data_1Z0F
# 
_entry.id   1Z0F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Z0F         
RCSB  RCSB032140   
WWPDB D_1000032140 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Z0F 
_pdbx_database_status.recvd_initial_deposition_date   2005-03-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Eathiraj, S.'    1 
'Pan, X.'         2 
'Ritacco, C.'     3 
'Lambright, D.G.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            436 
_citation.page_first                415 
_citation.page_last                 419 
_citation.year                      2005 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16034420 
_citation.pdbx_database_id_DOI      10.1038/nature03798 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Eathiraj, S.'    1 
primary 'Pan, X.'         2 
primary 'Ritacco, C.'     3 
primary 'Lambright, D.G.' 4 
# 
_cell.entry_id           1Z0F 
_cell.length_a           43.065 
_cell.length_b           40.780 
_cell.length_c           47.678 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.45 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Z0F 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RAB14, member RAS oncogene family' 20098.721 1  ? ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                     24.305    1  ? ? ? ? 
3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"          443.201   1  ? ? ? ? 
4 water       nat water                               18.015    88 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAV
TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAK
TGENVEDAFLEAAKKIYQN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAV
TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAK
TGENVEDAFLEAAKKIYQN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   ALA n 
1 7   THR n 
1 8   ALA n 
1 9   PRO n 
1 10  TYR n 
1 11  ASN n 
1 12  TYR n 
1 13  SER n 
1 14  TYR n 
1 15  ILE n 
1 16  PHE n 
1 17  LYS n 
1 18  TYR n 
1 19  ILE n 
1 20  ILE n 
1 21  ILE n 
1 22  GLY n 
1 23  ASP n 
1 24  MET n 
1 25  GLY n 
1 26  VAL n 
1 27  GLY n 
1 28  LYS n 
1 29  SER n 
1 30  CYS n 
1 31  LEU n 
1 32  LEU n 
1 33  HIS n 
1 34  GLN n 
1 35  PHE n 
1 36  THR n 
1 37  GLU n 
1 38  LYS n 
1 39  LYS n 
1 40  PHE n 
1 41  MET n 
1 42  ALA n 
1 43  ASP n 
1 44  CYS n 
1 45  PRO n 
1 46  HIS n 
1 47  THR n 
1 48  ILE n 
1 49  GLY n 
1 50  VAL n 
1 51  GLU n 
1 52  PHE n 
1 53  GLY n 
1 54  THR n 
1 55  ARG n 
1 56  ILE n 
1 57  ILE n 
1 58  GLU n 
1 59  VAL n 
1 60  SER n 
1 61  GLY n 
1 62  GLN n 
1 63  LYS n 
1 64  ILE n 
1 65  LYS n 
1 66  LEU n 
1 67  GLN n 
1 68  ILE n 
1 69  TRP n 
1 70  ASP n 
1 71  THR n 
1 72  ALA n 
1 73  GLY n 
1 74  GLN n 
1 75  GLU n 
1 76  ARG n 
1 77  PHE n 
1 78  ARG n 
1 79  ALA n 
1 80  VAL n 
1 81  THR n 
1 82  ARG n 
1 83  SER n 
1 84  TYR n 
1 85  TYR n 
1 86  ARG n 
1 87  GLY n 
1 88  ALA n 
1 89  ALA n 
1 90  GLY n 
1 91  ALA n 
1 92  LEU n 
1 93  MET n 
1 94  VAL n 
1 95  TYR n 
1 96  ASP n 
1 97  ILE n 
1 98  THR n 
1 99  ARG n 
1 100 ARG n 
1 101 SER n 
1 102 THR n 
1 103 TYR n 
1 104 ASN n 
1 105 HIS n 
1 106 LEU n 
1 107 SER n 
1 108 SER n 
1 109 TRP n 
1 110 LEU n 
1 111 THR n 
1 112 ASP n 
1 113 ALA n 
1 114 ARG n 
1 115 ASN n 
1 116 LEU n 
1 117 THR n 
1 118 ASN n 
1 119 PRO n 
1 120 ASN n 
1 121 THR n 
1 122 VAL n 
1 123 ILE n 
1 124 ILE n 
1 125 LEU n 
1 126 ILE n 
1 127 GLY n 
1 128 ASN n 
1 129 LYS n 
1 130 ALA n 
1 131 ASP n 
1 132 LEU n 
1 133 GLU n 
1 134 ALA n 
1 135 GLN n 
1 136 ARG n 
1 137 ASP n 
1 138 VAL n 
1 139 THR n 
1 140 TYR n 
1 141 GLU n 
1 142 GLU n 
1 143 ALA n 
1 144 LYS n 
1 145 GLN n 
1 146 PHE n 
1 147 ALA n 
1 148 GLU n 
1 149 GLU n 
1 150 ASN n 
1 151 GLY n 
1 152 LEU n 
1 153 LEU n 
1 154 PHE n 
1 155 LEU n 
1 156 GLU n 
1 157 ALA n 
1 158 SER n 
1 159 ALA n 
1 160 LYS n 
1 161 THR n 
1 162 GLY n 
1 163 GLU n 
1 164 ASN n 
1 165 VAL n 
1 166 GLU n 
1 167 ASP n 
1 168 ALA n 
1 169 PHE n 
1 170 LEU n 
1 171 GLU n 
1 172 ALA n 
1 173 ALA n 
1 174 LYS n 
1 175 LYS n 
1 176 ILE n 
1 177 TYR n 
1 178 GLN n 
1 179 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) Codon Plus-RIL Cells' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'GST fusion, pGEX' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX6P1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RAB14_HUMAN 
_struct_ref.pdbx_db_accession          P61106 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYY
RGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENV
EDAFLEAAKKIYQN
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1Z0F 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 179 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P61106 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  175 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       175 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1Z0F GLY A 1 ? UNP P61106 ? ? 'CLONING ARTIFACT' -3 1 
1 1Z0F PRO A 2 ? UNP P61106 ? ? 'CLONING ARTIFACT' -2 2 
1 1Z0F LEU A 3 ? UNP P61106 ? ? 'CLONING ARTIFACT' -1 3 
1 1Z0F GLY A 4 ? UNP P61106 ? ? 'CLONING ARTIFACT' 0  4 
1 1Z0F SER A 5 ? UNP P61106 ? ? 'CLONING ARTIFACT' 1  5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1Z0F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.22 
_exptl_crystal.density_percent_sol   44.28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'7% PEG 6000, 100mM Calcium Chloride, 50mM HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   2004-03-22 
_diffrn_detector.details                'Osmic mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1Z0F 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.15 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   8450 
_reflns.percent_possible_obs         97.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.122 
_reflns.pdbx_netI_over_sigmaI        16.1 
_reflns.B_iso_Wilson_estimate        36.1 
_reflns.pdbx_redundancy              4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   84.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.386 
_reflns_shell.meanI_over_sigI_obs    3.6 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      596 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1Z0F 
_refine.ls_number_reflns_obs                     7998 
_refine.ls_number_reflns_all                     8469 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             12.00 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    97.38 
_refine.ls_R_factor_obs                          0.20953 
_refine.ls_R_factor_all                          0.225 
_refine.ls_R_factor_R_work                       0.20737 
_refine.ls_R_factor_R_free                       0.2572 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  401 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.B_iso_mean                               28.305 
_refine.aniso_B[1][1]                            -1.33 
_refine.aniso_B[2][2]                            -0.82 
_refine.aniso_B[3][3]                            3.13 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            1.55 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'Polyalanine Rab4A' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.335 
_refine.pdbx_overall_ESU_R_Free                  0.234 
_refine.overall_SU_ML                            0.160 
_refine.overall_SU_B                             6.357 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1246 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             88 
_refine_hist.number_atoms_total               1363 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        12.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 1298 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.175  1.957  ? 1770 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.337  5.000  ? 166  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.713 23.889 ? 54   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.652 15.000 ? 192  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       23.745 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.071  0.200  ? 204  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 974  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.188  0.200  ? 524  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.294  0.200  ? 880  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.142  0.200  ? 79   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.109  0.200  ? 27   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.160  0.200  ? 9    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.442  1.500  ? 856  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.755  2.000  ? 1301 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.797  3.000  ? 534  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.259  4.500  ? 469  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.150 
_refine_ls_shell.d_res_low                        2.204 
_refine_ls_shell.number_reflns_R_work             459 
_refine_ls_shell.R_factor_R_work                  0.277 
_refine_ls_shell.percent_reflns_obs               82.82 
_refine_ls_shell.R_factor_R_free                  0.333 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             28 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1Z0F 
_struct.title                     'GDP-Bound Rab14 GTPase' 
_struct.pdbx_descriptor           'RAB14, member RAS oncogene family' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Z0F 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            'Rab GTPase, Rab14, Vesicular trafficking, Protein transport' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 27  ? LYS A 38  ? GLY A 23  LYS A 34  1 ? 12 
HELX_P HELX_P2 2 GLY A 73  ? PHE A 77  ? GLY A 69  PHE A 73  5 ? 5  
HELX_P HELX_P3 3 ARG A 78  ? GLY A 87  ? ARG A 74  GLY A 83  1 ? 10 
HELX_P HELX_P4 4 ARG A 99  ? HIS A 105 ? ARG A 95  HIS A 101 1 ? 7  
HELX_P HELX_P5 5 HIS A 105 ? THR A 117 ? HIS A 101 THR A 113 1 ? 13 
HELX_P HELX_P6 6 LEU A 132 ? ARG A 136 ? LEU A 128 ARG A 132 5 ? 5  
HELX_P HELX_P7 7 THR A 139 ? ASN A 150 ? THR A 135 ASN A 146 1 ? 12 
HELX_P HELX_P8 8 ASN A 164 ? TYR A 177 ? ASN A 160 TYR A 173 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 70 OD2 ? ? A MG 201 A ASP 66  1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 201 A HOH 257 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 C GDP .  O2B ? ? A MG 201 A GDP 200 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 201 A HOH 205 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 201 A HOH 240 1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 201 A HOH 247 1_555 ? ? ? ? ? ? ? 2.545 ? 
metalc7 metalc ? ? B MG . MG ? ? ? 1_555 A SER 29 OG  ? ? A MG 201 A SER 25  1_555 ? ? ? ? ? ? ? 2.490 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 52  ? VAL A 59  ? PHE A 48  VAL A 55  
A 2 GLN A 62  ? ASP A 70  ? GLN A 58  ASP A 66  
A 3 TYR A 14  ? ILE A 21  ? TYR A 10  ILE A 17  
A 4 GLY A 90  ? ASP A 96  ? GLY A 86  ASP A 92  
A 5 VAL A 122 ? ASN A 128 ? VAL A 118 ASN A 124 
A 6 LEU A 153 ? GLU A 156 ? LEU A 149 GLU A 152 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 55  ? N ARG A 51  O LEU A 66  ? O LEU A 62  
A 2 3 O GLN A 67  ? O GLN A 63  N TYR A 18  ? N TYR A 14  
A 3 4 N ILE A 21  ? N ILE A 17  O VAL A 94  ? O VAL A 90  
A 4 5 N ALA A 91  ? N ALA A 87  O ILE A 124 ? O ILE A 120 
A 5 6 N LEU A 125 ? N LEU A 121 O LEU A 153 ? O LEU A 149 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 201'  
AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE GDP A 200' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  SER A 29  ? SER A 25  . ? 1_555 ? 
2  AC1 7  ASP A 70  ? ASP A 66  . ? 1_555 ? 
3  AC1 7  GDP C .   ? GDP A 200 . ? 1_555 ? 
4  AC1 7  HOH D .   ? HOH A 205 . ? 1_555 ? 
5  AC1 7  HOH D .   ? HOH A 240 . ? 1_555 ? 
6  AC1 7  HOH D .   ? HOH A 247 . ? 1_555 ? 
7  AC1 7  HOH D .   ? HOH A 257 . ? 1_555 ? 
8  AC2 20 GLY A 25  ? GLY A 21  . ? 1_555 ? 
9  AC2 20 VAL A 26  ? VAL A 22  . ? 1_555 ? 
10 AC2 20 GLY A 27  ? GLY A 23  . ? 1_555 ? 
11 AC2 20 LYS A 28  ? LYS A 24  . ? 1_555 ? 
12 AC2 20 SER A 29  ? SER A 25  . ? 1_555 ? 
13 AC2 20 CYS A 30  ? CYS A 26  . ? 1_555 ? 
14 AC2 20 PHE A 40  ? PHE A 36  . ? 1_555 ? 
15 AC2 20 ASP A 70  ? ASP A 66  . ? 1_555 ? 
16 AC2 20 ASN A 128 ? ASN A 124 . ? 1_555 ? 
17 AC2 20 LYS A 129 ? LYS A 125 . ? 1_555 ? 
18 AC2 20 ASP A 131 ? ASP A 127 . ? 1_555 ? 
19 AC2 20 LEU A 132 ? LEU A 128 . ? 1_555 ? 
20 AC2 20 SER A 158 ? SER A 154 . ? 1_555 ? 
21 AC2 20 ALA A 159 ? ALA A 155 . ? 1_555 ? 
22 AC2 20 LYS A 160 ? LYS A 156 . ? 1_555 ? 
23 AC2 20 MG  B .   ? MG  A 201 . ? 1_555 ? 
24 AC2 20 HOH D .   ? HOH A 205 . ? 1_555 ? 
25 AC2 20 HOH D .   ? HOH A 252 . ? 1_555 ? 
26 AC2 20 HOH D .   ? HOH A 253 . ? 1_555 ? 
27 AC2 20 HOH D .   ? HOH A 268 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Z0F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Z0F 
_atom_sites.fract_transf_matrix[1][1]   0.023221 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007745 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024522 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022110 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASN A 1 11  ? 31.948  3.109   17.665  1.00 32.52  ? 7   ASN A N     1 
ATOM   2    C  CA    . ASN A 1 11  ? 32.521  1.729   17.575  1.00 32.43  ? 7   ASN A CA    1 
ATOM   3    C  C     . ASN A 1 11  ? 31.440  0.671   17.350  1.00 31.97  ? 7   ASN A C     1 
ATOM   4    O  O     . ASN A 1 11  ? 30.322  0.797   17.863  1.00 32.01  ? 7   ASN A O     1 
ATOM   5    C  CB    . ASN A 1 11  ? 33.326  1.399   18.834  1.00 32.67  ? 7   ASN A CB    1 
ATOM   6    C  CG    . ASN A 1 11  ? 34.314  0.258   18.623  1.00 33.85  ? 7   ASN A CG    1 
ATOM   7    O  OD1   . ASN A 1 11  ? 34.980  0.175   17.589  1.00 34.97  ? 7   ASN A OD1   1 
ATOM   8    N  ND2   . ASN A 1 11  ? 34.427  -0.619  19.618  1.00 35.27  ? 7   ASN A ND2   1 
ATOM   9    N  N     . TYR A 1 12  ? 31.782  -0.365  16.584  1.00 31.11  ? 8   TYR A N     1 
ATOM   10   C  CA    . TYR A 1 12  ? 30.838  -1.427  16.225  1.00 30.17  ? 8   TYR A CA    1 
ATOM   11   C  C     . TYR A 1 12  ? 31.554  -2.659  15.678  1.00 29.95  ? 8   TYR A C     1 
ATOM   12   O  O     . TYR A 1 12  ? 32.657  -2.559  15.123  1.00 29.87  ? 8   TYR A O     1 
ATOM   13   C  CB    . TYR A 1 12  ? 29.786  -0.921  15.219  1.00 30.00  ? 8   TYR A CB    1 
ATOM   14   C  CG    . TYR A 1 12  ? 30.333  -0.402  13.896  1.00 29.31  ? 8   TYR A CG    1 
ATOM   15   C  CD1   . TYR A 1 12  ? 30.405  -1.231  12.777  1.00 28.99  ? 8   TYR A CD1   1 
ATOM   16   C  CD2   . TYR A 1 12  ? 30.754  0.920   13.759  1.00 29.01  ? 8   TYR A CD2   1 
ATOM   17   C  CE1   . TYR A 1 12  ? 30.892  -0.763  11.563  1.00 28.89  ? 8   TYR A CE1   1 
ATOM   18   C  CE2   . TYR A 1 12  ? 31.246  1.399   12.542  1.00 28.66  ? 8   TYR A CE2   1 
ATOM   19   C  CZ    . TYR A 1 12  ? 31.311  0.552   11.450  1.00 29.26  ? 8   TYR A CZ    1 
ATOM   20   O  OH    . TYR A 1 12  ? 31.792  1.014   10.241  1.00 28.98  ? 8   TYR A OH    1 
ATOM   21   N  N     . SER A 1 13  ? 30.912  -3.815  15.825  1.00 29.48  ? 9   SER A N     1 
ATOM   22   C  CA    . SER A 1 13  ? 31.503  -5.090  15.420  1.00 29.18  ? 9   SER A CA    1 
ATOM   23   C  C     . SER A 1 13  ? 30.875  -5.667  14.156  1.00 28.79  ? 9   SER A C     1 
ATOM   24   O  O     . SER A 1 13  ? 31.456  -6.544  13.518  1.00 28.88  ? 9   SER A O     1 
ATOM   25   C  CB    . SER A 1 13  ? 31.414  -6.101  16.566  1.00 29.26  ? 9   SER A CB    1 
ATOM   26   O  OG    . SER A 1 13  ? 32.132  -5.638  17.698  1.00 29.97  ? 9   SER A OG    1 
ATOM   27   N  N     . TYR A 1 14  ? 29.689  -5.176  13.799  1.00 28.36  ? 10  TYR A N     1 
ATOM   28   C  CA    . TYR A 1 14  ? 28.977  -5.651  12.611  1.00 27.70  ? 10  TYR A CA    1 
ATOM   29   C  C     . TYR A 1 14  ? 28.179  -4.539  11.925  1.00 27.11  ? 10  TYR A C     1 
ATOM   30   O  O     . TYR A 1 14  ? 27.913  -3.493  12.524  1.00 27.03  ? 10  TYR A O     1 
ATOM   31   C  CB    . TYR A 1 14  ? 28.070  -6.843  12.967  1.00 27.95  ? 10  TYR A CB    1 
ATOM   32   N  N     . ILE A 1 15  ? 27.817  -4.778  10.664  1.00 26.60  ? 11  ILE A N     1 
ATOM   33   C  CA    . ILE A 1 15  ? 27.035  -3.841  9.848   1.00 26.04  ? 11  ILE A CA    1 
ATOM   34   C  C     . ILE A 1 15  ? 25.781  -4.546  9.305   1.00 25.77  ? 11  ILE A C     1 
ATOM   35   O  O     . ILE A 1 15  ? 25.886  -5.586  8.650   1.00 25.72  ? 11  ILE A O     1 
ATOM   36   C  CB    . ILE A 1 15  ? 27.882  -3.284  8.662   1.00 26.04  ? 11  ILE A CB    1 
ATOM   37   C  CG1   . ILE A 1 15  ? 29.041  -2.426  9.183   1.00 26.12  ? 11  ILE A CG1   1 
ATOM   38   C  CG2   . ILE A 1 15  ? 27.018  -2.478  7.691   1.00 25.64  ? 11  ILE A CG2   1 
ATOM   39   C  CD1   . ILE A 1 15  ? 30.180  -2.207  8.188   1.00 25.99  ? 11  ILE A CD1   1 
ATOM   40   N  N     . PHE A 1 16  ? 24.604  -3.988  9.594   1.00 25.16  ? 12  PHE A N     1 
ATOM   41   C  CA    . PHE A 1 16  ? 23.338  -4.512  9.067   1.00 24.55  ? 12  PHE A CA    1 
ATOM   42   C  C     . PHE A 1 16  ? 22.758  -3.528  8.045   1.00 24.08  ? 12  PHE A C     1 
ATOM   43   O  O     . PHE A 1 16  ? 22.535  -2.354  8.358   1.00 23.57  ? 12  PHE A O     1 
ATOM   44   C  CB    . PHE A 1 16  ? 22.313  -4.737  10.194  1.00 24.67  ? 12  PHE A CB    1 
ATOM   45   C  CG    . PHE A 1 16  ? 22.639  -5.883  11.143  1.00 24.90  ? 12  PHE A CG    1 
ATOM   46   C  CD1   . PHE A 1 16  ? 21.749  -6.202  12.176  1.00 25.38  ? 12  PHE A CD1   1 
ATOM   47   C  CD2   . PHE A 1 16  ? 23.796  -6.650  11.008  1.00 24.87  ? 12  PHE A CD2   1 
ATOM   48   C  CE1   . PHE A 1 16  ? 22.018  -7.251  13.069  1.00 25.00  ? 12  PHE A CE1   1 
ATOM   49   C  CE2   . PHE A 1 16  ? 24.073  -7.702  11.890  1.00 25.50  ? 12  PHE A CE2   1 
ATOM   50   C  CZ    . PHE A 1 16  ? 23.182  -8.002  12.926  1.00 24.99  ? 12  PHE A CZ    1 
ATOM   51   N  N     . LYS A 1 17  ? 22.520  -4.008  6.826   1.00 23.68  ? 13  LYS A N     1 
ATOM   52   C  CA    . LYS A 1 17  ? 21.854  -3.207  5.795   1.00 23.50  ? 13  LYS A CA    1 
ATOM   53   C  C     . LYS A 1 17  ? 20.333  -3.391  5.839   1.00 23.00  ? 13  LYS A C     1 
ATOM   54   O  O     . LYS A 1 17  ? 19.832  -4.518  5.774   1.00 22.85  ? 13  LYS A O     1 
ATOM   55   C  CB    . LYS A 1 17  ? 22.379  -3.565  4.398   1.00 23.77  ? 13  LYS A CB    1 
ATOM   56   C  CG    . LYS A 1 17  ? 23.828  -3.204  4.142   1.00 24.61  ? 13  LYS A CG    1 
ATOM   57   C  CD    . LYS A 1 17  ? 24.200  -3.489  2.694   1.00 26.86  ? 13  LYS A CD    1 
ATOM   58   C  CE    . LYS A 1 17  ? 25.610  -3.009  2.382   1.00 28.41  ? 13  LYS A CE    1 
ATOM   59   N  NZ    . LYS A 1 17  ? 25.788  -2.775  0.918   1.00 30.28  ? 13  LYS A NZ    1 
ATOM   60   N  N     . TYR A 1 18  ? 19.612  -2.278  5.947   1.00 22.50  ? 14  TYR A N     1 
ATOM   61   C  CA    . TYR A 1 18  ? 18.143  -2.278  5.918   1.00 22.23  ? 14  TYR A CA    1 
ATOM   62   C  C     . TYR A 1 18  ? 17.614  -1.557  4.677   1.00 21.53  ? 14  TYR A C     1 
ATOM   63   O  O     . TYR A 1 18  ? 18.139  -0.513  4.284   1.00 20.85  ? 14  TYR A O     1 
ATOM   64   C  CB    . TYR A 1 18  ? 17.563  -1.565  7.150   1.00 22.70  ? 14  TYR A CB    1 
ATOM   65   C  CG    . TYR A 1 18  ? 17.517  -2.340  8.461   1.00 23.42  ? 14  TYR A CG    1 
ATOM   66   C  CD1   . TYR A 1 18  ? 16.422  -2.210  9.316   1.00 24.39  ? 14  TYR A CD1   1 
ATOM   67   C  CD2   . TYR A 1 18  ? 18.566  -3.167  8.863   1.00 23.75  ? 14  TYR A CD2   1 
ATOM   68   C  CE1   . TYR A 1 18  ? 16.363  -2.891  10.530  1.00 24.29  ? 14  TYR A CE1   1 
ATOM   69   C  CE2   . TYR A 1 18  ? 18.514  -3.858  10.079  1.00 24.03  ? 14  TYR A CE2   1 
ATOM   70   C  CZ    . TYR A 1 18  ? 17.409  -3.711  10.904  1.00 23.93  ? 14  TYR A CZ    1 
ATOM   71   O  OH    . TYR A 1 18  ? 17.341  -4.380  12.109  1.00 24.43  ? 14  TYR A OH    1 
