2'"  . DC  A 1 11 ? 16.770  7.828   16.098 1.00 0.51 ? 111 DC  B "C2'"  1 
ATOM   328  C  "C1'"  . DC  A 1 11 ? 15.413  7.174   16.335 1.00 0.47 ? 111 DC  B "C1'"  1 
ATOM   329  N  N1     . DC  A 1 11 ? 15.222  6.019   15.415 1.00 0.47 ? 111 DC  B N1     1 
ATOM   330  C  C2     . DC  A 1 11 ? 15.151  4.741   15.965 1.00 0.47 ? 111 DC  B C2     1 
ATOM   331  O  O2     . DC  A 1 11 ? 15.236  4.591   17.181 1.00 0.48 ? 111 DC  B O2     1 
ATOM   332  N  N3     . DC  A 1 11 ? 14.989  3.683   15.125 1.00 0.50 ? 111 DC  B N3     1 
ATOM   333  C  C4     . DC  A 1 11 ? 14.898  3.861   13.802 1.00 0.53 ? 111 DC  B C4     1 
ATOM   334  N  N4     . DC  A 1 11 ? 14.737  2.802   13.009 1.00 0.59 ? 111 DC  B N4     1 
ATOM   335  C  C5     . DC  A 1 11 ? 14.970  5.170   13.230 1.00 0.53 ? 111 DC  B C5     1 
ATOM   336  C  C6     . DC  A 1 11 ? 15.132  6.213   14.066 1.00 0.49 ? 111 DC  B C6     1 
ATOM   337  H  "H5'"  . DC  A 1 11 ? 13.379  10.433  14.990 1.00 0.53 ? 111 DC  B "H5'"  1 
ATOM   338  H  "H5''" . DC  A 1 11 ? 14.948  11.237  14.786 1.00 0.54 ? 111 DC  B "H5''" 1 
ATOM   339  H  "H4'"  . DC  A 1 11 ? 14.759  10.039  16.955 1.00 0.50 ? 111 DC  B "H4'"  1 
ATOM   340  H  "H3'"  . DC  A 1 11 ? 16.908  9.676   15.006 1.00 0.54 ? 111 DC  B "H3'"  1 
ATOM   341  H  "H2'"  . DC  A 1 11 ? 17.212  7.433   15.180 1.00 0.54 ? 111 DC  B "H2'"  1 
ATOM   342  H  "H2''" . DC  A 1 11 ? 17.438  7.637   16.940 1.00 0.56 ? 111 DC  B "H2''" 1 
ATOM   343  H  "H1'"  . DC  A 1 11 ? 15.350  6.839   17.376 1.00 0.48 ? 111 DC  B "H1'"  1 
ATOM   344  H  H41    . DC  A 1 11 ? 14.685  1.876   13.407 1.00 0.61 ? 111 DC  B H41    1 
ATOM   345  H  H42    . DC  A 1 11 ? 14.666  2.926   12.009 1.00 0.64 ? 111 DC  B H42    1 
ATOM   346  H  H5     . DC  A 1 11 ? 14.896  5.318   12.152 1.00 0.57 ? 111 DC  B H5     1 
ATOM   347  H  H6     . DC  A 1 11 ? 15.195  7.221   13.662 1.00 0.49 ? 111 DC  B H6     1 
ATOM   348  O  "O5'"  . DG  B 2 1  ? 15.562  -6.357  17.902 1.00 0.91 ? 112 DG  C "O5'"  1 
ATOM   349  C  "C5'"  . DG  B 2 1  ? 16.174  -6.304  19.194 1.00 0.85 ? 112 DG  C "C5'"  1 
ATOM   350  C  "C4'"  . DG  B 2 1  ? 15.607  -5.159  20.039 1.00 0.72 ? 112 DG  C "C4'"  1 
ATOM   351  O  "O4'"  . DG  B 2 1  ? 15.930  -3.885  19.437 1.00 0.67 ? 112 DG  C "O4'"  1 
ATOM   352  C  "C3'"  . DG  B 2 1  ? 14.081  -5.248  20.183 1.00 0.65 ? 112 DG  C "C3'"  1 
ATOM   353  O  "O3'"  . DG  B 2 1  ? 13.708  -5.288  21.564 1.00 0.64 ? 112 DG  C "O3'"  1 
ATOM   354  C  "C2'"  . DG  B 2 1  ? 13.537  -4.002  19.516 1.00 0.58 ? 112 DG  C "C2'"  1 
ATOM   355  C  "C1'"  . DG  B 2 1  ? 14.733  -3.122  19.180 1.00 0.59 ? 112 DG  C "C1'"  1 
ATOM   356  N  N9     . DG  B 2 1  ? 14.685  -2.678  17.771 1.00 0.57 ? 112 DG  C N9     1 
ATOM   357  C  C8     . DG  B 2 1  ? 14.551  -3.422  16.633 1.00 0.62 ? 112 DG  C C8     1 
ATOM   358  N  N7     . DG  B 2 1  ? 14.533  -2.741  15.526 1.00 0.62 ? 112 DG  C N7     1 
ATOM   359  C  C5     . DG  B 2 1  ? 14.667  -1.424  15.960 1.00 0.57 ? 112 DG  C C5     1 
ATOM   360  C  C6     . DG  B 2 1  ? 14.714  -0.218  15.209 1.00 0.56 ? 112 DG  C C6     1 
ATOM   361  O  O6     . DG  B 2 1  ? 14.645  -0.075  13.990 1.00 0.61 ? 112 DG  C O6     1 
ATOM   362  N  N1     . DG  B 2 1  ? 14.859  0.891   16.034 1.00 0.52 ? 112 DG  C N1     1 
ATOM   363  C  C2     . DG  B 2 1  ? 14.946  0.848   17.410 1.00 0.51 ? 112 DG  C C2     1 
ATOM   364  N  N2     . DG  B 2 1  ? 15.084  2.021   18.030 1.00 0.51 ? 112 DG  C N2     1 
ATOM   365  N  N3     . DG  B 2 1  ? 14.903  -0.283  18.119 1.00 0.52 ? 112 DG  C N3     1 
ATOM   366  C  C4     . DG  B 2 1  ? 14.762  -1.376  17.333 1.00 0.54 ? 112 DG  C C4     1 
ATOM   367  H  "H5'"  . DG  B 2 1  ? 17.247  -6.160  19.073 1.00 0.94 ? 112 DG  C "H5'"  1 
ATOM   368  H  "H5''" . DG  B 2 1  ? 15.997  -7.248  19.709 1.00 0.92 ? 112 DG  C "H5''" 1 
ATOM   369  H  "H4'"  . DG  B 2 1  ? 16.055  -5.202  21.032 1.00 0.76 ? 112 DG  C "H4'"  1 
ATOM   370  H  "H3'"  . DG  B 2 1  ? 13.694  -6.141  19.681 1.00 0.70 ? 112 DG  C "H3'"  1 
ATOM   371  H  "H2'"  . DG  B 2 1  ? 13.008  -4.265  18.600 1.00 0.60 ? 112 DG  C "H2'"  1 
ATOM   372  H  "H2''" . DG  B 2 1  ? 12.859  -3.481  20.195 1.00 0.55 ? 112 DG  C "H2''" 1 
ATOM   373  H  "H1'"  . DG  B 2 1  ? 14.725  -2.244  19.827 1.00 0.57 ? 112 DG  C "H1'"  1 
ATOM   374  H  H8     . DG  B 2 1  ? 14.467  -4.509  16.652 1.00 0.66 ? 112 DG  C H8     1 
ATOM   375  H  H1     . DG  B 2 1  ? 14.899  1.787   15.570 1.00 0.52 ? 112 DG  C H1     1 
ATOM   376  H  H21    . DG  B 2 1  ? 15.117  2.875   17.493 1.00 0.51 ? 112 DG  C H21    1 
ATOM   377  H  H22    . DG  B 2 1  ? 15.155  2.054   19.037 1.00 0.52 ? 112 DG  C H22    1 
ATOM   378  P  P      . DT  B 2 2  ? 12.157  -5.327  21.998 1.00 0.62 ? 113 DT  C P      1 
ATOM   379  O  OP1    . DT  B 2 2  ? 12.032  -6.188  23.195 1.00 0.72 ? 113 DT  C OP1    1 
ATOM   380  O  OP2    . DT  B 2 2  ? 11.346  -5.613  20.794 1.00 0.66 ? 113 DT  C OP2    1 
ATOM   381  O  "O5'"  . DT  B 2 2  ? 11.879  -3.803  22.442 1.00 0.54 ? 113 DT  C "O5'"  1 
ATOM   382  C  "C5'"  . DT  B 2 2  ? 12.763  -3.141  23.351 1.00 0.54 ? 113 DT  C "C5'"  1 
ATOM   383  C  "C4'"  . DT  B 2 2  ? 12.398  -1.663  23.526 1.00 0.44 ? 113 DT  C "C4'"  1 
ATOM   384  O  "O4'"  . DT  B 2 2  ? 12.624  -0.936  22.299 1.00 0.46 ? 113 DT  C "O4'"  1 
ATOM   385  C  "C3'"  . DT  B 2 2  ? 10.931  -1.471  23.933 1.00 0.38 ? 113 DT  C "C3'"  1 
ATOM   386  O  "O3'"  . DT  B 2 2  ? 10.839  -0.953  25.263 1.00 0.39 ? 113 DT  C "O3'"  1 
ATOM   387  C  "C2'"  . DT  B 2 2  ? 10.356  -0.486  22.935 1.00 0.35 ? 113 DT  C "C2'"  1 
ATOM   388  C  "C1'"  . DT  B 2 2  ? 11.485  -0.110  21.980 1.00 0.39 ? 113 DT  C "C1'"  1 
ATOM   389  N  N1     . DT  B 2 2  ? 11.068  -0.320  20.566 1.00 0.39 ? 113 DT  C N1     1 
ATOM   390  C  C2     . DT  B 2 2  ? 11.003  0.786   19.727 1.00 0.42 ? 113 DT  C C2     1 
ATOM   391  O  O2     . DT  B 2 2  ? 11.276  1.919   20.117 1.00 0.44 ? 113 DT  C O2     1 
ATOM   392  N  N3     . DT  B 2 2  ? 10.614  0.539   18.424 1.00 0.45 ? 113 DT  C N3     1 
ATOM   393  C  C4     . DT  B 2 2  ? 10.285  -0.694  17.892 1.00 0.47 ? 113 DT  C C4     1 
ATOM   394  O  O4     . DT  B 2 2  ? 9.952   -0.799  16.713 1.00 0.53 ? 113 DT  C O4     1 
ATOM   395  C  C5     . DT  B 2 2  ? 10.375  -1.785  18.836 1.00 0.44 ? 113 DT  C C5     1 
ATOM   396  C  C7     . DT  B 2 2  ? 10.004  -3.197  18.395 1.00 0.49 ? 113 DT  C C7     1 
ATOM   397  C  C6     . DT  B 2 2  ? 10.758  -1.574  20.111 1.00 0.40 ? 113 DT  C C6     1 
ATOM   398  H  "H5'"  . DT  B 2 2  ? 13.782  -3.212  22.970 1.00 0.65 ? 113 DT  C "H5'"  1 
ATOM   399  H  "H5''" . DT  B 2 2  ? 12.712  -3.637  24.321 1.00 0.67 ? 113 DT  C "H5''" 1 
ATOM   400  H  "H4'"  . DT  B 2 2  ? 13.032  -1.239  24.304 1.00 0.47 ? 113 DT  C "H4'"  1 
ATOM   401  H  "H3'"  . DT  B 2 2  ? 10.387  -2.419  23.876 1.00 0.41 ? 113 DT  C "H3'"  1 
ATOM   402  H  "H2'"  . DT  B 2 2  ? 9.536   -0.944  22.376 1.00 0.35 ? 113 DT  C "H2'"  1 
ATOM   403  H  "H2''" . DT  B 2 2  ? 9.991   0.399   23.461 1.00 0.36 ? 113 DT  C "H2''" 1 
ATOM   404  H  "H1'"  . DT  B 2 2  ? 11.761  0.939   22.139 1.00 0.43 ? 113 DT  C "H1'"  1 
ATOM   405  H  H3     . DT  B 2 2  ? 10.567  1.333   17.802 1.00 0.49 ? 113 DT  C H3     1 
ATOM   406  H  H71    . DT  B 2 2  ? 10.757  -3.896  18.752 1.00 1.11 ? 113 DT  C H71    1 
ATOM   407  H  H72    . DT  B 2 2  ? 9.953   -3.242  17.307 1.00 1.12 ? 113 DT  C H72    1 
ATOM   408  H  H73    . DT  B 2 2  ? 9.035   -3.465  18.815 1.00 1.20 ? 113 DT  C H73    1 
ATOM   409  H  H6     . DT  B 2 2  ? 10.833  -2.423  20.791 1.00 0.42 ? 113 DT  C H6     1 
ATOM   410  P  P      . DA  B 2 3  ? 9.403   -0.651  25.924 1.00 0.40 ? 114 DA  C P      1 
ATOM   411  O  OP1    . DA  B 2 3  ? 9.576   -0.573  27.392 1.00 0.50 ? 114 DA  C OP1    1 
ATOM   412  O  OP2    . DA  B 2 3  ? 8.422   -1.596  25.347 1.00 0.46 ? 114 DA  C OP2    1 
ATOM   413  O  "O5'"  . DA  B 2 3  ? 9.066   0.826   25.376 1.00 0.40 ? 114 DA  C "O5'"  1 
ATOM   414  C  "C5'"  . DA  B 2 3  ? 9.824   1.954   25.821 1.00 0.39 ? 114 DA  C "C5'"  1 
ATOM   415  C  "C4'"  . DA  B 2 3  ? 9.369   3.249   25.139 1.00 0.34 ? 114 DA  C "C4'"  1 
ATOM   416  O  "O4'"  . DA  B 2 3  ? 9.514   3.138   23.703 1.00 0.35 ? 114 DA  C "O4'"  1 
ATOM   417  C  "C3'"  . DA  B 2 3  ? 7.902   3.583   25.446 1.00 0.32 ? 114 DA  C "C3'"  1 
ATOM   418  O  "O3'"  . DA  B 2 3  ? 7.801   4.912   25.980 1.00 0.34 ? 114 DA  C "O3'"  1 
ATOM   419  C  "C2'"  . DA  B 2 3  ? 7.180   3.468   24.119 1.00 0.33 ? 114 DA  C "C2'"  1 
ATOM   420  C  "C1'"  . DA  B 2 3  ? 8.254   3.383   23.044 1.00 0.30 ? 114 DA  C "C1'"  1 
ATOM   421  N  N9     . DA  B 2 3  ? 7.953   2.316   22.070 1.00 0.30 ? 114 DA  C N9     1 
ATOM   422  C  C8     . DA  B 2 3  ? 7.687   0.994   22.288 1.00 0.33 ? 114 DA  C C8     1 
ATOM   423  N  N7     . DA  B 2 3  ? 7.477   0.291   21.214 1.00 0.36 ? 114 DA  C N7     1 
ATOM   424  C  C5     . DA  B 2 3  ? 7.615   1.229   20.191 1.00 0.34 ? 114 DA  C C5     1 
ATOM   425  C  C6     . DA  B 2 3  ? 7.514   1.136   18.798 1.00 0.38 ? 114 DA  C C6     1 
ATOM   426  N  N6     . DA  B 2 3  ? 7.243   -0.003  18.160 1.00 0.44 ? 114 DA  C N6     1 
ATOM   427  N  N1     . DA  B 2 3  ? 7.708   2.260   18.087 1.00 0.38 ? 114 DA  C N1     1 
ATOM   428  C  C2     . DA  B 2 3  ? 7.985   3.408   18.707 1.00 0.36 ? 114 DA  C C2     1 
ATOM   429  N  N3     . DA  B 2 3  ? 8.102   3.604   20.015 1.00 0.32 ? 114 DA  C N3     1 
ATOM   430  C  C4     . DA  B 2 3  ? 7.903   2.461   20.703 1.00 0.31 ? 114 DA  C C4     1 
ATOM   431  H  "H5'"  . DA  B 2 3  ? 10.877  1.785   25.596 1.00 0.49 ? 114 DA  C "H5'"  1 
ATOM   432  H  "H5''" . DA  B 2 3  ? 9.703   2.060   26.900 1.00 0.45 ? 114 DA  C "H5''" 1 
ATOM   433  H  "H4'"  . DA  B 2 3  ? 9.995   4.068   25.491 1.00 0.36 ? 114 DA  C "H4'"  1 
ATOM   434  H  "H3'"  . DA  B 2 3  ? 7.482   2.872   26.165 1.00 0.34 ? 114 DA  C "H3'"  1 
ATOM   435  H  "H2'"  . DA  B 2 3  ? 6.565   2.567   24.097 1.00 0.37 ? 114 DA  C "H2'"  1 
ATOM   436  H  "H2''" . DA  B 2 3  ? 6.556   4.341   23.956 1.00 0.38 ? 114 DA  C "H2''" 1 
ATOM   437  H  "H1'"  . DA  B 2 3  ? 8.310   4.339   22.516 1.00 0.31 ? 114 DA  C "H1'"  1 
ATOM   438  H  H8     . DA  B 2 3  ? 7.651   0.560   23.287 1.00 0.36 ? 114 DA  C H8     1 
ATOM   439  H  H61    . DA  B 2 3  ? 7.183   -0.015  17.152 1.00 0.47 ? 114 DA  C H61    1 
ATOM   440  H  H62    . DA  B 2 3  ? 7.099   -0.853  18.685 1.00 0.46 ? 114 DA  C H62    1 
ATOM   441  H  H2     . DA  B 2 3  ? 8.130   4.281   18.070 1.00 0.39 ? 114 DA  C H2     1 
ATOM   442  P  P      . DC  B 2 4  ? 6.369   5.606   26.249 1.00 0.38 ? 115 DC  C P      1 
ATOM   443  O  OP1    . DC  B 2 4  ? 6.527   6.583   27.349 1.00 0.48 ? 115 DC  C OP1    1 
ATOM   444  O  OP2    . DC  B 2 4  ? 5.348   4.539   26.349 1.00 0.42 ? 115 DC  C OP2    1 
ATOM   445  O  "O5'"  . DC  B 2 4  ? 6.115   6.422   24.880 1.00 0.33 ? 115 DC  C "O5'"  1 
ATOM   446  C  "C5'"  . DC  B 2 4  ? 7.167   7.201   24.299 1.00 0.37 ? 115 DC  C "C5'"  1 
ATOM   447  C  "C4'"  . DC  B 2 4  ? 6.723   7.902   23.006 1.00 0.34 ? 115 DC  C "C4'"  1 
ATOM   448  O  "O4'"  . DC  B 2 4  ? 6.952   7.055   21.858 1.00 0.37 ? 115 DC  C "O4'"  1 
ATOM   449  C  "C3'"  . DC  B 2 4  ? 5.239   8.278   23.024 1.00 0.31 ? 115 DC  C "C3'"  1 
ATOM   450  O  "O3'"  . DC  B 2 4  ? 5.067   9.680   23.249 1.00 0.36 ? 115 DC  C "O3'"  1 
ATOM   451  C  "C2'"  . DC  B 2 4  ? 4.708   7.881   21.661 1.00 0.30 ? 115 DC  C "C2'"  1 
ATOM   452  C  "C1'"  . DC  B 2 4  ? 5.793   7.040   20.995 1.00 0.34 ? 115 DC  C "C1'"  1 
ATOM   453  N  N1     . DC  B 2 4  ? 5.321   5.641   20.794 1.00 0.35 ? 115 DC  C N1     1 
ATOM   454  C  C2     . DC  B 2 4  ? 5.366   5.106   19.510 1.00 0.44 ? 115 DC  C C2     1 
ATOM   455  O  O2     . DC  B 2 4  ? 5.768   5.790   18.572 1.00 0.50 ? 115 DC  C O2     1 
ATOM   456  N  N3     . DC  B 2 4  ? 4.956   3.821   19.331 1.00 0.50 ? 115 DC  C N3     1 
ATOM   457  C  C4     . DC  B 2 4  ? 4.521   3.088   20.362 1.00 0.48 ? 115 DC  C C4     1 
ATOM   458  N  N4     . DC  B 2 4  ? 4.133   1.834   20.157 1.00 0.58 ? 115 DC  C N4     1 
ATOM   459  C  C5     . DC  B 2 4  ? 4.468   3.628   21.680 1.00 0.40 ? 115 DC  C C5     1 
ATOM   460  C  C6     . DC  B 2 4  ? 4.875   4.902   21.852 1.00 0.33 ? 115 DC  C C6     1 
ATOM   461  H  "H5'"  . DC  B 2 4  ? 8.009   6.545   24.074 1.00 0.48 ? 115 DC  C "H5'"  1 
ATOM   462  H  "H5''" . DC  B 2 4  ? 7.488   7.952   25.022 1.00 0.46 ? 115 DC  C "H5''" 1 
ATOM   463  H  "H4'"  . DC  B 2 4  ? 7.309   8.814   22.883 1.00 0.38 ? 115 DC  C "H4'"  1 
ATOM   464  H  "H3'"  . DC  B 2 4  ? 4.713   7.719   23.803 1.00 0.31 ? 115 DC  C "H3'"  1 
ATOM   465  H  "H2'"  . DC  B 2 4  ? 3.793   7.298   21.759 1.00 0.28 ? 115 DC  C "H2'"  1 
ATOM   466  H  "H2''" . DC  B 2 4  ? 4.509   8.779   21.071 1.00 0.33 ? 115 DC  C "H2''" 1 
ATOM   467  H  "H1'"  . DC  B 2 4  ? 6.063   7.489   20.034 1.00 0.40 ? 115 DC  C "H1'"  1 
ATOM   468  H  H41    . DC  B 2 4  ? 4.166   1.441   19.227 1.00 0.65 ? 115 DC  C H41    1 
ATOM   469  H  H42    . DC  B 2 4  ? 3.805   1.273   20.930 1.00 0.60 ? 115 DC  C H42    1 
ATOM   470  H  H5     . DC  B 2 4  ? 4.108   3.027   22.517 1.00 0.44 ? 115 DC  C H5     1 
ATOM   471  H  H6     . DC  B 2 4  ? 4.838   5.352   22.841 1.00 0.31 ? 115 DC  C H6     1 
ATOM   472  P  P      . DT  B 2 5  ? 3.598   10.295  23.484 1.00 0.41 ? 116 DT  C P      1 
ATOM   473  O  OP1    . DT  B 2 5  ? 3.745   11.723  23.841 1.00 0.52 ? 116 DT  C OP1    1 
ATOM   474  O  OP2    . DT  B 2 5  ? 2.852   9.383   24.380 1.00 0.45 ? 116 DT  C OP2    1 
ATOM   475  O  "O5'"  . DT  B 2 5  ? 2.940   10.207  22.017 1.00 0.40 ? 116 DT  C "O5'"  1 
ATOM   476  C  "C5'"  . DT  B 2 5  ? 3.206   11.219  21.042 1.00 0.41 ? 116 DT  C "C5'"  1 
ATOM   477  C  "C4'"  . DT  B 2 5  ? 2.323   11.054  19.801 1.00 0.38 ? 116 DT  C "C4'"  1 
ATOM   478  O  "O4'"  . DT  B 2 5  ? 2.364   9.688   19.333 1.00 0.35 ? 116 DT  C "O4'"  1 
ATOM   479  C  "C3'"  . DT  B 2 5  ? 0.860   11.425  20.077 1.00 0.39 ? 116 DT  C "C3'"  1 
ATOM   480  O  "O3'"  . DT  B 2 5  ? 0.472   12.558  19.295 1.00 0.47 ? 116 DT  C "O3'"  1 
ATOM   481  C  "C2'"  . DT  B 2 5  ? 0.047   10.205  19.693 1.00 0.36 ? 116 DT  C "C2'"  1 
ATOM   482  C  "C1'"  . DT  B 2 5  ? 1.031   9.154   19.187 1.00 0.32 ? 116 DT  C "C1'"  1 
ATOM   483  N  N1     . DT  B 2 5  ? 0.896   7.889   19.962 1.00 0.28 ? 116 DT  C N1     1 
ATOM   484  C  C2     . DT  B 2 5  ? 0.479   6.746   19.292 1.00 0.31 ? 116 DT  C C2     1 
ATOM   485  O  O2     . DT  B 2 5  ? 0.197   6.757   18.096 1.00 0.36 ? 116 DT  C O2     1 
ATOM   486  N  N3     . DT  B 2 5  ? 0.397   5.592   20.049 1.00 0.31 ? 116 DT  C N3     1 
ATOM   487  C  C4     . DT  B 2 5  ? 0.689   5.477   21.396 1.00 0.30 ? 116 DT  C C4     1 
ATOM   488  O  O4     . DT  B 2 5  ? 0.591   4.392   21.967 1.00 0.35 ? 116 DT  C O4     1 
ATOM   489  C  C5     . DT  B 2 5  ? 1.110   6.718   22.015 1.00 0.28 ? 116 DT  C C5     1 
ATOM   490  C  C7     . DT  B 2 5  ? 1.444   6.743   23.509 1.00 0.34 ? 116 DT  C C7     1 
ATOM   491  C  C6     . DT  B 2 5  ? 1.199   7.858   21.297 1.00 0.28 ? 116 DT  C C6     1 
ATOM   492  H  "H5'"  . DT  B 2 5  ? 4.253   11.159  20.744 1.00 0.45 ? 116 DT  C "H5'"  1 
ATOM   493  H  "H5''" . DT  B 2 5  ? 3.018   12.197  21.485 1.00 0.45 ? 116 DT  C "H5''" 1 
ATOM   494  H  "H4'"  . DT  B 2 5  ? 2.704   11.705  19.014 1.00 0.43 ? 116 DT  C "H4'"  1 
ATOM   495  H  "H3'"  . DT  B 2 5  ? 0.712   11.652  21.138 1.00 0.42 ? 116 DT  C "H3'"  1 
ATOM   496  H  "H2'"  . DT  B 2 5  ? -0.493  9.818   20.560 1.00 0.36 ? 116 DT  C "H2'"  1 
