data_1Z6T
# 
_entry.id   1Z6T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Z6T         
RCSB  RCSB032370   
WWPDB D_1000032370 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Z6T 
_pdbx_database_status.recvd_initial_deposition_date   2005-03-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Riedl, S.J.'         1 
'Li, W.'              2 
'Chao, Y.'            3 
'Schwarzenbacher, R.' 4 
'Shi, Y.'             5 
# 
_citation.id                        primary 
_citation.title                     'Structure of the apoptotic protease-activating factor 1 bound to ADP' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            434 
_citation.page_first                926 
_citation.page_last                 933 
_citation.year                      2005 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15829969 
_citation.pdbx_database_id_DOI      10.1038/nature03465 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Riedl, S.J.'         1 
primary 'Li, W.'              2 
primary 'Chao, Y.'            3 
primary 'Schwarzenbacher, R.' 4 
primary 'Shi, Y.'             5 
# 
_cell.entry_id           1Z6T 
_cell.length_a           75.955 
_cell.length_b           92.883 
_cell.length_c           94.988 
_cell.angle_alpha        62.96 
_cell.angle_beta         89.99 
_cell.angle_gamma        90.05 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Z6T 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Apoptotic protease activating factor 1' 67855.008 4   ? ? 'Apaf-1, residues 1-591' ? 
2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"               427.201   4   ? ? ?                        ? 
3 water       nat water                                    18.015    803 ? ? ?                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Apaf-1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYVSFYNALLHEGY
KDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGK
SVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKECKGS
PLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVL
CILWDMETEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPF
PNIVQLGLCEPETSEVYQQAKLQAKQEVDNG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYVSFYNALLHEGY
KDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGK
SVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKECKGS
PLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVL
CILWDMETEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPF
PNIVQLGLCEPETSEVYQQAKLQAKQEVDNG
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ALA n 
1 4   LYS n 
1 5   ALA n 
1 6   ARG n 
1 7   ASN n 
1 8   CYS n 
1 9   LEU n 
1 10  LEU n 
1 11  GLN n 
1 12  HIS n 
1 13  ARG n 
1 14  GLU n 
1 15  ALA n 
1 16  LEU n 
1 17  GLU n 
1 18  LYS n 
1 19  ASP n 
1 20  ILE n 
1 21  LYS n 
1 22  THR n 
1 23  SER n 
1 24  TYR n 
1 25  ILE n 
1 26  MET n 
1 27  ASP n 
1 28  HIS n 
1 29  MET n 
1 30  ILE n 
1 31  SER n 
1 32  ASP n 
1 33  GLY n 
1 34  PHE n 
1 35  LEU n 
1 36  THR n 
1 37  ILE n 
1 38  SER n 
1 39  GLU n 
1 40  GLU n 
1 41  GLU n 
1 42  LYS n 
1 43  VAL n 
1 44  ARG n 
1 45  ASN n 
1 46  GLU n 
1 47  PRO n 
1 48  THR n 
1 49  GLN n 
1 50  GLN n 
1 51  GLN n 
1 52  ARG n 
1 53  ALA n 
1 54  ALA n 
1 55  MET n 
1 56  LEU n 
1 57  ILE n 
1 58  LYS n 
1 59  MET n 
1 60  ILE n 
1 61  LEU n 
1 62  LYS n 
1 63  LYS n 
1 64  ASP n 
1 65  ASN n 
1 66  ASP n 
1 67  SER n 
1 68  TYR n 
1 69  VAL n 
1 70  SER n 
1 71  PHE n 
1 72  TYR n 
1 73  ASN n 
1 74  ALA n 
1 75  LEU n 
1 76  LEU n 
1 77  HIS n 
1 78  GLU n 
1 79  GLY n 
1 80  TYR n 
1 81  LYS n 
1 82  ASP n 
1 83  LEU n 
1 84  ALA n 
1 85  ALA n 
1 86  LEU n 
1 87  LEU n 
1 88  HIS n 
1 89  ASP n 
1 90  GLY n 
1 91  ILE n 
1 92  PRO n 
1 93  VAL n 
1 94  VAL n 
1 95  SER n 
1 96  SER n 
1 97  SER n 
1 98  SER n 
1 99  GLY n 
1 100 LYS n 
1 101 ASP n 
1 102 SER n 
1 103 VAL n 
1 104 SER n 
1 105 GLY n 
1 106 ILE n 
1 107 THR n 
1 108 SER n 
1 109 TYR n 
1 110 VAL n 
1 111 ARG n 
1 112 THR n 
1 113 VAL n 
1 114 LEU n 
1 115 CYS n 
1 116 GLU n 
1 117 GLY n 
1 118 GLY n 
1 119 VAL n 
1 120 PRO n 
1 121 GLN n 
1 122 ARG n 
1 123 PRO n 
1 124 VAL n 
1 125 VAL n 
1 126 PHE n 
1 127 VAL n 
1 128 THR n 
1 129 ARG n 
1 130 LYS n 
1 131 LYS n 
1 132 LEU n 
1 133 VAL n 
1 134 ASN n 
1 135 ALA n 
1 136 ILE n 
1 137 GLN n 
1 138 GLN n 
1 139 LYS n 
1 140 LEU n 
1 141 SER n 
1 142 LYS n 
1 143 LEU n 
1 144 LYS n 
1 145 GLY n 
1 146 GLU n 
1 147 PRO n 
1 148 GLY n 
1 149 TRP n 
1 150 VAL n 
1 151 THR n 
1 152 ILE n 
1 153 HIS n 
1 154 GLY n 
1 155 MET n 
1 156 ALA n 
1 157 GLY n 
1 158 CYS n 
1 159 GLY n 
1 160 LYS n 
1 161 SER n 
1 162 VAL n 
1 163 LEU n 
1 164 ALA n 
1 165 ALA n 
1 166 GLU n 
1 167 ALA n 
1 168 VAL n 
1 169 ARG n 
1 170 ASP n 
1 171 HIS n 
1 172 SER n 
1 173 LEU n 
1 174 LEU n 
1 175 GLU n 
1 176 GLY n 
1 177 CYS n 
1 178 PHE n 
1 179 PRO n 
1 180 GLY n 
1 181 GLY n 
1 182 VAL n 
1 183 HIS n 
1 184 TRP n 
1 185 VAL n 
1 186 SER n 
1 187 VAL n 
1 188 GLY n 
1 189 LYS n 
1 190 GLN n 
1 191 ASP n 
1 192 LYS n 
1 193 SER n 
1 194 GLY n 
1 195 LEU n 
1 196 LEU n 
1 197 MET n 
1 198 LYS n 
1 199 LEU n 
1 200 GLN n 
1 201 ASN n 
1 202 LEU n 
1 203 CYS n 
1 204 THR n 
1 205 ARG n 
1 206 LEU n 
1 207 ASP n 
1 208 GLN n 
1 209 ASP n 
1 210 GLU n 
1 211 SER n 
1 212 PHE n 
1 213 SER n 
1 214 GLN n 
1 215 ARG n 
1 216 LEU n 
1 217 PRO n 
1 218 LEU n 
1 219 ASN n 
1 220 ILE n 
1 221 GLU n 
1 222 GLU n 
1 223 ALA n 
1 224 LYS n 
1 225 ASP n 
1 226 ARG n 
1 227 LEU n 
1 228 ARG n 
1 229 ILE n 
1 230 LEU n 
1 231 MET n 
1 232 LEU n 
1 233 ARG n 
1 234 LYS n 
1 235 HIS n 
1 236 PRO n 
1 237 ARG n 
1 238 SER n 
1 239 LEU n 
1 240 LEU n 
1 241 ILE n 
1 242 LEU n 
1 243 ASP n 
1 244 ASP n 
1 245 VAL n 
1 246 TRP n 
1 247 ASP n 
1 248 SER n 
1 249 TRP n 
1 250 VAL n 
1 251 LEU n 
1 252 LYS n 
1 253 ALA n 
1 254 PHE n 
1 255 ASP n 
1 256 SER n 
1 257 GLN n 
1 258 CYS n 
1 259 GLN n 
1 260 ILE n 
1 261 LEU n 
1 262 LEU n 
1 263 THR n 
1 264 THR n 
1 265 ARG n 
1 266 ASP n 
1 267 LYS n 
1 268 SER n 
1 269 VAL n 
1 270 THR n 
1 271 ASP n 
1 272 SER n 
1 273 VAL n 
1 274 MET n 
1 275 GLY n 
1 276 PRO n 
1 277 LYS n 
1 278 TYR n 
1 279 VAL n 
1 280 VAL n 
1 281 PRO n 
1 282 VAL n 
1 283 GLU n 
1 284 SER n 
1 285 SER n 
1 286 LEU n 
1 287 GLY n 
1 288 LYS n 
1 289 GLU n 
1 290 LYS n 
1 291 GLY n 
1 292 LEU n 
1 293 GLU n 
1 294 ILE n 
1 295 LEU n 
1 296 SER n 
1 297 LEU n 
1 298 PHE n 
1 299 VAL n 
1 300 ASN n 
1 301 MET n 
1 302 LYS n 
1 303 LYS n 
1 304 ALA n 
1 305 ASP n 
1 306 LEU n 
1 307 PRO n 
1 308 GLU n 
1 309 GLN n 
1 310 ALA n 
1 311 HIS n 
1 312 SER n 
1 313 ILE n 
1 314 ILE n 
1 315 LYS n 
1 316 GLU n 
1 317 CYS n 
1 318 LYS n 
1 319 GLY n 
1 320 SER n 
1 321 PRO n 
1 322 LEU n 
1 323 VAL n 
1 324 VAL n 
1 325 SER n 
1 326 LEU n 
1 327 ILE n 
1 328 GLY n 
1 329 ALA n 
1 330 LEU n 
1 331 LEU n 
1 332 ARG n 
1 333 ASP n 
1 334 PHE n 
1 335 PRO n 
1 336 ASN n 
1 337 ARG n 
1 338 TRP n 
1 339 GLU n 
1 340 TYR n 
1 341 TYR n 
1 342 LEU n 
1 343 LYS n 
1 344 GLN n 
1 345 LEU n 
1 346 GLN n 
1 347 ASN n 
1 348 LYS n 
1 349 GLN n 
1 350 PHE n 
1 351 LYS n 
1 352 ARG n 
1 353 ILE n 
1 354 ARG n 
1 355 LYS n 
1 356 SER n 
1 357 SER n 
1 358 SER n 
1 359 TYR n 
1 360 ASP n 
1 361 TYR n 
1 362 GLU n 
1 363 ALA n 
1 364 LEU n 
1 365 ASP n 
1 366 GLU n 
1 367 ALA n 
1 368 MET n 
1 369 SER n 
1 370 ILE n 
1 371 SER n 
1 372 VAL n 
1 373 GLU n 
1 374 MET n 
1 375 LEU n 
1 376 ARG n 
1 377 GLU n 
1 378 ASP n 
1 379 ILE n 
1 380 LYS n 
1 381 ASP n 
1 382 TYR n 
1 383 TYR n 
1 384 THR n 
1 385 ASP n 
1 386 LEU n 
1 387 SER n 
1 388 ILE n 
1 389 LEU n 
1 390 GLN n 
1 391 LYS n 
1 392 ASP n 
1 393 VAL n 
1 394 LYS n 
1 395 VAL n 
1 396 PRO n 
1 397 THR n 
1 398 LYS n 
1 399 VAL n 
1 400 LEU n 
1 401 CYS n 
1 402 ILE n 
1 403 LEU n 
1 404 TRP n 
1 405 ASP n 
1 406 MET n 
1 407 GLU n 
1 408 THR n 
1 409 GLU n 
1 410 GLU n 
1 411 VAL n 
1 412 GLU n 
1 413 ASP n 
1 414 ILE n 
1 415 LEU n 
1 416 GLN n 
1 417 GLU n 
1 418 PHE n 
1 419 VAL n 
1 420 ASN n 
1 421 LYS n 
1 422 SER n 
1 423 LEU n 
1 424 LEU n 
1 425 PHE n 
1 426 CYS n 
1 427 ASP n 
1 428 ARG n 
1 429 ASN n 
1 430 GLY n 
1 431 LYS n 
1 432 SER n 
1 433 PHE n 
1 434 ARG n 
1 435 TYR n 
1 436 TYR n 
1 437 LEU n 
1 438 HIS n 
1 439 ASP n 
1 440 LEU n 
1 441 GLN n 
1 442 VAL n 
1 443 ASP n 
1 444 PHE n 
1 445 LEU n 
1 446 THR n 
1 447 GLU n 
1 448 LYS n 
1 449 ASN n 
1 450 CYS n 
1 451 SER n 
1 452 GLN n 
1 453 LEU n 
1 454 GLN n 
1 455 ASP n 
1 456 LEU n 
1 457 HIS n 
1 458 LYS n 
1 459 LYS n 
1 460 ILE n 
1 461 ILE n 
1 462 THR n 
1 463 GLN n 
1 464 PHE n 
1 465 GLN n 
1 466 ARG n 
1 467 TYR n 
1 468 HIS n 
1 469 GLN n 
1 470 PRO n 
1 471 HIS n 
1 472 THR n 
1 473 LEU n 
1 474 SER n 
1 475 PRO n 
1 476 ASP n 
1 477 GLN n 
1 478 GLU n 
1 479 ASP n 
1 480 CYS n 
1 481 MET n 
1 482 TYR n 
1 483 TRP n 
1 484 TYR n 
1 485 ASN n 
1 486 PHE n 
1 487 LEU n 
1 488 ALA n 
1 489 TYR n 
1 490 HIS n 
1 491 MET n 
1 492 ALA n 
1 493 SER n 
1 494 ALA n 
1 495 LYS n 
1 496 MET n 
1 497 HIS n 
1 498 LYS n 
1 499 GLU n 
1 500 LEU n 
1 501 CYS n 
1 502 ALA n 
1 503 LEU n 
1 504 MET n 
1 505 PHE n 
1 506 SER n 
1 507 LEU n 
1 508 ASP n 
1 509 TRP n 
1 510 ILE n 
1 511 LYS n 
1 512 ALA n 
1 513 LYS n 
1 514 THR n 
1 515 GLU n 
1 516 LEU n 
1 517 VAL n 
1 518 GLY n 
1 519 PRO n 
1 520 ALA n 
1 521 HIS n 
1 522 LEU n 
1 523 ILE n 
1 524 HIS n 
1 525 GLU n 
1 526 PHE n 
1 527 VAL n 
1 528 GLU n 
1 529 TYR n 
1 530 ARG n 
1 531 HIS n 
1 532 ILE n 
1 533 LEU n 
1 534 ASP n 
1 535 GLU n 
1 536 LYS n 
1 537 ASP n 
1 538 CYS n 
1 539 ALA n 
1 540 VAL n 
1 541 SER n 
1 542 GLU n 
1 543 ASN n 
1 544 PHE n 
1 545 GLN n 
1 546 GLU n 
1 547 PHE n 
1 548 LEU n 
1 549 SER n 
1 550 LEU n 
1 551 ASN n 
1 552 GLY n 
1 553 HIS n 
1 554 LEU n 
1 555 LEU n 
1 556 GLY n 
1 557 ARG n 
1 558 GLN n 
1 559 PRO n 
1 560 PHE n 
1 561 PRO n 
1 562 ASN n 
1 563 ILE n 
1 564 VAL n 
1 565 GLN n 
1 566 LEU n 
1 567 GLY n 
1 568 LEU n 
1 569 CYS n 
1 570 GLU n 
1 571 PRO n 
1 572 GLU n 
1 573 THR n 
1 574 SER n 
1 575 GLU n 
1 576 VAL n 
1 577 TYR n 
1 578 GLN n 
1 579 GLN n 
1 580 ALA n 
1 581 LYS n 
1 582 LEU n 
1 583 GLN n 
1 584 ALA n 
1 585 LYS n 
1 586 GLN n 
1 587 GLU n 
1 588 VAL n 
1 589 ASP n 
1 590 ASN n 
1 591 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-29b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    APAF_HUMAN 
_struct_ref.pdbx_db_accession          O14727 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYVSFYNALLHEGY
KDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGK
SVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKECKGS
PLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVL
CILWDMETEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPF
PNIVQLGLCEPETSEVYQQAKLQAKQEVDNG
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1Z6T A 1 ? 591 ? O14727 1 ? 591 ? 1 591 
2 1 1Z6T B 1 ? 591 ? O14727 1 ? 591 ? 1 591 
3 1 1Z6T C 1 ? 591 ? O14727 1 ? 591 ? 1 591 
4 1 1Z6T D 1 ? 591 ? O14727 1 ? 591 ? 1 591 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1Z6T 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            276 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.10 
_exptl_crystal_grow.pdbx_details    
'HEPES, ammonium acetate, PEG-3350, pH 7.1, VAPOR DIFFUSION, SITTING DROP, temperature 276K, pH 7.10' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100.0 ? 1 
2 ?     ? 1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-07-01 
_diffrn_detector.details                ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M X25 'SINGLE WAVELENGTH' x-ray 
2 2 M ?   MAD                 x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.954  1.0 
2 1.0088 1.0 
3 0.9500 1.0 
4 1.0053 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'CHESS BEAMLINE A1' CHESS A1 0.954 ?                        
2 SYNCHROTRON 'CHESS BEAMLINE A1' CHESS A1 ?     '1.0088, 0.9500, 1.0053' 
# 
_reflns.entry_id                     1Z6T 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   103300 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.5 
_reflns.pdbx_Rmerge_I_obs            0.048 
_reflns.pdbx_Rsym_value              0.048 
_reflns.pdbx_netI_over_sigmaI        12.7000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.700 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.21 
_reflns_shell.d_res_low              2.27 
_reflns_shell.percent_possible_all   48.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.267 
_reflns_shell.meanI_over_sigI_obs    2.500 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1Z6T 
_refine.ls_number_reflns_obs                     97722 
_refine.ls_number_reflns_all                     102933 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.21 
_refine.ls_percent_reflns_obs                    89.2 
_refine.ls_R_factor_obs                          0.192 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  5211 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               36.38 
_refine.aniso_B[1][1]                            0.18000 
_refine.aniso_B[2][2]                            0.40000 
_refine.aniso_B[3][3]                            -0.17000 
_refine.aniso_B[1][2]                            0.13000 
_refine.aniso_B[1][3]                            0.77000 
_refine.aniso_B[2][3]                            -0.45000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS UNACCOUNTED DENSITY NEXT TO CYSTEINES A115, A450; B115,B450;C115,C450;D115,D450;' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.256 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18752 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         108 
_refine_hist.number_atoms_solvent             803 
_refine_hist.number_atoms_total               19663 
_refine_hist.d_res_high                       2.21 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 19376 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 17608 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.431  1.977  ? 26160 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.872  3.000  ? 41224 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.191  5.000  ? 2340  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.382 24.730 ? 888   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.481 15.000 ? 3676  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.503 15.000 ? 100   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.078  0.200  ? 2904  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 21084 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 3716  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.209  0.200  ? 4397  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.181  0.200  ? 17362 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.175  0.200  ? 9294  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.088  0.200  ? 10713 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.213  0.200  ? 856   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          0.230  0.200  ? 5     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.277  0.200  ? 62    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.261  0.200  ? 150   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.306  0.200  ? 29    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.190  3.000  ? 15178 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.239  3.000  ? 4724  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.682  5.000  ? 18904 'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.687  8.000  ? 9001  'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.432  11.000 ? 7256  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 2792 0.05 0.05 'tight positional'  1 'X-RAY DIFFRACTION' 1  ? ? ? 
2 B 2792 0.05 0.05 'tight positional'  1 'X-RAY DIFFRACTION' 2  ? ? ? 
3 C 2792 0.05 0.05 'tight positional'  1 'X-RAY DIFFRACTION' 3  ? ? ? 
4 D 2792 0.05 0.05 'tight positional'  1 'X-RAY DIFFRACTION' 4  ? ? ? 
1 A 4583 0.46 0.50 'medium positional' 1 'X-RAY DIFFRACTION' 5  ? ? ? 
2 B 4583 0.46 0.50 'medium positional' 1 'X-RAY DIFFRACTION' 6  ? ? ? 
3 C 4583 0.42 0.50 'medium positional' 1 'X-RAY DIFFRACTION' 7  ? ? ? 
4 D 4583 0.51 0.50 'medium positional' 1 'X-RAY DIFFRACTION' 8  ? ? ? 
1 A 2792 0.13 0.50 'tight thermal'     1 'X-RAY DIFFRACTION' 9  ? ? ? 
2 B 2792 0.13 0.50 'tight thermal'     1 'X-RAY DIFFRACTION' 10 ? ? ? 
3 C 2792 0.13 0.50 'tight thermal'     1 'X-RAY DIFFRACTION' 11 ? ? ? 
4 D 2792 0.13 0.50 'tight thermal'     1 'X-RAY DIFFRACTION' 12 ? ? ? 
1 A 4583 0.72 2.00 'medium thermal'    1 'X-RAY DIFFRACTION' 13 ? ? ? 
2 B 4583 0.71 2.00 'medium thermal'    1 'X-RAY DIFFRACTION' 14 ? ? ? 
3 C 4583 0.73 2.00 'medium thermal'    1 'X-RAY DIFFRACTION' 15 ? ? ? 
4 D 4583 0.72 2.00 'medium thermal'    1 'X-RAY DIFFRACTION' 16 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.21 
_refine_ls_shell.d_res_low                        2.27 
_refine_ls_shell.number_reflns_R_work             3661 
_refine_ls_shell.R_factor_R_work                  0.243 
_refine_ls_shell.percent_reflns_obs               46.10 
_refine_ls_shell.R_factor_R_free                  0.302 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             197 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 C 
1 4 D 
1 5 A 
1 6 B 
1 7 C 
1 8 D 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 106 A 350 1 2 A ILE 106 ? A PHE 350 ? 1 ? 
2 B 106 B 350 1 2 B ILE 106 ? B PHE 350 ? 1 ? 
3 C 106 C 350 1 2 C ILE 106 ? C PHE 350 ? 1 ? 
4 D 106 D 350 1 2 D ILE 106 ? D PHE 350 ? 1 ? 
5 A 360 A 586 2 2 A ASP 360 ? A GLN 586 ? 1 ? 
6 B 360 B 586 2 2 B ASP 360 ? B GLN 586 ? 1 ? 
7 C 360 C 586 2 2 C ASP 360 ? C GLN 586 ? 1 ? 
8 D 360 D 586 2 2 D ASP 360 ? D GLN 586 ? 1 ? 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1Z6T 
_struct.title                     'Structure of the apoptotic protease-activating factor 1 bound to ADP' 
_struct.pdbx_descriptor           'Apoptotic protease activating factor 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Z6T 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'Apaf-1, caspase activation, ADP, nucleotide binding, CARD, APOPTOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
4 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASP A 2   ? HIS A 12  ? ASP A 2   HIS A 12  1 ? 11 
HELX_P HELX_P2   2   HIS A 12  ? ILE A 20  ? HIS A 12  ILE A 20  1 ? 9  
HELX_P HELX_P3   3   LYS A 21  ? ASP A 32  ? LYS A 21  ASP A 32  1 ? 12 
HELX_P HELX_P4   4   THR A 36  ? ASN A 45  ? THR A 36  ASN A 45  1 ? 10 
HELX_P HELX_P5   5   THR A 48  ? LYS A 62  ? THR A 48  LYS A 62  1 ? 15 
HELX_P HELX_P6   6   ASP A 64  ? GLY A 79  ? ASP A 64  GLY A 79  1 ? 16 
HELX_P HELX_P7   7   TYR A 80  ? ASP A 89  ? TYR A 80  ASP A 89  1 ? 10 
HELX_P HELX_P8   8   THR A 107 ? GLY A 117 ? THR A 107 GLY A 117 1 ? 11 
HELX_P HELX_P9   9   ARG A 129 ? SER A 141 ? ARG A 129 SER A 141 1 ? 13 
HELX_P HELX_P10  10  GLY A 159 ? ARG A 169 ? GLY A 159 ARG A 169 1 ? 11 
HELX_P HELX_P11  11  ASP A 170 ? PHE A 178 ? ASP A 170 PHE A 178 1 ? 9  
HELX_P HELX_P12  12  ASP A 191 ? ASP A 207 ? ASP A 191 ASP A 207 1 ? 17 
HELX_P HELX_P13  13  ASN A 219 ? LYS A 234 ? ASN A 219 LYS A 234 1 ? 16 
HELX_P HELX_P14  14  ASP A 247 ? ALA A 253 ? ASP A 247 ALA A 253 1 ? 7  
HELX_P HELX_P15  15  ASP A 266 ? ASP A 271 ? ASP A 266 ASP A 271 5 ? 6  
HELX_P HELX_P16  16  GLY A 287 ? ASN A 300 ? GLY A 287 ASN A 300 1 ? 14 
HELX_P HELX_P17  17  LYS A 302 ? PRO A 307 ? LYS A 302 PRO A 307 5 ? 6  
HELX_P HELX_P18  18  GLU A 308 ? CYS A 317 ? GLU A 308 CYS A 317 1 ? 10 
HELX_P HELX_P19  19  SER A 320 ? PHE A 334 ? SER A 320 PHE A 334 1 ? 15 
HELX_P HELX_P20  20  ARG A 337 ? ASN A 347 ? ARG A 337 ASN A 347 1 ? 11 
HELX_P HELX_P21  21  TYR A 361 ? MET A 374 ? TYR A 361 MET A 374 1 ? 14 
HELX_P HELX_P22  22  ILE A 379 ? LEU A 386 ? ILE A 379 LEU A 386 1 ? 8  
HELX_P HELX_P23  23  SER A 387 ? LEU A 389 ? SER A 387 LEU A 389 5 ? 3  
HELX_P HELX_P24  24  THR A 397 ? ASP A 405 ? THR A 397 ASP A 405 1 ? 9  
HELX_P HELX_P25  25  GLU A 407 ? LYS A 421 ? GLU A 407 LYS A 421 1 ? 15 
HELX_P HELX_P26  26  HIS A 438 ? ASN A 449 ? HIS A 438 ASN A 449 1 ? 12 
HELX_P HELX_P27  27  GLN A 452 ? GLN A 465 ? GLN A 452 GLN A 465 1 ? 14 
HELX_P HELX_P28  28  GLN A 469 ? LEU A 473 ? GLN A 469 LEU A 473 5 ? 5  
HELX_P HELX_P29  29  ASP A 479 ? ALA A 494 ? ASP A 479 ALA A 494 1 ? 16 
HELX_P HELX_P30  30  MET A 496 ? PHE A 505 ? MET A 496 PHE A 505 1 ? 10 
HELX_P HELX_P31  31  SER A 506 ? GLY A 518 ? SER A 506 GLY A 518 1 ? 13 
HELX_P HELX_P32  32  PRO A 519 ? TYR A 529 ? PRO A 519 TYR A 529 1 ? 11 
HELX_P HELX_P33  33  ARG A 530 ? LEU A 533 ? ARG A 530 LEU A 533 5 ? 4  
HELX_P HELX_P34  34  ASP A 534 ? ASN A 551 ? ASP A 534 ASN A 551 1 ? 18 
HELX_P HELX_P35  35  ASN A 562 ? LEU A 568 ? ASN A 562 LEU A 568 1 ? 7  
HELX_P HELX_P36  36  SER A 574 ? GLN A 586 ? SER A 574 GLN A 586 1 ? 13 
HELX_P HELX_P37  37  ASP B 2   ? ILE B 20  ? ASP B 2   ILE B 20  1 ? 19 
HELX_P HELX_P38  38  THR B 22  ? GLY B 33  ? THR B 22  GLY B 33  1 ? 12 
HELX_P HELX_P39  39  THR B 36  ? ASN B 45  ? THR B 36  ASN B 45  1 ? 10 
HELX_P HELX_P40  40  THR B 48  ? LEU B 61  ? THR B 48  LEU B 61  1 ? 14 
HELX_P HELX_P41  41  ASP B 64  ? GLU B 78  ? ASP B 64  GLU B 78  1 ? 15 
HELX_P HELX_P42  42  TYR B 80  ? ASP B 89  ? TYR B 80  ASP B 89  1 ? 10 
HELX_P HELX_P43  43  GLY B 90  ? ILE B 91  ? GLY B 90  ILE B 91  5 ? 2  
HELX_P HELX_P44  44  PRO B 92  ? SER B 96  ? PRO B 92  SER B 96  5 ? 5  
HELX_P HELX_P45  45  SER B 98  ? GLY B 105 ? SER B 98  GLY B 105 1 ? 8  
HELX_P HELX_P46  46  THR B 107 ? GLY B 118 ? THR B 107 GLY B 118 1 ? 12 
HELX_P HELX_P47  47  ARG B 129 ? SER B 141 ? ARG B 129 SER B 141 1 ? 13 
HELX_P HELX_P48  48  GLY B 159 ? VAL B 168 ? GLY B 159 VAL B 168 1 ? 10 
HELX_P HELX_P49  49  ASP B 170 ? PHE B 178 ? ASP B 170 PHE B 178 1 ? 9  
HELX_P HELX_P50  50  ASP B 191 ? ASP B 207 ? ASP B 191 ASP B 207 1 ? 17 
HELX_P HELX_P51  51  ASN B 219 ? LYS B 234 ? ASN B 219 LYS B 234 1 ? 16 
HELX_P HELX_P52  52  ASP B 247 ? ALA B 253 ? ASP B 247 ALA B 253 1 ? 7  
HELX_P HELX_P53  53  ASP B 266 ? ASP B 271 ? ASP B 266 ASP B 271 5 ? 6  
HELX_P HELX_P54  54  GLY B 287 ? ASN B 300 ? GLY B 287 ASN B 300 1 ? 14 
HELX_P HELX_P55  55  LYS B 302 ? PRO B 307 ? LYS B 302 PRO B 307 5 ? 6  
HELX_P HELX_P56  56  GLU B 308 ? LYS B 318 ? GLU B 308 LYS B 318 1 ? 11 
HELX_P HELX_P57  57  SER B 320 ? PHE B 334 ? SER B 320 PHE B 334 1 ? 15 
HELX_P HELX_P58  58  ARG B 337 ? ASN B 347 ? ARG B 337 ASN B 347 1 ? 11 
HELX_P HELX_P59  59  TYR B 361 ? MET B 374 ? TYR B 361 MET B 374 1 ? 14 
HELX_P HELX_P60  60  ARG B 376 ? LEU B 386 ? ARG B 376 LEU B 386 1 ? 11 
HELX_P HELX_P61  61  SER B 387 ? LEU B 389 ? SER B 387 LEU B 389 5 ? 3  
HELX_P HELX_P62  62  THR B 397 ? ASP B 405 ? THR B 397 ASP B 405 1 ? 9  
HELX_P HELX_P63  63  GLU B 407 ? LYS B 421 ? GLU B 407 LYS B 421 1 ? 15 
HELX_P HELX_P64  64  HIS B 438 ? ASN B 449 ? HIS B 438 ASN B 449 1 ? 12 
HELX_P HELX_P65  65  GLN B 452 ? GLN B 465 ? GLN B 452 GLN B 465 1 ? 14 
HELX_P HELX_P66  66  GLN B 469 ? LEU B 473 ? GLN B 469 LEU B 473 5 ? 5  
HELX_P HELX_P67  67  ASP B 479 ? ALA B 494 ? ASP B 479 ALA B 494 1 ? 16 
HELX_P HELX_P68  68  MET B 496 ? PHE B 505 ? MET B 496 PHE B 505 1 ? 10 
HELX_P HELX_P69  69  SER B 506 ? GLY B 518 ? SER B 506 GLY B 518 1 ? 13 
HELX_P HELX_P70  70  PRO B 519 ? ARG B 530 ? PRO B 519 ARG B 530 1 ? 12 
HELX_P HELX_P71  71  HIS B 531 ? LEU B 533 ? HIS B 531 LEU B 533 5 ? 3  
HELX_P HELX_P72  72  ASP B 534 ? ASN B 551 ? ASP B 534 ASN B 551 1 ? 18 
HELX_P HELX_P73  73  ASN B 562 ? LEU B 568 ? ASN B 562 LEU B 568 1 ? 7  
HELX_P HELX_P74  74  SER B 574 ? GLN B 586 ? SER B 574 GLN B 586 1 ? 13 
HELX_P HELX_P75  75  ASP C 2   ? ILE C 20  ? ASP C 2   ILE C 20  1 ? 19 
HELX_P HELX_P76  76  THR C 22  ? GLY C 33  ? THR C 22  GLY C 33  1 ? 12 
HELX_P HELX_P77  77  THR C 36  ? ASN C 45  ? THR C 36  ASN C 45  1 ? 10 
HELX_P HELX_P78  78  THR C 48  ? LEU C 61  ? THR C 48  LEU C 61  1 ? 14 
HELX_P HELX_P79  79  ASP C 64  ? GLU C 78  ? ASP C 64  GLU C 78  1 ? 15 
HELX_P HELX_P80  80  TYR C 80  ? HIS C 88  ? TYR C 80  HIS C 88  1 ? 9  
HELX_P HELX_P81  81  ASP C 89  ? ILE C 91  ? ASP C 89  ILE C 91  5 ? 3  
HELX_P HELX_P82  82  PRO C 92  ? SER C 96  ? PRO C 92  SER C 96  5 ? 5  
HELX_P HELX_P83  83  SER C 98  ? GLY C 105 ? SER C 98  GLY C 105 1 ? 8  
HELX_P HELX_P84  84  THR C 107 ? GLY C 117 ? THR C 107 GLY C 117 1 ? 11 
HELX_P HELX_P85  85  ARG C 129 ? SER C 141 ? ARG C 129 SER C 141 1 ? 13 
HELX_P HELX_P86  86  GLY C 159 ? ARG C 169 ? GLY C 159 ARG C 169 1 ? 11 
HELX_P HELX_P87  87  ASP C 170 ? PHE C 178 ? ASP C 170 PHE C 178 1 ? 9  
HELX_P HELX_P88  88  ASP C 191 ? ASP C 207 ? ASP C 191 ASP C 207 1 ? 17 
HELX_P HELX_P89  89  ASN C 219 ? LYS C 234 ? ASN C 219 LYS C 234 1 ? 16 
HELX_P HELX_P90  90  ASP C 247 ? ALA C 253 ? ASP C 247 ALA C 253 1 ? 7  
HELX_P HELX_P91  91  ASP C 266 ? ASP C 271 ? ASP C 266 ASP C 271 5 ? 6  
HELX_P HELX_P92  92  GLY C 287 ? ASN C 300 ? GLY C 287 ASN C 300 1 ? 14 
HELX_P HELX_P93  93  LYS C 302 ? PRO C 307 ? LYS C 302 PRO C 307 5 ? 6  
HELX_P HELX_P94  94  GLU C 308 ? LYS C 318 ? GLU C 308 LYS C 318 1 ? 11 
HELX_P HELX_P95  95  SER C 320 ? PHE C 334 ? SER C 320 PHE C 334 1 ? 15 
HELX_P HELX_P96  96  ARG C 337 ? ASN C 347 ? ARG C 337 ASN C 347 1 ? 11 
HELX_P HELX_P97  97  TYR C 361 ? MET C 374 ? TYR C 361 MET C 374 1 ? 14 
HELX_P HELX_P98  98  ARG C 376 ? LEU C 386 ? ARG C 376 LEU C 386 1 ? 11 
HELX_P HELX_P99  99  SER C 387 ? LEU C 389 ? SER C 387 LEU C 389 5 ? 3  
HELX_P HELX_P100 100 THR C 397 ? ASP C 405 ? THR C 397 ASP C 405 1 ? 9  
HELX_P HELX_P101 101 GLU C 407 ? LYS C 421 ? GLU C 407 LYS C 421 1 ? 15 
HELX_P HELX_P102 102 HIS C 438 ? ASN C 449 ? HIS C 438 ASN C 449 1 ? 12 
HELX_P HELX_P103 103 GLN C 452 ? GLN C 465 ? GLN C 452 GLN C 465 1 ? 14 
HELX_P HELX_P104 104 GLN C 469 ? LEU C 473 ? GLN C 469 LEU C 473 5 ? 5  
HELX_P HELX_P105 105 ASP C 479 ? ALA C 494 ? ASP C 479 ALA C 494 1 ? 16 
HELX_P HELX_P106 106 MET C 496 ? PHE C 505 ? MET C 496 PHE C 505 1 ? 10 
HELX_P HELX_P107 107 SER C 506 ? GLY C 518 ? SER C 506 GLY C 518 1 ? 13 
HELX_P HELX_P108 108 PRO C 519 ? ARG C 530 ? PRO C 519 ARG C 530 1 ? 12 
HELX_P HELX_P109 109 HIS C 531 ? LEU C 533 ? HIS C 531 LEU C 533 5 ? 3  
HELX_P HELX_P110 110 ASP C 534 ? ASN C 551 ? ASP C 534 ASN C 551 1 ? 18 
HELX_P HELX_P111 111 ASN C 562 ? LEU C 568 ? ASN C 562 LEU C 568 1 ? 7  
HELX_P HELX_P112 112 SER C 574 ? GLN C 586 ? SER C 574 GLN C 586 1 ? 13 
HELX_P HELX_P113 113 ASP D 2   ? ILE D 20  ? ASP D 2   ILE D 20  1 ? 19 
HELX_P HELX_P114 114 THR D 22  ? ASP D 32  ? THR D 22  ASP D 32  1 ? 11 
HELX_P HELX_P115 115 THR D 36  ? GLU D 46  ? THR D 36  GLU D 46  1 ? 11 
HELX_P HELX_P116 116 THR D 48  ? LEU D 61  ? THR D 48  LEU D 61  1 ? 14 
HELX_P HELX_P117 117 ASP D 64  ? GLU D 78  ? ASP D 64  GLU D 78  1 ? 15 
HELX_P HELX_P118 118 TYR D 80  ? ASP D 89  ? TYR D 80  ASP D 89  1 ? 10 
HELX_P HELX_P119 119 THR D 107 ? GLY D 117 ? THR D 107 GLY D 117 1 ? 11 
HELX_P HELX_P120 120 ARG D 129 ? SER D 141 ? ARG D 129 SER D 141 1 ? 13 
HELX_P HELX_P121 121 GLY D 159 ? ARG D 169 ? GLY D 159 ARG D 169 1 ? 11 
HELX_P HELX_P122 122 ASP D 170 ? PHE D 178 ? ASP D 170 PHE D 178 1 ? 9  
HELX_P HELX_P123 123 ASP D 191 ? ASP D 207 ? ASP D 191 ASP D 207 1 ? 17 
HELX_P HELX_P124 124 ASN D 219 ? LYS D 234 ? ASN D 219 LYS D 234 1 ? 16 
HELX_P HELX_P125 125 ASP D 247 ? ALA D 253 ? ASP D 247 ALA D 253 1 ? 7  
HELX_P HELX_P126 126 ASP D 266 ? ASP D 271 ? ASP D 266 ASP D 271 5 ? 6  
HELX_P HELX_P127 127 GLY D 287 ? ASN D 300 ? GLY D 287 ASN D 300 1 ? 14 
HELX_P HELX_P128 128 LYS D 302 ? PRO D 307 ? LYS D 302 PRO D 307 5 ? 6  
HELX_P HELX_P129 129 GLU D 308 ? CYS D 317 ? GLU D 308 CYS D 317 1 ? 10 
HELX_P HELX_P130 130 SER D 320 ? PHE D 334 ? SER D 320 PHE D 334 1 ? 15 
HELX_P HELX_P131 131 ARG D 337 ? ASN D 347 ? ARG D 337 ASN D 347 1 ? 11 
HELX_P HELX_P132 132 TYR D 361 ? MET D 374 ? TYR D 361 MET D 374 1 ? 14 
HELX_P HELX_P133 133 ILE D 379 ? LEU D 386 ? ILE D 379 LEU D 386 1 ? 8  
HELX_P HELX_P134 134 SER D 387 ? LEU D 389 ? SER D 387 LEU D 389 5 ? 3  
HELX_P HELX_P135 135 THR D 397 ? ASP D 405 ? THR D 397 ASP D 405 1 ? 9  
HELX_P HELX_P136 136 GLU D 407 ? LYS D 421 ? GLU D 407 LYS D 421 1 ? 15 
HELX_P HELX_P137 137 HIS D 438 ? ASN D 449 ? HIS D 438 ASN D 449 1 ? 12 
HELX_P HELX_P138 138 GLN D 452 ? GLN D 465 ? GLN D 452 GLN D 465 1 ? 14 
HELX_P HELX_P139 139 GLN D 469 ? LEU D 473 ? GLN D 469 LEU D 473 5 ? 5  
HELX_P HELX_P140 140 ASP D 479 ? ALA D 494 ? ASP D 479 ALA D 494 1 ? 16 
HELX_P HELX_P141 141 MET D 496 ? PHE D 505 ? MET D 496 PHE D 505 1 ? 10 
HELX_P HELX_P142 142 SER D 506 ? GLY D 518 ? SER D 506 GLY D 518 1 ? 13 
HELX_P HELX_P143 143 PRO D 519 ? ARG D 530 ? PRO D 519 ARG D 530 1 ? 12 
HELX_P HELX_P144 144 HIS D 531 ? LEU D 533 ? HIS D 531 LEU D 533 5 ? 3  
HELX_P HELX_P145 145 ASP D 534 ? ASN D 551 ? ASP D 534 ASN D 551 1 ? 18 
HELX_P HELX_P146 146 ASN D 562 ? LEU D 568 ? ASN D 562 LEU D 568 1 ? 7  
HELX_P HELX_P147 147 SER D 574 ? GLN D 586 ? SER D 574 GLN D 586 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 558 A . ? GLN 558 A PRO 559 A ? PRO 559 A 1 -6.31 
2 GLN 558 B . ? GLN 558 B PRO 559 B ? PRO 559 B 1 -4.59 
3 GLN 558 C . ? GLN 558 C PRO 559 C ? PRO 559 C 1 -2.10 
4 GLN 558 D . ? GLN 558 D PRO 559 D ? PRO 559 D 1 -8.47 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 5 ? 
D ? 3 ? 