ATOM   72   N  N     . ILE A 1 19  ? 16.569  -2.118  4.073   1.00 20.91  ? 15  ILE A N     1 
ATOM   73   C  CA    . ILE A 1 19  ? 15.744  -1.367  3.129   1.00 20.49  ? 15  ILE A CA    1 
ATOM   74   C  C     . ILE A 1 19  ? 14.397  -1.052  3.770   1.00 20.27  ? 15  ILE A C     1 
ATOM   75   O  O     . ILE A 1 19  ? 13.953  -1.745  4.693   1.00 19.97  ? 15  ILE A O     1 
ATOM   76   C  CB    . ILE A 1 19  ? 15.538  -2.093  1.767   1.00 20.55  ? 15  ILE A CB    1 
ATOM   77   C  CG1   . ILE A 1 19  ? 14.841  -3.450  1.956   1.00 20.04  ? 15  ILE A CG1   1 
ATOM   78   C  CG2   . ILE A 1 19  ? 16.867  -2.224  1.035   1.00 20.63  ? 15  ILE A CG2   1 
ATOM   79   C  CD1   . ILE A 1 19  ? 14.328  -4.089  0.658   1.00 20.52  ? 15  ILE A CD1   1 
ATOM   80   N  N     . ILE A 1 20  ? 13.771  0.016   3.291   1.00 19.97  ? 16  ILE A N     1 
ATOM   81   C  CA    . ILE A 1 20  ? 12.425  0.369   3.707   1.00 20.01  ? 16  ILE A CA    1 
ATOM   82   C  C     . ILE A 1 20  ? 11.602  0.682   2.459   1.00 19.71  ? 16  ILE A C     1 
ATOM   83   O  O     . ILE A 1 20  ? 11.992  1.519   1.639   1.00 19.48  ? 16  ILE A O     1 
ATOM   84   C  CB    . ILE A 1 20  ? 12.417  1.504   4.771   1.00 20.10  ? 16  ILE A CB    1 
ATOM   85   C  CG1   . ILE A 1 20  ? 10.984  1.892   5.154   1.00 20.07  ? 16  ILE A CG1   1 
ATOM   86   C  CG2   . ILE A 1 20  ? 13.239  2.700   4.312   1.00 20.70  ? 16  ILE A CG2   1 
ATOM   87   C  CD1   . ILE A 1 20  ? 10.879  2.587   6.519   1.00 20.43  ? 16  ILE A CD1   1 
ATOM   88   N  N     . ILE A 1 21  ? 10.487  -0.037  2.315   1.00 19.49  ? 17  ILE A N     1 
ATOM   89   C  CA    . ILE A 1 21  ? 9.691   -0.033  1.089   1.00 19.22  ? 17  ILE A CA    1 
ATOM   90   C  C     . ILE A 1 21  ? 8.194   0.051   1.389   1.00 19.34  ? 17  ILE A C     1 
ATOM   91   O  O     . ILE A 1 21  ? 7.757   -0.192  2.524   1.00 19.13  ? 17  ILE A O     1 
ATOM   92   C  CB    . ILE A 1 21  ? 9.990   -1.278  0.199   1.00 19.48  ? 17  ILE A CB    1 
ATOM   93   C  CG1   . ILE A 1 21  ? 9.573   -2.577  0.910   1.00 19.27  ? 17  ILE A CG1   1 
ATOM   94   C  CG2   . ILE A 1 21  ? 11.470  -1.306  -0.210  1.00 19.19  ? 17  ILE A CG2   1 
ATOM   95   C  CD1   . ILE A 1 21  ? 9.681   -3.830  0.059   1.00 19.02  ? 17  ILE A CD1   1 
ATOM   96   N  N     . GLY A 1 22  ? 7.421   0.402   0.362   1.00 19.15  ? 18  GLY A N     1 
ATOM   97   C  CA    . GLY A 1 22  ? 5.986   0.620   0.493   1.00 19.29  ? 18  GLY A CA    1 
ATOM   98   C  C     . GLY A 1 22  ? 5.515   1.782   -0.362  1.00 19.53  ? 18  GLY A C     1 
ATOM   99   O  O     . GLY A 1 22  ? 6.331   2.514   -0.932  1.00 19.62  ? 18  GLY A O     1 
ATOM   100  N  N     . ASP A 1 23  ? 4.194   1.946   -0.443  1.00 19.40  ? 19  ASP A N     1 
ATOM   101  C  CA    . ASP A 1 23  ? 3.561   2.993   -1.240  1.00 19.53  ? 19  ASP A CA    1 
ATOM   102  C  C     . ASP A 1 23  ? 4.017   4.400   -0.859  1.00 19.70  ? 19  ASP A C     1 
ATOM   103  O  O     . ASP A 1 23  ? 4.459   4.641   0.272   1.00 19.55  ? 19  ASP A O     1 
ATOM   104  C  CB    . ASP A 1 23  ? 2.035   2.893   -1.127  1.00 19.52  ? 19  ASP A CB    1 
ATOM   105  C  CG    . ASP A 1 23  ? 1.438   1.795   -2.012  1.00 19.58  ? 19  ASP A CG    1 
ATOM   106  O  OD1   . ASP A 1 23  ? 2.176   0.905   -2.499  1.00 19.21  ? 19  ASP A OD1   1 
ATOM   107  O  OD2   . ASP A 1 23  ? 0.211   1.831   -2.215  1.00 19.08  ? 19  ASP A OD2   1 
ATOM   108  N  N     . MET A 1 24  ? 3.911   5.316   -1.820  1.00 19.82  ? 20  MET A N     1 
ATOM   109  C  CA    . MET A 1 24  ? 4.265   6.723   -1.630  1.00 20.30  ? 20  MET A CA    1 
ATOM   110  C  C     . MET A 1 24  ? 3.408   7.349   -0.532  1.00 20.12  ? 20  MET A C     1 
ATOM   111  O  O     . MET A 1 24  ? 2.185   7.154   -0.501  1.00 20.21  ? 20  MET A O     1 
ATOM   112  C  CB    . MET A 1 24  ? 4.075   7.507   -2.938  1.00 20.02  ? 20  MET A CB    1 
ATOM   113  C  CG    . MET A 1 24  ? 4.933   7.030   -4.119  1.00 20.15  ? 20  MET A CG    1 
ATOM   114  S  SD    . MET A 1 24  ? 4.446   7.771   -5.703  1.00 21.56  ? 20  MET A SD    1 
ATOM   115  C  CE    . MET A 1 24  ? 5.115   9.425   -5.543  1.00 21.70  ? 20  MET A CE    1 
ATOM   116  N  N     . GLY A 1 25  ? 4.055   8.084   0.368   1.00 19.99  ? 21  GLY A N     1 
ATOM   117  C  CA    . GLY A 1 25  ? 3.360   8.804   1.438   1.00 19.73  ? 21  GLY A CA    1 
ATOM   118  C  C     . GLY A 1 25  ? 2.977   8.032   2.699   1.00 19.66  ? 21  GLY A C     1 
ATOM   119  O  O     . GLY A 1 25  ? 2.258   8.567   3.551   1.00 19.75  ? 21  GLY A O     1 
ATOM   120  N  N     . VAL A 1 26  ? 3.445   6.790   2.837   1.00 19.43  ? 22  VAL A N     1 
ATOM   121  C  CA    . VAL A 1 26  ? 3.112   5.981   4.026   1.00 19.20  ? 22  VAL A CA    1 
ATOM   122  C  C     . VAL A 1 26  ? 3.924   6.374   5.278   1.00 19.26  ? 22  VAL A C     1 
ATOM   123  O  O     . VAL A 1 26  ? 3.549   6.028   6.409   1.00 19.05  ? 22  VAL A O     1 
ATOM   124  C  CB    . VAL A 1 26  ? 3.228   4.442   3.771   1.00 19.23  ? 22  VAL A CB    1 
ATOM   125  C  CG1   . VAL A 1 26  ? 2.271   3.991   2.673   1.00 19.29  ? 22  VAL A CG1   1 
ATOM   126  C  CG2   . VAL A 1 26  ? 4.661   4.036   3.436   1.00 18.91  ? 22  VAL A CG2   1 
ATOM   127  N  N     . GLY A 1 27  ? 5.035   7.081   5.070   1.00 19.11  ? 23  GLY A N     1 
ATOM   128  C  CA    . GLY A 1 27  ? 5.874   7.548   6.179   1.00 19.36  ? 23  GLY A CA    1 
ATOM   129  C  C     . GLY A 1 27  ? 7.258   6.925   6.280   1.00 19.45  ? 23  GLY A C     1 
ATOM   130  O  O     . GLY A 1 27  ? 7.855   6.917   7.361   1.00 18.78  ? 23  GLY A O     1 
ATOM   131  N  N     . LYS A 1 28  ? 7.781   6.420   5.159   1.00 19.66  ? 24  LYS A N     1 
ATOM   132  C  CA    . LYS A 1 28  ? 9.104   5.764   5.147   1.00 20.03  ? 24  LYS A CA    1 
ATOM   133  C  C     . LYS A 1 28  ? 10.241  6.725   5.532   1.00 20.60  ? 24  LYS A C     1 
ATOM   134  O  O     . LYS A 1 28  ? 11.102  6.380   6.341   1.00 20.60  ? 24  LYS A O     1 
ATOM   135  C  CB    . LYS A 1 28  ? 9.395   5.101   3.790   1.00 20.00  ? 24  LYS A CB    1 
ATOM   136  C  CG    . LYS A 1 28  ? 8.304   4.144   3.286   1.00 19.41  ? 24  LYS A CG    1 
ATOM   137  C  CD    . LYS A 1 28  ? 8.652   3.492   1.940   1.00 19.55  ? 24  LYS A CD    1 
ATOM   138  C  CE    . LYS A 1 28  ? 8.726   4.490   0.772   1.00 18.42  ? 24  LYS A CE    1 
ATOM   139  N  NZ    . LYS A 1 28  ? 7.402   5.084   0.421   1.00 17.18  ? 24  LYS A NZ    1 
ATOM   140  N  N     . SER A 1 29  ? 10.233  7.929   4.963   1.00 21.28  ? 25  SER A N     1 
ATOM   141  C  CA    . SER A 1 29  ? 11.245  8.947   5.277   1.00 22.14  ? 25  SER A CA    1 
ATOM   142  C  C     . SER A 1 29  ? 11.162  9.405   6.733   1.00 22.67  ? 25  SER A C     1 
ATOM   143  O  O     . SER A 1 29  ? 12.185  9.607   7.381   1.00 22.43  ? 25  SER A O     1 
ATOM   144  C  CB    . SER A 1 29  ? 11.119  10.152  4.341   1.00 22.10  ? 25  SER A CB    1 
ATOM   145  O  OG    . SER A 1 29  ? 11.582  9.833   3.040   1.00 22.66  ? 25  SER A OG    1 
ATOM   146  N  N     . CYS A 1 30  ? 9.939   9.555   7.237   1.00 23.45  ? 26  CYS A N     1 
ATOM   147  C  CA    . CYS A 1 30  ? 9.717   9.956   8.622   1.00 24.55  ? 26  CYS A CA    1 
ATOM   148  C  C     . CYS A 1 30  ? 10.124  8.896   9.644   1.00 24.92  ? 26  CYS A C     1 
ATOM   149  O  O     . CYS A 1 30  ? 10.699  9.227   10.682  1.00 25.07  ? 26  CYS A O     1 
ATOM   150  C  CB    . CYS A 1 30  ? 8.270   10.403  8.832   1.00 24.58  ? 26  CYS A CB    1 
ATOM   151  S  SG    . CYS A 1 30  ? 7.934   12.025  8.127   1.00 26.06  ? 26  CYS A SG    1 
ATOM   152  N  N     . LEU A 1 31  ? 9.836   7.631   9.343   1.00 25.58  ? 27  LEU A N     1 
ATOM   153  C  CA    . LEU A 1 31  ? 10.251  6.512   10.194  1.00 26.30  ? 27  LEU A CA    1 
ATOM   154  C  C     . LEU A 1 31  ? 11.774  6.419   10.313  1.00 26.97  ? 27  LEU A C     1 
ATOM   155  O  O     . LEU A 1 31  ? 12.306  6.224   11.407  1.00 26.72  ? 27  LEU A O     1 
ATOM   156  C  CB    . LEU A 1 31  ? 9.682   5.187   9.672   1.00 26.02  ? 27  LEU A CB    1 
ATOM   157  C  CG    . LEU A 1 31  ? 8.226   4.828   9.997   1.00 26.05  ? 27  LEU A CG    1 
ATOM   158  C  CD1   . LEU A 1 31  ? 7.784   3.632   9.180   1.00 25.08  ? 27  LEU A CD1   1 
ATOM   159  C  CD2   . LEU A 1 31  ? 8.024   4.547   11.486  1.00 25.64  ? 27  LEU A CD2   1 
ATOM   160  N  N     . LEU A 1 32  ? 12.458  6.553   9.175   1.00 27.95  ? 28  LEU A N     1 
ATOM   161  C  CA    . LEU A 1 32  ? 13.920  6.567   9.109   1.00 28.72  ? 28  LEU A CA    1 
ATOM   162  C  C     . LEU A 1 32  ? 14.493  7.743   9.906   1.00 29.42  ? 28  LEU A C     1 
ATOM   163  O  O     . LEU A 1 32  ? 15.423  7.561   10.691  1.00 29.21  ? 28  LEU A O     1 
ATOM   164  C  CB    . LEU A 1 32  ? 14.386  6.571   7.637   1.00 28.63  ? 28  LEU A CB    1 
ATOM   165  C  CG    . LEU A 1 32  ? 15.759  7.005   7.093   1.00 28.51  ? 28  LEU A CG    1 
ATOM   166  C  CD1   . LEU A 1 32  ? 16.936  6.571   7.944   1.00 29.18  ? 28  LEU A CD1   1 
ATOM   167  C  CD2   . LEU A 1 32  ? 15.934  6.489   5.666   1.00 28.85  ? 28  LEU A CD2   1 
ATOM   168  N  N     . HIS A 1 33  ? 13.912  8.927   9.722   1.00 30.43  ? 29  HIS A N     1 
ATOM   169  C  CA    . HIS A 1 33  ? 14.361  10.145  10.411  1.00 31.82  ? 29  HIS A CA    1 
ATOM   170  C  C     . HIS A 1 33  ? 14.147  10.104  11.931  1.00 32.19  ? 29  HIS A C     1 
ATOM   171  O  O     . HIS A 1 33  ? 15.039  10.489  12.693  1.00 32.25  ? 29  HIS A O     1 
ATOM   172  C  CB    . HIS A 1 33  ? 13.691  11.389  9.818   1.00 31.92  ? 29  HIS A CB    1 
ATOM   173  C  CG    . HIS A 1 33  ? 14.340  12.673  10.227  1.00 33.52  ? 29  HIS A CG    1 
ATOM   174  N  ND1   . HIS A 1 33  ? 15.358  13.256  9.501   1.00 35.11  ? 29  HIS A ND1   1 
ATOM   175  C  CD2   . HIS A 1 33  ? 14.125  13.484  11.290  1.00 34.54  ? 29  HIS A CD2   1 
ATOM   176  C  CE1   . HIS A 1 33  ? 15.738  14.373  10.096  1.00 35.06  ? 29  HIS A CE1   1 
ATOM   177  N  NE2   . HIS A 1 33  ? 15.007  14.533  11.185  1.00 35.43  ? 29  HIS A NE2   1 
ATOM   178  N  N     . GLN A 1 34  ? 12.971  9.642   12.360  1.00 32.71  ? 30  GLN A N     1 
ATOM   179  C  CA    . GLN A 1 34  ? 12.659  9.485   13.784  1.00 33.36  ? 30  GLN A CA    1 
ATOM   180  C  C     . GLN A 1 34  ? 13.669  8.575   14.491  1.00 33.96  ? 30  GLN A C     1 
ATOM   181  O  O     . GLN A 1 34  ? 14.076  8.854   15.616  1.00 33.93  ? 30  GLN A O     1 
ATOM   182  C  CB    . GLN A 1 34  ? 11.225  8.966   13.971  1.00 33.19  ? 30  GLN A CB    1 
ATOM   183  C  CG    . GLN A 1 34  ? 10.825  8.598   15.415  1.00 33.58  ? 30  GLN A CG    1 
ATOM   184  C  CD    . GLN A 1 34  ? 10.720  9.803   16.352  1.00 34.03  ? 30  GLN A CD    1 
ATOM   185  O  OE1   . GLN A 1 34  ? 11.438  9.886   17.350  1.00 33.98  ? 30  GLN A OE1   1 
ATOM   186  N  NE2   . GLN A 1 34  ? 9.824   10.734  16.034  1.00 33.41  ? 30  GLN A NE2   1 
ATOM   187  N  N     . PHE A 1 35  ? 14.074  7.495   13.824  1.00 34.70  ? 31  PHE A N     1 
ATOM   188  C  CA    . PHE A 1 35  ? 15.034  6.554   14.402  1.00 35.53  ? 31  PHE A CA    1 
ATOM   189  C  C     . PHE A 1 35  ? 16.472  7.087   14.461  1.00 36.28  ? 31  PHE A C     1 
ATOM   190  O  O     . PHE A 1 35  ? 17.131  6.958   15.492  1.00 36.52  ? 31  PHE A O     1 
ATOM   191  C  CB    . PHE A 1 35  ? 14.993  5.200   13.680  1.00 35.43  ? 31  PHE A CB    1 
ATOM   192  C  CG    . PHE A 1 35  ? 15.870  4.152   14.314  1.00 35.30  ? 31  PHE A CG    1 
ATOM   193  C  CD1   . PHE A 1 35  ? 15.529  3.590   15.543  1.00 34.60  ? 31  PHE A CD1   1 
ATOM   194  C  CD2   . PHE A 1 35  ? 17.043  3.735   13.690  1.00 35.12  ? 31  PHE A CD2   1 
ATOM   195  C  CE1   . PHE A 1 35  ? 16.337  2.628   16.137  1.00 34.72  ? 31  PHE A CE1   1 
ATOM   196  C  CE2   . PHE A 1 35  ? 17.860  2.770   14.279  1.00 34.78  ? 31  PHE A CE2   1 
ATOM   197  C  CZ    . PHE A 1 35  ? 17.505  2.218   15.504  1.00 34.84  ? 31  PHE A CZ    1 
ATOM   198  N  N     . THR A 1 36  ? 16.951  7.685   13.371  1.00 37.17  ? 32  THR A N     1 
ATOM   199  C  CA    . THR A 1 36  ? 18.343  8.153   13.299  1.00 38.11  ? 32  THR A CA    1 
ATOM   200  C  C     . THR A 1 36  ? 18.597  9.487   14.007  1.00 38.90  ? 32  THR A C     1 
ATOM   201  O  O     . THR A 1 36  ? 19.689  9.709   14.532  1.00 39.18  ? 32  THR A O     1 
ATOM   202  C  CB    . THR A 1 36  ? 18.854  8.272   11.842  1.00 37.99  ? 32  THR A CB    1 
ATOM   203  O  OG1   . THR A 1 36  ? 18.027  9.185   11.112  1.00 37.97  ? 32  THR A OG1   1 
ATOM   204  C  CG2   . THR A 1 36  ? 18.867  6.918   11.151  1.00 37.84  ? 32  THR A CG2   1 
ATOM   205  N  N     . GLU A 1 37  ? 17.599  10.368  14.009  1.00 39.78  ? 33  GLU A N     1 
ATOM   206  C  CA    . GLU A 1 37  ? 17.750  11.714  14.567  1.00 40.67  ? 33  GLU A CA    1 
ATOM   207  C  C     . GLU A 1 37  ? 16.865  11.983  15.795  1.00 41.33  ? 33  GLU A C     1 
ATOM   208  O  O     . GLU A 1 37  ? 16.973  13.041  16.417  1.00 41.55  ? 33  GLU A O     1 
ATOM   209  C  CB    . GLU A 1 37  ? 17.501  12.761  13.486  1.00 40.62  ? 33  GLU A CB    1 
ATOM   210  N  N     . LYS A 1 38  ? 15.996  11.024  16.124  1.00 42.07  ? 34  LYS A N     1 
ATOM   211  C  CA    . LYS A 1 38  ? 15.115  11.073  17.307  1.00 42.85  ? 34  LYS A CA    1 
ATOM   212  C  C     . LYS A 1 38  ? 14.108  12.235  17.334  1.00 43.49  ? 34  LYS A C     1 
ATOM   213  O  O     . LYS A 1 38  ? 13.645  12.644  18.405  1.00 43.55  ? 34  LYS A O     1 
ATOM   214  C  CB    . LYS A 1 38  ? 15.934  11.003  18.614  1.00 42.77  ? 34  LYS A CB    1 
ATOM   215  N  N     . LYS A 1 39  ? 13.758  12.747  16.153  1.00 44.23  ? 35  LYS A N     1 
ATOM   216  C  CA    . LYS A 1 39  ? 12.807  13.854  16.036  1.00 45.00  ? 35  LYS A CA    1 
ATOM   217  C  C     . LYS A 1 39  ? 11.890  13.749  14.812  1.00 45.61  ? 35  LYS A C     1 
ATOM   218  O  O     . LYS A 1 39  ? 12.273  13.202  13.774  1.00 45.51  ? 35  LYS A O     1 
ATOM   219  C  CB    . LYS A 1 39  ? 13.548  15.194  16.036  1.00 45.04  ? 35  LYS A CB    1 
ATOM   220  N  N     . PHE A 1 40  ? 10.671  14.265  14.963  1.00 46.38  ? 36  PHE A N     1 
ATOM   221  C  CA    . PHE A 1 40  ? 9.739   14.451  13.854  1.00 47.24  ? 36  PHE A CA    1 
ATOM   222  C  C     . PHE A 1 40  ? 9.743   15.929  13.488  1.00 47.86  ? 36  PHE A C     1 
ATOM   223  O  O     . PHE A 1 40  ? 9.612   16.790  14.364  1.00 47.84  ? 36  PHE A O     1 
ATOM   224  C  CB    . PHE A 1 40  ? 8.328   13.996  14.242  1.00 47.18  ? 36  PHE A CB    1 
ATOM   225  C  CG    . PHE A 1 40  ? 7.323   14.067  13.115  1.00 47.44  ? 36  PHE A CG    1 
ATOM   226  C  CD1   . PHE A 1 40  ? 7.266   13.065  12.145  1.00 47.66  ? 36  PHE A CD1   1 
ATOM   227  C  CD2   . PHE A 1 40  ? 6.421   15.123  13.035  1.00 47.51  ? 36  PHE A CD2   1 
ATOM   228  C  CE1   . PHE A 1 40  ? 6.328   13.122  11.108  1.00 47.36  ? 36  PHE A CE1   1 
ATOM   229  C  CE2   . PHE A 1 40  ? 5.482   15.189  12.000  1.00 47.52  ? 36  PHE A CE2   1 
ATOM   230  C  CZ    . PHE A 1 40  ? 5.438   14.185  11.036  1.00 47.25  ? 36  PHE A CZ    1 
ATOM   231  N  N     . MET A 1 41  ? 9.889   16.215  12.196  1.00 48.62  ? 37  MET A N     1 
ATOM   232  C  CA    . MET A 1 41  ? 10.109  17.585  11.727  1.00 49.43  ? 37  MET A CA    1 
ATOM   233  C  C     . MET A 1 41  ? 8.942   18.542  11.992  1.00 49.59  ? 37  MET A C     1 
ATOM   234  O  O     . MET A 1 41  ? 9.020   19.369  12.907  1.00 49.79  ? 37  MET A O     1 
ATOM   235  C  CB    . MET A 1 41  ? 10.522  17.603  10.249  1.00 49.84  ? 37  MET A CB    1 
ATOM   236  C  CG    . MET A 1 41  ? 11.990  17.257  10.006  1.00 50.61  ? 37  MET A CG    1 
ATOM   237  S  SD    . MET A 1 41  ? 13.138  18.277  10.966  1.00 53.17  ? 37  MET A SD    1 
ATOM   238  C  CE    . MET A 1 41  ? 14.516  18.417  9.822   1.00 51.21  ? 37  MET A CE    1 
ATOM   239  N  N     . ALA A 1 42  ? 7.877   18.428  11.194  1.00 49.57  ? 38  ALA A N     1 
ATOM   240  C  CA    . ALA A 1 42  ? 6.688   19.298  11.292  1.00 49.45  ? 38  ALA A CA    1 
ATOM   241  C  C     . ALA A 1 42  ? 6.928   20.769  10.901  1.00 49.26  ? 38  ALA A C     1 
ATOM   242  O  O     . ALA A 1 42  ? 5.983   21.486  10.553  1.00 49.46  ? 38  ALA A O     1 
ATOM   243  C  CB    . ALA A 1 42  ? 6.038   19.197  12.686  1.00 49.51  ? 38  ALA A CB    1 
ATOM   244  N  N     . ASP A 1 43  ? 8.182   21.211  10.961  1.00 48.81  ? 39  ASP A N     1 
ATOM   245  C  CA    . ASP A 1 43  ? 8.550   22.564  10.550  1.00 48.28  ? 39  ASP A CA    1 
ATOM   246  C  C     . ASP A 1 43  ? 9.245   22.576  9.185   1.00 47.84  ? 39  ASP A C     1 
ATOM   247  O  O     . ASP A 1 43  ? 9.671   23.635  8.707   1.00 47.96  ? 39  ASP A O     1 
ATOM   248  C  CB    . ASP A 1 43  ? 9.431   23.228  11.613  1.00 48.43  ? 39  ASP A CB    1 
ATOM   249  N  N     . CYS A 1 44  ? 9.348   21.402  8.559   1.00 47.02  ? 40  CYS A N     1 
ATOM   250  C  CA    . CYS A 1 44  ? 10.015  21.273  7.261   1.00 46.37  ? 40  CYS A CA    1 
ATOM   251  C  C     . CYS A 1 44  ? 9.205   20.485  6.226   1.00 45.44  ? 40  CYS A C     1 
ATOM   252  O  O     . CYS A 1 44  ? 9.665   19.444  5.751   1.00 45.52  ? 40  CYS A O     1 
ATOM   253  C  CB    . CYS A 1 44  ? 11.397  20.637  7.434   1.00 46.51  ? 40  CYS A CB    1 
ATOM   254  S  SG    . CYS A 1 44  ? 12.594  21.686  8.258   1.00 47.83  ? 40  CYS A SG    1 
ATOM   255  N  N     . PRO A 1 45  ? 8.005   20.978  5.858   1.00 44.52  ? 41  PRO A N     1 
ATOM   256  C  CA    . PRO A 1 45  ? 7.225   20.215  4.882   1.00 43.72  ? 41  PRO A CA    1 
ATOM   257  C  C     . PRO A 1 45  ? 7.665   20.431  3.426   1.00 42.90  ? 41  PRO A C     1 
ATOM   258  O  O     . PRO A 1 45  ? 7.186   19.729  2.536   1.00 42.88  ? 41  PRO A O     1 
ATOM   259  C  CB    . PRO A 1 45  ? 5.800   20.727  5.105   1.00 43.82  ? 41  PRO A CB    1 
ATOM   260  C  CG    . PRO A 1 45  ? 5.971   22.125  5.590   1.00 44.00  ? 41  PRO A CG    1 
ATOM   261  C  CD    . PRO A 1 45  ? 7.304   22.205  6.290   1.00 44.40  ? 41  PRO A CD    1 
ATOM   262  N  N     . HIS A 1 46  ? 8.579   21.374  3.199   1.00 41.89  ? 42  HIS A N     1 
ATOM   263  C  CA    . HIS A 1 46  ? 8.994   21.777  1.849   1.00 41.01  ? 42  HIS A CA    1 
ATOM   264  C  C     . HIS A 1 46  ? 10.096  20.911  1.226   1.00 40.23  ? 42  HIS A C     1 
ATOM   265  O  O     . HIS A 1 46  ? 10.360  21.011  0.023   1.00 40.16  ? 42  HIS A O     1 
ATOM   266  C  CB    . HIS A 1 46  ? 9.442   23.242  1.855   1.00 41.12  ? 42  HIS A CB    1 
ATOM   267  C  CG    . HIS A 1 46  ? 10.565  23.520  2.804   1.00 41.71  ? 42  HIS A CG    1 
ATOM   268  N  ND1   . HIS A 1 46  ? 10.360  23.803  4.138   1.00 41.99  ? 42  HIS A ND1   1 
ATOM   269  C  CD2   . HIS A 1 46  ? 11.906  23.545  2.616   1.00 41.94  ? 42  HIS A CD2   1 
ATOM   270  C  CE1   . HIS A 1 46  ? 11.526  23.997  4.729   1.00 42.14  ? 42  HIS A CE1   1 
ATOM   271  N  NE2   . HIS A 1 46  ? 12.480  23.844  3.828   1.00 42.30  ? 42  HIS A NE2   1 
ATOM   272  N  N     . THR A 1 47  ? 10.745  20.078  2.037   1.00 39.19  ? 43  THR A N     1 
ATOM   273  C  CA    . THR A 1 47  ? 11.839  19.224  1.553   1.00 38.00  ? 43  THR A CA    1 
ATOM   274  C  C     . THR A 1 47  ? 11.327  17.899  0.991   1.00 37.20  ? 43  THR A C     1 
ATOM   275  O  O     . THR A 1 47  ? 10.204  17.482  1.292   1.00 37.05  ? 43  THR A O     1 
ATOM   276  C  CB    . THR A 1 47  ? 12.896  18.956  2.654   1.00 38.13  ? 43  THR A CB    1 
ATOM   277  O  OG1   . THR A 1 47  ? 12.250  18.504  3.849   1.00 37.78  ? 43  THR A OG1   1 
ATOM   278  C  CG2   . THR A 1 47  ? 13.685  20.222  2.958   1.00 38.17  ? 43  THR A CG2   1 
ATOM   279  N  N     . ILE A 1 48  ? 12.154  17.245  0.175   1.00 36.14  ? 44  ILE A N     1 
ATOM   280  C  CA    . ILE A 1 48  ? 11.789  15.972  -0.455  1.00 35.31  ? 44  ILE A CA    1 
ATOM   281  C  C     . ILE A 1 48  ? 11.534  14.837  0.550   1.00 34.50  ? 44  ILE A C     1 