ATOM   497  H  "H2''" . DT  B 2 5  ? -0.662  10.470  18.906 1.00 0.39 ? 116 DT  C "H2''" 1 
ATOM   498  H  "H1'"  . DT  B 2 5  ? 0.846   8.965   18.123 1.00 0.35 ? 116 DT  C "H1'"  1 
ATOM   499  H  H3     . DT  B 2 5  ? 0.092   4.755   19.574 1.00 0.36 ? 116 DT  C H3     1 
ATOM   500  H  H71    . DT  B 2 5  ? 1.302   5.749   23.935 1.00 1.04 ? 116 DT  C H71    1 
ATOM   501  H  H72    . DT  B 2 5  ? 0.790   7.453   24.014 1.00 1.10 ? 116 DT  C H72    1 
ATOM   502  H  H73    . DT  B 2 5  ? 2.479   7.047   23.647 1.00 1.04 ? 116 DT  C H73    1 
ATOM   503  H  H6     . DT  B 2 5  ? 1.515   8.777   21.791 1.00 0.31 ? 116 DT  C H6     1 
ATOM   504  P  P      . DC  B 2 6  ? -1.030  13.132  19.370 1.00 0.85 ? 117 DC  C P      1 
ATOM   505  O  OP1    . DC  B 2 6  ? -1.057  14.449  18.696 1.00 1.47 ? 117 DC  C OP1    1 
ATOM   506  O  OP2    . DC  B 2 6  ? -1.504  13.008  20.767 1.00 1.46 ? 117 DC  C OP2    1 
ATOM   507  O  "O5'"  . DC  B 2 6  ? -1.854  12.086  18.464 1.00 0.60 ? 117 DC  C "O5'"  1 
ATOM   508  C  "C5'"  . DC  B 2 6  ? -1.848  12.200  17.039 1.00 0.51 ? 117 DC  C "C5'"  1 
ATOM   509  C  "C4'"  . DC  B 2 6  ? -2.656  11.077  16.381 1.00 0.40 ? 117 DC  C "C4'"  1 
ATOM   510  O  "O4'"  . DC  B 2 6  ? -2.318  9.803   16.974 1.00 0.36 ? 117 DC  C "O4'"  1 
ATOM   511  C  "C3'"  . DC  B 2 6  ? -4.172  11.284  16.533 1.00 0.39 ? 117 DC  C "C3'"  1 
ATOM   512  O  "O3'"  . DC  B 2 6  ? -4.804  11.353  15.249 1.00 0.41 ? 117 DC  C "O3'"  1 
ATOM   513  C  "C2'"  . DC  B 2 6  ? -4.664  10.080  17.301 1.00 0.39 ? 117 DC  C "C2'"  1 
ATOM   514  C  "C1'"  . DC  B 2 6  ? -3.517  9.081   17.315 1.00 0.34 ? 117 DC  C "C1'"  1 
ATOM   515  N  N1     . DC  B 2 6  ? -3.402  8.438   18.648 1.00 0.33 ? 117 DC  C N1     1 
ATOM   516  C  C2     . DC  B 2 6  ? -3.675  7.079   18.739 1.00 0.37 ? 117 DC  C C2     1 
ATOM   517  O  O2     . DC  B 2 6  ? -3.964  6.444   17.728 1.00 0.43 ? 117 DC  C O2     1 
ATOM   518  N  N3     . DC  B 2 6  ? -3.608  6.484   19.958 1.00 0.38 ? 117 DC  C N3     1 
ATOM   519  C  C4     . DC  B 2 6  ? -3.287  7.189   21.047 1.00 0.37 ? 117 DC  C C4     1 
ATOM   520  N  N4     . DC  B 2 6  ? -3.259  6.578   22.228 1.00 0.41 ? 117 DC  C N4     1 
ATOM   521  C  C5     . DC  B 2 6  ? -3.000  8.587   20.965 1.00 0.35 ? 117 DC  C C5     1 
ATOM   522  C  C6     . DC  B 2 6  ? -3.068  9.168   19.752 1.00 0.33 ? 117 DC  C C6     1 
ATOM   523  H  "H5'"  . DC  B 2 6  ? -0.819  12.153  16.683 1.00 0.64 ? 117 DC  C "H5'"  1 
ATOM   524  H  "H5''" . DC  B 2 6  ? -2.278  13.161  16.756 1.00 0.52 ? 117 DC  C "H5''" 1 
ATOM   525  H  "H4'"  . DC  B 2 6  ? -2.411  11.046  15.319 1.00 0.45 ? 117 DC  C "H4'"  1 
ATOM   526  H  "H3'"  . DC  B 2 6  ? -4.386  12.198  17.094 1.00 0.46 ? 117 DC  C "H3'"  1 
ATOM   527  H  "H2'"  . DC  B 2 6  ? -4.918  10.364  18.321 1.00 0.45 ? 117 DC  C "H2'"  1 
ATOM   528  H  "H2''" . DC  B 2 6  ? -5.536  9.652   16.816 1.00 0.44 ? 117 DC  C "H2''" 1 
ATOM   529  H  "H1'"  . DC  B 2 6  ? -3.693  8.323   16.544 1.00 0.39 ? 117 DC  C "H1'"  1 
ATOM   530  H  H41    . DC  B 2 6  ? -3.454  5.586   22.288 1.00 0.44 ? 117 DC  C H41    1 
ATOM   531  H  H42    . DC  B 2 6  ? -3.035  7.101   23.062 1.00 0.43 ? 117 DC  C H42    1 
ATOM   532  H  H5     . DC  B 2 6  ? -2.735  9.161   21.852 1.00 0.40 ? 117 DC  C H5     1 
ATOM   533  H  H6     . DC  B 2 6  ? -2.861  10.233  19.652 1.00 0.36 ? 117 DC  C H6     1 
ATOM   534  P  P      . DT  B 2 7  ? -6.401  11.541  15.126 1.00 0.45 ? 118 DT  C P      1 
ATOM   535  O  OP1    . DT  B 2 7  ? -6.718  11.900  13.725 1.00 0.54 ? 118 DT  C OP1    1 
ATOM   536  O  OP2    . DT  B 2 7  ? -6.848  12.419  16.230 1.00 0.48 ? 118 DT  C OP2    1 
ATOM   537  O  "O5'"  . DT  B 2 7  ? -6.963  10.055  15.406 1.00 0.41 ? 118 DT  C "O5'"  1 
ATOM   538  C  "C5'"  . DT  B 2 7  ? -6.621  8.960   14.548 1.00 0.43 ? 118 DT  C "C5'"  1 
ATOM   539  C  "C4'"  . DT  B 2 7  ? -7.478  7.725   14.842 1.00 0.41 ? 118 DT  C "C4'"  1 
ATOM   540  O  "O4'"  . DT  B 2 7  ? -6.943  7.019   15.986 1.00 0.39 ? 118 DT  C "O4'"  1 
ATOM   541  C  "C3'"  . DT  B 2 7  ? -8.940  8.083   15.152 1.00 0.41 ? 118 DT  C "C3'"  1 
ATOM   542  O  "O3'"  . DT  B 2 7  ? -9.818  7.650   14.110 1.00 0.47 ? 118 DT  C "O3'"  1 
ATOM   543  C  "C2'"  . DT  B 2 7  ? -9.274  7.338   16.428 1.00 0.38 ? 118 DT  C "C2'"  1 
ATOM   544  C  "C1'"  . DT  B 2 7  ? -8.010  6.596   16.857 1.00 0.37 ? 118 DT  C "C1'"  1 
ATOM   545  N  N1     . DT  B 2 7  ? -7.690  6.870   18.292 1.00 0.33 ? 118 DT  C N1     1 
ATOM   546  C  C2     . DT  B 2 7  ? -7.639  5.789   19.162 1.00 0.34 ? 118 DT  C C2     1 
ATOM   547  O  O2     . DT  B 2 7  ? -7.812  4.634   18.776 1.00 0.38 ? 118 DT  C O2     1 
ATOM   548  N  N3     . DT  B 2 7  ? -7.382  6.081   20.487 1.00 0.34 ? 118 DT  C N3     1 
ATOM   549  C  C4     . DT  B 2 7  ? -7.174  7.336   21.020 1.00 0.33 ? 118 DT  C C4     1 
ATOM   550  O  O4     . DT  B 2 7  ? -6.954  7.477   22.221 1.00 0.35 ? 118 DT  C O4     1 
ATOM   551  C  C5     . DT  B 2 7  ? -7.244  8.405   20.053 1.00 0.33 ? 118 DT  C C5     1 
ATOM   552  C  C7     . DT  B 2 7  ? -7.075  9.846   20.531 1.00 0.36 ? 118 DT  C C7     1 
ATOM   553  C  C6     . DT  B 2 7  ? -7.488  8.151   18.747 1.00 0.33 ? 118 DT  C C6     1 
ATOM   554  H  "H5'"  . DT  B 2 7  ? -5.572  8.705   14.696 1.00 0.47 ? 118 DT  C "H5'"  1 
ATOM   555  H  "H5''" . DT  B 2 7  ? -6.768  9.254   13.509 1.00 0.50 ? 118 DT  C "H5''" 1 
ATOM   556  H  "H4'"  . DT  B 2 7  ? -7.452  7.064   13.979 1.00 0.45 ? 118 DT  C "H4'"  1 
ATOM   557  H  "H3'"  . DT  B 2 7  ? -9.053  9.161   15.304 1.00 0.42 ? 118 DT  C "H3'"  1 
ATOM   558  H  "H2'"  . DT  B 2 7  ? -9.591  8.033   17.206 1.00 0.37 ? 118 DT  C "H2'"  1 
ATOM   559  H  "H2''" . DT  B 2 7  ? -10.074 6.625   16.230 1.00 0.41 ? 118 DT  C "H2''" 1 
ATOM   560  H  "H1'"  . DT  B 2 7  ? -8.162  5.521   16.711 1.00 0.40 ? 118 DT  C "H1'"  1 
ATOM   561  H  H3     . DT  B 2 7  ? -7.345  5.304   21.126 1.00 0.36 ? 118 DT  C H3     1 
ATOM   562  H  H71    . DT  B 2 7  ? -6.021  10.115  20.514 1.00 1.05 ? 118 DT  C H71    1 
ATOM   563  H  H72    . DT  B 2 7  ? -7.453  9.934   21.550 1.00 1.09 ? 118 DT  C H72    1 
ATOM   564  H  H73    . DT  B 2 7  ? -7.635  10.519  19.880 1.00 1.12 ? 118 DT  C H73    1 
ATOM   565  H  H6     . DT  B 2 7  ? -7.515  8.980   18.041 1.00 0.35 ? 118 DT  C H6     1 
ATOM   566  P  P      . DC  B 2 8  ? -11.412 7.851   14.264 1.00 0.50 ? 119 DC  C P      1 
ATOM   567  O  OP1    . DC  B 2 8  ? -12.006 7.923   12.912 1.00 0.60 ? 119 DC  C OP1    1 
ATOM   568  O  OP2    . DC  B 2 8  ? -11.648 8.946   15.231 1.00 0.50 ? 119 DC  C OP2    1 
ATOM   569  O  "O5'"  . DC  B 2 8  ? -11.875 6.468   14.949 1.00 0.48 ? 119 DC  C "O5'"  1 
ATOM   570  C  "C5'"  . DC  B 2 8  ? -11.444 5.217   14.408 1.00 0.52 ? 119 DC  C "C5'"  1 
ATOM   571  C  "C4'"  . DC  B 2 8  ? -11.842 4.035   15.299 1.00 0.46 ? 119 DC  C "C4'"  1 
ATOM   572  O  "O4'"  . DC  B 2 8  ? -11.040 4.018   16.502 1.00 0.45 ? 119 DC  C "O4'"  1 
ATOM   573  C  "C3'"  . DC  B 2 8  ? -13.319 4.082   15.713 1.00 0.45 ? 119 DC  C "C3'"  1 
ATOM   574  O  "O3'"  . DC  B 2 8  ? -14.040 2.991   15.133 1.00 0.49 ? 119 DC  C "O3'"  1 
ATOM   575  C  "C2'"  . DC  B 2 8  ? -13.323 3.969   17.225 1.00 0.41 ? 119 DC  C "C2'"  1 
ATOM   576  C  "C1'"  . DC  B 2 8  ? -11.871 3.787   17.659 1.00 0.40 ? 119 DC  C "C1'"  1 
ATOM   577  N  N1     . DC  B 2 8  ? -11.518 4.730   18.760 1.00 0.37 ? 119 DC  C N1     1 
ATOM   578  C  C2     . DC  B 2 8  ? -11.113 4.192   19.980 1.00 0.39 ? 119 DC  C C2     1 
ATOM   579  O  O2     . DC  B 2 8  ? -11.069 2.973   20.129 1.00 0.44 ? 119 DC  C O2     1 
ATOM   580  N  N3     . DC  B 2 8  ? -10.774 5.045   20.985 1.00 0.39 ? 119 DC  C N3     1 
ATOM   581  C  C4     . DC  B 2 8  ? -10.826 6.371   20.809 1.00 0.37 ? 119 DC  C C4     1 
ATOM   582  N  N4     . DC  B 2 8  ? -10.484 7.177   21.814 1.00 0.39 ? 119 DC  C N4     1 
ATOM   583  C  C5     . DC  B 2 8  ? -11.241 6.932   19.561 1.00 0.37 ? 119 DC  C C5     1 
ATOM   584  C  C6     . DC  B 2 8  ? -11.577 6.082   18.571 1.00 0.37 ? 119 DC  C C6     1 
ATOM   585  H  "H5'"  . DC  B 2 8  ? -10.360 5.232   14.303 1.00 0.59 ? 119 DC  C "H5'"  1 
ATOM   586  H  "H5''" . DC  B 2 8  ? -11.893 5.084   13.424 1.00 0.63 ? 119 DC  C "H5''" 1 
ATOM   587  H  "H4'"  . DC  B 2 8  ? -11.664 3.110   14.750 1.00 0.49 ? 119 DC  C "H4'"  1 
ATOM   588  H  "H3'"  . DC  B 2 8  ? -13.779 5.027   15.406 1.00 0.48 ? 119 DC  C "H3'"  1 
ATOM   589  H  "H2'"  . DC  B 2 8  ? -13.736 4.874   17.674 1.00 0.41 ? 119 DC  C "H2'"  1 
ATOM   590  H  "H2''" . DC  B 2 8  ? -13.919 3.105   17.526 1.00 0.44 ? 119 DC  C "H2''" 1 
ATOM   591  H  "H1'"  . DC  B 2 8  ? -11.721 2.754   17.990 1.00 0.43 ? 119 DC  C "H1'"  1 
ATOM   592  H  H41    . DC  B 2 8  ? -10.189 6.785   22.697 1.00 0.43 ? 119 DC  C H41    1 
ATOM   593  H  H42    . DC  B 2 8  ? -10.518 8.179   21.692 1.00 0.40 ? 119 DC  C H42    1 
ATOM   594  H  H5     . DC  B 2 8  ? -11.283 8.011   19.416 1.00 0.39 ? 119 DC  C H5     1 
ATOM   595  H  H6     . DC  B 2 8  ? -11.910 6.479   17.614 1.00 0.40 ? 119 DC  C H6     1 
ATOM   596  P  P      . DG  B 2 9  ? -15.619 2.820   15.398 1.00 0.49 ? 120 DG  C P      1 
ATOM   597  O  OP1    . DG  B 2 9  ? -16.177 1.960   14.331 1.00 0.59 ? 120 DG  C OP1    1 
ATOM   598  O  OP2    . DG  B 2 9  ? -16.196 4.161   15.642 1.00 0.51 ? 120 DG  C OP2    1 
ATOM   599  O  "O5'"  . DG  B 2 9  ? -15.659 1.996   16.782 1.00 0.47 ? 120 DG  C "O5'"  1 
ATOM   600  C  "C5'"  . DG  B 2 9  ? -15.103 0.680   16.858 1.00 0.51 ? 120 DG  C "C5'"  1 
ATOM   601  C  "C4'"  . DG  B 2 9  ? -15.322 0.051   18.239 1.00 0.46 ? 120 DG  C "C4'"  1 
ATOM   602  O  "O4'"  . DG  B 2 9  ? -14.633 0.817   19.255 1.00 0.44 ? 120 DG  C "O4'"  1 
ATOM   603  C  "C3'"  . DG  B 2 9  ? -16.809 -0.019  18.617 1.00 0.45 ? 120 DG  C "C3'"  1 
ATOM   604  O  "O3'"  . DG  B 2 9  ? -17.196 -1.376  18.878 1.00 0.51 ? 120 DG  C "O3'"  1 
ATOM   605  C  "C2'"  . DG  B 2 9  ? -16.948 0.829   19.864 1.00 0.46 ? 120 DG  C "C2'"  1 
ATOM   606  C  "C1'"  . DG  B 2 9  ? -15.540 1.183   20.316 1.00 0.41 ? 120 DG  C "C1'"  1 
ATOM   607  N  N9     . DG  B 2 9  ? -15.428 2.621   20.635 1.00 0.36 ? 120 DG  C N9     1 
ATOM   608  C  C8     . DG  B 2 9  ? -15.580 3.704   19.817 1.00 0.38 ? 120 DG  C C8     1 
ATOM   609  N  N7     . DG  B 2 9  ? -15.401 4.858   20.390 1.00 0.38 ? 120 DG  C N7     1 
ATOM   610  C  C5     . DG  B 2 9  ? -15.105 4.516   21.709 1.00 0.35 ? 120 DG  C C5     1 
ATOM   611  C  C6     . DG  B 2 9  ? -14.811 5.349   22.823 1.00 0.36 ? 120 DG  C C6     1 
ATOM   612  O  O6     . DG  B 2 9  ? -14.753 6.576   22.863 1.00 0.41 ? 120 DG  C O6     1 
ATOM   613  N  N1     . DG  B 2 9  ? -14.572 4.601   23.969 1.00 0.34 ? 120 DG  C N1     1 
ATOM   614  C  C2     . DG  B 2 9  ? -14.610 3.225   24.039 1.00 0.33 ? 120 DG  C C2     1 
ATOM   615  N  N2     . DG  B 2 9  ? -14.351 2.686   25.230 1.00 0.36 ? 120 DG  C N2     1 
ATOM   616  N  N3     . DG  B 2 9  ? -14.884 2.439   22.994 1.00 0.33 ? 120 DG  C N3     1 
ATOM   617  C  C4     . DG  B 2 9  ? -15.120 3.149   21.867 1.00 0.33 ? 120 DG  C C4     1 
ATOM   618  H  "H5'"  . DG  B 2 9  ? -14.033 0.735   16.659 1.00 0.59 ? 120 DG  C "H5'"  1 
ATOM   619  H  "H5''" . DG  B 2 9  ? -15.573 0.051   16.103 1.00 0.58 ? 120 DG  C "H5''" 1 
ATOM   620  H  "H4'"  . DG  B 2 9  ? -14.916 -0.961  18.229 1.00 0.49 ? 120 DG  C "H4'"  1 
ATOM   621  H  "H3'"  . DG  B 2 9  ? -17.434 0.388   17.816 1.00 0.46 ? 120 DG  C "H3'"  1 
ATOM   622  H  "H2'"  . DG  B 2 9  ? -17.505 1.743   19.645 1.00 0.48 ? 120 DG  C "H2'"  1 
ATOM   623  H  "H2''" . DG  B 2 9  ? -17.456 0.264   20.639 1.00 0.57 ? 120 DG  C "H2''" 1 
ATOM   624  H  "H1'"  . DG  B 2 9  ? -15.294 0.603   21.209 1.00 0.45 ? 120 DG  C "H1'"  1 
ATOM   625  H  H8     . DG  B 2 9  ? -15.839 3.609   18.763 1.00 0.42 ? 120 DG  C H8     1 
ATOM   626  H  H1     . DG  B 2 9  ? -14.358 5.124   24.805 1.00 0.36 ? 120 DG  C H1     1 
ATOM   627  H  H21    . DG  B 2 9  ? -14.144 3.281   26.019 1.00 0.37 ? 120 DG  C H21    1 
ATOM   628  H  H22    . DG  B 2 9  ? -14.363 1.682   25.344 1.00 0.39 ? 120 DG  C H22    1 
ATOM   629  P  P      . DG  B 2 10 ? -18.668 -1.734  19.434 1.00 0.55 ? 121 DG  C P      1 
ATOM   630  O  OP1    . DG  B 2 10 ? -18.946 -3.156  19.130 1.00 0.70 ? 121 DG  C OP1    1 
ATOM   631  O  OP2    . DG  B 2 10 ? -19.605 -0.684  18.974 1.00 0.64 ? 121 DG  C OP2    1 
ATOM   632  O  "O5'"  . DG  B 2 10 ? -18.488 -1.584  21.032 1.00 0.44 ? 121 DG  C "O5'"  1 
ATOM   633  C  "C5'"  . DG  B 2 10 ? -17.428 -2.266  21.711 1.00 0.45 ? 121 DG  C "C5'"  1 
ATOM   634  C  "C4'"  . DG  B 2 10 ? -17.614 -2.247  23.238 1.00 0.38 ? 121 DG  C "C4'"  1 
ATOM   635  O  "O4'"  . DG  B 2 10 ? -17.005 -1.066  23.807 1.00 0.36 ? 121 DG  C "O4'"  1 
ATOM   636  C  "C3'"  . DG  B 2 10 ? -19.094 -2.266  23.646 1.00 0.37 ? 121 DG  C "C3'"  1 
ATOM   637  O  "O3'"  . DG  B 2 10 ? -19.412 -3.480  24.334 1.00 0.42 ? 121 DG  C "O3'"  1 
ATOM   638  C  "C2'"  . DG  B 2 10 ? -19.284 -1.072  24.561 1.00 0.37 ? 121 DG  C "C2'"  1 
ATOM   639  C  "C1'"  . DG  B 2 10 ? -17.926 -0.389  24.689 1.00 0.34 ? 121 DG  C "C1'"  1 
ATOM   640  N  N9     . DG  B 2 10 ? -18.024 1.042   24.338 1.00 0.33 ? 121 DG  C N9     1 
ATOM   641  C  C8     . DG  B 2 10 ? -18.427 1.611   23.166 1.00 0.38 ? 121 DG  C C8     1 
ATOM   642  N  N7     . DG  B 2 10 ? -18.392 2.908   23.138 1.00 0.40 ? 121 DG  C N7     1 
ATOM   643  C  C5     . DG  B 2 10 ? -17.926 3.241   24.407 1.00 0.37 ? 121 DG  C C5     1 
ATOM   644  C  C6     . DG  B 2 10 ? -17.678 4.517   24.977 1.00 0.40 ? 121 DG  C C6     1 
ATOM   645  O  O6     . DG  B 2 10 ? -17.823 5.624   24.462 1.00 0.45 ? 121 DG  C O6     1 
ATOM   646  N  N1     . DG  B 2 10 ? -17.216 4.410   26.281 1.00 0.39 ? 121 DG  C N1     1 
ATOM   647  C  C2     . DG  B 2 10 ? -17.016 3.225   26.957 1.00 0.37 ? 121 DG  C C2     1 
ATOM   648  N  N2     . DG  B 2 10 ? -16.567 3.328   28.207 1.00 0.43 ? 121 DG  C N2     1 
ATOM   649  N  N3     . DG  B 2 10 ? -17.247 2.021   26.423 1.00 0.34 ? 121 DG  C N3     1 
ATOM   650  C  C4     . DG  B 2 10 ? -17.698 2.104   25.151 1.00 0.33 ? 121 DG  C C4     1 
ATOM   651  H  "H5'"  . DG  B 2 10 ? -16.482 -1.784  21.465 1.00 0.53 ? 121 DG  C "H5'"  1 
ATOM   652  H  "H5''" . DG  B 2 10 ? -17.398 -3.301  21.367 1.00 0.52 ? 121 DG  C "H5''" 1 
ATOM   653  H  "H4'"  . DG  B 2 10 ? -17.126 -3.126  23.662 1.00 0.42 ? 121 DG  C "H4'"  1 
ATOM   654  H  "H3'"  . DG  B 2 10 ? -19.739 -2.170  22.767 1.00 0.39 ? 121 DG  C "H3'"  1 
ATOM   655  H  "H2'"  . DG  B 2 10 ? -20.009 -0.376  24.132 1.00 0.41 ? 121 DG  C "H2'"  1 
ATOM   656  H  "H2''" . DG  B 2 10 ? -19.634 -1.410  25.539 1.00 0.43 ? 121 DG  C "H2''" 1 
ATOM   657  H  "H1'"  . DG  B 2 10 ? -17.565 -0.480  25.716 1.00 0.36 ? 121 DG  C "H1'"  1 
ATOM   658  H  H8     . DG  B 2 10 ? -18.762 1.020   22.320 1.00 0.42 ? 121 DG  C H8     1 
ATOM   659  H  H1     . DG  B 2 10 ? -17.018 5.279   26.752 1.00 0.42 ? 121 DG  C H1     1 
ATOM   660  H  H21    . DG  B 2 10 ? -16.393 4.238   28.608 1.00 0.46 ? 121 DG  C H21    1 
ATOM   661  H  H22    . DG  B 2 10 ? -16.401 2.495   28.755 1.00 0.45 ? 121 DG  C H22    1 
ATOM   662  P  P      . DC  B 2 11 ? -20.888 -3.721  24.929 1.00 0.48 ? 122 DC  C P      1 
ATOM   663  O  OP1    . DC  B 2 11 ? -21.117 -5.181  25.022 1.00 0.57 ? 122 DC  C OP1    1 
ATOM   664  O  OP2    . DC  B 2 11 ? -21.837 -2.873  24.173 1.00 0.49 ? 122 DC  C OP2    1 
ATOM   665  O  "O5'"  . DC  B 2 11 ? -20.767 -3.134  26.424 1.00 0.51 ? 122 DC  C "O5'"  1 