E ? 5 ? 
F ? 3 ? 
G ? 5 ? 
H ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 182 ? GLY A 188 ? VAL A 182 GLY A 188 
A 2 LEU A 239 ? VAL A 245 ? LEU A 239 VAL A 245 
A 3 GLN A 259 ? THR A 264 ? GLN A 259 THR A 264 
A 4 GLY A 148 ? HIS A 153 ? GLY A 148 HIS A 153 
A 5 LYS A 277 ? PRO A 281 ? LYS A 277 PRO A 281 
B 1 VAL A 395 ? PRO A 396 ? VAL A 395 PRO A 396 
B 2 SER A 432 ? TYR A 436 ? SER A 432 TYR A 436 
B 3 PHE A 425 ? ASN A 429 ? PHE A 425 ASN A 429 
C 1 VAL B 182 ? SER B 186 ? VAL B 182 SER B 186 
C 2 LEU B 239 ? ASP B 243 ? LEU B 239 ASP B 243 
C 3 GLN B 259 ? THR B 264 ? GLN B 259 THR B 264 
C 4 GLY B 148 ? HIS B 153 ? GLY B 148 HIS B 153 
C 5 LYS B 277 ? PRO B 281 ? LYS B 277 PRO B 281 
D 1 VAL B 395 ? PRO B 396 ? VAL B 395 PRO B 396 
D 2 SER B 432 ? TYR B 436 ? SER B 432 TYR B 436 
D 3 PHE B 425 ? ASN B 429 ? PHE B 425 ASN B 429 
E 1 VAL C 182 ? GLY C 188 ? VAL C 182 GLY C 188 
E 2 LEU C 239 ? VAL C 245 ? LEU C 239 VAL C 245 
E 3 GLN C 259 ? THR C 264 ? GLN C 259 THR C 264 
E 4 GLY C 148 ? HIS C 153 ? GLY C 148 HIS C 153 
E 5 LYS C 277 ? PRO C 281 ? LYS C 277 PRO C 281 
F 1 VAL C 395 ? PRO C 396 ? VAL C 395 PRO C 396 
F 2 SER C 432 ? TYR C 436 ? SER C 432 TYR C 436 
F 3 PHE C 425 ? ASN C 429 ? PHE C 425 ASN C 429 
G 1 VAL D 182 ? SER D 186 ? VAL D 182 SER D 186 
G 2 LEU D 239 ? ASP D 243 ? LEU D 239 ASP D 243 
G 3 GLN D 259 ? THR D 264 ? GLN D 259 THR D 264 
G 4 GLY D 148 ? HIS D 153 ? GLY D 148 HIS D 153 
G 5 LYS D 277 ? PRO D 281 ? LYS D 277 PRO D 281 
H 1 VAL D 395 ? PRO D 396 ? VAL D 395 PRO D 396 
H 2 SER D 432 ? TYR D 436 ? SER D 432 TYR D 436 
H 3 PHE D 425 ? ASN D 429 ? PHE D 425 ASN D 429 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 185 ? N VAL A 185 O ILE A 241 ? O ILE A 241 
A 2 3 N LEU A 242 ? N LEU A 242 O LEU A 261 ? O LEU A 261 
A 3 4 O LEU A 262 ? O LEU A 262 N ILE A 152 ? N ILE A 152 
A 4 5 N THR A 151 ? N THR A 151 O VAL A 280 ? O VAL A 280 
B 1 2 N VAL A 395 ? N VAL A 395 O TYR A 435 ? O TYR A 435 
B 2 3 O ARG A 434 ? O ARG A 434 N ASP A 427 ? N ASP A 427 
C 1 2 N VAL B 185 ? N VAL B 185 O ILE B 241 ? O ILE B 241 
C 2 3 N LEU B 242 ? N LEU B 242 O LEU B 261 ? O LEU B 261 
C 3 4 O LEU B 262 ? O LEU B 262 N ILE B 152 ? N ILE B 152 
C 4 5 N THR B 151 ? N THR B 151 O TYR B 278 ? O TYR B 278 
D 1 2 N VAL B 395 ? N VAL B 395 O TYR B 435 ? O TYR B 435 
D 2 3 O TYR B 436 ? O TYR B 436 N PHE B 425 ? N PHE B 425 
E 1 2 N VAL C 185 ? N VAL C 185 O ILE C 241 ? O ILE C 241 
E 2 3 N LEU C 240 ? N LEU C 240 O LEU C 261 ? O LEU C 261 
E 3 4 O LEU C 262 ? O LEU C 262 N ILE C 152 ? N ILE C 152 
E 4 5 N THR C 151 ? N THR C 151 O VAL C 280 ? O VAL C 280 
F 1 2 N VAL C 395 ? N VAL C 395 O TYR C 435 ? O TYR C 435 
F 2 3 O TYR C 436 ? O TYR C 436 N PHE C 425 ? N PHE C 425 
G 1 2 N VAL D 185 ? N VAL D 185 O ILE D 241 ? O ILE D 241 
G 2 3 N LEU D 242 ? N LEU D 242 O LEU D 261 ? O LEU D 261 
G 3 4 O LEU D 262 ? O LEU D 262 N ILE D 152 ? N ILE D 152 
G 4 5 N THR D 151 ? N THR D 151 O VAL D 280 ? O VAL D 280 
H 1 2 N VAL D 395 ? N VAL D 395 O TYR D 435 ? O TYR D 435 
H 2 3 O TYR D 436 ? O TYR D 436 N PHE D 425 ? N PHE D 425 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE ADP A 900' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ADP B 901' 
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE ADP C 902' 
AC4 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ADP D 903' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 VAL A 125 ? VAL A 125  . ? 1_555 ? 
2  AC1 22 PHE A 126 ? PHE A 126  . ? 1_555 ? 
3  AC1 22 VAL A 127 ? VAL A 127  . ? 1_555 ? 
4  AC1 22 ARG A 129 ? ARG A 129  . ? 1_555 ? 
5  AC1 22 GLY A 157 ? GLY A 157  . ? 1_555 ? 
6  AC1 22 CYS A 158 ? CYS A 158  . ? 1_555 ? 
7  AC1 22 GLY A 159 ? GLY A 159  . ? 1_555 ? 
8  AC1 22 LYS A 160 ? LYS A 160  . ? 1_555 ? 
9  AC1 22 SER A 161 ? SER A 161  . ? 1_555 ? 
10 AC1 22 VAL A 162 ? VAL A 162  . ? 1_555 ? 
11 AC1 22 PRO A 321 ? PRO A 321  . ? 1_555 ? 
12 AC1 22 LEU A 322 ? LEU A 322  . ? 1_555 ? 
13 AC1 22 PHE A 425 ? PHE A 425  . ? 1_555 ? 
14 AC1 22 HIS A 438 ? HIS A 438  . ? 1_555 ? 
15 AC1 22 HOH I .   ? HOH A 928  . ? 1_555 ? 
16 AC1 22 HOH I .   ? HOH A 970  . ? 1_555 ? 
17 AC1 22 HOH I .   ? HOH A 1074 . ? 1_555 ? 
18 AC1 22 HOH I .   ? HOH A 1075 . ? 1_555 ? 
19 AC1 22 HOH I .   ? HOH A 1076 . ? 1_555 ? 
20 AC1 22 HOH I .   ? HOH A 1077 . ? 1_555 ? 
21 AC1 22 HOH I .   ? HOH A 1078 . ? 1_555 ? 
22 AC1 22 HOH I .   ? HOH A 1079 . ? 1_555 ? 
23 AC2 17 VAL B 125 ? VAL B 125  . ? 1_555 ? 
24 AC2 17 PHE B 126 ? PHE B 126  . ? 1_555 ? 
25 AC2 17 VAL B 127 ? VAL B 127  . ? 1_555 ? 
26 AC2 17 GLY B 157 ? GLY B 157  . ? 1_555 ? 
27 AC2 17 CYS B 158 ? CYS B 158  . ? 1_555 ? 
28 AC2 17 GLY B 159 ? GLY B 159  . ? 1_555 ? 
29 AC2 17 LYS B 160 ? LYS B 160  . ? 1_555 ? 
30 AC2 17 SER B 161 ? SER B 161  . ? 1_555 ? 
31 AC2 17 VAL B 162 ? VAL B 162  . ? 1_555 ? 
32 AC2 17 PRO B 321 ? PRO B 321  . ? 1_555 ? 
33 AC2 17 LEU B 322 ? LEU B 322  . ? 1_555 ? 
34 AC2 17 PHE B 425 ? PHE B 425  . ? 1_555 ? 
35 AC2 17 HIS B 438 ? HIS B 438  . ? 1_555 ? 
36 AC2 17 HOH J .   ? HOH B 986  . ? 1_555 ? 
37 AC2 17 HOH J .   ? HOH B 1017 . ? 1_555 ? 
38 AC2 17 HOH J .   ? HOH B 1059 . ? 1_555 ? 
39 AC2 17 HOH J .   ? HOH B 1093 . ? 1_555 ? 
40 AC3 16 VAL C 125 ? VAL C 125  . ? 1_555 ? 
41 AC3 16 PHE C 126 ? PHE C 126  . ? 1_555 ? 
42 AC3 16 VAL C 127 ? VAL C 127  . ? 1_555 ? 
43 AC3 16 GLY C 157 ? GLY C 157  . ? 1_555 ? 
44 AC3 16 CYS C 158 ? CYS C 158  . ? 1_555 ? 
45 AC3 16 GLY C 159 ? GLY C 159  . ? 1_555 ? 
46 AC3 16 LYS C 160 ? LYS C 160  . ? 1_555 ? 
47 AC3 16 SER C 161 ? SER C 161  . ? 1_555 ? 
48 AC3 16 VAL C 162 ? VAL C 162  . ? 1_555 ? 
49 AC3 16 PRO C 321 ? PRO C 321  . ? 1_555 ? 
50 AC3 16 LEU C 322 ? LEU C 322  . ? 1_555 ? 
51 AC3 16 PHE C 425 ? PHE C 425  . ? 1_555 ? 
52 AC3 16 HIS C 438 ? HIS C 438  . ? 1_555 ? 
53 AC3 16 HOH K .   ? HOH C 937  . ? 1_555 ? 
54 AC3 16 HOH K .   ? HOH C 1009 . ? 1_555 ? 
55 AC3 16 HOH K .   ? HOH C 1081 . ? 1_555 ? 
56 AC4 20 VAL D 125 ? VAL D 125  . ? 1_555 ? 
57 AC4 20 PHE D 126 ? PHE D 126  . ? 1_555 ? 
58 AC4 20 VAL D 127 ? VAL D 127  . ? 1_555 ? 
59 AC4 20 ARG D 129 ? ARG D 129  . ? 1_555 ? 
60 AC4 20 GLY D 157 ? GLY D 157  . ? 1_555 ? 
61 AC4 20 CYS D 158 ? CYS D 158  . ? 1_555 ? 
62 AC4 20 GLY D 159 ? GLY D 159  . ? 1_555 ? 
63 AC4 20 LYS D 160 ? LYS D 160  . ? 1_555 ? 
64 AC4 20 SER D 161 ? SER D 161  . ? 1_555 ? 
65 AC4 20 VAL D 162 ? VAL D 162  . ? 1_555 ? 
66 AC4 20 PRO D 321 ? PRO D 321  . ? 1_555 ? 
67 AC4 20 LEU D 322 ? LEU D 322  . ? 1_555 ? 
68 AC4 20 PHE D 425 ? PHE D 425  . ? 1_555 ? 
69 AC4 20 HIS D 438 ? HIS D 438  . ? 1_555 ? 
70 AC4 20 HOH L .   ? HOH D 965  . ? 1_555 ? 
71 AC4 20 HOH L .   ? HOH D 977  . ? 1_555 ? 
72 AC4 20 HOH L .   ? HOH D 978  . ? 1_555 ? 
73 AC4 20 HOH L .   ? HOH D 1007 . ? 1_555 ? 
74 AC4 20 HOH L .   ? HOH D 1032 . ? 1_555 ? 
75 AC4 20 HOH L .   ? HOH D 1036 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Z6T 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Z6T 
_atom_sites.fract_transf_matrix[1][1]   0.013166 
_atom_sites.fract_transf_matrix[1][2]   0.000011 
_atom_sites.fract_transf_matrix[1][3]   -0.000009 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010766 
_atom_sites.fract_transf_matrix[2][3]   -0.005496 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011820 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . MET A 1 1   ? 30.464  37.414  92.175  1.00 55.61  ? 1    MET A N     1 
ATOM   2     C CA    . MET A 1 1   ? 29.734  38.650  92.594  1.00 56.14  ? 1    MET A CA    1 
ATOM   3     C C     . MET A 1 1   ? 30.338  39.265  93.875  1.00 55.59  ? 1    MET A C     1 
ATOM   4     O O     . MET A 1 1   ? 31.272  38.719  94.466  1.00 53.97  ? 1    MET A O     1 
ATOM   5     C CB    . MET A 1 1   ? 28.212  38.373  92.749  1.00 56.44  ? 1    MET A CB    1 
ATOM   6     C CG    . MET A 1 1   ? 27.796  37.398  93.898  1.00 58.72  ? 1    MET A CG    1 
ATOM   7     S SD    . MET A 1 1   ? 26.001  37.311  94.193  1.00 55.70  ? 1    MET A SD    1 
ATOM   8     C CE    . MET A 1 1   ? 25.438  36.747  92.587  1.00 52.93  ? 1    MET A CE    1 
ATOM   9     N N     . ASP A 1 2   ? 29.795  40.411  94.279  1.00 56.09  ? 2    ASP A N     1 
ATOM   10    C CA    . ASP A 1 2   ? 30.215  41.115  95.492  1.00 55.73  ? 2    ASP A CA    1 
ATOM   11    C C     . ASP A 1 2   ? 29.875  40.320  96.734  1.00 55.24  ? 2    ASP A C     1 
ATOM   12    O O     . ASP A 1 2   ? 28.977  39.478  96.723  1.00 55.68  ? 2    ASP A O     1 
ATOM   13    C CB    . ASP A 1 2   ? 29.535  42.489  95.588  1.00 56.57  ? 2    ASP A CB    1 
ATOM   14    C CG    . ASP A 1 2   ? 30.112  43.509  94.601  1.00 56.21  ? 2    ASP A CG    1 
ATOM   15    O OD1   . ASP A 1 2   ? 30.782  43.104  93.622  1.00 51.58  ? 2    ASP A OD1   1 
ATOM   16    O OD2   . ASP A 1 2   ? 29.883  44.721  94.810  1.00 52.36  ? 2    ASP A OD2   1 
ATOM   17    N N     . ALA A 1 3   ? 30.592  40.615  97.811  1.00 55.79  ? 3    ALA A N     1 
ATOM   18    C CA    . ALA A 1 3   ? 30.422  39.897  99.081  1.00 54.94  ? 3    ALA A CA    1 
ATOM   19    C C     . ALA A 1 3   ? 29.105  40.294  99.705  1.00 54.60  ? 3    ALA A C     1 
ATOM   20    O O     . ALA A 1 3   ? 28.400  39.447  100.253 1.00 56.93  ? 3    ALA A O     1 
ATOM   21    C CB    . ALA A 1 3   ? 31.565  40.192  100.030 1.00 54.95  ? 3    ALA A CB    1 
ATOM   22    N N     . LYS A 1 4   ? 28.778  41.583  99.608  1.00 53.16  ? 4    LYS A N     1 
ATOM   23    C CA    . LYS A 1 4   ? 27.469  42.083  100.014 1.00 52.39  ? 4    LYS A CA    1 
ATOM   24    C C     . LYS A 1 4   ? 26.413  41.233  99.332  1.00 51.16  ? 4    LYS A C     1 
ATOM   25    O O     . LYS A 1 4   ? 25.475  40.752  99.974  1.00 49.87  ? 4    LYS A O     1 
ATOM   26    C CB    . LYS A 1 4   ? 27.256  43.537  99.567  1.00 53.89  ? 4    LYS A CB    1 
ATOM   27    C CG    . LYS A 1 4   ? 28.238  44.585  100.083 1.00 54.28  ? 4    LYS A CG    1 
ATOM   28    C CD    . LYS A 1 4   ? 27.972  45.921  99.383  1.00 54.00  ? 4    LYS A CD    1 
ATOM   29    C CE    . LYS A 1 4   ? 28.891  47.052  99.879  1.00 62.18  ? 4    LYS A CE    1 
ATOM   30    N NZ    . LYS A 1 4   ? 30.354  46.707  99.907  1.00 61.37  ? 4    LYS A NZ    1 
ATOM   31    N N     . ALA A 1 5   ? 26.592  41.054  98.017  1.00 50.54  ? 5    ALA A N     1 
ATOM   32    C CA    . ALA A 1 5   ? 25.580  40.440  97.157  1.00 49.74  ? 5    ALA A CA    1 
ATOM   33    C C     . ALA A 1 5   ? 25.304  39.013  97.605  1.00 47.45  ? 5    ALA A C     1 
ATOM   34    O O     . ALA A 1 5   ? 24.186  38.694  97.972  1.00 45.73  ? 5    ALA A O     1 
ATOM   35    C CB    . ALA A 1 5   ? 26.020  40.490  95.675  1.00 48.98  ? 5    ALA A CB    1 
ATOM   36    N N     . ARG A 1 6   ? 26.347  38.185  97.596  1.00 47.58  ? 6    ARG A N     1 
ATOM   37    C CA    . ARG A 1 6   ? 26.269  36.786  98.001  1.00 46.94  ? 6    ARG A CA    1 
ATOM   38    C C     . ARG A 1 6   ? 25.702  36.613  99.406  1.00 45.59  ? 6    ARG A C     1 
ATOM   39    O O     . ARG A 1 6   ? 24.777  35.821  99.603  1.00 44.39  ? 6    ARG A O     1 
ATOM   40    C CB    . ARG A 1 6   ? 27.659  36.162  97.935  1.00 46.56  ? 6    ARG A CB    1 
ATOM   41    C CG    . ARG A 1 6   ? 27.720  34.688  98.349  1.00 50.91  ? 6    ARG A CG    1 
ATOM   42    C CD    . ARG A 1 6   ? 29.140  34.143  98.374  1.00 51.58  ? 6    ARG A CD    1 
ATOM   43    N NE    . ARG A 1 6   ? 29.805  34.240  97.071  1.00 61.20  ? 6    ARG A NE    1 
ATOM   44    C CZ    . ARG A 1 6   ? 31.025  33.764  96.812  1.00 64.90  ? 6    ARG A CZ    1 
ATOM   45    N NH1   . ARG A 1 6   ? 31.733  33.133  97.762  1.00 71.20  ? 6    ARG A NH1   1 
ATOM   46    N NH2   . ARG A 1 6   ? 31.547  33.917  95.595  1.00 64.36  ? 6    ARG A NH2   1 
ATOM   47    N N     . ASN A 1 7   ? 26.258  37.340  100.380 1.00 45.78  ? 7    ASN A N     1 
ATOM   48    C CA    . ASN A 1 7   ? 25.795  37.240  101.790 1.00 46.28  ? 7    ASN A CA    1 
ATOM   49    C C     . ASN A 1 7   ? 24.312  37.507  101.862 1.00 44.84  ? 7    ASN A C     1 
ATOM   50    O O     . ASN A 1 7   ? 23.574  36.808  102.557 1.00 42.19  ? 7    ASN A O     1 
ATOM   51    C CB    . ASN A 1 7   ? 26.478  38.253  102.733 1.00 46.34  ? 7    ASN A CB    1 
ATOM   52    C CG    . ASN A 1 7   ? 27.972  38.130  102.753 1.00 48.24  ? 7    ASN A CG    1 
ATOM   53    O OD1   . ASN A 1 7   ? 28.525  37.090  102.389 1.00 52.74  ? 7    ASN A OD1   1 
ATOM   54    N ND2   . ASN A 1 7   ? 28.647  39.203  103.179 1.00 49.73  ? 7    ASN A ND2   1 
ATOM   55    N N     . CYS A 1 8   ? 23.909  38.552  101.138 1.00 45.47  ? 8    CYS A N     1 
ATOM   56    C CA    . CYS A 1 8   ? 22.515  38.942  101.011 1.00 45.02  ? 8    CYS A CA    1 
ATOM   57    C C     . CYS A 1 8   ? 21.705  37.848  100.290 1.00 45.35  ? 8    CYS A C     1 
ATOM   58    O O     . CYS A 1 8   ? 20.602  37.502  100.717 1.00 47.88  ? 8    CYS A O     1 
ATOM   59    C CB    . CYS A 1 8   ? 22.432  40.280  100.263 1.00 43.62  ? 8    CYS A CB    1 
ATOM   60    S SG    . CYS A 1 8   ? 20.762  40.925  100.069 1.00 47.11  ? 8    CYS A SG    1 
ATOM   61    N N     . LEU A 1 9   ? 22.258  37.309  99.205  1.00 43.49  ? 9    LEU A N     1 
ATOM   62    C CA    . LEU A 1 9   ? 21.608  36.233  98.463  1.00 43.74  ? 9    LEU A CA    1 
ATOM   63    C C     . LEU A 1 9   ? 21.463  35.003  99.370  1.00 43.95  ? 9    LEU A C     1 
ATOM   64    O O     . LEU A 1 9   ? 20.331  34.542  99.632  1.00 41.00  ? 9    LEU A O     1 
ATOM   65    C CB    . LEU A 1 9   ? 22.411  35.890  97.196  1.00 42.38  ? 9    LEU A CB    1 
ATOM   66    C CG    . LEU A 1 9   ? 21.740  34.978  96.165  1.00 44.84  ? 9    LEU A CG    1 
ATOM   67    C CD1   . LEU A 1 9   ? 20.253  35.335  95.982  1.00 50.94  ? 9    LEU A CD1   1 
ATOM   68    C CD2   . LEU A 1 9   ? 22.466  35.037  94.813  1.00 41.41  ? 9    LEU A CD2   1 
ATOM   69    N N     . LEU A 1 10  ? 22.614  34.524  99.877  1.00 44.49  ? 10   LEU A N     1 
ATOM   70    C CA    . LEU A 1 10  ? 22.675  33.384  100.787 1.00 45.10  ? 10   LEU A CA    1 
ATOM   71    C C     . LEU A 1 10  ? 21.747  33.562  101.970 1.00 45.18  ? 10   LEU A C     1 
ATOM   72    O O     . LEU A 1 10  ? 21.156  32.595  102.451 1.00 44.37  ? 10   LEU A O     1 
ATOM   73    C CB    . LEU A 1 10  ? 24.089  33.183  101.324 1.00 46.32  ? 10   LEU A CB    1 
ATOM   74    C CG    . LEU A 1 10  ? 25.240  32.762  100.398 1.00 50.40  ? 10   LEU A CG    1 
ATOM   75    C CD1   . LEU A 1 10  ? 26.493  32.436  101.255 1.00 47.23  ? 10   LEU A CD1   1 
ATOM   76    C CD2   . LEU A 1 10  ? 24.865  31.582  99.507  1.00 50.10  ? 10   LEU A CD2   1 
ATOM   77    N N     . GLN A 1 11  ? 21.624  34.802  102.434 1.00 47.35  ? 11   GLN A N     1 
ATOM   78    C CA    . GLN A 1 11  ? 20.799  35.123  103.600 1.00 47.89  ? 11   GLN A CA    1 
ATOM   79    C C     . GLN A 1 11  ? 19.295  35.004  103.386 1.00 45.64  ? 11   GLN A C     1 
ATOM   80    O O     . GLN A 1 11  ? 18.560  34.770  104.344 1.00 44.10  ? 11   GLN A O     1 
ATOM   81    C CB    . GLN A 1 11  ? 21.118  36.546  104.077 1.00 49.77  ? 11   GLN A CB    1 
ATOM   82    C CG    . GLN A 1 11  ? 20.452  36.959  105.389 1.00 50.63  ? 11   GLN A CG    1 
ATOM   83    C CD    . GLN A 1 11  ? 20.929  38.315  105.872 1.00 51.22  ? 11   GLN A CD    1 
ATOM   84    O OE1   . GLN A 1 11  ? 20.120  39.190  106.194 1.00 59.02  ? 11   GLN A OE1   1 
ATOM   85    N NE2   . GLN A 1 11  ? 22.249  38.505  105.909 1.00 56.20  ? 11   GLN A NE2   1 
ATOM   86    N N     . HIS A 1 12  ? 18.835  35.185  102.149 1.00 46.98  ? 12   HIS A N     1 
ATOM   87    C CA    . HIS A 1 12  ? 17.384  35.255  101.862 1.00 47.97  ? 12   HIS A CA    1 
ATOM   88    C C     . HIS A 1 12  ? 16.905  34.104  101.011 1.00 46.48  ? 12   HIS A C     1 
ATOM   89    O O     . HIS A 1 12  ? 15.793  34.110  100.495 1.00 44.71  ? 12   HIS A O     1 
ATOM   90    C CB    . HIS A 1 12  ? 17.056  36.597  101.220 1.00 47.40  ? 12   HIS A CB    1 
ATOM   91    C CG    . HIS A 1 12  ? 17.510  37.743  102.057 1.00 51.54  ? 12   HIS A CG    1 
ATOM   92    N ND1   . HIS A 1 12  ? 18.470  38.640  101.639 1.00 47.71  ? 12   HIS A ND1   1 
ATOM   93    C CD2   . HIS A 1 12  ? 17.211  38.070  103.337 1.00 46.72  ? 12   HIS A CD2   1 
ATOM   94    C CE1   . HIS A 1 12  ? 18.705  39.502  102.613 1.00 55.24  ? 12   HIS A CE1   1 
ATOM   95    N NE2   . HIS A 1 12  ? 17.953  39.179  103.651 1.00 49.34  ? 12   HIS A NE2   1 
ATOM   96    N N     . ARG A 1 13  ? 17.756  33.091  100.937 1.00 47.51  ? 13   ARG A N     1 
ATOM   97    C CA    . ARG A 1 13  ? 17.597  31.984  100.019 1.00 48.40  ? 13   ARG A CA    1 
ATOM   98    C C     . ARG A 1 13  ? 16.343  31.186  100.316 1.00 46.66  ? 13   ARG A C     1 
ATOM   99    O O     . ARG A 1 13  ? 15.576  30.864  99.411  1.00 45.15  ? 13   ARG A O     1 
ATOM   100   C CB    . ARG A 1 13  ? 18.808  31.080  100.127 1.00 48.26  ? 13   ARG A CB    1 
ATOM   101   C CG    . ARG A 1 13  ? 19.063  30.317  98.895  1.00 50.41  ? 13   ARG A CG    1 
ATOM   102   C CD    . ARG A 1 13  ? 19.872  29.100  99.210  1.00 51.83  ? 13   ARG A CD    1 
ATOM   103   N NE    . ARG A 1 13  ? 20.306  28.513  97.955  1.00 58.13  ? 13   ARG A NE    1 
ATOM   104   C CZ    . ARG A 1 13  ? 21.458  27.880  97.774  1.00 56.52  ? 13   ARG A CZ    1 
ATOM   105   N NH1   . ARG A 1 13  ? 22.335  27.726  98.762  1.00 57.05  ? 13   ARG A NH1   1 
ATOM   106   N NH2   . ARG A 1 13  ? 21.736  27.415  96.580  1.00 57.47  ? 13   ARG A NH2   1 
ATOM   107   N N     . GLU A 1 14  ? 16.144  30.899  101.593 1.00 45.94  ? 14   GLU A N     1 
ATOM   108   C CA    . GLU A 1 14  ? 15.050  30.059  102.044 1.00 46.81  ? 14   GLU A CA    1 
ATOM   109   C C     . GLU A 1 14  ? 13.711  30.752  101.847 1.00 45.54  ? 14   GLU A C     1 
ATOM   110   O O     . GLU A 1 14  ? 12.729  30.114  101.476 1.00 44.06  ? 14   GLU A O     1 
ATOM   111   C CB    . GLU A 1 14  ? 15.267  29.666  103.516 1.00 48.22  ? 14   GLU A CB    1 
ATOM   112   C CG    . GLU A 1 14  ? 14.136  28.824  104.147 1.00 51.16  ? 14   GLU A CG    1 
ATOM   113   C CD    . GLU A 1 14  ? 13.314  29.593  105.194 1.00 60.83  ? 14   GLU A CD    1 
ATOM   114   O OE1   . GLU A 1 14  ? 12.451  30.429  104.813 1.00 52.00  ? 14   GLU A OE1   1 
ATOM   115   O OE2   . GLU A 1 14  ? 13.548  29.343  106.406 1.00 59.25  ? 14   GLU A OE2   1 
ATOM   116   N N     . ALA A 1 15  ? 13.691  32.061  102.100 1.00 45.58  ? 15   ALA A N     1 
ATOM   117   C CA    . ALA A 1 15  ? 12.578  32.949  101.714 1.00 43.06  ? 15   ALA A CA    1 
ATOM   118   C C     . ALA A 1 15  ? 12.295  32.908  100.202 1.00 39.31  ? 15   ALA A C     1 
ATOM   119   O O     . ALA A 1 15  ? 11.144  32.842  99.778  1.00 34.42  ? 15   ALA A O     1 
ATOM   120   C CB    . ALA A 1 15  ? 12.897  34.387  102.132 1.00 43.29  ? 15   ALA A CB    1 
ATOM   121   N N     . LEU A 1 16  ? 13.356  32.952  99.399  1.00 37.97  ? 16   LEU A N     1 
ATOM   122   C CA    . LEU A 1 16  ? 13.190  32.939  97.957  1.00 38.79  ? 16   LEU A CA    1 
ATOM   123   C C     . LEU A 1 16  ? 12.644  31.598  97.500  1.00 36.78  ? 16   LEU A C     1 
ATOM   124   O O     . LEU A 1 16  ? 11.589  31.561  96.865  1.00 36.30  ? 16   LEU A O     1 
ATOM   125   C CB    . LEU A 1 16  ? 14.489  33.258  97.244  1.00 38.53  ? 16   LEU A CB    1 
ATOM   126   C CG    . LEU A 1 16  ? 14.977  34.700  97.320  1.00 43.86  ? 16   LEU A CG    1 
ATOM   127   C CD1   . LEU A 1 16  ? 16.449  34.738  96.981  1.00 50.66  ? 16   LEU A CD1   1 
ATOM   128   C CD2   . LEU A 1 16  ? 14.197  35.616  96.384  1.00 44.32  ? 16   LEU A CD2   1 
ATOM   129   N N     . GLU A 1 17  ? 13.353  30.525  97.863  1.00 36.67  ? 17   GLU A N     1 
ATOM   130   C CA    . GLU A 1 17  ? 12.995  29.131  97.550  1.00 38.54  ? 17   GLU A CA    1 
ATOM   131   C C     . GLU A 1 17  ? 11.556  28.807  97.897  1.00 38.34  ? 17   GLU A C     1 
ATOM   132   O O     . GLU A 1 17  ? 10.860  28.141  97.127  1.00 36.65  ? 17   GLU A O     1 
ATOM   133   C CB    . GLU A 1 17  ? 13.922  28.140  98.283  1.00 35.60  ? 17   GLU A CB    1 
ATOM   134   C CG    . GLU A 1 17  ? 15.319  28.060  97.692  1.00 37.43  ? 17   GLU A CG    1 
ATOM   135   C CD    . GLU A 1 17  ? 16.344  27.298  98.554  1.00 42.09  ? 17   GLU A CD    1 
ATOM   136   O OE1   . GLU A 1 17  ? 15.983  26.723  99.606  1.00 48.96  ? 17   GLU A OE1   1 
ATOM   137   O OE2   . GLU A 1 17  ? 17.528  27.265  98.157  1.00 46.43  ? 17   GLU A OE2   1 
ATOM   138   N N     . LYS A 1 18  ? 11.117  29.311  99.044  1.00 40.91  ? 18   LYS A N     1 
ATOM   139   C CA    . LYS A 1 18  ? 9.783   29.064  99.558  1.00 42.48  ? 18   LYS A CA    1 
ATOM   140   C C     . LYS A 1 18  ? 8.706   29.612  98.641  1.00 43.25  ? 18   LYS A C     1 
ATOM   141   O O     . LYS A 1 18  ? 7.684   28.966  98.443  1.00 44.98  ? 18   LYS A O     1 
ATOM   142   C CB    . LYS A 1 18  ? 9.651   29.655  100.977 1.00 45.34  ? 18   LYS A CB    1 
ATOM   143   C CG    . LYS A 1 18  ? 8.284   29.457  101.684 1.00 45.59  ? 18   LYS A CG    1 
ATOM   144   C CD    . LYS A 1 18  ? 8.281   30.100  103.094 1.00 45.77  ? 18   LYS A CD    1 
ATOM   145   C CE    . LYS A 1 18  ? 6.989   29.813  103.908 1.00 55.67  ? 18   LYS A CE    1 
ATOM   146   N NZ    . LYS A 1 18  ? 7.209   29.789  105.440 1.00 53.12  ? 18   LYS A NZ    1 
ATOM   147   N N     . ASP A 1 19  ? 8.939   30.775  98.042  1.00 43.92  ? 19   ASP A N     1 
ATOM   148   C CA    . ASP A 1 19  ? 7.849   31.528  97.436  1.00 43.82  ? 19   ASP A CA    1 
ATOM   149   C C     . ASP A 1 19  ? 7.876   31.642  95.918  1.00 42.55  ? 19   ASP A C     1 
ATOM   150   O O     . ASP A 1 19  ? 6.806   31.714  95.307  1.00 44.36  ? 19   ASP A O     1 
ATOM   151   C CB    . ASP A 1 19  ? 7.798   32.935  98.042  1.00 47.88  ? 19   ASP A CB    1 
ATOM   152   C CG    . ASP A 1 19  ? 7.450   32.927  99.520  1.00 56.04  ? 19   ASP A CG    1 
ATOM   153   O OD1   . ASP A 1 19  ? 6.306   32.525  99.853  1.00 70.14  ? 19   ASP A OD1   1 
ATOM   154   O OD2   . ASP A 1 19  ? 8.316   33.325  100.342 1.00 62.87  ? 19   ASP A OD2   1 
ATOM   155   N N     . ILE A 1 20  ? 9.057   31.679  95.295  1.00 40.19  ? 20   ILE A N     1 
ATOM   156   C CA    . ILE A 1 20  ? 9.101   32.038  93.877  1.00 38.13  ? 20   ILE A CA    1 
ATOM   157   C C     . ILE A 1 20  ? 8.731   30.914  92.905  1.00 36.17  ? 20   ILE A C     1 
ATOM   158   O O     . ILE A 1 20  ? 9.137   29.772  93.072  1.00 35.00  ? 20   ILE A O     1 
ATOM   159   C CB    . ILE A 1 20  ? 10.442  32.715  93.441  1.00 37.15  ? 20   ILE A CB    1 
ATOM   160   C CG1   . ILE A 1 20  ? 11.586  31.710  93.338  1.00 37.07  ? 20   ILE A CG1   1 
ATOM   161   C CG2   . ILE A 1 20  ? 10.762  33.886  94.351  1.00 35.42  ? 20   ILE A CG2   1 
ATOM   162   C CD1   . ILE A 1 20  ? 12.810  32.264  92.629  1.00 37.84  ? 20   ILE A CD1   1 
ATOM   163   N N     . LYS A 1 21  ? 7.957   31.269  91.878  1.00 34.87  ? 21   LYS A N     1 
ATOM   164   C CA    . LYS A 1 21  ? 7.773   30.424  90.694  1.00 34.32  ? 21   LYS A CA    1 
ATOM   165   C C     . LYS A 1 21  ? 8.809   30.844  89.632  1.00 32.48  ? 21   LYS A C     1 
ATOM   166   O O     . LYS A 1 21  ? 9.036   32.022  89.380  1.00 33.28  ? 21   LYS A O     1 
ATOM   167   C CB    . LYS A 1 21  ? 6.336   30.521  90.198  1.00 34.41  ? 21   LYS A CB    1 
ATOM   168   C CG    . LYS A 1 21  ? 5.305   30.116  91.255  1.00 34.97  ? 21   LYS A CG    1 
ATOM   169   C CD    . LYS A 1 21  ? 3.861   30.181  90.694  1.00 39.80  ? 21   LYS A CD    1 
ATOM   170   C CE    . LYS A 1 21  ? 2.810   29.645  91.669  1.00 40.34  ? 21   LYS A CE    1 
ATOM   171   N NZ    . LYS A 1 21  ? 1.440   29.739  91.058  1.00 44.85  ? 21   LYS A NZ    1 
ATOM   172   N N     . THR A 1 22  ? 9.504   29.872  89.067  1.00 34.19  ? 22   THR A N     1 
ATOM   173   C CA    . THR A 1 22  ? 10.728  30.154  88.319  1.00 34.75  ? 22   THR A CA    1 