ATOM   282  O  O     . ILE A 1 48  ? 10.569  14.074  0.396   1.00 34.87  ? 44  ILE A O     1 
ATOM   283  C  CB    . ILE A 1 48  ? 12.812  15.552  -1.553  1.00 35.38  ? 44  ILE A CB    1 
ATOM   284  C  CG1   . ILE A 1 48  ? 12.548  16.356  -2.835  1.00 35.57  ? 44  ILE A CG1   1 
ATOM   285  C  CG2   . ILE A 1 48  ? 12.741  14.039  -1.835  1.00 35.32  ? 44  ILE A CG2   1 
ATOM   286  C  CD1   . ILE A 1 48  ? 13.516  16.089  -3.979  1.00 35.65  ? 44  ILE A CD1   1 
ATOM   287  N  N     . GLY A 1 49  ? 12.379  14.737  1.574   1.00 33.23  ? 45  GLY A N     1 
ATOM   288  C  CA    . GLY A 1 49  ? 12.272  13.654  2.554   1.00 31.65  ? 45  GLY A CA    1 
ATOM   289  C  C     . GLY A 1 49  ? 13.505  12.770  2.515   1.00 30.58  ? 45  GLY A C     1 
ATOM   290  O  O     . GLY A 1 49  ? 13.888  12.274  1.447   1.00 30.40  ? 45  GLY A O     1 
ATOM   291  N  N     . VAL A 1 50  ? 14.114  12.575  3.684   1.00 29.28  ? 46  VAL A N     1 
ATOM   292  C  CA    . VAL A 1 50  ? 15.404  11.884  3.825   1.00 28.09  ? 46  VAL A CA    1 
ATOM   293  C  C     . VAL A 1 50  ? 15.426  10.483  3.189   1.00 27.24  ? 46  VAL A C     1 
ATOM   294  O  O     . VAL A 1 50  ? 14.502  9.688   3.375   1.00 26.89  ? 46  VAL A O     1 
ATOM   295  C  CB    . VAL A 1 50  ? 15.886  11.858  5.319   1.00 28.06  ? 46  VAL A CB    1 
ATOM   296  C  CG1   . VAL A 1 50  ? 14.946  11.048  6.197   1.00 27.80  ? 46  VAL A CG1   1 
ATOM   297  C  CG2   . VAL A 1 50  ? 17.324  11.350  5.435   1.00 27.99  ? 46  VAL A CG2   1 
ATOM   298  N  N     . GLU A 1 51  ? 16.492  10.210  2.440   1.00 26.43  ? 47  GLU A N     1 
ATOM   299  C  CA    . GLU A 1 51  ? 16.629  8.980   1.652   1.00 25.91  ? 47  GLU A CA    1 
ATOM   300  C  C     . GLU A 1 51  ? 17.459  7.902   2.350   1.00 25.38  ? 47  GLU A C     1 
ATOM   301  O  O     . GLU A 1 51  ? 17.183  6.712   2.197   1.00 25.16  ? 47  GLU A O     1 
ATOM   302  C  CB    . GLU A 1 51  ? 17.236  9.300   0.276   1.00 25.81  ? 47  GLU A CB    1 
ATOM   303  C  CG    . GLU A 1 51  ? 17.589  8.074   -0.564  1.00 26.20  ? 47  GLU A CG    1 
ATOM   304  C  CD    . GLU A 1 51  ? 18.259  8.405   -1.895  1.00 26.05  ? 47  GLU A CD    1 
ATOM   305  O  OE1   . GLU A 1 51  ? 18.227  9.579   -2.327  1.00 25.80  ? 47  GLU A OE1   1 
ATOM   306  O  OE2   . GLU A 1 51  ? 18.816  7.471   -2.514  1.00 26.24  ? 47  GLU A OE2   1 
ATOM   307  N  N     . PHE A 1 52  ? 18.475  8.320   3.103   1.00 24.85  ? 48  PHE A N     1 
ATOM   308  C  CA    . PHE A 1 52  ? 19.436  7.392   3.695   1.00 24.44  ? 48  PHE A CA    1 
ATOM   309  C  C     . PHE A 1 52  ? 19.842  7.846   5.101   1.00 24.60  ? 48  PHE A C     1 
ATOM   310  O  O     . PHE A 1 52  ? 19.759  9.026   5.425   1.00 24.50  ? 48  PHE A O     1 
ATOM   311  C  CB    . PHE A 1 52  ? 20.665  7.258   2.781   1.00 24.03  ? 48  PHE A CB    1 
ATOM   312  C  CG    . PHE A 1 52  ? 21.628  6.163   3.189   1.00 23.37  ? 48  PHE A CG    1 
ATOM   313  C  CD1   . PHE A 1 52  ? 21.376  4.834   2.864   1.00 22.64  ? 48  PHE A CD1   1 
ATOM   314  C  CD2   . PHE A 1 52  ? 22.798  6.469   3.876   1.00 22.66  ? 48  PHE A CD2   1 
ATOM   315  C  CE1   . PHE A 1 52  ? 22.265  3.825   3.234   1.00 22.72  ? 48  PHE A CE1   1 
ATOM   316  C  CE2   . PHE A 1 52  ? 23.697  5.466   4.253   1.00 22.15  ? 48  PHE A CE2   1 
ATOM   317  C  CZ    . PHE A 1 52  ? 23.431  4.147   3.931   1.00 22.74  ? 48  PHE A CZ    1 
ATOM   318  N  N     . GLY A 1 53  ? 20.271  6.899   5.930   1.00 24.71  ? 49  GLY A N     1 
ATOM   319  C  CA    . GLY A 1 53  ? 20.697  7.197   7.290   1.00 25.09  ? 49  GLY A CA    1 
ATOM   320  C  C     . GLY A 1 53  ? 21.376  6.027   7.968   1.00 25.39  ? 49  GLY A C     1 
ATOM   321  O  O     . GLY A 1 53  ? 21.265  4.885   7.511   1.00 25.38  ? 49  GLY A O     1 
ATOM   322  N  N     . THR A 1 54  ? 22.085  6.315   9.058   1.00 25.49  ? 50  THR A N     1 
ATOM   323  C  CA    . THR A 1 54  ? 22.773  5.283   9.841   1.00 26.02  ? 50  THR A CA    1 
ATOM   324  C  C     . THR A 1 54  ? 22.592  5.525   11.343  1.00 26.56  ? 50  THR A C     1 
ATOM   325  O  O     . THR A 1 54  ? 22.293  6.645   11.769  1.00 26.40  ? 50  THR A O     1 
ATOM   326  C  CB    . THR A 1 54  ? 24.310  5.189   9.518   1.00 25.91  ? 50  THR A CB    1 
ATOM   327  O  OG1   . THR A 1 54  ? 25.011  6.285   10.122  1.00 25.70  ? 50  THR A OG1   1 
ATOM   328  C  CG2   . THR A 1 54  ? 24.592  5.163   8.003   1.00 25.34  ? 50  THR A CG2   1 
ATOM   329  N  N     . ARG A 1 55  ? 22.774  4.469   12.133  1.00 27.24  ? 51  ARG A N     1 
ATOM   330  C  CA    . ARG A 1 55  ? 22.770  4.564   13.598  1.00 28.26  ? 51  ARG A CA    1 
ATOM   331  C  C     . ARG A 1 55  ? 23.385  3.318   14.239  1.00 28.48  ? 51  ARG A C     1 
ATOM   332  O  O     . ARG A 1 55  ? 23.189  2.196   13.758  1.00 28.57  ? 51  ARG A O     1 
ATOM   333  C  CB    . ARG A 1 55  ? 21.352  4.786   14.142  1.00 28.15  ? 51  ARG A CB    1 
ATOM   334  C  CG    . ARG A 1 55  ? 21.302  5.012   15.654  1.00 28.90  ? 51  ARG A CG    1 
ATOM   335  C  CD    . ARG A 1 55  ? 19.893  5.239   16.147  1.00 29.21  ? 51  ARG A CD    1 
ATOM   336  N  NE    . ARG A 1 55  ? 19.744  4.837   17.543  1.00 30.80  ? 51  ARG A NE    1 
ATOM   337  C  CZ    . ARG A 1 55  ? 18.621  4.947   18.248  1.00 32.25  ? 51  ARG A CZ    1 
ATOM   338  N  NH1   . ARG A 1 55  ? 17.522  5.460   17.701  1.00 32.29  ? 51  ARG A NH1   1 
ATOM   339  N  NH2   . ARG A 1 55  ? 18.597  4.544   19.512  1.00 33.54  ? 51  ARG A NH2   1 
ATOM   340  N  N     . ILE A 1 56  ? 24.125  3.529   15.323  1.00 28.90  ? 52  ILE A N     1 
ATOM   341  C  CA    . ILE A 1 56  ? 24.705  2.432   16.090  1.00 29.46  ? 52  ILE A CA    1 
ATOM   342  C  C     . ILE A 1 56  ? 23.777  2.030   17.232  1.00 29.77  ? 52  ILE A C     1 
ATOM   343  O  O     . ILE A 1 56  ? 23.387  2.859   18.055  1.00 29.86  ? 52  ILE A O     1 
ATOM   344  C  CB    . ILE A 1 56  ? 26.126  2.768   16.613  1.00 29.53  ? 52  ILE A CB    1 
ATOM   345  C  CG1   . ILE A 1 56  ? 27.105  2.873   15.437  1.00 29.66  ? 52  ILE A CG1   1 
ATOM   346  C  CG2   . ILE A 1 56  ? 26.614  1.708   17.621  1.00 29.64  ? 52  ILE A CG2   1 
ATOM   347  C  CD1   . ILE A 1 56  ? 28.367  3.649   15.751  1.00 30.75  ? 52  ILE A CD1   1 
ATOM   348  N  N     . ILE A 1 57  ? 23.426  0.748   17.259  1.00 30.10  ? 53  ILE A N     1 
ATOM   349  C  CA    . ILE A 1 57  ? 22.566  0.193   18.298  1.00 30.69  ? 53  ILE A CA    1 
ATOM   350  C  C     . ILE A 1 57  ? 23.276  -0.932  19.059  1.00 30.88  ? 53  ILE A C     1 
ATOM   351  O  O     . ILE A 1 57  ? 24.257  -1.496  18.570  1.00 30.95  ? 53  ILE A O     1 
ATOM   352  C  CB    . ILE A 1 57  ? 21.220  -0.318  17.713  1.00 30.39  ? 53  ILE A CB    1 
ATOM   353  C  CG1   . ILE A 1 57  ? 21.456  -1.423  16.677  1.00 30.70  ? 53  ILE A CG1   1 
ATOM   354  C  CG2   . ILE A 1 57  ? 20.425  0.839   17.120  1.00 30.55  ? 53  ILE A CG2   1 
ATOM   355  C  CD1   . ILE A 1 57  ? 20.191  -2.157  16.249  1.00 30.91  ? 53  ILE A CD1   1 
ATOM   356  N  N     . GLU A 1 58  ? 22.780  -1.242  20.255  1.00 31.24  ? 54  GLU A N     1 
ATOM   357  C  CA    . GLU A 1 58  ? 23.295  -2.360  21.047  1.00 31.59  ? 54  GLU A CA    1 
ATOM   358  C  C     . GLU A 1 58  ? 22.288  -3.501  21.022  1.00 31.78  ? 54  GLU A C     1 
ATOM   359  O  O     . GLU A 1 58  ? 21.128  -3.323  21.397  1.00 31.72  ? 54  GLU A O     1 
ATOM   360  C  CB    . GLU A 1 58  ? 23.596  -1.923  22.484  1.00 31.44  ? 54  GLU A CB    1 
ATOM   361  N  N     . VAL A 1 59  ? 22.738  -4.662  20.555  1.00 32.20  ? 55  VAL A N     1 
ATOM   362  C  CA    . VAL A 1 59  ? 21.883  -5.833  20.381  1.00 32.81  ? 55  VAL A CA    1 
ATOM   363  C  C     . VAL A 1 59  ? 22.568  -7.031  21.011  1.00 33.08  ? 55  VAL A C     1 
ATOM   364  O  O     . VAL A 1 59  ? 23.693  -7.369  20.635  1.00 33.12  ? 55  VAL A O     1 
ATOM   365  C  CB    . VAL A 1 59  ? 21.625  -6.145  18.872  1.00 32.84  ? 55  VAL A CB    1 
ATOM   366  C  CG1   . VAL A 1 59  ? 20.827  -7.439  18.698  1.00 32.77  ? 55  VAL A CG1   1 
ATOM   367  C  CG2   . VAL A 1 59  ? 20.914  -4.993  18.189  1.00 33.17  ? 55  VAL A CG2   1 
ATOM   368  N  N     . SER A 1 60  ? 21.894  -7.667  21.970  1.00 33.52  ? 56  SER A N     1 
ATOM   369  C  CA    . SER A 1 60  ? 22.392  -8.902  22.586  1.00 33.73  ? 56  SER A CA    1 
ATOM   370  C  C     . SER A 1 60  ? 23.836  -8.764  23.106  1.00 33.64  ? 56  SER A C     1 
ATOM   371  O  O     . SER A 1 60  ? 24.624  -9.713  23.057  1.00 33.86  ? 56  SER A O     1 
ATOM   372  C  CB    . SER A 1 60  ? 22.257  -10.060 21.586  1.00 33.82  ? 56  SER A CB    1 
ATOM   373  O  OG    . SER A 1 60  ? 22.955  -11.213 22.016  1.00 35.40  ? 56  SER A OG    1 
ATOM   374  N  N     . GLY A 1 61  ? 24.175  -7.573  23.601  1.00 33.38  ? 57  GLY A N     1 
ATOM   375  C  CA    . GLY A 1 61  ? 25.530  -7.278  24.071  1.00 33.09  ? 57  GLY A CA    1 
ATOM   376  C  C     . GLY A 1 61  ? 26.539  -6.890  22.996  1.00 32.88  ? 57  GLY A C     1 
ATOM   377  O  O     . GLY A 1 61  ? 27.725  -6.725  23.289  1.00 32.97  ? 57  GLY A O     1 
ATOM   378  N  N     . GLN A 1 62  ? 26.078  -6.742  21.756  1.00 32.35  ? 58  GLN A N     1 
ATOM   379  C  CA    . GLN A 1 62  ? 26.956  -6.371  20.642  1.00 31.92  ? 58  GLN A CA    1 
ATOM   380  C  C     . GLN A 1 62  ? 26.619  -4.984  20.094  1.00 31.40  ? 58  GLN A C     1 
ATOM   381  O  O     . GLN A 1 62  ? 25.451  -4.598  20.043  1.00 31.42  ? 58  GLN A O     1 
ATOM   382  C  CB    . GLN A 1 62  ? 26.873  -7.413  19.531  1.00 32.03  ? 58  GLN A CB    1 
ATOM   383  N  N     . LYS A 1 63  ? 27.650  -4.242  19.696  1.00 30.66  ? 59  LYS A N     1 
ATOM   384  C  CA    . LYS A 1 63  ? 27.479  -2.945  19.043  1.00 29.98  ? 59  LYS A CA    1 
ATOM   385  C  C     . LYS A 1 63  ? 27.367  -3.136  17.524  1.00 29.56  ? 59  LYS A C     1 
ATOM   386  O  O     . LYS A 1 63  ? 28.256  -3.718  16.899  1.00 29.50  ? 59  LYS A O     1 
ATOM   387  C  CB    . LYS A 1 63  ? 28.636  -2.025  19.393  1.00 30.02  ? 59  LYS A CB    1 
ATOM   388  N  N     . ILE A 1 64  ? 26.268  -2.658  16.941  1.00 28.84  ? 60  ILE A N     1 
ATOM   389  C  CA    . ILE A 1 64  ? 25.975  -2.894  15.522  1.00 28.29  ? 60  ILE A CA    1 
ATOM   390  C  C     . ILE A 1 64  ? 25.564  -1.609  14.800  1.00 27.92  ? 60  ILE A C     1 
ATOM   391  O  O     . ILE A 1 64  ? 24.713  -0.867  15.286  1.00 27.57  ? 60  ILE A O     1 
ATOM   392  C  CB    . ILE A 1 64  ? 24.884  -4.001  15.333  1.00 28.46  ? 60  ILE A CB    1 
ATOM   393  C  CG1   . ILE A 1 64  ? 25.321  -5.314  16.012  1.00 28.19  ? 60  ILE A CG1   1 
ATOM   394  C  CG2   . ILE A 1 64  ? 24.571  -4.221  13.840  1.00 28.20  ? 60  ILE A CG2   1 
ATOM   395  C  CD1   . ILE A 1 64  ? 24.237  -6.360  16.142  1.00 28.04  ? 60  ILE A CD1   1 
ATOM   396  N  N     . LYS A 1 65  ? 26.187  -1.358  13.646  1.00 27.46  ? 61  LYS A N     1 
ATOM   397  C  CA    . LYS A 1 65  ? 25.859  -0.205  12.804  1.00 27.18  ? 61  LYS A CA    1 
ATOM   398  C  C     . LYS A 1 65  ? 24.758  -0.555  11.805  1.00 26.91  ? 61  LYS A C     1 
ATOM   399  O  O     . LYS A 1 65  ? 24.906  -1.482  11.004  1.00 26.85  ? 61  LYS A O     1 
ATOM   400  C  CB    . LYS A 1 65  ? 27.105  0.299   12.064  1.00 27.07  ? 61  LYS A CB    1 
ATOM   401  C  CG    . LYS A 1 65  ? 26.851  1.474   11.123  1.00 26.97  ? 61  LYS A CG    1 
ATOM   402  C  CD    . LYS A 1 65  ? 28.107  1.850   10.364  1.00 27.54  ? 61  LYS A CD    1 
ATOM   403  C  CE    . LYS A 1 65  ? 27.834  2.921   9.319   1.00 29.05  ? 61  LYS A CE    1 
ATOM   404  N  NZ    . LYS A 1 65  ? 29.089  3.350   8.623   1.00 29.94  ? 61  LYS A NZ    1 
ATOM   405  N  N     . LEU A 1 66  ? 23.654  0.184   11.862  1.00 26.69  ? 62  LEU A N     1 
ATOM   406  C  CA    . LEU A 1 66  ? 22.560  -0.011  10.912  1.00 26.63  ? 62  LEU A CA    1 
ATOM   407  C  C     . LEU A 1 66  ? 22.642  1.015   9.794   1.00 26.24  ? 62  LEU A C     1 
ATOM   408  O  O     . LEU A 1 66  ? 22.798  2.205   10.056  1.00 26.11  ? 62  LEU A O     1 
ATOM   409  C  CB    . LEU A 1 66  ? 21.188  0.109   11.591  1.00 26.67  ? 62  LEU A CB    1 
ATOM   410  C  CG    . LEU A 1 66  ? 20.733  -0.783  12.748  1.00 27.48  ? 62  LEU A CG    1 
ATOM   411  C  CD1   . LEU A 1 66  ? 19.237  -0.601  12.955  1.00 27.38  ? 62  LEU A CD1   1 
ATOM   412  C  CD2   . LEU A 1 66  ? 21.055  -2.252  12.529  1.00 28.27  ? 62  LEU A CD2   1 
ATOM   413  N  N     . GLN A 1 67  ? 22.543  0.544   8.554   1.00 25.84  ? 63  GLN A N     1 
ATOM   414  C  CA    . GLN A 1 67  ? 22.349  1.421   7.402   1.00 25.79  ? 63  GLN A CA    1 
ATOM   415  C  C     . GLN A 1 67  ? 20.906  1.261   6.935   1.00 25.36  ? 63  GLN A C     1 
ATOM   416  O  O     . GLN A 1 67  ? 20.403  0.142   6.852   1.00 25.32  ? 63  GLN A O     1 
ATOM   417  C  CB    . GLN A 1 67  ? 23.317  1.058   6.274   1.00 25.71  ? 63  GLN A CB    1 
ATOM   418  C  CG    . GLN A 1 67  ? 24.789  1.263   6.617   1.00 26.10  ? 63  GLN A CG    1 
ATOM   419  C  CD    . GLN A 1 67  ? 25.713  0.702   5.559   1.00 26.60  ? 63  GLN A CD    1 
ATOM   420  O  OE1   . GLN A 1 67  ? 25.470  -0.378  5.014   1.00 28.87  ? 63  GLN A OE1   1 
ATOM   421  N  NE2   . GLN A 1 67  ? 26.782  1.430   5.258   1.00 27.30  ? 63  GLN A NE2   1 
ATOM   422  N  N     . ILE A 1 68  ? 20.239  2.377   6.649   1.00 25.05  ? 64  ILE A N     1 
ATOM   423  C  CA    . ILE A 1 68  ? 18.812  2.364   6.294   1.00 24.92  ? 64  ILE A CA    1 
ATOM   424  C  C     . ILE A 1 68  ? 18.569  3.162   5.009   1.00 24.78  ? 64  ILE A C     1 
ATOM   425  O  O     . ILE A 1 68  ? 18.962  4.322   4.919   1.00 24.54  ? 64  ILE A O     1 
ATOM   426  C  CB    . ILE A 1 68  ? 17.938  2.927   7.451   1.00 24.96  ? 64  ILE A CB    1 
ATOM   427  C  CG1   . ILE A 1 68  ? 18.344  2.296   8.789   1.00 25.30  ? 64  ILE A CG1   1 
ATOM   428  C  CG2   . ILE A 1 68  ? 16.453  2.685   7.178   1.00 24.48  ? 64  ILE A CG2   1 
ATOM   429  C  CD1   . ILE A 1 68  ? 18.365  3.267   9.959   1.00 26.67  ? 64  ILE A CD1   1 
ATOM   430  N  N     . TRP A 1 69  ? 17.924  2.538   4.024   1.00 24.85  ? 65  TRP A N     1 
ATOM   431  C  CA    . TRP A 1 69  ? 17.735  3.159   2.706   1.00 25.16  ? 65  TRP A CA    1 
ATOM   432  C  C     . TRP A 1 69  ? 16.274  3.169   2.234   1.00 25.45  ? 65  TRP A C     1 
ATOM   433  O  O     . TRP A 1 69  ? 15.696  2.116   1.948   1.00 25.17  ? 65  TRP A O     1 
ATOM   434  C  CB    . TRP A 1 69  ? 18.617  2.461   1.650   1.00 24.91  ? 65  TRP A CB    1 
ATOM   435  C  CG    . TRP A 1 69  ? 18.974  3.304   0.430   1.00 24.97  ? 65  TRP A CG    1 
ATOM   436  C  CD1   . TRP A 1 69  ? 18.415  4.496   0.052   1.00 24.95  ? 65  TRP A CD1   1 
ATOM   437  C  CD2   . TRP A 1 69  ? 19.949  2.986   -0.579  1.00 25.02  ? 65  TRP A CD2   1 
ATOM   438  N  NE1   . TRP A 1 69  ? 18.995  4.950   -1.114  1.00 25.15  ? 65  TRP A NE1   1 
ATOM   439  C  CE2   . TRP A 1 69  ? 19.933  4.041   -1.526  1.00 24.83  ? 65  TRP A CE2   1 
ATOM   440  C  CE3   . TRP A 1 69  ? 20.838  1.916   -0.773  1.00 25.21  ? 65  TRP A CE3   1 
ATOM   441  C  CZ2   . TRP A 1 69  ? 20.776  4.060   -2.648  1.00 24.91  ? 65  TRP A CZ2   1 
ATOM   442  C  CZ3   . TRP A 1 69  ? 21.682  1.934   -1.894  1.00 25.11  ? 65  TRP A CZ3   1 
ATOM   443  C  CH2   . TRP A 1 69  ? 21.641  3.003   -2.815  1.00 24.84  ? 65  TRP A CH2   1 
ATOM   444  N  N     . ASP A 1 70  ? 15.690  4.364   2.151   1.00 26.00  ? 66  ASP A N     1 
ATOM   445  C  CA    . ASP A 1 70  ? 14.418  4.560   1.463   1.00 26.89  ? 66  ASP A CA    1 
ATOM   446  C  C     . ASP A 1 70  ? 14.727  4.386   -0.021  1.00 27.74  ? 66  ASP A C     1 
ATOM   447  O  O     . ASP A 1 70  ? 15.057  5.334   -0.728  1.00 27.85  ? 66  ASP A O     1 
ATOM   448  C  CB    . ASP A 1 70  ? 13.834  5.945   1.774   1.00 26.68  ? 66  ASP A CB    1 
ATOM   449  C  CG    . ASP A 1 70  ? 12.484  6.197   1.103   1.00 26.70  ? 66  ASP A CG    1 
ATOM   450  O  OD1   . ASP A 1 70  ? 12.011  5.347   0.311   1.00 27.01  ? 66  ASP A OD1   1 
ATOM   451  O  OD2   . ASP A 1 70  ? 11.888  7.270   1.368   1.00 26.49  ? 66  ASP A OD2   1 
ATOM   452  N  N     . THR A 1 71  ? 14.618  3.145   -0.471  1.00 28.93  ? 67  THR A N     1 
ATOM   453  C  CA    . THR A 1 71  ? 15.219  2.702   -1.723  1.00 30.26  ? 67  THR A CA    1 
ATOM   454  C  C     . THR A 1 71  ? 14.500  3.241   -2.983  1.00 30.98  ? 67  THR A C     1 
ATOM   455  O  O     . THR A 1 71  ? 15.127  3.427   -4.027  1.00 31.09  ? 67  THR A O     1 
ATOM   456  C  CB    . THR A 1 71  ? 15.404  1.156   -1.696  1.00 30.24  ? 67  THR A CB    1 
ATOM   457  O  OG1   . THR A 1 71  ? 16.554  0.783   -2.459  1.00 31.45  ? 67  THR A OG1   1 
ATOM   458  C  CG2   . THR A 1 71  ? 14.170  0.420   -2.180  1.00 29.93  ? 67  THR A CG2   1 
ATOM   459  N  N     . ALA A 1 72  ? 13.195  3.494   -2.861  1.00 31.94  ? 68  ALA A N     1 
ATOM   460  C  CA    . ALA A 1 72  ? 12.377  4.150   -3.900  1.00 32.99  ? 68  ALA A CA    1 
ATOM   461  C  C     . ALA A 1 72  ? 12.439  3.522   -5.310  1.00 33.78  ? 68  ALA A C     1 
ATOM   462  O  O     . ALA A 1 72  ? 12.299  4.223   -6.321  1.00 33.90  ? 68  ALA A O     1 
ATOM   463  C  CB    . ALA A 1 72  ? 12.675  5.660   -3.948  1.00 32.72  ? 68  ALA A CB    1 
ATOM   464  N  N     . GLY A 1 73  ? 12.644  2.207   -5.368  1.00 34.61  ? 69  GLY A N     1 
ATOM   465  C  CA    . GLY A 1 73  ? 12.594  1.465   -6.631  1.00 35.77  ? 69  GLY A CA    1 
ATOM   466  C  C     . GLY A 1 73  ? 13.804  1.623   -7.539  1.00 36.54  ? 69  GLY A C     1 
ATOM   467  O  O     . GLY A 1 73  ? 13.766  1.220   -8.707  1.00 36.46  ? 69  GLY A O     1 
ATOM   468  N  N     . GLN A 1 74  ? 14.880  2.192   -6.996  1.00 37.21  ? 70  GLN A N     1 
ATOM   469  C  CA    . GLN A 1 74  ? 16.103  2.468   -7.757  1.00 37.87  ? 70  GLN A CA    1 
ATOM   470  C  C     . GLN A 1 74  ? 16.906  1.202   -8.090  1.00 38.19  ? 70  GLN A C     1 
ATOM   471  O  O     . GLN A 1 74  ? 17.849  1.249   -8.888  1.00 38.10  ? 70  GLN A O     1 
ATOM   472  C  CB    . GLN A 1 74  ? 16.971  3.497   -7.018  1.00 37.76  ? 70  GLN A CB    1 
ATOM   473  C  CG    . GLN A 1 74  ? 16.395  4.915   -7.036  1.00 38.10  ? 70  GLN A CG    1 
ATOM   474  C  CD    . GLN A 1 74  ? 17.009  5.822   -5.977  1.00 38.22  ? 70  GLN A CD    1 
ATOM   475  O  OE1   . GLN A 1 74  ? 18.160  6.245   -6.091  1.00 38.70  ? 70  GLN A OE1   1 
ATOM   476  N  NE2   . GLN A 1 74  ? 16.231  6.134   -4.947  1.00 38.49  ? 70  GLN A NE2   1 
ATOM   477  N  N     . GLU A 1 75  ? 16.510  0.077   -7.489  1.00 38.78  ? 71  GLU A N     1 
ATOM   478  C  CA    . GLU A 1 75  ? 17.125  -1.231  -7.743  1.00 39.39  ? 71  GLU A CA    1 
ATOM   479  C  C     . GLU A 1 75  ? 16.908  -1.741  -9.176  1.00 39.94  ? 71  GLU A C     1 
ATOM   480  O  O     . GLU A 1 75  ? 17.578  -2.687  -9.611  1.00 40.41  ? 71  GLU A O     1 
ATOM   481  C  CB    . GLU A 1 75  ? 16.618  -2.256  -6.733  1.00 39.42  ? 71  GLU A CB    1 
ATOM   482  N  N     . ARG A 1 76  ? 15.973  -1.123  -9.897  1.00 40.13  ? 72  ARG A N     1 
ATOM   483  C  CA    . ARG A 1 76  ? 15.681  -1.485  -11.286 1.00 40.36  ? 72  ARG A CA    1 
ATOM   484  C  C     . ARG A 1 76  ? 16.588  -0.744  -12.265 1.00 40.49  ? 72  ARG A C     1 
ATOM   485  O  O     . ARG A 1 76  ? 16.700  -1.133  -13.436 1.00 40.80  ? 72  ARG A O     1 
ATOM   486  C  CB    . ARG A 1 76  ? 14.214  -1.209  -11.616 1.00 40.34  ? 72  ARG A CB    1 
ATOM   487  N  N     . PHE A 1 77  ? 17.235  0.315   -11.778 1.00 40.27  ? 73  PHE A N     1 
ATOM   488  C  CA    . PHE A 1 77  ? 18.033  1.196   -12.627 1.00 39.90  ? 73  PHE A CA    1 
ATOM   489  C  C     . PHE A 1 77  ? 19.509  1.276   -12.221 1.00 39.59  ? 73  PHE A C     1 
ATOM   490  O  O     . PHE A 1 77  ? 20.383  1.358   -13.088 1.00 39.79  ? 73  PHE A O     1 
ATOM   491  C  CB    . PHE A 1 77  ? 17.407  2.596   -12.673 1.00 39.93  ? 73  PHE A CB    1 