ATOM   666  C  "C5'"  . DC  B 2 11 ? -19.878 -3.734  27.369 1.00 0.57 ? 122 DC  C "C5'"  1 
ATOM   667  C  "C4'"  . DC  B 2 11 ? -19.868 -2.971  28.698 1.00 0.60 ? 122 DC  C "C4'"  1 
ATOM   668  O  "O4'"  . DC  B 2 11 ? -19.497 -1.592  28.482 1.00 0.57 ? 122 DC  C "O4'"  1 
ATOM   669  C  "C3'"  . DC  B 2 11 ? -21.235 -2.998  29.393 1.00 0.68 ? 122 DC  C "C3'"  1 
ATOM   670  O  "O3'"  . DC  B 2 11 ? -21.160 -3.717  30.627 1.00 0.78 ? 122 DC  C "O3'"  1 
ATOM   671  C  "C2'"  . DC  B 2 11 ? -21.600 -1.549  29.640 1.00 0.68 ? 122 DC  C "C2'"  1 
ATOM   672  C  "C1'"  . DC  B 2 11 ? -20.463 -0.700  29.077 1.00 0.60 ? 122 DC  C "C1'"  1 
ATOM   673  N  N1     . DC  B 2 11 ? -20.979 0.255   28.059 1.00 0.58 ? 122 DC  C N1     1 
ATOM   674  C  C2     . DC  B 2 11 ? -20.840 1.620   28.300 1.00 0.58 ? 122 DC  C C2     1 
ATOM   675  O  O2     . DC  B 2 11 ? -20.303 2.009   29.335 1.00 0.60 ? 122 DC  C O2     1 
ATOM   676  N  N3     . DC  B 2 11 ? -21.311 2.493   27.369 1.00 0.58 ? 122 DC  C N3     1 
ATOM   677  C  C4     . DC  B 2 11 ? -21.895 2.055   26.247 1.00 0.59 ? 122 DC  C C4     1 
ATOM   678  N  N4     . DC  B 2 11 ? -22.347 2.938   25.357 1.00 0.63 ? 122 DC  C N4     1 
ATOM   679  C  C5     . DC  B 2 11 ? -22.042 0.655   25.992 1.00 0.58 ? 122 DC  C C5     1 
ATOM   680  C  C6     . DC  B 2 11 ? -21.573 -0.204  26.918 1.00 0.57 ? 122 DC  C C6     1 
ATOM   681  H  "H5'"  . DC  B 2 11 ? -18.870 -3.740  26.955 1.00 0.64 ? 122 DC  C "H5'"  1 
ATOM   682  H  "H5''" . DC  B 2 11 ? -20.194 -4.761  27.552 1.00 0.66 ? 122 DC  C "H5''" 1 
ATOM   683  H  "H4'"  . DC  B 2 11 ? -19.132 -3.431  29.358 1.00 0.65 ? 122 DC  C "H4'"  1 
ATOM   684  H  "H3'"  . DC  B 2 11 ? -21.987 -3.467  28.750 1.00 0.68 ? 122 DC  C "H3'"  1 
ATOM   685  H  "H2'"  . DC  B 2 11 ? -22.534 -1.299  29.132 1.00 0.68 ? 122 DC  C "H2'"  1 
ATOM   686  H  "H2''" . DC  B 2 11 ? -21.709 -1.375  30.713 1.00 0.76 ? 122 DC  C "H2''" 1 
ATOM   687  H  "H1'"  . DC  B 2 11 ? -19.977 -0.154  29.894 1.00 0.64 ? 122 DC  C "H1'"  1 
ATOM   688  H  H41    . DC  B 2 11 ? -22.246 3.928   25.532 1.00 0.64 ? 122 DC  C H41    1 
ATOM   689  H  H42    . DC  B 2 11 ? -22.790 2.618   24.508 1.00 0.65 ? 122 DC  C H42    1 
ATOM   690  H  H5     . DC  B 2 11 ? -22.517 0.295   25.080 1.00 0.61 ? 122 DC  C H5     1 
ATOM   691  H  H6     . DC  B 2 11 ? -21.668 -1.277  26.755 1.00 0.58 ? 122 DC  C H6     1 
ATOM   692  N  N      . PRO C 3 1  ? -7.945  9.122   0.226  1.00 6.62 ? 10  PRO A N      1 
ATOM   693  C  CA     . PRO C 3 1  ? -9.193  9.347   0.989  1.00 6.05 ? 10  PRO A CA     1 
ATOM   694  C  C      . PRO C 3 1  ? -8.890  9.767   2.433  1.00 5.28 ? 10  PRO A C      1 
ATOM   695  O  O      . PRO C 3 1  ? -8.514  10.890  2.701  1.00 5.41 ? 10  PRO A O      1 
ATOM   696  C  CB     . PRO C 3 1  ? -9.831  7.962   0.946  1.00 6.23 ? 10  PRO A CB     1 
ATOM   697  C  CG     . PRO C 3 1  ? -8.669  7.006   1.019  1.00 6.85 ? 10  PRO A CG     1 
ATOM   698  C  CD     . PRO C 3 1  ? -7.428  7.776   0.511  1.00 7.12 ? 10  PRO A CD     1 
ATOM   699  H  HA     . PRO C 3 1  ? -9.831  10.063  0.494  1.00 6.44 ? 10  PRO A HA     1 
ATOM   700  H  HB2    . PRO C 3 1  ? -10.504 7.826   1.783  1.00 5.89 ? 10  PRO A HB2    1 
ATOM   701  H  HB3    . PRO C 3 1  ? -10.361 7.829   0.015  1.00 6.63 ? 10  PRO A HB3    1 
ATOM   702  H  HG2    . PRO C 3 1  ? -8.518  6.681   2.044  1.00 6.83 ? 10  PRO A HG2    1 
ATOM   703  H  HG3    . PRO C 3 1  ? -8.850  6.149   0.386  1.00 7.43 ? 10  PRO A HG3    1 
ATOM   704  H  HD2    . PRO C 3 1  ? -6.664  7.817   1.277  1.00 7.20 ? 10  PRO A HD2    1 
ATOM   705  H  HD3    . PRO C 3 1  ? -7.039  7.327   -0.390 1.00 7.85 ? 10  PRO A HD3    1 
ATOM   706  N  N      . LYS C 3 2  ? -9.037  8.859   3.362  1.00 4.84 ? 11  LYS A N      1 
ATOM   707  C  CA     . LYS C 3 2  ? -8.749  9.161   4.797  1.00 4.41 ? 11  LYS A CA     1 
ATOM   708  C  C      . LYS C 3 2  ? -8.098  7.927   5.398  1.00 3.72 ? 11  LYS A C      1 
ATOM   709  O  O      . LYS C 3 2  ? -7.654  7.048   4.688  1.00 4.01 ? 11  LYS A O      1 
ATOM   710  C  CB     . LYS C 3 2  ? -10.055 9.411   5.573  1.00 4.88 ? 11  LYS A CB     1 
ATOM   711  C  CG     . LYS C 3 2  ? -10.890 10.563  4.950  1.00 5.57 ? 11  LYS A CG     1 
ATOM   712  C  CD     . LYS C 3 2  ? -12.355 10.134  4.764  1.00 6.26 ? 11  LYS A CD     1 
ATOM   713  C  CE     . LYS C 3 2  ? -12.486 9.229   3.530  1.00 7.09 ? 11  LYS A CE     1 
ATOM   714  N  NZ     . LYS C 3 2  ? -12.102 9.983   2.304  1.00 7.74 ? 11  LYS A NZ     1 
ATOM   715  H  H      . LYS C 3 2  ? -9.331  7.964   3.114  1.00 5.07 ? 11  LYS A H      1 
ATOM   716  H  HA     . LYS C 3 2  ? -8.087  10.009  4.884  1.00 4.74 ? 11  LYS A HA     1 
ATOM   717  H  HB2    . LYS C 3 2  ? -10.627 8.498   5.569  1.00 4.97 ? 11  LYS A HB2    1 
ATOM   718  H  HB3    . LYS C 3 2  ? -9.809  9.661   6.597  1.00 5.11 ? 11  LYS A HB3    1 
ATOM   719  H  HG2    . LYS C 3 2  ? -10.863 11.423  5.605  1.00 5.86 ? 11  LYS A HG2    1 
ATOM   720  H  HG3    . LYS C 3 2  ? -10.485 10.840  4.000  1.00 5.65 ? 11  LYS A HG3    1 
ATOM   721  H  HD2    . LYS C 3 2  ? -12.690 9.599   5.643  1.00 6.29 ? 11  LYS A HD2    1 
ATOM   722  H  HD3    . LYS C 3 2  ? -12.966 11.014  4.627  1.00 6.51 ? 11  LYS A HD3    1 
ATOM   723  H  HE2    . LYS C 3 2  ? -11.843 8.371   3.634  1.00 7.41 ? 11  LYS A HE2    1 
ATOM   724  H  HE3    . LYS C 3 2  ? -13.510 8.899   3.437  1.00 7.20 ? 11  LYS A HE3    1 
ATOM   725  H  HZ1    . LYS C 3 2  ? -11.182 10.444  2.448  1.00 7.94 ? 11  LYS A HZ1    1 
ATOM   726  H  HZ2    . LYS C 3 2  ? -12.032 9.325   1.503  1.00 7.97 ? 11  LYS A HZ2    1 
ATOM   727  H  HZ3    . LYS C 3 2  ? -12.824 10.704  2.100  1.00 8.05 ? 11  LYS A HZ3    1 
ATOM   728  N  N      . ALA C 3 3  ? -8.046  7.839   6.697  1.00 3.28 ? 12  ALA A N      1 
ATOM   729  C  CA     . ALA C 3 3  ? -7.441  6.643   7.321  1.00 3.02 ? 12  ALA A CA     1 
ATOM   730  C  C      . ALA C 3 3  ? -7.937  6.514   8.756  1.00 2.14 ? 12  ALA A C      1 
ATOM   731  O  O      . ALA C 3 3  ? -7.227  6.781   9.698  1.00 2.46 ? 12  ALA A O      1 
ATOM   732  C  CB     . ALA C 3 3  ? -5.903  6.753   7.276  1.00 3.96 ? 12  ALA A CB     1 
ATOM   733  H  H      . ALA C 3 3  ? -8.421  8.549   7.258  1.00 3.51 ? 12  ALA A H      1 
ATOM   734  H  HA     . ALA C 3 3  ? -7.755  5.767   6.773  1.00 3.38 ? 12  ALA A HA     1 
ATOM   735  H  HB1    . ALA C 3 3  ? -5.624  7.770   7.053  1.00 4.29 ? 12  ALA A HB1    1 
ATOM   736  H  HB2    . ALA C 3 3  ? -5.477  6.465   8.225  1.00 4.40 ? 12  ALA A HB2    1 
ATOM   737  H  HB3    . ALA C 3 3  ? -5.518  6.101   6.506  1.00 4.36 ? 12  ALA A HB3    1 
ATOM   738  N  N      . LYS C 3 4  ? -9.141  6.069   8.930  1.00 1.63 ? 13  LYS A N      1 
ATOM   739  C  CA     . LYS C 3 4  ? -9.646  5.875   10.311 1.00 1.34 ? 13  LYS A CA     1 
ATOM   740  C  C      . LYS C 3 4  ? -8.981  4.594   10.781 1.00 1.13 ? 13  LYS A C      1 
ATOM   741  O  O      . LYS C 3 4  ? -9.054  3.574   10.126 1.00 1.19 ? 13  LYS A O      1 
ATOM   742  C  CB     . LYS C 3 4  ? -11.196 5.747   10.357 1.00 1.84 ? 13  LYS A CB     1 
ATOM   743  C  CG     . LYS C 3 4  ? -11.812 6.080   8.991  1.00 2.45 ? 13  LYS A CG     1 
ATOM   744  C  CD     . LYS C 3 4  ? -11.545 7.563   8.604  1.00 3.30 ? 13  LYS A CD     1 
ATOM   745  C  CE     . LYS C 3 4  ? -12.706 8.476   9.044  1.00 4.02 ? 13  LYS A CE     1 
ATOM   746  N  NZ     . LYS C 3 4  ? -14.019 7.856   8.722  1.00 4.52 ? 13  LYS A NZ     1 
ATOM   747  H  H      . LYS C 3 4  ? -9.682  5.836   8.162  1.00 2.06 ? 13  LYS A H      1 
ATOM   748  H  HA     . LYS C 3 4  ? -9.325  6.698   10.934 1.00 1.82 ? 13  LYS A HA     1 
ATOM   749  H  HB2    . LYS C 3 4  ? -11.479 4.739   10.634 1.00 2.12 ? 13  LYS A HB2    1 
ATOM   750  H  HB3    . LYS C 3 4  ? -11.589 6.432   11.096 1.00 2.45 ? 13  LYS A HB3    1 
ATOM   751  H  HG2    . LYS C 3 4  ? -11.388 5.424   8.245  1.00 2.81 ? 13  LYS A HG2    1 
ATOM   752  H  HG3    . LYS C 3 4  ? -12.873 5.903   9.039  1.00 2.71 ? 13  LYS A HG3    1 
ATOM   753  H  HD2    . LYS C 3 4  ? -10.633 7.912   9.071  1.00 3.60 ? 13  LYS A HD2    1 
ATOM   754  H  HD3    . LYS C 3 4  ? -11.433 7.635   7.534  1.00 3.67 ? 13  LYS A HD3    1 
ATOM   755  H  HE2    . LYS C 3 4  ? -12.650 8.659   10.105 1.00 4.42 ? 13  LYS A HE2    1 
ATOM   756  H  HE3    . LYS C 3 4  ? -12.627 9.412   8.518  1.00 4.31 ? 13  LYS A HE3    1 
ATOM   757  H  HZ1    . LYS C 3 4  ? -13.942 7.333   7.825  1.00 4.79 ? 13  LYS A HZ1    1 
ATOM   758  H  HZ2    . LYS C 3 4  ? -14.297 7.205   9.485  1.00 4.82 ? 13  LYS A HZ2    1 
ATOM   759  H  HZ3    . LYS C 3 4  ? -14.735 8.602   8.630  1.00 4.76 ? 13  LYS A HZ3    1 
ATOM   760  N  N      . ARG C 3 5  ? -8.297  4.632   11.873 1.00 0.93 ? 14  ARG A N      1 
ATOM   761  C  CA     . ARG C 3 5  ? -7.606  3.404   12.310 1.00 0.78 ? 14  ARG A CA     1 
ATOM   762  C  C      . ARG C 3 5  ? -8.660  2.413   12.758 1.00 0.70 ? 14  ARG A C      1 
ATOM   763  O  O      . ARG C 3 5  ? -9.062  2.349   13.903 1.00 0.65 ? 14  ARG A O      1 
ATOM   764  C  CB     . ARG C 3 5  ? -6.641  3.751   13.428 1.00 0.66 ? 14  ARG A CB     1 
ATOM   765  C  CG     . ARG C 3 5  ? -5.711  4.863   12.919 1.00 0.88 ? 14  ARG A CG     1 
ATOM   766  C  CD     . ARG C 3 5  ? -4.748  5.339   14.023 1.00 0.78 ? 14  ARG A CD     1 
ATOM   767  N  NE     . ARG C 3 5  ? -3.391  4.853   13.679 1.00 0.93 ? 14  ARG A NE     1 
ATOM   768  C  CZ     . ARG C 3 5  ? -2.344  5.309   14.304 1.00 0.81 ? 14  ARG A CZ     1 
ATOM   769  N  NH1    . ARG C 3 5  ? -2.479  6.214   15.232 1.00 1.22 ? 14  ARG A NH1    1 
ATOM   770  N  NH2    . ARG C 3 5  ? -1.158  4.863   13.992 1.00 1.21 ? 14  ARG A NH2    1 
ATOM   771  H  H      . ARG C 3 5  ? -8.208  5.466   12.381 1.00 0.93 ? 14  ARG A H      1 
ATOM   772  H  HA     . ARG C 3 5  ? -7.055  2.985   11.478 1.00 0.89 ? 14  ARG A HA     1 
ATOM   773  H  HB2    . ARG C 3 5  ? -7.194  4.093   14.290 1.00 0.61 ? 14  ARG A HB2    1 
ATOM   774  H  HB3    . ARG C 3 5  ? -6.059  2.881   13.684 1.00 0.66 ? 14  ARG A HB3    1 
ATOM   775  H  HG2    . ARG C 3 5  ? -5.136  4.480   12.088 1.00 1.10 ? 14  ARG A HG2    1 
ATOM   776  H  HG3    . ARG C 3 5  ? -6.301  5.695   12.573 1.00 1.00 ? 14  ARG A HG3    1 
ATOM   777  H  HD2    . ARG C 3 5  ? -4.741  6.420   14.067 1.00 0.86 ? 14  ARG A HD2    1 
ATOM   778  H  HD3    . ARG C 3 5  ? -5.047  4.943   14.984 1.00 1.01 ? 14  ARG A HD3    1 
ATOM   779  H  HE     . ARG C 3 5  ? -3.287  4.190   12.974 1.00 1.55 ? 14  ARG A HE     1 
ATOM   780  H  HH11   . ARG C 3 5  ? -3.388  6.559   15.464 1.00 1.44 ? 14  ARG A HH11   1 
ATOM   781  H  HH12   . ARG C 3 5  ? -1.674  6.564   15.711 1.00 1.67 ? 14  ARG A HH12   1 
ATOM   782  H  HH21   . ARG C 3 5  ? -1.057  4.173   13.274 1.00 1.71 ? 14  ARG A HH21   1 
ATOM   783  H  HH22   . ARG C 3 5  ? -0.351  5.209   14.469 1.00 1.34 ? 14  ARG A HH22   1 
ATOM   784  N  N      . ALA C 3 6  ? -9.119  1.656   11.811 1.00 0.76 ? 15  ALA A N      1 
ATOM   785  C  CA     . ALA C 3 6  ? -10.175 0.654   12.068 1.00 0.75 ? 15  ALA A CA     1 
ATOM   786  C  C      . ALA C 3 6  ? -9.553  -0.635  12.585 1.00 0.68 ? 15  ALA A C      1 
ATOM   787  O  O      . ALA C 3 6  ? -8.726  -1.238  11.937 1.00 0.71 ? 15  ALA A O      1 
ATOM   788  C  CB     . ALA C 3 6  ? -10.906 0.363   10.755 1.00 0.90 ? 15  ALA A CB     1 
ATOM   789  H  H      . ALA C 3 6  ? -8.770  1.767   10.905 1.00 0.85 ? 15  ALA A H      1 
ATOM   790  H  HA     . ALA C 3 6  ? -10.876 1.037   12.791 1.00 0.76 ? 15  ALA A HA     1 
ATOM   791  H  HB1    . ALA C 3 6  ? -11.223 1.293   10.306 1.00 1.36 ? 15  ALA A HB1    1 
ATOM   792  H  HB2    . ALA C 3 6  ? -10.239 -0.153  10.078 1.00 1.31 ? 15  ALA A HB2    1 
ATOM   793  H  HB3    . ALA C 3 6  ? -11.769 -0.255  10.951 1.00 1.46 ? 15  ALA A HB3    1 
ATOM   794  N  N      . LYS C 3 7  ? -9.961  -1.068  13.743 1.00 0.70 ? 16  LYS A N      1 
ATOM   795  C  CA     . LYS C 3 7  ? -9.434  -2.343  14.302 1.00 0.73 ? 16  LYS A CA     1 
ATOM   796  C  C      . LYS C 3 7  ? -10.383 -3.463  13.859 1.00 0.81 ? 16  LYS A C      1 
ATOM   797  O  O      . LYS C 3 7  ? -10.394 -4.544  14.412 1.00 0.90 ? 16  LYS A O      1 
ATOM   798  C  CB     . LYS C 3 7  ? -9.414  -2.271  15.834 1.00 0.94 ? 16  LYS A CB     1 
ATOM   799  C  CG     . LYS C 3 7  ? -8.859  -0.921  16.295 1.00 0.77 ? 16  LYS A CG     1 
ATOM   800  C  CD     . LYS C 3 7  ? -8.885  -0.867  17.825 1.00 0.79 ? 16  LYS A CD     1 
ATOM   801  C  CE     . LYS C 3 7  ? -8.397  0.501   18.306 1.00 1.10 ? 16  LYS A CE     1 
ATOM   802  N  NZ     . LYS C 3 7  ? -9.415  1.538   17.977 1.00 2.01 ? 16  LYS A NZ     1 
ATOM   803  H  H      . LYS C 3 7  ? -10.639 -0.565  14.238 1.00 0.77 ? 16  LYS A H      1 
ATOM   804  H  HA     . LYS C 3 7  ? -8.438  -2.531  13.927 1.00 0.70 ? 16  LYS A HA     1 
ATOM   805  H  HB2    . LYS C 3 7  ? -10.418 -2.390  16.214 1.00 1.65 ? 16  LYS A HB2    1 
ATOM   806  H  HB3    . LYS C 3 7  ? -8.789  -3.063  16.220 1.00 1.41 ? 16  LYS A HB3    1 
ATOM   807  H  HG2    . LYS C 3 7  ? -7.843  -0.808  15.946 1.00 1.28 ? 16  LYS A HG2    1 
ATOM   808  H  HG3    . LYS C 3 7  ? -9.469  -0.123  15.899 1.00 1.48 ? 16  LYS A HG3    1 
ATOM   809  H  HD2    . LYS C 3 7  ? -9.895  -1.031  18.172 1.00 1.38 ? 16  LYS A HD2    1 
ATOM   810  H  HD3    . LYS C 3 7  ? -8.239  -1.636  18.221 1.00 1.37 ? 16  LYS A HD3    1 
ATOM   811  H  HE2    . LYS C 3 7  ? -8.248  0.471   19.376 1.00 1.52 ? 16  LYS A HE2    1 
ATOM   812  H  HE3    . LYS C 3 7  ? -7.464  0.743   17.820 1.00 1.65 ? 16  LYS A HE3    1 
ATOM   813  H  HZ1    . LYS C 3 7  ? -10.338 1.081   17.827 1.00 2.40 ? 16  LYS A HZ1    1 
ATOM   814  H  HZ2    . LYS C 3 7  ? -9.486  2.214   18.763 1.00 2.51 ? 16  LYS A HZ2    1 
ATOM   815  H  HZ3    . LYS C 3 7  ? -9.131  2.042   17.114 1.00 2.55 ? 16  LYS A HZ3    1 
ATOM   816  N  N      . HIS C 3 8  ? -11.217 -3.180  12.891 1.00 0.87 ? 17  HIS A N      1 
ATOM   817  C  CA     . HIS C 3 8  ? -12.221 -4.184  12.427 1.00 1.09 ? 17  HIS A CA     1 
ATOM   818  C  C      . HIS C 3 8  ? -11.597 -5.216  11.467 1.00 1.06 ? 17  HIS A C      1 
ATOM   819  O  O      . HIS C 3 8  ? -11.933 -6.382  11.521 1.00 1.21 ? 17  HIS A O      1 
ATOM   820  C  CB     . HIS C 3 8  ? -13.381 -3.427  11.725 1.00 1.31 ? 17  HIS A CB     1 
ATOM   821  C  CG     . HIS C 3 8  ? -14.684 -3.656  12.452 1.00 1.72 ? 17  HIS A CG     1 
ATOM   822  N  ND1    . HIS C 3 8  ? -15.792 -4.207  11.829 1.00 2.41 ? 17  HIS A ND1    1 
ATOM   823  C  CD2    . HIS C 3 8  ? -15.064 -3.417  13.749 1.00 2.37 ? 17  HIS A CD2    1 
ATOM   824  C  CE1    . HIS C 3 8  ? -16.776 -4.281  12.744 1.00 3.03 ? 17  HIS A CE1    1 
ATOM   825  N  NE2    . HIS C 3 8  ? -16.385 -3.813  13.931 1.00 2.98 ? 17  HIS A NE2    1 
ATOM   826  H  H      . HIS C 3 8  ? -11.208 -2.284  12.492 1.00 0.84 ? 17  HIS A H      1 
ATOM   827  H  HA     . HIS C 3 8  ? -12.603 -4.710  13.291 1.00 1.20 ? 17  HIS A HA     1 
ATOM   828  H  HB2    . HIS C 3 8  ? -13.162 -2.370  11.725 1.00 1.75 ? 17  HIS A HB2    1 
ATOM   829  H  HB3    . HIS C 3 8  ? -13.484 -3.763  10.701 1.00 1.41 ? 17  HIS A HB3    1 
ATOM   830  H  HD1    . HIS C 3 8  ? -15.848 -4.489  10.892 1.00 2.80 ? 17  HIS A HD1    1 
ATOM   831  H  HD2    . HIS C 3 8  ? -14.433 -2.988  14.513 1.00 2.83 ? 17  HIS A HD2    1 
ATOM   832  H  HE1    . HIS C 3 8  ? -17.761 -4.674  12.543 1.00 3.82 ? 17  HIS A HE1    1 
ATOM   833  N  N      . PRO C 3 9  ? -10.721 -4.810  10.588 1.00 0.99 ? 18  PRO A N      1 
ATOM   834  C  CA     . PRO C 3 9  ? -10.093 -5.745  9.613  1.00 1.10 ? 18  PRO A CA     1 
ATOM   835  C  C      . PRO C 3 9  ? -9.483  -6.965  10.325 1.00 1.01 ? 18  PRO A C      1 