ATOM   174   C C     . THR A 1 22  ? 10.470  30.459  86.840  1.00 34.58  ? 22   THR A C     1 
ATOM   175   O O     . THR A 1 22  ? 11.277  31.107  86.194  1.00 30.88  ? 22   THR A O     1 
ATOM   176   C CB    . THR A 1 22  ? 11.728  28.967  88.411  1.00 33.42  ? 22   THR A CB    1 
ATOM   177   O OG1   . THR A 1 22  ? 11.015  27.739  88.308  1.00 34.46  ? 22   THR A OG1   1 
ATOM   178   C CG2   . THR A 1 22  ? 12.523  28.990  89.723  1.00 38.29  ? 22   THR A CG2   1 
ATOM   179   N N     . SER A 1 23  ? 9.345   29.992  86.302  1.00 36.16  ? 23   SER A N     1 
ATOM   180   C CA    . SER A 1 23  ? 9.159   30.009  84.846  1.00 37.97  ? 23   SER A CA    1 
ATOM   181   C C     . SER A 1 23  ? 9.331   31.391  84.216  1.00 38.98  ? 23   SER A C     1 
ATOM   182   O O     . SER A 1 23  ? 10.229  31.578  83.394  1.00 42.08  ? 23   SER A O     1 
ATOM   183   C CB    . SER A 1 23  ? 7.821   29.382  84.456  1.00 36.46  ? 23   SER A CB    1 
ATOM   184   O OG    . SER A 1 23  ? 6.745   30.081  85.040  1.00 40.22  ? 23   SER A OG    1 
ATOM   185   N N     . TYR A 1 24  ? 8.499   32.355  84.609  1.00 39.20  ? 24   TYR A N     1 
ATOM   186   C CA    . TYR A 1 24  ? 8.558   33.716  84.017  1.00 39.04  ? 24   TYR A CA    1 
ATOM   187   C C     . TYR A 1 24  ? 9.801   34.489  84.534  1.00 39.52  ? 24   TYR A C     1 
ATOM   188   O O     . TYR A 1 24  ? 10.375  35.286  83.813  1.00 41.75  ? 24   TYR A O     1 
ATOM   189   C CB    . TYR A 1 24  ? 7.211   34.493  84.191  1.00 39.32  ? 24   TYR A CB    1 
ATOM   190   C CG    . TYR A 1 24  ? 5.970   33.786  83.581  1.00 34.14  ? 24   TYR A CG    1 
ATOM   191   C CD1   . TYR A 1 24  ? 5.322   32.798  84.283  1.00 35.44  ? 24   TYR A CD1   1 
ATOM   192   C CD2   . TYR A 1 24  ? 5.457   34.127  82.310  1.00 44.34  ? 24   TYR A CD2   1 
ATOM   193   C CE1   . TYR A 1 24  ? 4.211   32.119  83.776  1.00 41.46  ? 24   TYR A CE1   1 
ATOM   194   C CE2   . TYR A 1 24  ? 4.297   33.457  81.759  1.00 31.62  ? 24   TYR A CE2   1 
ATOM   195   C CZ    . TYR A 1 24  ? 3.686   32.434  82.516  1.00 50.27  ? 24   TYR A CZ    1 
ATOM   196   O OH    . TYR A 1 24  ? 2.574   31.687  82.087  1.00 37.55  ? 24   TYR A OH    1 
ATOM   197   N N     . ILE A 1 25  ? 10.271  34.218  85.749  1.00 38.98  ? 25   ILE A N     1 
ATOM   198   C CA    . ILE A 1 25  ? 11.571  34.767  86.167  1.00 38.75  ? 25   ILE A CA    1 
ATOM   199   C C     . ILE A 1 25  ? 12.684  34.368  85.182  1.00 38.54  ? 25   ILE A C     1 
ATOM   200   O O     . ILE A 1 25  ? 13.497  35.197  84.798  1.00 37.98  ? 25   ILE A O     1 
ATOM   201   C CB    . ILE A 1 25  ? 11.956  34.372  87.639  1.00 38.86  ? 25   ILE A CB    1 
ATOM   202   C CG1   . ILE A 1 25  ? 11.097  35.167  88.624  1.00 35.93  ? 25   ILE A CG1   1 
ATOM   203   C CG2   . ILE A 1 25  ? 13.461  34.605  87.930  1.00 36.46  ? 25   ILE A CG2   1 
ATOM   204   C CD1   . ILE A 1 25  ? 11.289  34.757  90.059  1.00 39.28  ? 25   ILE A CD1   1 
ATOM   205   N N     . MET A 1 26  ? 12.735  33.106  84.777  1.00 39.74  ? 26   MET A N     1 
ATOM   206   C CA    . MET A 1 26  ? 13.805  32.650  83.876  1.00 39.88  ? 26   MET A CA    1 
ATOM   207   C C     . MET A 1 26  ? 13.644  33.240  82.470  1.00 39.68  ? 26   MET A C     1 
ATOM   208   O O     . MET A 1 26  ? 14.624  33.522  81.794  1.00 38.31  ? 26   MET A O     1 
ATOM   209   C CB    . MET A 1 26  ? 13.848  31.114  83.814  1.00 38.72  ? 26   MET A CB    1 
ATOM   210   C CG    . MET A 1 26  ? 14.183  30.470  85.143  1.00 36.27  ? 26   MET A CG    1 
ATOM   211   S SD    . MET A 1 26  ? 14.687  28.726  85.100  1.00 37.02  ? 26   MET A SD    1 
ATOM   212   C CE    . MET A 1 26  ? 13.111  27.907  84.788  1.00 37.24  ? 26   MET A CE    1 
ATOM   213   N N     . ASP A 1 27  ? 12.405  33.407  82.026  1.00 42.86  ? 27   ASP A N     1 
ATOM   214   C CA    . ASP A 1 27  ? 12.136  34.044  80.728  1.00 45.67  ? 27   ASP A CA    1 
ATOM   215   C C     . ASP A 1 27  ? 12.834  35.410  80.636  1.00 47.11  ? 27   ASP A C     1 
ATOM   216   O O     . ASP A 1 27  ? 13.482  35.726  79.631  1.00 49.72  ? 27   ASP A O     1 
ATOM   217   C CB    . ASP A 1 27  ? 10.628  34.192  80.494  1.00 45.67  ? 27   ASP A CB    1 
ATOM   218   C CG    . ASP A 1 27  ? 9.919   32.852  80.355  1.00 55.07  ? 27   ASP A CG    1 
ATOM   219   O OD1   . ASP A 1 27  ? 10.466  31.943  79.693  1.00 64.86  ? 27   ASP A OD1   1 
ATOM   220   O OD2   . ASP A 1 27  ? 8.804   32.700  80.906  1.00 67.42  ? 27   ASP A OD2   1 
ATOM   221   N N     . HIS A 1 28  ? 12.722  36.198  81.703  1.00 46.43  ? 28   HIS A N     1 
ATOM   222   C CA    . HIS A 1 28  ? 13.403  37.496  81.798  1.00 45.51  ? 28   HIS A CA    1 
ATOM   223   C C     . HIS A 1 28  ? 14.920  37.398  81.797  1.00 44.78  ? 28   HIS A C     1 
ATOM   224   O O     . HIS A 1 28  ? 15.599  38.125  81.092  1.00 43.39  ? 28   HIS A O     1 
ATOM   225   C CB    . HIS A 1 28  ? 12.974  38.222  83.070  1.00 44.86  ? 28   HIS A CB    1 
ATOM   226   C CG    . HIS A 1 28  ? 11.503  38.431  83.157  1.00 44.26  ? 28   HIS A CG    1 
ATOM   227   N ND1   . HIS A 1 28  ? 10.726  38.650  82.041  1.00 49.82  ? 28   HIS A ND1   1 
ATOM   228   C CD2   . HIS A 1 28  ? 10.665  38.456  84.218  1.00 44.23  ? 28   HIS A CD2   1 
ATOM   229   C CE1   . HIS A 1 28  ? 9.466   38.791  82.411  1.00 56.48  ? 28   HIS A CE1   1 
ATOM   230   N NE2   . HIS A 1 28  ? 9.403   38.674  83.726  1.00 48.26  ? 28   HIS A NE2   1 
ATOM   231   N N     . MET A 1 29  ? 15.441  36.515  82.632  1.00 46.97  ? 29   MET A N     1 
ATOM   232   C CA    . MET A 1 29  ? 16.876  36.322  82.756  1.00 47.83  ? 29   MET A CA    1 
ATOM   233   C C     . MET A 1 29  ? 17.517  35.778  81.471  1.00 48.66  ? 29   MET A C     1 
ATOM   234   O O     . MET A 1 29  ? 18.654  36.126  81.153  1.00 48.38  ? 29   MET A O     1 
ATOM   235   C CB    . MET A 1 29  ? 17.167  35.420  83.954  1.00 47.08  ? 29   MET A CB    1 
ATOM   236   C CG    . MET A 1 29  ? 16.830  36.095  85.270  1.00 41.74  ? 29   MET A CG    1 
ATOM   237   S SD    . MET A 1 29  ? 17.465  35.185  86.669  1.00 47.72  ? 29   MET A SD    1 
ATOM   238   C CE    . MET A 1 29  ? 19.212  35.587  86.616  1.00 49.47  ? 29   MET A CE    1 
ATOM   239   N N     . ILE A 1 30  ? 16.788  34.934  80.750  1.00 49.07  ? 30   ILE A N     1 
ATOM   240   C CA    . ILE A 1 30  ? 17.212  34.475  79.435  1.00 52.00  ? 30   ILE A CA    1 
ATOM   241   C C     . ILE A 1 30  ? 17.303  35.657  78.455  1.00 54.06  ? 30   ILE A C     1 
ATOM   242   O O     . ILE A 1 30  ? 18.274  35.784  77.717  1.00 54.49  ? 30   ILE A O     1 
ATOM   243   C CB    . ILE A 1 30  ? 16.233  33.383  78.885  1.00 51.96  ? 30   ILE A CB    1 
ATOM   244   C CG1   . ILE A 1 30  ? 16.424  32.061  79.650  1.00 52.37  ? 30   ILE A CG1   1 
ATOM   245   C CG2   . ILE A 1 30  ? 16.427  33.165  77.361  1.00 50.81  ? 30   ILE A CG2   1 
ATOM   246   C CD1   . ILE A 1 30  ? 15.236  31.108  79.570  1.00 51.60  ? 30   ILE A CD1   1 
ATOM   247   N N     . SER A 1 31  ? 16.284  36.510  78.458  1.00 55.96  ? 31   SER A N     1 
ATOM   248   C CA    . SER A 1 31  ? 16.236  37.673  77.575  1.00 58.36  ? 31   SER A CA    1 
ATOM   249   C C     . SER A 1 31  ? 17.378  38.656  77.875  1.00 60.33  ? 31   SER A C     1 
ATOM   250   O O     . SER A 1 31  ? 17.943  39.254  76.955  1.00 59.78  ? 31   SER A O     1 
ATOM   251   C CB    . SER A 1 31  ? 14.864  38.359  77.693  1.00 59.86  ? 31   SER A CB    1 
ATOM   252   O OG    . SER A 1 31  ? 14.800  39.587  76.981  1.00 63.09  ? 31   SER A OG    1 
ATOM   253   N N     . ASP A 1 32  ? 17.720  38.802  79.157  1.00 61.64  ? 32   ASP A N     1 
ATOM   254   C CA    . ASP A 1 32  ? 18.863  39.628  79.587  1.00 61.79  ? 32   ASP A CA    1 
ATOM   255   C C     . ASP A 1 32  ? 20.229  38.968  79.296  1.00 61.77  ? 32   ASP A C     1 
ATOM   256   O O     . ASP A 1 32  ? 21.280  39.582  79.509  1.00 61.87  ? 32   ASP A O     1 
ATOM   257   C CB    . ASP A 1 32  ? 18.774  39.935  81.094  1.00 63.08  ? 32   ASP A CB    1 
ATOM   258   C CG    . ASP A 1 32  ? 17.510  40.697  81.475  1.00 67.45  ? 32   ASP A CG    1 
ATOM   259   O OD1   . ASP A 1 32  ? 16.654  40.917  80.588  1.00 75.22  ? 32   ASP A OD1   1 
ATOM   260   O OD2   . ASP A 1 32  ? 17.373  41.071  82.670  1.00 67.97  ? 32   ASP A OD2   1 
ATOM   261   N N     . GLY A 1 33  ? 20.221  37.721  78.833  1.00 61.84  ? 33   GLY A N     1 
ATOM   262   C CA    . GLY A 1 33  ? 21.457  37.021  78.490  1.00 61.54  ? 33   GLY A CA    1 
ATOM   263   C C     . GLY A 1 33  ? 22.257  36.493  79.673  1.00 62.39  ? 33   GLY A C     1 
ATOM   264   O O     . GLY A 1 33  ? 23.396  36.034  79.492  1.00 63.63  ? 33   GLY A O     1 
ATOM   265   N N     . PHE A 1 34  ? 21.683  36.522  80.881  1.00 61.47  ? 34   PHE A N     1 
ATOM   266   C CA    . PHE A 1 34  ? 22.397  36.016  82.078  1.00 60.54  ? 34   PHE A CA    1 
ATOM   267   C C     . PHE A 1 34  ? 21.986  34.603  82.508  1.00 59.43  ? 34   PHE A C     1 
ATOM   268   O O     . PHE A 1 34  ? 22.320  34.169  83.604  1.00 61.72  ? 34   PHE A O     1 
ATOM   269   C CB    . PHE A 1 34  ? 22.247  36.999  83.252  1.00 60.19  ? 34   PHE A CB    1 
ATOM   270   C CG    . PHE A 1 34  ? 22.774  38.368  82.948  1.00 56.62  ? 34   PHE A CG    1 
ATOM   271   C CD1   . PHE A 1 34  ? 24.133  38.592  82.874  1.00 60.11  ? 34   PHE A CD1   1 
ATOM   272   C CD2   . PHE A 1 34  ? 21.904  39.419  82.702  1.00 61.02  ? 34   PHE A CD2   1 
ATOM   273   C CE1   . PHE A 1 34  ? 24.621  39.841  82.564  1.00 59.52  ? 34   PHE A CE1   1 
ATOM   274   C CE2   . PHE A 1 34  ? 22.379  40.680  82.395  1.00 57.15  ? 34   PHE A CE2   1 
ATOM   275   C CZ    . PHE A 1 34  ? 23.737  40.890  82.328  1.00 60.22  ? 34   PHE A CZ    1 
ATOM   276   N N     . LEU A 1 35  ? 21.286  33.880  81.643  1.00 58.31  ? 35   LEU A N     1 
ATOM   277   C CA    . LEU A 1 35  ? 20.874  32.516  81.946  1.00 58.68  ? 35   LEU A CA    1 
ATOM   278   C C     . LEU A 1 35  ? 20.680  31.761  80.635  1.00 57.68  ? 35   LEU A C     1 
ATOM   279   O O     . LEU A 1 35  ? 20.082  32.294  79.705  1.00 55.08  ? 35   LEU A O     1 
ATOM   280   C CB    . LEU A 1 35  ? 19.580  32.516  82.778  1.00 59.03  ? 35   LEU A CB    1 
ATOM   281   C CG    . LEU A 1 35  ? 19.064  31.160  83.287  1.00 58.47  ? 35   LEU A CG    1 
ATOM   282   C CD1   . LEU A 1 35  ? 19.779  30.766  84.573  1.00 57.89  ? 35   LEU A CD1   1 
ATOM   283   C CD2   . LEU A 1 35  ? 17.553  31.170  83.485  1.00 57.11  ? 35   LEU A CD2   1 
ATOM   284   N N     . THR A 1 36  ? 21.188  30.525  80.577  1.00 59.74  ? 36   THR A N     1 
ATOM   285   C CA    . THR A 1 36  ? 21.187  29.725  79.344  1.00 61.17  ? 36   THR A CA    1 
ATOM   286   C C     . THR A 1 36  ? 19.978  28.782  79.255  1.00 62.10  ? 36   THR A C     1 
ATOM   287   O O     . THR A 1 36  ? 19.232  28.615  80.221  1.00 63.51  ? 36   THR A O     1 
ATOM   288   C CB    . THR A 1 36  ? 22.519  28.939  79.172  1.00 61.81  ? 36   THR A CB    1 
ATOM   289   O OG1   . THR A 1 36  ? 22.588  27.859  80.109  1.00 61.27  ? 36   THR A OG1   1 
ATOM   290   C CG2   . THR A 1 36  ? 23.718  29.853  79.385  1.00 61.03  ? 36   THR A CG2   1 
ATOM   291   N N     . ILE A 1 37  ? 19.784  28.183  78.084  1.00 62.73  ? 37   ILE A N     1 
ATOM   292   C CA    . ILE A 1 37  ? 18.605  27.346  77.820  1.00 62.40  ? 37   ILE A CA    1 
ATOM   293   C C     . ILE A 1 37  ? 18.699  25.997  78.525  1.00 62.05  ? 37   ILE A C     1 
ATOM   294   O O     . ILE A 1 37  ? 17.667  25.421  78.901  1.00 62.73  ? 37   ILE A O     1 
ATOM   295   C CB    . ILE A 1 37  ? 18.377  27.127  76.279  1.00 63.69  ? 37   ILE A CB    1 
ATOM   296   C CG1   . ILE A 1 37  ? 17.684  28.349  75.651  1.00 65.87  ? 37   ILE A CG1   1 
ATOM   297   C CG2   . ILE A 1 37  ? 17.564  25.837  75.974  1.00 63.10  ? 37   ILE A CG2   1 
ATOM   298   C CD1   . ILE A 1 37  ? 16.260  28.635  76.176  1.00 67.07  ? 37   ILE A CD1   1 
ATOM   299   N N     . SER A 1 38  ? 19.919  25.485  78.681  1.00 60.28  ? 38   SER A N     1 
ATOM   300   C CA    . SER A 1 38  ? 20.116  24.194  79.339  1.00 59.78  ? 38   SER A CA    1 
ATOM   301   C C     . SER A 1 38  ? 20.001  24.376  80.848  1.00 57.89  ? 38   SER A C     1 
ATOM   302   O O     . SER A 1 38  ? 19.547  23.483  81.564  1.00 57.13  ? 38   SER A O     1 
ATOM   303   C CB    . SER A 1 38  ? 21.456  23.549  78.935  1.00 60.00  ? 38   SER A CB    1 
ATOM   304   O OG    . SER A 1 38  ? 22.551  24.070  79.668  1.00 61.74  ? 38   SER A OG    1 
ATOM   305   N N     . GLU A 1 39  ? 20.415  25.550  81.313  1.00 57.83  ? 39   GLU A N     1 
ATOM   306   C CA    . GLU A 1 39  ? 20.202  25.957  82.691  1.00 57.31  ? 39   GLU A CA    1 
ATOM   307   C C     . GLU A 1 39  ? 18.717  26.001  83.037  1.00 56.38  ? 39   GLU A C     1 
ATOM   308   O O     . GLU A 1 39  ? 18.337  25.539  84.110  1.00 56.69  ? 39   GLU A O     1 
ATOM   309   C CB    . GLU A 1 39  ? 20.859  27.309  82.975  1.00 56.75  ? 39   GLU A CB    1 
ATOM   310   C CG    . GLU A 1 39  ? 22.378  27.261  83.026  1.00 56.27  ? 39   GLU A CG    1 
ATOM   311   C CD    . GLU A 1 39  ? 22.986  28.589  83.442  1.00 58.18  ? 39   GLU A CD    1 
ATOM   312   O OE1   . GLU A 1 39  ? 22.789  29.603  82.725  1.00 62.02  ? 39   GLU A OE1   1 
ATOM   313   O OE2   . GLU A 1 39  ? 23.663  28.616  84.495  1.00 58.97  ? 39   GLU A OE2   1 
ATOM   314   N N     . GLU A 1 40  ? 17.889  26.537  82.137  1.00 55.41  ? 40   GLU A N     1 
ATOM   315   C CA    . GLU A 1 40  ? 16.429  26.504  82.303  1.00 55.99  ? 40   GLU A CA    1 
ATOM   316   C C     . GLU A 1 40  ? 15.884  25.076  82.365  1.00 54.32  ? 40   GLU A C     1 
ATOM   317   O O     . GLU A 1 40  ? 15.054  24.755  83.212  1.00 52.39  ? 40   GLU A O     1 
ATOM   318   C CB    . GLU A 1 40  ? 15.713  27.250  81.165  1.00 54.60  ? 40   GLU A CB    1 
ATOM   319   C CG    . GLU A 1 40  ? 14.178  27.321  81.338  1.00 57.27  ? 40   GLU A CG    1 
ATOM   320   C CD    . GLU A 1 40  ? 13.401  27.390  80.014  1.00 62.57  ? 40   GLU A CD    1 
ATOM   321   O OE1   . GLU A 1 40  ? 12.795  26.359  79.613  1.00 66.36  ? 40   GLU A OE1   1 
ATOM   322   O OE2   . GLU A 1 40  ? 13.393  28.476  79.377  1.00 73.18  ? 40   GLU A OE2   1 
ATOM   323   N N     . GLU A 1 41  ? 16.333  24.252  81.425  1.00 55.04  ? 41   GLU A N     1 
ATOM   324   C CA    . GLU A 1 41  ? 15.911  22.845  81.279  1.00 54.02  ? 41   GLU A CA    1 
ATOM   325   C C     . GLU A 1 41  ? 16.255  22.007  82.521  1.00 51.42  ? 41   GLU A C     1 
ATOM   326   O O     . GLU A 1 41  ? 15.476  21.143  82.930  1.00 49.13  ? 41   GLU A O     1 
ATOM   327   C CB    . GLU A 1 41  ? 16.586  22.288  80.014  1.00 54.80  ? 41   GLU A CB    1 
ATOM   328   C CG    . GLU A 1 41  ? 16.742  20.770  79.861  1.00 57.78  ? 41   GLU A CG    1 
ATOM   329   C CD    . GLU A 1 41  ? 17.850  20.412  78.843  1.00 59.20  ? 41   GLU A CD    1 
ATOM   330   O OE1   . GLU A 1 41  ? 18.557  21.339  78.364  1.00 61.54  ? 41   GLU A OE1   1 
ATOM   331   O OE2   . GLU A 1 41  ? 18.018  19.206  78.534  1.00 64.94  ? 41   GLU A OE2   1 
ATOM   332   N N     . LYS A 1 42  ? 17.428  22.279  83.097  1.00 49.46  ? 42   LYS A N     1 
ATOM   333   C CA    . LYS A 1 42  ? 17.883  21.656  84.336  1.00 48.61  ? 42   LYS A CA    1 
ATOM   334   C C     . LYS A 1 42  ? 17.002  22.054  85.550  1.00 47.57  ? 42   LYS A C     1 
ATOM   335   O O     . LYS A 1 42  ? 16.748  21.241  86.464  1.00 43.48  ? 42   LYS A O     1 
ATOM   336   C CB    . LYS A 1 42  ? 19.340  22.052  84.589  1.00 48.40  ? 42   LYS A CB    1 
ATOM   337   C CG    . LYS A 1 42  ? 20.087  21.127  85.549  1.00 49.11  ? 42   LYS A CG    1 
ATOM   338   C CD    . LYS A 1 42  ? 21.435  21.721  85.950  1.00 49.19  ? 42   LYS A CD    1 
ATOM   339   C CE    . LYS A 1 42  ? 22.039  21.010  87.166  1.00 48.64  ? 42   LYS A CE    1 
ATOM   340   N NZ    . LYS A 1 42  ? 23.026  21.881  87.896  1.00 49.54  ? 42   LYS A NZ    1 
ATOM   341   N N     . VAL A 1 43  ? 16.544  23.308  85.548  1.00 46.85  ? 43   VAL A N     1 
ATOM   342   C CA    . VAL A 1 43  ? 15.643  23.817  86.593  1.00 46.67  ? 43   VAL A CA    1 
ATOM   343   C C     . VAL A 1 43  ? 14.236  23.244  86.420  1.00 44.43  ? 43   VAL A C     1 
ATOM   344   O O     . VAL A 1 43  ? 13.589  22.847  87.390  1.00 42.11  ? 43   VAL A O     1 
ATOM   345   C CB    . VAL A 1 43  ? 15.581  25.379  86.599  1.00 45.87  ? 43   VAL A CB    1 
ATOM   346   C CG1   . VAL A 1 43  ? 14.449  25.890  87.496  1.00 47.20  ? 43   VAL A CG1   1 
ATOM   347   C CG2   . VAL A 1 43  ? 16.914  25.972  87.031  1.00 42.20  ? 43   VAL A CG2   1 
ATOM   348   N N     . ARG A 1 44  ? 13.777  23.191  85.181  1.00 44.49  ? 44   ARG A N     1 
ATOM   349   C CA    . ARG A 1 44  ? 12.425  22.747  84.896  1.00 46.88  ? 44   ARG A CA    1 
ATOM   350   C C     . ARG A 1 44  ? 12.224  21.261  85.143  1.00 44.68  ? 44   ARG A C     1 
ATOM   351   O O     . ARG A 1 44  ? 11.089  20.792  85.285  1.00 43.94  ? 44   ARG A O     1 
ATOM   352   C CB    . ARG A 1 44  ? 12.053  23.077  83.462  1.00 47.66  ? 44   ARG A CB    1 
ATOM   353   C CG    . ARG A 1 44  ? 10.562  23.222  83.295  1.00 53.40  ? 44   ARG A CG    1 
ATOM   354   C CD    . ARG A 1 44  ? 10.217  23.784  81.941  1.00 54.01  ? 44   ARG A CD    1 
ATOM   355   N NE    . ARG A 1 44  ? 8.908   23.295  81.530  1.00 65.64  ? 44   ARG A NE    1 
ATOM   356   C CZ    . ARG A 1 44  ? 8.337   23.593  80.371  1.00 70.54  ? 44   ARG A CZ    1 
ATOM   357   N NH1   . ARG A 1 44  ? 8.955   24.402  79.503  1.00 73.41  ? 44   ARG A NH1   1 
ATOM   358   N NH2   . ARG A 1 44  ? 7.140   23.086  80.086  1.00 68.41  ? 44   ARG A NH2   1 
ATOM   359   N N     . ASN A 1 45  ? 13.328  20.528  85.195  1.00 44.63  ? 45   ASN A N     1 
ATOM   360   C CA    . ASN A 1 45  ? 13.269  19.114  85.457  1.00 45.35  ? 45   ASN A CA    1 
ATOM   361   C C     . ASN A 1 45  ? 13.172  18.769  86.940  1.00 44.72  ? 45   ASN A C     1 
ATOM   362   O O     . ASN A 1 45  ? 12.900  17.622  87.269  1.00 46.02  ? 45   ASN A O     1 
ATOM   363   C CB    . ASN A 1 45  ? 14.467  18.397  84.838  1.00 46.37  ? 45   ASN A CB    1 
ATOM   364   C CG    . ASN A 1 45  ? 14.200  16.920  84.633  1.00 50.46  ? 45   ASN A CG    1 
ATOM   365   O OD1   . ASN A 1 45  ? 13.160  16.539  84.082  1.00 51.56  ? 45   ASN A OD1   1 
ATOM   366   N ND2   . ASN A 1 45  ? 15.123  16.078  85.090  1.00 54.43  ? 45   ASN A ND2   1 
ATOM   367   N N     . GLU A 1 46  ? 13.396  19.739  87.826  1.00 42.14  ? 46   GLU A N     1 
ATOM   368   C CA    . GLU A 1 46  ? 13.225  19.502  89.250  1.00 41.08  ? 46   GLU A CA    1 
ATOM   369   C C     . GLU A 1 46  ? 11.767  19.230  89.510  1.00 39.16  ? 46   GLU A C     1 
ATOM   370   O O     . GLU A 1 46  ? 10.912  19.865  88.917  1.00 41.05  ? 46   GLU A O     1 
ATOM   371   C CB    . GLU A 1 46  ? 13.703  20.679  90.096  1.00 41.64  ? 46   GLU A CB    1 
ATOM   372   C CG    . GLU A 1 46  ? 15.232  20.892  90.063  1.00 44.15  ? 46   GLU A CG    1 
ATOM   373   C CD    . GLU A 1 46  ? 16.019  19.725  90.637  1.00 39.52  ? 46   GLU A CD    1 
ATOM   374   O OE1   . GLU A 1 46  ? 16.059  19.563  91.882  1.00 41.40  ? 46   GLU A OE1   1 
ATOM   375   O OE2   . GLU A 1 46  ? 16.613  18.978  89.835  1.00 39.65  ? 46   GLU A OE2   1 
ATOM   376   N N     . PRO A 1 47  ? 11.473  18.241  90.367  1.00 38.31  ? 47   PRO A N     1 
ATOM   377   C CA    . PRO A 1 47  ? 10.083  17.804  90.525  1.00 36.63  ? 47   PRO A CA    1 
ATOM   378   C C     . PRO A 1 47  ? 9.106   18.784  91.178  1.00 35.58  ? 47   PRO A C     1 
ATOM   379   O O     . PRO A 1 47  ? 7.911   18.555  91.093  1.00 37.41  ? 47   PRO A O     1 
ATOM   380   C CB    . PRO A 1 47  ? 10.211  16.550  91.392  1.00 36.12  ? 47   PRO A CB    1 
ATOM   381   C CG    . PRO A 1 47  ? 11.547  16.669  92.079  1.00 37.47  ? 47   PRO A CG    1 
ATOM   382   C CD    . PRO A 1 47  ? 12.417  17.436  91.170  1.00 37.78  ? 47   PRO A CD    1 
ATOM   383   N N     . THR A 1 48  ? 9.581   19.829  91.856  1.00 33.07  ? 48   THR A N     1 
ATOM   384   C CA    . THR A 1 48  ? 8.672   20.723  92.587  1.00 31.89  ? 48   THR A CA    1 
ATOM   385   C C     . THR A 1 48  ? 9.027   22.180  92.400  1.00 29.57  ? 48   THR A C     1 
ATOM   386   O O     . THR A 1 48  ? 10.141  22.513  91.997  1.00 29.74  ? 48   THR A O     1 
ATOM   387   C CB    . THR A 1 48  ? 8.677   20.447  94.102  1.00 30.07  ? 48   THR A CB    1 
ATOM   388   O OG1   . THR A 1 48  ? 9.979   20.695  94.601  1.00 26.06  ? 48   THR A OG1   1 
ATOM   389   C CG2   . THR A 1 48  ? 8.281   18.997  94.409  1.00 32.43  ? 48   THR A CG2   1 
ATOM   390   N N     . GLN A 1 49  ? 8.069   23.033  92.739  1.00 29.66  ? 49   GLN A N     1 
ATOM   391   C CA    . GLN A 1 49  ? 8.224   24.475  92.681  1.00 32.41  ? 49   GLN A CA    1 
ATOM   392   C C     . GLN A 1 49  ? 9.432   24.986  93.459  1.00 32.02  ? 49   GLN A C     1 
ATOM   393   O O     . GLN A 1 49  ? 10.183  25.812  92.964  1.00 33.52  ? 49   GLN A O     1 
ATOM   394   C CB    . GLN A 1 49  ? 6.969   25.141  93.236  1.00 30.96  ? 49   GLN A CB    1 
ATOM   395   C CG    . GLN A 1 49  ? 7.053   26.642  93.269  1.00 33.73  ? 49   GLN A CG    1 
ATOM   396   C CD    . GLN A 1 49  ? 5.788   27.277  93.776  1.00 36.65  ? 49   GLN A CD    1 
ATOM   397   O OE1   . GLN A 1 49  ? 4.702   27.057  93.231  1.00 41.53  ? 49   GLN A OE1   1 
ATOM   398   N NE2   . GLN A 1 49  ? 5.917   28.078  94.821  1.00 47.19  ? 49   GLN A NE2   1 
ATOM   399   N N     . GLN A 1 50  ? 9.582   24.507  94.694  1.00 32.96  ? 50   GLN A N     1 
ATOM   400   C CA    . GLN A 1 50  ? 10.677  24.916  95.576  1.00 32.90  ? 50   GLN A CA    1 
ATOM   401   C C     . GLN A 1 50  ? 12.019  24.360  95.181  1.00 29.76  ? 50   GLN A C     1 
ATOM   402   O O     . GLN A 1 50  ? 13.031  25.003  95.414  1.00 32.33  ? 50   GLN A O     1 
ATOM   403   C CB    . GLN A 1 50  ? 10.373  24.528  97.033  1.00 31.98  ? 50   GLN A CB    1 
ATOM   404   C CG    . GLN A 1 50  ? 9.157   25.254  97.545  1.00 39.30  ? 50   GLN A CG    1 
ATOM   405   C CD    . GLN A 1 50  ? 9.055   25.270  99.052  1.00 40.56  ? 50   GLN A CD    1 
ATOM   406   O OE1   . GLN A 1 50  ? 10.038  24.997  99.783  1.00 44.61  ? 50   GLN A OE1   1 
ATOM   407   N NE2   . GLN A 1 50  ? 7.853   25.604  99.536  1.00 42.80  ? 50   GLN A NE2   1 
ATOM   408   N N     . GLN A 1 51  ? 12.042  23.162  94.609  1.00 28.45  ? 51   GLN A N     1 
ATOM   409   C CA    . GLN A 1 51  ? 13.298  22.582  94.123  1.00 29.35  ? 51   GLN A CA    1 
ATOM   410   C C     . GLN A 1 51  ? 13.739  23.218  92.794  1.00 27.85  ? 51   GLN A C     1 
ATOM   411   O O     . GLN A 1 51  ? 14.926  23.359  92.527  1.00 28.55  ? 51   GLN A O     1 
ATOM   412   C CB    . GLN A 1 51  ? 13.168  21.053  94.035  1.00 29.93  ? 51   GLN A CB    1 
ATOM   413   C CG    . GLN A 1 51  ? 13.095  20.417  95.444  1.00 28.59  ? 51   GLN A CG    1 
ATOM   414   C CD    . GLN A 1 51  ? 12.877  18.891  95.457  1.00 32.77  ? 51   GLN A CD    1 
ATOM   415   O OE1   . GLN A 1 51  ? 13.376  18.151  94.598  1.00 32.17  ? 51   GLN A OE1   1 
ATOM   416   N NE2   . GLN A 1 51  ? 12.141  18.421  96.468  1.00 34.40  ? 51   GLN A NE2   1 
ATOM   417   N N     . ARG A 1 52  ? 12.782  23.602  91.956  1.00 28.09  ? 52   ARG A N     1 
ATOM   418   C CA    . ARG A 1 52  ? 13.089  24.472  90.817  1.00 29.18  ? 52   ARG A CA    1 
ATOM   419   C C     . ARG A 1 52  ? 13.735  25.797  91.306  1.00 28.69  ? 52   ARG A C     1 
ATOM   420   O O     . ARG A 1 52  ? 14.746  26.245  90.767  1.00 26.22  ? 52   ARG A O     1 
ATOM   421   C CB    . ARG A 1 52  ? 11.824  24.740  89.989  1.00 27.25  ? 52   ARG A CB    1 
ATOM   422   C CG    . ARG A 1 52  ? 11.272  23.470  89.284  1.00 27.95  ? 52   ARG A CG    1 
ATOM   423   C CD    . ARG A 1 52  ? 10.172  23.792  88.333  1.00 31.74  ? 52   ARG A CD    1 