ATOM   492  N  N     . ARG A 1 78  ? 19.783  1.250   -10.916 1.00 38.87  ? 74  ARG A N     1 
ATOM   493  C  CA    . ARG A 1 78  ? 21.139  1.468   -10.404 1.00 38.30  ? 74  ARG A CA    1 
ATOM   494  C  C     . ARG A 1 78  ? 21.813  0.186   -9.917  1.00 37.82  ? 74  ARG A C     1 
ATOM   495  O  O     . ARG A 1 78  ? 21.280  -0.515  -9.053  1.00 37.87  ? 74  ARG A O     1 
ATOM   496  C  CB    . ARG A 1 78  ? 21.121  2.515   -9.292  1.00 38.47  ? 74  ARG A CB    1 
ATOM   497  N  N     . ALA A 1 79  ? 22.995  -0.098  -10.463 1.00 37.09  ? 75  ALA A N     1 
ATOM   498  C  CA    . ALA A 1 79  ? 23.738  -1.321  -10.139 1.00 36.39  ? 75  ALA A CA    1 
ATOM   499  C  C     . ALA A 1 79  ? 24.144  -1.429  -8.664  1.00 35.85  ? 75  ALA A C     1 
ATOM   500  O  O     . ALA A 1 79  ? 24.138  -2.520  -8.096  1.00 35.82  ? 75  ALA A O     1 
ATOM   501  C  CB    . ALA A 1 79  ? 24.958  -1.464  -11.042 1.00 36.42  ? 75  ALA A CB    1 
ATOM   502  N  N     . VAL A 1 80  ? 24.492  -0.300  -8.051  1.00 35.15  ? 76  VAL A N     1 
ATOM   503  C  CA    . VAL A 1 80  ? 24.875  -0.277  -6.636  1.00 34.48  ? 76  VAL A CA    1 
ATOM   504  C  C     . VAL A 1 80  ? 23.670  -0.527  -5.730  1.00 33.94  ? 76  VAL A C     1 
ATOM   505  O  O     . VAL A 1 80  ? 23.769  -1.285  -4.757  1.00 33.87  ? 76  VAL A O     1 
ATOM   506  C  CB    . VAL A 1 80  ? 25.591  1.037   -6.248  1.00 34.49  ? 76  VAL A CB    1 
ATOM   507  C  CG1   . VAL A 1 80  ? 25.989  1.025   -4.780  1.00 34.42  ? 76  VAL A CG1   1 
ATOM   508  C  CG2   . VAL A 1 80  ? 26.821  1.236   -7.113  1.00 34.92  ? 76  VAL A CG2   1 
ATOM   509  N  N     . THR A 1 81  ? 22.540  0.104   -6.057  1.00 33.29  ? 77  THR A N     1 
ATOM   510  C  CA    . THR A 1 81  ? 21.285  -0.117  -5.334  1.00 32.72  ? 77  THR A CA    1 
ATOM   511  C  C     . THR A 1 81  ? 20.865  -1.577  -5.473  1.00 32.24  ? 77  THR A C     1 
ATOM   512  O  O     . THR A 1 81  ? 20.363  -2.181  -4.521  1.00 32.16  ? 77  THR A O     1 
ATOM   513  C  CB    . THR A 1 81  ? 20.152  0.818   -5.829  1.00 32.71  ? 77  THR A CB    1 
ATOM   514  O  OG1   . THR A 1 81  ? 20.589  2.178   -5.753  1.00 32.94  ? 77  THR A OG1   1 
ATOM   515  C  CG2   . THR A 1 81  ? 18.885  0.659   -4.974  1.00 32.70  ? 77  THR A CG2   1 
ATOM   516  N  N     . ARG A 1 82  ? 21.101  -2.135  -6.659  1.00 31.64  ? 78  ARG A N     1 
ATOM   517  C  CA    . ARG A 1 82  ? 20.786  -3.530  -6.955  1.00 31.32  ? 78  ARG A CA    1 
ATOM   518  C  C     . ARG A 1 82  ? 21.489  -4.493  -5.989  1.00 30.49  ? 78  ARG A C     1 
ATOM   519  O  O     . ARG A 1 82  ? 20.864  -5.429  -5.488  1.00 30.36  ? 78  ARG A O     1 
ATOM   520  C  CB    . ARG A 1 82  ? 21.133  -3.853  -8.417  1.00 31.33  ? 78  ARG A CB    1 
ATOM   521  C  CG    . ARG A 1 82  ? 20.279  -4.947  -9.037  1.00 32.00  ? 78  ARG A CG    1 
ATOM   522  C  CD    . ARG A 1 82  ? 20.496  -5.078  -10.552 1.00 32.64  ? 78  ARG A CD    1 
ATOM   523  N  NE    . ARG A 1 82  ? 20.033  -3.900  -11.287 1.00 35.87  ? 78  ARG A NE    1 
ATOM   524  C  CZ    . ARG A 1 82  ? 20.743  -3.236  -12.199 1.00 36.61  ? 78  ARG A CZ    1 
ATOM   525  N  NH1   . ARG A 1 82  ? 21.965  -3.637  -12.531 1.00 37.12  ? 78  ARG A NH1   1 
ATOM   526  N  NH2   . ARG A 1 82  ? 20.222  -2.170  -12.794 1.00 36.96  ? 78  ARG A NH2   1 
ATOM   527  N  N     . SER A 1 83  ? 22.771  -4.246  -5.705  1.00 29.69  ? 79  SER A N     1 
ATOM   528  C  CA    . SER A 1 83  ? 23.547  -5.142  -4.837  1.00 28.88  ? 79  SER A CA    1 
ATOM   529  C  C     . SER A 1 83  ? 23.394  -4.880  -3.332  1.00 28.12  ? 79  SER A C     1 
ATOM   530  O  O     . SER A 1 83  ? 23.555  -5.804  -2.535  1.00 28.06  ? 79  SER A O     1 
ATOM   531  C  CB    . SER A 1 83  ? 25.024  -5.192  -5.244  1.00 29.01  ? 79  SER A CB    1 
ATOM   532  O  OG    . SER A 1 83  ? 25.693  -3.986  -4.930  1.00 30.17  ? 79  SER A OG    1 
ATOM   533  N  N     . TYR A 1 84  ? 23.097  -3.635  -2.951  1.00 27.01  ? 80  TYR A N     1 
ATOM   534  C  CA    . TYR A 1 84  ? 22.714  -3.308  -1.568  1.00 26.29  ? 80  TYR A CA    1 
ATOM   535  C  C     . TYR A 1 84  ? 21.454  -4.106  -1.193  1.00 26.10  ? 80  TYR A C     1 
ATOM   536  O  O     . TYR A 1 84  ? 21.376  -4.713  -0.120  1.00 25.97  ? 80  TYR A O     1 
ATOM   537  C  CB    . TYR A 1 84  ? 22.470  -1.797  -1.418  1.00 25.90  ? 80  TYR A CB    1 
ATOM   538  C  CG    . TYR A 1 84  ? 22.046  -1.317  -0.032  1.00 25.11  ? 80  TYR A CG    1 
ATOM   539  C  CD1   . TYR A 1 84  ? 22.948  -0.659  0.804   1.00 25.33  ? 80  TYR A CD1   1 
ATOM   540  C  CD2   . TYR A 1 84  ? 20.741  -1.491  0.424   1.00 24.32  ? 80  TYR A CD2   1 
ATOM   541  C  CE1   . TYR A 1 84  ? 22.565  -0.200  2.069   1.00 24.54  ? 80  TYR A CE1   1 
ATOM   542  C  CE2   . TYR A 1 84  ? 20.349  -1.039  1.678   1.00 24.26  ? 80  TYR A CE2   1 
ATOM   543  C  CZ    . TYR A 1 84  ? 21.266  -0.397  2.499   1.00 24.86  ? 80  TYR A CZ    1 
ATOM   544  O  OH    . TYR A 1 84  ? 20.878  0.047   3.748   1.00 24.34  ? 80  TYR A OH    1 
ATOM   545  N  N     . TYR A 1 85  ? 20.485  -4.092  -2.103  1.00 25.75  ? 81  TYR A N     1 
ATOM   546  C  CA    . TYR A 1 85  ? 19.239  -4.840  -1.992  1.00 25.81  ? 81  TYR A CA    1 
ATOM   547  C  C     . TYR A 1 85  ? 19.508  -6.335  -1.797  1.00 25.52  ? 81  TYR A C     1 
ATOM   548  O  O     . TYR A 1 85  ? 18.897  -6.973  -0.940  1.00 25.57  ? 81  TYR A O     1 
ATOM   549  C  CB    . TYR A 1 85  ? 18.413  -4.608  -3.262  1.00 26.17  ? 81  TYR A CB    1 
ATOM   550  C  CG    . TYR A 1 85  ? 16.928  -4.422  -3.056  1.00 26.42  ? 81  TYR A CG    1 
ATOM   551  C  CD1   . TYR A 1 85  ? 16.367  -3.148  -2.967  1.00 26.89  ? 81  TYR A CD1   1 
ATOM   552  C  CD2   . TYR A 1 85  ? 16.079  -5.521  -2.980  1.00 27.47  ? 81  TYR A CD2   1 
ATOM   553  C  CE1   . TYR A 1 85  ? 14.985  -2.977  -2.794  1.00 26.42  ? 81  TYR A CE1   1 
ATOM   554  C  CE2   . TYR A 1 85  ? 14.708  -5.367  -2.803  1.00 27.77  ? 81  TYR A CE2   1 
ATOM   555  C  CZ    . TYR A 1 85  ? 14.168  -4.096  -2.715  1.00 27.38  ? 81  TYR A CZ    1 
ATOM   556  O  OH    . TYR A 1 85  ? 12.808  -3.972  -2.540  1.00 27.94  ? 81  TYR A OH    1 
ATOM   557  N  N     . ARG A 1 86  ? 20.445  -6.873  -2.579  1.00 25.17  ? 82  ARG A N     1 
ATOM   558  C  CA    . ARG A 1 86  ? 20.850  -8.288  -2.505  1.00 24.71  ? 82  ARG A CA    1 
ATOM   559  C  C     . ARG A 1 86  ? 21.600  -8.650  -1.226  1.00 24.27  ? 82  ARG A C     1 
ATOM   560  O  O     . ARG A 1 86  ? 21.713  -9.830  -0.882  1.00 24.40  ? 82  ARG A O     1 
ATOM   561  C  CB    . ARG A 1 86  ? 21.709  -8.671  -3.719  1.00 24.70  ? 82  ARG A CB    1 
ATOM   562  C  CG    . ARG A 1 86  ? 20.941  -8.822  -5.021  1.00 25.10  ? 82  ARG A CG    1 
ATOM   563  C  CD    . ARG A 1 86  ? 20.119  -10.096 -5.039  1.00 25.74  ? 82  ARG A CD    1 
ATOM   564  N  NE    . ARG A 1 86  ? 19.440  -10.295 -6.319  1.00 26.49  ? 82  ARG A NE    1 
ATOM   565  C  CZ    . ARG A 1 86  ? 18.404  -11.111 -6.496  1.00 26.91  ? 82  ARG A CZ    1 
ATOM   566  N  NH1   . ARG A 1 86  ? 17.913  -11.804 -5.478  1.00 26.77  ? 82  ARG A NH1   1 
ATOM   567  N  NH2   . ARG A 1 86  ? 17.848  -11.228 -7.692  1.00 27.62  ? 82  ARG A NH2   1 
ATOM   568  N  N     . GLY A 1 87  ? 22.116  -7.639  -0.532  1.00 23.57  ? 83  GLY A N     1 
ATOM   569  C  CA    . GLY A 1 87  ? 22.819  -7.846  0.728   1.00 22.80  ? 83  GLY A CA    1 
ATOM   570  C  C     . GLY A 1 87  ? 22.033  -7.394  1.945   1.00 22.32  ? 83  GLY A C     1 
ATOM   571  O  O     . GLY A 1 87  ? 22.593  -7.268  3.039   1.00 22.10  ? 83  GLY A O     1 
ATOM   572  N  N     . ALA A 1 88  ? 20.735  -7.156  1.756   1.00 21.61  ? 84  ALA A N     1 
ATOM   573  C  CA    . ALA A 1 88  ? 19.869  -6.664  2.822   1.00 21.06  ? 84  ALA A CA    1 
ATOM   574  C  C     . ALA A 1 88  ? 19.715  -7.689  3.943   1.00 20.79  ? 84  ALA A C     1 
ATOM   575  O  O     . ALA A 1 88  ? 19.359  -8.841  3.695   1.00 20.62  ? 84  ALA A O     1 
ATOM   576  C  CB    . ALA A 1 88  ? 18.508  -6.268  2.265   1.00 21.07  ? 84  ALA A CB    1 
ATOM   577  N  N     . ALA A 1 89  ? 20.012  -7.265  5.169   1.00 20.55  ? 85  ALA A N     1 
ATOM   578  C  CA    . ALA A 1 89  ? 19.804  -8.101  6.354   1.00 20.50  ? 85  ALA A CA    1 
ATOM   579  C  C     . ALA A 1 89  ? 18.359  -7.988  6.835   1.00 20.40  ? 85  ALA A C     1 
ATOM   580  O  O     . ALA A 1 89  ? 17.785  -8.953  7.330   1.00 20.53  ? 85  ALA A O     1 
ATOM   581  C  CB    . ALA A 1 89  ? 20.766  -7.711  7.459   1.00 20.27  ? 85  ALA A CB    1 
ATOM   582  N  N     . GLY A 1 90  ? 17.775  -6.804  6.675   1.00 20.65  ? 86  GLY A N     1 
ATOM   583  C  CA    . GLY A 1 90  ? 16.390  -6.559  7.079   1.00 20.75  ? 86  GLY A CA    1 
ATOM   584  C  C     . GLY A 1 90  ? 15.591  -5.678  6.131   1.00 20.77  ? 86  GLY A C     1 
ATOM   585  O  O     . GLY A 1 90  ? 16.150  -4.842  5.415   1.00 20.61  ? 86  GLY A O     1 
ATOM   586  N  N     . ALA A 1 91  ? 14.274  -5.872  6.135   1.00 20.94  ? 87  ALA A N     1 
ATOM   587  C  CA    . ALA A 1 91  ? 13.365  -5.069  5.319   1.00 21.17  ? 87  ALA A CA    1 
ATOM   588  C  C     . ALA A 1 91  ? 12.160  -4.630  6.139   1.00 21.35  ? 87  ALA A C     1 
ATOM   589  O  O     . ALA A 1 91  ? 11.432  -5.474  6.674   1.00 21.69  ? 87  ALA A O     1 
ATOM   590  C  CB    . ALA A 1 91  ? 12.909  -5.858  4.094   1.00 21.04  ? 87  ALA A CB    1 
ATOM   591  N  N     . LEU A 1 92  ? 11.952  -3.318  6.250   1.00 21.29  ? 88  LEU A N     1 
ATOM   592  C  CA    . LEU A 1 92  ? 10.697  -2.810  6.797   1.00 21.16  ? 88  LEU A CA    1 
ATOM   593  C  C     . LEU A 1 92  ? 9.730   -2.591  5.644   1.00 20.96  ? 88  LEU A C     1 
ATOM   594  O  O     . LEU A 1 92  ? 9.982   -1.768  4.760   1.00 20.67  ? 88  LEU A O     1 
ATOM   595  C  CB    . LEU A 1 92  ? 10.874  -1.507  7.590   1.00 21.27  ? 88  LEU A CB    1 
ATOM   596  C  CG    . LEU A 1 92  ? 11.963  -1.218  8.639   1.00 22.20  ? 88  LEU A CG    1 
ATOM   597  C  CD1   . LEU A 1 92  ? 11.386  -0.282  9.689   1.00 23.32  ? 88  LEU A CD1   1 
ATOM   598  C  CD2   . LEU A 1 92  ? 12.541  -2.432  9.315   1.00 22.19  ? 88  LEU A CD2   1 
ATOM   599  N  N     . MET A 1 93  ? 8.640   -3.354  5.652   1.00 20.83  ? 89  MET A N     1 
ATOM   600  C  CA    . MET A 1 93  ? 7.561   -3.215  4.676   1.00 21.29  ? 89  MET A CA    1 
ATOM   601  C  C     . MET A 1 93  ? 6.437   -2.413  5.332   1.00 20.52  ? 89  MET A C     1 
ATOM   602  O  O     . MET A 1 93  ? 5.830   -2.856  6.312   1.00 20.41  ? 89  MET A O     1 
ATOM   603  C  CB    . MET A 1 93  ? 7.074   -4.602  4.246   1.00 21.27  ? 89  MET A CB    1 
ATOM   604  C  CG    . MET A 1 93  ? 6.403   -4.678  2.887   1.00 22.19  ? 89  MET A CG    1 
ATOM   605  S  SD    . MET A 1 93  ? 6.176   -6.399  2.341   1.00 23.53  ? 89  MET A SD    1 
ATOM   606  C  CE    . MET A 1 93  ? 5.046   -7.038  3.570   1.00 23.50  ? 89  MET A CE    1 
ATOM   607  N  N     . VAL A 1 94  ? 6.178   -1.226  4.793   1.00 20.20  ? 90  VAL A N     1 
ATOM   608  C  CA    . VAL A 1 94  ? 5.336   -0.231  5.457   1.00 19.79  ? 90  VAL A CA    1 
ATOM   609  C  C     . VAL A 1 94  ? 4.028   0.036   4.709   1.00 19.91  ? 90  VAL A C     1 
ATOM   610  O  O     . VAL A 1 94  ? 4.020   0.178   3.477   1.00 20.01  ? 90  VAL A O     1 
ATOM   611  C  CB    . VAL A 1 94  ? 6.107   1.120   5.661   1.00 20.00  ? 90  VAL A CB    1 
ATOM   612  C  CG1   . VAL A 1 94  ? 5.344   2.071   6.610   1.00 18.99  ? 90  VAL A CG1   1 
ATOM   613  C  CG2   . VAL A 1 94  ? 7.526   0.872   6.184   1.00 19.48  ? 90  VAL A CG2   1 
ATOM   614  N  N     . TYR A 1 95  ? 2.932   0.096   5.466   1.00 19.61  ? 91  TYR A N     1 
ATOM   615  C  CA    . TYR A 1 95  ? 1.652   0.606   4.971   1.00 19.58  ? 91  TYR A CA    1 
ATOM   616  C  C     . TYR A 1 95  ? 1.128   1.714   5.900   1.00 19.81  ? 91  TYR A C     1 
ATOM   617  O  O     . TYR A 1 95  ? 1.648   1.913   7.013   1.00 19.55  ? 91  TYR A O     1 
ATOM   618  C  CB    . TYR A 1 95  ? 0.618   -0.526  4.802   1.00 19.54  ? 91  TYR A CB    1 
ATOM   619  C  CG    . TYR A 1 95  ? 0.138   -1.114  6.111   1.00 19.26  ? 91  TYR A CG    1 
ATOM   620  C  CD1   . TYR A 1 95  ? -1.027  -0.649  6.720   1.00 18.79  ? 91  TYR A CD1   1 
ATOM   621  C  CD2   . TYR A 1 95  ? 0.859   -2.123  6.750   1.00 18.84  ? 91  TYR A CD2   1 
ATOM   622  C  CE1   . TYR A 1 95  ? -1.460  -1.174  7.934   1.00 18.75  ? 91  TYR A CE1   1 
ATOM   623  C  CE2   . TYR A 1 95  ? 0.430   -2.657  7.957   1.00 18.13  ? 91  TYR A CE2   1 
ATOM   624  C  CZ    . TYR A 1 95  ? -0.728  -2.178  8.544   1.00 18.93  ? 91  TYR A CZ    1 
ATOM   625  O  OH    . TYR A 1 95  ? -1.150  -2.697  9.749   1.00 19.40  ? 91  TYR A OH    1 
ATOM   626  N  N     . ASP A 1 96  ? 0.112   2.429   5.415   1.00 19.88  ? 92  ASP A N     1 
ATOM   627  C  CA    . ASP A 1 96  ? -0.558  3.514   6.129   1.00 20.12  ? 92  ASP A CA    1 
ATOM   628  C  C     . ASP A 1 96  ? -1.896  2.981   6.655   1.00 20.32  ? 92  ASP A C     1 
ATOM   629  O  O     . ASP A 1 96  ? -2.799  2.657   5.874   1.00 19.98  ? 92  ASP A O     1 
ATOM   630  C  CB    . ASP A 1 96  ? -0.767  4.698   5.160   1.00 20.19  ? 92  ASP A CB    1 
ATOM   631  C  CG    . ASP A 1 96  ? -1.375  5.950   5.823   1.00 20.98  ? 92  ASP A CG    1 
ATOM   632  O  OD1   . ASP A 1 96  ? -1.911  5.892   6.963   1.00 20.55  ? 92  ASP A OD1   1 
ATOM   633  O  OD2   . ASP A 1 96  ? -1.320  7.018   5.168   1.00 20.86  ? 92  ASP A OD2   1 
ATOM   634  N  N     . ILE A 1 97  ? -2.015  2.897   7.983   1.00 20.45  ? 93  ILE A N     1 
ATOM   635  C  CA    . ILE A 1 97  ? -3.232  2.407   8.654   1.00 20.60  ? 93  ILE A CA    1 
ATOM   636  C  C     . ILE A 1 97  ? -4.509  3.166   8.251   1.00 20.44  ? 93  ILE A C     1 
ATOM   637  O  O     . ILE A 1 97  ? -5.609  2.608   8.288   1.00 20.39  ? 93  ILE A O     1 
ATOM   638  C  CB    . ILE A 1 97  ? -3.071  2.425   10.207  1.00 20.73  ? 93  ILE A CB    1 
ATOM   639  C  CG1   . ILE A 1 97  ? -1.937  1.490   10.641  1.00 20.24  ? 93  ILE A CG1   1 
ATOM   640  C  CG2   . ILE A 1 97  ? -4.361  1.995   10.896  1.00 21.00  ? 93  ILE A CG2   1 
ATOM   641  C  CD1   . ILE A 1 97  ? -1.487  1.680   12.079  1.00 21.02  ? 93  ILE A CD1   1 
ATOM   642  N  N     . THR A 1 98  ? -4.358  4.432   7.872   1.00 20.46  ? 94  THR A N     1 
ATOM   643  C  CA    . THR A 1 98  ? -5.496  5.246   7.444   1.00 20.49  ? 94  THR A CA    1 
ATOM   644  C  C     . THR A 1 98  ? -5.812  5.090   5.945   1.00 20.73  ? 94  THR A C     1 
ATOM   645  O  O     . THR A 1 98  ? -6.768  5.698   5.456   1.00 20.65  ? 94  THR A O     1 
ATOM   646  C  CB    . THR A 1 98  ? -5.289  6.757   7.758   1.00 20.57  ? 94  THR A CB    1 
ATOM   647  O  OG1   . THR A 1 98  ? -4.384  7.331   6.806   1.00 20.62  ? 94  THR A OG1   1 
ATOM   648  C  CG2   . THR A 1 98  ? -4.759  6.981   9.184   1.00 20.06  ? 94  THR A CG2   1 
ATOM   649  N  N     . ARG A 1 99  ? -5.017  4.294   5.222   1.00 20.73  ? 95  ARG A N     1 
ATOM   650  C  CA    . ARG A 1 99  ? -5.207  4.123   3.768   1.00 21.20  ? 95  ARG A CA    1 
ATOM   651  C  C     . ARG A 1 99  ? -5.126  2.670   3.315   1.00 21.13  ? 95  ARG A C     1 
ATOM   652  O  O     . ARG A 1 99  ? -4.040  2.119   3.118   1.00 20.72  ? 95  ARG A O     1 
ATOM   653  C  CB    . ARG A 1 99  ? -4.229  4.995   2.971   1.00 21.57  ? 95  ARG A CB    1 
ATOM   654  C  CG    . ARG A 1 99  ? -4.587  6.477   2.957   1.00 22.67  ? 95  ARG A CG    1 
ATOM   655  C  CD    . ARG A 1 99  ? -3.386  7.366   2.629   1.00 25.54  ? 95  ARG A CD    1 
ATOM   656  N  NE    . ARG A 1 99  ? -2.850  7.127   1.292   1.00 27.00  ? 95  ARG A NE    1 
ATOM   657  C  CZ    . ARG A 1 99  ? -1.565  6.922   1.009   1.00 27.29  ? 95  ARG A CZ    1 
ATOM   658  N  NH1   . ARG A 1 99  ? -0.641  6.930   1.963   1.00 27.86  ? 95  ARG A NH1   1 
ATOM   659  N  NH2   . ARG A 1 99  ? -1.203  6.715   -0.245  1.00 27.12  ? 95  ARG A NH2   1 
ATOM   660  N  N     . ARG A 1 100 ? -6.299  2.070   3.132   1.00 21.32  ? 96  ARG A N     1 
ATOM   661  C  CA    . ARG A 1 100 ? -6.429  0.661   2.768   1.00 21.81  ? 96  ARG A CA    1 
ATOM   662  C  C     . ARG A 1 100 ? -5.678  0.246   1.493   1.00 21.73  ? 96  ARG A C     1 
ATOM   663  O  O     . ARG A 1 100 ? -5.170  -0.871  1.412   1.00 21.63  ? 96  ARG A O     1 
ATOM   664  C  CB    . ARG A 1 100 ? -7.907  0.288   2.655   1.00 21.95  ? 96  ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 100 ? -8.142  -1.190  2.543   1.00 23.19  ? 96  ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 100 ? -9.463  -1.608  3.149   1.00 24.55  ? 96  ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 100 ? -9.384  -3.031  3.419   1.00 27.00  ? 96  ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 100 ? -9.271  -3.579  4.621   1.00 27.05  ? 96  ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 100 ? -9.283  -2.835  5.724   1.00 27.30  ? 96  ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 100 ? -9.178  -4.893  4.708   1.00 27.48  ? 96  ARG A NH2   1 
ATOM   671  N  N     . SER A 1 101 ? -5.602  1.140   0.509   1.00 21.83  ? 97  SER A N     1 
ATOM   672  C  CA    . SER A 1 101 ? -4.913  0.830   -0.745  1.00 21.91  ? 97  SER A CA    1 
ATOM   673  C  C     . SER A 1 101 ? -3.428  0.491   -0.538  1.00 21.89  ? 97  SER A C     1 
ATOM   674  O  O     . SER A 1 101 ? -2.853  -0.317  -1.280  1.00 21.83  ? 97  SER A O     1 
ATOM   675  C  CB    . SER A 1 101 ? -5.085  1.966   -1.762  1.00 22.00  ? 97  SER A CB    1 
ATOM   676  O  OG    . SER A 1 101 ? -4.299  3.096   -1.425  1.00 23.08  ? 97  SER A OG    1 
ATOM   677  N  N     . THR A 1 102 ? -2.820  1.102   0.481   1.00 21.55  ? 98  THR A N     1 
ATOM   678  C  CA    . THR A 1 102 ? -1.419  0.846   0.807   1.00 21.15  ? 98  THR A CA    1 
ATOM   679  C  C     . THR A 1 102 ? -1.255  -0.539  1.431   1.00 21.29  ? 98  THR A C     1 
ATOM   680  O  O     . THR A 1 102 ? -0.219  -1.184  1.264   1.00 21.33  ? 98  THR A O     1 
ATOM   681  C  CB    . THR A 1 102 ? -0.807  1.958   1.709   1.00 21.14  ? 98  THR A CB    1 
ATOM   682  O  OG1   . THR A 1 102 ? -1.376  1.911   3.028   1.00 20.47  ? 98  THR A OG1   1 
ATOM   683  C  CG2   . THR A 1 102 ? -1.049  3.332   1.099   1.00 20.44  ? 98  THR A CG2   1 
ATOM   684  N  N     . TYR A 1 103 ? -2.291  -0.987  2.136   1.00 21.42  ? 99  TYR A N     1 
ATOM   685  C  CA    . TYR A 1 103 ? -2.354  -2.342  2.686   1.00 21.70  ? 99  TYR A CA    1 
ATOM   686  C  C     . TYR A 1 103 ? -2.592  -3.360  1.563   1.00 21.65  ? 99  TYR A C     1 
ATOM   687  O  O     . TYR A 1 103 ? -1.960  -4.414  1.532   1.00 21.61  ? 99  TYR A O     1 
ATOM   688  C  CB    . TYR A 1 103 ? -3.446  -2.420  3.769   1.00 21.78  ? 99  TYR A CB    1 
ATOM   689  C  CG    . TYR A 1 103 ? -3.733  -3.807  4.314   1.00 22.28  ? 99  TYR A CG    1 
ATOM   690  C  CD1   . TYR A 1 103 ? -2.927  -4.369  5.310   1.00 22.54  ? 99  TYR A CD1   1 
ATOM   691  C  CD2   . TYR A 1 103 ? -4.825  -4.549  3.855   1.00 22.27  ? 99  TYR A CD2   1 
ATOM   692  C  CE1   . TYR A 1 103 ? -3.187  -5.641  5.819   1.00 22.02  ? 99  TYR A CE1   1 
ATOM   693  C  CE2   . TYR A 1 103 ? -5.093  -5.822  4.356   1.00 22.68  ? 99  TYR A CE2   1 
ATOM   694  C  CZ    . TYR A 1 103 ? -4.267  -6.359  5.342   1.00 23.02  ? 99  TYR A CZ    1 
ATOM   695  O  OH    . TYR A 1 103 ? -4.519  -7.617  5.848   1.00 23.48  ? 99  TYR A OH    1 
ATOM   696  N  N     . ASN A 1 104 ? -3.484  -3.023  0.632   1.00 21.66  ? 100 ASN A N     1 
ATOM   697  C  CA    . ASN A 1 104 ? -3.801  -3.887  -0.518  1.00 21.64  ? 100 ASN A CA    1 
ATOM   698  C  C     . ASN A 1 104 ? -2.625  -4.192  -1.465  1.00 21.72  ? 100 ASN A C     1 
ATOM   699  O  O     . ASN A 1 104 ? -2.626  -5.215  -2.155  1.00 21.70  ? 100 ASN A O     1 
ATOM   700  C  CB    . ASN A 1 104 ? -4.998  -3.327  -1.299  1.00 21.58  ? 100 ASN A CB    1 
ATOM   701  C  CG    . ASN A 1 104 ? -6.327  -3.579  -0.600  1.00 21.53  ? 100 ASN A CG    1 