ATOM   836  O  O      . PRO C 3 9  ? -8.988  -6.850  11.429 1.00 0.91 ? 18  PRO A O      1 
ATOM   837  C  CB     . PRO C 3 9  ? -9.009  -4.892  8.933  1.00 1.16 ? 18  PRO A CB     1 
ATOM   838  C  CG     . PRO C 3 9  ? -9.492  -3.486  9.082  1.00 1.11 ? 18  PRO A CG     1 
ATOM   839  C  CD     . PRO C 3 9  ? -10.222 -3.441  10.424 1.00 0.93 ? 18  PRO A CD     1 
ATOM   840  H  HA     . PRO C 3 9  ? -10.824 -6.050  8.885  1.00 1.30 ? 18  PRO A HA     1 
ATOM   841  H  HB2    . PRO C 3 9  ? -8.056  -5.020  9.432  1.00 1.13 ? 18  PRO A HB2    1 
ATOM   842  H  HB3    . PRO C 3 9  ? -8.924  -5.148  7.887  1.00 1.39 ? 18  PRO A HB3    1 
ATOM   843  H  HG2    . PRO C 3 9  ? -8.654  -2.800  9.083  1.00 1.14 ? 18  PRO A HG2    1 
ATOM   844  H  HG3    . PRO C 3 9  ? -10.178 -3.237  8.286  1.00 1.28 ? 18  PRO A HG3    1 
ATOM   845  H  HD2    . PRO C 3 9  ? -9.531  -3.202  11.213 1.00 0.80 ? 18  PRO A HD2    1 
ATOM   846  H  HD3    . PRO C 3 9  ? -11.042 -2.740  10.399 1.00 1.04 ? 18  PRO A HD3    1 
ATOM   847  N  N      . PRO C 3 10 ? -9.517  -8.125  9.714  1.00 1.11 ? 19  PRO A N      1 
ATOM   848  C  CA     . PRO C 3 10 ? -8.961  -9.362  10.333 1.00 1.10 ? 19  PRO A CA     1 
ATOM   849  C  C      . PRO C 3 10 ? -7.432  -9.314  10.422 1.00 1.06 ? 19  PRO A C      1 
ATOM   850  O  O      . PRO C 3 10 ? -6.800  -8.397  9.935  1.00 1.08 ? 19  PRO A O      1 
ATOM   851  C  CB     . PRO C 3 10 ? -9.430  -10.485 9.394  1.00 1.23 ? 19  PRO A CB     1 
ATOM   852  C  CG     . PRO C 3 10 ? -9.623  -9.820  8.070  1.00 1.34 ? 19  PRO A CG     1 
ATOM   853  C  CD     . PRO C 3 10 ? -10.082 -8.393  8.378  1.00 1.30 ? 19  PRO A CD     1 
ATOM   854  H  HA     . PRO C 3 10 ? -9.383  -9.509  11.314 1.00 1.08 ? 19  PRO A HA     1 
ATOM   855  H  HB2    . PRO C 3 10 ? -8.683  -11.266 9.326  1.00 1.31 ? 19  PRO A HB2    1 
ATOM   856  H  HB3    . PRO C 3 10 ? -10.369 -10.895 9.741  1.00 1.33 ? 19  PRO A HB3    1 
ATOM   857  H  HG2    . PRO C 3 10 ? -8.688  -9.804  7.523  1.00 1.43 ? 19  PRO A HG2    1 
ATOM   858  H  HG3    . PRO C 3 10 ? -10.382 -10.332 7.496  1.00 1.49 ? 19  PRO A HG3    1 
ATOM   859  H  HD2    . PRO C 3 10 ? -9.684  -7.700  7.648  1.00 1.39 ? 19  PRO A HD2    1 
ATOM   860  H  HD3    . PRO C 3 10 ? -11.159 -8.336  8.411  1.00 1.40 ? 19  PRO A HD3    1 
ATOM   861  N  N      . GLY C 3 11 ? -6.836  -10.293 11.040 1.00 1.08 ? 20  GLY A N      1 
ATOM   862  C  CA     . GLY C 3 11 ? -5.352  -10.303 11.159 1.00 1.12 ? 20  GLY A CA     1 
ATOM   863  C  C      . GLY C 3 11 ? -4.909  -9.291  12.215 1.00 1.00 ? 20  GLY A C      1 
ATOM   864  O  O      . GLY C 3 11 ? -3.797  -8.800  12.186 1.00 1.04 ? 20  GLY A O      1 
ATOM   865  H  H      . GLY C 3 11 ? -7.364  -11.024 11.424 1.00 1.12 ? 20  GLY A H      1 
ATOM   866  H  HA2    . GLY C 3 11 ? -5.026  -11.292 11.450 1.00 1.20 ? 20  GLY A HA2    1 
ATOM   867  H  HA3    . GLY C 3 11 ? -4.913  -10.046 10.208 1.00 1.20 ? 20  GLY A HA3    1 
ATOM   868  N  N      . THR C 3 12 ? -5.762  -8.976  13.155 1.00 0.91 ? 21  THR A N      1 
ATOM   869  C  CA     . THR C 3 12 ? -5.374  -8.001  14.219 1.00 0.83 ? 21  THR A CA     1 
ATOM   870  C  C      . THR C 3 12 ? -4.779  -8.767  15.401 1.00 0.84 ? 21  THR A C      1 
ATOM   871  O  O      . THR C 3 12 ? -5.459  -9.129  16.338 1.00 0.88 ? 21  THR A O      1 
ATOM   872  C  CB     . THR C 3 12 ? -6.601  -7.193  14.680 1.00 0.82 ? 21  THR A CB     1 
ATOM   873  O  OG1    . THR C 3 12 ? -6.232  -6.378  15.784 1.00 0.82 ? 21  THR A OG1    1 
ATOM   874  C  CG2    . THR C 3 12 ? -7.747  -8.125  15.104 1.00 0.90 ? 21  THR A CG2    1 
ATOM   875  H  H      . THR C 3 12 ? -6.649  -9.389  13.164 1.00 0.93 ? 21  THR A H      1 
ATOM   876  H  HA     . THR C 3 12 ? -4.628  -7.319  13.831 1.00 0.84 ? 21  THR A HA     1 
ATOM   877  H  HB     . THR C 3 12 ? -6.936  -6.562  13.870 1.00 0.88 ? 21  THR A HB     1 
ATOM   878  H  HG1    . THR C 3 12 ? -5.615  -6.876  16.327 1.00 1.23 ? 21  THR A HG1    1 
ATOM   879  H  HG21   . THR C 3 12 ? -7.736  -9.019  14.504 1.00 1.38 ? 21  THR A HG21   1 
ATOM   880  H  HG22   . THR C 3 12 ? -7.630  -8.389  16.142 1.00 1.35 ? 21  THR A HG22   1 
ATOM   881  H  HG23   . THR C 3 12 ? -8.690  -7.616  14.971 1.00 1.41 ? 21  THR A HG23   1 
ATOM   882  N  N      . GLU C 3 13 ? -3.504  -9.021  15.354 1.00 0.88 ? 22  GLU A N      1 
ATOM   883  C  CA     . GLU C 3 13 ? -2.845  -9.765  16.462 1.00 0.93 ? 22  GLU A CA     1 
ATOM   884  C  C      . GLU C 3 13 ? -2.588  -8.813  17.630 1.00 0.83 ? 22  GLU A C      1 
ATOM   885  O  O      . GLU C 3 13 ? -2.374  -7.632  17.442 1.00 0.81 ? 22  GLU A O      1 
ATOM   886  C  CB     . GLU C 3 13 ? -1.523  -10.362 15.964 1.00 1.07 ? 22  GLU A CB     1 
ATOM   887  C  CG     . GLU C 3 13 ? -1.773  -11.180 14.678 1.00 1.23 ? 22  GLU A CG     1 
ATOM   888  C  CD     . GLU C 3 13 ? -0.727  -12.288 14.546 1.00 1.50 ? 22  GLU A CD     1 
ATOM   889  O  OE1    . GLU C 3 13 ? 0.430   -12.017 14.817 1.00 2.23 ? 22  GLU A OE1    1 
ATOM   890  O  OE2    . GLU C 3 13 ? -1.102  -13.388 14.172 1.00 1.99 ? 22  GLU A OE2    1 
ATOM   891  H  H      . GLU C 3 13 ? -2.980  -8.720  14.586 1.00 0.92 ? 22  GLU A H      1 
ATOM   892  H  HA     . GLU C 3 13 ? -3.495  -10.564 16.791 1.00 1.00 ? 22  GLU A HA     1 
ATOM   893  H  HB2    . GLU C 3 13 ? -0.827  -9.562  15.754 1.00 1.07 ? 22  GLU A HB2    1 
ATOM   894  H  HB3    . GLU C 3 13 ? -1.112  -11.004 16.730 1.00 1.13 ? 22  GLU A HB3    1 
ATOM   895  H  HG2    . GLU C 3 13 ? -2.758  -11.627 14.710 1.00 1.68 ? 22  GLU A HG2    1 
ATOM   896  H  HG3    . GLU C 3 13 ? -1.706  -10.529 13.820 1.00 1.70 ? 22  GLU A HG3    1 
ATOM   897  N  N      . LYS C 3 14 ? -2.639  -9.316  18.838 1.00 0.85 ? 23  LYS A N      1 
ATOM   898  C  CA     . LYS C 3 14 ? -2.425  -8.448  20.041 1.00 0.81 ? 23  LYS A CA     1 
ATOM   899  C  C      . LYS C 3 14 ? -1.026  -8.672  20.649 1.00 0.78 ? 23  LYS A C      1 
ATOM   900  O  O      . LYS C 3 14 ? -0.904  -9.313  21.674 1.00 0.86 ? 23  LYS A O      1 
ATOM   901  C  CB     . LYS C 3 14 ? -3.496  -8.794  21.085 1.00 0.92 ? 23  LYS A CB     1 
ATOM   902  C  CG     . LYS C 3 14 ? -4.849  -9.017  20.384 1.00 1.05 ? 23  LYS A CG     1 
ATOM   903  C  CD     . LYS C 3 14 ? -6.014  -8.807  21.379 1.00 1.26 ? 23  LYS A CD     1 
ATOM   904  C  CE     . LYS C 3 14 ? -6.447  -7.332  21.430 1.00 1.36 ? 23  LYS A CE     1 
ATOM   905  N  NZ     . LYS C 3 14 ? -7.860  -7.254  21.895 1.00 2.06 ? 23  LYS A NZ     1 
ATOM   906  H  H      . LYS C 3 14 ? -2.836  -10.268 18.958 1.00 0.95 ? 23  LYS A H      1 
ATOM   907  H  HA     . LYS C 3 14 ? -2.537  -7.411  19.770 1.00 0.80 ? 23  LYS A HA     1 
ATOM   908  H  HB2    . LYS C 3 14 ? -3.212  -9.697  21.609 1.00 0.98 ? 23  LYS A HB2    1 
ATOM   909  H  HB3    . LYS C 3 14 ? -3.586  -7.982  21.792 1.00 0.98 ? 23  LYS A HB3    1 
ATOM   910  H  HG2    . LYS C 3 14 ? -4.944  -8.336  19.550 1.00 1.41 ? 23  LYS A HG2    1 
ATOM   911  H  HG3    . LYS C 3 14 ? -4.884  -10.030 20.011 1.00 1.33 ? 23  LYS A HG3    1 
ATOM   912  H  HD2    . LYS C 3 14 ? -6.857  -9.408  21.071 1.00 1.77 ? 23  LYS A HD2    1 
ATOM   913  H  HD3    . LYS C 3 14 ? -5.704  -9.118  22.367 1.00 1.78 ? 23  LYS A HD3    1 
ATOM   914  H  HE2    . LYS C 3 14 ? -5.815  -6.794  22.119 1.00 1.78 ? 23  LYS A HE2    1 
ATOM   915  H  HE3    . LYS C 3 14 ? -6.374  -6.884  20.451 1.00 1.49 ? 23  LYS A HE3    1 
ATOM   916  H  HZ1    . LYS C 3 14 ? -8.104  -8.119  22.417 1.00 2.46 ? 23  LYS A HZ1    1 
ATOM   917  H  HZ2    . LYS C 3 14 ? -7.972  -6.432  22.519 1.00 2.52 ? 23  LYS A HZ2    1 
ATOM   918  H  HZ3    . LYS C 3 14 ? -8.492  -7.154  21.072 1.00 2.47 ? 23  LYS A HZ3    1 
ATOM   919  N  N      . PRO C 3 15 ? 0.027   -8.144  20.060 1.00 0.74 ? 24  PRO A N      1 
ATOM   920  C  CA     . PRO C 3 15 ? 1.398   -8.311  20.628 1.00 0.73 ? 24  PRO A CA     1 
ATOM   921  C  C      . PRO C 3 15 ? 1.521   -7.574  21.969 1.00 0.67 ? 24  PRO A C      1 
ATOM   922  O  O      . PRO C 3 15 ? 1.018   -6.480  22.131 1.00 0.60 ? 24  PRO A O      1 
ATOM   923  C  CB     . PRO C 3 15 ? 2.329   -7.710  19.560 1.00 0.76 ? 24  PRO A CB     1 
ATOM   924  C  CG     . PRO C 3 15 ? 1.467   -6.781  18.761 1.00 0.84 ? 24  PRO A CG     1 
ATOM   925  C  CD     . PRO C 3 15 ? 0.045   -7.349  18.816 1.00 0.81 ? 24  PRO A CD     1 
ATOM   926  H  HA     . PRO C 3 15 ? 1.620   -9.359  20.760 1.00 0.80 ? 24  PRO A HA     1 
ATOM   927  H  HB2    . PRO C 3 15 ? 3.146   -7.170  20.025 1.00 0.72 ? 24  PRO A HB2    1 
ATOM   928  H  HB3    . PRO C 3 15 ? 2.719   -8.491  18.921 1.00 0.92 ? 24  PRO A HB3    1 
ATOM   929  H  HG2    . PRO C 3 15 ? 1.491   -5.790  19.195 1.00 0.93 ? 24  PRO A HG2    1 
ATOM   930  H  HG3    . PRO C 3 15 ? 1.806   -6.741  17.736 1.00 0.97 ? 24  PRO A HG3    1 
ATOM   931  H  HD2    . PRO C 3 15 ? -0.675  -6.545  18.855 1.00 0.87 ? 24  PRO A HD2    1 
ATOM   932  H  HD3    . PRO C 3 15 ? -0.140  -7.987  17.966 1.00 0.89 ? 24  PRO A HD3    1 
ATOM   933  N  N      . ARG C 3 16 ? 2.154   -8.174  22.938 1.00 0.73 ? 25  ARG A N      1 
ATOM   934  C  CA     . ARG C 3 16 ? 2.266   -7.515  24.270 1.00 0.72 ? 25  ARG A CA     1 
ATOM   935  C  C      . ARG C 3 16 ? 3.249   -6.343  24.217 1.00 0.58 ? 25  ARG A C      1 
ATOM   936  O  O      . ARG C 3 16 ? 3.368   -5.587  25.160 1.00 0.51 ? 25  ARG A O      1 
ATOM   937  C  CB     . ARG C 3 16 ? 2.731   -8.545  25.299 1.00 0.88 ? 25  ARG A CB     1 
ATOM   938  C  CG     . ARG C 3 16 ? 1.624   -9.583  25.485 1.00 1.22 ? 25  ARG A CG     1 
ATOM   939  C  CD     . ARG C 3 16 ? 2.144   -10.767 26.299 1.00 1.84 ? 25  ARG A CD     1 
ATOM   940  N  NE     . ARG C 3 16 ? 1.099   -11.829 26.333 1.00 2.29 ? 25  ARG A NE     1 
ATOM   941  C  CZ     . ARG C 3 16 ? 1.406   -13.040 26.707 1.00 2.73 ? 25  ARG A CZ     1 
ATOM   942  N  NH1    . ARG C 3 16 ? 2.630   -13.326 27.055 1.00 3.18 ? 25  ARG A NH1    1 
ATOM   943  N  NH2    . ARG C 3 16 ? 0.486   -13.965 26.731 1.00 3.21 ? 25  ARG A NH2    1 
ATOM   944  H  H      . ARG C 3 16 ? 2.533   -9.067  22.798 1.00 0.82 ? 25  ARG A H      1 
ATOM   945  H  HA     . ARG C 3 16 ? 1.295   -7.145  24.561 1.00 0.76 ? 25  ARG A HA     1 
ATOM   946  H  HB2    . ARG C 3 16 ? 3.631   -9.030  24.946 1.00 0.94 ? 25  ARG A HB2    1 
ATOM   947  H  HB3    . ARG C 3 16 ? 2.928   -8.056  26.241 1.00 1.18 ? 25  ARG A HB3    1 
ATOM   948  H  HG2    . ARG C 3 16 ? 0.792   -9.130  26.003 1.00 1.71 ? 25  ARG A HG2    1 
ATOM   949  H  HG3    . ARG C 3 16 ? 1.296   -9.933  24.517 1.00 1.51 ? 25  ARG A HG3    1 
ATOM   950  H  HD2    . ARG C 3 16 ? 3.041   -11.156 25.839 1.00 2.17 ? 25  ARG A HD2    1 
ATOM   951  H  HD3    . ARG C 3 16 ? 2.364   -10.445 27.305 1.00 2.30 ? 25  ARG A HD3    1 
ATOM   952  H  HE     . ARG C 3 16 ? 0.178   -11.616 26.071 1.00 2.63 ? 25  ARG A HE     1 
ATOM   953  H  HH11   . ARG C 3 16 ? 3.334   -12.617 27.036 1.00 3.08 ? 25  ARG A HH11   1 
ATOM   954  H  HH12   . ARG C 3 16 ? 2.863   -14.255 27.342 1.00 3.87 ? 25  ARG A HH12   1 
ATOM   955  H  HH21   . ARG C 3 16 ? -0.453  -13.745 26.463 1.00 3.34 ? 25  ARG A HH21   1 
ATOM   956  H  HH22   . ARG C 3 16 ? 0.718   -14.894 27.017 1.00 3.70 ? 25  ARG A HH22   1 
ATOM   957  N  N      . SER C 3 17 ? 3.942   -6.167  23.128 1.00 0.60 ? 26  SER A N      1 
ATOM   958  C  CA     . SER C 3 17 ? 4.890   -5.021  23.043 1.00 0.55 ? 26  SER A CA     1 
ATOM   959  C  C      . SER C 3 17 ? 4.084   -3.723  22.942 1.00 0.48 ? 26  SER A C      1 
ATOM   960  O  O      . SER C 3 17 ? 4.628   -2.658  22.728 1.00 0.49 ? 26  SER A O      1 
ATOM   961  C  CB     . SER C 3 17 ? 5.779   -5.173  21.808 1.00 0.69 ? 26  SER A CB     1 
ATOM   962  O  OG     . SER C 3 17 ? 6.585   -6.335  21.950 1.00 0.84 ? 26  SER A OG     1 
ATOM   963  H  H      . SER C 3 17 ? 3.830   -6.774  22.367 1.00 0.70 ? 26  SER A H      1 
ATOM   964  H  HA     . SER C 3 17 ? 5.505   -4.995  23.931 1.00 0.55 ? 26  SER A HA     1 
ATOM   965  H  HB2    . SER C 3 17 ? 5.165   -5.273  20.929 1.00 0.73 ? 26  SER A HB2    1 
ATOM   966  H  HB3    . SER C 3 17 ? 6.407   -4.297  21.708 1.00 0.70 ? 26  SER A HB3    1 
ATOM   967  H  HG     . SER C 3 17 ? 6.064   -7.005  22.398 1.00 1.24 ? 26  SER A HG     1 
ATOM   968  N  N      . ARG C 3 18 ? 2.782   -3.814  23.088 1.00 0.48 ? 27  ARG A N      1 
ATOM   969  C  CA     . ARG C 3 18 ? 1.907   -2.600  22.997 1.00 0.48 ? 27  ARG A CA     1 
ATOM   970  C  C      . ARG C 3 18 ? 1.314   -2.292  24.374 1.00 0.45 ? 27  ARG A C      1 
ATOM   971  O  O      . ARG C 3 18 ? 1.226   -1.152  24.783 1.00 0.53 ? 27  ARG A O      1 
ATOM   972  C  CB     . ARG C 3 18 ? 0.752   -2.867  22.022 1.00 0.58 ? 27  ARG A CB     1 
ATOM   973  C  CG     . ARG C 3 18 ? 1.276   -3.496  20.727 1.00 0.66 ? 27  ARG A CG     1 
ATOM   974  C  CD     . ARG C 3 18 ? 2.113   -2.488  19.932 1.00 0.77 ? 27  ARG A CD     1 
ATOM   975  N  NE     . ARG C 3 18 ? 2.064   -2.898  18.493 1.00 1.22 ? 27  ARG A NE     1 
ATOM   976  C  CZ     . ARG C 3 18 ? 2.681   -2.201  17.585 1.00 1.27 ? 27  ARG A CZ     1 
ATOM   977  N  NH1    . ARG C 3 18 ? 3.442   -1.218  17.943 1.00 1.67 ? 27  ARG A NH1    1 
ATOM   978  N  NH2    . ARG C 3 18 ? 2.548   -2.500  16.323 1.00 1.75 ? 27  ARG A NH2    1 
ATOM   979  H  H      . ARG C 3 18 ? 2.376   -4.690  23.254 1.00 0.53 ? 27  ARG A H      1 
ATOM   980  H  HA     . ARG C 3 18 ? 2.478   -1.750  22.653 1.00 0.49 ? 27  ARG A HA     1 
ATOM   981  H  HB2    . ARG C 3 18 ? 0.046   -3.544  22.483 1.00 0.69 ? 27  ARG A HB2    1 
ATOM   982  H  HB3    . ARG C 3 18 ? 0.254   -1.937  21.792 1.00 0.63 ? 27  ARG A HB3    1 
ATOM   983  H  HG2    . ARG C 3 18 ? 1.886   -4.353  20.967 1.00 0.73 ? 27  ARG A HG2    1 
ATOM   984  H  HG3    . ARG C 3 18 ? 0.439   -3.815  20.124 1.00 0.79 ? 27  ARG A HG3    1 
ATOM   985  H  HD2    . ARG C 3 18 ? 1.705   -1.499  20.027 1.00 1.04 ? 27  ARG A HD2    1 
ATOM   986  H  HD3    . ARG C 3 18 ? 3.133   -2.484  20.307 1.00 0.74 ? 27  ARG A HD3    1 
ATOM   987  H  HE     . ARG C 3 18 ? 1.526   -3.672  18.228 1.00 1.90 ? 27  ARG A HE     1 
ATOM   988  H  HH11   . ARG C 3 18 ? 3.552   -0.999  18.913 1.00 1.68 ? 27  ARG A HH11   1 
ATOM   989  H  HH12   . ARG C 3 18 ? 3.924   -0.680  17.252 1.00 2.30 ? 27  ARG A HH12   1 
ATOM   990  H  HH21   . ARG C 3 18 ? 1.969   -3.267  16.049 1.00 2.13 ? 27  ARG A HH21   1 
ATOM   991  H  HH22   . ARG C 3 18 ? 3.027   -1.962  15.629 1.00 2.04 ? 27  ARG A HH22   1 
ATOM   992  N  N      . SER C 3 19 ? 0.889   -3.304  25.085 1.00 0.41 ? 28  SER A N      1 
ATOM   993  C  CA     . SER C 3 19 ? 0.278   -3.081  26.431 1.00 0.42 ? 28  SER A CA     1 
ATOM   994  C  C      . SER C 3 19 ? 1.329   -3.294  27.522 1.00 0.44 ? 28  SER A C      1 
ATOM   995  O  O      . SER C 3 19 ? 1.214   -2.773  28.613 1.00 0.48 ? 28  SER A O      1 
ATOM   996  C  CB     . SER C 3 19 ? -0.868  -4.074  26.632 1.00 0.46 ? 28  SER A CB     1 
ATOM   997  O  OG     . SER C 3 19 ? -0.438  -5.371  26.235 1.00 0.51 ? 28  SER A OG     1 
ATOM   998  H  H      . SER C 3 19 ? 0.959   -4.212  24.726 1.00 0.42 ? 28  SER A H      1 
ATOM   999  H  HA     . SER C 3 19 ? -0.108  -2.075  26.498 1.00 0.44 ? 28  SER A HA     1 
ATOM   1000 H  HB2    . SER C 3 19 ? -1.152  -4.097  27.671 1.00 0.50 ? 28  SER A HB2    1 
ATOM   1001 H  HB3    . SER C 3 19 ? -1.718  -3.767  26.035 1.00 0.46 ? 28  SER A HB3    1 
ATOM   1002 H  HG     . SER C 3 19 ? 0.374   -5.572  26.707 1.00 1.05 ? 28  SER A HG     1 
ATOM   1003 N  N      . GLN C 3 20 ? 2.350   -4.055  27.243 1.00 0.45 ? 29  GLN A N      1 
ATOM   1004 C  CA     . GLN C 3 20 ? 3.395   -4.291  28.278 1.00 0.50 ? 29  GLN A CA     1 
ATOM   1005 C  C      . GLN C 3 20 ? 4.241   -3.028  28.428 1.00 0.49 ? 29  GLN A C      1 