ATOM   424   N NE    . ARG A 1 52  ? 9.510   22.616  87.801  1.00 34.77  ? 52   ARG A NE    1 
ATOM   425   C CZ    . ARG A 1 52  ? 8.484   22.657  86.956  1.00 38.52  ? 52   ARG A CZ    1 
ATOM   426   N NH1   . ARG A 1 52  ? 8.009   23.819  86.544  1.00 35.52  ? 52   ARG A NH1   1 
ATOM   427   N NH2   . ARG A 1 52  ? 7.919   21.524  86.524  1.00 42.04  ? 52   ARG A NH2   1 
ATOM   428   N N     . ALA A 1 53  ? 13.146  26.388  92.347  1.00 27.36  ? 53   ALA A N     1 
ATOM   429   C CA    . ALA A 1 53  ? 13.657  27.629  92.916  1.00 29.40  ? 53   ALA A CA    1 
ATOM   430   C C     . ALA A 1 53  ? 15.044  27.473  93.539  1.00 29.95  ? 53   ALA A C     1 
ATOM   431   O O     . ALA A 1 53  ? 15.893  28.348  93.360  1.00 29.76  ? 53   ALA A O     1 
ATOM   432   C CB    . ALA A 1 53  ? 12.681  28.180  93.932  1.00 30.93  ? 53   ALA A CB    1 
ATOM   433   N N     . ALA A 1 54  ? 15.250  26.365  94.260  1.00 28.98  ? 54   ALA A N     1 
ATOM   434   C CA    . ALA A 1 54  ? 16.538  26.011  94.871  1.00 30.08  ? 54   ALA A CA    1 
ATOM   435   C C     . ALA A 1 54  ? 17.625  25.861  93.820  1.00 30.67  ? 54   ALA A C     1 
ATOM   436   O O     . ALA A 1 54  ? 18.716  26.404  93.965  1.00 30.28  ? 54   ALA A O     1 
ATOM   437   C CB    . ALA A 1 54  ? 16.414  24.718  95.667  1.00 28.08  ? 54   ALA A CB    1 
ATOM   438   N N     . MET A 1 55  ? 17.299  25.131  92.764  1.00 31.22  ? 55   MET A N     1 
ATOM   439   C CA    . MET A 1 55  ? 18.196  24.895  91.664  1.00 32.83  ? 55   MET A CA    1 
ATOM   440   C C     . MET A 1 55  ? 18.629  26.223  91.037  1.00 34.91  ? 55   MET A C     1 
ATOM   441   O O     . MET A 1 55  ? 19.826  26.490  90.918  1.00 35.48  ? 55   MET A O     1 
ATOM   442   C CB    . MET A 1 55  ? 17.503  23.998  90.627  1.00 35.14  ? 55   MET A CB    1 
ATOM   443   C CG    . MET A 1 55  ? 18.364  23.514  89.458  1.00 37.54  ? 55   MET A CG    1 
ATOM   444   S SD    . MET A 1 55  ? 19.952  22.818  89.964  1.00 57.75  ? 55   MET A SD    1 
ATOM   445   C CE    . MET A 1 55  ? 19.499  21.518  91.127  1.00 54.85  ? 55   MET A CE    1 
ATOM   446   N N     . LEU A 1 56  ? 17.664  27.066  90.676  1.00 33.97  ? 56   LEU A N     1 
ATOM   447   C CA    . LEU A 1 56  ? 17.975  28.364  90.077  1.00 35.36  ? 56   LEU A CA    1 
ATOM   448   C C     . LEU A 1 56  ? 18.867  29.230  90.939  1.00 34.27  ? 56   LEU A C     1 
ATOM   449   O O     . LEU A 1 56  ? 19.845  29.749  90.459  1.00 35.58  ? 56   LEU A O     1 
ATOM   450   C CB    . LEU A 1 56  ? 16.697  29.151  89.785  1.00 35.34  ? 56   LEU A CB    1 
ATOM   451   C CG    . LEU A 1 56  ? 16.859  30.511  89.092  1.00 33.26  ? 56   LEU A CG    1 
ATOM   452   C CD1   . LEU A 1 56  ? 17.548  30.352  87.755  1.00 38.85  ? 56   LEU A CD1   1 
ATOM   453   C CD2   . LEU A 1 56  ? 15.498  31.168  88.896  1.00 34.39  ? 56   LEU A CD2   1 
ATOM   454   N N     . ILE A 1 57  ? 18.500  29.422  92.191  1.00 37.35  ? 57   ILE A N     1 
ATOM   455   C CA    . ILE A 1 57  ? 19.284  30.240  93.109  1.00 42.63  ? 57   ILE A CA    1 
ATOM   456   C C     . ILE A 1 57  ? 20.713  29.703  93.262  1.00 46.15  ? 57   ILE A C     1 
ATOM   457   O O     . ILE A 1 57  ? 21.648  30.498  93.327  1.00 45.81  ? 57   ILE A O     1 
ATOM   458   C CB    . ILE A 1 57  ? 18.587  30.371  94.483  1.00 42.19  ? 57   ILE A CB    1 
ATOM   459   C CG1   . ILE A 1 57  ? 17.328  31.221  94.334  1.00 44.51  ? 57   ILE A CG1   1 
ATOM   460   C CG2   . ILE A 1 57  ? 19.507  31.003  95.510  1.00 41.35  ? 57   ILE A CG2   1 
ATOM   461   C CD1   . ILE A 1 57  ? 16.371  31.081  95.472  1.00 46.23  ? 57   ILE A CD1   1 
ATOM   462   N N     . LYS A 1 58  ? 20.870  28.370  93.304  1.00 49.77  ? 58   LYS A N     1 
ATOM   463   C CA    . LYS A 1 58  ? 22.195  27.709  93.196  1.00 51.50  ? 58   LYS A CA    1 
ATOM   464   C C     . LYS A 1 58  ? 22.979  28.138  91.945  1.00 51.76  ? 58   LYS A C     1 
ATOM   465   O O     . LYS A 1 58  ? 24.187  28.344  92.018  1.00 51.35  ? 58   LYS A O     1 
ATOM   466   C CB    . LYS A 1 58  ? 22.076  26.165  93.187  1.00 53.36  ? 58   LYS A CB    1 
ATOM   467   C CG    . LYS A 1 58  ? 21.670  25.531  94.509  1.00 54.56  ? 58   LYS A CG    1 
ATOM   468   C CD    . LYS A 1 58  ? 21.623  24.007  94.500  1.00 56.27  ? 58   LYS A CD    1 
ATOM   469   C CE    . LYS A 1 58  ? 20.844  23.489  95.737  1.00 61.42  ? 58   LYS A CE    1 
ATOM   470   N NZ    . LYS A 1 58  ? 20.754  22.000  95.788  1.00 58.63  ? 58   LYS A NZ    1 
ATOM   471   N N     . MET A 1 59  ? 22.303  28.253  90.804  1.00 52.80  ? 59   MET A N     1 
ATOM   472   C CA    . MET A 1 59  ? 22.972  28.657  89.557  1.00 54.70  ? 59   MET A CA    1 
ATOM   473   C C     . MET A 1 59  ? 23.369  30.131  89.629  1.00 56.69  ? 59   MET A C     1 
ATOM   474   O O     . MET A 1 59  ? 24.518  30.494  89.353  1.00 57.21  ? 59   MET A O     1 
ATOM   475   C CB    . MET A 1 59  ? 22.092  28.400  88.329  1.00 54.24  ? 59   MET A CB    1 
ATOM   476   C CG    . MET A 1 59  ? 21.674  26.939  88.203  1.00 56.26  ? 59   MET A CG    1 
ATOM   477   S SD    . MET A 1 59  ? 20.630  26.554  86.790  1.00 54.88  ? 59   MET A SD    1 
ATOM   478   C CE    . MET A 1 59  ? 21.776  25.529  85.893  1.00 61.29  ? 59   MET A CE    1 
ATOM   479   N N     . ILE A 1 60  ? 22.425  30.964  90.055  1.00 57.53  ? 60   ILE A N     1 
ATOM   480   C CA    . ILE A 1 60  ? 22.663  32.402  90.205  1.00 57.38  ? 60   ILE A CA    1 
ATOM   481   C C     . ILE A 1 60  ? 23.784  32.718  91.210  1.00 57.73  ? 60   ILE A C     1 
ATOM   482   O O     . ILE A 1 60  ? 24.474  33.728  91.067  1.00 56.72  ? 60   ILE A O     1 
ATOM   483   C CB    . ILE A 1 60  ? 21.359  33.156  90.572  1.00 56.44  ? 60   ILE A CB    1 
ATOM   484   C CG1   . ILE A 1 60  ? 20.384  33.077  89.404  1.00 54.23  ? 60   ILE A CG1   1 
ATOM   485   C CG2   . ILE A 1 60  ? 21.638  34.632  90.877  1.00 58.08  ? 60   ILE A CG2   1 
ATOM   486   C CD1   . ILE A 1 60  ? 19.040  33.613  89.720  1.00 57.71  ? 60   ILE A CD1   1 
ATOM   487   N N     . LEU A 1 61  ? 23.970  31.859  92.212  1.00 58.22  ? 61   LEU A N     1 
ATOM   488   C CA    . LEU A 1 61  ? 25.018  32.075  93.201  1.00 58.35  ? 61   LEU A CA    1 
ATOM   489   C C     . LEU A 1 61  ? 26.403  31.979  92.576  1.00 60.14  ? 61   LEU A C     1 
ATOM   490   O O     . LEU A 1 61  ? 27.331  32.643  93.031  1.00 61.33  ? 61   LEU A O     1 
ATOM   491   C CB    . LEU A 1 61  ? 24.896  31.088  94.363  1.00 57.29  ? 61   LEU A CB    1 
ATOM   492   C CG    . LEU A 1 61  ? 23.901  31.478  95.461  1.00 54.49  ? 61   LEU A CG    1 
ATOM   493   C CD1   . LEU A 1 61  ? 23.712  30.314  96.428  1.00 54.66  ? 61   LEU A CD1   1 
ATOM   494   C CD2   . LEU A 1 61  ? 24.337  32.736  96.222  1.00 48.10  ? 61   LEU A CD2   1 
ATOM   495   N N     . LYS A 1 62  ? 26.538  31.162  91.535  1.00 60.61  ? 62   LYS A N     1 
ATOM   496   C CA    . LYS A 1 62  ? 27.803  31.016  90.822  1.00 61.00  ? 62   LYS A CA    1 
ATOM   497   C C     . LYS A 1 62  ? 27.844  31.955  89.623  1.00 61.46  ? 62   LYS A C     1 
ATOM   498   O O     . LYS A 1 62  ? 28.271  31.555  88.542  1.00 62.42  ? 62   LYS A O     1 
ATOM   499   C CB    . LYS A 1 62  ? 27.982  29.565  90.343  1.00 62.00  ? 62   LYS A CB    1 
ATOM   500   C CG    . LYS A 1 62  ? 28.221  28.541  91.442  1.00 60.39  ? 62   LYS A CG    1 
ATOM   501   C CD    . LYS A 1 62  ? 28.073  27.135  90.893  1.00 61.72  ? 62   LYS A CD    1 
ATOM   502   C CE    . LYS A 1 62  ? 28.453  26.088  91.933  1.00 65.59  ? 62   LYS A CE    1 
ATOM   503   N NZ    . LYS A 1 62  ? 27.793  24.773  91.673  1.00 64.16  ? 62   LYS A NZ    1 
ATOM   504   N N     . LYS A 1 63  ? 27.407  33.200  89.815  1.00 61.49  ? 63   LYS A N     1 
ATOM   505   C CA    . LYS A 1 63  ? 27.233  34.137  88.703  1.00 61.74  ? 63   LYS A CA    1 
ATOM   506   C C     . LYS A 1 63  ? 27.478  35.599  89.091  1.00 62.25  ? 63   LYS A C     1 
ATOM   507   O O     . LYS A 1 63  ? 27.229  36.025  90.227  1.00 62.05  ? 63   LYS A O     1 
ATOM   508   C CB    . LYS A 1 63  ? 25.838  34.001  88.080  1.00 60.88  ? 63   LYS A CB    1 
ATOM   509   C CG    . LYS A 1 63  ? 25.654  32.793  87.160  1.00 60.17  ? 63   LYS A CG    1 
ATOM   510   C CD    . LYS A 1 63  ? 24.264  32.821  86.514  1.00 62.69  ? 63   LYS A CD    1 
ATOM   511   C CE    . LYS A 1 63  ? 24.012  31.627  85.605  1.00 63.72  ? 63   LYS A CE    1 
ATOM   512   N NZ    . LYS A 1 63  ? 24.793  31.701  84.348  1.00 63.23  ? 63   LYS A NZ    1 
ATOM   513   N N     . ASP A 1 64  ? 27.940  36.350  88.092  1.00 62.19  ? 64   ASP A N     1 
ATOM   514   C CA    . ASP A 1 64  ? 28.354  37.750  88.217  1.00 62.34  ? 64   ASP A CA    1 
ATOM   515   C C     . ASP A 1 64  ? 27.310  38.708  88.821  1.00 62.26  ? 64   ASP A C     1 
ATOM   516   O O     . ASP A 1 64  ? 26.142  38.347  89.048  1.00 62.02  ? 64   ASP A O     1 
ATOM   517   C CB    . ASP A 1 64  ? 28.811  38.281  86.832  1.00 62.11  ? 64   ASP A CB    1 
ATOM   518   C CG    . ASP A 1 64  ? 27.697  38.261  85.782  1.00 63.63  ? 64   ASP A CG    1 
ATOM   519   O OD1   . ASP A 1 64  ? 26.782  37.424  85.899  1.00 69.51  ? 64   ASP A OD1   1 
ATOM   520   O OD2   . ASP A 1 64  ? 27.732  39.080  84.834  1.00 70.71  ? 64   ASP A OD2   1 
ATOM   521   N N     . ASN A 1 65  ? 27.771  39.938  89.064  1.00 62.15  ? 65   ASN A N     1 
ATOM   522   C CA    . ASN A 1 65  ? 26.945  41.051  89.572  1.00 61.32  ? 65   ASN A CA    1 
ATOM   523   C C     . ASN A 1 65  ? 25.686  41.371  88.753  1.00 59.57  ? 65   ASN A C     1 
ATOM   524   O O     . ASN A 1 65  ? 24.654  41.768  89.303  1.00 58.85  ? 65   ASN A O     1 
ATOM   525   C CB    . ASN A 1 65  ? 27.808  42.321  89.651  1.00 62.75  ? 65   ASN A CB    1 
ATOM   526   C CG    . ASN A 1 65  ? 28.970  42.175  90.610  1.00 64.06  ? 65   ASN A CG    1 
ATOM   527   O OD1   . ASN A 1 65  ? 30.127  42.357  90.237  1.00 73.99  ? 65   ASN A OD1   1 
ATOM   528   N ND2   . ASN A 1 65  ? 28.666  41.838  91.852  1.00 64.66  ? 65   ASN A ND2   1 
ATOM   529   N N     . ASP A 1 66  ? 25.785  41.209  87.439  1.00 58.37  ? 66   ASP A N     1 
ATOM   530   C CA    . ASP A 1 66  ? 24.717  41.602  86.529  1.00 56.35  ? 66   ASP A CA    1 
ATOM   531   C C     . ASP A 1 66  ? 23.541  40.634  86.582  1.00 54.30  ? 66   ASP A C     1 
ATOM   532   O O     . ASP A 1 66  ? 22.374  41.049  86.402  1.00 53.98  ? 66   ASP A O     1 
ATOM   533   C CB    . ASP A 1 66  ? 25.254  41.703  85.102  1.00 58.00  ? 66   ASP A CB    1 
ATOM   534   C CG    . ASP A 1 66  ? 26.382  42.737  84.959  1.00 61.30  ? 66   ASP A CG    1 
ATOM   535   O OD1   . ASP A 1 66  ? 27.564  42.360  85.147  1.00 58.48  ? 66   ASP A OD1   1 
ATOM   536   O OD2   . ASP A 1 66  ? 26.076  43.909  84.635  1.00 58.30  ? 66   ASP A OD2   1 
ATOM   537   N N     . SER A 1 67  ? 23.853  39.354  86.822  1.00 51.04  ? 67   SER A N     1 
ATOM   538   C CA    . SER A 1 67  ? 22.836  38.302  87.014  1.00 48.86  ? 67   SER A CA    1 
ATOM   539   C C     . SER A 1 67  ? 21.963  38.559  88.250  1.00 45.45  ? 67   SER A C     1 
ATOM   540   O O     . SER A 1 67  ? 20.749  38.493  88.168  1.00 40.82  ? 67   SER A O     1 
ATOM   541   C CB    . SER A 1 67  ? 23.498  36.930  87.108  1.00 49.00  ? 67   SER A CB    1 
ATOM   542   O OG    . SER A 1 67  ? 24.021  36.543  85.846  1.00 53.72  ? 67   SER A OG    1 
ATOM   543   N N     . TYR A 1 68  ? 22.603  38.876  89.379  1.00 45.20  ? 68   TYR A N     1 
ATOM   544   C CA    . TYR A 1 68  ? 21.922  39.363  90.586  1.00 44.68  ? 68   TYR A CA    1 
ATOM   545   C C     . TYR A 1 68  ? 20.872  40.443  90.276  1.00 44.59  ? 68   TYR A C     1 
ATOM   546   O O     . TYR A 1 68  ? 19.691  40.332  90.649  1.00 46.47  ? 68   TYR A O     1 
ATOM   547   C CB    . TYR A 1 68  ? 22.972  39.924  91.547  1.00 44.46  ? 68   TYR A CB    1 
ATOM   548   C CG    . TYR A 1 68  ? 22.496  40.133  92.955  1.00 44.65  ? 68   TYR A CG    1 
ATOM   549   C CD1   . TYR A 1 68  ? 21.779  41.273  93.320  1.00 44.63  ? 68   TYR A CD1   1 
ATOM   550   C CD2   . TYR A 1 68  ? 22.765  39.193  93.931  1.00 43.40  ? 68   TYR A CD2   1 
ATOM   551   C CE1   . TYR A 1 68  ? 21.343  41.457  94.641  1.00 43.65  ? 68   TYR A CE1   1 
ATOM   552   C CE2   . TYR A 1 68  ? 22.338  39.368  95.232  1.00 43.87  ? 68   TYR A CE2   1 
ATOM   553   C CZ    . TYR A 1 68  ? 21.638  40.494  95.588  1.00 41.01  ? 68   TYR A CZ    1 
ATOM   554   O OH    . TYR A 1 68  ? 21.251  40.632  96.913  1.00 49.74  ? 68   TYR A OH    1 
ATOM   555   N N     . VAL A 1 69  ? 21.305  41.480  89.570  1.00 44.22  ? 69   VAL A N     1 
ATOM   556   C CA    . VAL A 1 69  ? 20.436  42.608  89.212  1.00 43.72  ? 69   VAL A CA    1 
ATOM   557   C C     . VAL A 1 69  ? 19.351  42.194  88.198  1.00 43.05  ? 69   VAL A C     1 
ATOM   558   O O     . VAL A 1 69  ? 18.189  42.608  88.320  1.00 45.63  ? 69   VAL A O     1 
ATOM   559   C CB    . VAL A 1 69  ? 21.273  43.821  88.675  1.00 44.60  ? 69   VAL A CB    1 
ATOM   560   C CG1   . VAL A 1 69  ? 20.360  45.001  88.317  1.00 45.64  ? 69   VAL A CG1   1 
ATOM   561   C CG2   . VAL A 1 69  ? 22.303  44.258  89.714  1.00 45.92  ? 69   VAL A CG2   1 
ATOM   562   N N     . SER A 1 70  ? 19.732  41.395  87.199  1.00 41.51  ? 70   SER A N     1 
ATOM   563   C CA    . SER A 1 70  ? 18.762  40.787  86.275  1.00 39.61  ? 70   SER A CA    1 
ATOM   564   C C     . SER A 1 70  ? 17.692  39.984  87.045  1.00 39.44  ? 70   SER A C     1 
ATOM   565   O O     . SER A 1 70  ? 16.500  40.102  86.787  1.00 41.80  ? 70   SER A O     1 
ATOM   566   C CB    . SER A 1 70  ? 19.488  39.863  85.285  1.00 37.53  ? 70   SER A CB    1 
ATOM   567   O OG    . SER A 1 70  ? 18.544  39.198  84.450  1.00 44.25  ? 70   SER A OG    1 
ATOM   568   N N     . PHE A 1 71  ? 18.143  39.170  87.994  1.00 38.26  ? 71   PHE A N     1 
ATOM   569   C CA    . PHE A 1 71  ? 17.268  38.361  88.813  1.00 38.36  ? 71   PHE A CA    1 
ATOM   570   C C     . PHE A 1 71  ? 16.423  39.285  89.691  1.00 38.11  ? 71   PHE A C     1 
ATOM   571   O O     . PHE A 1 71  ? 15.202  39.097  89.810  1.00 36.81  ? 71   PHE A O     1 
ATOM   572   C CB    . PHE A 1 71  ? 18.121  37.389  89.634  1.00 37.69  ? 71   PHE A CB    1 
ATOM   573   C CG    . PHE A 1 71  ? 17.345  36.521  90.588  1.00 39.02  ? 71   PHE A CG    1 
ATOM   574   C CD1   . PHE A 1 71  ? 16.300  35.726  90.144  1.00 42.57  ? 71   PHE A CD1   1 
ATOM   575   C CD2   . PHE A 1 71  ? 17.700  36.457  91.924  1.00 43.81  ? 71   PHE A CD2   1 
ATOM   576   C CE1   . PHE A 1 71  ? 15.618  34.932  91.013  1.00 36.23  ? 71   PHE A CE1   1 
ATOM   577   C CE2   . PHE A 1 71  ? 17.007  35.652  92.797  1.00 39.60  ? 71   PHE A CE2   1 
ATOM   578   C CZ    . PHE A 1 71  ? 15.967  34.904  92.350  1.00 28.99  ? 71   PHE A CZ    1 
ATOM   579   N N     . TYR A 1 72  ? 17.069  40.288  90.288  1.00 39.38  ? 72   TYR A N     1 
ATOM   580   C CA    . TYR A 1 72  ? 16.352  41.354  91.017  1.00 40.37  ? 72   TYR A CA    1 
ATOM   581   C C     . TYR A 1 72  ? 15.233  41.969  90.163  1.00 38.47  ? 72   TYR A C     1 
ATOM   582   O O     . TYR A 1 72  ? 14.106  42.090  90.595  1.00 37.50  ? 72   TYR A O     1 
ATOM   583   C CB    . TYR A 1 72  ? 17.325  42.458  91.484  1.00 43.33  ? 72   TYR A CB    1 
ATOM   584   C CG    . TYR A 1 72  ? 16.636  43.633  92.143  1.00 43.30  ? 72   TYR A CG    1 
ATOM   585   C CD1   . TYR A 1 72  ? 16.287  43.583  93.494  1.00 49.24  ? 72   TYR A CD1   1 
ATOM   586   C CD2   . TYR A 1 72  ? 16.329  44.798  91.420  1.00 48.85  ? 72   TYR A CD2   1 
ATOM   587   C CE1   . TYR A 1 72  ? 15.635  44.647  94.115  1.00 47.55  ? 72   TYR A CE1   1 
ATOM   588   C CE2   . TYR A 1 72  ? 15.672  45.888  92.038  1.00 49.40  ? 72   TYR A CE2   1 
ATOM   589   C CZ    . TYR A 1 72  ? 15.331  45.797  93.391  1.00 52.55  ? 72   TYR A CZ    1 
ATOM   590   O OH    . TYR A 1 72  ? 14.700  46.828  94.056  1.00 50.67  ? 72   TYR A OH    1 
ATOM   591   N N     . ASN A 1 73  ? 15.560  42.342  88.936  1.00 40.20  ? 73   ASN A N     1 
ATOM   592   C CA    . ASN A 1 73  ? 14.573  42.902  88.016  1.00 39.65  ? 73   ASN A CA    1 
ATOM   593   C C     . ASN A 1 73  ? 13.479  41.940  87.585  1.00 38.56  ? 73   ASN A C     1 
ATOM   594   O O     . ASN A 1 73  ? 12.333  42.358  87.417  1.00 40.37  ? 73   ASN A O     1 
ATOM   595   C CB    . ASN A 1 73  ? 15.275  43.458  86.789  1.00 41.77  ? 73   ASN A CB    1 
ATOM   596   C CG    . ASN A 1 73  ? 16.011  44.759  87.078  1.00 47.80  ? 73   ASN A CG    1 
ATOM   597   O OD1   . ASN A 1 73  ? 15.526  45.607  87.837  1.00 45.01  ? 73   ASN A OD1   1 
ATOM   598   N ND2   . ASN A 1 73  ? 17.170  44.933  86.446  1.00 45.30  ? 73   ASN A ND2   1 
ATOM   599   N N     . ALA A 1 74  ? 13.811  40.666  87.391  1.00 37.92  ? 74   ALA A N     1 
ATOM   600   C CA    . ALA A 1 74  ? 12.774  39.647  87.137  1.00 37.25  ? 74   ALA A CA    1 
ATOM   601   C C     . ALA A 1 74  ? 11.801  39.563  88.325  1.00 36.99  ? 74   ALA A C     1 
ATOM   602   O O     . ALA A 1 74  ? 10.579  39.556  88.154  1.00 35.34  ? 74   ALA A O     1 
ATOM   603   C CB    . ALA A 1 74  ? 13.411  38.297  86.858  1.00 35.03  ? 74   ALA A CB    1 
ATOM   604   N N     . LEU A 1 75  ? 12.345  39.539  89.541  1.00 38.15  ? 75   LEU A N     1 
ATOM   605   C CA    . LEU A 1 75  ? 11.513  39.572  90.758  1.00 39.08  ? 75   LEU A CA    1 
ATOM   606   C C     . LEU A 1 75  ? 10.521  40.749  90.798  1.00 39.79  ? 75   LEU A C     1 
ATOM   607   O O     . LEU A 1 75  ? 9.361   40.549  91.115  1.00 41.07  ? 75   LEU A O     1 
ATOM   608   C CB    . LEU A 1 75  ? 12.387  39.558  92.025  1.00 38.71  ? 75   LEU A CB    1 
ATOM   609   C CG    . LEU A 1 75  ? 13.151  38.254  92.334  1.00 39.10  ? 75   LEU A CG    1 
ATOM   610   C CD1   . LEU A 1 75  ? 14.070  38.490  93.500  1.00 36.48  ? 75   LEU A CD1   1 
ATOM   611   C CD2   . LEU A 1 75  ? 12.215  37.077  92.616  1.00 36.64  ? 75   LEU A CD2   1 
ATOM   612   N N     . LEU A 1 76  ? 10.957  41.965  90.472  1.00 42.16  ? 76   LEU A N     1 
ATOM   613   C CA    . LEU A 1 76  ? 10.034  43.131  90.419  1.00 43.32  ? 76   LEU A CA    1 
ATOM   614   C C     . LEU A 1 76  ? 9.027   43.039  89.277  1.00 45.63  ? 76   LEU A C     1 
ATOM   615   O O     . LEU A 1 76  ? 7.832   43.264  89.474  1.00 46.34  ? 76   LEU A O     1 
ATOM   616   C CB    . LEU A 1 76  ? 10.812  44.444  90.268  1.00 43.34  ? 76   LEU A CB    1 
ATOM   617   C CG    . LEU A 1 76  ? 11.773  44.879  91.377  1.00 43.68  ? 76   LEU A CG    1 
ATOM   618   C CD1   . LEU A 1 76  ? 12.327  46.243  91.023  1.00 44.13  ? 76   LEU A CD1   1 
ATOM   619   C CD2   . LEU A 1 76  ? 11.109  44.876  92.773  1.00 39.23  ? 76   LEU A CD2   1 
ATOM   620   N N     . HIS A 1 77  ? 9.545   42.728  88.088  1.00 49.14  ? 77   HIS A N     1 
ATOM   621   C CA    . HIS A 1 77  ? 8.781   42.469  86.860  1.00 47.78  ? 77   HIS A CA    1 
ATOM   622   C C     . HIS A 1 77  ? 7.660   41.469  87.084  1.00 47.55  ? 77   HIS A C     1 
ATOM   623   O O     . HIS A 1 77  ? 6.592   41.569  86.473  1.00 49.78  ? 77   HIS A O     1 
ATOM   624   C CB    . HIS A 1 77  ? 9.762   41.908  85.803  1.00 50.42  ? 77   HIS A CB    1 
ATOM   625   C CG    . HIS A 1 77  ? 9.285   41.991  84.383  1.00 55.03  ? 77   HIS A CG    1 
ATOM   626   N ND1   . HIS A 1 77  ? 10.017  42.622  83.396  1.00 63.36  ? 77   HIS A ND1   1 
ATOM   627   C CD2   . HIS A 1 77  ? 8.181   41.489  83.770  1.00 65.14  ? 77   HIS A CD2   1 
ATOM   628   C CE1   . HIS A 1 77  ? 9.377   42.516  82.243  1.00 66.30  ? 77   HIS A CE1   1 
ATOM   629   N NE2   . HIS A 1 77  ? 8.256   41.842  82.444  1.00 65.61  ? 77   HIS A NE2   1 
ATOM   630   N N     . GLU A 1 78  ? 7.901   40.508  87.965  1.00 47.41  ? 78   GLU A N     1 
ATOM   631   C CA    . GLU A 1 78  ? 6.964   39.415  88.218  1.00 47.49  ? 78   GLU A CA    1 
ATOM   632   C C     . GLU A 1 78  ? 6.213   39.549  89.517  1.00 48.50  ? 78   GLU A C     1 
ATOM   633   O O     . GLU A 1 78  ? 5.362   38.727  89.826  1.00 50.73  ? 78   GLU A O     1 
ATOM   634   C CB    . GLU A 1 78  ? 7.718   38.084  88.188  1.00 46.53  ? 78   GLU A CB    1 
ATOM   635   C CG    . GLU A 1 78  ? 8.274   37.796  86.825  1.00 40.79  ? 78   GLU A CG    1 
ATOM   636   C CD    . GLU A 1 78  ? 7.169   37.764  85.803  1.00 41.80  ? 78   GLU A CD    1 
ATOM   637   O OE1   . GLU A 1 78  ? 6.146   37.094  86.059  1.00 23.26  ? 78   GLU A OE1   1 
ATOM   638   O OE2   . GLU A 1 78  ? 7.309   38.409  84.757  1.00 38.57  ? 78   GLU A OE2   1 
ATOM   639   N N     . GLY A 1 79  ? 6.525   40.573  90.292  1.00 51.28  ? 79   GLY A N     1 
ATOM   640   C CA    . GLY A 1 79  ? 5.702   40.933  91.446  1.00 50.65  ? 79   GLY A CA    1 
ATOM   641   C C     . GLY A 1 79  ? 6.203   40.409  92.756  1.00 50.27  ? 79   GLY A C     1 
ATOM   642   O O     . GLY A 1 79  ? 5.457   40.342  93.731  1.00 54.13  ? 79   GLY A O     1 
ATOM   643   N N     . TYR A 1 80  ? 7.475   40.060  92.806  1.00 49.58  ? 80   TYR A N     1 
ATOM   644   C CA    . TYR A 1 80  ? 8.093   39.669  94.057  1.00 48.97  ? 80   TYR A CA    1 
ATOM   645   C C     . TYR A 1 80  ? 8.783   40.891  94.703  1.00 51.37  ? 80   TYR A C     1 
ATOM   646   O O     . TYR A 1 80  ? 10.015  40.924  94.919  1.00 50.49  ? 80   TYR A O     1 
ATOM   647   C CB    . TYR A 1 80  ? 9.031   38.492  93.834  1.00 44.09  ? 80   TYR A CB    1 
ATOM   648   C CG    . TYR A 1 80  ? 8.314   37.228  93.372  1.00 41.54  ? 80   TYR A CG    1 
ATOM   649   C CD1   . TYR A 1 80  ? 7.622   36.432  94.276  1.00 38.58  ? 80   TYR A CD1   1 
ATOM   650   C CD2   . TYR A 1 80  ? 8.337   36.829  92.034  1.00 41.90  ? 80   TYR A CD2   1 
ATOM   651   C CE1   . TYR A 1 80  ? 6.989   35.276  93.881  1.00 39.17  ? 80   TYR A CE1   1 
ATOM   652   C CE2   . TYR A 1 80  ? 7.695   35.660  91.618  1.00 41.22  ? 80   TYR A CE2   1 
ATOM   653   C CZ    . TYR A 1 80  ? 7.035   34.888  92.554  1.00 38.02  ? 80   TYR A CZ    1 
ATOM   654   O OH    . TYR A 1 80  ? 6.386   33.737  92.182  1.00 42.51  ? 80   TYR A OH    1 
ATOM   655   N N     . LYS A 1 81  ? 7.933   41.880  95.007  1.00 53.16  ? 81   LYS A N     1 
ATOM   656   C CA    . LYS A 1 81  ? 8.278   43.145  95.704  1.00 53.93  ? 81   LYS A CA    1 
ATOM   657   C C     . LYS A 1 81  ? 9.057   42.962  97.021  1.00 52.38  ? 81   LYS A C     1 
ATOM   658   O O     . LYS A 1 81  ? 10.159  43.484  97.195  1.00 52.17  ? 81   LYS A O     1 
ATOM   659   C CB    . LYS A 1 81  ? 6.957   43.882  95.989  1.00 55.60  ? 81   LYS A CB    1 
ATOM   660   C CG    . LYS A 1 81  ? 7.063   45.238  96.631  1.00 56.73  ? 81   LYS A CG    1 
ATOM   661   C CD    . LYS A 1 81  ? 5.678   45.741  97.034  1.00 58.19  ? 81   LYS A CD    1 
ATOM   662   C CE    . LYS A 1 81  ? 5.786   46.814  98.127  1.00 67.46  ? 81   LYS A CE    1 
ATOM   663   N NZ    . LYS A 1 81  ? 4.460   47.362  98.526  1.00 68.53  ? 81   LYS A NZ    1 
ATOM   664   N N     . ASP A 1 82  ? 8.473   42.201  97.936  1.00 52.38  ? 82   ASP A N     1 
ATOM   665   C CA    . ASP A 1 82  ? 9.041   42.010  99.266  1.00 53.09  ? 82   ASP A CA    1 
ATOM   666   C C     . ASP A 1 82  ? 10.321  41.157  99.267  1.00 52.77  ? 82   ASP A C     1 
ATOM   667   O O     . ASP A 1 82  ? 11.190  41.337  100.135 1.00 51.50  ? 82   ASP A O     1 
ATOM   668   C CB    . ASP A 1 82  ? 7.998   41.383  100.211 1.00 54.87  ? 82   ASP A CB    1 
ATOM   669   C CG    . ASP A 1 82  ? 6.723   42.218  100.323 1.00 60.28  ? 82   ASP A CG    1 
ATOM   670   O OD1   . ASP A 1 82  ? 5.877   42.164  99.390  1.00 58.34  ? 82   ASP A OD1   1 
ATOM   671   O OD2   . ASP A 1 82  ? 6.577   42.921  101.352 1.00 67.64  ? 82   ASP A OD2   1 
ATOM   672   N N     . LEU A 1 83  ? 10.433  40.227  98.312  1.00 52.08  ? 83   LEU A N     1 
ATOM   673   C CA    . LEU A 1 83  ? 11.647  39.396  98.196  1.00 49.22  ? 83   LEU A CA    1 