ATOM   702  O  OD1   . ASN A 1 104 ? -6.430  -4.434  0.280   1.00 21.40  ? 100 ASN A OD1   1 
ATOM   703  N  ND2   . ASN A 1 104 ? -7.357  -2.834  -0.997  1.00 21.35  ? 100 ASN A ND2   1 
ATOM   704  N  N     . HIS A 1 105 ? -1.624  -3.311  -1.481  1.00 21.85  ? 101 HIS A N     1 
ATOM   705  C  CA    . HIS A 1 105 ? -0.435  -3.498  -2.315  1.00 21.75  ? 101 HIS A CA    1 
ATOM   706  C  C     . HIS A 1 105 ? 0.683   -4.299  -1.641  1.00 21.56  ? 101 HIS A C     1 
ATOM   707  O  O     . HIS A 1 105 ? 1.757   -4.461  -2.219  1.00 21.50  ? 101 HIS A O     1 
ATOM   708  C  CB    . HIS A 1 105 ? 0.123   -2.145  -2.783  1.00 22.04  ? 101 HIS A CB    1 
ATOM   709  C  CG    . HIS A 1 105 ? -0.768  -1.412  -3.739  1.00 22.52  ? 101 HIS A CG    1 
ATOM   710  N  ND1   . HIS A 1 105 ? -1.410  -2.032  -4.791  1.00 23.85  ? 101 HIS A ND1   1 
ATOM   711  C  CD2   . HIS A 1 105 ? -1.100  -0.102  -3.817  1.00 22.82  ? 101 HIS A CD2   1 
ATOM   712  C  CE1   . HIS A 1 105 ? -2.114  -1.138  -5.462  1.00 24.33  ? 101 HIS A CE1   1 
ATOM   713  N  NE2   . HIS A 1 105 ? -1.943  0.041   -4.892  1.00 24.01  ? 101 HIS A NE2   1 
ATOM   714  N  N     . LEU A 1 106 ? 0.437   -4.802  -0.432  1.00 21.51  ? 102 LEU A N     1 
ATOM   715  C  CA    . LEU A 1 106 ? 1.470   -5.518  0.328   1.00 21.15  ? 102 LEU A CA    1 
ATOM   716  C  C     . LEU A 1 106 ? 2.006   -6.788  -0.341  1.00 21.51  ? 102 LEU A C     1 
ATOM   717  O  O     . LEU A 1 106 ? 3.198   -7.093  -0.222  1.00 21.29  ? 102 LEU A O     1 
ATOM   718  C  CB    . LEU A 1 106 ? 1.002   -5.821  1.756   1.00 21.07  ? 102 LEU A CB    1 
ATOM   719  C  CG    . LEU A 1 106 ? 0.945   -4.652  2.750   1.00 20.40  ? 102 LEU A CG    1 
ATOM   720  C  CD1   . LEU A 1 106 ? 0.419   -5.145  4.089   1.00 20.09  ? 102 LEU A CD1   1 
ATOM   721  C  CD2   . LEU A 1 106 ? 2.292   -3.939  2.918   1.00 18.90  ? 102 LEU A CD2   1 
ATOM   722  N  N     . SER A 1 107 ? 1.147   -7.529  -1.039  1.00 21.73  ? 103 SER A N     1 
ATOM   723  C  CA    . SER A 1 107 ? 1.613   -8.742  -1.717  1.00 22.35  ? 103 SER A CA    1 
ATOM   724  C  C     . SER A 1 107 ? 2.626   -8.421  -2.824  1.00 22.27  ? 103 SER A C     1 
ATOM   725  O  O     . SER A 1 107 ? 3.572   -9.188  -3.033  1.00 22.20  ? 103 SER A O     1 
ATOM   726  C  CB    . SER A 1 107 ? 0.455   -9.601  -2.240  1.00 22.33  ? 103 SER A CB    1 
ATOM   727  O  OG    . SER A 1 107 ? -0.286  -8.922  -3.234  1.00 24.18  ? 103 SER A OG    1 
ATOM   728  N  N     . SER A 1 108 ? 2.434   -7.286  -3.504  1.00 22.37  ? 104 SER A N     1 
ATOM   729  C  CA    . SER A 1 108 ? 3.393   -6.779  -4.498  1.00 22.54  ? 104 SER A CA    1 
ATOM   730  C  C     . SER A 1 108 ? 4.735   -6.396  -3.876  1.00 22.63  ? 104 SER A C     1 
ATOM   731  O  O     . SER A 1 108 ? 5.787   -6.710  -4.433  1.00 22.30  ? 104 SER A O     1 
ATOM   732  C  CB    . SER A 1 108 ? 2.810   -5.583  -5.268  1.00 22.62  ? 104 SER A CB    1 
ATOM   733  N  N     . TRP A 1 109 ? 4.694   -5.711  -2.732  1.00 22.92  ? 105 TRP A N     1 
ATOM   734  C  CA    . TRP A 1 109 ? 5.920   -5.311  -2.031  1.00 23.35  ? 105 TRP A CA    1 
ATOM   735  C  C     . TRP A 1 109 ? 6.664   -6.513  -1.459  1.00 23.84  ? 105 TRP A C     1 
ATOM   736  O  O     . TRP A 1 109 ? 7.895   -6.566  -1.512  1.00 24.01  ? 105 TRP A O     1 
ATOM   737  C  CB    . TRP A 1 109 ? 5.637   -4.267  -0.939  1.00 22.90  ? 105 TRP A CB    1 
ATOM   738  C  CG    . TRP A 1 109 ? 5.198   -2.954  -1.495  1.00 22.32  ? 105 TRP A CG    1 
ATOM   739  C  CD1   . TRP A 1 109 ? 3.975   -2.370  -1.347  1.00 21.84  ? 105 TRP A CD1   1 
ATOM   740  C  CD2   . TRP A 1 109 ? 5.971   -2.066  -2.317  1.00 22.32  ? 105 TRP A CD2   1 
ATOM   741  N  NE1   . TRP A 1 109 ? 3.938   -1.172  -2.018  1.00 22.14  ? 105 TRP A NE1   1 
ATOM   742  C  CE2   . TRP A 1 109 ? 5.149   -0.961  -2.622  1.00 21.99  ? 105 TRP A CE2   1 
ATOM   743  C  CE3   . TRP A 1 109 ? 7.281   -2.096  -2.821  1.00 21.84  ? 105 TRP A CE3   1 
ATOM   744  C  CZ2   . TRP A 1 109 ? 5.591   0.108   -3.411  1.00 22.35  ? 105 TRP A CZ2   1 
ATOM   745  C  CZ3   . TRP A 1 109 ? 7.721   -1.034  -3.604  1.00 22.11  ? 105 TRP A CZ3   1 
ATOM   746  C  CH2   . TRP A 1 109 ? 6.876   0.053   -3.891  1.00 22.36  ? 105 TRP A CH2   1 
ATOM   747  N  N     . LEU A 1 110 ? 5.912   -7.477  -0.933  1.00 24.66  ? 106 LEU A N     1 
ATOM   748  C  CA    . LEU A 1 110 ? 6.482   -8.724  -0.412  1.00 25.57  ? 106 LEU A CA    1 
ATOM   749  C  C     . LEU A 1 110 ? 7.170   -9.549  -1.507  1.00 26.43  ? 106 LEU A C     1 
ATOM   750  O  O     . LEU A 1 110 ? 8.231   -10.135 -1.271  1.00 26.38  ? 106 LEU A O     1 
ATOM   751  C  CB    . LEU A 1 110 ? 5.410   -9.551  0.309   1.00 25.45  ? 106 LEU A CB    1 
ATOM   752  C  CG    . LEU A 1 110 ? 5.817   -10.773 1.145   1.00 25.66  ? 106 LEU A CG    1 
ATOM   753  C  CD1   . LEU A 1 110 ? 6.912   -10.440 2.170   1.00 25.78  ? 106 LEU A CD1   1 
ATOM   754  C  CD2   . LEU A 1 110 ? 4.598   -11.371 1.833   1.00 25.07  ? 106 LEU A CD2   1 
ATOM   755  N  N     . THR A 1 111 ? 6.563   -9.582  -2.697  1.00 27.49  ? 107 THR A N     1 
ATOM   756  C  CA    . THR A 1 111 ? 7.150   -10.249 -3.865  1.00 28.38  ? 107 THR A CA    1 
ATOM   757  C  C     . THR A 1 111 ? 8.490   -9.617  -4.249  1.00 29.38  ? 107 THR A C     1 
ATOM   758  O  O     . THR A 1 111 ? 9.486   -10.328 -4.370  1.00 29.59  ? 107 THR A O     1 
ATOM   759  C  CB    . THR A 1 111 ? 6.183   -10.254 -5.073  1.00 28.34  ? 107 THR A CB    1 
ATOM   760  O  OG1   . THR A 1 111 ? 5.075   -11.122 -4.797  1.00 28.24  ? 107 THR A OG1   1 
ATOM   761  C  CG2   . THR A 1 111 ? 6.886   -10.733 -6.344  1.00 28.03  ? 107 THR A CG2   1 
ATOM   762  N  N     . ASP A 1 112 ? 8.513   -8.293  -4.429  1.00 30.50  ? 108 ASP A N     1 
ATOM   763  C  CA    . ASP A 1 112 ? 9.759   -7.558  -4.686  1.00 31.63  ? 108 ASP A CA    1 
ATOM   764  C  C     . ASP A 1 112 ? 10.810  -7.868  -3.631  1.00 32.11  ? 108 ASP A C     1 
ATOM   765  O  O     . ASP A 1 112 ? 11.934  -8.255  -3.958  1.00 32.47  ? 108 ASP A O     1 
ATOM   766  C  CB    . ASP A 1 112 ? 9.518   -6.046  -4.722  1.00 31.81  ? 108 ASP A CB    1 
ATOM   767  C  CG    . ASP A 1 112 ? 8.658   -5.618  -5.884  1.00 33.34  ? 108 ASP A CG    1 
ATOM   768  O  OD1   . ASP A 1 112 ? 8.468   -6.424  -6.820  1.00 35.34  ? 108 ASP A OD1   1 
ATOM   769  O  OD2   . ASP A 1 112 ? 8.167   -4.468  -5.867  1.00 34.98  ? 108 ASP A OD2   1 
ATOM   770  N  N     . ALA A 1 113 ? 10.430  -7.705  -2.365  1.00 32.70  ? 109 ALA A N     1 
ATOM   771  C  CA    . ALA A 1 113 ? 11.323  -7.970  -1.247  1.00 33.15  ? 109 ALA A CA    1 
ATOM   772  C  C     . ALA A 1 113 ? 12.016  -9.317  -1.426  1.00 33.56  ? 109 ALA A C     1 
ATOM   773  O  O     . ALA A 1 113 ? 13.234  -9.368  -1.614  1.00 33.99  ? 109 ALA A O     1 
ATOM   774  C  CB    . ALA A 1 113 ? 10.562  -7.917  0.076   1.00 33.16  ? 109 ALA A CB    1 
ATOM   775  N  N     . ARG A 1 114 ? 11.237  -10.397 -1.390  1.00 33.66  ? 110 ARG A N     1 
ATOM   776  C  CA    . ARG A 1 114 ? 11.773  -11.759 -1.479  1.00 33.64  ? 110 ARG A CA    1 
ATOM   777  C  C     . ARG A 1 114 ? 12.551  -12.019 -2.769  1.00 33.30  ? 110 ARG A C     1 
ATOM   778  O  O     . ARG A 1 114 ? 13.663  -12.537 -2.720  1.00 33.53  ? 110 ARG A O     1 
ATOM   779  C  CB    . ARG A 1 114 ? 10.654  -12.790 -1.287  1.00 33.83  ? 110 ARG A CB    1 
ATOM   780  C  CG    . ARG A 1 114 ? 10.101  -12.834 0.139   1.00 34.57  ? 110 ARG A CG    1 
ATOM   781  C  CD    . ARG A 1 114 ? 10.813  -13.884 0.973   1.00 35.89  ? 110 ARG A CD    1 
ATOM   782  N  NE    . ARG A 1 114 ? 10.980  -13.489 2.372   1.00 37.51  ? 110 ARG A NE    1 
ATOM   783  C  CZ    . ARG A 1 114 ? 10.098  -13.707 3.346   1.00 38.32  ? 110 ARG A CZ    1 
ATOM   784  N  NH1   . ARG A 1 114 ? 8.940   -14.313 3.098   1.00 38.79  ? 110 ARG A NH1   1 
ATOM   785  N  NH2   . ARG A 1 114 ? 10.378  -13.310 4.582   1.00 39.14  ? 110 ARG A NH2   1 
ATOM   786  N  N     . ASN A 1 115 ? 11.968  -11.632 -3.905  1.00 32.84  ? 111 ASN A N     1 
ATOM   787  C  CA    . ASN A 1 115 ? 12.587  -11.773 -5.238  1.00 32.33  ? 111 ASN A CA    1 
ATOM   788  C  C     . ASN A 1 115 ? 13.951  -11.084 -5.389  1.00 31.66  ? 111 ASN A C     1 
ATOM   789  O  O     . ASN A 1 115 ? 14.804  -11.553 -6.144  1.00 31.66  ? 111 ASN A O     1 
ATOM   790  C  CB    . ASN A 1 115 ? 11.622  -11.244 -6.316  1.00 32.57  ? 111 ASN A CB    1 
ATOM   791  C  CG    . ASN A 1 115 ? 12.157  -11.400 -7.737  1.00 33.54  ? 111 ASN A CG    1 
ATOM   792  O  OD1   . ASN A 1 115 ? 12.367  -12.514 -8.224  1.00 34.59  ? 111 ASN A OD1   1 
ATOM   793  N  ND2   . ASN A 1 115 ? 12.357  -10.273 -8.416  1.00 34.31  ? 111 ASN A ND2   1 
ATOM   794  N  N     . LEU A 1 116 ? 14.161  -9.981  -4.672  1.00 30.55  ? 112 LEU A N     1 
ATOM   795  C  CA    . LEU A 1 116 ? 15.326  -9.134  -4.932  1.00 29.56  ? 112 LEU A CA    1 
ATOM   796  C  C     . LEU A 1 116 ? 16.362  -9.041  -3.808  1.00 28.74  ? 112 LEU A C     1 
ATOM   797  O  O     . LEU A 1 116 ? 17.372  -8.345  -3.954  1.00 28.45  ? 112 LEU A O     1 
ATOM   798  C  CB    . LEU A 1 116 ? 14.881  -7.733  -5.379  1.00 29.65  ? 112 LEU A CB    1 
ATOM   799  C  CG    . LEU A 1 116 ? 14.182  -7.604  -6.739  1.00 30.16  ? 112 LEU A CG    1 
ATOM   800  C  CD1   . LEU A 1 116 ? 13.475  -6.264  -6.855  1.00 30.03  ? 112 LEU A CD1   1 
ATOM   801  C  CD2   . LEU A 1 116 ? 15.163  -7.800  -7.899  1.00 30.83  ? 112 LEU A CD2   1 
ATOM   802  N  N     . THR A 1 117 ? 16.126  -9.733  -2.696  1.00 27.77  ? 113 THR A N     1 
ATOM   803  C  CA    . THR A 1 117 ? 17.093  -9.730  -1.598  1.00 27.09  ? 113 THR A CA    1 
ATOM   804  C  C     . THR A 1 117 ? 17.857  -11.058 -1.551  1.00 26.77  ? 113 THR A C     1 
ATOM   805  O  O     . THR A 1 117 ? 18.251  -11.578 -2.598  1.00 26.53  ? 113 THR A O     1 
ATOM   806  C  CB    . THR A 1 117 ? 16.438  -9.369  -0.231  1.00 27.13  ? 113 THR A CB    1 
ATOM   807  O  OG1   . THR A 1 117 ? 15.433  -10.335 0.100   1.00 27.24  ? 113 THR A OG1   1 
ATOM   808  C  CG2   . THR A 1 117 ? 15.815  -7.971  -0.270  1.00 26.39  ? 113 THR A CG2   1 
ATOM   809  N  N     . ASN A 1 118 ? 18.082  -11.592 -0.351  1.00 26.27  ? 114 ASN A N     1 
ATOM   810  C  CA    . ASN A 1 118 ? 18.688  -12.915 -0.187  1.00 25.96  ? 114 ASN A CA    1 
ATOM   811  C  C     . ASN A 1 118 ? 17.869  -13.787 0.783   1.00 26.06  ? 114 ASN A C     1 
ATOM   812  O  O     . ASN A 1 118 ? 17.014  -13.264 1.498   1.00 26.00  ? 114 ASN A O     1 
ATOM   813  C  CB    . ASN A 1 118 ? 20.155  -12.791 0.247   1.00 25.82  ? 114 ASN A CB    1 
ATOM   814  C  CG    . ASN A 1 118 ? 20.307  -12.238 1.646   1.00 25.30  ? 114 ASN A CG    1 
ATOM   815  O  OD1   . ASN A 1 118 ? 20.022  -12.919 2.629   1.00 25.03  ? 114 ASN A OD1   1 
ATOM   816  N  ND2   . ASN A 1 118 ? 20.776  -11.002 1.744   1.00 24.62  ? 114 ASN A ND2   1 
ATOM   817  N  N     . PRO A 1 119 ? 18.120  -15.115 0.810   1.00 26.03  ? 115 PRO A N     1 
ATOM   818  C  CA    . PRO A 1 119 ? 17.272  -16.003 1.618   1.00 25.93  ? 115 PRO A CA    1 
ATOM   819  C  C     . PRO A 1 119 ? 17.277  -15.743 3.135   1.00 25.81  ? 115 PRO A C     1 
ATOM   820  O  O     . PRO A 1 119 ? 16.354  -16.180 3.820   1.00 25.75  ? 115 PRO A O     1 
ATOM   821  C  CB    . PRO A 1 119 ? 17.824  -17.401 1.301   1.00 26.02  ? 115 PRO A CB    1 
ATOM   822  C  CG    . PRO A 1 119 ? 18.555  -17.241 -0.003  1.00 25.90  ? 115 PRO A CG    1 
ATOM   823  C  CD    . PRO A 1 119 ? 19.158  -15.877 0.089   1.00 26.09  ? 115 PRO A CD    1 
ATOM   824  N  N     . ASN A 1 120 ? 18.283  -15.034 3.648   1.00 25.50  ? 116 ASN A N     1 
ATOM   825  C  CA    . ASN A 1 120 ? 18.323  -14.677 5.075   1.00 25.28  ? 116 ASN A CA    1 
ATOM   826  C  C     . ASN A 1 120 ? 17.505  -13.438 5.463   1.00 24.86  ? 116 ASN A C     1 
ATOM   827  O  O     . ASN A 1 120 ? 17.140  -13.281 6.627   1.00 25.08  ? 116 ASN A O     1 
ATOM   828  C  CB    . ASN A 1 120 ? 19.767  -14.496 5.564   1.00 25.43  ? 116 ASN A CB    1 
ATOM   829  C  CG    . ASN A 1 120 ? 20.387  -15.784 6.098   1.00 26.03  ? 116 ASN A CG    1 
ATOM   830  O  OD1   . ASN A 1 120 ? 19.704  -16.781 6.344   1.00 26.44  ? 116 ASN A OD1   1 
ATOM   831  N  ND2   . ASN A 1 120 ? 21.697  -15.758 6.285   1.00 26.68  ? 116 ASN A ND2   1 
ATOM   832  N  N     . THR A 1 121 ? 17.226  -12.567 4.495   1.00 24.15  ? 117 THR A N     1 
ATOM   833  C  CA    . THR A 1 121 ? 16.604  -11.267 4.766   1.00 23.63  ? 117 THR A CA    1 
ATOM   834  C  C     . THR A 1 121 ? 15.394  -11.379 5.696   1.00 23.40  ? 117 THR A C     1 
ATOM   835  O  O     . THR A 1 121 ? 14.438  -12.101 5.402   1.00 23.37  ? 117 THR A O     1 
ATOM   836  C  CB    . THR A 1 121 ? 16.206  -10.550 3.461   1.00 23.56  ? 117 THR A CB    1 
ATOM   837  O  OG1   . THR A 1 121 ? 17.322  -10.546 2.564   1.00 23.52  ? 117 THR A OG1   1 
ATOM   838  C  CG2   . THR A 1 121 ? 15.783  -9.115  3.735   1.00 23.44  ? 117 THR A CG2   1 
ATOM   839  N  N     . VAL A 1 122 ? 15.463  -10.667 6.819   1.00 22.94  ? 118 VAL A N     1 
ATOM   840  C  CA    . VAL A 1 122 ? 14.404  -10.656 7.827   1.00 22.53  ? 118 VAL A CA    1 
ATOM   841  C  C     . VAL A 1 122 ? 13.436  -9.507  7.537   1.00 22.33  ? 118 VAL A C     1 
ATOM   842  O  O     . VAL A 1 122 ? 13.842  -8.348  7.454   1.00 22.10  ? 118 VAL A O     1 
ATOM   843  C  CB    . VAL A 1 122 ? 14.994  -10.524 9.263   1.00 22.69  ? 118 VAL A CB    1 
ATOM   844  C  CG1   . VAL A 1 122 ? 13.897  -10.261 10.288  1.00 22.66  ? 118 VAL A CG1   1 
ATOM   845  C  CG2   . VAL A 1 122 ? 15.803  -11.769 9.644   1.00 22.36  ? 118 VAL A CG2   1 
ATOM   846  N  N     . ILE A 1 123 ? 12.155  -9.831  7.390   1.00 22.20  ? 119 ILE A N     1 
ATOM   847  C  CA    . ILE A 1 123 ? 11.160  -8.836  6.986   1.00 22.02  ? 119 ILE A CA    1 
ATOM   848  C  C     . ILE A 1 123 ? 10.186  -8.522  8.122   1.00 22.02  ? 119 ILE A C     1 
ATOM   849  O  O     . ILE A 1 123 ? 9.617   -9.433  8.729   1.00 22.32  ? 119 ILE A O     1 
ATOM   850  C  CB    . ILE A 1 123 ? 10.405  -9.267  5.684   1.00 21.98  ? 119 ILE A CB    1 
ATOM   851  C  CG1   . ILE A 1 123 ? 11.401  -9.485  4.539   1.00 21.55  ? 119 ILE A CG1   1 
ATOM   852  C  CG2   . ILE A 1 123 ? 9.347   -8.227  5.281   1.00 21.32  ? 119 ILE A CG2   1 
ATOM   853  C  CD1   . ILE A 1 123 ? 10.810  -10.137 3.299   1.00 22.02  ? 119 ILE A CD1   1 
ATOM   854  N  N     . ILE A 1 124 ? 10.014  -7.231  8.409   1.00 21.79  ? 120 ILE A N     1 
ATOM   855  C  CA    . ILE A 1 124 ? 9.035   -6.769  9.401   1.00 21.63  ? 120 ILE A CA    1 
ATOM   856  C  C     . ILE A 1 124 ? 7.964   -5.850  8.791   1.00 21.43  ? 120 ILE A C     1 
ATOM   857  O  O     . ILE A 1 124 ? 8.271   -4.918  8.047   1.00 21.44  ? 120 ILE A O     1 
ATOM   858  C  CB    . ILE A 1 124 ? 9.714   -6.098  10.632  1.00 21.53  ? 120 ILE A CB    1 
ATOM   859  C  CG1   . ILE A 1 124 ? 8.668   -5.639  11.660  1.00 21.96  ? 120 ILE A CG1   1 
ATOM   860  C  CG2   . ILE A 1 124 ? 10.595  -4.938  10.206  1.00 21.98  ? 120 ILE A CG2   1 
ATOM   861  C  CD1   . ILE A 1 124 ? 9.242   -5.210  13.008  1.00 21.55  ? 120 ILE A CD1   1 
ATOM   862  N  N     . LEU A 1 125 ? 6.708   -6.139  9.110   1.00 21.21  ? 121 LEU A N     1 
ATOM   863  C  CA    . LEU A 1 125 ? 5.582   -5.327  8.670   1.00 21.03  ? 121 LEU A CA    1 
ATOM   864  C  C     . LEU A 1 125 ? 5.316   -4.196  9.661   1.00 20.99  ? 121 LEU A C     1 
ATOM   865  O  O     . LEU A 1 125 ? 5.134   -4.437  10.857  1.00 21.29  ? 121 LEU A O     1 
ATOM   866  C  CB    . LEU A 1 125 ? 4.331   -6.205  8.513   1.00 20.87  ? 121 LEU A CB    1 
ATOM   867  C  CG    . LEU A 1 125 ? 3.017   -5.564  8.052   1.00 21.00  ? 121 LEU A CG    1 
ATOM   868  C  CD1   . LEU A 1 125 ? 3.108   -5.092  6.601   1.00 21.73  ? 121 LEU A CD1   1 
ATOM   869  C  CD2   . LEU A 1 125 ? 1.865   -6.536  8.223   1.00 20.83  ? 121 LEU A CD2   1 
ATOM   870  N  N     . ILE A 1 126 ? 5.294   -2.967  9.159   1.00 20.85  ? 122 ILE A N     1 
ATOM   871  C  CA    . ILE A 1 126 ? 4.966   -1.806  9.976   1.00 20.63  ? 122 ILE A CA    1 
ATOM   872  C  C     . ILE A 1 126 ? 3.697   -1.122  9.458   1.00 20.57  ? 122 ILE A C     1 
ATOM   873  O  O     . ILE A 1 126 ? 3.615   -0.740  8.284   1.00 20.11  ? 122 ILE A O     1 
ATOM   874  C  CB    . ILE A 1 126 ? 6.135   -0.765  10.030  1.00 20.71  ? 122 ILE A CB    1 
ATOM   875  C  CG1   . ILE A 1 126 ? 7.483   -1.416  10.401  1.00 20.75  ? 122 ILE A CG1   1 
ATOM   876  C  CG2   . ILE A 1 126 ? 5.784   0.415   10.949  1.00 20.48  ? 122 ILE A CG2   1 
ATOM   877  C  CD1   . ILE A 1 126 ? 7.536   -2.079  11.789  1.00 22.03  ? 122 ILE A CD1   1 
ATOM   878  N  N     . GLY A 1 127 ? 2.708   -0.996  10.338  1.00 20.47  ? 123 GLY A N     1 
ATOM   879  C  CA    . GLY A 1 127 ? 1.552   -0.139  10.093  1.00 20.69  ? 123 GLY A CA    1 
ATOM   880  C  C     . GLY A 1 127 ? 1.822   1.207   10.736  1.00 20.77  ? 123 GLY A C     1 
ATOM   881  O  O     . GLY A 1 127 ? 1.843   1.320   11.965  1.00 20.86  ? 123 GLY A O     1 
ATOM   882  N  N     . ASN A 1 128 ? 2.050   2.219   9.903   1.00 20.72  ? 124 ASN A N     1 
ATOM   883  C  CA    . ASN A 1 128 ? 2.418   3.549   10.368  1.00 20.71  ? 124 ASN A CA    1 
ATOM   884  C  C     . ASN A 1 128 ? 1.216   4.492   10.513  1.00 20.90  ? 124 ASN A C     1 
ATOM   885  O  O     . ASN A 1 128 ? 0.109   4.174   10.070  1.00 20.93  ? 124 ASN A O     1 
ATOM   886  C  CB    . ASN A 1 128 ? 3.475   4.156   9.438   1.00 20.78  ? 124 ASN A CB    1 
ATOM   887  C  CG    . ASN A 1 128 ? 4.169   5.363   10.050  1.00 20.78  ? 124 ASN A CG    1 
ATOM   888  O  OD1   . ASN A 1 128 ? 4.529   5.354   11.231  1.00 20.62  ? 124 ASN A OD1   1 
ATOM   889  N  ND2   . ASN A 1 128 ? 4.354   6.410   9.249   1.00 19.42  ? 124 ASN A ND2   1 
ATOM   890  N  N     . LYS A 1 129 ? 1.452   5.649   11.137  1.00 21.12  ? 125 LYS A N     1 
ATOM   891  C  CA    . LYS A 1 129 ? 0.418   6.653   11.438  1.00 21.32  ? 125 LYS A CA    1 
ATOM   892  C  C     . LYS A 1 129 ? -0.631  6.145   12.439  1.00 21.45  ? 125 LYS A C     1 
ATOM   893  O  O     . LYS A 1 129 ? -1.818  6.459   12.321  1.00 21.38  ? 125 LYS A O     1 
ATOM   894  C  CB    . LYS A 1 129 ? -0.241  7.208   10.154  1.00 21.49  ? 125 LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 129 ? 0.753   7.672   9.080   1.00 21.23  ? 125 LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 129 ? 0.082   8.466   7.961   1.00 21.54  ? 125 LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 129 ? 1.061   8.735   6.813   1.00 21.07  ? 125 LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 129 ? 0.576   9.790   5.886   1.00 21.37  ? 125 LYS A NZ    1 
ATOM   899  N  N     . ALA A 1 130 ? -0.175  5.380   13.435  1.00 21.64  ? 126 ALA A N     1 
ATOM   900  C  CA    . ALA A 1 130 ? -1.042  4.873   14.516  1.00 21.99  ? 126 ALA A CA    1 
ATOM   901  C  C     . ALA A 1 130 ? -1.612  5.983   15.399  1.00 22.38  ? 126 ALA A C     1 
ATOM   902  O  O     . ALA A 1 130 ? -2.585  5.769   16.121  1.00 22.60  ? 126 ALA A O     1 
ATOM   903  C  CB    . ALA A 1 130 ? -0.300  3.837   15.372  1.00 21.87  ? 126 ALA A CB    1 
ATOM   904  N  N     . ASP A 1 131 ? -1.011  7.167   15.331  1.00 22.77  ? 127 ASP A N     1 
ATOM   905  C  CA    . ASP A 1 131 ? -1.480  8.333   16.087  1.00 23.15  ? 127 ASP A CA    1 
ATOM   906  C  C     . ASP A 1 131 ? -2.831  8.860   15.588  1.00 23.56  ? 127 ASP A C     1 
ATOM   907  O  O     . ASP A 1 131 ? -3.576  9.491   16.343  1.00 23.29  ? 127 ASP A O     1 
ATOM   908  C  CB    . ASP A 1 131 ? -0.426  9.455   16.068  1.00 22.92  ? 127 ASP A CB    1 
ATOM   909  C  CG    . ASP A 1 131 ? -0.029  9.871   14.656  1.00 22.99  ? 127 ASP A CG    1 
ATOM   910  O  OD1   . ASP A 1 131 ? -0.328  11.023  14.273  1.00 23.00  ? 127 ASP A OD1   1 
ATOM   911  O  OD2   . ASP A 1 131 ? 0.582   9.051   13.930  1.00 22.28  ? 127 ASP A OD2   1 