ATOM   1006 O  O      . GLN C 3 20 ? 4.590   -2.629  29.521 1.00 0.54 ? 29  GLN A O      1 
ATOM   1007 C  CB     . GLN C 3 20 ? 4.286   -5.466  27.852 1.00 0.55 ? 29  GLN A CB     1 
ATOM   1008 C  CG     . GLN C 3 20 ? 5.292   -5.811  28.975 1.00 1.27 ? 29  GLN A CG     1 
ATOM   1009 C  CD     . GLN C 3 20 ? 5.581   -7.318  28.979 1.00 1.92 ? 29  GLN A CD     1 
ATOM   1010 O  OE1    . GLN C 3 20 ? 5.618   -7.945  27.940 1.00 2.56 ? 29  GLN A OE1    1 
ATOM   1011 N  NE2    . GLN C 3 20 ? 5.785   -7.926  30.114 1.00 2.58 ? 29  GLN A NE2    1 
ATOM   1012 H  H      . GLN C 3 20 ? 2.427   -4.473  26.360 1.00 0.45 ? 29  GLN A H      1 
ATOM   1013 H  HA     . GLN C 3 20 ? 2.918   -4.521  29.221 1.00 0.54 ? 29  GLN A HA     1 
ATOM   1014 H  HB2    . GLN C 3 20 ? 3.661   -6.324  27.641 1.00 0.95 ? 29  GLN A HB2    1 
ATOM   1015 H  HB3    . GLN C 3 20 ? 4.828   -5.194  26.958 1.00 1.06 ? 29  GLN A HB3    1 
ATOM   1016 H  HG2    . GLN C 3 20 ? 6.215   -5.274  28.808 1.00 1.91 ? 29  GLN A HG2    1 
ATOM   1017 H  HG3    . GLN C 3 20 ? 4.886   -5.528  29.937 1.00 1.84 ? 29  GLN A HG3    1 
ATOM   1018 H  HE21   . GLN C 3 20 ? 5.754   -7.421  30.952 1.00 2.75 ? 29  GLN A HE21   1 
ATOM   1019 H  HE22   . GLN C 3 20 ? 5.967   -8.888  30.127 1.00 3.25 ? 29  GLN A HE22   1 
ATOM   1020 N  N      . SER C 3 21 ? 4.562   -2.388  27.338 1.00 0.47 ? 30  SER A N      1 
ATOM   1021 C  CA     . SER C 3 21 ? 5.375   -1.144  27.416 1.00 0.49 ? 30  SER A CA     1 
ATOM   1022 C  C      . SER C 3 21 ? 4.695   -0.157  28.364 1.00 0.46 ? 30  SER A C      1 
ATOM   1023 O  O      . SER C 3 21 ? 5.334   0.683   28.968 1.00 0.52 ? 30  SER A O      1 
ATOM   1024 C  CB     . SER C 3 21 ? 5.481   -0.518  26.025 1.00 0.51 ? 30  SER A CB     1 
ATOM   1025 O  OG     . SER C 3 21 ? 6.033   -1.468  25.124 1.00 0.58 ? 30  SER A OG     1 
ATOM   1026 H  H      . SER C 3 21 ? 4.261   -2.723  26.467 1.00 0.46 ? 30  SER A H      1 
ATOM   1027 H  HA     . SER C 3 21 ? 6.362   -1.378  27.784 1.00 0.56 ? 30  SER A HA     1 
ATOM   1028 H  HB2    . SER C 3 21 ? 4.501   -0.232  25.682 1.00 0.49 ? 30  SER A HB2    1 
ATOM   1029 H  HB3    . SER C 3 21 ? 6.113   0.359   26.074 1.00 0.56 ? 30  SER A HB3    1 
ATOM   1030 H  HG     . SER C 3 21 ? 5.479   -1.489  24.340 1.00 1.09 ? 30  SER A HG     1 
ATOM   1031 N  N      . GLU C 3 22 ? 3.400   -0.250  28.497 1.00 0.42 ? 31  GLU A N      1 
ATOM   1032 C  CA     . GLU C 3 22 ? 2.669   0.682   29.403 1.00 0.44 ? 31  GLU A CA     1 
ATOM   1033 C  C      . GLU C 3 22 ? 2.592   0.079   30.804 1.00 0.41 ? 31  GLU A C      1 
ATOM   1034 O  O      . GLU C 3 22 ? 2.525   -1.123  30.970 1.00 0.43 ? 31  GLU A O      1 
ATOM   1035 C  CB     . GLU C 3 22 ? 1.258   0.897   28.869 1.00 0.51 ? 31  GLU A CB     1 
ATOM   1036 C  CG     . GLU C 3 22 ? 1.330   1.515   27.476 1.00 0.55 ? 31  GLU A CG     1 
ATOM   1037 C  CD     . GLU C 3 22 ? 1.908   2.928   27.569 1.00 0.67 ? 31  GLU A CD     1 
ATOM   1038 O  OE1    . GLU C 3 22 ? 1.920   3.472   28.660 1.00 0.71 ? 31  GLU A OE1    1 
ATOM   1039 O  OE2    . GLU C 3 22 ? 2.328   3.443   26.545 1.00 0.81 ? 31  GLU A OE2    1 
ATOM   1040 H  H      . GLU C 3 22 ? 2.905   -0.933  27.999 1.00 0.41 ? 31  GLU A H      1 
ATOM   1041 H  HA     . GLU C 3 22 ? 3.184   1.632   29.446 1.00 0.48 ? 31  GLU A HA     1 
ATOM   1042 H  HB2    . GLU C 3 22 ? 0.742   -0.051  28.819 1.00 0.52 ? 31  GLU A HB2    1 
ATOM   1043 H  HB3    . GLU C 3 22 ? 0.726   1.561   29.527 1.00 0.58 ? 31  GLU A HB3    1 
ATOM   1044 H  HG2    . GLU C 3 22 ? 1.960   0.906   26.843 1.00 0.49 ? 31  GLU A HG2    1 
ATOM   1045 H  HG3    . GLU C 3 22 ? 0.341   1.562   27.059 1.00 0.65 ? 31  GLU A HG3    1 
ATOM   1046 N  N      . GLN C 3 23 ? 2.609   0.912   31.816 1.00 0.41 ? 32  GLN A N      1 
ATOM   1047 C  CA     . GLN C 3 23 ? 2.547   0.415   33.227 1.00 0.43 ? 32  GLN A CA     1 
ATOM   1048 C  C      . GLN C 3 23 ? 1.429   1.163   33.977 1.00 0.38 ? 32  GLN A C      1 
ATOM   1049 O  O      . GLN C 3 23 ? 1.131   2.300   33.665 1.00 0.37 ? 32  GLN A O      1 
ATOM   1050 C  CB     . GLN C 3 23 ? 3.903   0.677   33.885 1.00 0.51 ? 32  GLN A CB     1 
ATOM   1051 C  CG     . GLN C 3 23 ? 4.979   -0.097  33.119 1.00 0.58 ? 32  GLN A CG     1 
ATOM   1052 C  CD     . GLN C 3 23 ? 6.369   0.346   33.577 1.00 1.31 ? 32  GLN A CD     1 
ATOM   1053 O  OE1    . GLN C 3 23 ? 7.187   0.745   32.773 1.00 2.03 ? 32  GLN A OE1    1 
ATOM   1054 N  NE2    . GLN C 3 23 ? 6.674   0.290   34.843 1.00 2.13 ? 32  GLN A NE2    1 
ATOM   1055 H  H      . GLN C 3 23 ? 2.670   1.876   31.646 1.00 0.45 ? 32  GLN A H      1 
ATOM   1056 H  HA     . GLN C 3 23 ? 2.343   -0.646  33.233 1.00 0.45 ? 32  GLN A HA     1 
ATOM   1057 H  HB2    . GLN C 3 23 ? 4.123   1.734   33.849 1.00 0.56 ? 32  GLN A HB2    1 
ATOM   1058 H  HB3    . GLN C 3 23 ? 3.885   0.346   34.911 1.00 0.59 ? 32  GLN A HB3    1 
ATOM   1059 H  HG2    . GLN C 3 23 ? 4.860   -1.154  33.306 1.00 1.21 ? 32  GLN A HG2    1 
ATOM   1060 H  HG3    . GLN C 3 23 ? 4.874   0.095   32.062 1.00 1.03 ? 32  GLN A HG3    1 
ATOM   1061 H  HE21   . GLN C 3 23 ? 6.016   -0.035  35.491 1.00 2.45 ? 32  GLN A HE21   1 
ATOM   1062 H  HE22   . GLN C 3 23 ? 7.563   0.570   35.144 1.00 2.81 ? 32  GLN A HE22   1 
ATOM   1063 N  N      . PRO C 3 24 ? 0.797   0.536   34.948 1.00 0.39 ? 33  PRO A N      1 
ATOM   1064 C  CA     . PRO C 3 24 ? -0.310  1.168   35.718 1.00 0.37 ? 33  PRO A CA     1 
ATOM   1065 C  C      . PRO C 3 24 ? -0.066  2.657   35.983 1.00 0.34 ? 33  PRO A C      1 
ATOM   1066 O  O      . PRO C 3 24 ? 1.061   3.110   36.048 1.00 0.36 ? 33  PRO A O      1 
ATOM   1067 C  CB     . PRO C 3 24 ? -0.337  0.380   37.032 1.00 0.42 ? 33  PRO A CB     1 
ATOM   1068 C  CG     . PRO C 3 24 ? 0.217   -0.980  36.702 1.00 0.66 ? 33  PRO A CG     1 
ATOM   1069 C  CD     . PRO C 3 24 ? 1.064   -0.835  35.421 1.00 0.49 ? 33  PRO A CD     1 
ATOM   1070 H  HA     . PRO C 3 24 ? -1.243  1.033   35.199 1.00 0.36 ? 33  PRO A HA     1 
ATOM   1071 H  HB2    . PRO C 3 24 ? 0.277   0.873   37.776 1.00 0.55 ? 33  PRO A HB2    1 
ATOM   1072 H  HB3    . PRO C 3 24 ? -1.352  0.292   37.394 1.00 0.55 ? 33  PRO A HB3    1 
ATOM   1073 H  HG2    . PRO C 3 24 ? 0.834   -1.336  37.521 1.00 0.97 ? 33  PRO A HG2    1 
ATOM   1074 H  HG3    . PRO C 3 24 ? -0.591  -1.678  36.526 1.00 0.92 ? 33  PRO A HG3    1 
ATOM   1075 H  HD2    . PRO C 3 24 ? 2.115   -0.959  35.646 1.00 0.55 ? 33  PRO A HD2    1 
ATOM   1076 H  HD3    . PRO C 3 24 ? 0.752   -1.551  34.675 1.00 0.49 ? 33  PRO A HD3    1 
ATOM   1077 N  N      . ALA C 3 25 ? -1.115  3.423   36.140 1.00 0.32 ? 34  ALA A N      1 
ATOM   1078 C  CA     . ALA C 3 25 ? -0.937  4.888   36.404 1.00 0.31 ? 34  ALA A CA     1 
ATOM   1079 C  C      . ALA C 3 25 ? -2.079  5.410   37.296 1.00 0.30 ? 34  ALA A C      1 
ATOM   1080 O  O      . ALA C 3 25 ? -3.239  5.137   37.059 1.00 0.31 ? 34  ALA A O      1 
ATOM   1081 C  CB     . ALA C 3 25 ? -0.913  5.636   35.058 1.00 0.30 ? 34  ALA A CB     1 
ATOM   1082 H  H      . ALA C 3 25 ? -2.017  3.033   36.084 1.00 0.32 ? 34  ALA A H      1 
ATOM   1083 H  HA     . ALA C 3 25 ? 0.004   5.047   36.919 1.00 0.34 ? 34  ALA A HA     1 
ATOM   1084 H  HB1    . ALA C 3 25 ? -0.644  4.945   34.273 1.00 1.05 ? 34  ALA A HB1    1 
ATOM   1085 H  HB2    . ALA C 3 25 ? -1.888  6.053   34.845 1.00 1.07 ? 34  ALA A HB2    1 
ATOM   1086 H  HB3    . ALA C 3 25 ? -0.183  6.430   35.095 1.00 1.04 ? 34  ALA A HB3    1 
ATOM   1087 N  N      . THR C 3 26 ? -1.747  6.164   38.322 1.00 0.32 ? 35  THR A N      1 
ATOM   1088 C  CA     . THR C 3 26 ? -2.785  6.722   39.250 1.00 0.33 ? 35  THR A CA     1 
ATOM   1089 C  C      . THR C 3 26 ? -2.834  8.252   39.124 1.00 0.32 ? 35  THR A C      1 
ATOM   1090 O  O      . THR C 3 26 ? -1.858  8.890   38.783 1.00 0.39 ? 35  THR A O      1 
ATOM   1091 C  CB     . THR C 3 26 ? -2.415  6.350   40.689 1.00 0.38 ? 35  THR A CB     1 
ATOM   1092 O  OG1    . THR C 3 26 ? -2.274  4.941   40.791 1.00 0.40 ? 35  THR A OG1    1 
ATOM   1093 C  CG2    . THR C 3 26 ? -3.507  6.828   41.648 1.00 0.41 ? 35  THR A CG2    1 
ATOM   1094 H  H      . THR C 3 26 ? -0.804  6.365   38.483 1.00 0.34 ? 35  THR A H      1 
ATOM   1095 H  HA     . THR C 3 26 ? -3.757  6.311   39.013 1.00 0.32 ? 35  THR A HA     1 
ATOM   1096 H  HB     . THR C 3 26 ? -1.482  6.823   40.951 1.00 0.40 ? 35  THR A HB     1 
ATOM   1097 H  HG1    . THR C 3 26 ? -3.152  4.559   40.857 1.00 1.00 ? 35  THR A HG1    1 
ATOM   1098 H  HG21   . THR C 3 26 ? -4.451  6.384   41.369 1.00 1.06 ? 35  THR A HG21   1 
ATOM   1099 H  HG22   . THR C 3 26 ? -3.254  6.533   42.655 1.00 1.10 ? 35  THR A HG22   1 
ATOM   1100 H  HG23   . THR C 3 26 ? -3.586  7.904   41.598 1.00 1.14 ? 35  THR A HG23   1 
ATOM   1101 N  N      . CYS C 3 27 ? -3.967  8.843   39.414 1.00 0.33 ? 36  CYS A N      1 
ATOM   1102 C  CA     . CYS C 3 27 ? -4.100  10.332  39.336 1.00 0.34 ? 36  CYS A CA     1 
ATOM   1103 C  C      . CYS C 3 27 ? -3.799  10.928  40.726 1.00 0.39 ? 36  CYS A C      1 
ATOM   1104 O  O      . CYS C 3 27 ? -4.486  10.626  41.676 1.00 0.51 ? 36  CYS A O      1 
ATOM   1105 C  CB     . CYS C 3 27 ? -5.540  10.664  38.925 1.00 0.31 ? 36  CYS A CB     1 
ATOM   1106 S  SG     . CYS C 3 27 ? -5.961  12.368  39.377 1.00 0.35 ? 36  CYS A SG     1 
ATOM   1107 H  H      . CYS C 3 27 ? -4.733  8.305   39.697 1.00 0.38 ? 36  CYS A H      1 
ATOM   1108 H  HA     . CYS C 3 27 ? -3.422  10.716  38.599 1.00 0.34 ? 36  CYS A HA     1 
ATOM   1109 H  HB2    . CYS C 3 27 ? -5.642  10.546  37.857 1.00 0.30 ? 36  CYS A HB2    1 
ATOM   1110 H  HB3    . CYS C 3 27 ? -6.215  9.987   39.422 1.00 0.33 ? 36  CYS A HB3    1 
ATOM   1111 N  N      . PRO C 3 28 ? -2.784  11.755  40.873 1.00 0.47 ? 37  PRO A N      1 
ATOM   1112 C  CA     . PRO C 3 28 ? -2.447  12.336  42.204 1.00 0.51 ? 37  PRO A CA     1 
ATOM   1113 C  C      . PRO C 3 28 ? -3.467  13.388  42.667 1.00 0.50 ? 37  PRO A C      1 
ATOM   1114 O  O      . PRO C 3 28 ? -3.309  13.992  43.710 1.00 0.55 ? 37  PRO A O      1 
ATOM   1115 C  CB     . PRO C 3 28 ? -1.051  12.951  42.004 1.00 0.57 ? 37  PRO A CB     1 
ATOM   1116 C  CG     . PRO C 3 28 ? -0.942  13.230  40.535 1.00 1.01 ? 37  PRO A CG     1 
ATOM   1117 C  CD     . PRO C 3 28 ? -1.862  12.229  39.819 1.00 0.68 ? 37  PRO A CD     1 
ATOM   1118 H  HA     . PRO C 3 28 ? -2.387  11.546  42.937 1.00 0.53 ? 37  PRO A HA     1 
ATOM   1119 H  HB2    . PRO C 3 28 ? -0.953  13.868  42.574 1.00 0.53 ? 37  PRO A HB2    1 
ATOM   1120 H  HB3    . PRO C 3 28 ? -0.287  12.247  42.303 1.00 0.85 ? 37  PRO A HB3    1 
ATOM   1121 H  HG2    . PRO C 3 28 ? -1.260  14.245  40.326 1.00 1.36 ? 37  PRO A HG2    1 
ATOM   1122 H  HG3    . PRO C 3 28 ? 0.077   13.090  40.201 1.00 1.51 ? 37  PRO A HG3    1 
ATOM   1123 H  HD2    . PRO C 3 28 ? -2.410  12.726  39.029 1.00 0.72 ? 37  PRO A HD2    1 
ATOM   1124 H  HD3    . PRO C 3 28 ? -1.294  11.400  39.423 1.00 0.72 ? 37  PRO A HD3    1 
ATOM   1125 N  N      . ILE C 3 29 ? -4.517  13.604  41.909 1.00 0.45 ? 38  ILE A N      1 
ATOM   1126 C  CA     . ILE C 3 29 ? -5.554  14.608  42.313 1.00 0.47 ? 38  ILE A CA     1 
ATOM   1127 C  C      . ILE C 3 29 ? -6.782  13.878  42.866 1.00 0.47 ? 38  ILE A C      1 
ATOM   1128 O  O      . ILE C 3 29 ? -7.203  14.124  43.979 1.00 0.53 ? 38  ILE A O      1 
ATOM   1129 C  CB     . ILE C 3 29 ? -5.959  15.455  41.100 1.00 0.48 ? 38  ILE A CB     1 
ATOM   1130 C  CG1    . ILE C 3 29 ? -4.690  16.021  40.438 1.00 0.53 ? 38  ILE A CG1    1 
ATOM   1131 C  CG2    . ILE C 3 29 ? -6.861  16.615  41.553 1.00 0.53 ? 38  ILE A CG2    1 
ATOM   1132 C  CD1    . ILE C 3 29 ? -5.035  16.811  39.163 1.00 0.56 ? 38  ILE A CD1    1 
ATOM   1133 H  H      . ILE C 3 29 ? -4.628  13.101  41.078 1.00 0.43 ? 38  ILE A H      1 
ATOM   1134 H  HA     . ILE C 3 29 ? -5.158  15.257  43.076 1.00 0.50 ? 38  ILE A HA     1 
ATOM   1135 H  HB     . ILE C 3 29 ? -6.493  14.839  40.391 1.00 0.46 ? 38  ILE A HB     1 
ATOM   1136 H  HG12   . ILE C 3 29 ? -4.189  16.676  41.136 1.00 0.61 ? 38  ILE A HG12   1 
ATOM   1137 H  HG13   . ILE C 3 29 ? -4.029  15.206  40.181 1.00 0.55 ? 38  ILE A HG13   1 
ATOM   1138 H  HG21   . ILE C 3 29 ? -7.554  16.270  42.306 1.00 1.13 ? 38  ILE A HG21   1 
ATOM   1139 H  HG22   . ILE C 3 29 ? -6.254  17.409  41.964 1.00 1.20 ? 38  ILE A HG22   1 
ATOM   1140 H  HG23   . ILE C 3 29 ? -7.413  16.990  40.705 1.00 1.08 ? 38  ILE A HG23   1 
ATOM   1141 H  HD11   . ILE C 3 29 ? -6.095  17.018  39.120 1.00 1.14 ? 38  ILE A HD11   1 
ATOM   1142 H  HD12   . ILE C 3 29 ? -4.492  17.744  39.166 1.00 1.18 ? 38  ILE A HD12   1 
ATOM   1143 H  HD13   . ILE C 3 29 ? -4.747  16.234  38.297 1.00 1.15 ? 38  ILE A HD13   1 
ATOM   1144 N  N      . CYS C 3 30 ? -7.361  12.983  42.097 1.00 0.45 ? 39  CYS A N      1 
ATOM   1145 C  CA     . CYS C 3 30 ? -8.572  12.230  42.570 1.00 0.47 ? 39  CYS A CA     1 
ATOM   1146 C  C      . CYS C 3 30 ? -8.265  10.727  42.637 1.00 0.45 ? 39  CYS A C      1 
ATOM   1147 O  O      . CYS C 3 30 ? -9.154  9.899   42.676 1.00 0.48 ? 39  CYS A O      1 
ATOM   1148 C  CB     . CYS C 3 30 ? -9.741  12.491  41.617 1.00 0.46 ? 39  CYS A CB     1 
ATOM   1149 S  SG     . CYS C 3 30 ? -9.518  11.568  40.078 1.00 0.40 ? 39  CYS A SG     1 
ATOM   1150 H  H      . CYS C 3 30 ? -6.999  12.810  41.205 1.00 0.45 ? 39  CYS A H      1 
ATOM   1151 H  HA     . CYS C 3 30 ? -8.850  12.566  43.560 1.00 0.51 ? 39  CYS A HA     1 
ATOM   1152 H  HB2    . CYS C 3 30 ? -10.661 12.178  42.088 1.00 0.49 ? 39  CYS A HB2    1 
ATOM   1153 H  HB3    . CYS C 3 30 ? -9.795  13.543  41.403 1.00 0.48 ? 39  CYS A HB3    1 
ATOM   1154 N  N      . TYR C 3 31 ? -7.007  10.378  42.691 1.00 0.44 ? 40  TYR A N      1 
ATOM   1155 C  CA     . TYR C 3 31 ? -6.609  8.940   42.804 1.00 0.44 ? 40  TYR A CA     1 
ATOM   1156 C  C      . TYR C 3 31 ? -7.251  8.071   41.717 1.00 0.41 ? 40  TYR A C      1 
ATOM   1157 O  O      . TYR C 3 31 ? -7.270  6.861   41.825 1.00 0.43 ? 40  TYR A O      1 
ATOM   1158 C  CB     . TYR C 3 31 ? -7.010  8.426   44.184 1.00 0.50 ? 40  TYR A CB     1 
ATOM   1159 C  CG     . TYR C 3 31 ? -6.179  9.141   45.224 1.00 0.55 ? 40  TYR A CG     1 
ATOM   1160 C  CD1    . TYR C 3 31 ? -4.816  8.845   45.348 1.00 0.58 ? 40  TYR A CD1    1 
ATOM   1161 C  CD2    . TYR C 3 31 ? -6.762  10.110  46.050 1.00 0.60 ? 40  TYR A CD2    1 
ATOM   1162 C  CE1    . TYR C 3 31 ? -4.038  9.512   46.301 1.00 0.65 ? 40  TYR A CE1    1 
ATOM   1163 C  CE2    . TYR C 3 31 ? -5.983  10.779  47.002 1.00 0.66 ? 40  TYR A CE2    1 
ATOM   1164 C  CZ     . TYR C 3 31 ? -4.620  10.481  47.126 1.00 0.68 ? 40  TYR A CZ     1 
ATOM   1165 O  OH     . TYR C 3 31 ? -3.851  11.141  48.062 1.00 0.76 ? 40  TYR A OH     1 
ATOM   1166 H  H      . TYR C 3 31 ? -6.314  11.071  42.686 1.00 0.46 ? 40  TYR A H      1 
ATOM   1167 H  HA     . TYR C 3 31 ? -5.538  8.866   42.712 1.00 0.43 ? 40  TYR A HA     1 
ATOM   1168 H  HB2    . TYR C 3 31 ? -8.059  8.621   44.354 1.00 0.52 ? 40  TYR A HB2    1 
ATOM   1169 H  HB3    . TYR C 3 31 ? -6.824  7.364   44.242 1.00 0.52 ? 40  TYR A HB3    1 
ATOM   1170 H  HD1    . TYR C 3 31 ? -4.366  8.098   44.711 1.00 0.59 ? 40  TYR A HD1    1 
ATOM   1171 H  HD2    . TYR C 3 31 ? -7.813  10.339  45.954 1.00 0.62 ? 40  TYR A HD2    1 
ATOM   1172 H  HE1    . TYR C 3 31 ? -2.987  9.282   46.396 1.00 0.71 ? 40  TYR A HE1    1 
ATOM   1173 H  HE2    . TYR C 3 31 ? -6.432  11.526  47.639 1.00 0.72 ? 40  TYR A HE2    1 
ATOM   1174 H  HH     . TYR C 3 31 ? -4.383  11.262  48.852 1.00 1.16 ? 40  TYR A HH     1 