ATOM   674   C C     . LEU A 1 83  ? 12.743  40.185  97.543  1.00 46.10  ? 83   LEU A C     1 
ATOM   675   O O     . LEU A 1 83  ? 13.923  40.003  97.863  1.00 43.98  ? 83   LEU A O     1 
ATOM   676   C CB    . LEU A 1 83  ? 11.389  38.106  97.404  1.00 49.10  ? 83   LEU A CB    1 
ATOM   677   C CG    . LEU A 1 83  ? 10.621  37.004  98.152  1.00 46.83  ? 83   LEU A CG    1 
ATOM   678   C CD1   . LEU A 1 83  ? 10.224  35.905  97.193  1.00 48.19  ? 83   LEU A CD1   1 
ATOM   679   C CD2   . LEU A 1 83  ? 11.442  36.435  99.297  1.00 45.60  ? 83   LEU A CD2   1 
ATOM   680   N N     . ALA A 1 84  ? 12.356  41.056  96.617  1.00 44.66  ? 84   ALA A N     1 
ATOM   681   C CA    . ALA A 1 84  ? 13.322  41.932  95.953  1.00 46.47  ? 84   ALA A CA    1 
ATOM   682   C C     . ALA A 1 84  ? 13.832  42.982  96.935  1.00 46.37  ? 84   ALA A C     1 
ATOM   683   O O     . ALA A 1 84  ? 14.997  43.365  96.881  1.00 43.51  ? 84   ALA A O     1 
ATOM   684   C CB    . ALA A 1 84  ? 12.708  42.594  94.721  1.00 43.03  ? 84   ALA A CB    1 
ATOM   685   N N     . ALA A 1 85  ? 12.951  43.425  97.837  1.00 50.62  ? 85   ALA A N     1 
ATOM   686   C CA    . ALA A 1 85  ? 13.319  44.343  98.934  1.00 51.57  ? 85   ALA A CA    1 
ATOM   687   C C     . ALA A 1 85  ? 14.414  43.768  99.799  1.00 53.09  ? 85   ALA A C     1 
ATOM   688   O O     . ALA A 1 85  ? 15.327  44.492  100.205 1.00 55.30  ? 85   ALA A O     1 
ATOM   689   C CB    . ALA A 1 85  ? 12.113  44.674  99.787  1.00 51.88  ? 85   ALA A CB    1 
ATOM   690   N N     . LEU A 1 86  ? 14.339  42.471  100.081 1.00 54.19  ? 86   LEU A N     1 
ATOM   691   C CA    . LEU A 1 86  ? 15.418  41.798  100.816 1.00 54.37  ? 86   LEU A CA    1 
ATOM   692   C C     . LEU A 1 86  ? 16.727  41.722  99.998  1.00 53.96  ? 86   LEU A C     1 
ATOM   693   O O     . LEU A 1 86  ? 17.818  41.738  100.577 1.00 49.64  ? 86   LEU A O     1 
ATOM   694   C CB    . LEU A 1 86  ? 14.993  40.394  101.262 1.00 55.10  ? 86   LEU A CB    1 
ATOM   695   C CG    . LEU A 1 86  ? 13.752  40.226  102.148 1.00 59.74  ? 86   LEU A CG    1 
ATOM   696   C CD1   . LEU A 1 86  ? 13.862  38.918  102.906 1.00 57.43  ? 86   LEU A CD1   1 
ATOM   697   C CD2   . LEU A 1 86  ? 13.562  41.375  103.137 1.00 64.14  ? 86   LEU A CD2   1 
ATOM   698   N N     . LEU A 1 87  ? 16.613  41.629  98.669  1.00 55.45  ? 87   LEU A N     1 
ATOM   699   C CA    . LEU A 1 87  ? 17.790  41.611  97.773  1.00 56.86  ? 87   LEU A CA    1 
ATOM   700   C C     . LEU A 1 87  ? 18.368  42.998  97.472  1.00 56.49  ? 87   LEU A C     1 
ATOM   701   O O     . LEU A 1 87  ? 19.509  43.104  97.028  1.00 52.13  ? 87   LEU A O     1 
ATOM   702   C CB    . LEU A 1 87  ? 17.457  40.933  96.436  1.00 57.85  ? 87   LEU A CB    1 
ATOM   703   C CG    . LEU A 1 87  ? 17.314  39.405  96.355  1.00 60.64  ? 87   LEU A CG    1 
ATOM   704   C CD1   . LEU A 1 87  ? 17.641  38.933  94.923  1.00 57.60  ? 87   LEU A CD1   1 
ATOM   705   C CD2   . LEU A 1 87  ? 18.211  38.680  97.372  1.00 61.78  ? 87   LEU A CD2   1 
ATOM   706   N N     . HIS A 1 88  ? 17.561  44.041  97.678  1.00 59.73  ? 88   HIS A N     1 
ATOM   707   C CA    . HIS A 1 88  ? 17.971  45.446  97.474  1.00 60.60  ? 88   HIS A CA    1 
ATOM   708   C C     . HIS A 1 88  ? 19.204  45.748  98.358  1.00 60.95  ? 88   HIS A C     1 
ATOM   709   O O     . HIS A 1 88  ? 20.194  46.323  97.905  1.00 60.55  ? 88   HIS A O     1 
ATOM   710   C CB    . HIS A 1 88  ? 16.780  46.369  97.806  1.00 61.32  ? 88   HIS A CB    1 
ATOM   711   C CG    . HIS A 1 88  ? 16.983  47.815  97.458  1.00 62.48  ? 88   HIS A CG    1 
ATOM   712   N ND1   . HIS A 1 88  ? 16.033  48.550  96.777  1.00 70.91  ? 88   HIS A ND1   1 
ATOM   713   C CD2   . HIS A 1 88  ? 17.993  48.676  97.737  1.00 64.96  ? 88   HIS A CD2   1 
ATOM   714   C CE1   . HIS A 1 88  ? 16.459  49.794  96.633  1.00 68.81  ? 88   HIS A CE1   1 
ATOM   715   N NE2   . HIS A 1 88  ? 17.646  49.895  97.205  1.00 69.98  ? 88   HIS A NE2   1 
ATOM   716   N N     . ASP A 1 89  ? 19.116  45.335  99.618  1.00 61.04  ? 89   ASP A N     1 
ATOM   717   C CA    . ASP A 1 89  ? 20.236  45.328  100.558 1.00 60.83  ? 89   ASP A CA    1 
ATOM   718   C C     . ASP A 1 89  ? 21.567  45.111  99.838  1.00 60.63  ? 89   ASP A C     1 
ATOM   719   O O     . ASP A 1 89  ? 22.417  46.006  99.832  1.00 62.63  ? 89   ASP A O     1 
ATOM   720   C CB    . ASP A 1 89  ? 19.984  44.240  101.633 1.00 61.44  ? 89   ASP A CB    1 
ATOM   721   C CG    . ASP A 1 89  ? 21.173  44.011  102.571 1.00 62.66  ? 89   ASP A CG    1 
ATOM   722   O OD1   . ASP A 1 89  ? 22.176  44.754  102.498 1.00 70.97  ? 89   ASP A OD1   1 
ATOM   723   O OD2   . ASP A 1 89  ? 21.098  43.064  103.396 1.00 66.07  ? 89   ASP A OD2   1 
ATOM   724   N N     . GLY A 1 90  ? 21.732  43.945  99.214  1.00 58.49  ? 90   GLY A N     1 
ATOM   725   C CA    . GLY A 1 90  ? 23.011  43.556  98.599  1.00 57.37  ? 90   GLY A CA    1 
ATOM   726   C C     . GLY A 1 90  ? 23.207  43.905  97.132  1.00 54.76  ? 90   GLY A C     1 
ATOM   727   O O     . GLY A 1 90  ? 24.153  43.417  96.513  1.00 54.88  ? 90   GLY A O     1 
ATOM   728   N N     . ILE A 1 91  ? 22.338  44.752  96.585  1.00 54.51  ? 91   ILE A N     1 
ATOM   729   C CA    . ILE A 1 91  ? 22.380  45.133  95.151  1.00 56.75  ? 91   ILE A CA    1 
ATOM   730   C C     . ILE A 1 91  ? 23.731  45.713  94.682  1.00 57.64  ? 91   ILE A C     1 
ATOM   731   O O     . ILE A 1 91  ? 24.161  46.783  95.139  1.00 57.11  ? 91   ILE A O     1 
ATOM   732   C CB    . ILE A 1 91  ? 21.238  46.124  94.791  1.00 55.70  ? 91   ILE A CB    1 
ATOM   733   C CG1   . ILE A 1 91  ? 19.981  45.351  94.402  1.00 55.22  ? 91   ILE A CG1   1 
ATOM   734   C CG2   . ILE A 1 91  ? 21.616  47.050  93.624  1.00 56.78  ? 91   ILE A CG2   1 
ATOM   735   C CD1   . ILE A 1 91  ? 18.794  46.244  94.065  1.00 56.22  ? 91   ILE A CD1   1 
ATOM   736   N N     . PRO A 1 92  ? 24.400  45.010  93.758  1.00 58.87  ? 92   PRO A N     1 
ATOM   737   C CA    . PRO A 1 92  ? 25.673  45.496  93.234  1.00 58.97  ? 92   PRO A CA    1 
ATOM   738   C C     . PRO A 1 92  ? 25.516  46.468  92.058  1.00 60.41  ? 92   PRO A C     1 
ATOM   739   O O     . PRO A 1 92  ? 24.419  46.622  91.516  1.00 61.85  ? 92   PRO A O     1 
ATOM   740   C CB    . PRO A 1 92  ? 26.364  44.213  92.784  1.00 58.13  ? 92   PRO A CB    1 
ATOM   741   C CG    . PRO A 1 92  ? 25.240  43.307  92.385  1.00 60.79  ? 92   PRO A CG    1 
ATOM   742   C CD    . PRO A 1 92  ? 24.023  43.708  93.180  1.00 58.87  ? 92   PRO A CD    1 
ATOM   743   N N     . VAL A 1 93  ? 26.620  47.110  91.674  1.00 61.17  ? 93   VAL A N     1 
ATOM   744   C CA    . VAL A 1 93  ? 26.657  47.978  90.499  1.00 61.74  ? 93   VAL A CA    1 
ATOM   745   C C     . VAL A 1 93  ? 26.638  47.096  89.255  1.00 62.82  ? 93   VAL A C     1 
ATOM   746   O O     . VAL A 1 93  ? 27.249  46.029  89.233  1.00 63.00  ? 93   VAL A O     1 
ATOM   747   C CB    . VAL A 1 93  ? 27.927  48.883  90.487  1.00 60.32  ? 93   VAL A CB    1 
ATOM   748   C CG1   . VAL A 1 93  ? 27.956  49.768  89.245  1.00 57.54  ? 93   VAL A CG1   1 
ATOM   749   C CG2   . VAL A 1 93  ? 28.002  49.728  91.752  1.00 56.79  ? 93   VAL A CG2   1 
ATOM   750   N N     . VAL A 1 94  ? 25.932  47.546  88.228  1.00 65.69  ? 94   VAL A N     1 
ATOM   751   C CA    . VAL A 1 94  ? 25.838  46.810  86.971  1.00 68.07  ? 94   VAL A CA    1 
ATOM   752   C C     . VAL A 1 94  ? 26.981  47.188  86.020  1.00 73.16  ? 94   VAL A C     1 
ATOM   753   O O     . VAL A 1 94  ? 27.927  47.881  86.399  1.00 71.52  ? 94   VAL A O     1 
ATOM   754   C CB    . VAL A 1 94  ? 24.466  47.086  86.249  1.00 69.17  ? 94   VAL A CB    1 
ATOM   755   C CG1   . VAL A 1 94  ? 23.340  46.337  86.911  1.00 68.48  ? 94   VAL A CG1   1 
ATOM   756   C CG2   . VAL A 1 94  ? 24.136  48.580  86.198  1.00 69.62  ? 94   VAL A CG2   1 
ATOM   757   N N     . GLY A 1 105 ? 13.552  53.960  79.427  1.00 67.47  ? 105  GLY A N     1 
ATOM   758   C CA    . GLY A 1 105 ? 12.672  54.583  80.432  1.00 61.79  ? 105  GLY A CA    1 
ATOM   759   C C     . GLY A 1 105 ? 12.115  53.693  81.536  1.00 54.48  ? 105  GLY A C     1 
ATOM   760   O O     . GLY A 1 105 ? 11.312  54.174  82.355  1.00 46.35  ? 105  GLY A O     1 
ATOM   761   N N     . ILE A 1 106 ? 12.542  52.414  81.555  1.00 48.71  ? 106  ILE A N     1 
ATOM   762   C CA    . ILE A 1 106 ? 12.026  51.417  82.501  1.00 46.17  ? 106  ILE A CA    1 
ATOM   763   C C     . ILE A 1 106 ? 13.006  51.107  83.655  1.00 43.33  ? 106  ILE A C     1 
ATOM   764   O O     . ILE A 1 106 ? 14.001  50.391  83.529  1.00 42.32  ? 106  ILE A O     1 
ATOM   765   C CB    . ILE A 1 106 ? 11.609  50.120  81.846  1.00 45.00  ? 106  ILE A CB    1 
ATOM   766   C CG1   . ILE A 1 106 ? 10.565  50.375  80.754  1.00 49.36  ? 106  ILE A CG1   1 
ATOM   767   C CG2   . ILE A 1 106 ? 10.971  49.204  82.895  1.00 47.36  ? 106  ILE A CG2   1 
ATOM   768   C CD1   . ILE A 1 106 ? 9.987   49.078  80.133  1.00 46.97  ? 106  ILE A CD1   1 
ATOM   769   N N     . THR A 1 107 ? 12.656  51.643  84.804  1.00 39.45  ? 107  THR A N     1 
ATOM   770   C CA    . THR A 1 107 ? 13.433  51.498  85.996  1.00 36.66  ? 107  THR A CA    1 
ATOM   771   C C     . THR A 1 107 ? 12.777  50.467  86.933  1.00 34.71  ? 107  THR A C     1 
ATOM   772   O O     . THR A 1 107 ? 11.693  49.924  86.632  1.00 33.65  ? 107  THR A O     1 
ATOM   773   C CB    . THR A 1 107 ? 13.546  52.871  86.685  1.00 35.28  ? 107  THR A CB    1 
ATOM   774   O OG1   . THR A 1 107 ? 12.232  53.378  86.963  1.00 27.91  ? 107  THR A OG1   1 
ATOM   775   C CG2   . THR A 1 107 ? 14.288  53.855  85.766  1.00 33.99  ? 107  THR A CG2   1 
ATOM   776   N N     . SER A 1 108 ? 13.451  50.190  88.048  1.00 32.93  ? 108  SER A N     1 
ATOM   777   C CA    . SER A 1 108 ? 12.897  49.370  89.138  1.00 32.23  ? 108  SER A CA    1 
ATOM   778   C C     . SER A 1 108 ? 11.629  49.992  89.704  1.00 30.66  ? 108  SER A C     1 
ATOM   779   O O     . SER A 1 108 ? 10.637  49.317  89.977  1.00 30.05  ? 108  SER A O     1 
ATOM   780   C CB    . SER A 1 108 ? 13.906  49.255  90.284  1.00 29.83  ? 108  SER A CB    1 
ATOM   781   O OG    . SER A 1 108 ? 15.041  48.527  89.860  1.00 32.78  ? 108  SER A OG    1 
ATOM   782   N N     . TYR A 1 109 ? 11.693  51.298  89.912  1.00 30.42  ? 109  TYR A N     1 
ATOM   783   C CA    . TYR A 1 109 ? 10.506  52.089  90.281  1.00 30.38  ? 109  TYR A CA    1 
ATOM   784   C C     . TYR A 1 109 ? 9.302   51.853  89.349  1.00 28.38  ? 109  TYR A C     1 
ATOM   785   O O     . TYR A 1 109 ? 8.215   51.597  89.821  1.00 30.02  ? 109  TYR A O     1 
ATOM   786   C CB    . TYR A 1 109 ? 10.879  53.588  90.355  1.00 32.60  ? 109  TYR A CB    1 
ATOM   787   C CG    . TYR A 1 109 ? 9.715   54.556  90.604  1.00 33.15  ? 109  TYR A CG    1 
ATOM   788   C CD1   . TYR A 1 109 ? 9.285   54.860  91.906  1.00 35.39  ? 109  TYR A CD1   1 
ATOM   789   C CD2   . TYR A 1 109 ? 9.061   55.172  89.533  1.00 36.44  ? 109  TYR A CD2   1 
ATOM   790   C CE1   . TYR A 1 109 ? 8.232   55.749  92.123  1.00 39.42  ? 109  TYR A CE1   1 
ATOM   791   C CE2   . TYR A 1 109 ? 8.010   56.052  89.738  1.00 32.93  ? 109  TYR A CE2   1 
ATOM   792   C CZ    . TYR A 1 109 ? 7.594   56.335  91.025  1.00 39.96  ? 109  TYR A CZ    1 
ATOM   793   O OH    . TYR A 1 109 ? 6.555   57.220  91.193  1.00 44.63  ? 109  TYR A OH    1 
ATOM   794   N N     . VAL A 1 110 ? 9.495   51.884  88.034  1.00 29.91  ? 110  VAL A N     1 
ATOM   795   C CA    . VAL A 1 110 ? 8.397   51.620  87.107  1.00 28.98  ? 110  VAL A CA    1 
ATOM   796   C C     . VAL A 1 110 ? 7.914   50.186  87.238  1.00 28.29  ? 110  VAL A C     1 
ATOM   797   O O     . VAL A 1 110 ? 6.704   49.942  87.268  1.00 25.14  ? 110  VAL A O     1 
ATOM   798   C CB    . VAL A 1 110 ? 8.794   51.894  85.622  1.00 30.03  ? 110  VAL A CB    1 
ATOM   799   C CG1   . VAL A 1 110 ? 7.683   51.456  84.689  1.00 26.39  ? 110  VAL A CG1   1 
ATOM   800   C CG2   . VAL A 1 110 ? 9.118   53.356  85.403  1.00 25.97  ? 110  VAL A CG2   1 
ATOM   801   N N     . ARG A 1 111 ? 8.848   49.238  87.288  1.00 26.84  ? 111  ARG A N     1 
ATOM   802   C CA    . ARG A 1 111 ? 8.491   47.841  87.351  1.00 30.06  ? 111  ARG A CA    1 
ATOM   803   C C     . ARG A 1 111 ? 7.626   47.533  88.603  1.00 30.49  ? 111  ARG A C     1 
ATOM   804   O O     . ARG A 1 111 ? 6.612   46.839  88.487  1.00 30.81  ? 111  ARG A O     1 
ATOM   805   C CB    . ARG A 1 111 ? 9.754   46.972  87.222  1.00 32.84  ? 111  ARG A CB    1 
ATOM   806   C CG    . ARG A 1 111 ? 10.200  46.804  85.753  1.00 34.94  ? 111  ARG A CG    1 
ATOM   807   C CD    . ARG A 1 111 ? 11.433  45.890  85.582  1.00 37.75  ? 111  ARG A CD    1 
ATOM   808   N NE    . ARG A 1 111 ? 12.653  46.643  85.845  1.00 52.07  ? 111  ARG A NE    1 
ATOM   809   C CZ    . ARG A 1 111 ? 13.609  46.904  84.954  1.00 49.07  ? 111  ARG A CZ    1 
ATOM   810   N NH1   . ARG A 1 111 ? 13.546  46.434  83.704  1.00 49.33  ? 111  ARG A NH1   1 
ATOM   811   N NH2   . ARG A 1 111 ? 14.644  47.654  85.328  1.00 49.69  ? 111  ARG A NH2   1 
ATOM   812   N N     . THR A 1 112 ? 7.995   48.077  89.755  1.00 30.61  ? 112  THR A N     1 
ATOM   813   C CA    . THR A 1 112 ? 7.239   47.887  91.009  1.00 32.70  ? 112  THR A CA    1 
ATOM   814   C C     . THR A 1 112 ? 5.879   48.605  91.044  1.00 31.92  ? 112  THR A C     1 
ATOM   815   O O     . THR A 1 112 ? 4.869   48.014  91.368  1.00 32.19  ? 112  THR A O     1 
ATOM   816   C CB    . THR A 1 112 ? 8.010   48.368  92.259  1.00 35.18  ? 112  THR A CB    1 
ATOM   817   O OG1   . THR A 1 112 ? 8.443   49.729  92.095  1.00 45.17  ? 112  THR A OG1   1 
ATOM   818   C CG2   . THR A 1 112 ? 9.185   47.541  92.449  1.00 39.14  ? 112  THR A CG2   1 
ATOM   819   N N     . VAL A 1 113 ? 5.867   49.882  90.703  1.00 32.06  ? 113  VAL A N     1 
ATOM   820   C CA    . VAL A 1 113 ? 4.613   50.621  90.572  1.00 31.09  ? 113  VAL A CA    1 
ATOM   821   C C     . VAL A 1 113 ? 3.589   49.912  89.675  1.00 31.19  ? 113  VAL A C     1 
ATOM   822   O O     . VAL A 1 113 ? 2.418   49.789  90.089  1.00 32.66  ? 113  VAL A O     1 
ATOM   823   C CB    . VAL A 1 113 ? 4.855   52.095  90.118  1.00 31.07  ? 113  VAL A CB    1 
ATOM   824   C CG1   . VAL A 1 113 ? 3.558   52.812  89.646  1.00 25.88  ? 113  VAL A CG1   1 
ATOM   825   C CG2   . VAL A 1 113 ? 5.487   52.874  91.245  1.00 30.95  ? 113  VAL A CG2   1 
ATOM   826   N N     . LEU A 1 114 ? 3.999   49.429  88.494  1.00 30.96  ? 114  LEU A N     1 
ATOM   827   C CA    . LEU A 1 114 ? 3.033   48.799  87.566  1.00 32.34  ? 114  LEU A CA    1 
ATOM   828   C C     . LEU A 1 114 ? 2.550   47.470  88.063  1.00 33.21  ? 114  LEU A C     1 
ATOM   829   O O     . LEU A 1 114 ? 1.369   47.175  87.966  1.00 30.79  ? 114  LEU A O     1 
ATOM   830   C CB    . LEU A 1 114 ? 3.596   48.648  86.162  1.00 31.51  ? 114  LEU A CB    1 
ATOM   831   C CG    . LEU A 1 114 ? 3.951   49.950  85.427  1.00 37.93  ? 114  LEU A CG    1 
ATOM   832   C CD1   . LEU A 1 114 ? 3.983   49.700  83.939  1.00 40.11  ? 114  LEU A CD1   1 
ATOM   833   C CD2   . LEU A 1 114 ? 3.042   51.125  85.774  1.00 35.91  ? 114  LEU A CD2   1 
ATOM   834   N N     . CYS A 1 115 ? 3.458   46.667  88.602  1.00 37.28  ? 115  CYS A N     1 
ATOM   835   C CA    . CYS A 1 115 ? 3.081   45.398  89.209  1.00 36.72  ? 115  CYS A CA    1 
ATOM   836   C C     . CYS A 1 115 ? 2.113   45.578  90.367  1.00 33.37  ? 115  CYS A C     1 
ATOM   837   O O     . CYS A 1 115 ? 1.086   44.938  90.395  1.00 32.22  ? 115  CYS A O     1 
ATOM   838   C CB    . CYS A 1 115 ? 4.331   44.664  89.674  1.00 38.81  ? 115  CYS A CB    1 
ATOM   839   S SG    . CYS A 1 115 ? 4.101   42.932  89.632  1.00 52.83  ? 115  CYS A SG    1 
ATOM   840   N N     . GLU A 1 116 ? 2.436   46.469  91.301  1.00 34.06  ? 116  GLU A N     1 
ATOM   841   C CA    . GLU A 1 116 ? 1.519   46.866  92.388  1.00 37.39  ? 116  GLU A CA    1 
ATOM   842   C C     . GLU A 1 116 ? 0.132   47.221  91.894  1.00 36.21  ? 116  GLU A C     1 
ATOM   843   O O     . GLU A 1 116 ? -0.856  46.841  92.521  1.00 36.20  ? 116  GLU A O     1 
ATOM   844   C CB    . GLU A 1 116 ? 2.067   48.065  93.186  1.00 38.98  ? 116  GLU A CB    1 
ATOM   845   C CG    . GLU A 1 116 ? 3.015   47.658  94.315  1.00 50.77  ? 116  GLU A CG    1 
ATOM   846   C CD    . GLU A 1 116 ? 3.667   48.837  95.070  1.00 47.55  ? 116  GLU A CD    1 
ATOM   847   O OE1   . GLU A 1 116 ? 3.903   49.928  94.473  1.00 59.07  ? 116  GLU A OE1   1 
ATOM   848   O OE2   . GLU A 1 116 ? 3.978   48.639  96.272  1.00 61.88  ? 116  GLU A OE2   1 
ATOM   849   N N     . GLY A 1 117 ? 0.050   47.940  90.768  1.00 33.65  ? 117  GLY A N     1 
ATOM   850   C CA    . GLY A 1 117 ? -1.244  48.304  90.183  1.00 30.83  ? 117  GLY A CA    1 
ATOM   851   C C     . GLY A 1 117 ? -1.938  47.227  89.355  1.00 29.02  ? 117  GLY A C     1 
ATOM   852   O O     . GLY A 1 117 ? -3.038  47.457  88.865  1.00 28.05  ? 117  GLY A O     1 
ATOM   853   N N     . GLY A 1 118 ? -1.313  46.062  89.182  1.00 27.35  ? 118  GLY A N     1 
ATOM   854   C CA    . GLY A 1 118 ? -1.887  44.984  88.374  1.00 26.84  ? 118  GLY A CA    1 
ATOM   855   C C     . GLY A 1 118 ? -1.914  45.299  86.893  1.00 28.67  ? 118  GLY A C     1 
ATOM   856   O O     . GLY A 1 118 ? -2.824  44.849  86.185  1.00 28.62  ? 118  GLY A O     1 
ATOM   857   N N     . VAL A 1 119 ? -0.941  46.083  86.416  1.00 29.20  ? 119  VAL A N     1 
ATOM   858   C CA    . VAL A 1 119 ? -0.852  46.409  84.991  1.00 27.25  ? 119  VAL A CA    1 
ATOM   859   C C     . VAL A 1 119 ? -0.254  45.214  84.269  1.00 26.99  ? 119  VAL A C     1 
ATOM   860   O O     . VAL A 1 119 ? 0.794   44.697  84.699  1.00 26.36  ? 119  VAL A O     1 
ATOM   861   C CB    . VAL A 1 119 ? 0.021   47.651  84.680  1.00 25.01  ? 119  VAL A CB    1 
ATOM   862   C CG1   . VAL A 1 119 ? 0.075   47.892  83.142  1.00 27.54  ? 119  VAL A CG1   1 
ATOM   863   C CG2   . VAL A 1 119 ? -0.518  48.899  85.355  1.00 26.38  ? 119  VAL A CG2   1 
ATOM   864   N N     . PRO A 1 120 ? -0.897  44.768  83.164  1.00 26.61  ? 120  PRO A N     1 
ATOM   865   C CA    . PRO A 1 120 ? -0.417  43.590  82.442  1.00 28.54  ? 120  PRO A CA    1 
ATOM   866   C C     . PRO A 1 120 ? 1.020   43.745  82.032  1.00 27.90  ? 120  PRO A C     1 
ATOM   867   O O     . PRO A 1 120 ? 1.406   44.829  81.589  1.00 25.97  ? 120  PRO A O     1 
ATOM   868   C CB    . PRO A 1 120 ? -1.310  43.558  81.196  1.00 29.16  ? 120  PRO A CB    1 
ATOM   869   C CG    . PRO A 1 120 ? -2.590  44.194  81.675  1.00 29.30  ? 120  PRO A CG    1 
ATOM   870   C CD    . PRO A 1 120 ? -2.133  45.303  82.593  1.00 22.04  ? 120  PRO A CD    1 
ATOM   871   N N     . GLN A 1 121 ? 1.807   42.684  82.178  1.00 29.52  ? 121  GLN A N     1 
ATOM   872   C CA    . GLN A 1 121 ? 3.137   42.635  81.572  1.00 31.66  ? 121  GLN A CA    1 
ATOM   873   C C     . GLN A 1 121 ? 3.067   42.786  80.028  1.00 32.28  ? 121  GLN A C     1 
ATOM   874   O O     . GLN A 1 121 ? 2.012   42.562  79.413  1.00 29.51  ? 121  GLN A O     1 
ATOM   875   C CB    . GLN A 1 121 ? 3.817   41.323  81.983  1.00 33.71  ? 121  GLN A CB    1 
ATOM   876   C CG    . GLN A 1 121 ? 4.410   41.313  83.451  1.00 35.61  ? 121  GLN A CG    1 
ATOM   877   C CD    . GLN A 1 121 ? 3.531   40.658  84.592  1.00 46.38  ? 121  GLN A CD    1 
ATOM   878   O OE1   . GLN A 1 121 ? 2.346   40.237  84.415  1.00 38.84  ? 121  GLN A OE1   1 
ATOM   879   N NE2   . GLN A 1 121 ? 4.151   40.572  85.791  1.00 40.62  ? 121  GLN A NE2   1 
ATOM   880   N N     . ARG A 1 122 ? 4.176   43.209  79.402  1.00 34.20  ? 122  ARG A N     1 
ATOM   881   C CA    . ARG A 1 122 ? 4.262   43.231  77.939  1.00 33.85  ? 122  ARG A CA    1 
ATOM   882   C C     . ARG A 1 122 ? 3.927   41.876  77.312  1.00 37.23  ? 122  ARG A C     1 
ATOM   883   O O     . ARG A 1 122 ? 4.173   40.828  77.921  1.00 39.15  ? 122  ARG A O     1 
ATOM   884   C CB    . ARG A 1 122 ? 5.649   43.624  77.488  1.00 35.53  ? 122  ARG A CB    1 
ATOM   885   C CG    . ARG A 1 122 ? 5.893   45.080  77.483  1.00 27.59  ? 122  ARG A CG    1 
ATOM   886   C CD    . ARG A 1 122 ? 7.238   45.347  76.999  1.00 31.61  ? 122  ARG A CD    1 
ATOM   887   N NE    . ARG A 1 122 ? 7.472   46.787  76.877  1.00 31.02  ? 122  ARG A NE    1 
ATOM   888   C CZ    . ARG A 1 122 ? 8.624   47.310  76.491  1.00 35.51  ? 122  ARG A CZ    1 
ATOM   889   N NH1   . ARG A 1 122 ? 9.674   46.527  76.223  1.00 38.81  ? 122  ARG A NH1   1 
ATOM   890   N NH2   . ARG A 1 122 ? 8.741   48.620  76.397  1.00 30.15  ? 122  ARG A NH2   1 
ATOM   891   N N     . PRO A 1 123 ? 3.351   41.887  76.088  1.00 38.31  ? 123  PRO A N     1 
ATOM   892   C CA    . PRO A 1 123 ? 3.134   40.632  75.377  1.00 37.15  ? 123  PRO A CA    1 
ATOM   893   C C     . PRO A 1 123 ? 4.443   39.856  75.166  1.00 38.12  ? 123  PRO A C     1 
ATOM   894   O O     . PRO A 1 123 ? 5.546   40.443  75.221  1.00 32.53  ? 123  PRO A O     1 
ATOM   895   C CB    . PRO A 1 123 ? 2.529   41.078  74.029  1.00 39.32  ? 123  PRO A CB    1 
ATOM   896   C CG    . PRO A 1 123 ? 2.495   42.563  74.025  1.00 35.84  ? 123  PRO A CG    1 
ATOM   897   C CD    . PRO A 1 123 ? 2.883   43.073  75.339  1.00 38.23  ? 123  PRO A CD    1 
ATOM   898   N N     . VAL A 1 124 ? 4.302   38.547  74.920  1.00 40.34  ? 124  VAL A N     1 
ATOM   899   C CA    . VAL A 1 124 ? 5.464   37.650  74.725  1.00 40.22  ? 124  VAL A CA    1 
ATOM   900   C C     . VAL A 1 124 ? 6.473   38.264  73.738  1.00 40.49  ? 124  VAL A C     1 
ATOM   901   O O     . VAL A 1 124 ? 7.666   38.285  74.011  1.00 44.36  ? 124  VAL A O     1 
ATOM   902   C CB    . VAL A 1 124 ? 5.063   36.144  74.367  1.00 41.76  ? 124  VAL A CB    1 
ATOM   903   C CG1   . VAL A 1 124 ? 4.256   35.516  75.494  1.00 43.39  ? 124  VAL A CG1   1 
ATOM   904   C CG2   . VAL A 1 124 ? 4.301   36.014  73.052  1.00 43.88  ? 124  VAL A CG2   1 
ATOM   905   N N     . VAL A 1 125 ? 5.979   38.787  72.619  1.00 37.27  ? 125  VAL A N     1 
ATOM   906   C CA    . VAL A 1 125 ? 6.777   39.541  71.651  1.00 32.90  ? 125  VAL A CA    1 
ATOM   907   C C     . VAL A 1 125 ? 6.123   40.916  71.565  1.00 31.93  ? 125  VAL A C     1 
ATOM   908   O O     . VAL A 1 125 ? 4.899   41.012  71.509  1.00 31.50  ? 125  VAL A O     1 
ATOM   909   C CB    . VAL A 1 125 ? 6.766   38.846  70.265  1.00 30.85  ? 125  VAL A CB    1 
ATOM   910   C CG1   . VAL A 1 125 ? 7.208   39.781  69.163  1.00 31.64  ? 125  VAL A CG1   1 
ATOM   911   C CG2   . VAL A 1 125 ? 7.612   37.602  70.287  1.00 28.77  ? 125  VAL A CG2   1 
ATOM   912   N N     . PHE A 1 126 ? 6.942   41.967  71.535  1.00 31.47  ? 126  PHE A N     1 
ATOM   913   C CA    . PHE A 1 126 ? 6.462   43.332  71.662  1.00 29.43  ? 126  PHE A CA    1 
ATOM   914   C C     . PHE A 1 126 ? 7.201   44.245  70.704  1.00 28.22  ? 126  PHE A C     1 
ATOM   915   O O     . PHE A 1 126 ? 8.396   44.268  70.704  1.00 28.18  ? 126  PHE A O     1 
ATOM   916   C CB    . PHE A 1 126 ? 6.678   43.858  73.107  1.00 30.70  ? 126  PHE A CB    1 
ATOM   917   C CG    . PHE A 1 126 ? 6.385   45.335  73.248  1.00 30.32  ? 126  PHE A CG    1 
ATOM   918   C CD1   . PHE A 1 126 ? 5.091   45.789  73.318  1.00 28.59  ? 126  PHE A CD1   1 
ATOM   919   C CD2   . PHE A 1 126 ? 7.410   46.261  73.238  1.00 28.27  ? 126  PHE A CD2   1 
ATOM   920   C CE1   . PHE A 1 126 ? 4.812   47.153  73.394  1.00 30.60  ? 126  PHE A CE1   1 
ATOM   921   C CE2   . PHE A 1 126 ? 7.149   47.600  73.311  1.00 26.85  ? 126  PHE A CE2   1 
ATOM   922   C CZ    . PHE A 1 126 ? 5.847   48.053  73.397  1.00 29.54  ? 126  PHE A CZ    1 
ATOM   923   N N     . VAL A 1 127 ? 6.466   45.032  69.917  1.00 28.64  ? 127  VAL A N     1 