ATOM   912  N  N     . LEU A 1 132 ? -3.139  8.594   14.320  1.00 24.07  ? 128 LEU A N     1 
ATOM   913  C  CA    . LEU A 1 132 ? -4.385  9.055   13.709  1.00 24.71  ? 128 LEU A CA    1 
ATOM   914  C  C     . LEU A 1 132 ? -5.508  8.040   13.929  1.00 25.21  ? 128 LEU A C     1 
ATOM   915  O  O     . LEU A 1 132 ? -6.077  7.501   12.972  1.00 25.23  ? 128 LEU A O     1 
ATOM   916  C  CB    . LEU A 1 132 ? -4.183  9.332   12.213  1.00 24.78  ? 128 LEU A CB    1 
ATOM   917  C  CG    . LEU A 1 132 ? -3.042  10.262  11.782  1.00 24.94  ? 128 LEU A CG    1 
ATOM   918  C  CD1   . LEU A 1 132 ? -2.870  10.212  10.267  1.00 24.21  ? 128 LEU A CD1   1 
ATOM   919  C  CD2   . LEU A 1 132 ? -3.272  11.698  12.268  1.00 24.60  ? 128 LEU A CD2   1 
ATOM   920  N  N     . GLU A 1 133 ? -5.820  7.804   15.204  1.00 25.82  ? 129 GLU A N     1 
ATOM   921  C  CA    . GLU A 1 133 ? -6.791  6.794   15.640  1.00 26.73  ? 129 GLU A CA    1 
ATOM   922  C  C     . GLU A 1 133 ? -8.171  6.930   14.997  1.00 26.38  ? 129 GLU A C     1 
ATOM   923  O  O     . GLU A 1 133 ? -8.744  5.941   14.528  1.00 26.51  ? 129 GLU A O     1 
ATOM   924  C  CB    . GLU A 1 133 ? -6.936  6.822   17.169  1.00 26.60  ? 129 GLU A CB    1 
ATOM   925  C  CG    . GLU A 1 133 ? -5.691  6.383   17.928  1.00 27.91  ? 129 GLU A CG    1 
ATOM   926  C  CD    . GLU A 1 133 ? -5.796  6.616   19.427  1.00 28.63  ? 129 GLU A CD    1 
ATOM   927  O  OE1   . GLU A 1 133 ? -6.920  6.536   19.972  1.00 31.79  ? 129 GLU A OE1   1 
ATOM   928  O  OE2   . GLU A 1 133 ? -4.749  6.874   20.064  1.00 31.25  ? 129 GLU A OE2   1 
ATOM   929  N  N     . ALA A 1 134 ? -8.694  8.154   14.978  1.00 26.22  ? 130 ALA A N     1 
ATOM   930  C  CA    . ALA A 1 134 ? -10.034 8.418   14.463  1.00 26.29  ? 130 ALA A CA    1 
ATOM   931  C  C     . ALA A 1 134 ? -10.181 8.067   12.979  1.00 26.07  ? 130 ALA A C     1 
ATOM   932  O  O     . ALA A 1 134 ? -11.290 7.831   12.503  1.00 26.17  ? 130 ALA A O     1 
ATOM   933  C  CB    . ALA A 1 134 ? -10.423 9.875   14.717  1.00 26.45  ? 130 ALA A CB    1 
ATOM   934  N  N     . GLN A 1 135 ? -9.056  8.007   12.269  1.00 25.69  ? 131 GLN A N     1 
ATOM   935  C  CA    . GLN A 1 135 ? -9.053  7.787   10.824  1.00 25.61  ? 131 GLN A CA    1 
ATOM   936  C  C     . GLN A 1 135 ? -8.588  6.392   10.398  1.00 25.00  ? 131 GLN A C     1 
ATOM   937  O  O     . GLN A 1 135 ? -8.351  6.148   9.206   1.00 24.95  ? 131 GLN A O     1 
ATOM   938  C  CB    . GLN A 1 135 ? -8.216  8.868   10.137  1.00 25.85  ? 131 GLN A CB    1 
ATOM   939  C  CG    . GLN A 1 135 ? -8.906  10.221  10.103  1.00 27.65  ? 131 GLN A CG    1 
ATOM   940  C  CD    . GLN A 1 135 ? -7.966  11.354  9.759   1.00 29.69  ? 131 GLN A CD    1 
ATOM   941  O  OE1   . GLN A 1 135 ? -6.824  11.389  10.217  1.00 30.63  ? 131 GLN A OE1   1 
ATOM   942  N  NE2   . GLN A 1 135 ? -8.449  12.301  8.957   1.00 29.79  ? 131 GLN A NE2   1 
ATOM   943  N  N     . ARG A 1 136 ? -8.471  5.485   11.369  1.00 24.19  ? 132 ARG A N     1 
ATOM   944  C  CA    . ARG A 1 136 ? -8.113  4.087   11.111  1.00 23.63  ? 132 ARG A CA    1 
ATOM   945  C  C     . ARG A 1 136 ? -8.983  3.466   10.015  1.00 23.59  ? 132 ARG A C     1 
ATOM   946  O  O     . ARG A 1 136 ? -10.211 3.531   10.080  1.00 23.56  ? 132 ARG A O     1 
ATOM   947  C  CB    . ARG A 1 136 ? -8.224  3.258   12.394  1.00 23.41  ? 132 ARG A CB    1 
ATOM   948  C  CG    . ARG A 1 136 ? -7.978  1.780   12.200  1.00 22.93  ? 132 ARG A CG    1 
ATOM   949  C  CD    . ARG A 1 136 ? -8.116  0.999   13.503  1.00 23.26  ? 132 ARG A CD    1 
ATOM   950  N  NE    . ARG A 1 136 ? -6.976  1.200   14.398  1.00 22.15  ? 132 ARG A NE    1 
ATOM   951  C  CZ    . ARG A 1 136 ? -5.819  0.542   14.316  1.00 22.04  ? 132 ARG A CZ    1 
ATOM   952  N  NH1   . ARG A 1 136 ? -5.623  -0.375  13.373  1.00 21.05  ? 132 ARG A NH1   1 
ATOM   953  N  NH2   . ARG A 1 136 ? -4.845  0.805   15.184  1.00 21.26  ? 132 ARG A NH2   1 
ATOM   954  N  N     . ASP A 1 137 ? -8.333  2.864   9.020   1.00 23.42  ? 133 ASP A N     1 
ATOM   955  C  CA    . ASP A 1 137 ? -9.021  2.254   7.879   1.00 23.26  ? 133 ASP A CA    1 
ATOM   956  C  C     . ASP A 1 137 ? -8.733  0.754   7.806   1.00 23.25  ? 133 ASP A C     1 
ATOM   957  O  O     . ASP A 1 137 ? -9.443  0.014   7.127   1.00 23.41  ? 133 ASP A O     1 
ATOM   958  C  CB    . ASP A 1 137 ? -8.586  2.956   6.586   1.00 23.19  ? 133 ASP A CB    1 
ATOM   959  C  CG    . ASP A 1 137 ? -9.497  2.655   5.394   1.00 23.06  ? 133 ASP A CG    1 
ATOM   960  O  OD1   . ASP A 1 137 ? -10.705 2.383   5.573   1.00 21.21  ? 133 ASP A OD1   1 
ATOM   961  O  OD2   . ASP A 1 137 ? -8.987  2.713   4.255   1.00 22.96  ? 133 ASP A OD2   1 
ATOM   962  N  N     . VAL A 1 138 ? -7.687  0.320   8.509   1.00 23.46  ? 134 VAL A N     1 
ATOM   963  C  CA    . VAL A 1 138 ? -7.258  -1.082  8.543   1.00 23.49  ? 134 VAL A CA    1 
ATOM   964  C  C     . VAL A 1 138 ? -7.151  -1.542  10.005  1.00 23.63  ? 134 VAL A C     1 
ATOM   965  O  O     . VAL A 1 138 ? -6.567  -0.843  10.835  1.00 23.50  ? 134 VAL A O     1 
ATOM   966  C  CB    . VAL A 1 138 ? -5.883  -1.280  7.836   1.00 23.60  ? 134 VAL A CB    1 
ATOM   967  C  CG1   . VAL A 1 138 ? -5.468  -2.757  7.821   1.00 23.43  ? 134 VAL A CG1   1 
ATOM   968  C  CG2   . VAL A 1 138 ? -5.904  -0.728  6.405   1.00 24.01  ? 134 VAL A CG2   1 
ATOM   969  N  N     . THR A 1 139 ? -7.707  -2.714  10.311  1.00 23.79  ? 135 THR A N     1 
ATOM   970  C  CA    . THR A 1 139 ? -7.656  -3.261  11.675  1.00 24.08  ? 135 THR A CA    1 
ATOM   971  C  C     . THR A 1 139 ? -6.299  -3.886  12.005  1.00 24.39  ? 135 THR A C     1 
ATOM   972  O  O     . THR A 1 139 ? -5.599  -4.386  11.117  1.00 23.99  ? 135 THR A O     1 
ATOM   973  C  CB    . THR A 1 139 ? -8.764  -4.325  11.947  1.00 24.00  ? 135 THR A CB    1 
ATOM   974  O  OG1   . THR A 1 139 ? -8.422  -5.564  11.314  1.00 23.70  ? 135 THR A OG1   1 
ATOM   975  C  CG2   . THR A 1 139 ? -10.136 -3.848  11.473  1.00 23.57  ? 135 THR A CG2   1 
ATOM   976  N  N     . TYR A 1 140 ? -5.945  -3.854  13.289  1.00 24.68  ? 136 TYR A N     1 
ATOM   977  C  CA    . TYR A 1 140 ? -4.761  -4.545  13.795  1.00 25.09  ? 136 TYR A CA    1 
ATOM   978  C  C     . TYR A 1 140 ? -4.858  -6.035  13.463  1.00 25.28  ? 136 TYR A C     1 
ATOM   979  O  O     . TYR A 1 140 ? -3.881  -6.651  13.028  1.00 25.10  ? 136 TYR A O     1 
ATOM   980  C  CB    . TYR A 1 140 ? -4.627  -4.348  15.317  1.00 25.48  ? 136 TYR A CB    1 
ATOM   981  C  CG    . TYR A 1 140 ? -3.461  -5.096  15.937  1.00 25.77  ? 136 TYR A CG    1 
ATOM   982  C  CD1   . TYR A 1 140 ? -2.225  -4.480  16.103  1.00 26.02  ? 136 TYR A CD1   1 
ATOM   983  C  CD2   . TYR A 1 140 ? -3.593  -6.425  16.344  1.00 26.39  ? 136 TYR A CD2   1 
ATOM   984  C  CE1   . TYR A 1 140 ? -1.148  -5.163  16.663  1.00 26.30  ? 136 TYR A CE1   1 
ATOM   985  C  CE2   . TYR A 1 140 ? -2.518  -7.121  16.903  1.00 26.83  ? 136 TYR A CE2   1 
ATOM   986  C  CZ    . TYR A 1 140 ? -1.301  -6.478  17.057  1.00 26.29  ? 136 TYR A CZ    1 
ATOM   987  O  OH    . TYR A 1 140 ? -0.236  -7.150  17.605  1.00 26.89  ? 136 TYR A OH    1 
ATOM   988  N  N     . GLU A 1 141 ? -6.056  -6.588  13.659  1.00 25.46  ? 137 GLU A N     1 
ATOM   989  C  CA    . GLU A 1 141 ? -6.320  -8.017  13.514  1.00 25.83  ? 137 GLU A CA    1 
ATOM   990  C  C     . GLU A 1 141 ? -6.043  -8.587  12.118  1.00 25.55  ? 137 GLU A C     1 
ATOM   991  O  O     . GLU A 1 141 ? -5.389  -9.631  11.997  1.00 25.53  ? 137 GLU A O     1 
ATOM   992  C  CB    . GLU A 1 141 ? -7.758  -8.338  13.945  1.00 26.19  ? 137 GLU A CB    1 
ATOM   993  C  CG    . GLU A 1 141 ? -7.987  -8.301  15.463  1.00 28.05  ? 137 GLU A CG    1 
ATOM   994  C  CD    . GLU A 1 141 ? -8.139  -6.890  16.042  1.00 30.24  ? 137 GLU A CD    1 
ATOM   995  O  OE1   . GLU A 1 141 ? -8.058  -5.889  15.293  1.00 30.53  ? 137 GLU A OE1   1 
ATOM   996  O  OE2   . GLU A 1 141 ? -8.350  -6.786  17.269  1.00 32.13  ? 137 GLU A OE2   1 
ATOM   997  N  N     . GLU A 1 142 ? -6.535  -7.920  11.073  1.00 25.06  ? 138 GLU A N     1 
ATOM   998  C  CA    . GLU A 1 142 ? -6.337  -8.419  9.703   1.00 24.57  ? 138 GLU A CA    1 
ATOM   999  C  C     . GLU A 1 142 ? -4.868  -8.371  9.275   1.00 24.65  ? 138 GLU A C     1 
ATOM   1000 O  O     . GLU A 1 142 ? -4.373  -9.293  8.617   1.00 24.79  ? 138 GLU A O     1 
ATOM   1001 C  CB    . GLU A 1 142 ? -7.240  -7.698  8.692   1.00 24.64  ? 138 GLU A CB    1 
ATOM   1002 C  CG    . GLU A 1 142 ? -7.037  -6.183  8.591   1.00 24.11  ? 138 GLU A CG    1 
ATOM   1003 C  CD    . GLU A 1 142 ? -8.040  -5.522  7.667   1.00 24.09  ? 138 GLU A CD    1 
ATOM   1004 O  OE1   . GLU A 1 142 ? -8.521  -4.419  8.000   1.00 23.22  ? 138 GLU A OE1   1 
ATOM   1005 O  OE2   . GLU A 1 142 ? -8.354  -6.113  6.613   1.00 22.27  ? 138 GLU A OE2   1 
ATOM   1006 N  N     . ALA A 1 143 ? -4.177  -7.302  9.668   1.00 24.53  ? 139 ALA A N     1 
ATOM   1007 C  CA    . ALA A 1 143 ? -2.753  -7.148  9.379   1.00 24.62  ? 139 ALA A CA    1 
ATOM   1008 C  C     . ALA A 1 143 ? -1.906  -8.161  10.146  1.00 24.66  ? 139 ALA A C     1 
ATOM   1009 O  O     . ALA A 1 143 ? -0.893  -8.640  9.633   1.00 24.78  ? 139 ALA A O     1 
ATOM   1010 C  CB    . ALA A 1 143 ? -2.298  -5.727  9.683   1.00 24.53  ? 139 ALA A CB    1 
ATOM   1011 N  N     . LYS A 1 144 ? -2.323  -8.481  11.372  1.00 24.73  ? 140 LYS A N     1 
ATOM   1012 C  CA    . LYS A 1 144 ? -1.641  -9.489  12.187  1.00 24.70  ? 140 LYS A CA    1 
ATOM   1013 C  C     . LYS A 1 144 ? -1.727  -10.881 11.551  1.00 24.61  ? 140 LYS A C     1 
ATOM   1014 O  O     . LYS A 1 144 ? -0.772  -11.656 11.607  1.00 24.90  ? 140 LYS A O     1 
ATOM   1015 C  CB    . LYS A 1 144 ? -2.204  -9.508  13.608  1.00 24.75  ? 140 LYS A CB    1 
ATOM   1016 N  N     . GLN A 1 145 ? -2.870  -11.186 10.944  1.00 24.49  ? 141 GLN A N     1 
ATOM   1017 C  CA    . GLN A 1 145 ? -3.068  -12.457 10.259  1.00 24.10  ? 141 GLN A CA    1 
ATOM   1018 C  C     . GLN A 1 145 ? -2.267  -12.547 8.959   1.00 23.96  ? 141 GLN A C     1 
ATOM   1019 O  O     . GLN A 1 145 ? -1.749  -13.614 8.633   1.00 24.14  ? 141 GLN A O     1 
ATOM   1020 C  CB    . GLN A 1 145 ? -4.552  -12.708 10.005  1.00 24.31  ? 141 GLN A CB    1 
ATOM   1021 N  N     . PHE A 1 146 ? -2.169  -11.440 8.218   1.00 23.67  ? 142 PHE A N     1 
ATOM   1022 C  CA    . PHE A 1 146 ? -1.300  -11.380 7.030   1.00 23.24  ? 142 PHE A CA    1 
ATOM   1023 C  C     . PHE A 1 146 ? 0.151   -11.642 7.429   1.00 23.25  ? 142 PHE A C     1 
ATOM   1024 O  O     . PHE A 1 146 ? 0.846   -12.435 6.786   1.00 22.88  ? 142 PHE A O     1 
ATOM   1025 C  CB    . PHE A 1 146 ? -1.424  -10.025 6.316   1.00 23.04  ? 142 PHE A CB    1 
ATOM   1026 C  CG    . PHE A 1 146 ? -0.595  -9.913  5.048   1.00 23.07  ? 142 PHE A CG    1 
ATOM   1027 C  CD1   . PHE A 1 146 ? -1.069  -10.421 3.836   1.00 22.31  ? 142 PHE A CD1   1 
ATOM   1028 C  CD2   . PHE A 1 146 ? 0.652   -9.275  5.063   1.00 22.80  ? 142 PHE A CD2   1 
ATOM   1029 C  CE1   . PHE A 1 146 ? -0.308  -10.308 2.661   1.00 22.27  ? 142 PHE A CE1   1 
ATOM   1030 C  CE2   . PHE A 1 146 ? 1.426   -9.161  3.894   1.00 22.13  ? 142 PHE A CE2   1 
ATOM   1031 C  CZ    . PHE A 1 146 ? 0.944   -9.673  2.692   1.00 22.11  ? 142 PHE A CZ    1 
ATOM   1032 N  N     . ALA A 1 147 ? 0.589   -10.982 8.503   1.00 23.31  ? 143 ALA A N     1 
ATOM   1033 C  CA    . ALA A 1 147 ? 1.952   -11.133 9.017   1.00 23.86  ? 143 ALA A CA    1 
ATOM   1034 C  C     . ALA A 1 147 ? 2.246   -12.561 9.472   1.00 24.11  ? 143 ALA A C     1 
ATOM   1035 O  O     . ALA A 1 147 ? 3.311   -13.098 9.177   1.00 24.21  ? 143 ALA A O     1 
ATOM   1036 C  CB    . ALA A 1 147 ? 2.209   -10.147 10.150  1.00 23.83  ? 143 ALA A CB    1 
ATOM   1037 N  N     . GLU A 1 148 ? 1.294   -13.167 10.182  1.00 24.73  ? 144 GLU A N     1 
ATOM   1038 C  CA    . GLU A 1 148 ? 1.447   -14.530 10.699  1.00 25.07  ? 144 GLU A CA    1 
ATOM   1039 C  C     . GLU A 1 148 ? 1.518   -15.550 9.567   1.00 25.46  ? 144 GLU A C     1 
ATOM   1040 O  O     . GLU A 1 148 ? 2.365   -16.439 9.593   1.00 25.53  ? 144 GLU A O     1 
ATOM   1041 C  CB    . GLU A 1 148 ? 0.320   -14.868 11.677  1.00 25.18  ? 144 GLU A CB    1 
ATOM   1042 N  N     . GLU A 1 149 ? 0.641   -15.401 8.570   1.00 25.80  ? 145 GLU A N     1 
ATOM   1043 C  CA    . GLU A 1 149 ? 0.652   -16.237 7.358   1.00 26.13  ? 145 GLU A CA    1 
ATOM   1044 C  C     . GLU A 1 149 ? 2.004   -16.249 6.651   1.00 26.12  ? 145 GLU A C     1 
ATOM   1045 O  O     . GLU A 1 149 ? 2.436   -17.282 6.133   1.00 26.16  ? 145 GLU A O     1 
ATOM   1046 C  CB    . GLU A 1 149 ? -0.396  -15.742 6.355   1.00 26.11  ? 145 GLU A CB    1 
ATOM   1047 C  CG    . GLU A 1 149 ? -1.654  -16.581 6.259   1.00 26.49  ? 145 GLU A CG    1 
ATOM   1048 C  CD    . GLU A 1 149 ? -2.469  -16.285 5.006   1.00 26.50  ? 145 GLU A CD    1 
ATOM   1049 O  OE1   . GLU A 1 149 ? -1.948  -15.657 4.056   1.00 26.13  ? 145 GLU A OE1   1 
ATOM   1050 O  OE2   . GLU A 1 149 ? -3.646  -16.685 4.975   1.00 27.51  ? 145 GLU A OE2   1 
ATOM   1051 N  N     . ASN A 1 150 ? 2.651   -15.087 6.617   1.00 26.26  ? 146 ASN A N     1 
ATOM   1052 C  CA    . ASN A 1 150 ? 3.857   -14.883 5.821   1.00 26.20  ? 146 ASN A CA    1 
ATOM   1053 C  C     . ASN A 1 150 ? 5.140   -14.918 6.658   1.00 26.21  ? 146 ASN A C     1 
ATOM   1054 O  O     . ASN A 1 150 ? 6.239   -14.676 6.144   1.00 26.01  ? 146 ASN A O     1 
ATOM   1055 C  CB    . ASN A 1 150 ? 3.737   -13.571 5.038   1.00 26.32  ? 146 ASN A CB    1 
ATOM   1056 C  CG    . ASN A 1 150 ? 2.651   -13.625 3.971   1.00 26.89  ? 146 ASN A CG    1 
ATOM   1057 O  OD1   . ASN A 1 150 ? 2.833   -14.246 2.923   1.00 27.73  ? 146 ASN A OD1   1 
ATOM   1058 N  ND2   . ASN A 1 150 ? 1.520   -12.968 4.229   1.00 26.24  ? 146 ASN A ND2   1 
ATOM   1059 N  N     . GLY A 1 151 ? 4.983   -15.223 7.946   1.00 26.27  ? 147 GLY A N     1 
ATOM   1060 C  CA    . GLY A 1 151 ? 6.102   -15.339 8.880   1.00 26.48  ? 147 GLY A CA    1 
ATOM   1061 C  C     . GLY A 1 151 ? 6.849   -14.038 9.114   1.00 26.65  ? 147 GLY A C     1 
ATOM   1062 O  O     . GLY A 1 151 ? 8.073   -14.039 9.243   1.00 26.95  ? 147 GLY A O     1 
ATOM   1063 N  N     . LEU A 1 152 ? 6.112   -12.930 9.169   1.00 26.50  ? 148 LEU A N     1 
ATOM   1064 C  CA    . LEU A 1 152 ? 6.711   -11.616 9.359   1.00 26.27  ? 148 LEU A CA    1 
ATOM   1065 C  C     . LEU A 1 152 ? 6.506   -11.153 10.793  1.00 26.57  ? 148 LEU A C     1 
ATOM   1066 O  O     . LEU A 1 152 ? 5.567   -11.582 11.466  1.00 26.36  ? 148 LEU A O     1 
ATOM   1067 C  CB    . LEU A 1 152 ? 6.095   -10.590 8.396   1.00 26.05  ? 148 LEU A CB    1 
ATOM   1068 C  CG    . LEU A 1 152 ? 5.810   -10.975 6.935   1.00 25.54  ? 148 LEU A CG    1 
ATOM   1069 C  CD1   . LEU A 1 152 ? 5.019   -9.877  6.237   1.00 25.01  ? 148 LEU A CD1   1 
ATOM   1070 C  CD2   . LEU A 1 152 ? 7.085   -11.297 6.159   1.00 24.63  ? 148 LEU A CD2   1 
ATOM   1071 N  N     . LEU A 1 153 ? 7.392   -10.280 11.258  1.00 26.70  ? 149 LEU A N     1 
ATOM   1072 C  CA    . LEU A 1 153 ? 7.146   -9.547  12.491  1.00 27.50  ? 149 LEU A CA    1 
ATOM   1073 C  C     . LEU A 1 153 ? 6.165   -8.425  12.181  1.00 26.53  ? 149 LEU A C     1 
ATOM   1074 O  O     . LEU A 1 153 ? 6.076   -7.981  11.036  1.00 26.46  ? 149 LEU A O     1 
ATOM   1075 C  CB    . LEU A 1 153 ? 8.463   -9.064  13.099  1.00 27.25  ? 149 LEU A CB    1 
ATOM   1076 C  CG    . LEU A 1 153 ? 9.477   -10.148 13.468  1.00 28.34  ? 149 LEU A CG    1 
ATOM   1077 C  CD1   . LEU A 1 153 ? 10.734  -9.530  14.058  1.00 20.00  ? 149 LEU A CD1   1 
ATOM   1078 C  CD2   . LEU A 1 153 ? 8.866   -11.148 14.437  1.00 20.00  ? 149 LEU A CD2   1 
ATOM   1079 N  N     . PHE A 1 154 ? 5.428   -7.978  13.196  1.00 25.82  ? 150 PHE A N     1 
ATOM   1080 C  CA    . PHE A 1 154 ? 4.405   -6.954  13.011  1.00 25.20  ? 150 PHE A CA    1 
ATOM   1081 C  C     . PHE A 1 154 ? 4.285   -5.994  14.194  1.00 24.86  ? 150 PHE A C     1 
ATOM   1082 O  O     . PHE A 1 154 ? 4.104   -6.410  15.345  1.00 24.73  ? 150 PHE A O     1 
ATOM   1083 C  CB    . PHE A 1 154 ? 3.044   -7.594  12.682  1.00 25.01  ? 150 PHE A CB    1 
ATOM   1084 C  CG    . PHE A 1 154 ? 1.899   -6.608  12.627  1.00 24.95  ? 150 PHE A CG    1 
ATOM   1085 C  CD1   . PHE A 1 154 ? 1.944   -5.502  11.780  1.00 24.14  ? 150 PHE A CD1   1 
ATOM   1086 C  CD2   . PHE A 1 154 ? 0.772   -6.793  13.418  1.00 25.00  ? 150 PHE A CD2   1 
ATOM   1087 C  CE1   . PHE A 1 154 ? 0.898   -4.596  11.737  1.00 24.12  ? 150 PHE A CE1   1 
ATOM   1088 C  CE2   . PHE A 1 154 ? -0.286  -5.890  13.376  1.00 24.61  ? 150 PHE A CE2   1 
ATOM   1089 C  CZ    . PHE A 1 154 ? -0.221  -4.792  12.534  1.00 24.43  ? 150 PHE A CZ    1 
ATOM   1090 N  N     . LEU A 1 155 ? 4.392   -4.703  13.886  1.00 24.45  ? 151 LEU A N     1 
ATOM   1091 C  CA    . LEU A 1 155 ? 4.125   -3.630  14.843  1.00 24.09  ? 151 LEU A CA    1 
ATOM   1092 C  C     . LEU A 1 155 ? 3.323   -2.502  14.202  1.00 23.76  ? 151 LEU A C     1 
ATOM   1093 O  O     . LEU A 1 155 ? 3.531   -2.156  13.035  1.00 23.34  ? 151 LEU A O     1 
ATOM   1094 C  CB    . LEU A 1 155 ? 5.433   -3.070  15.426  1.00 24.10  ? 151 LEU A CB    1 
ATOM   1095 C  CG    . LEU A 1 155 ? 6.182   -3.953  16.432  1.00 24.21  ? 151 LEU A CG    1 
ATOM   1096 C  CD1   . LEU A 1 155 ? 7.607   -3.480  16.629  1.00 24.10  ? 151 LEU A CD1   1 
ATOM   1097 C  CD2   . LEU A 1 155 ? 5.443   -4.049  17.779  1.00 24.94  ? 151 LEU A CD2   1 
ATOM   1098 N  N     . GLU A 1 156 ? 2.388   -1.953  14.967  1.00 23.55  ? 152 GLU A N     1 
ATOM   1099 C  CA    . GLU A 1 156 ? 1.769   -0.684  14.616  1.00 23.45  ? 152 GLU A CA    1 
ATOM   1100 C  C     . GLU A 1 156 ? 2.580   0.410   15.290  1.00 23.57  ? 152 GLU A C     1 
ATOM   1101 O  O     . GLU A 1 156 ? 2.904   0.314   16.477  1.00 23.36  ? 152 GLU A O     1 
ATOM   1102 C  CB    . GLU A 1 156 ? 0.298   -0.630  15.038  1.00 23.40  ? 152 GLU A CB    1 
ATOM   1103 C  CG    . GLU A 1 156 ? -0.645  -1.428  14.127  1.00 23.17  ? 152 GLU A CG    1 
ATOM   1104 C  CD    . GLU A 1 156 ? -2.123  -1.111  14.354  1.00 23.28  ? 152 GLU A CD    1 
ATOM   1105 O  OE1   . GLU A 1 156 ? -2.447  -0.371  15.309  1.00 22.33  ? 152 GLU A OE1   1 
ATOM   1106 O  OE2   . GLU A 1 156 ? -2.966  -1.602  13.567  1.00 22.38  ? 152 GLU A OE2   1 
ATOM   1107 N  N     . ALA A 1 157 ? 2.922   1.436   14.520  1.00 23.75  ? 153 ALA A N     1 
ATOM   1108 C  CA    . ALA A 1 157 ? 3.849   2.460   14.974  1.00 24.21  ? 153 ALA A CA    1 
ATOM   1109 C  C     . ALA A 1 157 ? 3.421   3.869   14.559  1.00 24.60  ? 153 ALA A C     1 
ATOM   1110 O  O     . ALA A 1 157 ? 2.471   4.046   13.784  1.00 24.41  ? 153 ALA A O     1 
ATOM   1111 C  CB    . ALA A 1 157 ? 5.260   2.152   14.465  1.00 24.08  ? 153 ALA A CB    1 
ATOM   1112 N  N     . SER A 1 158 ? 4.126   4.863   15.095  1.00 25.03  ? 154 SER A N     1 
ATOM   1113 C  CA    . SER A 1 158 ? 3.898   6.256   14.744  1.00 25.76  ? 154 SER A CA    1 
ATOM   1114 C  C     . SER A 1 158 ? 5.221   7.006   14.635  1.00 26.28  ? 154 SER A C     1 
ATOM   1115 O  O     . SER A 1 158 ? 5.862   7.307   15.653  1.00 26.33  ? 154 SER A O     1 
ATOM   1116 C  CB    . SER A 1 158 ? 2.981   6.932   15.774  1.00 25.64  ? 154 SER A CB    1 
ATOM   1117 O  OG    . SER A 1 158 ? 2.953   8.340   15.592  1.00 25.27  ? 154 SER A OG    1 
ATOM   1118 N  N     . ALA A 1 159 ? 5.617   7.310   13.400  1.00 26.73  ? 155 ALA A N     1 
ATOM   1119 C  CA    . ALA A 1 159 ? 6.819   8.101   13.133  1.00 27.26  ? 155 ALA A CA    1 
ATOM   1120 C  C     . ALA A 1 159 ? 6.722   9.492   13.745  1.00 27.68  ? 155 ALA A C     1 
ATOM   1121 O  O     . ALA A 1 159 ? 7.743   10.101  14.074  1.00 27.81  ? 155 ALA A O     1 
ATOM   1122 C  CB    . ALA A 1 159 ? 7.066   8.208   11.644  1.00 27.15  ? 155 ALA A CB    1 