ATOM   1175 N  N      . ALA C 3 32 ? -7.745  8.649   40.658 1.00 0.38 ? 41  ALA A N      1 
ATOM   1176 C  CA     . ALA C 3 32 ? -8.334  7.802   39.580 1.00 0.36 ? 41  ALA A CA     1 
ATOM   1177 C  C      . ALA C 3 32 ? -7.263  6.789   39.141 1.00 0.34 ? 41  ALA A C      1 
ATOM   1178 O  O      . ALA C 3 32 ? -6.108  7.132   38.982 1.00 0.33 ? 41  ALA A O      1 
ATOM   1179 C  CB     . ALA C 3 32 ? -8.759  8.695   38.393 1.00 0.35 ? 41  ALA A CB     1 
ATOM   1180 H  H      . ALA C 3 32 ? -7.706  9.623   40.559 1.00 0.38 ? 41  ALA A H      1 
ATOM   1181 H  HA     . ALA C 3 32 ? -9.192  7.270   39.970 1.00 0.40 ? 41  ALA A HA     1 
ATOM   1182 H  HB1    . ALA C 3 32 ? -8.367  9.690   38.538 1.00 1.07 ? 41  ALA A HB1    1 
ATOM   1183 H  HB2    . ALA C 3 32 ? -8.378  8.294   37.463 1.00 1.05 ? 41  ALA A HB2    1 
ATOM   1184 H  HB3    . ALA C 3 32 ? -9.838  8.744   38.340 1.00 1.06 ? 41  ALA A HB3    1 
ATOM   1185 N  N      . VAL C 3 33 ? -7.628  5.547   38.957 1.00 0.35 ? 42  VAL A N      1 
ATOM   1186 C  CA     . VAL C 3 33 ? -6.617  4.522   38.544 1.00 0.34 ? 42  VAL A CA     1 
ATOM   1187 C  C      . VAL C 3 33 ? -6.621  4.367   37.023 1.00 0.30 ? 42  VAL A C      1 
ATOM   1188 O  O      . VAL C 3 33 ? -7.493  3.741   36.454 1.00 0.32 ? 42  VAL A O      1 
ATOM   1189 C  CB     . VAL C 3 33 ? -6.966  3.177   39.188 1.00 0.39 ? 42  VAL A CB     1 
ATOM   1190 C  CG1    . VAL C 3 33 ? -5.916  2.129   38.798 1.00 0.41 ? 42  VAL A CG1    1 
ATOM   1191 C  CG2    . VAL C 3 33 ? -6.992  3.337   40.711 1.00 0.45 ? 42  VAL A CG2    1 
ATOM   1192 H  H      . VAL C 3 33 ? -8.561  5.284   39.099 1.00 0.37 ? 42  VAL A H      1 
ATOM   1193 H  HA     . VAL C 3 33 ? -5.628  4.828   38.870 1.00 0.34 ? 42  VAL A HA     1 
ATOM   1194 H  HB     . VAL C 3 33 ? -7.938  2.856   38.842 1.00 0.41 ? 42  VAL A HB     1 
ATOM   1195 H  HG11   . VAL C 3 33 ? -4.931  2.570   38.837 1.00 1.02 ? 42  VAL A HG11   1 
ATOM   1196 H  HG12   . VAL C 3 33 ? -5.964  1.295   39.483 1.00 1.11 ? 42  VAL A HG12   1 
ATOM   1197 H  HG13   . VAL C 3 33 ? -6.113  1.780   37.795 1.00 1.12 ? 42  VAL A HG13   1 
ATOM   1198 H  HG21   . VAL C 3 33 ? -7.567  4.213   40.971 1.00 1.04 ? 42  VAL A HG21   1 
ATOM   1199 H  HG22   . VAL C 3 33 ? -7.445  2.463   41.156 1.00 1.14 ? 42  VAL A HG22   1 
ATOM   1200 H  HG23   . VAL C 3 33 ? -5.982  3.446   41.079 1.00 1.16 ? 42  VAL A HG23   1 
ATOM   1201 N  N      . ILE C 3 34 ? -5.639  4.927   36.363 1.00 0.27 ? 43  ILE A N      1 
ATOM   1202 C  CA     . ILE C 3 34 ? -5.552  4.817   34.873 1.00 0.25 ? 43  ILE A CA     1 
ATOM   1203 C  C      . ILE C 3 34 ? -4.465  3.797   34.522 1.00 0.26 ? 43  ILE A C      1 
ATOM   1204 O  O      . ILE C 3 34 ? -3.340  3.897   34.971 1.00 0.28 ? 43  ILE A O      1 
ATOM   1205 C  CB     . ILE C 3 34 ? -5.188  6.186   34.294 1.00 0.24 ? 43  ILE A CB     1 
ATOM   1206 C  CG1    . ILE C 3 34 ? -6.161  7.250   34.837 1.00 0.27 ? 43  ILE A CG1    1 
ATOM   1207 C  CG2    . ILE C 3 34 ? -5.251  6.144   32.764 1.00 0.24 ? 43  ILE A CG2    1 
ATOM   1208 C  CD1    . ILE C 3 34 ? -7.620  6.929   34.457 1.00 0.31 ? 43  ILE A CD1    1 
ATOM   1209 H  H      . ILE C 3 34 ? -4.946  5.417   36.852 1.00 0.28 ? 43  ILE A H      1 
ATOM   1210 H  HA     . ILE C 3 34 ? -6.499  4.488   34.467 1.00 0.25 ? 43  ILE A HA     1 
ATOM   1211 H  HB     . ILE C 3 34 ? -4.182  6.439   34.597 1.00 0.26 ? 43  ILE A HB     1 
ATOM   1212 H  HG12   . ILE C 3 34 ? -6.079  7.284   35.913 1.00 0.31 ? 43  ILE A HG12   1 
ATOM   1213 H  HG13   . ILE C 3 34 ? -5.895  8.214   34.434 1.00 0.28 ? 43  ILE A HG13   1 
ATOM   1214 H  HG21   . ILE C 3 34 ? -6.140  5.617   32.453 1.00 1.05 ? 43  ILE A HG21   1 
ATOM   1215 H  HG22   . ILE C 3 34 ? -5.277  7.153   32.377 1.00 1.03 ? 43  ILE A HG22   1 
ATOM   1216 H  HG23   . ILE C 3 34 ? -4.379  5.635   32.381 1.00 1.03 ? 43  ILE A HG23   1 
ATOM   1217 H  HD11   . ILE C 3 34 ? -7.657  6.296   33.584 1.00 1.03 ? 43  ILE A HD11   1 
ATOM   1218 H  HD12   . ILE C 3 34 ? -8.103  6.428   35.282 1.00 1.07 ? 43  ILE A HD12   1 
ATOM   1219 H  HD13   . ILE C 3 34 ? -8.141  7.853   34.248 1.00 1.07 ? 43  ILE A HD13   1 
ATOM   1220 N  N      . ARG C 3 35 ? -4.795  2.805   33.743 1.00 0.27 ? 44  ARG A N      1 
ATOM   1221 C  CA     . ARG C 3 35 ? -3.785  1.767   33.388 1.00 0.30 ? 44  ARG A CA     1 
ATOM   1222 C  C      . ARG C 3 35 ? -2.670  2.360   32.524 1.00 0.30 ? 44  ARG A C      1 
ATOM   1223 O  O      . ARG C 3 35 ? -1.533  2.458   32.941 1.00 0.33 ? 44  ARG A O      1 
ATOM   1224 C  CB     . ARG C 3 35 ? -4.458  0.645   32.602 1.00 0.33 ? 44  ARG A CB     1 
ATOM   1225 C  CG     . ARG C 3 35 ? -5.651  0.091   33.387 1.00 0.32 ? 44  ARG A CG     1 
ATOM   1226 C  CD     . ARG C 3 35 ? -6.098  -1.221  32.753 1.00 0.39 ? 44  ARG A CD     1 
ATOM   1227 N  NE     . ARG C 3 35 ? -7.545  -1.447  33.104 1.00 0.77 ? 44  ARG A NE     1 
ATOM   1228 C  CZ     . ARG C 3 35 ? -7.921  -2.233  34.063 1.00 1.34 ? 44  ARG A CZ     1 
ATOM   1229 N  NH1    . ARG C 3 35 ? -7.039  -2.925  34.732 1.00 2.11 ? 44  ARG A NH1    1 
ATOM   1230 N  NH2    . ARG C 3 35 ? -9.190  -2.350  34.346 1.00 1.76 ? 44  ARG A NH2    1 
ATOM   1231 H  H      . ARG C 3 35 ? -5.712  2.732   33.404 1.00 0.28 ? 44  ARG A H      1 
ATOM   1232 H  HA     . ARG C 3 35 ? -3.359  1.360   34.293 1.00 0.32 ? 44  ARG A HA     1 
ATOM   1233 H  HB2    . ARG C 3 35 ? -4.801  1.029   31.652 1.00 0.35 ? 44  ARG A HB2    1 
ATOM   1234 H  HB3    . ARG C 3 35 ? -3.745  -0.148  32.431 1.00 0.39 ? 44  ARG A HB3    1 
ATOM   1235 H  HG2    . ARG C 3 35 ? -5.360  -0.081  34.413 1.00 0.37 ? 44  ARG A HG2    1 
ATOM   1236 H  HG3    . ARG C 3 35 ? -6.465  0.801   33.355 1.00 0.32 ? 44  ARG A HG3    1 
ATOM   1237 H  HD2    . ARG C 3 35 ? -6.057  -1.149  31.694 1.00 0.71 ? 44  ARG A HD2    1 
ATOM   1238 H  HD3    . ARG C 3 35 ? -5.412  -2.017  33.072 1.00 0.60 ? 44  ARG A HD3    1 
ATOM   1239 H  HE     . ARG C 3 35 ? -8.230  -0.965  32.597 1.00 1.37 ? 44  ARG A HE     1 
ATOM   1240 H  HH11   . ARG C 3 35 ? -6.069  -2.850  34.507 1.00 2.10 ? 44  ARG A HH11   1 
ATOM   1241 H  HH12   . ARG C 3 35 ? -7.336  -3.535  35.466 1.00 2.90 ? 44  ARG A HH12   1 
ATOM   1242 H  HH21   . ARG C 3 35 ? -9.868  -1.833  33.824 1.00 1.82 ? 44  ARG A HH21   1 
ATOM   1243 H  HH22   . ARG C 3 35 ? -9.484  -2.959  35.083 1.00 2.37 ? 44  ARG A HH22   1 
ATOM   1244 N  N      . GLN C 3 36 ? -2.978  2.726   31.309 1.00 0.28 ? 45  GLN A N      1 
ATOM   1245 C  CA     . GLN C 3 36 ? -1.924  3.275   30.410 1.00 0.29 ? 45  GLN A CA     1 
ATOM   1246 C  C      . GLN C 3 36 ? -1.533  4.689   30.840 1.00 0.27 ? 45  GLN A C      1 
ATOM   1247 O  O      . GLN C 3 36 ? -2.367  5.508   31.169 1.00 0.26 ? 45  GLN A O      1 
ATOM   1248 C  CB     . GLN C 3 36 ? -2.436  3.292   28.969 1.00 0.30 ? 45  GLN A CB     1 
ATOM   1249 C  CG     . GLN C 3 36 ? -2.919  1.891   28.582 1.00 0.34 ? 45  GLN A CG     1 
ATOM   1250 C  CD     . GLN C 3 36 ? -3.409  1.899   27.133 1.00 0.42 ? 45  GLN A CD     1 
ATOM   1251 O  OE1    . GLN C 3 36 ? -3.928  2.890   26.660 1.00 0.51 ? 45  GLN A OE1    1 
ATOM   1252 N  NE2    . GLN C 3 36 ? -3.267  0.827   26.403 1.00 0.75 ? 45  GLN A NE2    1 
ATOM   1253 H  H      . GLN C 3 36 ? -3.895  2.617   30.980 1.00 0.27 ? 45  GLN A H      1 
ATOM   1254 H  HA     . GLN C 3 36 ? -1.057  2.641   30.468 1.00 0.31 ? 45  GLN A HA     1 
ATOM   1255 H  HB2    . GLN C 3 36 ? -3.252  3.993   28.883 1.00 0.30 ? 45  GLN A HB2    1 
ATOM   1256 H  HB3    . GLN C 3 36 ? -1.635  3.586   28.309 1.00 0.32 ? 45  GLN A HB3    1 
ATOM   1257 H  HG2    . GLN C 3 36 ? -2.102  1.190   28.683 1.00 0.37 ? 45  GLN A HG2    1 
ATOM   1258 H  HG3    . GLN C 3 36 ? -3.728  1.597   29.233 1.00 0.37 ? 45  GLN A HG3    1 
ATOM   1259 H  HE21   . GLN C 3 36 ? -2.849  0.026   26.784 1.00 0.99 ? 45  GLN A HE21   1 
ATOM   1260 H  HE22   . GLN C 3 36 ? -3.578  0.822   25.474 1.00 0.84 ? 45  GLN A HE22   1 
ATOM   1261 N  N      . SER C 3 37 ? -0.258  4.974   30.836 1.00 0.30 ? 46  SER A N      1 
ATOM   1262 C  CA     . SER C 3 37 ? 0.214   6.327   31.241 1.00 0.31 ? 46  SER A CA     1 
ATOM   1263 C  C      . SER C 3 37 ? -0.276  7.370   30.235 1.00 0.30 ? 46  SER A C      1 
ATOM   1264 O  O      . SER C 3 37 ? -0.625  8.474   30.596 1.00 0.30 ? 46  SER A O      1 
ATOM   1265 C  CB     . SER C 3 37 ? 1.742   6.339   31.285 1.00 0.37 ? 46  SER A CB     1 
ATOM   1266 O  OG     . SER C 3 37 ? 2.252   6.004   30.001 1.00 0.42 ? 46  SER A OG     1 
ATOM   1267 H  H      . SER C 3 37 ? 0.393   4.293   30.566 1.00 0.34 ? 46  SER A H      1 
ATOM   1268 H  HA     . SER C 3 37 ? -0.175  6.563   32.221 1.00 0.30 ? 46  SER A HA     1 
ATOM   1269 H  HB2    . SER C 3 37 ? 2.089   7.322   31.559 1.00 0.39 ? 46  SER A HB2    1 
ATOM   1270 H  HB3    . SER C 3 37 ? 2.085   5.622   32.019 1.00 0.41 ? 46  SER A HB3    1 
ATOM   1271 H  HG     . SER C 3 37 ? 2.280   6.807   29.475 1.00 1.03 ? 46  SER A HG     1 
ATOM   1272 N  N      . ARG C 3 38 ? -0.310  7.040   28.975 1.00 0.30 ? 47  ARG A N      1 
ATOM   1273 C  CA     . ARG C 3 38 ? -0.785  8.034   27.974 1.00 0.31 ? 47  ARG A CA     1 
ATOM   1274 C  C      . ARG C 3 38 ? -2.206  8.464   28.340 1.00 0.28 ? 47  ARG A C      1 
ATOM   1275 O  O      . ARG C 3 38 ? -2.568  9.620   28.230 1.00 0.30 ? 47  ARG A O      1 
ATOM   1276 C  CB     . ARG C 3 38 ? -0.773  7.412   26.573 1.00 0.33 ? 47  ARG A CB     1 
ATOM   1277 C  CG     . ARG C 3 38 ? -1.867  6.337   26.458 1.00 0.43 ? 47  ARG A CG     1 
ATOM   1278 C  CD     . ARG C 3 38 ? -1.680  5.515   25.162 1.00 0.47 ? 47  ARG A CD     1 
ATOM   1279 N  NE     . ARG C 3 38 ? -1.264  4.126   25.518 1.00 0.82 ? 47  ARG A NE     1 
ATOM   1280 C  CZ     . ARG C 3 38 ? -1.216  3.210   24.591 1.00 1.03 ? 47  ARG A CZ     1 
ATOM   1281 N  NH1    . ARG C 3 38 ? -1.439  3.535   23.362 1.00 1.46 ? 47  ARG A NH1    1 
ATOM   1282 N  NH2    . ARG C 3 38 ? -0.947  1.974   24.888 1.00 1.76 ? 47  ARG A NH2    1 
ATOM   1283 H  H      . ARG C 3 38 ? -0.027  6.146   28.689 1.00 0.32 ? 47  ARG A H      1 
ATOM   1284 H  HA     . ARG C 3 38 ? -0.134  8.897   27.990 1.00 0.33 ? 47  ARG A HA     1 
ATOM   1285 H  HB2    . ARG C 3 38 ? -0.951  8.184   25.839 1.00 0.41 ? 47  ARG A HB2    1 
ATOM   1286 H  HB3    . ARG C 3 38 ? 0.191   6.961   26.391 1.00 0.42 ? 47  ARG A HB3    1 
ATOM   1287 H  HG2    . ARG C 3 38 ? -1.806  5.680   27.311 1.00 0.68 ? 47  ARG A HG2    1 
ATOM   1288 H  HG3    . ARG C 3 38 ? -2.837  6.815   26.445 1.00 0.68 ? 47  ARG A HG3    1 
ATOM   1289 H  HD2    . ARG C 3 38 ? -2.610  5.466   24.621 1.00 0.99 ? 47  ARG A HD2    1 
ATOM   1290 H  HD3    . ARG C 3 38 ? -0.935  5.977   24.528 1.00 1.11 ? 47  ARG A HD3    1 
ATOM   1291 H  HE     . ARG C 3 38 ? -1.065  3.895   26.449 1.00 1.59 ? 47  ARG A HE     1 
ATOM   1292 H  HH11   . ARG C 3 38 ? -1.647  4.484   23.126 1.00 1.67 ? 47  ARG A HH11   1 
ATOM   1293 H  HH12   . ARG C 3 38 ? -1.398  2.839   22.644 1.00 2.03 ? 47  ARG A HH12   1 
ATOM   1294 H  HH21   . ARG C 3 38 ? -0.780  1.715   25.834 1.00 2.30 ? 47  ARG A HH21   1 
ATOM   1295 H  HH22   . ARG C 3 38 ? -0.902  1.285   24.166 1.00 2.05 ? 47  ARG A HH22   1 
ATOM   1296 N  N      . ASN C 3 39 ? -3.014  7.538   28.778 1.00 0.27 ? 48  ASN A N      1 
ATOM   1297 C  CA     . ASN C 3 39 ? -4.409  7.886   29.155 1.00 0.27 ? 48  ASN A CA     1 
ATOM   1298 C  C      . ASN C 3 39 ? -4.389  8.760   30.408 1.00 0.26 ? 48  ASN A C      1 
ATOM   1299 O  O      . ASN C 3 39 ? -5.212  9.639   30.573 1.00 0.29 ? 48  ASN A O      1 
ATOM   1300 C  CB     . ASN C 3 39 ? -5.200  6.606   29.426 1.00 0.27 ? 48  ASN A CB     1 
ATOM   1301 C  CG     . ASN C 3 39 ? -5.502  5.907   28.099 1.00 0.30 ? 48  ASN A CG     1 
ATOM   1302 O  OD1    . ASN C 3 39 ? -5.829  6.550   27.122 1.00 0.35 ? 48  ASN A OD1    1 
ATOM   1303 N  ND2    . ASN C 3 39 ? -5.410  4.607   28.024 1.00 0.33 ? 48  ASN A ND2    1 
ATOM   1304 H  H      . ASN C 3 39 ? -2.700  6.613   28.861 1.00 0.28 ? 48  ASN A H      1 
ATOM   1305 H  HA     . ASN C 3 39 ? -4.873  8.431   28.345 1.00 0.29 ? 48  ASN A HA     1 
ATOM   1306 H  HB2    . ASN C 3 39 ? -4.619  5.950   30.058 1.00 0.27 ? 48  ASN A HB2    1 
ATOM   1307 H  HB3    . ASN C 3 39 ? -6.128  6.854   29.920 1.00 0.29 ? 48  ASN A HB3    1 
ATOM   1308 H  HD21   . ASN C 3 39 ? -5.151  4.088   28.813 1.00 0.35 ? 48  ASN A HD21   1 
ATOM   1309 H  HD22   . ASN C 3 39 ? -5.601  4.151   27.178 1.00 0.36 ? 48  ASN A HD22   1 
ATOM   1310 N  N      . LEU C 3 40 ? -3.448  8.544   31.291 1.00 0.25 ? 49  LEU A N      1 
ATOM   1311 C  CA     . LEU C 3 40 ? -3.385  9.389   32.516 1.00 0.26 ? 49  LEU A CA     1 
ATOM   1312 C  C      . LEU C 3 40 ? -3.385  10.851  32.088 1.00 0.29 ? 49  LEU A C      1 
ATOM   1313 O  O      . LEU C 3 40 ? -4.080  11.676  32.641 1.00 0.30 ? 49  LEU A O      1 
ATOM   1314 C  CB     . LEU C 3 40 ? -2.097  9.093   33.298 1.00 0.30 ? 49  LEU A CB     1 
ATOM   1315 C  CG     . LEU C 3 40 ? -2.018  9.987   34.547 1.00 0.33 ? 49  LEU A CG     1 
ATOM   1316 C  CD1    . LEU C 3 40 ? -3.170  9.653   35.504 1.00 0.42 ? 49  LEU A CD1    1 
ATOM   1317 C  CD2    . LEU C 3 40 ? -0.674  9.758   35.244 1.00 0.40 ? 49  LEU A CD2    1 
ATOM   1318 H  H      . LEU C 3 40 ? -2.782  7.841   31.141 1.00 0.26 ? 49  LEU A H      1 
ATOM   1319 H  HA     . LEU C 3 40 ? -4.243  9.191   33.135 1.00 0.27 ? 49  LEU A HA     1 
ATOM   1320 H  HB2    . LEU C 3 40 ? -2.089  8.055   33.598 1.00 0.32 ? 49  LEU A HB2    1 
ATOM   1321 H  HB3    . LEU C 3 40 ? -1.244  9.290   32.671 1.00 0.31 ? 49  LEU A HB3    1 
ATOM   1322 H  HG     . LEU C 3 40 ? -2.090  11.024  34.257 1.00 0.34 ? 49  LEU A HG     1 
ATOM   1323 H  HD11   . LEU C 3 40 ? -3.375  8.593   35.477 1.00 1.11 ? 49  LEU A HD11   1 
ATOM   1324 H  HD12   . LEU C 3 40 ? -2.899  9.938   36.507 1.00 1.12 ? 49  LEU A HD12   1 
ATOM   1325 H  HD13   . LEU C 3 40 ? -4.053  10.199  35.206 1.00 1.10 ? 49  LEU A HD13   1 
ATOM   1326 H  HD21   . LEU C 3 40 ? -0.502  8.701   35.356 1.00 1.07 ? 49  LEU A HD21   1 
ATOM   1327 H  HD22   . LEU C 3 40 ? 0.117   10.190  34.650 1.00 1.09 ? 49  LEU A HD22   1 
ATOM   1328 H  HD23   . LEU C 3 40 ? -0.690  10.225  36.218 1.00 1.11 ? 49  LEU A HD23   1 
ATOM   1329 N  N      . ARG C 3 41 ? -2.600  11.172  31.106 1.00 0.32 ? 50  ARG A N      1 
ATOM   1330 C  CA     . ARG C 3 41 ? -2.539  12.575  30.633 1.00 0.36 ? 50  ARG A CA     1 
ATOM   1331 C  C      . ARG C 3 41 ? -3.944  13.017  30.216 1.00 0.35 ? 50  ARG A C      1 
ATOM   1332 O  O      . ARG C 3 41 ? -4.423  14.067  30.597 1.00 0.37 ? 50  ARG A O      1 
ATOM   1333 C  CB     . ARG C 3 41 ? -1.577  12.645  29.422 1.00 0.43 ? 50  ARG A CB     1 
ATOM   1334 C  CG     . ARG C 3 41 ? -0.632  13.848  29.564 1.00 1.27 ? 50  ARG A CG     1 
ATOM   1335 C  CD     . ARG C 3 41 ? 0.033   14.208  28.218 1.00 1.72 ? 50  ARG A CD     1 
ATOM   1336 N  NE     . ARG C 3 41 ? 1.477   13.799  28.323 1.00 2.29 ? 50  ARG A NE     1 
ATOM   1337 C  CZ     . ARG C 3 41 ? 2.438   14.505  27.816 1.00 2.94 ? 50  ARG A CZ     1 
ATOM   1338 N  NH1    . ARG C 3 41 ? 2.188   15.667  27.275 1.00 3.29 ? 50  ARG A NH1    1 
ATOM   1339 N  NH2    . ARG C 3 41 ? 3.665   14.065  27.871 1.00 3.76 ? 50  ARG A NH2    1 
ATOM   1340 H  H      . ARG C 3 41 ? -2.046  10.486  30.678 1.00 0.33 ? 50  ARG A H      1 
ATOM   1341 H  HA     . ARG C 3 41 ? -2.184  13.206  31.434 1.00 0.38 ? 50  ARG A HA     1 
ATOM   1342 H  HB2    . ARG C 3 41 ? -0.993  11.736  29.384 1.00 1.03 ? 50  ARG A HB2    1 
ATOM   1343 H  HB3    . ARG C 3 41 ? -2.144  12.737  28.506 1.00 1.02 ? 50  ARG A HB3    1 
ATOM   1344 H  HG2    . ARG C 3 41 ? -1.198  14.696  29.926 1.00 1.99 ? 50  ARG A HG2    1 