ATOM   924   C CA    . VAL A 1 127 ? 7.068   46.061  69.101  1.00 27.20  ? 127  VAL A CA    1 
ATOM   925   C C     . VAL A 1 127 ? 6.627   47.453  69.556  1.00 26.80  ? 127  VAL A C     1 
ATOM   926   O O     . VAL A 1 127 ? 5.496   47.655  69.938  1.00 28.34  ? 127  VAL A O     1 
ATOM   927   C CB    . VAL A 1 127 ? 6.777   45.814  67.559  1.00 27.04  ? 127  VAL A CB    1 
ATOM   928   C CG1   . VAL A 1 127 ? 7.273   44.440  67.169  1.00 26.46  ? 127  VAL A CG1   1 
ATOM   929   C CG2   . VAL A 1 127 ? 5.300   45.951  67.227  1.00 24.77  ? 127  VAL A CG2   1 
ATOM   930   N N     . THR A 1 128 ? 7.515   48.433  69.465  1.00 29.06  ? 128  THR A N     1 
ATOM   931   C CA    . THR A 1 128 ? 7.191   49.781  69.871  1.00 27.81  ? 128  THR A CA    1 
ATOM   932   C C     . THR A 1 128 ? 6.191   50.420  68.910  1.00 29.32  ? 128  THR A C     1 
ATOM   933   O O     . THR A 1 128 ? 6.147   50.086  67.717  1.00 31.66  ? 128  THR A O     1 
ATOM   934   C CB    . THR A 1 128 ? 8.422   50.686  69.936  1.00 29.98  ? 128  THR A CB    1 
ATOM   935   O OG1   . THR A 1 128 ? 8.982   50.853  68.621  1.00 29.03  ? 128  THR A OG1   1 
ATOM   936   C CG2   . THR A 1 128 ? 9.448   50.155  70.884  1.00 26.95  ? 128  THR A CG2   1 
ATOM   937   N N     . ARG A 1 129 ? 5.407   51.354  69.438  1.00 28.26  ? 129  ARG A N     1 
ATOM   938   C CA    . ARG A 1 129 ? 4.423   52.092  68.682  1.00 29.80  ? 129  ARG A CA    1 
ATOM   939   C C     . ARG A 1 129 ? 4.537   53.498  69.215  1.00 31.12  ? 129  ARG A C     1 
ATOM   940   O O     . ARG A 1 129 ? 3.641   54.012  69.870  1.00 28.62  ? 129  ARG A O     1 
ATOM   941   C CB    . ARG A 1 129 ? 3.014   51.489  68.891  1.00 29.13  ? 129  ARG A CB    1 
ATOM   942   C CG    . ARG A 1 129 ? 2.927   50.058  68.335  1.00 26.50  ? 129  ARG A CG    1 
ATOM   943   C CD    . ARG A 1 129 ? 1.586   49.488  68.447  1.00 28.54  ? 129  ARG A CD    1 
ATOM   944   N NE    . ARG A 1 129 ? 0.711   50.094  67.453  1.00 30.52  ? 129  ARG A NE    1 
ATOM   945   C CZ    . ARG A 1 129 ? -0.593  49.868  67.346  1.00 29.47  ? 129  ARG A CZ    1 
ATOM   946   N NH1   . ARG A 1 129 ? -1.183  49.015  68.171  1.00 23.29  ? 129  ARG A NH1   1 
ATOM   947   N NH2   . ARG A 1 129 ? -1.298  50.489  66.369  1.00 32.58  ? 129  ARG A NH2   1 
ATOM   948   N N     . LYS A 1 130 ? 5.680   54.104  68.911  1.00 35.92  ? 130  LYS A N     1 
ATOM   949   C CA    . LYS A 1 130 ? 6.149   55.312  69.588  1.00 36.36  ? 130  LYS A CA    1 
ATOM   950   C C     . LYS A 1 130 ? 5.214   56.498  69.449  1.00 35.23  ? 130  LYS A C     1 
ATOM   951   O O     . LYS A 1 130 ? 4.954   57.199  70.421  1.00 37.21  ? 130  LYS A O     1 
ATOM   952   C CB    . LYS A 1 130 ? 7.504   55.727  69.043  1.00 37.90  ? 130  LYS A CB    1 
ATOM   953   C CG    . LYS A 1 130 ? 8.311   56.554  70.045  1.00 43.18  ? 130  LYS A CG    1 
ATOM   954   C CD    . LYS A 1 130 ? 9.397   57.377  69.364  1.00 45.11  ? 130  LYS A CD    1 
ATOM   955   C CE    . LYS A 1 130 ? 10.724  57.231  70.083  1.00 55.65  ? 130  LYS A CE    1 
ATOM   956   N NZ    . LYS A 1 130 ? 11.685  58.275  69.641  1.00 57.41  ? 130  LYS A NZ    1 
ATOM   957   N N     . LYS A 1 131 ? 4.715   56.729  68.246  1.00 34.83  ? 131  LYS A N     1 
ATOM   958   C CA    . LYS A 1 131 ? 3.857   57.876  67.991  1.00 34.28  ? 131  LYS A CA    1 
ATOM   959   C C     . LYS A 1 131 ? 2.542   57.784  68.767  1.00 32.74  ? 131  LYS A C     1 
ATOM   960   O O     . LYS A 1 131 ? 2.088   58.784  69.319  1.00 31.81  ? 131  LYS A O     1 
ATOM   961   C CB    . LYS A 1 131 ? 3.583   58.029  66.495  1.00 34.16  ? 131  LYS A CB    1 
ATOM   962   C CG    . LYS A 1 131 ? 2.770   59.257  66.158  1.00 37.10  ? 131  LYS A CG    1 
ATOM   963   C CD    . LYS A 1 131 ? 2.547   59.397  64.655  1.00 39.55  ? 131  LYS A CD    1 
ATOM   964   C CE    . LYS A 1 131 ? 1.575   60.529  64.355  1.00 46.38  ? 131  LYS A CE    1 
ATOM   965   N NZ    . LYS A 1 131 ? 1.035   60.447  62.956  1.00 49.17  ? 131  LYS A NZ    1 
ATOM   966   N N     . LEU A 1 132 ? 1.941   56.596  68.816  1.00 31.94  ? 132  LEU A N     1 
ATOM   967   C CA    . LEU A 1 132 ? 0.743   56.391  69.656  1.00 31.31  ? 132  LEU A CA    1 
ATOM   968   C C     . LEU A 1 132 ? 1.078   56.488  71.164  1.00 30.10  ? 132  LEU A C     1 
ATOM   969   O O     . LEU A 1 132 ? 0.362   57.162  71.906  1.00 29.15  ? 132  LEU A O     1 
ATOM   970   C CB    . LEU A 1 132 ? 0.066   55.066  69.339  1.00 28.99  ? 132  LEU A CB    1 
ATOM   971   C CG    . LEU A 1 132 ? -0.713  55.105  68.041  1.00 27.85  ? 132  LEU A CG    1 
ATOM   972   C CD1   . LEU A 1 132 ? -0.949  53.710  67.530  1.00 26.81  ? 132  LEU A CD1   1 
ATOM   973   C CD2   . LEU A 1 132 ? -2.038  55.832  68.233  1.00 26.64  ? 132  LEU A CD2   1 
ATOM   974   N N     . VAL A 1 133 ? 2.133   55.820  71.612  1.00 29.20  ? 133  VAL A N     1 
ATOM   975   C CA    . VAL A 1 133 ? 2.489   55.850  73.035  1.00 29.79  ? 133  VAL A CA    1 
ATOM   976   C C     . VAL A 1 133 ? 2.760   57.278  73.495  1.00 29.10  ? 133  VAL A C     1 
ATOM   977   O O     . VAL A 1 133 ? 2.192   57.708  74.481  1.00 28.09  ? 133  VAL A O     1 
ATOM   978   C CB    . VAL A 1 133 ? 3.638   54.871  73.390  1.00 31.16  ? 133  VAL A CB    1 
ATOM   979   C CG1   . VAL A 1 133 ? 4.136   55.069  74.814  1.00 30.84  ? 133  VAL A CG1   1 
ATOM   980   C CG2   . VAL A 1 133 ? 3.154   53.425  73.244  1.00 32.51  ? 133  VAL A CG2   1 
ATOM   981   N N     . ASN A 1 134 ? 3.545   58.035  72.729  1.00 28.77  ? 134  ASN A N     1 
ATOM   982   C CA    . ASN A 1 134 ? 3.776   59.463  73.009  1.00 29.33  ? 134  ASN A CA    1 
ATOM   983   C C     . ASN A 1 134 ? 2.520   60.339  72.997  1.00 28.39  ? 134  ASN A C     1 
ATOM   984   O O     . ASN A 1 134 ? 2.423   61.278  73.791  1.00 28.20  ? 134  ASN A O     1 
ATOM   985   C CB    . ASN A 1 134 ? 4.822   60.100  72.036  1.00 29.44  ? 134  ASN A CB    1 
ATOM   986   C CG    . ASN A 1 134 ? 6.243   59.597  72.271  1.00 36.30  ? 134  ASN A CG    1 
ATOM   987   O OD1   . ASN A 1 134 ? 7.146   59.872  71.469  1.00 48.03  ? 134  ASN A OD1   1 
ATOM   988   N ND2   . ASN A 1 134 ? 6.453   58.858  73.359  1.00 37.62  ? 134  ASN A ND2   1 
ATOM   989   N N     . ALA A 1 135 ? 1.582   60.088  72.086  1.00 26.03  ? 135  ALA A N     1 
ATOM   990   C CA    . ALA A 1 135 ? 0.320   60.827  72.110  1.00 27.27  ? 135  ALA A CA    1 
ATOM   991   C C     . ALA A 1 135 ? -0.548  60.568  73.369  1.00 27.43  ? 135  ALA A C     1 
ATOM   992   O O     . ALA A 1 135 ? -1.196  61.489  73.895  1.00 24.78  ? 135  ALA A O     1 
ATOM   993   C CB    . ALA A 1 135 ? -0.496  60.554  70.857  1.00 30.61  ? 135  ALA A CB    1 
ATOM   994   N N     . ILE A 1 136 ? -0.531  59.334  73.862  1.00 26.40  ? 136  ILE A N     1 
ATOM   995   C CA    . ILE A 1 136 ? -1.233  59.005  75.110  1.00 26.82  ? 136  ILE A CA    1 
ATOM   996   C C     . ILE A 1 136 ? -0.558  59.719  76.291  1.00 26.26  ? 136  ILE A C     1 
ATOM   997   O O     . ILE A 1 136 ? -1.215  60.361  77.109  1.00 24.63  ? 136  ILE A O     1 
ATOM   998   C CB    . ILE A 1 136 ? -1.277  57.507  75.366  1.00 27.11  ? 136  ILE A CB    1 
ATOM   999   C CG1   . ILE A 1 136 ? -2.060  56.812  74.252  1.00 24.32  ? 136  ILE A CG1   1 
ATOM   1000  C CG2   . ILE A 1 136 ? -1.879  57.209  76.758  1.00 25.49  ? 136  ILE A CG2   1 
ATOM   1001  C CD1   . ILE A 1 136 ? -1.748  55.362  74.115  1.00 26.82  ? 136  ILE A CD1   1 
ATOM   1002  N N     . GLN A 1 137 ? 0.764   59.640  76.321  1.00 28.13  ? 137  GLN A N     1 
ATOM   1003  C CA    . GLN A 1 137 ? 1.565   60.235  77.399  1.00 29.84  ? 137  GLN A CA    1 
ATOM   1004  C C     . GLN A 1 137 ? 1.393   61.751  77.458  1.00 28.84  ? 137  GLN A C     1 
ATOM   1005  O O     . GLN A 1 137 ? 1.297   62.332  78.547  1.00 28.88  ? 137  GLN A O     1 
ATOM   1006  C CB    . GLN A 1 137 ? 3.045   59.882  77.246  1.00 28.12  ? 137  GLN A CB    1 
ATOM   1007  C CG    . GLN A 1 137 ? 3.298   58.447  77.569  1.00 29.87  ? 137  GLN A CG    1 
ATOM   1008  C CD    . GLN A 1 137 ? 4.705   58.024  77.289  1.00 30.65  ? 137  GLN A CD    1 
ATOM   1009  O OE1   . GLN A 1 137 ? 5.377   58.621  76.465  1.00 32.27  ? 137  GLN A OE1   1 
ATOM   1010  N NE2   . GLN A 1 137 ? 5.144   56.969  77.941  1.00 23.92  ? 137  GLN A NE2   1 
ATOM   1011  N N     . GLN A 1 138 ? 1.339   62.363  76.284  1.00 29.13  ? 138  GLN A N     1 
ATOM   1012  C CA    . GLN A 1 138 ? 1.076   63.782  76.140  1.00 30.81  ? 138  GLN A CA    1 
ATOM   1013  C C     . GLN A 1 138 ? -0.292  64.196  76.698  1.00 28.96  ? 138  GLN A C     1 
ATOM   1014  O O     . GLN A 1 138 ? -0.380  65.195  77.426  1.00 29.26  ? 138  GLN A O     1 
ATOM   1015  C CB    . GLN A 1 138 ? 1.181   64.169  74.664  1.00 31.40  ? 138  GLN A CB    1 
ATOM   1016  C CG    . GLN A 1 138 ? 1.096   65.674  74.369  1.00 38.19  ? 138  GLN A CG    1 
ATOM   1017  C CD    . GLN A 1 138 ? -0.002  66.077  73.343  1.00 46.12  ? 138  GLN A CD    1 
ATOM   1018  O OE1   . GLN A 1 138 ? -0.303  67.272  73.190  1.00 63.56  ? 138  GLN A OE1   1 
ATOM   1019  N NE2   . GLN A 1 138 ? -0.593  65.090  72.649  1.00 57.80  ? 138  GLN A NE2   1 
ATOM   1020  N N     . LYS A 1 139 ? -1.346  63.445  76.381  1.00 28.04  ? 139  LYS A N     1 
ATOM   1021  C CA    . LYS A 1 139 ? -2.694  63.682  76.975  1.00 27.23  ? 139  LYS A CA    1 
ATOM   1022  C C     . LYS A 1 139 ? -2.695  63.464  78.499  1.00 26.21  ? 139  LYS A C     1 
ATOM   1023  O O     . LYS A 1 139 ? -3.266  64.258  79.248  1.00 26.51  ? 139  LYS A O     1 
ATOM   1024  C CB    . LYS A 1 139 ? -3.779  62.768  76.344  1.00 27.30  ? 139  LYS A CB    1 
ATOM   1025  C CG    . LYS A 1 139 ? -3.899  62.770  74.817  1.00 27.50  ? 139  LYS A CG    1 
ATOM   1026  C CD    . LYS A 1 139 ? -3.982  64.161  74.315  1.00 27.66  ? 139  LYS A CD    1 
ATOM   1027  C CE    . LYS A 1 139 ? -4.282  64.264  72.846  1.00 35.19  ? 139  LYS A CE    1 
ATOM   1028  N NZ    . LYS A 1 139 ? -4.423  65.742  72.538  1.00 33.12  ? 139  LYS A NZ    1 
ATOM   1029  N N     . LEU A 1 140 ? -2.076  62.379  78.957  1.00 25.85  ? 140  LEU A N     1 
ATOM   1030  C CA    . LEU A 1 140 ? -1.985  62.121  80.415  1.00 27.09  ? 140  LEU A CA    1 
ATOM   1031  C C     . LEU A 1 140 ? -1.288  63.269  81.140  1.00 28.62  ? 140  LEU A C     1 
ATOM   1032  O O     . LEU A 1 140 ? -1.648  63.605  82.256  1.00 31.23  ? 140  LEU A O     1 
ATOM   1033  C CB    . LEU A 1 140 ? -1.244  60.817  80.701  1.00 25.67  ? 140  LEU A CB    1 
ATOM   1034  C CG    . LEU A 1 140 ? -1.943  59.517  80.297  1.00 27.68  ? 140  LEU A CG    1 
ATOM   1035  C CD1   . LEU A 1 140 ? -1.025  58.358  80.536  1.00 27.79  ? 140  LEU A CD1   1 
ATOM   1036  C CD2   . LEU A 1 140 ? -3.220  59.342  81.080  1.00 31.53  ? 140  LEU A CD2   1 
ATOM   1037  N N     . SER A 1 141 ? -0.285  63.862  80.494  1.00 28.20  ? 141  SER A N     1 
ATOM   1038  C CA    . SER A 1 141 ? 0.459   64.974  81.063  1.00 30.33  ? 141  SER A CA    1 
ATOM   1039  C C     . SER A 1 141 ? -0.359  66.278  81.063  1.00 30.30  ? 141  SER A C     1 
ATOM   1040  O O     . SER A 1 141 ? -0.010  67.241  81.701  1.00 31.69  ? 141  SER A O     1 
ATOM   1041  C CB    . SER A 1 141 ? 1.755   65.192  80.296  1.00 29.63  ? 141  SER A CB    1 
ATOM   1042  O OG    . SER A 1 141 ? 1.494   66.022  79.172  1.00 40.48  ? 141  SER A OG    1 
ATOM   1043  N N     . LYS A 1 142 ? -1.476  66.315  80.379  1.00 32.78  ? 142  LYS A N     1 
ATOM   1044  C CA    . LYS A 1 142 ? -2.356  67.486  80.473  1.00 33.21  ? 142  LYS A CA    1 
ATOM   1045  C C     . LYS A 1 142 ? -3.345  67.438  81.660  1.00 33.77  ? 142  LYS A C     1 
ATOM   1046  O O     . LYS A 1 142 ? -4.015  68.425  81.944  1.00 33.23  ? 142  LYS A O     1 
ATOM   1047  C CB    . LYS A 1 142 ? -3.097  67.690  79.156  1.00 34.24  ? 142  LYS A CB    1 
ATOM   1048  C CG    . LYS A 1 142 ? -2.214  68.311  78.103  1.00 36.18  ? 142  LYS A CG    1 
ATOM   1049  C CD    . LYS A 1 142 ? -2.758  68.106  76.738  1.00 38.48  ? 142  LYS A CD    1 
ATOM   1050  C CE    . LYS A 1 142 ? -1.816  68.700  75.691  1.00 46.31  ? 142  LYS A CE    1 
ATOM   1051  N NZ    . LYS A 1 142 ? -2.382  68.513  74.311  1.00 51.65  ? 142  LYS A NZ    1 
ATOM   1052  N N     . LEU A 1 143 ? -3.426  66.311  82.360  1.00 34.42  ? 143  LEU A N     1 
ATOM   1053  C CA    . LEU A 1 143 ? -4.328  66.202  83.488  1.00 34.68  ? 143  LEU A CA    1 
ATOM   1054  C C     . LEU A 1 143 ? -3.858  67.084  84.647  1.00 35.21  ? 143  LEU A C     1 
ATOM   1055  O O     . LEU A 1 143 ? -4.686  67.638  85.371  1.00 33.75  ? 143  LEU A O     1 
ATOM   1056  C CB    . LEU A 1 143 ? -4.530  64.741  83.908  1.00 34.33  ? 143  LEU A CB    1 
ATOM   1057  C CG    . LEU A 1 143 ? -5.242  63.818  82.877  1.00 31.19  ? 143  LEU A CG    1 
ATOM   1058  C CD1   . LEU A 1 143 ? -5.072  62.329  83.206  1.00 36.80  ? 143  LEU A CD1   1 
ATOM   1059  C CD2   . LEU A 1 143 ? -6.703  64.119  82.722  1.00 33.30  ? 143  LEU A CD2   1 
ATOM   1060  N N     . LYS A 1 144 ? -2.541  67.223  84.800  1.00 36.06  ? 144  LYS A N     1 
ATOM   1061  C CA    . LYS A 1 144 ? -1.921  68.129  85.784  1.00 37.54  ? 144  LYS A CA    1 
ATOM   1062  C C     . LYS A 1 144 ? -2.465  67.979  87.205  1.00 35.81  ? 144  LYS A C     1 
ATOM   1063  O O     . LYS A 1 144 ? -2.750  68.974  87.854  1.00 34.96  ? 144  LYS A O     1 
ATOM   1064  C CB    . LYS A 1 144 ? -2.060  69.604  85.341  1.00 40.34  ? 144  LYS A CB    1 
ATOM   1065  C CG    . LYS A 1 144 ? -1.538  69.937  83.942  1.00 46.99  ? 144  LYS A CG    1 
ATOM   1066  C CD    . LYS A 1 144 ? -0.293  70.835  83.949  1.00 53.94  ? 144  LYS A CD    1 
ATOM   1067  C CE    . LYS A 1 144 ? 0.989   70.062  84.298  1.00 60.62  ? 144  LYS A CE    1 
ATOM   1068  N NZ    . LYS A 1 144 ? 2.253   70.672  83.718  1.00 59.89  ? 144  LYS A NZ    1 
ATOM   1069  N N     . GLY A 1 145 ? -2.590  66.743  87.689  1.00 35.10  ? 145  GLY A N     1 
ATOM   1070  C CA    . GLY A 1 145 ? -3.022  66.503  89.062  1.00 35.33  ? 145  GLY A CA    1 
ATOM   1071  C C     . GLY A 1 145 ? -4.495  66.786  89.331  1.00 36.83  ? 145  GLY A C     1 
ATOM   1072  O O     . GLY A 1 145 ? -4.925  66.730  90.496  1.00 37.07  ? 145  GLY A O     1 
ATOM   1073  N N     . GLU A 1 146 ? -5.263  67.076  88.269  1.00 34.15  ? 146  GLU A N     1 
ATOM   1074  C CA    . GLU A 1 146 ? -6.688  67.378  88.377  1.00 34.00  ? 146  GLU A CA    1 
ATOM   1075  C C     . GLU A 1 146 ? -7.463  66.279  87.670  1.00 33.48  ? 146  GLU A C     1 
ATOM   1076  O O     . GLU A 1 146 ? -6.929  65.678  86.745  1.00 34.67  ? 146  GLU A O     1 
ATOM   1077  C CB    . GLU A 1 146 ? -7.026  68.714  87.698  1.00 34.58  ? 146  GLU A CB    1 
ATOM   1078  C CG    . GLU A 1 146 ? -6.526  69.947  88.429  1.00 41.36  ? 146  GLU A CG    1 
ATOM   1079  C CD    . GLU A 1 146 ? -7.239  70.145  89.767  1.00 51.87  ? 146  GLU A CD    1 
ATOM   1080  O OE1   . GLU A 1 146 ? -8.415  70.591  89.761  1.00 58.95  ? 146  GLU A OE1   1 
ATOM   1081  O OE2   . GLU A 1 146 ? -6.632  69.844  90.825  1.00 56.19  ? 146  GLU A OE2   1 
ATOM   1082  N N     . PRO A 1 147 ? -8.729  66.039  88.075  1.00 31.91  ? 147  PRO A N     1 
ATOM   1083  C CA    . PRO A 1 147 ? -9.556  65.034  87.440  1.00 31.58  ? 147  PRO A CA    1 
ATOM   1084  C C     . PRO A 1 147 ? -9.740  65.227  85.924  1.00 31.19  ? 147  PRO A C     1 
ATOM   1085  O O     . PRO A 1 147 ? -9.707  66.338  85.399  1.00 31.39  ? 147  PRO A O     1 
ATOM   1086  C CB    . PRO A 1 147 ? -10.908 65.189  88.140  1.00 31.53  ? 147  PRO A CB    1 
ATOM   1087  C CG    . PRO A 1 147 ? -10.622 65.859  89.400  1.00 32.31  ? 147  PRO A CG    1 
ATOM   1088  C CD    . PRO A 1 147 ? -9.457  66.734  89.150  1.00 31.43  ? 147  PRO A CD    1 
ATOM   1089  N N     . GLY A 1 148 ? -9.944  64.126  85.230  1.00 30.66  ? 148  GLY A N     1 
ATOM   1090  C CA    . GLY A 1 148 ? -10.093 64.166  83.791  1.00 29.37  ? 148  GLY A CA    1 
ATOM   1091  C C     . GLY A 1 148 ? -10.033 62.789  83.211  1.00 27.72  ? 148  GLY A C     1 
ATOM   1092  O O     . GLY A 1 148 ? -9.724  61.827  83.897  1.00 27.17  ? 148  GLY A O     1 
ATOM   1093  N N     . TRP A 1 149 ? -10.326 62.726  81.927  1.00 27.34  ? 149  TRP A N     1 
ATOM   1094  C CA    . TRP A 1 149 ? -10.470 61.476  81.198  1.00 28.43  ? 149  TRP A CA    1 
ATOM   1095  C C     . TRP A 1 149 ? -9.585  61.489  79.976  1.00 27.88  ? 149  TRP A C     1 
ATOM   1096  O O     . TRP A 1 149 ? -9.573  62.468  79.230  1.00 29.05  ? 149  TRP A O     1 
ATOM   1097  C CB    . TRP A 1 149 ? -11.909 61.270  80.750  1.00 28.25  ? 149  TRP A CB    1 
ATOM   1098  C CG    . TRP A 1 149 ? -12.944 61.485  81.794  1.00 25.61  ? 149  TRP A CG    1 
ATOM   1099  C CD1   . TRP A 1 149 ? -13.531 62.676  82.149  1.00 25.68  ? 149  TRP A CD1   1 
ATOM   1100  C CD2   . TRP A 1 149 ? -13.534 60.482  82.627  1.00 26.11  ? 149  TRP A CD2   1 
ATOM   1101  N NE1   . TRP A 1 149 ? -14.417 62.475  83.183  1.00 24.42  ? 149  TRP A NE1   1 
ATOM   1102  C CE2   . TRP A 1 149 ? -14.445 61.135  83.485  1.00 31.33  ? 149  TRP A CE2   1 
ATOM   1103  C CE3   . TRP A 1 149 ? -13.367 59.096  82.745  1.00 28.67  ? 149  TRP A CE3   1 
ATOM   1104  C CZ2   . TRP A 1 149 ? -15.221 60.436  84.409  1.00 28.99  ? 149  TRP A CZ2   1 
ATOM   1105  C CZ3   . TRP A 1 149 ? -14.128 58.406  83.657  1.00 27.23  ? 149  TRP A CZ3   1 
ATOM   1106  C CH2   . TRP A 1 149 ? -15.046 59.072  84.479  1.00 26.40  ? 149  TRP A CH2   1 
ATOM   1107  N N     . VAL A 1 150 ? -8.828  60.413  79.784  1.00 26.77  ? 150  VAL A N     1 
ATOM   1108  C CA    . VAL A 1 150 ? -8.083  60.216  78.542  1.00 27.66  ? 150  VAL A CA    1 
ATOM   1109  C C     . VAL A 1 150 ? -8.616  58.912  77.947  1.00 26.24  ? 150  VAL A C     1 
ATOM   1110  O O     . VAL A 1 150 ? -8.641  57.888  78.601  1.00 26.29  ? 150  VAL A O     1 
ATOM   1111  C CB    . VAL A 1 150 ? -6.561  60.203  78.750  1.00 25.04  ? 150  VAL A CB    1 
ATOM   1112  C CG1   . VAL A 1 150 ? -5.851  59.979  77.418  1.00 23.89  ? 150  VAL A CG1   1 
ATOM   1113  C CG2   . VAL A 1 150 ? -6.087  61.521  79.389  1.00 23.79  ? 150  VAL A CG2   1 
ATOM   1114  N N     . THR A 1 151 ? -9.112  58.988  76.723  1.00 28.01  ? 151  THR A N     1 
ATOM   1115  C CA    . THR A 1 151 ? -9.733  57.833  76.088  1.00 29.60  ? 151  THR A CA    1 
ATOM   1116  C C     . THR A 1 151 ? -8.924  57.349  74.875  1.00 30.14  ? 151  THR A C     1 
ATOM   1117  O O     . THR A 1 151 ? -8.688  58.104  73.938  1.00 28.18  ? 151  THR A O     1 
ATOM   1118  C CB    . THR A 1 151 ? -11.193 58.147  75.662  1.00 29.98  ? 151  THR A CB    1 
ATOM   1119  O OG1   . THR A 1 151 ? -11.965 58.607  76.798  1.00 27.31  ? 151  THR A OG1   1 
ATOM   1120  C CG2   . THR A 1 151 ? -11.851 56.891  75.046  1.00 31.35  ? 151  THR A CG2   1 
ATOM   1121  N N     . ILE A 1 152 ? -8.542  56.076  74.915  1.00 28.69  ? 152  ILE A N     1 
ATOM   1122  C CA    . ILE A 1 152 ? -7.933  55.390  73.808  1.00 29.46  ? 152  ILE A CA    1 
ATOM   1123  C C     . ILE A 1 152 ? -9.031  54.603  73.139  1.00 28.75  ? 152  ILE A C     1 
ATOM   1124  O O     . ILE A 1 152 ? -9.647  53.708  73.765  1.00 26.93  ? 152  ILE A O     1 
ATOM   1125  C CB    . ILE A 1 152 ? -6.835  54.418  74.290  1.00 27.70  ? 152  ILE A CB    1 
ATOM   1126  C CG1   . ILE A 1 152 ? -5.718  55.189  75.014  1.00 28.83  ? 152  ILE A CG1   1 
ATOM   1127  C CG2   . ILE A 1 152 ? -6.265  53.594  73.138  1.00 27.63  ? 152  ILE A CG2   1 
ATOM   1128  C CD1   . ILE A 1 152 ? -4.756  54.291  75.818  1.00 26.66  ? 152  ILE A CD1   1 
ATOM   1129  N N     . HIS A 1 153 ? -9.285  54.910  71.869  1.00 29.45  ? 153  HIS A N     1 
ATOM   1130  C CA    . HIS A 1 153 ? -10.388 54.235  71.181  1.00 32.26  ? 153  HIS A CA    1 
ATOM   1131  C C     . HIS A 1 153 ? -9.991  53.645  69.827  1.00 32.41  ? 153  HIS A C     1 
ATOM   1132  O O     . HIS A 1 153 ? -9.088  54.149  69.149  1.00 31.82  ? 153  HIS A O     1 
ATOM   1133  C CB    . HIS A 1 153 ? -11.636 55.129  71.105  1.00 32.85  ? 153  HIS A CB    1 
ATOM   1134  C CG    . HIS A 1 153 ? -11.588 56.157  70.028  1.00 35.53  ? 153  HIS A CG    1 
ATOM   1135  N ND1   . HIS A 1 153 ? -12.002 55.903  68.739  1.00 38.74  ? 153  HIS A ND1   1 
ATOM   1136  C CD2   . HIS A 1 153 ? -11.162 57.439  70.047  1.00 37.18  ? 153  HIS A CD2   1 
ATOM   1137  C CE1   . HIS A 1 153 ? -11.832 56.991  68.008  1.00 43.59  ? 153  HIS A CE1   1 
ATOM   1138  N NE2   . HIS A 1 153 ? -11.336 57.941  68.782  1.00 38.84  ? 153  HIS A NE2   1 
ATOM   1139  N N     . GLY A 1 154 ? -10.668 52.554  69.476  1.00 32.74  ? 154  GLY A N     1 
ATOM   1140  C CA    . GLY A 1 154 ? -10.395 51.791  68.266  1.00 32.83  ? 154  GLY A CA    1 
ATOM   1141  C C     . GLY A 1 154 ? -10.988 50.396  68.340  1.00 33.57  ? 154  GLY A C     1 
ATOM   1142  O O     . GLY A 1 154 ? -11.532 49.966  69.363  1.00 32.39  ? 154  GLY A O     1 
ATOM   1143  N N     . MET A 1 155 ? -10.854 49.675  67.248  1.00 35.86  ? 155  MET A N     1 
ATOM   1144  C CA    . MET A 1 155 ? -11.476 48.383  67.108  1.00 39.91  ? 155  MET A CA    1 
ATOM   1145  C C     . MET A 1 155 ? -10.896 47.333  68.073  1.00 37.94  ? 155  MET A C     1 
ATOM   1146  O O     . MET A 1 155 ? -9.767  47.442  68.552  1.00 35.97  ? 155  MET A O     1 
ATOM   1147  C CB    . MET A 1 155 ? -11.364 47.918  65.650  1.00 40.24  ? 155  MET A CB    1 
ATOM   1148  C CG    . MET A 1 155 ? -10.003 47.340  65.311  1.00 49.02  ? 155  MET A CG    1 
ATOM   1149  S SD    . MET A 1 155 ? -9.884  46.523  63.712  1.00 57.75  ? 155  MET A SD    1 
ATOM   1150  C CE    . MET A 1 155 ? -11.089 45.203  63.869  1.00 62.23  ? 155  MET A CE    1 
ATOM   1151  N N     . ALA A 1 156 ? -11.706 46.313  68.341  1.00 36.66  ? 156  ALA A N     1 
ATOM   1152  C CA    . ALA A 1 156 ? -11.300 45.161  69.128  1.00 35.41  ? 156  ALA A CA    1 
ATOM   1153  C C     . ALA A 1 156 ? -10.039 44.510  68.547  1.00 34.43  ? 156  ALA A C     1 
ATOM   1154  O O     . ALA A 1 156 ? -9.938  44.266  67.344  1.00 34.87  ? 156  ALA A O     1 
ATOM   1155  C CB    . ALA A 1 156 ? -12.445 44.151  69.180  1.00 34.93  ? 156  ALA A CB    1 
ATOM   1156  N N     . GLY A 1 157 ? -9.077  44.237  69.416  1.00 32.24  ? 157  GLY A N     1 
ATOM   1157  C CA    . GLY A 1 157 ? -7.809  43.656  69.001  1.00 31.99  ? 157  GLY A CA    1 
ATOM   1158  C C     . GLY A 1 157 ? -6.773  44.552  68.333  1.00 30.86  ? 157  GLY A C     1 
ATOM   1159  O O     . GLY A 1 157 ? -5.740  44.068  67.892  1.00 32.42  ? 157  GLY A O     1 
ATOM   1160  N N     . CYS A 1 158 ? -7.012  45.851  68.269  1.00 30.26  ? 158  CYS A N     1 
ATOM   1161  C CA    . CYS A 1 158 ? -6.060  46.730  67.595  1.00 30.36  ? 158  CYS A CA    1 
ATOM   1162  C C     . CYS A 1 158 ? -4.849  47.109  68.443  1.00 30.20  ? 158  CYS A C     1 
ATOM   1163  O O     . CYS A 1 158 ? -3.956  47.778  67.939  1.00 29.15  ? 158  CYS A O     1 
ATOM   1164  C CB    . CYS A 1 158 ? -6.733  47.991  67.012  1.00 30.17  ? 158  CYS A CB    1 
ATOM   1165  S SG    . CYS A 1 158 ? -7.187  49.288  68.180  1.00 27.81  ? 158  CYS A SG    1 
ATOM   1166  N N     . GLY A 1 159 ? -4.835  46.678  69.708  1.00 28.72  ? 159  GLY A N     1 
ATOM   1167  C CA    . GLY A 1 159 ? -3.709  46.819  70.611  1.00 28.03  ? 159  GLY A CA    1 
ATOM   1168  C C     . GLY A 1 159 ? -3.835  47.934  71.646  1.00 26.52  ? 159  GLY A C     1 
ATOM   1169  O O     . GLY A 1 159 ? -2.825  48.450  72.093  1.00 25.64  ? 159  GLY A O     1 
ATOM   1170  N N     . LYS A 1 160 ? -5.063  48.299  72.026  1.00 27.36  ? 160  LYS A N     1 
ATOM   1171  C CA    . LYS A 1 160 ? -5.290  49.427  72.934  1.00 27.10  ? 160  LYS A CA    1 
ATOM   1172  C C     . LYS A 1 160 ? -4.772  49.168  74.369  1.00 26.56  ? 160  LYS A C     1 
ATOM   1173  O O     . LYS A 1 160 ? -4.172  50.040  75.013  1.00 26.78  ? 160  LYS A O     1 
ATOM   1174  C CB    . LYS A 1 160 ? -6.768  49.799  72.964  1.00 27.21  ? 160  LYS A CB    1 