ATOM   1123 N  N     . LYS A 1 160 ? 5.492   9.983   13.891  1.00 28.12  ? 156 LYS A N     1 
ATOM   1124 C  CA    . LYS A 1 160 ? 5.238   11.313  14.434  1.00 28.52  ? 156 LYS A CA    1 
ATOM   1125 C  C     . LYS A 1 160 ? 5.515   11.395  15.934  1.00 28.66  ? 156 LYS A C     1 
ATOM   1126 O  O     . LYS A 1 160 ? 6.218   12.298  16.394  1.00 28.88  ? 156 LYS A O     1 
ATOM   1127 C  CB    . LYS A 1 160 ? 3.805   11.754  14.139  1.00 28.53  ? 156 LYS A CB    1 
ATOM   1128 C  CG    . LYS A 1 160 ? 3.556   13.222  14.428  1.00 29.51  ? 156 LYS A CG    1 
ATOM   1129 C  CD    . LYS A 1 160 ? 2.082   13.579  14.375  1.00 30.85  ? 156 LYS A CD    1 
ATOM   1130 C  CE    . LYS A 1 160 ? 1.896   15.067  14.613  1.00 32.23  ? 156 LYS A CE    1 
ATOM   1131 N  NZ    . LYS A 1 160 ? 0.493   15.393  14.975  1.00 34.04  ? 156 LYS A NZ    1 
ATOM   1132 N  N     . THR A 1 161 ? 4.963   10.451  16.689  1.00 28.84  ? 157 THR A N     1 
ATOM   1133 C  CA    . THR A 1 161 ? 5.080   10.468  18.147  1.00 28.83  ? 157 THR A CA    1 
ATOM   1134 C  C     . THR A 1 161 ? 6.292   9.684   18.640  1.00 29.15  ? 157 THR A C     1 
ATOM   1135 O  O     . THR A 1 161 ? 6.807   9.948   19.729  1.00 29.26  ? 157 THR A O     1 
ATOM   1136 C  CB    . THR A 1 161 ? 3.804   9.933   18.831  1.00 28.68  ? 157 THR A CB    1 
ATOM   1137 O  OG1   . THR A 1 161 ? 3.678   8.526   18.591  1.00 27.71  ? 157 THR A OG1   1 
ATOM   1138 C  CG2   . THR A 1 161 ? 2.561   10.667  18.310  1.00 28.49  ? 157 THR A CG2   1 
ATOM   1139 N  N     . GLY A 1 162 ? 6.737   8.722   17.835  1.00 29.49  ? 158 GLY A N     1 
ATOM   1140 C  CA    . GLY A 1 162 ? 7.871   7.870   18.184  1.00 29.79  ? 158 GLY A CA    1 
ATOM   1141 C  C     . GLY A 1 162 ? 7.454   6.526   18.750  1.00 30.22  ? 158 GLY A C     1 
ATOM   1142 O  O     . GLY A 1 162 ? 8.305   5.692   19.064  1.00 30.35  ? 158 GLY A O     1 
ATOM   1143 N  N     . GLU A 1 163 ? 6.145   6.319   18.882  1.00 30.60  ? 159 GLU A N     1 
ATOM   1144 C  CA    . GLU A 1 163 ? 5.588   5.077   19.421  1.00 31.21  ? 159 GLU A CA    1 
ATOM   1145 C  C     . GLU A 1 163 ? 5.922   3.821   18.615  1.00 31.19  ? 159 GLU A C     1 
ATOM   1146 O  O     . GLU A 1 163 ? 5.541   3.696   17.447  1.00 30.97  ? 159 GLU A O     1 
ATOM   1147 C  CB    . GLU A 1 163 ? 4.060   5.185   19.570  1.00 31.25  ? 159 GLU A CB    1 
ATOM   1148 C  CG    . GLU A 1 163 ? 3.361   3.912   20.035  1.00 31.75  ? 159 GLU A CG    1 
ATOM   1149 C  CD    . GLU A 1 163 ? 1.837   3.983   19.951  1.00 32.36  ? 159 GLU A CD    1 
ATOM   1150 O  OE1   . GLU A 1 163 ? 1.330   4.863   19.232  1.00 33.94  ? 159 GLU A OE1   1 
ATOM   1151 O  OE2   . GLU A 1 163 ? 1.173   3.143   20.602  1.00 33.67  ? 159 GLU A OE2   1 
ATOM   1152 N  N     . ASN A 1 164 ? 6.637   2.915   19.268  1.00 31.14  ? 160 ASN A N     1 
ATOM   1153 C  CA    . ASN A 1 164 ? 7.098   1.637   18.716  1.00 31.32  ? 160 ASN A CA    1 
ATOM   1154 C  C     . ASN A 1 164 ? 8.149   1.736   17.577  1.00 31.28  ? 160 ASN A C     1 
ATOM   1155 O  O     . ASN A 1 164 ? 8.456   0.737   16.930  1.00 31.29  ? 160 ASN A O     1 
ATOM   1156 C  CB    . ASN A 1 164 ? 5.864   0.807   18.349  1.00 31.48  ? 160 ASN A CB    1 
ATOM   1157 C  CG    . ASN A 1 164 ? 5.199   0.291   19.622  1.00 32.05  ? 160 ASN A CG    1 
ATOM   1158 O  OD1   . ASN A 1 164 ? 5.841   0.150   20.666  1.00 32.14  ? 160 ASN A OD1   1 
ATOM   1159 N  ND2   . ASN A 1 164 ? 3.907   0.000   19.539  1.00 20.00  ? 160 ASN A ND2   1 
ATOM   1160 N  N     . VAL A 1 165 ? 8.719   2.946   17.338  1.00 31.26  ? 161 VAL A N     1 
ATOM   1161 C  CA    . VAL A 1 165 ? 9.712   3.153   16.236  1.00 31.41  ? 161 VAL A CA    1 
ATOM   1162 C  C     . VAL A 1 165 ? 11.068  2.527   16.585  1.00 31.58  ? 161 VAL A C     1 
ATOM   1163 O  O     . VAL A 1 165 ? 11.676  1.848   15.752  1.00 31.50  ? 161 VAL A O     1 
ATOM   1164 C  CB    . VAL A 1 165 ? 9.873   4.644   15.838  1.00 31.35  ? 161 VAL A CB    1 
ATOM   1165 C  CG1   . VAL A 1 165 ? 10.964  4.801   14.782  1.00 31.20  ? 161 VAL A CG1   1 
ATOM   1166 C  CG2   . VAL A 1 165 ? 8.551   5.208   15.322  1.00 30.97  ? 161 VAL A CG2   1 
ATOM   1167 N  N     . GLU A 1 166 ? 11.496  2.722   17.817  1.00 31.75  ? 162 GLU A N     1 
ATOM   1168 C  CA    . GLU A 1 166 ? 12.738  2.114   18.324  1.00 32.05  ? 162 GLU A CA    1 
ATOM   1169 C  C     . GLU A 1 166 ? 12.595  0.595   18.245  1.00 31.66  ? 162 GLU A C     1 
ATOM   1170 O  O     . GLU A 1 166 ? 13.477  -0.112  17.750  1.00 31.57  ? 162 GLU A O     1 
ATOM   1171 C  CB    . GLU A 1 166 ? 13.020  2.551   19.765  1.00 32.42  ? 162 GLU A CB    1 
ATOM   1172 C  CG    . GLU A 1 166 ? 14.399  2.168   20.295  1.00 34.17  ? 162 GLU A CG    1 
ATOM   1173 C  CD    . GLU A 1 166 ? 15.477  3.177   19.935  1.00 36.66  ? 162 GLU A CD    1 
ATOM   1174 O  OE1   . GLU A 1 166 ? 15.184  4.394   19.888  1.00 38.34  ? 162 GLU A OE1   1 
ATOM   1175 O  OE2   . GLU A 1 166 ? 16.630  2.750   19.711  1.00 37.97  ? 162 GLU A OE2   1 
ATOM   1176 N  N     . ASP A 1 167 ? 11.472  0.078   18.748  1.00 31.38  ? 163 ASP A N     1 
ATOM   1177 C  CA    . ASP A 1 167 ? 11.174  -1.358  18.721  1.00 31.30  ? 163 ASP A CA    1 
ATOM   1178 C  C     . ASP A 1 167 ? 11.150  -1.933  17.307  1.00 31.08  ? 163 ASP A C     1 
ATOM   1179 O  O     . ASP A 1 167 ? 11.650  -3.031  17.080  1.00 31.06  ? 163 ASP A O     1 
ATOM   1180 C  CB    . ASP A 1 167 ? 9.836   -1.659  19.404  1.00 31.51  ? 163 ASP A CB    1 
ATOM   1181 C  CG    . ASP A 1 167 ? 9.783   -1.166  20.836  1.00 32.13  ? 163 ASP A CG    1 
ATOM   1182 O  OD1   . ASP A 1 167 ? 9.780   0.065   21.045  1.00 33.06  ? 163 ASP A OD1   1 
ATOM   1183 O  OD2   . ASP A 1 167 ? 9.721   -2.009  21.750  1.00 32.49  ? 163 ASP A OD2   1 
ATOM   1184 N  N     . ALA A 1 168 ? 10.564  -1.194  16.366  1.00 30.88  ? 164 ALA A N     1 
ATOM   1185 C  CA    . ALA A 1 168 ? 10.510  -1.620  14.969  1.00 30.73  ? 164 ALA A CA    1 
ATOM   1186 C  C     . ALA A 1 168 ? 11.887  -2.070  14.472  1.00 30.69  ? 164 ALA A C     1 
ATOM   1187 O  O     . ALA A 1 168 ? 12.049  -3.214  14.033  1.00 30.68  ? 164 ALA A O     1 
ATOM   1188 C  CB    . ALA A 1 168 ? 9.949   -0.507  14.088  1.00 30.68  ? 164 ALA A CB    1 
ATOM   1189 N  N     . PHE A 1 169 ? 12.873  -1.179  14.580  1.00 30.42  ? 165 PHE A N     1 
ATOM   1190 C  CA    . PHE A 1 169 ? 14.240  -1.454  14.130  1.00 30.30  ? 165 PHE A CA    1 
ATOM   1191 C  C     . PHE A 1 169 ? 14.985  -2.460  15.015  1.00 30.33  ? 165 PHE A C     1 
ATOM   1192 O  O     . PHE A 1 169 ? 15.735  -3.294  14.503  1.00 30.33  ? 165 PHE A O     1 
ATOM   1193 C  CB    . PHE A 1 169 ? 15.040  -0.151  14.020  1.00 30.26  ? 165 PHE A CB    1 
ATOM   1194 C  CG    . PHE A 1 169 ? 14.618  0.730   12.872  1.00 30.17  ? 165 PHE A CG    1 
ATOM   1195 C  CD1   . PHE A 1 169 ? 13.585  1.651   13.026  1.00 30.01  ? 165 PHE A CD1   1 
ATOM   1196 C  CD2   . PHE A 1 169 ? 15.259  0.640   11.636  1.00 29.86  ? 165 PHE A CD2   1 
ATOM   1197 C  CE1   . PHE A 1 169 ? 13.192  2.467   11.965  1.00 30.15  ? 165 PHE A CE1   1 
ATOM   1198 C  CE2   . PHE A 1 169 ? 14.878  1.452   10.571  1.00 29.67  ? 165 PHE A CE2   1 
ATOM   1199 C  CZ    . PHE A 1 169 ? 13.844  2.369   10.735  1.00 29.96  ? 165 PHE A CZ    1 
ATOM   1200 N  N     . LEU A 1 170 ? 14.767  -2.384  16.329  1.00 30.25  ? 166 LEU A N     1 
ATOM   1201 C  CA    . LEU A 1 170 ? 15.474  -3.234  17.295  1.00 30.43  ? 166 LEU A CA    1 
ATOM   1202 C  C     . LEU A 1 170 ? 15.011  -4.688  17.296  1.00 30.58  ? 166 LEU A C     1 
ATOM   1203 O  O     . LEU A 1 170 ? 15.831  -5.597  17.430  1.00 30.45  ? 166 LEU A O     1 
ATOM   1204 C  CB    . LEU A 1 170 ? 15.384  -2.646  18.701  1.00 30.45  ? 166 LEU A CB    1 
ATOM   1205 N  N     . GLU A 1 171 ? 13.705  -4.907  17.159  1.00 30.92  ? 167 GLU A N     1 
ATOM   1206 C  CA    . GLU A 1 171 ? 13.149  -6.264  17.115  1.00 31.53  ? 167 GLU A CA    1 
ATOM   1207 C  C     . GLU A 1 171 ? 13.619  -7.027  15.882  1.00 31.40  ? 167 GLU A C     1 
ATOM   1208 O  O     . GLU A 1 171 ? 13.927  -8.223  15.961  1.00 31.25  ? 167 GLU A O     1 
ATOM   1209 C  CB    . GLU A 1 171 ? 11.618  -6.236  17.158  1.00 31.79  ? 167 GLU A CB    1 
ATOM   1210 C  CG    . GLU A 1 171 ? 11.032  -5.921  18.530  1.00 33.60  ? 167 GLU A CG    1 
ATOM   1211 C  CD    . GLU A 1 171 ? 11.415  -6.945  19.583  1.00 36.06  ? 167 GLU A CD    1 
ATOM   1212 O  OE1   . GLU A 1 171 ? 11.419  -8.160  19.277  1.00 37.14  ? 167 GLU A OE1   1 
ATOM   1213 O  OE2   . GLU A 1 171 ? 11.716  -6.529  20.722  1.00 37.58  ? 167 GLU A OE2   1 
ATOM   1214 N  N     . ALA A 1 172 ? 13.668  -6.327  14.750  1.00 31.33  ? 168 ALA A N     1 
ATOM   1215 C  CA    . ALA A 1 172 ? 14.224  -6.876  13.517  1.00 31.42  ? 168 ALA A CA    1 
ATOM   1216 C  C     . ALA A 1 172 ? 15.680  -7.308  13.711  1.00 31.52  ? 168 ALA A C     1 
ATOM   1217 O  O     . ALA A 1 172 ? 16.055  -8.426  13.341  1.00 31.42  ? 168 ALA A O     1 
ATOM   1218 C  CB    . ALA A 1 172 ? 14.105  -5.867  12.384  1.00 31.37  ? 168 ALA A CB    1 
ATOM   1219 N  N     . ALA A 1 173 ? 16.480  -6.429  14.315  1.00 31.59  ? 169 ALA A N     1 
ATOM   1220 C  CA    . ALA A 1 173 ? 17.906  -6.680  14.541  1.00 31.94  ? 169 ALA A CA    1 
ATOM   1221 C  C     . ALA A 1 173 ? 18.182  -7.883  15.448  1.00 32.23  ? 169 ALA A C     1 
ATOM   1222 O  O     . ALA A 1 173 ? 19.115  -8.651  15.196  1.00 32.10  ? 169 ALA A O     1 
ATOM   1223 C  CB    . ALA A 1 173 ? 18.586  -5.432  15.089  1.00 31.80  ? 169 ALA A CB    1 
ATOM   1224 N  N     . LYS A 1 174 ? 17.372  -8.044  16.492  1.00 32.57  ? 170 LYS A N     1 
ATOM   1225 C  CA    . LYS A 1 174 ? 17.541  -9.160  17.424  1.00 33.20  ? 170 LYS A CA    1 
ATOM   1226 C  C     . LYS A 1 174 ? 17.247  -10.498 16.747  1.00 33.64  ? 170 LYS A C     1 
ATOM   1227 O  O     . LYS A 1 174 ? 17.920  -11.491 17.020  1.00 33.76  ? 170 LYS A O     1 
ATOM   1228 C  CB    . LYS A 1 174 ? 16.683  -8.968  18.679  1.00 33.01  ? 170 LYS A CB    1 
ATOM   1229 N  N     . LYS A 1 175 ? 16.258  -10.510 15.850  1.00 34.13  ? 171 LYS A N     1 
ATOM   1230 C  CA    . LYS A 1 175 ? 15.940  -11.698 15.052  1.00 34.62  ? 171 LYS A CA    1 
ATOM   1231 C  C     . LYS A 1 175 ? 17.052  -12.034 14.048  1.00 35.00  ? 171 LYS A C     1 
ATOM   1232 O  O     . LYS A 1 175 ? 17.320  -13.213 13.783  1.00 35.04  ? 171 LYS A O     1 
ATOM   1233 C  CB    . LYS A 1 175 ? 14.592  -11.531 14.344  1.00 34.55  ? 171 LYS A CB    1 
ATOM   1234 N  N     . ILE A 1 176 ? 17.697  -10.999 13.503  1.00 35.34  ? 172 ILE A N     1 
ATOM   1235 C  CA    . ILE A 1 176 ? 18.893  -11.163 12.658  1.00 35.74  ? 172 ILE A CA    1 
ATOM   1236 C  C     . ILE A 1 176 ? 20.048  -11.790 13.458  1.00 36.19  ? 172 ILE A C     1 
ATOM   1237 O  O     . ILE A 1 176 ? 20.966  -12.375 12.879  1.00 36.29  ? 172 ILE A O     1 
ATOM   1238 C  CB    . ILE A 1 176 ? 19.342  -9.816  11.999  1.00 35.59  ? 172 ILE A CB    1 
ATOM   1239 C  CG1   . ILE A 1 176 ? 18.230  -9.247  11.112  1.00 35.64  ? 172 ILE A CG1   1 
ATOM   1240 C  CG2   . ILE A 1 176 ? 20.610  -10.007 11.161  1.00 35.24  ? 172 ILE A CG2   1 
ATOM   1241 C  CD1   . ILE A 1 176 ? 18.454  -7.809  10.657  1.00 35.64  ? 172 ILE A CD1   1 
ATOM   1242 N  N     . TYR A 1 177 ? 19.966  -11.676 14.787  1.00 36.71  ? 173 TYR A N     1 
ATOM   1243 C  CA    . TYR A 1 177 ? 20.933  -12.240 15.745  1.00 36.97  ? 173 TYR A CA    1 
ATOM   1244 C  C     . TYR A 1 177 ? 22.276  -11.539 15.679  1.00 37.16  ? 173 TYR A C     1 
ATOM   1245 O  O     . TYR A 1 177 ? 22.451  -10.483 16.288  1.00 37.56  ? 173 TYR A O     1 
ATOM   1246 C  CB    . TYR A 1 177 ? 21.090  -13.756 15.572  1.00 36.85  ? 173 TYR A CB    1 
HETATM 1247 MG MG    . MG  B 2 .   ? 10.434  9.079   0.963   1.00 9.53   ? 201 MG  A MG    1 
HETATM 1248 P  PB    . GDP C 3 .   ? 7.239   8.403   2.203   1.00 20.41  ? 200 GDP A PB    1 
HETATM 1249 O  O1B   . GDP C 3 .   ? 6.816   6.970   2.407   1.00 20.62  ? 200 GDP A O1B   1 
HETATM 1250 O  O2B   . GDP C 3 .   ? 8.721   8.527   2.471   1.00 20.16  ? 200 GDP A O2B   1 
HETATM 1251 O  O3B   . GDP C 3 .   ? 6.940   8.794   0.766   1.00 21.12  ? 200 GDP A O3B   1 
HETATM 1252 O  O3A   . GDP C 3 .   ? 6.379   9.334   3.195   1.00 21.88  ? 200 GDP A O3A   1 
HETATM 1253 P  PA    . GDP C 3 .   ? 6.941   10.531  4.124   1.00 22.31  ? 200 GDP A PA    1 
HETATM 1254 O  O1A   . GDP C 3 .   ? 7.869   10.007  5.187   1.00 23.26  ? 200 GDP A O1A   1 
HETATM 1255 O  O2A   . GDP C 3 .   ? 7.599   11.605  3.299   1.00 23.45  ? 200 GDP A O2A   1 
HETATM 1256 O  "O5'" . GDP C 3 .   ? 5.591   11.100  4.791   1.00 23.27  ? 200 GDP A "O5'" 1 
HETATM 1257 C  "C5'" . GDP C 3 .   ? 4.486   11.525  3.985   1.00 22.69  ? 200 GDP A "C5'" 1 
HETATM 1258 C  "C4'" . GDP C 3 .   ? 3.581   12.440  4.804   1.00 23.04  ? 200 GDP A "C4'" 1 
HETATM 1259 O  "O4'" . GDP C 3 .   ? 3.034   11.715  5.916   1.00 23.67  ? 200 GDP A "O4'" 1 
HETATM 1260 C  "C3'" . GDP C 3 .   ? 4.330   13.629  5.388   1.00 23.07  ? 200 GDP A "C3'" 1 
HETATM 1261 O  "O3'" . GDP C 3 .   ? 3.506   14.792  5.260   1.00 23.90  ? 200 GDP A "O3'" 1 
HETATM 1262 C  "C2'" . GDP C 3 .   ? 4.521   13.273  6.854   1.00 23.61  ? 200 GDP A "C2'" 1 
HETATM 1263 O  "O2'" . GDP C 3 .   ? 4.538   14.431  7.694   1.00 23.59  ? 200 GDP A "O2'" 1 
HETATM 1264 C  "C1'" . GDP C 3 .   ? 3.336   12.366  7.154   1.00 23.31  ? 200 GDP A "C1'" 1 
HETATM 1265 N  N9    . GDP C 3 .   ? 3.617   11.329  8.180   1.00 23.48  ? 200 GDP A N9    1 
HETATM 1266 C  C8    . GDP C 3 .   ? 4.633   10.442  8.159   1.00 23.36  ? 200 GDP A C8    1 
HETATM 1267 N  N7    . GDP C 3 .   ? 4.594   9.621   9.237   1.00 23.03  ? 200 GDP A N7    1 
HETATM 1268 C  C5    . GDP C 3 .   ? 3.520   9.975   9.969   1.00 23.25  ? 200 GDP A C5    1 
HETATM 1269 C  C6    . GDP C 3 .   ? 2.893   9.522   11.232  1.00 22.84  ? 200 GDP A C6    1 
HETATM 1270 O  O6    . GDP C 3 .   ? 3.372   8.575   11.880  1.00 23.16  ? 200 GDP A O6    1 
HETATM 1271 N  N1    . GDP C 3 .   ? 1.788   10.149  11.656  1.00 23.64  ? 200 GDP A N1    1 
HETATM 1272 C  C2    . GDP C 3 .   ? 1.234   11.176  10.976  1.00 23.41  ? 200 GDP A C2    1 
HETATM 1273 N  N2    . GDP C 3 .   ? 0.119   11.753  11.484  1.00 23.37  ? 200 GDP A N2    1 
HETATM 1274 N  N3    . GDP C 3 .   ? 1.753   11.649  9.809   1.00 23.17  ? 200 GDP A N3    1 
HETATM 1275 C  C4    . GDP C 3 .   ? 2.876   11.100  9.269   1.00 23.33  ? 200 GDP A C4    1 
HETATM 1276 O  O     . HOH D 4 .   ? 0.457   6.081   -2.313  1.00 12.93  ? 202 HOH A O     1 
HETATM 1277 O  O     . HOH D 4 .   ? 1.738   -2.962  17.745  1.00 21.42  ? 203 HOH A O     1 
HETATM 1278 O  O     . HOH D 4 .   ? -0.321  -6.459  -4.199  1.00 27.54  ? 204 HOH A O     1 
HETATM 1279 O  O     . HOH D 4 .   ? 9.568   11.266  1.132   1.00 17.89  ? 205 HOH A O     1 
HETATM 1280 O  O     . HOH D 4 .   ? 11.536  0.400   -3.569  1.00 35.46  ? 206 HOH A O     1 
HETATM 1281 O  O     . HOH D 4 .   ? 7.774   5.828   -2.181  1.00 21.81  ? 207 HOH A O     1 
HETATM 1282 O  O     . HOH D 4 .   ? 9.527   1.544   -2.039  1.00 16.32  ? 208 HOH A O     1 
HETATM 1283 O  O     . HOH D 4 .   ? -7.307  -8.289  5.353   1.00 26.19  ? 209 HOH A O     1 
HETATM 1284 O  O     . HOH D 4 .   ? -3.461  -2.187  11.043  1.00 15.09  ? 210 HOH A O     1 
HETATM 1285 O  O     . HOH D 4 .   ? 11.388  2.890   -0.829  1.00 14.61  ? 211 HOH A O     1 
HETATM 1286 O  O     . HOH D 4 .   ? 22.246  9.428   9.290   1.00 32.37  ? 212 HOH A O     1 
HETATM 1287 O  O     . HOH D 4 .   ? -10.546 -7.336  11.115  1.00 23.03  ? 213 HOH A O     1 
HETATM 1288 O  O     . HOH D 4 .   ? 12.235  13.301  6.215   1.00 33.91  ? 214 HOH A O     1 
HETATM 1289 O  O     . HOH D 4 .   ? -8.540  -5.294  1.927   1.00 25.72  ? 215 HOH A O     1 
HETATM 1290 O  O     . HOH D 4 .   ? -7.141  3.631   0.671   1.00 24.22  ? 216 HOH A O     1 
HETATM 1291 O  O     . HOH D 4 .   ? 11.385  -12.629 7.065   1.00 33.19  ? 217 HOH A O     1 
HETATM 1292 O  O     . HOH D 4 .   ? 6.758   3.653   -3.349  1.00 24.66  ? 218 HOH A O     1 
HETATM 1293 O  O     . HOH D 4 .   ? 19.662  10.241  8.377   1.00 32.07  ? 219 HOH A O     1 
HETATM 1294 O  O     . HOH D 4 .   ? 2.536   0.124   1.185   1.00 17.62  ? 220 HOH A O     1 
HETATM 1295 O  O     . HOH D 4 .   ? -8.100  -8.421  2.805   1.00 27.45  ? 221 HOH A O     1 
HETATM 1296 O  O     . HOH D 4 .   ? -8.899  -10.512 6.198   1.00 36.25  ? 222 HOH A O     1 
HETATM 1297 O  O     . HOH D 4 .   ? 13.054  -9.867  1.057   1.00 49.47  ? 223 HOH A O     1 
HETATM 1298 O  O     . HOH D 4 .   ? 2.290   0.216   -5.090  1.00 22.09  ? 224 HOH A O     1 
HETATM 1299 O  O     . HOH D 4 .   ? 19.430  -11.221 7.561   1.00 23.63  ? 225 HOH A O     1 
HETATM 1300 O  O     . HOH D 4 .   ? 18.404  -6.775  -6.239  1.00 27.19  ? 226 HOH A O     1 
HETATM 1301 O  O     . HOH D 4 .   ? 23.619  -6.482  5.694   1.00 24.35  ? 227 HOH A O     1 
HETATM 1302 O  O     . HOH D 4 .   ? -1.954  3.560   -2.290  1.00 23.11  ? 228 HOH A O     1 
HETATM 1303 O  O     . HOH D 4 .   ? -0.018  -10.737 15.630  1.00 58.68  ? 229 HOH A O     1 
HETATM 1304 O  O     . HOH D 4 .   ? 16.278  -6.678  21.009  1.00 63.85  ? 230 HOH A O     1 
HETATM 1305 O  O     . HOH D 4 .   ? 28.764  -8.682  15.673  1.00 51.95  ? 231 HOH A O     1 
HETATM 1306 O  O     . HOH D 4 .   ? 17.551  -0.551  19.140  1.00 71.02  ? 232 HOH A O     1 
HETATM 1307 O  O     . HOH D 4 .   ? 27.989  0.001   21.891  1.00 77.32  ? 233 HOH A O     1 
HETATM 1308 O  O     . HOH D 4 .   ? 20.986  -13.407 9.581   1.00 38.29  ? 234 HOH A O     1 
HETATM 1309 O  O     . HOH D 4 .   ? -4.000  4.832   12.560  1.00 57.62  ? 235 HOH A O     1 
HETATM 1310 O  O     . HOH D 4 .   ? 26.158  5.642   12.824  1.00 26.96  ? 236 HOH A O     1 
HETATM 1311 O  O     . HOH D 4 .   ? 24.988  6.549   16.187  1.00 25.32  ? 237 HOH A O     1 
HETATM 1312 O  O     . HOH D 4 .   ? 9.890   -13.751 -6.443  1.00 36.70  ? 238 HOH A O     1 
HETATM 1313 O  O     . HOH D 4 .   ? 2.372   -10.742 -4.942  1.00 22.99  ? 239 HOH A O     1 
HETATM 1314 O  O     . HOH D 4 .   ? 12.173  10.078  -0.036  1.00 29.42  ? 240 HOH A O     1 
HETATM 1315 O  O     . HOH D 4 .   ? -11.705 0.093   4.644   1.00 27.80  ? 241 HOH A O     1 
HETATM 1316 O  O     . HOH D 4 .   ? 25.266  -7.621  -1.743  1.00 33.80  ? 242 HOH A O     1 
HETATM 1317 O  O     . HOH D 4 .   ? -5.747  -17.102 5.702   1.00 37.36  ? 243 HOH A O     1 
HETATM 1318 O  O     . HOH D 4 .   ? 2.743   -9.121  -7.099  1.00 27.46  ? 244 HOH A O     1 
HETATM 1319 O  O     . HOH D 4 .   ? 13.150  -4.081  20.901  1.00 43.41  ? 245 HOH A O     1 
HETATM 1320 O  O     . HOH D 4 .   ? 35.284  -2.494  15.237  1.00 23.64  ? 246 HOH A O     1 
HETATM 1321 O  O     . HOH D 4 .   ? 9.560   9.869   -1.293  1.00 31.13  ? 247 HOH A O     1 
HETATM 1322 O  O     . HOH D 4 .   ? 29.174  -9.325  20.463  1.00 39.84  ? 248 HOH A O     1 
HETATM 1323 O  O     . HOH D 4 .   ? -14.251 -0.794  3.507   1.00 32.26  ? 249 HOH A O     1 
HETATM 1324 O  O     . HOH D 4 .   ? 9.022   2.835   -4.474  1.00 43.21  ? 250 HOH A O     1 
HETATM 1325 O  O     . HOH D 4 .   ? 20.567  0.480   21.128  1.00 38.93  ? 251 HOH A O     1 
HETATM 1326 O  O     . HOH D 4 .   ? 6.975   15.555  7.586   1.00 32.65  ? 252 HOH A O     1 
HETATM 1327 O  O     . HOH D 4 .   ? 4.956   17.049  4.924   1.00 43.65  ? 253 HOH A O     1 
HETATM 1328 O  O     . HOH D 4 .   ? 10.550  11.784  11.711  1.00 32.76  ? 254 HOH A O     1 
HETATM 1329 O  O     . HOH D 4 .   ? 9.166   1.389   -6.677  1.00 37.86  ? 255 HOH A O     1 
HETATM 1330 O  O     . HOH D 4 .   ? -9.494  3.346   1.884   1.00 47.83  ? 256 HOH A O     1 
HETATM 1331 O  O     . HOH D 4 .   ? 9.944   7.308   -1.254  1.00 33.40  ? 257 HOH A O     1 
HETATM 1332 O  O     . HOH D 4 .   ? -5.484  5.777   -1.244  1.00 34.55  ? 258 HOH A O     1 