ATOM   1345 H  HG3    . ARG C 3 41 ? 0.135   13.606  30.286 1.00 1.84 ? 50  ARG A HG3    1 
ATOM   1346 H  HD2    . ARG C 3 41 ? -0.387  13.662  27.411 1.00 2.05 ? 50  ARG A HD2    1 
ATOM   1347 H  HD3    . ARG C 3 41 ? -0.122  15.277  28.018 1.00 2.32 ? 50  ARG A HD3    1 
ATOM   1348 H  HE     . ARG C 3 41 ? 1.695   12.951  28.764 1.00 2.67 ? 50  ARG A HE     1 
ATOM   1349 H  HH11   . ARG C 3 41 ? 1.253   16.016  27.248 1.00 3.10 ? 50  ARG A HH11   1 
ATOM   1350 H  HH12   . ARG C 3 41 ? 2.934   16.212  26.895 1.00 4.06 ? 50  ARG A HH12   1 
ATOM   1351 H  HH21   . ARG C 3 41 ? 3.861   13.184  28.301 1.00 3.99 ? 50  ARG A HH21   1 
ATOM   1352 H  HH22   . ARG C 3 41 ? 4.409   14.611  27.486 1.00 4.38 ? 50  ARG A HH22   1 
ATOM   1353 N  N      . ARG C 3 42 ? -4.593  12.213  29.430 1.00 0.33 ? 51  ARG A N      1 
ATOM   1354 C  CA     . ARG C 3 42 ? -5.961  12.558  28.960 1.00 0.34 ? 51  ARG A CA     1 
ATOM   1355 C  C      . ARG C 3 42 ? -6.892  12.727  30.162 1.00 0.31 ? 51  ARG A C      1 
ATOM   1356 O  O      . ARG C 3 42 ? -7.803  13.531  30.147 1.00 0.33 ? 51  ARG A O      1 
ATOM   1357 C  CB     . ARG C 3 42 ? -6.469  11.430  28.065 1.00 0.35 ? 51  ARG A CB     1 
ATOM   1358 C  CG     . ARG C 3 42 ? -7.723  11.881  27.319 1.00 0.39 ? 51  ARG A CG     1 
ATOM   1359 C  CD     . ARG C 3 42 ? -8.181  10.757  26.391 1.00 0.46 ? 51  ARG A CD     1 
ATOM   1360 N  NE     . ARG C 3 42 ? -8.338  9.502   27.182 1.00 0.50 ? 51  ARG A NE     1 
ATOM   1361 C  CZ     . ARG C 3 42 ? -8.949  8.478   26.661 1.00 0.58 ? 51  ARG A CZ     1 
ATOM   1362 N  NH1    . ARG C 3 42 ? -9.418  8.552   25.448 1.00 0.88 ? 51  ARG A NH1    1 
ATOM   1363 N  NH2    . ARG C 3 42 ? -9.081  7.378   27.351 1.00 0.65 ? 51  ARG A NH2    1 
ATOM   1364 H  H      . ARG C 3 42 ? -4.174  11.373  29.142 1.00 0.33 ? 51  ARG A H      1 
ATOM   1365 H  HA     . ARG C 3 42 ? -5.927  13.479  28.397 1.00 0.37 ? 51  ARG A HA     1 
ATOM   1366 H  HB2    . ARG C 3 42 ? -5.702  11.167  27.351 1.00 0.38 ? 51  ARG A HB2    1 
ATOM   1367 H  HB3    . ARG C 3 42 ? -6.704  10.569  28.672 1.00 0.33 ? 51  ARG A HB3    1 
ATOM   1368 H  HG2    . ARG C 3 42 ? -8.503  12.107  28.030 1.00 0.37 ? 51  ARG A HG2    1 
ATOM   1369 H  HG3    . ARG C 3 42 ? -7.499  12.760  26.734 1.00 0.45 ? 51  ARG A HG3    1 
ATOM   1370 H  HD2    . ARG C 3 42 ? -9.126  11.018  25.943 1.00 0.50 ? 51  ARG A HD2    1 
ATOM   1371 H  HD3    . ARG C 3 42 ? -7.444  10.610  25.614 1.00 0.51 ? 51  ARG A HD3    1 
ATOM   1372 H  HE     . ARG C 3 42 ? -7.981  9.446   28.092 1.00 0.71 ? 51  ARG A HE     1 
ATOM   1373 H  HH11   . ARG C 3 42 ? -9.307  9.394   24.920 1.00 0.90 ? 51  ARG A HH11   1 
ATOM   1374 H  HH12   . ARG C 3 42 ? -9.890  7.769   25.047 1.00 1.18 ? 51  ARG A HH12   1 
ATOM   1375 H  HH21   . ARG C 3 42 ? -8.713  7.323   28.279 1.00 0.68 ? 51  ARG A HH21   1 
ATOM   1376 H  HH22   . ARG C 3 42 ? -9.552  6.592   26.952 1.00 0.86 ? 51  ARG A HH22   1 
ATOM   1377 N  N      . HIS C 3 43 ? -6.669  11.978  31.206 1.00 0.28 ? 52  HIS A N      1 
ATOM   1378 C  CA     . HIS C 3 43 ? -7.538  12.099  32.410 1.00 0.28 ? 52  HIS A CA     1 
ATOM   1379 C  C      . HIS C 3 43 ? -7.324  13.480  33.042 1.00 0.31 ? 52  HIS A C      1 
ATOM   1380 O  O      . HIS C 3 43 ? -8.228  14.056  33.613 1.00 0.33 ? 52  HIS A O      1 
ATOM   1381 C  CB     . HIS C 3 43 ? -7.177  10.987  33.407 1.00 0.26 ? 52  HIS A CB     1 
ATOM   1382 C  CG     . HIS C 3 43 ? -7.780  11.266  34.759 1.00 0.27 ? 52  HIS A CG     1 
ATOM   1383 N  ND1    . HIS C 3 43 ? -9.021  10.747  35.147 1.00 0.31 ? 52  HIS A ND1    1 
ATOM   1384 C  CD2    . HIS C 3 43 ? -7.317  11.982  35.840 1.00 0.28 ? 52  HIS A CD2    1 
ATOM   1385 C  CE1    . HIS C 3 43 ? -9.255  11.154  36.412 1.00 0.34 ? 52  HIS A CE1    1 
ATOM   1386 N  NE2    . HIS C 3 43 ? -8.252  11.895  36.851 1.00 0.31 ? 52  HIS A NE2    1 
ATOM   1387 H  H      . HIS C 3 43 ? -5.927  11.338  31.199 1.00 0.28 ? 52  HIS A H      1 
ATOM   1388 H  HA     . HIS C 3 43 ? -8.573  11.997  32.116 1.00 0.29 ? 52  HIS A HA     1 
ATOM   1389 H  HB2    . HIS C 3 43 ? -7.555  10.045  33.039 1.00 0.27 ? 52  HIS A HB2    1 
ATOM   1390 H  HB3    . HIS C 3 43 ? -6.105  10.925  33.501 1.00 0.27 ? 52  HIS A HB3    1 
ATOM   1391 H  HD1    . HIS C 3 43 ? -9.611  10.191  34.599 1.00 0.34 ? 52  HIS A HD1    1 
ATOM   1392 H  HD2    . HIS C 3 43 ? -6.383  12.517  35.889 1.00 0.29 ? 52  HIS A HD2    1 
ATOM   1393 H  HE1    . HIS C 3 43 ? -10.138 10.910  36.984 1.00 0.39 ? 52  HIS A HE1    1 
ATOM   1394 N  N      . LEU C 3 44 ? -6.139  14.019  32.937 1.00 0.33 ? 53  LEU A N      1 
ATOM   1395 C  CA     . LEU C 3 44 ? -5.882  15.363  33.526 1.00 0.37 ? 53  LEU A CA     1 
ATOM   1396 C  C      . LEU C 3 44 ? -6.716  16.413  32.786 1.00 0.40 ? 53  LEU A C      1 
ATOM   1397 O  O      . LEU C 3 44 ? -7.319  17.280  33.387 1.00 0.43 ? 53  LEU A O      1 
ATOM   1398 C  CB     . LEU C 3 44 ? -4.394  15.720  33.397 1.00 0.41 ? 53  LEU A CB     1 
ATOM   1399 C  CG     . LEU C 3 44 ? -3.524  14.691  34.138 1.00 0.42 ? 53  LEU A CG     1 
ATOM   1400 C  CD1    . LEU C 3 44 ? -2.045  15.026  33.910 1.00 0.46 ? 53  LEU A CD1    1 
ATOM   1401 C  CD2    . LEU C 3 44 ? -3.828  14.724  35.648 1.00 0.40 ? 53  LEU A CD2    1 
ATOM   1402 H  H      . LEU C 3 44 ? -5.422  13.542  32.467 1.00 0.34 ? 53  LEU A H      1 
ATOM   1403 H  HA     . LEU C 3 44 ? -6.159  15.360  34.562 1.00 0.37 ? 53  LEU A HA     1 
ATOM   1404 H  HB2    . LEU C 3 44 ? -4.120  15.731  32.353 1.00 0.43 ? 53  LEU A HB2    1 
ATOM   1405 H  HB3    . LEU C 3 44 ? -4.224  16.699  33.820 1.00 0.44 ? 53  LEU A HB3    1 
ATOM   1406 H  HG     . LEU C 3 44 ? -3.729  13.706  33.750 1.00 0.42 ? 53  LEU A HG     1 
ATOM   1407 H  HD11   . LEU C 3 44 ? -1.883  15.262  32.869 1.00 1.06 ? 53  LEU A HD11   1 
ATOM   1408 H  HD12   . LEU C 3 44 ? -1.770  15.875  34.519 1.00 1.20 ? 53  LEU A HD12   1 
ATOM   1409 H  HD13   . LEU C 3 44 ? -1.437  14.176  34.185 1.00 1.10 ? 53  LEU A HD13   1 
ATOM   1410 H  HD21   . LEU C 3 44 ? -4.017  15.741  35.960 1.00 1.08 ? 53  LEU A HD21   1 
ATOM   1411 H  HD22   . LEU C 3 44 ? -4.695  14.118  35.854 1.00 1.12 ? 53  LEU A HD22   1 
ATOM   1412 H  HD23   . LEU C 3 44 ? -2.984  14.331  36.200 1.00 1.07 ? 53  LEU A HD23   1 
ATOM   1413 N  N      . GLU C 3 45 ? -6.732  16.354  31.483 1.00 0.40 ? 54  GLU A N      1 
ATOM   1414 C  CA     . GLU C 3 45 ? -7.500  17.360  30.690 1.00 0.44 ? 54  GLU A CA     1 
ATOM   1415 C  C      . GLU C 3 45 ? -9.012  17.110  30.757 1.00 0.43 ? 54  GLU A C      1 
ATOM   1416 O  O      . GLU C 3 45 ? -9.790  17.975  30.411 1.00 0.48 ? 54  GLU A O      1 
ATOM   1417 C  CB     . GLU C 3 45 ? -7.037  17.310  29.229 1.00 0.47 ? 54  GLU A CB     1 
ATOM   1418 C  CG     . GLU C 3 45 ? -5.515  17.555  29.154 1.00 0.52 ? 54  GLU A CG     1 
ATOM   1419 C  CD     . GLU C 3 45 ? -5.148  18.174  27.803 1.00 1.28 ? 54  GLU A CD     1 
ATOM   1420 O  OE1    . GLU C 3 45 ? -5.943  18.061  26.886 1.00 2.09 ? 54  GLU A OE1    1 
ATOM   1421 O  OE2    . GLU C 3 45 ? -4.078  18.752  27.712 1.00 1.88 ? 54  GLU A OE2    1 
ATOM   1422 H  H      . GLU C 3 45 ? -6.222  15.656  31.021 1.00 0.39 ? 54  GLU A H      1 
ATOM   1423 H  HA     . GLU C 3 45 ? -7.298  18.343  31.085 1.00 0.49 ? 54  GLU A HA     1 
ATOM   1424 H  HB2    . GLU C 3 45 ? -7.268  16.338  28.813 1.00 0.45 ? 54  GLU A HB2    1 
ATOM   1425 H  HB3    . GLU C 3 45 ? -7.557  18.072  28.667 1.00 0.51 ? 54  GLU A HB3    1 
ATOM   1426 H  HG2    . GLU C 3 45 ? -5.211  18.227  29.945 1.00 1.09 ? 54  GLU A HG2    1 
ATOM   1427 H  HG3    . GLU C 3 45 ? -4.995  16.615  29.265 1.00 0.97 ? 54  GLU A HG3    1 
ATOM   1428 N  N      . LEU C 3 46 ? -9.449  15.947  31.175 1.00 0.39 ? 55  LEU A N      1 
ATOM   1429 C  CA     . LEU C 3 46 ? -10.925 15.678  31.227 1.00 0.40 ? 55  LEU A CA     1 
ATOM   1430 C  C      . LEU C 3 46 ? -11.474 15.855  32.649 1.00 0.42 ? 55  LEU A C      1 
ATOM   1431 O  O      . LEU C 3 46 ? -12.567 16.356  32.832 1.00 0.50 ? 55  LEU A O      1 
ATOM   1432 C  CB     . LEU C 3 46 ? -11.210 14.234  30.788 1.00 0.40 ? 55  LEU A CB     1 
ATOM   1433 C  CG     . LEU C 3 46 ? -10.887 14.030  29.299 1.00 0.42 ? 55  LEU A CG     1 
ATOM   1434 C  CD1    . LEU C 3 46 ? -11.208 12.578  28.926 1.00 0.48 ? 55  LEU A CD1    1 
ATOM   1435 C  CD2    . LEU C 3 46 ? -11.727 14.982  28.423 1.00 0.52 ? 55  LEU A CD2    1 
ATOM   1436 H  H      . LEU C 3 46 ? -8.816  15.251  31.442 1.00 0.38 ? 55  LEU A H      1 
ATOM   1437 H  HA     . LEU C 3 46 ? -11.443 16.356  30.571 1.00 0.45 ? 55  LEU A HA     1 
ATOM   1438 H  HB2    . LEU C 3 46 ? -10.606 13.560  31.378 1.00 0.40 ? 55  LEU A HB2    1 
ATOM   1439 H  HB3    . LEU C 3 46 ? -12.254 14.012  30.957 1.00 0.45 ? 55  LEU A HB3    1 
ATOM   1440 H  HG     . LEU C 3 46 ? -9.835  14.217  29.133 1.00 0.41 ? 55  LEU A HG     1 
ATOM   1441 H  HD11   . LEU C 3 46 ? -10.756 11.912  29.645 1.00 1.05 ? 55  LEU A HD11   1 
ATOM   1442 H  HD12   . LEU C 3 46 ? -12.279 12.436  28.928 1.00 1.22 ? 55  LEU A HD12   1 
ATOM   1443 H  HD13   . LEU C 3 46 ? -10.820 12.364  27.942 1.00 1.14 ? 55  LEU A HD13   1 
ATOM   1444 H  HD21   . LEU C 3 46 ? -12.686 15.160  28.890 1.00 1.10 ? 55  LEU A HD21   1 
ATOM   1445 H  HD22   . LEU C 3 46 ? -11.205 15.919  28.312 1.00 1.08 ? 55  LEU A HD22   1 
ATOM   1446 H  HD23   . LEU C 3 46 ? -11.880 14.545  27.446 1.00 1.18 ? 55  LEU A HD23   1 
ATOM   1447 N  N      . ARG C 3 47 ? -10.759 15.410  33.652 1.00 0.42 ? 56  ARG A N      1 
ATOM   1448 C  CA     . ARG C 3 47 ? -11.280 15.511  35.057 1.00 0.48 ? 56  ARG A CA     1 
ATOM   1449 C  C      . ARG C 3 47 ? -10.576 16.612  35.862 1.00 0.49 ? 56  ARG A C      1 
ATOM   1450 O  O      . ARG C 3 47 ? -10.753 16.696  37.060 1.00 0.54 ? 56  ARG A O      1 
ATOM   1451 C  CB     . ARG C 3 47 ? -11.043 14.174  35.754 1.00 0.50 ? 56  ARG A CB     1 
ATOM   1452 C  CG     . ARG C 3 47 ? -11.640 13.034  34.917 1.00 0.53 ? 56  ARG A CG     1 
ATOM   1453 C  CD     . ARG C 3 47 ? -13.157 13.201  34.751 1.00 0.63 ? 56  ARG A CD     1 
ATOM   1454 N  NE     . ARG C 3 47 ? -13.755 13.719  36.020 1.00 0.93 ? 56  ARG A NE     1 
ATOM   1455 C  CZ     . ARG C 3 47 ? -15.013 14.058  36.060 1.00 1.52 ? 56  ARG A CZ     1 
ATOM   1456 N  NH1    . ARG C 3 47 ? -15.785 13.818  35.036 1.00 2.09 ? 56  ARG A NH1    1 
ATOM   1457 N  NH2    . ARG C 3 47 ? -15.507 14.605  37.136 1.00 2.06 ? 56  ARG A NH2    1 
ATOM   1458 H  H      . ARG C 3 47 ? -9.896  14.977  33.482 1.00 0.42 ? 56  ARG A H      1 
ATOM   1459 H  HA     . ARG C 3 47 ? -12.342 15.710  35.045 1.00 0.53 ? 56  ARG A HA     1 
ATOM   1460 H  HB2    . ARG C 3 47 ? -9.979  14.017  35.862 1.00 0.48 ? 56  ARG A HB2    1 
ATOM   1461 H  HB3    . ARG C 3 47 ? -11.499 14.188  36.729 1.00 0.57 ? 56  ARG A HB3    1 
ATOM   1462 H  HG2    . ARG C 3 47 ? -11.175 13.031  33.942 1.00 0.52 ? 56  ARG A HG2    1 
ATOM   1463 H  HG3    . ARG C 3 47 ? -11.441 12.094  35.406 1.00 0.56 ? 56  ARG A HG3    1 
ATOM   1464 H  HD2    . ARG C 3 47 ? -13.362 13.898  33.961 1.00 1.01 ? 56  ARG A HD2    1 
ATOM   1465 H  HD3    . ARG C 3 47 ? -13.592 12.242  34.492 1.00 0.95 ? 56  ARG A HD3    1 
ATOM   1466 H  HE     . ARG C 3 47 ? -13.196 13.839  36.812 1.00 1.36 ? 56  ARG A HE     1 
ATOM   1467 H  HH11   . ARG C 3 47 ? -15.411 13.375  34.221 1.00 2.04 ? 56  ARG A HH11   1 
ATOM   1468 H  HH12   . ARG C 3 47 ? -16.752 14.072  35.068 1.00 2.79 ? 56  ARG A HH12   1 
ATOM   1469 H  HH21   . ARG C 3 47 ? -14.921 14.765  37.930 1.00 2.17 ? 56  ARG A HH21   1 
ATOM   1470 H  HH22   . ARG C 3 47 ? -16.473 14.863  37.167 1.00 2.62 ? 56  ARG A HH22   1 
ATOM   1471 N  N      . HIS C 3 48 ? -9.784  17.458  35.253 1.00 0.50 ? 57  HIS A N      1 
ATOM   1472 C  CA     . HIS C 3 48 ? -9.102  18.522  36.062 1.00 0.55 ? 57  HIS A CA     1 
ATOM   1473 C  C      . HIS C 3 48 ? -8.803  19.753  35.202 1.00 0.63 ? 57  HIS A C      1 
ATOM   1474 O  O      . HIS C 3 48 ? -9.439  20.779  35.338 1.00 0.72 ? 57  HIS A O      1 
ATOM   1475 C  CB     . HIS C 3 48 ? -7.799  17.964  36.639 1.00 0.51 ? 57  HIS A CB     1 
ATOM   1476 C  CG     . HIS C 3 48 ? -8.108  16.753  37.479 1.00 0.45 ? 57  HIS A CG     1 
ATOM   1477 N  ND1    . HIS C 3 48 ? -8.921  16.818  38.616 1.00 0.48 ? 57  HIS A ND1    1 
ATOM   1478 C  CD2    . HIS C 3 48 ? -7.744  15.432  37.354 1.00 0.42 ? 57  HIS A CD2    1 
ATOM   1479 C  CE1    . HIS C 3 48 ? -9.020  15.568  39.119 1.00 0.46 ? 57  HIS A CE1    1 
ATOM   1480 N  NE2    . HIS C 3 48 ? -8.321  14.717  38.379 1.00 0.39 ? 57  HIS A NE2    1 
ATOM   1481 H  H      . HIS C 3 48 ? -9.636  17.395  34.287 1.00 0.51 ? 57  HIS A H      1 
ATOM   1482 H  HA     . HIS C 3 48 ? -9.747  18.820  36.878 1.00 0.58 ? 57  HIS A HA     1 
ATOM   1483 H  HB2    . HIS C 3 48 ? -7.137  17.685  35.831 1.00 0.52 ? 57  HIS A HB2    1 
ATOM   1484 H  HB3    . HIS C 3 48 ? -7.324  18.715  37.252 1.00 0.55 ? 57  HIS A HB3    1 
ATOM   1485 H  HD1    . HIS C 3 48 ? -9.343  17.624  38.981 1.00 0.54 ? 57  HIS A HD1    1 
ATOM   1486 H  HD2    . HIS C 3 48 ? -7.108  15.024  36.591 1.00 0.49 ? 57  HIS A HD2    1 
ATOM   1487 H  HE1    . HIS C 3 48 ? -9.592  15.305  39.990 1.00 0.55 ? 57  HIS A HE1    1 
ATOM   1488 N  N      . PHE C 3 49 ? -7.840  19.673  34.326 1.00 0.62 ? 58  PHE A N      1 
ATOM   1489 C  CA     . PHE C 3 49 ? -7.517  20.858  33.482 1.00 0.73 ? 58  PHE A CA     1 
ATOM   1490 C  C      . PHE C 3 49 ? -8.561  20.980  32.373 1.00 0.76 ? 58  PHE A C      1 
ATOM   1491 O  O      . PHE C 3 49 ? -8.382  21.698  31.408 1.00 0.90 ? 58  PHE A O      1 
ATOM   1492 C  CB     . PHE C 3 49 ? -6.125  20.690  32.871 1.00 0.75 ? 58  PHE A CB     1 
ATOM   1493 C  CG     . PHE C 3 49 ? -5.079  20.849  33.947 1.00 0.76 ? 58  PHE A CG     1 
ATOM   1494 C  CD1    . PHE C 3 49 ? -4.690  19.742  34.710 1.00 0.65 ? 58  PHE A CD1    1 
ATOM   1495 C  CD2    . PHE C 3 49 ? -4.498  22.100  34.183 1.00 0.96 ? 58  PHE A CD2    1 
ATOM   1496 C  CE1    . PHE C 3 49 ? -3.720  19.886  35.709 1.00 0.69 ? 58  PHE A CE1    1 
ATOM   1497 C  CE2    . PHE C 3 49 ? -3.528  22.245  35.182 1.00 1.00 ? 58  PHE A CE2    1 
ATOM   1498 C  CZ     . PHE C 3 49 ? -3.138  21.137  35.945 1.00 0.84 ? 58  PHE A CZ     1 
ATOM   1499 H  H      . PHE C 3 49 ? -7.328  18.844  34.229 1.00 0.57 ? 58  PHE A H      1 
ATOM   1500 H  HA     . PHE C 3 49 ? -7.537  21.749  34.093 1.00 0.80 ? 58  PHE A HA     1 
ATOM   1501 H  HB2    . PHE C 3 49 ? -6.042  19.710  32.434 1.00 0.71 ? 58  PHE A HB2    1 
ATOM   1502 H  HB3    . PHE C 3 49 ? -5.974  21.440  32.109 1.00 0.84 ? 58  PHE A HB3    1 
ATOM   1503 H  HD1    . PHE C 3 49 ? -5.139  18.777  34.529 1.00 0.62 ? 58  PHE A HD1    1 
ATOM   1504 H  HD2    . PHE C 3 49 ? -4.798  22.955  33.594 1.00 1.12 ? 58  PHE A HD2    1 
ATOM   1505 H  HE1    . PHE C 3 49 ? -3.420  19.032  36.297 1.00 0.69 ? 58  PHE A HE1    1 
ATOM   1506 H  HE2    . PHE C 3 49 ? -3.079  23.210  35.363 1.00 1.18 ? 58  PHE A HE2    1 
ATOM   1507 H  HZ     . PHE C 3 49 ? -2.390  21.248  36.715 1.00 0.89 ? 58  PHE A HZ     1 
ATOM   1508 N  N      . ALA C 3 50 ? -9.655  20.285  32.512 1.00 0.68 ? 59  ALA A N      1 
ATOM   1509 C  CA     . ALA C 3 50 ? -10.727 20.354  31.481 1.00 0.73 ? 59  ALA A CA     1 
ATOM   1510 C  C      . ALA C 3 50 ? -11.451 21.701  31.593 1.00 0.95 ? 59  ALA A C      1 
ATOM   1511 O  O      . ALA C 3 50 ? -12.421 21.953  30.906 1.00 1.06 ? 59  ALA A O      1 
ATOM   1512 C  CB     . ALA C 3 50 ? -11.719 19.197  31.697 1.00 0.66 ? 59  ALA A CB     1 
ATOM   1513 H  H      . ALA C 3 50 ? -9.771  19.717  33.300 1.00 0.62 ? 59  ALA A H      1 
ATOM   1514 H  HA     . ALA C 3 50 ? -10.281 20.272  30.499 1.00 0.73 ? 59  ALA A HA     1 