ATOM   1175  C CG    . LYS A 1 160 ? -7.371  50.212  71.618  1.00 27.19  ? 160  LYS A CG    1 
ATOM   1176  C CD    . LYS A 1 160 ? -8.853  50.588  71.777  1.00 27.10  ? 160  LYS A CD    1 
ATOM   1177  C CE    . LYS A 1 160 ? -9.711  49.406  72.207  1.00 27.34  ? 160  LYS A CE    1 
ATOM   1178  N NZ    . LYS A 1 160 ? -9.788  48.363  71.166  1.00 23.39  ? 160  LYS A NZ    1 
ATOM   1179  N N     . SER A 1 161 ? -4.989  47.970  74.864  1.00 26.15  ? 161  SER A N     1 
ATOM   1180  C CA    . SER A 1 161 ? -4.619  47.665  76.233  1.00 27.34  ? 161  SER A CA    1 
ATOM   1181  C C     . SER A 1 161 ? -3.100  47.566  76.347  1.00 26.42  ? 161  SER A C     1 
ATOM   1182  O O     . SER A 1 161 ? -2.498  48.002  77.330  1.00 26.07  ? 161  SER A O     1 
ATOM   1183  C CB    . SER A 1 161 ? -5.245  46.364  76.693  1.00 26.19  ? 161  SER A CB    1 
ATOM   1184  O OG    . SER A 1 161 ? -4.303  45.362  76.445  1.00 31.94  ? 161  SER A OG    1 
ATOM   1185  N N     . VAL A 1 162 ? -2.464  46.983  75.345  1.00 26.22  ? 162  VAL A N     1 
ATOM   1186  C CA    . VAL A 1 162 ? -0.999  47.018  75.280  1.00 26.28  ? 162  VAL A CA    1 
ATOM   1187  C C     . VAL A 1 162 ? -0.481  48.455  75.240  1.00 25.73  ? 162  VAL A C     1 
ATOM   1188  O O     . VAL A 1 162 ? 0.525   48.764  75.883  1.00 25.77  ? 162  VAL A O     1 
ATOM   1189  C CB    . VAL A 1 162 ? -0.454  46.265  74.082  1.00 25.01  ? 162  VAL A CB    1 
ATOM   1190  C CG1   . VAL A 1 162 ? 1.027   46.507  73.935  1.00 26.91  ? 162  VAL A CG1   1 
ATOM   1191  C CG2   . VAL A 1 162 ? -0.720  44.765  74.247  1.00 23.52  ? 162  VAL A CG2   1 
ATOM   1192  N N     . LEU A 1 163 ? -1.160  49.323  74.485  1.00 25.69  ? 163  LEU A N     1 
ATOM   1193  C CA    . LEU A 1 163 ? -0.802  50.732  74.413  1.00 25.97  ? 163  LEU A CA    1 
ATOM   1194  C C     . LEU A 1 163 ? -0.942  51.452  75.755  1.00 26.38  ? 163  LEU A C     1 
ATOM   1195  O O     . LEU A 1 163 ? -0.071  52.221  76.146  1.00 27.77  ? 163  LEU A O     1 
ATOM   1196  C CB    . LEU A 1 163 ? -1.648  51.474  73.352  1.00 27.35  ? 163  LEU A CB    1 
ATOM   1197  C CG    . LEU A 1 163 ? -1.310  51.388  71.860  1.00 23.80  ? 163  LEU A CG    1 
ATOM   1198  C CD1   . LEU A 1 163 ? -2.388  52.039  71.015  1.00 27.52  ? 163  LEU A CD1   1 
ATOM   1199  C CD2   . LEU A 1 163 ? 0.048   51.982  71.564  1.00 27.74  ? 163  LEU A CD2   1 
ATOM   1200  N N     . ALA A 1 164 ? -2.041  51.216  76.449  1.00 28.07  ? 164  ALA A N     1 
ATOM   1201  C CA    . ALA A 1 164 ? -2.297  51.858  77.746  1.00 27.53  ? 164  ALA A CA    1 
ATOM   1202  C C     . ALA A 1 164 ? -1.263  51.488  78.802  1.00 26.66  ? 164  ALA A C     1 
ATOM   1203  O O     . ALA A 1 164 ? -0.825  52.340  79.589  1.00 26.02  ? 164  ALA A O     1 
ATOM   1204  C CB    . ALA A 1 164 ? -3.677  51.508  78.234  1.00 27.50  ? 164  ALA A CB    1 
ATOM   1205  N N     . ALA A 1 165 ? -0.887  50.222  78.832  1.00 26.43  ? 165  ALA A N     1 
ATOM   1206  C CA    . ALA A 1 165 ? 0.185   49.731  79.711  1.00 26.43  ? 165  ALA A CA    1 
ATOM   1207  C C     . ALA A 1 165 ? 1.551   50.338  79.347  1.00 26.56  ? 165  ALA A C     1 
ATOM   1208  O O     . ALA A 1 165 ? 2.272   50.781  80.221  1.00 27.83  ? 165  ALA A O     1 
ATOM   1209  C CB    . ALA A 1 165 ? 0.226   48.181  79.688  1.00 24.40  ? 165  ALA A CB    1 
ATOM   1210  N N     . GLU A 1 166 ? 1.895   50.425  78.062  1.00 26.90  ? 166  GLU A N     1 
ATOM   1211  C CA    . GLU A 1 166 ? 3.160   51.050  77.641  1.00 25.83  ? 166  GLU A CA    1 
ATOM   1212  C C     . GLU A 1 166 ? 3.255   52.516  77.974  1.00 25.63  ? 166  GLU A C     1 
ATOM   1213  O O     . GLU A 1 166 ? 4.325   53.005  78.317  1.00 27.39  ? 166  GLU A O     1 
ATOM   1214  C CB    . GLU A 1 166 ? 3.408   50.952  76.156  1.00 24.80  ? 166  GLU A CB    1 
ATOM   1215  C CG    . GLU A 1 166 ? 3.900   49.632  75.723  1.00 33.95  ? 166  GLU A CG    1 
ATOM   1216  C CD    . GLU A 1 166 ? 5.096   49.161  76.551  1.00 38.91  ? 166  GLU A CD    1 
ATOM   1217  O OE1   . GLU A 1 166 ? 6.185   49.772  76.469  1.00 30.10  ? 166  GLU A OE1   1 
ATOM   1218  O OE2   . GLU A 1 166 ? 4.918   48.170  77.292  1.00 44.92  ? 166  GLU A OE2   1 
ATOM   1219  N N     . ALA A 1 167 ? 2.139   53.221  77.863  1.00 27.50  ? 167  ALA A N     1 
ATOM   1220  C CA    . ALA A 1 167 ? 2.110   54.632  78.170  1.00 27.83  ? 167  ALA A CA    1 
ATOM   1221  C C     . ALA A 1 167 ? 2.534   54.968  79.613  1.00 27.93  ? 167  ALA A C     1 
ATOM   1222  O O     . ALA A 1 167 ? 3.178   55.999  79.844  1.00 27.45  ? 167  ALA A O     1 
ATOM   1223  C CB    . ALA A 1 167 ? 0.740   55.190  77.853  1.00 28.97  ? 167  ALA A CB    1 
ATOM   1224  N N     . VAL A 1 168 ? 2.200   54.090  80.565  1.00 28.01  ? 168  VAL A N     1 
ATOM   1225  C CA    . VAL A 1 168 ? 2.583   54.270  81.971  1.00 27.12  ? 168  VAL A CA    1 
ATOM   1226  C C     . VAL A 1 168 ? 3.905   53.597  82.346  1.00 29.22  ? 168  VAL A C     1 
ATOM   1227  O O     . VAL A 1 168 ? 4.389   53.749  83.497  1.00 27.54  ? 168  VAL A O     1 
ATOM   1228  C CB    . VAL A 1 168 ? 1.463   53.800  82.973  1.00 28.00  ? 168  VAL A CB    1 
ATOM   1229  C CG1   . VAL A 1 168 ? 0.248   54.716  82.905  1.00 32.04  ? 168  VAL A CG1   1 
ATOM   1230  C CG2   . VAL A 1 168 ? 1.061   52.372  82.764  1.00 24.46  ? 168  VAL A CG2   1 
ATOM   1231  N N     . ARG A 1 169 ? 4.487   52.868  81.387  1.00 28.87  ? 169  ARG A N     1 
ATOM   1232  C CA    . ARG A 1 169 ? 5.736   52.161  81.574  1.00 31.15  ? 169  ARG A CA    1 
ATOM   1233  C C     . ARG A 1 169 ? 6.884   53.149  81.349  1.00 32.25  ? 169  ARG A C     1 
ATOM   1234  O O     . ARG A 1 169 ? 7.762   52.937  80.548  1.00 33.23  ? 169  ARG A O     1 
ATOM   1235  C CB    . ARG A 1 169 ? 5.775   50.978  80.609  1.00 31.00  ? 169  ARG A CB    1 
ATOM   1236  C CG    . ARG A 1 169 ? 6.706   49.863  81.016  1.00 32.34  ? 169  ARG A CG    1 
ATOM   1237  C CD    . ARG A 1 169 ? 6.409   48.549  80.296  1.00 34.54  ? 169  ARG A CD    1 
ATOM   1238  N NE    . ARG A 1 169 ? 5.475   47.720  81.072  1.00 43.34  ? 169  ARG A NE    1 
ATOM   1239  C CZ    . ARG A 1 169 ? 4.309   47.264  80.636  1.00 34.85  ? 169  ARG A CZ    1 
ATOM   1240  N NH1   . ARG A 1 169 ? 3.916   47.509  79.428  1.00 43.45  ? 169  ARG A NH1   1 
ATOM   1241  N NH2   . ARG A 1 169 ? 3.541   46.530  81.419  1.00 49.20  ? 169  ARG A NH2   1 
ATOM   1242  N N     . ASP A 1 170 ? 6.845   54.251  82.088  1.00 33.04  ? 170  ASP A N     1 
ATOM   1243  C CA    . ASP A 1 170 ? 7.777   55.363  81.925  1.00 33.73  ? 170  ASP A CA    1 
ATOM   1244  C C     . ASP A 1 170 ? 8.043   56.071  83.261  1.00 33.54  ? 170  ASP A C     1 
ATOM   1245  O O     . ASP A 1 170 ? 7.125   56.564  83.898  1.00 33.94  ? 170  ASP A O     1 
ATOM   1246  C CB    . ASP A 1 170 ? 7.220   56.418  80.963  1.00 35.61  ? 170  ASP A CB    1 
ATOM   1247  C CG    . ASP A 1 170 ? 8.236   57.509  80.669  1.00 34.08  ? 170  ASP A CG    1 
ATOM   1248  O OD1   . ASP A 1 170 ? 9.143   57.229  79.876  1.00 49.24  ? 170  ASP A OD1   1 
ATOM   1249  O OD2   . ASP A 1 170 ? 8.158   58.616  81.251  1.00 45.57  ? 170  ASP A OD2   1 
ATOM   1250  N N     . HIS A 1 171 ? 9.297   56.162  83.659  1.00 33.18  ? 171  HIS A N     1 
ATOM   1251  C CA    . HIS A 1 171 ? 9.657   56.723  84.970  1.00 33.07  ? 171  HIS A CA    1 
ATOM   1252  C C     . HIS A 1 171 ? 9.260   58.203  85.168  1.00 32.40  ? 171  HIS A C     1 
ATOM   1253  O O     . HIS A 1 171 ? 8.696   58.588  86.189  1.00 30.47  ? 171  HIS A O     1 
ATOM   1254  C CB    . HIS A 1 171 ? 11.171  56.610  85.198  1.00 32.66  ? 171  HIS A CB    1 
ATOM   1255  C CG    . HIS A 1 171 ? 11.606  57.006  86.578  1.00 33.48  ? 171  HIS A CG    1 
ATOM   1256  N ND1   . HIS A 1 171 ? 11.848  56.079  87.574  1.00 31.93  ? 171  HIS A ND1   1 
ATOM   1257  C CD2   . HIS A 1 171 ? 11.829  58.221  87.128  1.00 30.64  ? 171  HIS A CD2   1 
ATOM   1258  C CE1   . HIS A 1 171 ? 12.187  56.711  88.683  1.00 36.45  ? 171  HIS A CE1   1 
ATOM   1259  N NE2   . HIS A 1 171 ? 12.188  58.010  88.439  1.00 33.72  ? 171  HIS A NE2   1 
ATOM   1260  N N     . SER A 1 172 ? 9.603   59.036  84.200  1.00 34.12  ? 172  SER A N     1 
ATOM   1261  C CA    . SER A 1 172 ? 9.378   60.480  84.291  1.00 34.53  ? 172  SER A CA    1 
ATOM   1262  C C     . SER A 1 172 ? 7.889   60.828  84.344  1.00 34.41  ? 172  SER A C     1 
ATOM   1263  O O     . SER A 1 172 ? 7.458   61.588  85.206  1.00 34.53  ? 172  SER A O     1 
ATOM   1264  C CB    . SER A 1 172 ? 10.012  61.176  83.097  1.00 34.74  ? 172  SER A CB    1 
ATOM   1265  O OG    . SER A 1 172 ? 11.275  60.560  82.809  1.00 44.25  ? 172  SER A OG    1 
ATOM   1266  N N     . LEU A 1 173 ? 7.116   60.249  83.431  1.00 35.28  ? 173  LEU A N     1 
ATOM   1267  C CA    . LEU A 1 173 ? 5.664   60.360  83.483  1.00 36.19  ? 173  LEU A CA    1 
ATOM   1268  C C     . LEU A 1 173 ? 5.088   59.905  84.825  1.00 34.43  ? 173  LEU A C     1 
ATOM   1269  O O     . LEU A 1 173 ? 4.232   60.562  85.402  1.00 32.98  ? 173  LEU A O     1 
ATOM   1270  C CB    . LEU A 1 173 ? 5.007   59.513  82.376  1.00 38.16  ? 173  LEU A CB    1 
ATOM   1271  C CG    . LEU A 1 173 ? 3.493   59.761  82.216  1.00 39.47  ? 173  LEU A CG    1 
ATOM   1272  C CD1   . LEU A 1 173 ? 3.242   61.044  81.419  1.00 46.99  ? 173  LEU A CD1   1 
ATOM   1273  C CD2   . LEU A 1 173 ? 2.810   58.615  81.549  1.00 39.94  ? 173  LEU A CD2   1 
ATOM   1274  N N     . LEU A 1 174 ? 5.536   58.749  85.301  1.00 34.34  ? 174  LEU A N     1 
ATOM   1275  C CA    . LEU A 1 174 ? 4.980   58.186  86.527  1.00 35.35  ? 174  LEU A CA    1 
ATOM   1276  C C     . LEU A 1 174 ? 5.330   59.052  87.725  1.00 36.32  ? 174  LEU A C     1 
ATOM   1277  O O     . LEU A 1 174 ? 4.465   59.447  88.484  1.00 35.93  ? 174  LEU A O     1 
ATOM   1278  C CB    . LEU A 1 174 ? 5.502   56.781  86.718  1.00 35.61  ? 174  LEU A CB    1 
ATOM   1279  C CG    . LEU A 1 174 ? 4.557   55.617  86.992  1.00 36.01  ? 174  LEU A CG    1 
ATOM   1280  C CD1   . LEU A 1 174 ? 3.212   55.752  86.360  1.00 29.92  ? 174  LEU A CD1   1 
ATOM   1281  C CD2   . LEU A 1 174 ? 5.281   54.347  86.574  1.00 35.84  ? 174  LEU A CD2   1 
ATOM   1282  N N     . GLU A 1 175 ? 6.612   59.355  87.875  1.00 37.89  ? 175  GLU A N     1 
ATOM   1283  C CA    . GLU A 1 175 ? 7.098   60.152  88.985  1.00 39.31  ? 175  GLU A CA    1 
ATOM   1284  C C     . GLU A 1 175 ? 6.539   61.580  88.905  1.00 38.87  ? 175  GLU A C     1 
ATOM   1285  O O     . GLU A 1 175 ? 6.090   62.132  89.894  1.00 39.01  ? 175  GLU A O     1 
ATOM   1286  C CB    . GLU A 1 175 ? 8.632   60.178  88.953  1.00 39.87  ? 175  GLU A CB    1 
ATOM   1287  C CG    . GLU A 1 175 ? 9.314   60.841  90.097  1.00 42.21  ? 175  GLU A CG    1 
ATOM   1288  C CD    . GLU A 1 175 ? 10.807  60.952  89.871  1.00 45.39  ? 175  GLU A CD    1 
ATOM   1289  O OE1   . GLU A 1 175 ? 11.204  61.388  88.764  1.00 61.55  ? 175  GLU A OE1   1 
ATOM   1290  O OE2   . GLU A 1 175 ? 11.583  60.577  90.783  1.00 59.39  ? 175  GLU A OE2   1 
ATOM   1291  N N     . GLY A 1 176 ? 6.545   62.161  87.709  1.00 37.81  ? 176  GLY A N     1 
ATOM   1292  C CA    . GLY A 1 176 ? 6.095   63.530  87.532  1.00 37.58  ? 176  GLY A CA    1 
ATOM   1293  C C     . GLY A 1 176 ? 4.595   63.757  87.538  1.00 38.16  ? 176  GLY A C     1 
ATOM   1294  O O     . GLY A 1 176 ? 4.116   64.774  88.022  1.00 38.37  ? 176  GLY A O     1 
ATOM   1295  N N     . CYS A 1 177 ? 3.843   62.813  86.984  1.00 36.94  ? 177  CYS A N     1 
ATOM   1296  C CA    . CYS A 1 177 ? 2.408   62.977  86.857  1.00 33.38  ? 177  CYS A CA    1 
ATOM   1297  C C     . CYS A 1 177 ? 1.607   62.183  87.848  1.00 29.81  ? 177  CYS A C     1 
ATOM   1298  O O     . CYS A 1 177 ? 0.554   62.649  88.241  1.00 26.73  ? 177  CYS A O     1 
ATOM   1299  C CB    . CYS A 1 177 ? 1.960   62.621  85.443  1.00 34.63  ? 177  CYS A CB    1 
ATOM   1300  S SG    . CYS A 1 177 ? 2.619   63.767  84.206  1.00 43.03  ? 177  CYS A SG    1 
ATOM   1301  N N     . PHE A 1 178 ? 2.083   60.998  88.244  1.00 27.65  ? 178  PHE A N     1 
ATOM   1302  C CA    . PHE A 1 178 ? 1.297   60.076  89.055  1.00 28.02  ? 178  PHE A CA    1 
ATOM   1303  C C     . PHE A 1 178 ? 2.051   59.448  90.213  1.00 28.22  ? 178  PHE A C     1 
ATOM   1304  O O     . PHE A 1 178 ? 2.061   58.221  90.348  1.00 27.48  ? 178  PHE A O     1 
ATOM   1305  C CB    . PHE A 1 178 ? 0.691   58.979  88.167  1.00 27.58  ? 178  PHE A CB    1 
ATOM   1306  C CG    . PHE A 1 178 ? -0.026  59.518  86.965  1.00 27.22  ? 178  PHE A CG    1 
ATOM   1307  C CD1   . PHE A 1 178 ? -1.222  60.211  87.110  1.00 23.61  ? 178  PHE A CD1   1 
ATOM   1308  C CD2   . PHE A 1 178 ? 0.525   59.400  85.702  1.00 28.38  ? 178  PHE A CD2   1 
ATOM   1309  C CE1   . PHE A 1 178 ? -1.888  60.735  86.004  1.00 24.93  ? 178  PHE A CE1   1 
ATOM   1310  C CE2   . PHE A 1 178 ? -0.134  59.936  84.588  1.00 30.23  ? 178  PHE A CE2   1 
ATOM   1311  C CZ    . PHE A 1 178 ? -1.339  60.607  84.748  1.00 27.29  ? 178  PHE A CZ    1 
ATOM   1312  N N     . PRO A 1 179 ? 2.604   60.286  91.113  1.00 28.80  ? 179  PRO A N     1 
ATOM   1313  C CA    . PRO A 1 179 ? 3.333   59.791  92.298  1.00 28.02  ? 179  PRO A CA    1 
ATOM   1314  C C     . PRO A 1 179 ? 2.528   58.846  93.224  1.00 28.45  ? 179  PRO A C     1 
ATOM   1315  O O     . PRO A 1 179 ? 3.130   58.126  94.033  1.00 27.36  ? 179  PRO A O     1 
ATOM   1316  C CB    . PRO A 1 179 ? 3.712   61.076  93.042  1.00 30.43  ? 179  PRO A CB    1 
ATOM   1317  C CG    . PRO A 1 179 ? 2.949   62.174  92.429  1.00 27.38  ? 179  PRO A CG    1 
ATOM   1318  C CD    . PRO A 1 179 ? 2.559   61.764  91.067  1.00 28.17  ? 179  PRO A CD    1 
ATOM   1319  N N     . GLY A 1 180 ? 1.200   58.863  93.109  1.00 27.03  ? 180  GLY A N     1 
ATOM   1320  C CA    . GLY A 1 180 ? 0.337   57.950  93.825  1.00 28.95  ? 180  GLY A CA    1 
ATOM   1321  C C     . GLY A 1 180 ? 0.107   56.612  93.140  1.00 30.96  ? 180  GLY A C     1 
ATOM   1322  O O     . GLY A 1 180 ? -0.628  55.768  93.668  1.00 33.78  ? 180  GLY A O     1 
ATOM   1323  N N     . GLY A 1 181 ? 0.717   56.422  91.966  1.00 31.01  ? 181  GLY A N     1 
ATOM   1324  C CA    . GLY A 1 181 ? 0.711   55.144  91.275  1.00 28.93  ? 181  GLY A CA    1 
ATOM   1325  C C     . GLY A 1 181 ? -0.370  55.009  90.240  1.00 29.86  ? 181  GLY A C     1 
ATOM   1326  O O     . GLY A 1 181 ? -0.970  56.000  89.808  1.00 27.03  ? 181  GLY A O     1 
ATOM   1327  N N     . VAL A 1 182 ? -0.585  53.765  89.820  1.00 29.21  ? 182  VAL A N     1 
ATOM   1328  C CA    . VAL A 1 182 ? -1.548  53.439  88.779  1.00 29.40  ? 182  VAL A CA    1 
ATOM   1329  C C     . VAL A 1 182 ? -2.238  52.180  89.232  1.00 28.92  ? 182  VAL A C     1 
ATOM   1330  O O     . VAL A 1 182 ? -1.605  51.345  89.879  1.00 30.66  ? 182  VAL A O     1 
ATOM   1331  C CB    . VAL A 1 182 ? -0.887  53.213  87.362  1.00 29.12  ? 182  VAL A CB    1 
ATOM   1332  C CG1   . VAL A 1 182 ? -0.050  54.402  86.955  1.00 30.69  ? 182  VAL A CG1   1 
ATOM   1333  C CG2   . VAL A 1 182 ? 0.011   52.022  87.352  1.00 34.14  ? 182  VAL A CG2   1 
ATOM   1334  N N     . HIS A 1 183 ? -3.535  52.069  88.940  1.00 26.91  ? 183  HIS A N     1 
ATOM   1335  C CA    . HIS A 1 183 ? -4.271  50.831  89.189  1.00 27.51  ? 183  HIS A CA    1 
ATOM   1336  C C     . HIS A 1 183 ? -5.033  50.453  87.937  1.00 26.25  ? 183  HIS A C     1 
ATOM   1337  O O     . HIS A 1 183 ? -5.761  51.261  87.389  1.00 26.12  ? 183  HIS A O     1 
ATOM   1338  C CB    . HIS A 1 183 ? -5.195  50.977  90.405  1.00 27.29  ? 183  HIS A CB    1 
ATOM   1339  C CG    . HIS A 1 183 ? -4.434  51.092  91.690  1.00 34.90  ? 183  HIS A CG    1 
ATOM   1340  N ND1   . HIS A 1 183 ? -4.124  52.310  92.271  1.00 40.43  ? 183  HIS A ND1   1 
ATOM   1341  C CD2   . HIS A 1 183 ? -3.852  50.142  92.463  1.00 37.34  ? 183  HIS A CD2   1 
ATOM   1342  C CE1   . HIS A 1 183 ? -3.398  52.101  93.355  1.00 43.72  ? 183  HIS A CE1   1 
ATOM   1343  N NE2   . HIS A 1 183 ? -3.235  50.794  93.503  1.00 45.20  ? 183  HIS A NE2   1 
ATOM   1344  N N     . TRP A 1 184 ? -4.837  49.220  87.492  1.00 25.71  ? 184  TRP A N     1 
ATOM   1345  C CA    . TRP A 1 184 ? -5.476  48.715  86.308  1.00 26.44  ? 184  TRP A CA    1 
ATOM   1346  C C     . TRP A 1 184 ? -6.748  47.968  86.621  1.00 27.83  ? 184  TRP A C     1 
ATOM   1347  O O     . TRP A 1 184 ? -6.723  47.061  87.432  1.00 29.44  ? 184  TRP A O     1 
ATOM   1348  C CB    . TRP A 1 184 ? -4.538  47.756  85.674  1.00 26.63  ? 184  TRP A CB    1 
ATOM   1349  C CG    . TRP A 1 184 ? -4.970  47.214  84.401  1.00 24.62  ? 184  TRP A CG    1 
ATOM   1350  C CD1   . TRP A 1 184 ? -5.781  46.146  84.192  1.00 22.86  ? 184  TRP A CD1   1 
ATOM   1351  C CD2   . TRP A 1 184 ? -4.546  47.666  83.119  1.00 26.19  ? 184  TRP A CD2   1 
ATOM   1352  N NE1   . TRP A 1 184 ? -5.938  45.932  82.843  1.00 24.76  ? 184  TRP A NE1   1 
ATOM   1353  C CE2   . TRP A 1 184 ? -5.157  46.828  82.162  1.00 23.50  ? 184  TRP A CE2   1 
ATOM   1354  C CE3   . TRP A 1 184 ? -3.644  48.654  82.685  1.00 24.00  ? 184  TRP A CE3   1 
ATOM   1355  C CZ2   . TRP A 1 184 ? -4.921  46.965  80.816  1.00 28.60  ? 184  TRP A CZ2   1 
ATOM   1356  C CZ3   . TRP A 1 184 ? -3.440  48.805  81.352  1.00 26.00  ? 184  TRP A CZ3   1 
ATOM   1357  C CH2   . TRP A 1 184 ? -4.061  47.961  80.426  1.00 22.61  ? 184  TRP A CH2   1 
ATOM   1358  N N     . VAL A 1 185 ? -7.841  48.318  85.951  1.00 27.27  ? 185  VAL A N     1 
ATOM   1359  C CA    . VAL A 1 185 ? -9.092  47.616  86.085  1.00 27.67  ? 185  VAL A CA    1 
ATOM   1360  C C     . VAL A 1 185 ? -9.503  47.042  84.727  1.00 29.37  ? 185  VAL A C     1 
ATOM   1361  O O     . VAL A 1 185 ? -9.662  47.774  83.738  1.00 28.35  ? 185  VAL A O     1 
ATOM   1362  C CB    . VAL A 1 185 ? -10.217 48.552  86.578  1.00 31.09  ? 185  VAL A CB    1 
ATOM   1363  C CG1   . VAL A 1 185 ? -11.417 47.723  87.066  1.00 28.01  ? 185  VAL A CG1   1 
ATOM   1364  C CG2   . VAL A 1 185 ? -9.720  49.540  87.666  1.00 30.21  ? 185  VAL A CG2   1 
ATOM   1365  N N     . SER A 1 186 ? -9.662  45.726  84.679  1.00 29.37  ? 186  SER A N     1 
ATOM   1366  C CA    . SER A 1 186 ? -10.182 45.050  83.497  1.00 32.12  ? 186  SER A CA    1 
ATOM   1367  C C     . SER A 1 186 ? -11.713 45.023  83.580  1.00 32.95  ? 186  SER A C     1 
ATOM   1368  O O     . SER A 1 186 ? -12.283 44.423  84.487  1.00 35.31  ? 186  SER A O     1 
ATOM   1369  C CB    . SER A 1 186 ? -9.602  43.632  83.419  1.00 35.47  ? 186  SER A CB    1 
ATOM   1370  O OG    . SER A 1 186 ? -9.984  42.999  82.201  1.00 48.59  ? 186  SER A OG    1 
ATOM   1371  N N     . VAL A 1 187 ? -12.379 45.721  82.664  1.00 31.72  ? 187  VAL A N     1 
ATOM   1372  C CA    . VAL A 1 187 ? -13.806 45.931  82.787  1.00 32.27  ? 187  VAL A CA    1 
ATOM   1373  C C     . VAL A 1 187 ? -14.529 44.998  81.804  1.00 32.77  ? 187  VAL A C     1 
ATOM   1374  O O     . VAL A 1 187 ? -15.137 44.012  82.209  1.00 32.97  ? 187  VAL A O     1 
ATOM   1375  C CB    . VAL A 1 187 ? -14.177 47.430  82.574  1.00 31.76  ? 187  VAL A CB    1 
ATOM   1376  C CG1   . VAL A 1 187 ? -15.655 47.655  82.769  1.00 35.71  ? 187  VAL A CG1   1 
ATOM   1377  C CG2   . VAL A 1 187 ? -13.411 48.343  83.555  1.00 30.04  ? 187  VAL A CG2   1 
ATOM   1378  N N     . GLY A 1 188 ? -14.427 45.306  80.519  1.00 32.43  ? 188  GLY A N     1 
ATOM   1379  C CA    . GLY A 1 188 ? -15.210 44.629  79.497  1.00 33.88  ? 188  GLY A CA    1 
ATOM   1380  C C     . GLY A 1 188 ? -16.692 44.951  79.545  1.00 33.81  ? 188  GLY A C     1 
ATOM   1381  O O     . GLY A 1 188 ? -17.131 45.846  80.293  1.00 32.30  ? 188  GLY A O     1 
ATOM   1382  N N     . LYS A 1 189 ? -17.459 44.196  78.760  1.00 34.41  ? 189  LYS A N     1 
ATOM   1383  C CA    . LYS A 1 189 ? -18.923 44.337  78.717  1.00 35.62  ? 189  LYS A CA    1 
ATOM   1384  C C     . LYS A 1 189 ? -19.496 43.780  80.019  1.00 36.22  ? 189  LYS A C     1 
ATOM   1385  O O     . LYS A 1 189 ? -19.255 42.622  80.371  1.00 37.06  ? 189  LYS A O     1 
ATOM   1386  C CB    . LYS A 1 189 ? -19.511 43.643  77.485  1.00 34.23  ? 189  LYS A CB    1 
ATOM   1387  C CG    . LYS A 1 189 ? -21.017 43.719  77.395  1.00 37.87  ? 189  LYS A CG    1 
ATOM   1388  C CD    . LYS A 1 189 ? -21.515 45.158  77.152  1.00 45.14  ? 189  LYS A CD    1 
ATOM   1389  C CE    . LYS A 1 189 ? -23.028 45.182  76.836  1.00 46.90  ? 189  LYS A CE    1 
ATOM   1390  N NZ    . LYS A 1 189 ? -23.526 46.512  76.356  1.00 43.46  ? 189  LYS A NZ    1 
ATOM   1391  N N     . GLN A 1 190 ? -20.216 44.624  80.748  1.00 35.88  ? 190  GLN A N     1 
ATOM   1392  C CA    . GLN A 1 190 ? -20.753 44.244  82.044  1.00 36.15  ? 190  GLN A CA    1 
ATOM   1393  C C     . GLN A 1 190 ? -22.202 44.699  82.161  1.00 36.98  ? 190  GLN A C     1 
ATOM   1394  O O     . GLN A 1 190 ? -22.586 45.731  81.579  1.00 35.43  ? 190  GLN A O     1 
ATOM   1395  C CB    . GLN A 1 190 ? -19.917 44.876  83.175  1.00 35.14  ? 190  GLN A CB    1 
ATOM   1396  C CG    . GLN A 1 190 ? -18.454 44.413  83.220  1.00 35.56  ? 190  GLN A CG    1 
ATOM   1397  C CD    . GLN A 1 190 ? -18.318 42.900  83.393  1.00 33.16  ? 190  GLN A CD    1 
ATOM   1398  O OE1   . GLN A 1 190 ? -19.214 42.249  83.937  1.00 35.89  ? 190  GLN A OE1   1 
ATOM   1399  N NE2   . GLN A 1 190 ? -17.206 42.338  82.922  1.00 25.36  ? 190  GLN A NE2   1 
ATOM   1400  N N     . ASP A 1 191 ? -22.983 43.904  82.898  1.00 36.93  ? 191  ASP A N     1 
ATOM   1401  C CA    . ASP A 1 191 ? -24.276 44.325  83.428  1.00 38.48  ? 191  ASP A CA    1 
ATOM   1402  C C     . ASP A 1 191 ? -24.012 44.874  84.843  1.00 36.75  ? 191  ASP A C     1 
ATOM   1403  O O     . ASP A 1 191 ? -22.847 44.962  85.249  1.00 37.00  ? 191  ASP A O     1 
ATOM   1404  C CB    . ASP A 1 191 ? -25.299 43.162  83.386  1.00 40.19  ? 191  ASP A CB    1 
ATOM   1405  C CG    . ASP A 1 191 ? -24.824 41.915  84.127  1.00 44.79  ? 191  ASP A CG    1 
ATOM   1406  O OD1   . ASP A 1 191 ? -23.838 41.994  84.879  1.00 48.43  ? 191  ASP A OD1   1 
ATOM   1407  O OD2   . ASP A 1 191 ? -25.439 40.845  83.943  1.00 54.13  ? 191  ASP A OD2   1 
ATOM   1408  N N     . LYS A 1 192 ? -25.060 45.250  85.572  1.00 35.83  ? 192  LYS A N     1 
ATOM   1409  C CA    . LYS A 1 192 ? -24.916 45.848  86.900  1.00 37.55  ? 192  LYS A CA    1 
ATOM   1410  C C     . LYS A 1 192 ? -24.190 44.931  87.874  1.00 36.75  ? 192  LYS A C     1 
ATOM   1411  O O     . LYS A 1 192 ? -23.306 45.379  88.596  1.00 36.75  ? 192  LYS A O     1 
ATOM   1412  C CB    . LYS A 1 192 ? -26.277 46.184  87.522  1.00 39.07  ? 192  LYS A CB    1 
ATOM   1413  C CG    . LYS A 1 192 ? -27.149 47.162  86.777  1.00 47.32  ? 192  LYS A CG    1 
ATOM   1414  C CD    . LYS A 1 192 ? -26.572 48.555  86.715  1.00 53.95  ? 192  LYS A CD    1 
ATOM   1415  C CE    . LYS A 1 192 ? -27.575 49.496  86.013  1.00 57.80  ? 192  LYS A CE    1 
ATOM   1416  N NZ    . LYS A 1 192 ? -26.929 50.599  85.228  1.00 55.23  ? 192  LYS A NZ    1 
ATOM   1417  N N     . SER A 1 193 ? -24.580 43.665  87.924  1.00 35.40  ? 193  SER A N     1 
ATOM   1418  C CA    . SER A 1 193 ? -23.990 42.749  88.905  1.00 37.03  ? 193  SER A CA    1 
ATOM   1419  C C     . SER A 1 193 ? -22.570 42.337  88.487  1.00 33.17  ? 193  SER A C     1 
ATOM   1420  O O     . SER A 1 193 ? -21.731 42.062  89.331  1.00 31.37  ? 193  SER A O     1 
ATOM   1421  C CB    . SER A 1 193 ? -24.898 41.530  89.191  1.00 38.45  ? 193  SER A CB    1 
ATOM   1422  O OG    . SER A 1 193 ? -24.861 40.617  88.139  1.00 40.09  ? 193  SER A OG    1 
ATOM   1423  N N     . GLY A 1 194 ? -22.312 42.335  87.187  1.00 32.53  ? 194  GLY A N     1 
ATOM   1424  C CA    . GLY A 1 194 ? -20.963 42.155  86.660  1.00 32.42  ? 194  GLY A CA    1 