HETATM 1333 O  O     . HOH D 4 .   ? -1.479  13.421  15.488  1.00 32.37  ? 259 HOH A O     1 
HETATM 1334 O  O     . HOH D 4 .   ? 9.816   2.229   20.573  1.00 33.54  ? 260 HOH A O     1 
HETATM 1335 O  O     . HOH D 4 .   ? 24.770  -10.343 17.148  1.00 50.25  ? 261 HOH A O     1 
HETATM 1336 O  O     . HOH D 4 .   ? 11.492  0.260   -10.276 1.00 47.85  ? 262 HOH A O     1 
HETATM 1337 O  O     . HOH D 4 .   ? 10.373  14.176  10.397  1.00 48.14  ? 263 HOH A O     1 
HETATM 1338 O  O     . HOH D 4 .   ? 10.714  4.698   19.871  1.00 31.73  ? 264 HOH A O     1 
HETATM 1339 O  O     . HOH D 4 .   ? 4.967   -2.655  -5.711  1.00 42.10  ? 265 HOH A O     1 
HETATM 1340 O  O     . HOH D 4 .   ? 25.737  -12.087 18.529  1.00 35.10  ? 266 HOH A O     1 
HETATM 1341 O  O     . HOH D 4 .   ? 30.566  -5.164  19.736  1.00 37.07  ? 267 HOH A O     1 
HETATM 1342 O  O     . HOH D 4 .   ? 6.154   11.131  -0.199  1.00 38.32  ? 268 HOH A O     1 
HETATM 1343 O  O     . HOH D 4 .   ? -12.484 1.509   7.356   1.00 34.69  ? 269 HOH A O     1 
HETATM 1344 O  O     . HOH D 4 .   ? 24.859  -5.039  -8.409  1.00 73.38  ? 270 HOH A O     1 
HETATM 1345 O  O     . HOH D 4 .   ? 22.045  5.038   -11.042 1.00 36.93  ? 271 HOH A O     1 
HETATM 1346 O  O     . HOH D 4 .   ? 13.393  -13.452 3.531   1.00 35.20  ? 272 HOH A O     1 
HETATM 1347 O  O     . HOH D 4 .   ? 16.541  11.659  -2.111  1.00 38.12  ? 273 HOH A O     1 
HETATM 1348 O  O     . HOH D 4 .   ? -12.123 5.419   10.476  1.00 33.19  ? 274 HOH A O     1 
HETATM 1349 O  O     . HOH D 4 .   ? 27.737  4.156   5.811   1.00 40.08  ? 275 HOH A O     1 
HETATM 1350 O  O     . HOH D 4 .   ? -2.057  -7.769  -0.914  1.00 37.24  ? 276 HOH A O     1 
HETATM 1351 O  O     . HOH D 4 .   ? 25.861  -2.232  -2.847  1.00 37.15  ? 277 HOH A O     1 
HETATM 1352 O  O     . HOH D 4 .   ? -5.359  -11.726 13.960  1.00 34.19  ? 278 HOH A O     1 
HETATM 1353 O  O     . HOH D 4 .   ? 22.884  -9.636  4.470   1.00 34.93  ? 279 HOH A O     1 
HETATM 1354 O  O     . HOH D 4 .   ? 22.553  -5.778  24.779  1.00 39.85  ? 280 HOH A O     1 
HETATM 1355 O  O     . HOH D 4 .   ? 23.199  -6.953  -7.864  1.00 52.52  ? 281 HOH A O     1 
HETATM 1356 O  O     . HOH D 4 .   ? 13.465  18.035  6.572   1.00 144.76 ? 282 HOH A O     1 
HETATM 1357 O  O     . HOH D 4 .   ? -5.606  -10.435 16.491  1.00 43.28  ? 283 HOH A O     1 
HETATM 1358 O  O     . HOH D 4 .   ? -4.844  4.135   15.571  1.00 46.74  ? 284 HOH A O     1 
HETATM 1359 O  O     . HOH D 4 .   ? 17.911  9.187   -4.988  1.00 35.78  ? 285 HOH A O     1 
HETATM 1360 O  O     . HOH D 4 .   ? 32.577  -9.452  18.122  1.00 51.09  ? 286 HOH A O     1 
HETATM 1361 O  O     . HOH D 4 .   ? -1.659  1.357   17.596  1.00 39.94  ? 287 HOH A O     1 
HETATM 1362 O  O     . HOH D 4 .   ? 15.827  -14.008 -4.544  1.00 53.17  ? 288 HOH A O     1 
HETATM 1363 O  O     . HOH D 4 .   ? 23.981  3.688   -11.663 1.00 36.46  ? 289 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -3  ?   ?   ?   A . n 
A 1 2   PRO 2   -2  ?   ?   ?   A . n 
A 1 3   LEU 3   -1  ?   ?   ?   A . n 
A 1 4   GLY 4   0   ?   ?   ?   A . n 
A 1 5   SER 5   1   ?   ?   ?   A . n 
A 1 6   ALA 6   2   ?   ?   ?   A . n 
A 1 7   THR 7   3   ?   ?   ?   A . n 
A 1 8   ALA 8   4   ?   ?   ?   A . n 
A 1 9   PRO 9   5   ?   ?   ?   A . n 
A 1 10  TYR 10  6   ?   ?   ?   A . n 
A 1 11  ASN 11  7   7   ASN ASN A . n 
A 1 12  TYR 12  8   8   TYR TYR A . n 
A 1 13  SER 13  9   9   SER SER A . n 
A 1 14  TYR 14  10  10  TYR ALA A . n 
A 1 15  ILE 15  11  11  ILE ILE A . n 
A 1 16  PHE 16  12  12  PHE PHE A . n 
A 1 17  LYS 17  13  13  LYS LYS A . n 
A 1 18  TYR 18  14  14  TYR TYR A . n 
A 1 19  ILE 19  15  15  ILE ILE A . n 
A 1 20  ILE 20  16  16  ILE ILE A . n 
A 1 21  ILE 21  17  17  ILE ILE A . n 
A 1 22  GLY 22  18  18  GLY GLY A . n 
A 1 23  ASP 23  19  19  ASP ASP A . n 
A 1 24  MET 24  20  20  MET MET A . n 
A 1 25  GLY 25  21  21  GLY GLY A . n 
A 1 26  VAL 26  22  22  VAL VAL A . n 
A 1 27  GLY 27  23  23  GLY GLY A . n 
A 1 28  LYS 28  24  24  LYS LYS A . n 
A 1 29  SER 29  25  25  SER SER A . n 
A 1 30  CYS 30  26  26  CYS CYS A . n 
A 1 31  LEU 31  27  27  LEU LEU A . n 
A 1 32  LEU 32  28  28  LEU LEU A . n 
A 1 33  HIS 33  29  29  HIS HIS A . n 
A 1 34  GLN 34  30  30  GLN GLN A . n 
A 1 35  PHE 35  31  31  PHE PHE A . n 
A 1 36  THR 36  32  32  THR THR A . n 
A 1 37  GLU 37  33  33  GLU ALA A . n 
A 1 38  LYS 38  34  34  LYS ALA A . n 
A 1 39  LYS 39  35  35  LYS ALA A . n 
A 1 40  PHE 40  36  36  PHE PHE A . n 
A 1 41  MET 41  37  37  MET MET A . n 
A 1 42  ALA 42  38  38  ALA ALA A . n 
A 1 43  ASP 43  39  39  ASP ALA A . n 
A 1 44  CYS 44  40  40  CYS CYS A . n 
A 1 45  PRO 45  41  41  PRO PRO A . n 
A 1 46  HIS 46  42  42  HIS HIS A . n 
A 1 47  THR 47  43  43  THR THR A . n 
A 1 48  ILE 48  44  44  ILE ILE A . n 
A 1 49  GLY 49  45  45  GLY GLY A . n 
A 1 50  VAL 50  46  46  VAL VAL A . n 
A 1 51  GLU 51  47  47  GLU GLU A . n 
A 1 52  PHE 52  48  48  PHE PHE A . n 
A 1 53  GLY 53  49  49  GLY GLY A . n 
A 1 54  THR 54  50  50  THR THR A . n 
A 1 55  ARG 55  51  51  ARG ARG A . n 
A 1 56  ILE 56  52  52  ILE ILE A . n 
A 1 57  ILE 57  53  53  ILE ILE A . n 
A 1 58  GLU 58  54  54  GLU ALA A . n 
A 1 59  VAL 59  55  55  VAL VAL A . n 
A 1 60  SER 60  56  56  SER SER A . n 
A 1 61  GLY 61  57  57  GLY GLY A . n 
A 1 62  GLN 62  58  58  GLN ALA A . n 
A 1 63  LYS 63  59  59  LYS ALA A . n 
A 1 64  ILE 64  60  60  ILE ILE A . n 
A 1 65  LYS 65  61  61  LYS LYS A . n 
A 1 66  LEU 66  62  62  LEU LEU A . n 
A 1 67  GLN 67  63  63  GLN GLN A . n 
A 1 68  ILE 68  64  64  ILE ILE A . n 
A 1 69  TRP 69  65  65  TRP TRP A . n 
A 1 70  ASP 70  66  66  ASP ASP A . n 
A 1 71  THR 71  67  67  THR THR A . n 
A 1 72  ALA 72  68  68  ALA ALA A . n 
A 1 73  GLY 73  69  69  GLY GLY A . n 
A 1 74  GLN 74  70  70  GLN GLN A . n 
A 1 75  GLU 75  71  71  GLU ALA A . n 
A 1 76  ARG 76  72  72  ARG ALA A . n 
A 1 77  PHE 77  73  73  PHE ALA A . n 
A 1 78  ARG 78  74  74  ARG ALA A . n 
A 1 79  ALA 79  75  75  ALA ALA A . n 
A 1 80  VAL 80  76  76  VAL VAL A . n 
A 1 81  THR 81  77  77  THR THR A . n 
A 1 82  ARG 82  78  78  ARG ARG A . n 
A 1 83  SER 83  79  79  SER SER A . n 
A 1 84  TYR 84  80  80  TYR TYR A . n 
A 1 85  TYR 85  81  81  TYR TYR A . n 
A 1 86  ARG 86  82  82  ARG ARG A . n 
A 1 87  GLY 87  83  83  GLY GLY A . n 
A 1 88  ALA 88  84  84  ALA ALA A . n 
A 1 89  ALA 89  85  85  ALA ALA A . n 
A 1 90  GLY 90  86  86  GLY GLY A . n 
A 1 91  ALA 91  87  87  ALA ALA A . n 
A 1 92  LEU 92  88  88  LEU LEU A . n 
A 1 93  MET 93  89  89  MET MET A . n 
A 1 94  VAL 94  90  90  VAL VAL A . n 
A 1 95  TYR 95  91  91  TYR TYR A . n 
A 1 96  ASP 96  92  92  ASP ASP A . n 
A 1 97  ILE 97  93  93  ILE ILE A . n 
A 1 98  THR 98  94  94  THR THR A . n 
A 1 99  ARG 99  95  95  ARG ARG A . n 
A 1 100 ARG 100 96  96  ARG ARG A . n 
A 1 101 SER 101 97  97  SER SER A . n 
A 1 102 THR 102 98  98  THR THR A . n 
A 1 103 TYR 103 99  99  TYR TYR A . n 
A 1 104 ASN 104 100 100 ASN ASN A . n 
A 1 105 HIS 105 101 101 HIS HIS A . n 
A 1 106 LEU 106 102 102 LEU LEU A . n 
A 1 107 SER 107 103 103 SER SER A . n 
A 1 108 SER 108 104 104 SER ALA A . n 
A 1 109 TRP 109 105 105 TRP TRP A . n 
A 1 110 LEU 110 106 106 LEU LEU A . n 
A 1 111 THR 111 107 107 THR THR A . n 
A 1 112 ASP 112 108 108 ASP ASP A . n 
A 1 113 ALA 113 109 109 ALA ALA A . n 
A 1 114 ARG 114 110 110 ARG ARG A . n 
A 1 115 ASN 115 111 111 ASN ASN A . n 
A 1 116 LEU 116 112 112 LEU LEU A . n 
A 1 117 THR 117 113 113 THR THR A . n 
A 1 118 ASN 118 114 114 ASN ASN A . n 
A 1 119 PRO 119 115 115 PRO PRO A . n 
A 1 120 ASN 120 116 116 ASN ASN A . n 
A 1 121 THR 121 117 117 THR THR A . n 
A 1 122 VAL 122 118 118 VAL VAL A . n 
A 1 123 ILE 123 119 119 ILE ILE A . n 
A 1 124 ILE 124 120 120 ILE ILE A . n 
A 1 125 LEU 125 121 121 LEU LEU A . n 
A 1 126 ILE 126 122 122 ILE ILE A . n 
A 1 127 GLY 127 123 123 GLY GLY A . n 
A 1 128 ASN 128 124 124 ASN ASN A . n 
A 1 129 LYS 129 125 125 LYS LYS A . n 
A 1 130 ALA 130 126 126 ALA ALA A . n 
A 1 131 ASP 131 127 127 ASP ASP A . n 
A 1 132 LEU 132 128 128 LEU LEU A . n 
A 1 133 GLU 133 129 129 GLU GLU A . n 
A 1 134 ALA 134 130 130 ALA ALA A . n 
A 1 135 GLN 135 131 131 GLN GLN A . n 
A 1 136 ARG 136 132 132 ARG ARG A . n 
A 1 137 ASP 137 133 133 ASP ASP A . n 
A 1 138 VAL 138 134 134 VAL VAL A . n 
A 1 139 THR 139 135 135 THR THR A . n 
A 1 140 TYR 140 136 136 TYR TYR A . n 
A 1 141 GLU 141 137 137 GLU GLU A . n 
A 1 142 GLU 142 138 138 GLU GLU A . n 
A 1 143 ALA 143 139 139 ALA ALA A . n 
A 1 144 LYS 144 140 140 LYS ALA A . n 
A 1 145 GLN 145 141 141 GLN ALA A . n 
A 1 146 PHE 146 142 142 PHE PHE A . n 
A 1 147 ALA 147 143 143 ALA ALA A . n 
A 1 148 GLU 148 144 144 GLU ALA A . n 
A 1 149 GLU 149 145 145 GLU GLU A . n 
A 1 150 ASN 150 146 146 ASN ASN A . n 
A 1 151 GLY 151 147 147 GLY GLY A . n 
A 1 152 LEU 152 148 148 LEU LEU A . n 
A 1 153 LEU 153 149 149 LEU LEU A . n 
A 1 154 PHE 154 150 150 PHE PHE A . n 
A 1 155 LEU 155 151 151 LEU LEU A . n 
A 1 156 GLU 156 152 152 GLU GLU A . n 
A 1 157 ALA 157 153 153 ALA ALA A . n 
A 1 158 SER 158 154 154 SER SER A . n 
A 1 159 ALA 159 155 155 ALA ALA A . n 
A 1 160 LYS 160 156 156 LYS LYS A . n 
A 1 161 THR 161 157 157 THR THR A . n 
A 1 162 GLY 162 158 158 GLY GLY A . n 
A 1 163 GLU 163 159 159 GLU GLU A . n 
A 1 164 ASN 164 160 160 ASN ASN A . n 
A 1 165 VAL 165 161 161 VAL VAL A . n 
A 1 166 GLU 166 162 162 GLU GLU A . n 
A 1 167 ASP 167 163 163 ASP ASP A . n 
A 1 168 ALA 168 164 164 ALA ALA A . n 
A 1 169 PHE 169 165 165 PHE PHE A . n 
A 1 170 LEU 170 166 166 LEU ALA A . n 
A 1 171 GLU 171 167 167 GLU GLU A . n 
A 1 172 ALA 172 168 168 ALA ALA A . n 
A 1 173 ALA 173 169 169 ALA ALA A . n 
A 1 174 LYS 174 170 170 LYS ALA A . n 
A 1 175 LYS 175 171 171 LYS ALA A . n 
A 1 176 ILE 176 172 172 ILE ILE A . n 
A 1 177 TYR 177 173 173 TYR ALA A . n 
A 1 178 GLN 178 174 ?   ?   ?   A . n 
A 1 179 ASN 179 175 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1  201 201 MG  MG  A . 
C 3 GDP 1  200 200 GDP GDP A . 
D 4 HOH 1  202 1   HOH HOH A . 
D 4 HOH 2  203 2   HOH HOH A . 
D 4 HOH 3  204 3   HOH HOH A . 
D 4 HOH 4  205 4   HOH HOH A . 
D 4 HOH 5  206 5   HOH HOH A . 
D 4 HOH 6  207 6   HOH HOH A . 
D 4 HOH 7  208 7   HOH HOH A . 
D 4 HOH 8  209 8   HOH HOH A . 
D 4 HOH 9  210 9   HOH HOH A . 
D 4 HOH 10 211 10  HOH HOH A . 
D 4 HOH 11 212 12  HOH HOH A . 
D 4 HOH 12 213 13  HOH HOH A . 
D 4 HOH 13 214 14  HOH HOH A . 
D 4 HOH 14 215 15  HOH HOH A . 
D 4 HOH 15 216 16  HOH HOH A . 
D 4 HOH 16 217 17  HOH HOH A . 
D 4 HOH 17 218 18  HOH HOH A . 
D 4 HOH 18 219 19  HOH HOH A . 
D 4 HOH 19 220 20  HOH HOH A . 
D 4 HOH 20 221 21  HOH HOH A . 
D 4 HOH 21 222 23  HOH HOH A . 
D 4 HOH 22 223 24  HOH HOH A . 
D 4 HOH 23 224 27  HOH HOH A . 
D 4 HOH 24 225 28  HOH HOH A . 
D 4 HOH 25 226 29  HOH HOH A . 
D 4 HOH 26 227 30  HOH HOH A . 
D 4 HOH 27 228 31  HOH HOH A . 
D 4 HOH 28 229 32  HOH HOH A . 
D 4 HOH 29 230 34  HOH HOH A . 
D 4 HOH 30 231 36  HOH HOH A . 
D 4 HOH 31 232 39  HOH HOH A . 
D 4 HOH 32 233 40  HOH HOH A . 
D 4 HOH 33 234 41  HOH HOH A . 
D 4 HOH 34 235 42  HOH HOH A . 
D 4 HOH 35 236 43  HOH HOH A . 
D 4 HOH 36 237 44  HOH HOH A . 
D 4 HOH 37 238 45  HOH HOH A . 
D 4 HOH 38 239 46  HOH HOH A . 
D 4 HOH 39 240 48  HOH HOH A . 
D 4 HOH 40 241 49  HOH HOH A . 
D 4 HOH 41 242 50  HOH HOH A . 
D 4 HOH 42 243 51  HOH HOH A . 
D 4 HOH 43 244 53  HOH HOH A . 
D 4 HOH 44 245 54  HOH HOH A . 
D 4 HOH 45 246 56  HOH HOH A . 
D 4 HOH 46 247 57  HOH HOH A . 
D 4 HOH 47 248 58  HOH HOH A . 
D 4 HOH 48 249 61  HOH HOH A . 
D 4 HOH 49 250 62  HOH HOH A . 
D 4 HOH 50 251 63  HOH HOH A . 
D 4 HOH 51 252 64  HOH HOH A . 
D 4 HOH 52 253 65  HOH HOH A . 
D 4 HOH 53 254 66  HOH HOH A . 
D 4 HOH 54 255 67  HOH HOH A . 
D 4 HOH 55 256 68  HOH HOH A . 
D 4 HOH 56 257 69  HOH HOH A . 
D 4 HOH 57 258 70  HOH HOH A . 
D 4 HOH 58 259 71  HOH HOH A . 
D 4 HOH 59 260 73  HOH HOH A . 
D 4 HOH 60 261 74  HOH HOH A . 
D 4 HOH 61 262 75  HOH HOH A . 
D 4 HOH 62 263 76  HOH HOH A . 
D 4 HOH 63 264 77  HOH HOH A . 
D 4 HOH 64 265 80  HOH HOH A . 
D 4 HOH 65 266 81  HOH HOH A . 
D 4 HOH 66 267 84  HOH HOH A . 
D 4 HOH 67 268 85  HOH HOH A . 
D 4 HOH 68 269 87  HOH HOH A . 
D 4 HOH 69 270 89  HOH HOH A . 
D 4 HOH 70 271 90  HOH HOH A . 
D 4 HOH 71 272 91  HOH HOH A . 
D 4 HOH 72 273 92  HOH HOH A . 
D 4 HOH 73 274 93  HOH HOH A . 
D 4 HOH 74 275 94  HOH HOH A . 
D 4 HOH 75 276 98  HOH HOH A . 
D 4 HOH 76 277 99  HOH HOH A . 
D 4 HOH 77 278 100 HOH HOH A . 
D 4 HOH 78 279 101 HOH HOH A . 
D 4 HOH 79 280 102 HOH HOH A . 
D 4 HOH 80 281 105 HOH HOH A . 
D 4 HOH 81 282 106 HOH HOH A . 
D 4 HOH 82 283 108 HOH HOH A . 
D 4 HOH 83 284 109 HOH HOH A . 
D 4 HOH 84 285 111 HOH HOH A . 
D 4 HOH 85 286 112 HOH HOH A . 
D 4 HOH 86 287 113 HOH HOH A . 
D 4 HOH 87 288 114 HOH HOH A . 
D 4 HOH 88 289 115 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 70 ? A ASP 66  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 257 ? 1_555 76.4  ? 
2  OD2 ? A ASP 70 ? A ASP 66  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2B ? C GDP .  ? A GDP 200 ? 1_555 99.2  ? 
3  O   ? D HOH .  ? A HOH 257 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2B ? C GDP .  ? A GDP 200 ? 1_555 103.0 ? 
4  OD2 ? A ASP 70 ? A ASP 66  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 1_555 157.9 ? 
5  O   ? D HOH .  ? A HOH 257 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 1_555 124.3 ? 
6  O2B ? C GDP .  ? A GDP 200 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 1_555 84.5  ? 
7  OD2 ? A ASP 70 ? A ASP 66  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 240 ? 1_555 86.6  ? 
8  O   ? D HOH .  ? A HOH 257 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 240 ? 1_555 93.6  ? 
9  O2B ? C GDP .  ? A GDP 200 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 240 ? 1_555 163.2 ? 
10 O   ? D HOH .  ? A HOH 205 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 240 ? 1_555 84.5  ? 
11 OD2 ? A ASP 70 ? A ASP 66  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 247 ? 1_555 127.1 ? 
12 O   ? D HOH .  ? A HOH 257 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 247 ? 1_555 56.6  ? 
13 O2B ? C GDP .  ? A GDP 200 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 247 ? 1_555 113.1 ? 
14 O   ? D HOH .  ? A HOH 205 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 247 ? 1_555 69.5  ? 
15 O   ? D HOH .  ? A HOH 240 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 247 ? 1_555 74.5  ? 
16 OD2 ? A ASP 70 ? A ASP 66  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG  ? A SER 29 ? A SER 25  ? 1_555 78.7  ? 
17 O   ? D HOH .  ? A HOH 257 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG  ? A SER 29 ? A SER 25  ? 1_555 155.1 ? 
18 O2B ? C GDP .  ? A GDP 200 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG  ? A SER 29 ? A SER 25  ? 1_555 82.6  ? 
19 O   ? D HOH .  ? A HOH 205 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG  ? A SER 29 ? A SER 25  ? 1_555 80.1  ? 
20 O   ? D HOH .  ? A HOH 240 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG  ? A SER 29 ? A SER 25  ? 1_555 83.1  ? 
21 O   ? D HOH .  ? A HOH 247 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG  ? A SER 29 ? A SER 25  ? 1_555 143.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-26 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
DENZO     'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
AMoRE     phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 37  ? ? -64.22  -76.11  
2 1 ALA A 38  ? ? 67.78   -22.05  
3 1 THR A 113 ? ? -105.05 -138.76 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TYR 10  ? CG  ? A TYR 14  CG  
2  1 Y 1 A TYR 10  ? CD1 ? A TYR 14  CD1 
3  1 Y 1 A TYR 10  ? CD2 ? A TYR 14  CD2 
4  1 Y 1 A TYR 10  ? CE1 ? A TYR 14  CE1 
5  1 Y 1 A TYR 10  ? CE2 ? A TYR 14  CE2 
6  1 Y 1 A TYR 10  ? CZ  ? A TYR 14  CZ  
7  1 Y 1 A TYR 10  ? OH  ? A TYR 14  OH  
8  1 Y 1 A GLU 33  ? CG  ? A GLU 37  CG  
9  1 Y 1 A GLU 33  ? CD  ? A GLU 37  CD  
10 1 Y 1 A GLU 33  ? OE1 ? A GLU 37  OE1 
11 1 Y 1 A GLU 33  ? OE2 ? A GLU 37  OE2 
12 1 Y 1 A LYS 34  ? CG  ? A LYS 38  CG  
13 1 Y 1 A LYS 34  ? CD  ? A LYS 38  CD  
14 1 Y 1 A LYS 34  ? CE  ? A LYS 38  CE  
15 1 Y 1 A LYS 34  ? NZ  ? A LYS 38  NZ  
16 1 Y 1 A LYS 35  ? CG  ? A LYS 39  CG  
17 1 Y 1 A LYS 35  ? CD  ? A LYS 39  CD  
18 1 Y 1 A LYS 35  ? CE  ? A LYS 39  CE  
19 1 Y 1 A LYS 35  ? NZ  ? A LYS 39  NZ  
20 1 Y 1 A ASP 39  ? CG  ? A ASP 43  CG  
21 1 Y 1 A ASP 39  ? OD1 ? A ASP 43  OD1 
22 1 Y 1 A ASP 39  ? OD2 ? A ASP 43  OD2 
23 1 Y 1 A GLU 54  ? CG  ? A GLU 58  CG  
24 1 Y 1 A GLU 54  ? CD  ? A GLU 58  CD  
25 1 Y 1 A GLU 54  ? OE1 ? A GLU 58  OE1 
26 1 Y 1 A GLU 54  ? OE2 ? A GLU 58  OE2 
27 1 Y 1 A GLN 58  ? CG  ? A GLN 62  CG  
28 1 Y 1 A GLN 58  ? CD  ? A GLN 62  CD  
29 1 Y 1 A GLN 58  ? OE1 ? A GLN 62  OE1 
30 1 Y 1 A GLN 58  ? NE2 ? A GLN 62  NE2 
31 1 Y 1 A LYS 59  ? CG  ? A LYS 63  CG  
32 1 Y 1 A LYS 59  ? CD  ? A LYS 63  CD  
33 1 Y 1 A LYS 59  ? CE  ? A LYS 63  CE  
34 1 Y 1 A LYS 59  ? NZ  ? A LYS 63  NZ  
35 1 Y 1 A GLU 71  ? CG  ? A GLU 75  CG  
36 1 Y 1 A GLU 71  ? CD  ? A GLU 75  CD  
37 1 Y 1 A GLU 71  ? OE1 ? A GLU 75  OE1 
38 1 Y 1 A GLU 71  ? OE2 ? A GLU 75  OE2 
39 1 Y 1 A ARG 72  ? CG  ? A ARG 76  CG  
40 1 Y 1 A ARG 72  ? CD  ? A ARG 76  CD  
41 1 Y 1 A ARG 72  ? NE  ? A ARG 76  NE  
42 1 Y 1 A ARG 72  ? CZ  ? A ARG 76  CZ  
43 1 Y 1 A ARG 72  ? NH1 ? A ARG 76  NH1 
44 1 Y 1 A ARG 72  ? NH2 ? A ARG 76  NH2 
45 1 Y 1 A PHE 73  ? CG  ? A PHE 77  CG  
46 1 Y 1 A PHE 73  ? CD1 ? A PHE 77  CD1 
47 1 Y 1 A PHE 73  ? CD2 ? A PHE 77  CD2 
48 1 Y 1 A PHE 73  ? CE1 ? A PHE 77  CE1 
49 1 Y 1 A PHE 73  ? CE2 ? A PHE 77  CE2 
50 1 Y 1 A PHE 73  ? CZ  ? A PHE 77  CZ  
51 1 Y 1 A ARG 74  ? CG  ? A ARG 78  CG  
52 1 Y 1 A ARG 74  ? CD  ? A ARG 78  CD  
53 1 Y 1 A ARG 74  ? NE  ? A ARG 78  NE  
54 1 Y 1 A ARG 74  ? CZ  ? A ARG 78  CZ  
55 1 Y 1 A ARG 74  ? NH1 ? A ARG 78  NH1 
56 1 Y 1 A ARG 74  ? NH2 ? A ARG 78  NH2 
57 1 Y 1 A SER 104 ? OG  ? A SER 108 OG  
58 1 Y 1 A LYS 140 ? CG  ? A LYS 144 CG  
59 1 Y 1 A LYS 140 ? CD  ? A LYS 144 CD  
60 1 Y 1 A LYS 140 ? CE  ? A LYS 144 CE  
61 1 Y 1 A LYS 140 ? NZ  ? A LYS 144 NZ  
62 1 Y 1 A GLN 141 ? CG  ? A GLN 145 CG  
63 1 Y 1 A GLN 141 ? CD  ? A GLN 145 CD  
64 1 Y 1 A GLN 141 ? OE1 ? A GLN 145 OE1 
65 1 Y 1 A GLN 141 ? NE2 ? A GLN 145 NE2 
66 1 Y 1 A GLU 144 ? CG  ? A GLU 148 CG  
67 1 Y 1 A GLU 144 ? CD  ? A GLU 148 CD  
68 1 Y 1 A GLU 144 ? OE1 ? A GLU 148 OE1 
69 1 Y 1 A GLU 144 ? OE2 ? A GLU 148 OE2 
70 1 Y 1 A LEU 166 ? CG  ? A LEU 170 CG  
71 1 Y 1 A LEU 166 ? CD1 ? A LEU 170 CD1 
72 1 Y 1 A LEU 166 ? CD2 ? A LEU 170 CD2 
73 1 Y 1 A LYS 170 ? CG  ? A LYS 174 CG  
74 1 Y 1 A LYS 170 ? CD  ? A LYS 174 CD  
75 1 Y 1 A LYS 170 ? CE  ? A LYS 174 CE  
76 1 Y 1 A LYS 170 ? NZ  ? A LYS 174 NZ  
77 1 Y 1 A LYS 171 ? CG  ? A LYS 175 CG  
78 1 Y 1 A LYS 171 ? CD  ? A LYS 175 CD  
79 1 Y 1 A LYS 171 ? CE  ? A LYS 175 CE  
80 1 Y 1 A LYS 171 ? NZ  ? A LYS 175 NZ  
81 1 Y 1 A TYR 173 ? CG  ? A TYR 177 CG  
82 1 Y 1 A TYR 173 ? CD1 ? A TYR 177 CD1 
83 1 Y 1 A TYR 173 ? CD2 ? A TYR 177 CD2 
84 1 Y 1 A TYR 173 ? CE1 ? A TYR 177 CE1 
85 1 Y 1 A TYR 173 ? CE2 ? A TYR 177 CE2 
86 1 Y 1 A TYR 173 ? CZ  ? A TYR 177 CZ  
87 1 Y 1 A TYR 173 ? OH  ? A TYR 177 OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -3  ? A GLY 1   
2  1 Y 1 A PRO -2  ? A PRO 2   
3  1 Y 1 A LEU -1  ? A LEU 3   
4  1 Y 1 A GLY 0   ? A GLY 4   
5  1 Y 1 A SER 1   ? A SER 5   
6  1 Y 1 A ALA 2   ? A ALA 6   
7  1 Y 1 A THR 3   ? A THR 7   
8  1 Y 1 A ALA 4   ? A ALA 8   
9  1 Y 1 A PRO 5   ? A PRO 9   
10 1 Y 1 A TYR 6   ? A TYR 10  
11 1 Y 1 A GLN 174 ? A GLN 178 
12 1 Y 1 A ASN 175 ? A ASN 179 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 "GUANOSINE-5'-DIPHOSPHATE" GDP 
4 water                      HOH 
#