ATOM   1515 H  HB1    . ALA C 3 50 ? -11.219 18.398  32.221 1.00 1.22 ? 59  ALA A HB1    1 
ATOM   1516 H  HB2    . ALA C 3 50 ? -12.563 19.533  32.284 1.00 1.20 ? 59  ALA A HB2    1 
ATOM   1517 H  HB3    . ALA C 3 50 ? -12.070 18.833  30.741 1.00 1.20 ? 59  ALA A HB3    1 
ATOM   1518 N  N      . LYS C 3 51 ? -10.976 22.575  32.438 1.00 1.09 ? 60  LYS A N      1 
ATOM   1519 C  CA     . LYS C 3 51 ? -11.629 23.909  32.570 1.00 1.35 ? 60  LYS A CA     1 
ATOM   1520 C  C      . LYS C 3 51 ? -11.082 24.800  31.468 1.00 1.55 ? 60  LYS A C      1 
ATOM   1521 O  O      . LYS C 3 51 ? -9.939  24.657  31.085 1.00 1.62 ? 60  LYS A O      1 
ATOM   1522 C  CB     . LYS C 3 51 ? -11.231 24.578  33.888 1.00 1.51 ? 60  LYS A CB     1 
ATOM   1523 C  CG     . LYS C 3 51 ? -11.768 23.818  35.104 1.00 1.76 ? 60  LYS A CG     1 
ATOM   1524 C  CD     . LYS C 3 51 ? -11.555 24.688  36.369 1.00 2.09 ? 60  LYS A CD     1 
ATOM   1525 C  CE     . LYS C 3 51 ? -11.312 23.809  37.596 1.00 2.54 ? 60  LYS A CE     1 
ATOM   1526 N  NZ     . LYS C 3 51 ? -12.415 22.815  37.718 1.00 3.22 ? 60  LYS A NZ     1 
ATOM   1527 H  H      . LYS C 3 51 ? -10.183 22.360  32.974 1.00 1.06 ? 60  LYS A H      1 
ATOM   1528 H  HA     . LYS C 3 51 ? -12.701 23.814  32.501 1.00 1.36 ? 60  LYS A HA     1 
ATOM   1529 H  HB2    . LYS C 3 51 ? -10.153 24.618  33.949 1.00 1.88 ? 60  LYS A HB2    1 
ATOM   1530 H  HB3    . LYS C 3 51 ? -11.619 25.587  33.901 1.00 1.90 ? 60  LYS A HB3    1 
ATOM   1531 H  HG2    . LYS C 3 51 ? -12.823 23.618  34.966 1.00 2.18 ? 60  LYS A HG2    1 
ATOM   1532 H  HG3    . LYS C 3 51 ? -11.233 22.885  35.207 1.00 2.16 ? 60  LYS A HG3    1 
ATOM   1533 H  HD2    . LYS C 3 51 ? -10.696 25.330  36.232 1.00 2.48 ? 60  LYS A HD2    1 
ATOM   1534 H  HD3    . LYS C 3 51 ? -12.431 25.299  36.538 1.00 2.47 ? 60  LYS A HD3    1 
ATOM   1535 H  HE2    . LYS C 3 51 ? -10.370 23.293  37.480 1.00 2.85 ? 60  LYS A HE2    1 
ATOM   1536 H  HE3    . LYS C 3 51 ? -11.276 24.427  38.483 1.00 2.90 ? 60  LYS A HE3    1 
ATOM   1537 H  HZ1    . LYS C 3 51 ? -13.187 23.077  37.074 1.00 3.44 ? 60  LYS A HZ1    1 
ATOM   1538 H  HZ2    . LYS C 3 51 ? -12.058 21.874  37.464 1.00 3.66 ? 60  LYS A HZ2    1 
ATOM   1539 H  HZ3    . LYS C 3 51 ? -12.768 22.802  38.698 1.00 3.65 ? 60  LYS A HZ3    1 
ATOM   1540 N  N      . PRO C 3 52 ? -11.835 25.745  30.982 1.00 1.75 ? 61  PRO A N      1 
ATOM   1541 C  CA     . PRO C 3 52 ? -11.294 26.655  29.955 1.00 2.04 ? 61  PRO A CA     1 
ATOM   1542 C  C      . PRO C 3 52 ? -10.058 27.342  30.537 1.00 2.31 ? 61  PRO A C      1 
ATOM   1543 O  O      . PRO C 3 52 ? -10.111 27.923  31.603 1.00 2.39 ? 61  PRO A O      1 
ATOM   1544 C  CB     . PRO C 3 52 ? -12.436 27.658  29.673 1.00 2.19 ? 61  PRO A CB     1 
ATOM   1545 C  CG     . PRO C 3 52 ? -13.458 27.449  30.762 1.00 2.13 ? 61  PRO A CG     1 
ATOM   1546 C  CD     . PRO C 3 52 ? -13.229 26.045  31.334 1.00 1.81 ? 61  PRO A CD     1 
ATOM   1547 H  HA     . PRO C 3 52 ? -11.037 26.110  29.059 1.00 2.05 ? 61  PRO A HA     1 
ATOM   1548 H  HB2    . PRO C 3 52 ? -12.061 28.677  29.695 1.00 2.39 ? 61  PRO A HB2    1 
ATOM   1549 H  HB3    . PRO C 3 52 ? -12.878 27.454  28.708 1.00 2.31 ? 61  PRO A HB3    1 
ATOM   1550 H  HG2    . PRO C 3 52 ? -13.329 28.193  31.541 1.00 2.33 ? 61  PRO A HG2    1 
ATOM   1551 H  HG3    . PRO C 3 52 ? -14.458 27.517  30.356 1.00 2.25 ? 61  PRO A HG3    1 
ATOM   1552 H  HD2    . PRO C 3 52 ? -13.361 26.047  32.408 1.00 1.84 ? 61  PRO A HD2    1 
ATOM   1553 H  HD3    . PRO C 3 52 ? -13.891 25.328  30.871 1.00 1.70 ? 61  PRO A HD3    1 
ATOM   1554 N  N      . GLY C 3 53 ? -8.946  27.269  29.871 1.00 2.59 ? 62  GLY A N      1 
ATOM   1555 C  CA     . GLY C 3 53 ? -7.724  27.910  30.426 1.00 2.96 ? 62  GLY A CA     1 
ATOM   1556 C  C      . GLY C 3 53 ? -7.863  29.422  30.304 1.00 3.48 ? 62  GLY A C      1 
ATOM   1557 O  O      . GLY C 3 53 ? -8.953  29.941  30.172 1.00 3.90 ? 62  GLY A O      1 
ATOM   1558 H  H      . GLY C 3 53 ? -8.909  26.783  29.021 1.00 2.64 ? 62  GLY A H      1 
ATOM   1559 H  HA2    . GLY C 3 53 ? -7.617  27.638  31.468 1.00 3.05 ? 62  GLY A HA2    1 
ATOM   1560 H  HA3    . GLY C 3 53 ? -6.855  27.583  29.876 1.00 3.12 ? 62  GLY A HA3    1 
ATOM   1561 N  N      . VAL C 3 54 ? -6.767  30.133  30.342 1.00 3.93 ? 63  VAL A N      1 
ATOM   1562 C  CA     . VAL C 3 54 ? -6.825  31.621  30.219 1.00 4.73 ? 63  VAL A CA     1 
ATOM   1563 C  C      . VAL C 3 54 ? -5.722  32.076  29.260 1.00 5.32 ? 63  VAL A C      1 
ATOM   1564 O  O      . VAL C 3 54 ? -5.943  33.047  28.558 1.00 5.68 ? 63  VAL A O      1 
ATOM   1565 C  CB     . VAL C 3 54 ? -6.633  32.271  31.610 1.00 5.40 ? 63  VAL A CB     1 
ATOM   1566 C  CG1    . VAL C 3 54 ? -7.489  33.538  31.721 1.00 5.85 ? 63  VAL A CG1    1 
ATOM   1567 C  CG2    . VAL C 3 54 ? -7.061  31.286  32.705 1.00 5.58 ? 63  VAL A CG2    1 
ATOM   1568 O  OXT    . VAL C 3 54 ? -4.678  31.443  29.241 1.00 5.76 ? 63  VAL A OXT    1 
ATOM   1569 H  H      . VAL C 3 54 ? -5.901  29.688  30.446 1.00 4.02 ? 63  VAL A H      1 
ATOM   1570 H  HA     . VAL C 3 54 ? -7.782  31.915  29.805 1.00 4.84 ? 63  VAL A HA     1 
ATOM   1571 H  HB     . VAL C 3 54 ? -5.593  32.533  31.754 1.00 5.90 ? 63  VAL A HB     1 
ATOM   1572 H  HG11   . VAL C 3 54 ? -7.356  34.143  30.835 1.00 6.00 ? 63  VAL A HG11   1 
ATOM   1573 H  HG12   . VAL C 3 54 ? -8.530  33.262  31.814 1.00 6.11 ? 63  VAL A HG12   1 
ATOM   1574 H  HG13   . VAL C 3 54 ? -7.188  34.101  32.591 1.00 6.17 ? 63  VAL A HG13   1 
ATOM   1575 H  HG21   . VAL C 3 54 ? -8.063  30.938  32.507 1.00 5.79 ? 63  VAL A HG21   1 
ATOM   1576 H  HG22   . VAL C 3 54 ? -6.383  30.445  32.718 1.00 5.77 ? 63  VAL A HG22   1 
ATOM   1577 H  HG23   . VAL C 3 54 ? -7.035  31.783  33.664 1.00 5.75 ? 63  VAL A HG23   1 
HETATM 1578 ZN ZN     . ZN  D 4 .  ? -8.114  12.736  38.660 1.00 0.35 ? 64  ZN  A ZN     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DG  1  101 101 DG  G   B . n 
A 1 2  DC  2  102 102 DC  C   B . n 
A 1 3  DC  3  103 103 DC  C   B . n 
A 1 4  DG  4  104 104 DG  G   B . n 
A 1 5  DA  5  105 105 DA  A   B . n 
A 1 6  DG  6  106 106 DG  G   B . n 
A 1 7  DA  7  107 107 DA  A   B . n 
A 1 8  DG  8  108 108 DG  G   B . n 
A 1 9  DT  9  109 109 DT  T   B . n 
A 1 10 DA  10 110 110 DA  A   B . n 
A 1 11 DC  11 111 111 DC  C   B . n 
B 2 1  DG  1  112 112 DG  G   C . n 
B 2 2  DT  2  113 113 DT  T   C . n 
B 2 3  DA  3  114 114 DA  A   C . n 
B 2 4  DC  4  115 115 DC  C   C . n 
B 2 5  DT  5  116 116 DT  T   C . n 
B 2 6  DC  6  117 117 DC  C   C . n 
B 2 7  DT  7  118 118 DT  T   C . n 
B 2 8  DC  8  119 119 DC  C   C . n 
B 2 9  DG  9  120 120 DG  G   C . n 
B 2 10 DG  10 121 121 DG  G   C . n 
B 2 11 DC  11 122 122 DC  C   C . n 
C 3 1  PRO 1  10  10  PRO PRO A . n 
C 3 2  LYS 2  11  11  LYS LYS A . n 
C 3 3  ALA 3  12  12  ALA ALA A . n 
C 3 4  LYS 4  13  13  LYS LYS A . n 
C 3 5  ARG 5  14  14  ARG ARG A . n 
C 3 6  ALA 6  15  15  ALA ALA A . n 
C 3 7  LYS 7  16  16  LYS LYS A . n 
C 3 8  HIS 8  17  17  HIS HIS A . n 
C 3 9  PRO 9  18  18  PRO PRO A . n 
C 3 10 PRO 10 19  19  PRO PRO A . n 
C 3 11 GLY 11 20  20  GLY GLY A . n 
C 3 12 THR 12 21  21  THR THR A . n 
C 3 13 GLU 13 22  22  GLU GLU A . n 
C 3 14 LYS 14 23  23  LYS LYS A . n 
C 3 15 PRO 15 24  24  PRO PRO A . n 
C 3 16 ARG 16 25  25  ARG ARG A . n 
C 3 17 SER 17 26  26  SER SER A . n 
C 3 18 ARG 18 27  27  ARG ARG A . n 
C 3 19 SER 19 28  28  SER SER A . n 
C 3 20 GLN 20 29  29  GLN GLN A . n 
C 3 21 SER 21 30  30  SER SER A . n 
C 3 22 GLU 22 31  31  GLU GLU A . n 
C 3 23 GLN 23 32  32  GLN GLN A . n 
C 3 24 PRO 24 33  33  PRO PRO A . n 
C 3 25 ALA 25 34  34  ALA ALA A . n 
C 3 26 THR 26 35  35  THR THR A . n 
C 3 27 CYS 27 36  36  CYS CYS A . n 
C 3 28 PRO 28 37  37  PRO PRO A . n 
C 3 29 ILE 29 38  38  ILE ILE A . n 
C 3 30 CYS 30 39  39  CYS CYS A . n 
C 3 31 TYR 31 40  40  TYR TYR A . n 
C 3 32 ALA 32 41  41  ALA ALA A . n 
C 3 33 VAL 33 42  42  VAL VAL A . n 
C 3 34 ILE 34 43  43  ILE ILE A . n 
C 3 35 ARG 35 44  44  ARG ARG A . n 
C 3 36 GLN 36 45  45  GLN GLN A . n 
C 3 37 SER 37 46  46  SER SER A . n 
C 3 38 ARG 38 47  47  ARG ARG A . n 
C 3 39 ASN 39 48  48  ASN ASN A . n 
C 3 40 LEU 40 49  49  LEU LEU A . n 
C 3 41 ARG 41 50  50  ARG ARG A . n 
C 3 42 ARG 42 51  51  ARG ARG A . n 
C 3 43 HIS 43 52  52  HIS HIS A . n 
C 3 44 LEU 44 53  53  LEU LEU A . n 
C 3 45 GLU 45 54  54  GLU GLU A . n 
C 3 46 LEU 46 55  55  LEU LEU A . n 
C 3 47 ARG 47 56  56  ARG ARG A . n 
C 3 48 HIS 48 57  57  HIS HIS A . n 
C 3 49 PHE 49 58  58  PHE PHE A . n 
C 3 50 ALA 50 59  59  ALA ALA A . n 
C 3 51 LYS 51 60  60  LYS LYS A . n 
C 3 52 PRO 52 61  61  PRO PRO A . n 
C 3 53 GLY 53 62  62  GLY GLY A . n 
C 3 54 VAL 54 63  63  VAL VAL A . n 
# 
_pdbx_nonpoly_scheme.asym_id         D 
_pdbx_nonpoly_scheme.entity_id       4 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     64 
_pdbx_nonpoly_scheme.auth_seq_num    64 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? C CYS 27 ? A CYS 36 ? 1_555 ZN ? D ZN . ? A ZN 64 ? 1_555 SG  ? C CYS 30 ? A CYS 39 ? 1_555 107.3 ? 
2 SG  ? C CYS 27 ? A CYS 36 ? 1_555 ZN ? D ZN . ? A ZN 64 ? 1_555 NE2 ? C HIS 43 ? A HIS 52 ? 1_555 106.2 ? 
3 SG  ? C CYS 30 ? A CYS 39 ? 1_555 ZN ? D ZN . ? A ZN 64 ? 1_555 NE2 ? C HIS 43 ? A HIS 52 ? 1_555 107.5 ? 
4 SG  ? C CYS 27 ? A CYS 36 ? 1_555 ZN ? D ZN . ? A ZN 64 ? 1_555 NE2 ? C HIS 48 ? A HIS 57 ? 1_555 107.3 ? 
5 SG  ? C CYS 30 ? A CYS 39 ? 1_555 ZN ? D ZN . ? A ZN 64 ? 1_555 NE2 ? C HIS 48 ? A HIS 57 ? 1_555 121.4 ? 
6 NE2 ? C HIS 43 ? A HIS 52 ? 1_555 ZN ? D ZN . ? A ZN 64 ? 1_555 NE2 ? C HIS 48 ? A HIS 57 ? 1_555 106.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-12-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.1 ? 1 
X-PLOR refinement       3.1 ? 2 
X-PLOR phasing          3.1 ? 3 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" B DG 101 ? ? "C1'" B DG 101 ? ? N9 B DG 101 ? ? 110.39 108.30 2.09  0.30 N 
2  1 "O4'" B DC 102 ? ? "C1'" B DC 102 ? ? N1 B DC 102 ? ? 110.41 108.30 2.11  0.30 N 
3  1 "O4'" B DC 103 ? ? "C1'" B DC 103 ? ? N1 B DC 103 ? ? 110.58 108.30 2.28  0.30 N 
4  1 "O4'" B DG 104 ? ? "C1'" B DG 104 ? ? N9 B DG 104 ? ? 110.75 108.30 2.45  0.30 N 
5  1 "O4'" B DA 105 ? ? "C1'" B DA 105 ? ? N9 B DA 105 ? ? 111.42 108.30 3.12  0.30 N 
6  1 "O4'" B DG 106 ? ? "C1'" B DG 106 ? ? N9 B DG 106 ? ? 110.64 108.30 2.34  0.30 N 
7  1 "O4'" B DA 107 ? ? "C1'" B DA 107 ? ? N9 B DA 107 ? ? 110.61 108.30 2.31  0.30 N 
8  1 "O4'" B DG 108 ? ? "C1'" B DG 108 ? ? N9 B DG 108 ? ? 111.43 108.30 3.13  0.30 N 
9  1 "O4'" B DT 109 ? ? "C1'" B DT 109 ? ? N1 B DT 109 ? ? 110.37 108.30 2.07  0.30 N 
10 1 "O4'" B DA 110 ? ? "C1'" B DA 110 ? ? N9 B DA 110 ? ? 110.47 108.30 2.17  0.30 N 
11 1 "O4'" B DC 111 ? ? "C1'" B DC 111 ? ? N1 B DC 111 ? ? 110.90 108.30 2.60  0.30 N 
12 1 "O4'" C DG 112 ? ? "C1'" C DG 112 ? ? N9 C DG 112 ? ? 110.83 108.30 2.53  0.30 N 
13 1 "O4'" C DT 113 ? ? "C1'" C DT 113 ? ? N1 C DT 113 ? ? 110.51 108.30 2.21  0.30 N 
14 1 C6    C DT 113 ? ? C5    C DT 113 ? ? C7 C DT 113 ? ? 119.18 122.90 -3.72 0.60 N 
15 1 "O4'" C DA 114 ? ? "C1'" C DA 114 ? ? N9 C DA 114 ? ? 110.90 108.30 2.60  0.30 N 
16 1 "O4'" C DC 115 ? ? "C1'" C DC 115 ? ? N1 C DC 115 ? ? 110.14 108.30 1.84  0.30 N 
17 1 "O4'" C DT 116 ? ? "C1'" C DT 116 ? ? N1 C DT 116 ? ? 110.20 108.30 1.90  0.30 N 
18 1 "O4'" C DC 117 ? ? "C1'" C DC 117 ? ? N1 C DC 117 ? ? 111.42 108.30 3.12  0.30 N 
19 1 "O4'" C DT 118 ? ? "C1'" C DT 118 ? ? N1 C DT 118 ? ? 111.58 108.30 3.28  0.30 N 
20 1 "O4'" C DC 119 ? ? "C1'" C DC 119 ? ? N1 C DC 119 ? ? 110.75 108.30 2.45  0.30 N 
21 1 "O4'" C DG 120 ? ? "C1'" C DG 120 ? ? N9 C DG 120 ? ? 110.98 108.30 2.68  0.30 N 
22 1 "O4'" C DG 121 ? ? "C1'" C DG 121 ? ? N9 C DG 121 ? ? 110.58 108.30 2.28  0.30 N 
23 1 "O4'" C DC 122 ? ? "C1'" C DC 122 ? ? N1 C DC 122 ? ? 110.29 108.30 1.99  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 12 ? ? -159.26 76.32  
2 1 LYS A 23 ? ? -104.38 76.45  
3 1 PRO A 33 ? ? -37.70  152.93 
4 1 TYR A 40 ? ? 52.98   17.58  
5 1 HIS A 57 ? ? -152.68 -73.20 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1YUI 'double helix'        
1YUI 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 11 1_555 -0.253 -0.087 0.008  0.251   -0.002  -1.538 1  B_DG101:DC122_C B 101 ? C 122 ? 19 1 
1 A DC 2  1_555 B DG 10 1_555 0.566  -0.254 -0.005 3.258   -3.367  -4.259 2  B_DC102:DG121_C B 102 ? C 121 ? 19 1 
1 A DC 3  1_555 B DG 9  1_555 -0.067 -0.015 -0.021 14.535  -13.276 3.061  3  B_DC103:DG120_C B 103 ? C 120 ? 19 1 
1 A DG 4  1_555 B DC 8  1_555 -0.053 -0.155 -0.730 1.234   -4.368  3.799  4  B_DG104:DC119_C B 104 ? C 119 ? 19 1 
1 A DA 5  1_555 B DT 7  1_555 0.264  -0.111 -0.534 15.663  -8.308  5.158  5  B_DA105:DT118_C B 105 ? C 118 ? 20 1 
1 A DG 6  1_555 B DC 6  1_555 -0.538 -0.146 0.276  11.249  -13.391 5.474  6  B_DG106:DC117_C B 106 ? C 117 ? 19 1 
1 A DA 7  1_555 B DT 5  1_555 -0.145 -0.084 -0.218 11.801  -16.773 7.032  7  B_DA107:DT116_C B 107 ? C 116 ? 20 1 
1 A DG 8  1_555 B DC 4  1_555 -0.065 -0.380 -1.356 -16.312 -15.461 0.475  8  B_DG108:DC115_C B 108 ? C 115 ? 19 1 
1 A DT 9  1_555 B DA 3  1_555 -0.525 0.029  -0.029 -10.863 -5.357  -1.873 9  B_DT109:DA114_C B 109 ? C 114 ? 20 1 
1 A DA 10 1_555 B DT 2  1_555 0.176  -0.038 0.270  7.332   -5.411  -2.150 10 B_DA110:DT113_C B 110 ? C 113 ? 20 1 
1 A DC 11 1_555 B DG 1  1_555 -0.174 -0.028 -0.055 0.297   0.906   2.143  11 B_DC111:DG112_C B 111 ? C 112 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 11 1_555 A DC 2  1_555 B DG 10 1_555 -0.049 0.861  4.204 0.468  -8.634 36.288 2.785  0.155  3.904 -13.625 
-0.739 37.270 1  BB_DG101DC102:DG121DC122_CC B 101 ? C 122 ? B 102 ? C 121 ? 
1 A DC 2  1_555 B DG 10 1_555 A DC 3  1_555 B DG 9  1_555 0.701  -0.226 3.170 2.616  -6.321 32.504 0.648  -0.795 3.201 -11.139 
-4.611 33.197 2  BB_DC102DC103:DG120DG121_CC B 102 ? C 121 ? B 103 ? C 120 ? 
1 A DC 3  1_555 B DG 9  1_555 A DG 4  1_555 B DC 8  1_555 -0.136 0.342  4.237 1.638  8.707  35.479 -1.027 0.513  4.192 14.019  
-2.637 36.534 3  BB_DC103DG104:DC119DG120_CC B 103 ? C 120 ? B 104 ? C 119 ? 
1 A DG 4  1_555 B DC 8  1_555 A DA 5  1_555 B DT 7  1_555 0.148  0.194  3.058 -1.351 0.759  31.502 0.225  -0.508 3.053 1.398   
2.487  31.539 4  BB_DG104DA105:DT118DC119_CC B 104 ? C 119 ? B 105 ? C 118 ? 
1 A DA 5  1_555 B DT 7  1_555 A DG 6  1_555 B DC 6  1_555 -0.831 -0.254 3.999 -5.131 -0.418 36.058 -0.334 0.446  4.077 -0.671  
8.237  36.412 5  BB_DA105DG106:DC117DT118_CC B 105 ? C 118 ? B 106 ? C 117 ? 
1 A DG 6  1_555 B DC 6  1_555 A DA 7  1_555 B DT 5  1_555 0.074  0.532  3.751 3.680  -1.957 35.833 1.177  0.477  3.707 -3.168  
-5.956 36.067 6  BB_DG106DA107:DT116DC117_CC B 106 ? C 117 ? B 107 ? C 116 ? 
1 A DA 7  1_555 B DT 5  1_555 A DG 8  1_555 B DC 4  1_555 -0.663 0.703  4.823 2.495  20.520 34.461 -2.596 1.409  4.484 31.388  
-3.817 40.023 7  BB_DA107DG108:DC115DT116_CC B 107 ? C 116 ? B 108 ? C 115 ? 
1 A DG 8  1_555 B DC 4  1_555 A DT 9  1_555 B DA 3  1_555 -0.040 -0.124 3.488 -5.541 -8.765 34.989 1.108  -0.762 3.388 -14.197 
8.975  36.447 8  BB_DG108DT109:DA114DC115_CC B 108 ? C 115 ? B 109 ? C 114 ? 
1 A DT 9  1_555 B DA 3  1_555 A DA 10 1_555 B DT 2  1_555 -0.215 0.633  2.955 -1.765 1.389  36.517 0.834  0.122  2.983 2.214   
2.814  36.583 9  BB_DT109DA110:DT113DA114_CC B 109 ? C 114 ? B 110 ? C 113 ? 
1 A DA 10 1_555 B DT 2  1_555 A DC 11 1_555 B DG 1  1_555 0.630  0.241  4.534 -0.218 -7.593 30.023 2.474  -1.238 4.340 -14.370 
0.413  30.948 10 BB_DA110DC111:DG112DT113_CC B 110 ? C 113 ? B 111 ? C 112 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
#