ATOM   1425  C C     . GLY A 1 194 ? -20.040 43.304  87.014  1.00 32.01  ? 194  GLY A C     1 
ATOM   1426  O O     . GLY A 1 194 ? -18.916 43.101  87.401  1.00 32.51  ? 194  GLY A O     1 
ATOM   1427  N N     . LEU A 1 195 ? -20.517 44.532  86.877  1.00 33.01  ? 195  LEU A N     1 
ATOM   1428  C CA    . LEU A 1 195 ? -19.688 45.669  87.272  1.00 33.01  ? 195  LEU A CA    1 
ATOM   1429  C C     . LEU A 1 195 ? -19.469 45.680  88.775  1.00 31.49  ? 195  LEU A C     1 
ATOM   1430  O O     . LEU A 1 195 ? -18.371 45.990  89.225  1.00 32.58  ? 195  LEU A O     1 
ATOM   1431  C CB    . LEU A 1 195 ? -20.261 47.007  86.811  1.00 32.61  ? 195  LEU A CB    1 
ATOM   1432  C CG    . LEU A 1 195 ? -19.402 48.239  87.218  1.00 36.52  ? 195  LEU A CG    1 
ATOM   1433  C CD1   . LEU A 1 195 ? -17.974 48.142  86.713  1.00 36.45  ? 195  LEU A CD1   1 
ATOM   1434  C CD2   . LEU A 1 195 ? -20.030 49.560  86.764  1.00 36.65  ? 195  LEU A CD2   1 
ATOM   1435  N N     . LEU A 1 196 ? -20.507 45.351  89.553  1.00 31.95  ? 196  LEU A N     1 
ATOM   1436  C CA    . LEU A 1 196 ? -20.376 45.281  91.006  1.00 31.75  ? 196  LEU A CA    1 
ATOM   1437  C C     . LEU A 1 196 ? -19.261 44.327  91.429  1.00 31.08  ? 196  LEU A C     1 
ATOM   1438  O O     . LEU A 1 196 ? -18.429 44.666  92.270  1.00 32.17  ? 196  LEU A O     1 
ATOM   1439  C CB    . LEU A 1 196 ? -21.704 44.879  91.640  1.00 31.97  ? 196  LEU A CB    1 
ATOM   1440  C CG    . LEU A 1 196 ? -21.677 44.826  93.166  1.00 31.33  ? 196  LEU A CG    1 
ATOM   1441  C CD1   . LEU A 1 196 ? -21.220 46.179  93.741  1.00 29.63  ? 196  LEU A CD1   1 
ATOM   1442  C CD2   . LEU A 1 196 ? -23.013 44.408  93.741  1.00 32.12  ? 196  LEU A CD2   1 
ATOM   1443  N N     . MET A 1 197 ? -19.215 43.145  90.823  1.00 32.75  ? 197  MET A N     1 
ATOM   1444  C CA    . MET A 1 197 ? -18.132 42.185  91.113  1.00 34.44  ? 197  MET A CA    1 
ATOM   1445  C C     . MET A 1 197 ? -16.774 42.829  90.875  1.00 31.41  ? 197  MET A C     1 
ATOM   1446  O O     . MET A 1 197 ? -15.891 42.694  91.697  1.00 31.23  ? 197  MET A O     1 
ATOM   1447  C CB    . MET A 1 197 ? -18.258 40.901  90.268  1.00 34.61  ? 197  MET A CB    1 
ATOM   1448  C CG    . MET A 1 197 ? -19.397 39.941  90.722  1.00 41.57  ? 197  MET A CG    1 
ATOM   1449  S SD    . MET A 1 197 ? -19.625 38.387  89.762  1.00 39.65  ? 197  MET A SD    1 
ATOM   1450  C CE    . MET A 1 197 ? -19.711 38.923  88.085  1.00 48.50  ? 197  MET A CE    1 
ATOM   1451  N N     . LYS A 1 198 ? -16.626 43.538  89.752  1.00 30.73  ? 198  LYS A N     1 
ATOM   1452  C CA    . LYS A 1 198 ? -15.378 44.238  89.433  1.00 31.12  ? 198  LYS A CA    1 
ATOM   1453  C C     . LYS A 1 198 ? -15.048 45.355  90.431  1.00 28.95  ? 198  LYS A C     1 
ATOM   1454  O O     . LYS A 1 198 ? -13.913 45.497  90.845  1.00 30.62  ? 198  LYS A O     1 
ATOM   1455  C CB    . LYS A 1 198 ? -15.425 44.832  88.029  1.00 32.36  ? 198  LYS A CB    1 
ATOM   1456  C CG    . LYS A 1 198 ? -15.669 43.836  86.901  1.00 34.12  ? 198  LYS A CG    1 
ATOM   1457  C CD    . LYS A 1 198 ? -14.553 42.884  86.788  1.00 32.05  ? 198  LYS A CD    1 
ATOM   1458  C CE    . LYS A 1 198 ? -14.671 42.028  85.545  1.00 35.14  ? 198  LYS A CE    1 
ATOM   1459  N NZ    . LYS A 1 198 ? -13.323 41.736  85.012  1.00 30.14  ? 198  LYS A NZ    1 
ATOM   1460  N N     . LEU A 1 199 ? -16.055 46.147  90.816  1.00 30.87  ? 199  LEU A N     1 
ATOM   1461  C CA    . LEU A 1 199 ? -15.840 47.205  91.806  1.00 29.28  ? 199  LEU A CA    1 
ATOM   1462  C C     . LEU A 1 199 ? -15.499 46.661  93.210  1.00 29.83  ? 199  LEU A C     1 
ATOM   1463  O O     . LEU A 1 199 ? -14.682 47.258  93.927  1.00 31.27  ? 199  LEU A O     1 
ATOM   1464  C CB    . LEU A 1 199 ? -17.053 48.113  91.879  1.00 28.63  ? 199  LEU A CB    1 
ATOM   1465  C CG    . LEU A 1 199 ? -17.359 48.940  90.633  1.00 34.97  ? 199  LEU A CG    1 
ATOM   1466  C CD1   . LEU A 1 199 ? -18.737 49.566  90.693  1.00 30.58  ? 199  LEU A CD1   1 
ATOM   1467  C CD2   . LEU A 1 199 ? -16.286 50.019  90.488  1.00 42.56  ? 199  LEU A CD2   1 
ATOM   1468  N N     . GLN A 1 200 ? -16.137 45.557  93.609  1.00 28.88  ? 200  GLN A N     1 
ATOM   1469  C CA    . GLN A 1 200 ? -15.828 44.915  94.881  1.00 29.50  ? 200  GLN A CA    1 
ATOM   1470  C C     . GLN A 1 200 ? -14.354 44.464  94.937  1.00 29.63  ? 200  GLN A C     1 
ATOM   1471  O O     . GLN A 1 200 ? -13.635 44.749  95.867  1.00 28.54  ? 200  GLN A O     1 
ATOM   1472  C CB    . GLN A 1 200 ? -16.786 43.711  95.136  1.00 28.50  ? 200  GLN A CB    1 
ATOM   1473  C CG    . GLN A 1 200 ? -18.251 44.128  95.450  1.00 29.34  ? 200  GLN A CG    1 
ATOM   1474  C CD    . GLN A 1 200 ? -19.181 42.949  95.679  1.00 29.28  ? 200  GLN A CD    1 
ATOM   1475  O OE1   . GLN A 1 200 ? -19.043 41.895  95.054  1.00 26.92  ? 200  GLN A OE1   1 
ATOM   1476  N NE2   . GLN A 1 200 ? -20.140 43.130  96.567  1.00 26.49  ? 200  GLN A NE2   1 
ATOM   1477  N N     . ASN A 1 201 ? -13.913 43.781  93.899  1.00 32.92  ? 201  ASN A N     1 
ATOM   1478  C CA    . ASN A 1 201 ? -12.510 43.377  93.768  1.00 31.68  ? 201  ASN A CA    1 
ATOM   1479  C C     . ASN A 1 201 ? -11.525 44.575  93.763  1.00 31.48  ? 201  ASN A C     1 
ATOM   1480  O O     . ASN A 1 201 ? -10.450 44.526  94.395  1.00 31.41  ? 201  ASN A O     1 
ATOM   1481  C CB    . ASN A 1 201 ? -12.328 42.499  92.510  1.00 31.83  ? 201  ASN A CB    1 
ATOM   1482  C CG    . ASN A 1 201 ? -10.849 42.165  92.234  1.00 38.69  ? 201  ASN A CG    1 
ATOM   1483  O OD1   . ASN A 1 201 ? -10.209 41.422  92.996  1.00 52.73  ? 201  ASN A OD1   1 
ATOM   1484  N ND2   . ASN A 1 201 ? -10.292 42.747  91.168  1.00 46.32  ? 201  ASN A ND2   1 
ATOM   1485  N N     . LEU A 1 202 ? -11.906 45.651  93.072  1.00 30.37  ? 202  LEU A N     1 
ATOM   1486  C CA    . LEU A 1 202 ? -11.111 46.860  93.042  1.00 29.57  ? 202  LEU A CA    1 
ATOM   1487  C C     . LEU A 1 202 ? -11.012 47.497  94.418  1.00 31.07  ? 202  LEU A C     1 
ATOM   1488  O O     . LEU A 1 202 ? -9.920  47.869  94.844  1.00 29.54  ? 202  LEU A O     1 
ATOM   1489  C CB    . LEU A 1 202 ? -11.697 47.852  92.046  1.00 28.37  ? 202  LEU A CB    1 
ATOM   1490  C CG    . LEU A 1 202 ? -10.939 49.187  91.892  1.00 31.86  ? 202  LEU A CG    1 
ATOM   1491  C CD1   . LEU A 1 202 ? -9.460  48.977  91.506  1.00 27.98  ? 202  LEU A CD1   1 
ATOM   1492  C CD2   . LEU A 1 202 ? -11.649 50.086  90.876  1.00 26.76  ? 202  LEU A CD2   1 
ATOM   1493  N N     . CYS A 1 203 ? -12.140 47.622  95.123  1.00 31.76  ? 203  CYS A N     1 
ATOM   1494  C CA    . CYS A 1 203 ? -12.111 48.238  96.457  1.00 33.12  ? 203  CYS A CA    1 
ATOM   1495  C C     . CYS A 1 203 ? -11.200 47.450  97.411  1.00 31.73  ? 203  CYS A C     1 
ATOM   1496  O O     . CYS A 1 203 ? -10.481 48.048  98.220  1.00 30.70  ? 203  CYS A O     1 
ATOM   1497  C CB    . CYS A 1 203 ? -13.527 48.431  97.033  1.00 34.38  ? 203  CYS A CB    1 
ATOM   1498  S SG    . CYS A 1 203 ? -14.504 49.662  96.108  1.00 40.52  ? 203  CYS A SG    1 
ATOM   1499  N N     . THR A 1 204 ? -11.214 46.127  97.293  1.00 31.37  ? 204  THR A N     1 
ATOM   1500  C CA    . THR A 1 204 ? -10.341 45.273  98.087  1.00 34.15  ? 204  THR A CA    1 
ATOM   1501  C C     . THR A 1 204 ? -8.855  45.549  97.759  1.00 35.10  ? 204  THR A C     1 
ATOM   1502  O O     . THR A 1 204 ? -8.025  45.723  98.648  1.00 34.27  ? 204  THR A O     1 
ATOM   1503  C CB    . THR A 1 204 ? -10.642 43.756  97.829  1.00 34.07  ? 204  THR A CB    1 
ATOM   1504  O OG1   . THR A 1 204 ? -11.976 43.436  98.216  1.00 33.07  ? 204  THR A OG1   1 
ATOM   1505  C CG2   . THR A 1 204 ? -9.678  42.846  98.613  1.00 34.04  ? 204  THR A CG2   1 
ATOM   1506  N N     . ARG A 1 205 ? -8.535  45.611  96.474  1.00 36.33  ? 205  ARG A N     1 
ATOM   1507  C CA    . ARG A 1 205 ? -7.176  45.924  96.028  1.00 36.82  ? 205  ARG A CA    1 
ATOM   1508  C C     . ARG A 1 205 ? -6.673  47.277  96.497  1.00 36.79  ? 205  ARG A C     1 
ATOM   1509  O O     . ARG A 1 205 ? -5.495  47.431  96.766  1.00 35.62  ? 205  ARG A O     1 
ATOM   1510  C CB    . ARG A 1 205 ? -7.086  45.912  94.510  1.00 35.96  ? 205  ARG A CB    1 
ATOM   1511  C CG    . ARG A 1 205 ? -7.082  44.555  93.857  1.00 40.12  ? 205  ARG A CG    1 
ATOM   1512  C CD    . ARG A 1 205 ? -6.328  44.628  92.525  1.00 40.40  ? 205  ARG A CD    1 
ATOM   1513  N NE    . ARG A 1 205 ? -7.212  45.070  91.478  1.00 39.07  ? 205  ARG A NE    1 
ATOM   1514  C CZ    . ARG A 1 205 ? -6.901  45.854  90.444  1.00 39.30  ? 205  ARG A CZ    1 
ATOM   1515  N NH1   . ARG A 1 205 ? -5.691  46.385  90.254  1.00 39.23  ? 205  ARG A NH1   1 
ATOM   1516  N NH2   . ARG A 1 205 ? -7.867  46.128  89.588  1.00 42.65  ? 205  ARG A NH2   1 
ATOM   1517  N N     . LEU A 1 206 ? -7.558  48.261  96.556  1.00 38.32  ? 206  LEU A N     1 
ATOM   1518  C CA    . LEU A 1 206 ? -7.167  49.634  96.866  1.00 39.65  ? 206  LEU A CA    1 
ATOM   1519  C C     . LEU A 1 206 ? -7.070  49.907  98.364  1.00 39.61  ? 206  LEU A C     1 
ATOM   1520  O O     . LEU A 1 206 ? -6.583  50.964  98.751  1.00 38.58  ? 206  LEU A O     1 
ATOM   1521  C CB    . LEU A 1 206 ? -8.134  50.628  96.219  1.00 38.30  ? 206  LEU A CB    1 
ATOM   1522  C CG    . LEU A 1 206 ? -8.176  50.740  94.699  1.00 33.53  ? 206  LEU A CG    1 
ATOM   1523  C CD1   . LEU A 1 206 ? -9.372  51.614  94.331  1.00 30.63  ? 206  LEU A CD1   1 
ATOM   1524  C CD2   . LEU A 1 206 ? -6.907  51.322  94.138  1.00 34.22  ? 206  LEU A CD2   1 
ATOM   1525  N N     . ASP A 1 207 ? -7.522  48.965  99.187  1.00 44.55  ? 207  ASP A N     1 
ATOM   1526  C CA    . ASP A 1 207 ? -7.474  49.094  100.649 1.00 48.87  ? 207  ASP A CA    1 
ATOM   1527  C C     . ASP A 1 207 ? -6.980  47.771  101.239 1.00 52.14  ? 207  ASP A C     1 
ATOM   1528  O O     . ASP A 1 207 ? -7.708  47.056  101.924 1.00 53.28  ? 207  ASP A O     1 
ATOM   1529  C CB    . ASP A 1 207 ? -8.862  49.445  101.168 1.00 49.01  ? 207  ASP A CB    1 
ATOM   1530  C CG    . ASP A 1 207 ? -8.912  49.610  102.668 1.00 47.28  ? 207  ASP A CG    1 
ATOM   1531  O OD1   . ASP A 1 207 ? -7.885  50.021  103.275 1.00 46.48  ? 207  ASP A OD1   1 
ATOM   1532  O OD2   . ASP A 1 207 ? -9.999  49.305  103.213 1.00 45.69  ? 207  ASP A OD2   1 
ATOM   1533  N N     . GLN A 1 208 ? -5.735  47.436  100.949 1.00 57.08  ? 208  GLN A N     1 
ATOM   1534  C CA    . GLN A 1 208 ? -5.181  46.172  101.428 1.00 61.33  ? 208  GLN A CA    1 
ATOM   1535  C C     . GLN A 1 208 ? -4.871  46.251  102.931 1.00 64.08  ? 208  GLN A C     1 
ATOM   1536  O O     . GLN A 1 208 ? -5.346  45.410  103.694 1.00 65.24  ? 208  GLN A O     1 
ATOM   1537  C CB    . GLN A 1 208 ? -3.968  45.747  100.596 1.00 61.94  ? 208  GLN A CB    1 
ATOM   1538  C CG    . GLN A 1 208 ? -4.346  44.920  99.361  1.00 63.26  ? 208  GLN A CG    1 
ATOM   1539  C CD    . GLN A 1 208 ? -3.325  45.024  98.236  1.00 64.87  ? 208  GLN A CD    1 
ATOM   1540  O OE1   . GLN A 1 208 ? -2.239  45.587  98.410  1.00 70.78  ? 208  GLN A OE1   1 
ATOM   1541  N NE2   . GLN A 1 208 ? -3.677  44.489  97.070  1.00 67.37  ? 208  GLN A NE2   1 
ATOM   1542  N N     . ASP A 1 209 ? -4.151  47.292  103.358 1.00 66.22  ? 209  ASP A N     1 
ATOM   1543  C CA    . ASP A 1 209 ? -3.865  47.503  104.791 1.00 68.36  ? 209  ASP A CA    1 
ATOM   1544  C C     . ASP A 1 209 ? -5.119  47.688  105.645 1.00 69.45  ? 209  ASP A C     1 
ATOM   1545  O O     . ASP A 1 209 ? -5.021  47.807  106.862 1.00 69.72  ? 209  ASP A O     1 
ATOM   1546  C CB    . ASP A 1 209 ? -2.917  48.692  104.997 1.00 70.01  ? 209  ASP A CB    1 
ATOM   1547  C CG    . ASP A 1 209 ? -3.465  49.991  104.425 1.00 76.31  ? 209  ASP A CG    1 
ATOM   1548  O OD1   . ASP A 1 209 ? -4.648  50.309  104.688 1.00 86.01  ? 209  ASP A OD1   1 
ATOM   1549  O OD2   . ASP A 1 209 ? -2.706  50.698  103.716 1.00 80.41  ? 209  ASP A OD2   1 
ATOM   1550  N N     . GLU A 1 210 ? -6.282  47.747  104.998 1.00 71.14  ? 210  GLU A N     1 
ATOM   1551  C CA    . GLU A 1 210 ? -7.580  47.678  105.677 1.00 71.63  ? 210  GLU A CA    1 
ATOM   1552  C C     . GLU A 1 210 ? -7.915  48.896  106.557 1.00 71.47  ? 210  GLU A C     1 
ATOM   1553  O O     . GLU A 1 210 ? -8.697  48.786  107.508 1.00 71.73  ? 210  GLU A O     1 
ATOM   1554  C CB    . GLU A 1 210 ? -7.646  46.385  106.514 1.00 72.96  ? 210  GLU A CB    1 
ATOM   1555  C CG    . GLU A 1 210 ? -9.051  45.944  106.955 1.00 74.69  ? 210  GLU A CG    1 
ATOM   1556  C CD    . GLU A 1 210 ? -9.869  45.380  105.829 1.00 77.23  ? 210  GLU A CD    1 
ATOM   1557  O OE1   . GLU A 1 210 ? -9.844  45.987  104.734 1.00 79.85  ? 210  GLU A OE1   1 
ATOM   1558  O OE2   . GLU A 1 210 ? -10.532 44.330  106.041 1.00 82.82  ? 210  GLU A OE2   1 
ATOM   1559  N N     . SER A 1 211 ? -7.350  50.057  106.220 1.00 69.96  ? 211  SER A N     1 
ATOM   1560  C CA    . SER A 1 211 ? -7.573  51.293  106.980 1.00 68.71  ? 211  SER A CA    1 
ATOM   1561  C C     . SER A 1 211 ? -9.002  51.838  106.840 1.00 66.47  ? 211  SER A C     1 
ATOM   1562  O O     . SER A 1 211 ? -9.386  52.780  107.528 1.00 64.96  ? 211  SER A O     1 
ATOM   1563  C CB    . SER A 1 211 ? -6.551  52.359  106.549 1.00 68.96  ? 211  SER A CB    1 
ATOM   1564  O OG    . SER A 1 211 ? -6.472  52.449  105.141 1.00 68.52  ? 211  SER A OG    1 
ATOM   1565  N N     . PHE A 1 212 ? -9.770  51.245  105.926 1.00 66.44  ? 212  PHE A N     1 
ATOM   1566  C CA    . PHE A 1 212 ? -11.183 51.575  105.727 1.00 66.82  ? 212  PHE A CA    1 
ATOM   1567  C C     . PHE A 1 212 ? -11.984 50.268  105.834 1.00 66.74  ? 212  PHE A C     1 
ATOM   1568  O O     . PHE A 1 212 ? -11.417 49.242  106.227 1.00 66.89  ? 212  PHE A O     1 
ATOM   1569  C CB    . PHE A 1 212 ? -11.359 52.343  104.400 1.00 66.37  ? 212  PHE A CB    1 
ATOM   1570  C CG    . PHE A 1 212 ? -10.579 53.638  104.362 1.00 66.13  ? 212  PHE A CG    1 
ATOM   1571  C CD1   . PHE A 1 212 ? -9.240  53.653  103.978 1.00 65.32  ? 212  PHE A CD1   1 
ATOM   1572  C CD2   . PHE A 1 212 ? -11.162 54.830  104.789 1.00 67.02  ? 212  PHE A CD2   1 
ATOM   1573  C CE1   . PHE A 1 212 ? -8.502  54.844  103.996 1.00 64.64  ? 212  PHE A CE1   1 
ATOM   1574  C CE2   . PHE A 1 212 ? -10.439 56.017  104.809 1.00 64.69  ? 212  PHE A CE2   1 
ATOM   1575  C CZ    . PHE A 1 212 ? -9.103  56.025  104.411 1.00 65.45  ? 212  PHE A CZ    1 
ATOM   1576  N N     . SER A 1 213 ? -13.280 50.302  105.524 1.00 66.91  ? 213  SER A N     1 
ATOM   1577  C CA    . SER A 1 213 ? -14.208 49.205  105.890 1.00 66.62  ? 213  SER A CA    1 
ATOM   1578  C C     . SER A 1 213 ? -13.714 47.809  105.498 1.00 66.10  ? 213  SER A C     1 
ATOM   1579  O O     . SER A 1 213 ? -13.148 47.628  104.425 1.00 66.44  ? 213  SER A O     1 
ATOM   1580  C CB    . SER A 1 213 ? -15.606 49.453  105.296 1.00 67.40  ? 213  SER A CB    1 
ATOM   1581  O OG    . SER A 1 213 ? -16.590 48.598  105.874 1.00 64.31  ? 213  SER A OG    1 
ATOM   1582  N N     . GLN A 1 214 ? -13.932 46.834  106.380 1.00 66.04  ? 214  GLN A N     1 
ATOM   1583  C CA    . GLN A 1 214 ? -13.556 45.441  106.116 1.00 65.28  ? 214  GLN A CA    1 
ATOM   1584  C C     . GLN A 1 214 ? -14.563 44.745  105.200 1.00 63.68  ? 214  GLN A C     1 
ATOM   1585  O O     . GLN A 1 214 ? -14.227 43.766  104.534 1.00 64.66  ? 214  GLN A O     1 
ATOM   1586  C CB    . GLN A 1 214 ? -13.414 44.639  107.431 1.00 67.33  ? 214  GLN A CB    1 
ATOM   1587  C CG    . GLN A 1 214 ? -13.326 43.097  107.228 1.00 68.01  ? 214  GLN A CG    1 
ATOM   1588  C CD    . GLN A 1 214 ? -12.904 42.331  108.471 1.00 68.87  ? 214  GLN A CD    1 
ATOM   1589  O OE1   . GLN A 1 214 ? -12.800 42.890  109.567 1.00 73.24  ? 214  GLN A OE1   1 
ATOM   1590  N NE2   . GLN A 1 214 ? -12.656 41.032  108.301 1.00 71.72  ? 214  GLN A NE2   1 
ATOM   1591  N N     . ARG A 1 215 ? -15.796 45.236  105.185 1.00 60.16  ? 215  ARG A N     1 
ATOM   1592  C CA    . ARG A 1 215 ? -16.836 44.652  104.353 1.00 57.76  ? 215  ARG A CA    1 
ATOM   1593  C C     . ARG A 1 215 ? -16.877 45.300  102.967 1.00 53.53  ? 215  ARG A C     1 
ATOM   1594  O O     . ARG A 1 215 ? -16.547 46.463  102.810 1.00 52.55  ? 215  ARG A O     1 
ATOM   1595  C CB    . ARG A 1 215 ? -18.201 44.730  105.054 1.00 58.86  ? 215  ARG A CB    1 
ATOM   1596  C CG    . ARG A 1 215 ? -19.010 46.005  104.828 1.00 61.30  ? 215  ARG A CG    1 
ATOM   1597  C CD    . ARG A 1 215 ? -20.489 45.670  104.624 1.00 62.85  ? 215  ARG A CD    1 
ATOM   1598  N NE    . ARG A 1 215 ? -21.167 46.717  103.860 1.00 67.77  ? 215  ARG A NE    1 
ATOM   1599  C CZ    . ARG A 1 215 ? -22.057 47.579  104.347 1.00 71.49  ? 215  ARG A CZ    1 
ATOM   1600  N NH1   . ARG A 1 215 ? -22.424 47.546  105.626 1.00 72.54  ? 215  ARG A NH1   1 
ATOM   1601  N NH2   . ARG A 1 215 ? -22.597 48.483  103.534 1.00 71.95  ? 215  ARG A NH2   1 
ATOM   1602  N N     . LEU A 1 216 ? -17.288 44.526  101.972 1.00 47.43  ? 216  LEU A N     1 
ATOM   1603  C CA    . LEU A 1 216 ? -17.388 45.009  100.601 1.00 43.64  ? 216  LEU A CA    1 
ATOM   1604  C C     . LEU A 1 216 ? -18.553 45.963  100.392 1.00 39.97  ? 216  LEU A C     1 
ATOM   1605  O O     . LEU A 1 216 ? -19.544 45.890  101.102 1.00 37.99  ? 216  LEU A O     1 
ATOM   1606  C CB    . LEU A 1 216 ? -17.517 43.829  99.638  1.00 42.16  ? 216  LEU A CB    1 
ATOM   1607  C CG    . LEU A 1 216 ? -16.289 42.912  99.567  1.00 39.13  ? 216  LEU A CG    1 
ATOM   1608  C CD1   . LEU A 1 216 ? -16.539 41.677  98.715  1.00 38.27  ? 216  LEU A CD1   1 
ATOM   1609  C CD2   . LEU A 1 216 ? -15.116 43.679  99.030  1.00 41.32  ? 216  LEU A CD2   1 
ATOM   1610  N N     . PRO A 1 217 ? -18.429 46.883  99.415  1.00 38.19  ? 217  PRO A N     1 
ATOM   1611  C CA    . PRO A 1 217 ? -19.605 47.655  99.033  1.00 37.00  ? 217  PRO A CA    1 
ATOM   1612  C C     . PRO A 1 217 ? -20.628 46.683  98.454  1.00 35.18  ? 217  PRO A C     1 
ATOM   1613  O O     . PRO A 1 217 ? -20.242 45.719  97.791  1.00 33.73  ? 217  PRO A O     1 
ATOM   1614  C CB    . PRO A 1 217 ? -19.075 48.610  97.966  1.00 35.31  ? 217  PRO A CB    1 
ATOM   1615  C CG    . PRO A 1 217 ? -17.815 47.955  97.443  1.00 38.24  ? 217  PRO A CG    1 
ATOM   1616  C CD    . PRO A 1 217 ? -17.242 47.226  98.606  1.00 37.28  ? 217  PRO A CD    1 
ATOM   1617  N N     . LEU A 1 218 ? -21.913 46.926  98.716  1.00 35.23  ? 218  LEU A N     1 
ATOM   1618  C CA    . LEU A 1 218 ? -22.953 45.932  98.426  1.00 34.33  ? 218  LEU A CA    1 
ATOM   1619  C C     . LEU A 1 218 ? -23.807 46.276  97.235  1.00 32.57  ? 218  LEU A C     1 
ATOM   1620  O O     . LEU A 1 218 ? -24.596 45.453  96.783  1.00 34.15  ? 218  LEU A O     1 
ATOM   1621  C CB    . LEU A 1 218 ? -23.847 45.710  99.646  1.00 34.64  ? 218  LEU A CB    1 
ATOM   1622  C CG    . LEU A 1 218 ? -23.200 45.236  100.951 1.00 35.63  ? 218  LEU A CG    1 
ATOM   1623  C CD1   . LEU A 1 218 ? -24.328 44.914  101.944 1.00 38.77  ? 218  LEU A CD1   1 
ATOM   1624  C CD2   . LEU A 1 218 ? -22.290 44.026  100.782 1.00 32.25  ? 218  LEU A CD2   1 
ATOM   1625  N N     . ASN A 1 219 ? -23.664 47.488  96.731  1.00 31.99  ? 219  ASN A N     1 
ATOM   1626  C CA    . ASN A 1 219 ? -24.297 47.898  95.479  1.00 32.95  ? 219  ASN A CA    1 
ATOM   1627  C C     . ASN A 1 219 ? -23.409 48.915  94.752  1.00 32.21  ? 219  ASN A C     1 
ATOM   1628  O O     . ASN A 1 219 ? -22.388 49.356  95.289  1.00 31.99  ? 219  ASN A O     1 
ATOM   1629  C CB    . ASN A 1 219 ? -25.706 48.446  95.716  1.00 32.26  ? 219  ASN A CB    1 
ATOM   1630  C CG    . ASN A 1 219 ? -25.759 49.540  96.764  1.00 34.63  ? 219  ASN A CG    1 
ATOM   1631  O OD1   . ASN A 1 219 ? -25.294 50.670  96.558  1.00 36.05  ? 219  ASN A OD1   1 
ATOM   1632  N ND2   . ASN A 1 219 ? -26.376 49.220  97.888  1.00 36.02  ? 219  ASN A ND2   1 
ATOM   1633  N N     . ILE A 1 220 ? -23.797 49.292  93.543  1.00 33.27  ? 220  ILE A N     1 
ATOM   1634  C CA    . ILE A 1 220 ? -22.970 50.191  92.751  1.00 35.49  ? 220  ILE A CA    1 
ATOM   1635  C C     . ILE A 1 220 ? -22.788 51.572  93.394  1.00 35.79  ? 220  ILE A C     1 
ATOM   1636  O O     . ILE A 1 220 ? -21.698 52.127  93.364  1.00 36.26  ? 220  ILE A O     1 
ATOM   1637  C CB    . ILE A 1 220 ? -23.480 50.277  91.308  1.00 34.92  ? 220  ILE A CB    1 
ATOM   1638  C CG1   . ILE A 1 220 ? -23.192 48.939  90.620  1.00 33.41  ? 220  ILE A CG1   1 
ATOM   1639  C CG2   . ILE A 1 220 ? -22.787 51.433  90.575  1.00 35.82  ? 220  ILE A CG2   1 
ATOM   1640  C CD1   . ILE A 1 220 ? -23.896 48.740  89.397  1.00 37.40  ? 220  ILE A CD1   1 
ATOM   1641  N N     . GLU A 1 221 ? -23.853 52.101  93.988  1.00 37.16  ? 221  GLU A N     1 
ATOM   1642  C CA    . GLU A 1 221 ? -23.824 53.422  94.613  1.00 37.25  ? 221  GLU A CA    1 
ATOM   1643  C C     . GLU A 1 221 ? -22.830 53.440  95.776  1.00 35.64  ? 221  GLU A C     1 
ATOM   1644  O O     . GLU A 1 221 ? -22.027 54.366  95.900  1.00 32.32  ? 221  GLU A O     1 
ATOM   1645  C CB    . GLU A 1 221 ? -25.234 53.801  95.080  1.00 38.71  ? 221  GLU A CB    1 
ATOM   1646  C CG    . GLU A 1 221 ? -25.499 55.292  95.185  1.00 43.41  ? 221  GLU A CG    1 
ATOM   1647  C CD    . GLU A 1 221 ? -26.755 55.620  96.015  1.00 47.55  ? 221  GLU A CD    1 
ATOM   1648  O OE1   . GLU A 1 221 ? -27.683 54.773  96.055  1.00 59.27  ? 221  GLU A OE1   1 
ATOM   1649  O OE2   . GLU A 1 221 ? -26.805 56.724  96.620  1.00 58.99  ? 221  GLU A OE2   1 
ATOM   1650  N N     . GLU A 1 222 ? -22.886 52.411  96.617  1.00 34.19  ? 222  GLU A N     1 
ATOM   1651  C CA    . GLU A 1 222 ? -21.921 52.248  97.713  1.00 34.64  ? 222  GLU A CA    1 
ATOM   1652  C C     . GLU A 1 222 ? -20.483 52.070  97.253  1.00 32.09  ? 222  GLU A C     1 
ATOM   1653  O O     . GLU A 1 222 ? -19.560 52.556  97.924  1.00 28.44  ? 222  GLU A O     1 
ATOM   1654  C CB    . GLU A 1 222 ? -22.237 51.022  98.551  1.00 33.80  ? 222  GLU A CB    1 
ATOM   1655  C CG    . GLU A 1 222 ? -23.477 51.094  99.359  1.00 40.24  ? 222  GLU A CG    1 
ATOM   1656  C CD    . GLU A 1 222 ? -23.571 49.944  100.380 1.00 41.98  ? 222  GLU A CD    1 
ATOM   1657  O OE1   . GLU A 1 222 ? -22.615 49.117  100.478 1.00 43.71  ? 222  GLU A OE1   1 
ATOM   1658  O OE2   . GLU A 1 222 ? -24.601 49.892  101.100 1.00 51.44  ? 222  GLU A OE2   1 
ATOM   1659  N N     . ALA A 1 223 ? -20.299 51.324  96.159  1.00 30.30  ? 223  ALA A N     1 
ATOM   1660  C CA    . ALA A 1 223 ? -18.973 51.089  95.607  1.00 32.50  ? 223  ALA A CA    1 
ATOM   1661  C C     . ALA A 1 223 ? -18.376 52.363  94.997  1.00 32.46  ? 223  ALA A C     1 
ATOM   1662  O O     . ALA A 1 223 ? -17.170 52.610  95.120  1.00 30.18  ? 223  ALA A O     1 
ATOM   1663  C CB    . ALA A 1 223 ? -19.007 50.009  94.591  1.00 33.10  ? 223  ALA A CB    1 
ATOM   1664  N N     . LYS A 1 224 ? -19.222 53.147  94.325  1.00 32.67  ? 224  LYS A N     1 
ATOM   1665  C CA    . LYS A 1 224 ? -18.813 54.419  93.745  1.00 33.62  ? 224  LYS A CA    1 
ATOM   1666  C C     . LYS A 1 224 ? -18.331 55.356  94.862  1.00 34.33  ? 224  LYS A C     1 
ATOM   1667  O O     . LYS A 1 224 ? -17.241 55.954  94.780  1.00 34.27  ? 224  LYS A O     1 
ATOM   1668  C CB    . LYS A 1 224 ? -19.980 55.050  92.960  1.00 32.24  ? 224  LYS A CB    1 
ATOM   1669  C CG    . LYS A 1 224 ? -19.783 56.487  92.562  1.00 32.62  ? 224  LYS A CG    1 
ATOM   1670  C CD    . LYS A 1 224 ? -20.827 56.923  91.540  1.00 35.67  ? 224  LYS A CD    1 
ATOM   1671  C CE    . LYS A 1 224 ? -20.676 58.424  91.220  1.00 38.65  ? 224  LYS A CE    1 
ATOM   1672  N NZ    . LYS A 1 224 ? -21.419 58.852  90.006  1.00 40.02  ? 224  LYS A NZ    1 
ATOM   1673  N N     . ASP A 1 225 ? -19.140 55.449  95.911  1.00 32.84  ? 225  ASP A N     1 
ATOM   1674  C CA    . ASP A 1 225 ? -18.784 56.193  97.103  1.00 34.21  ? 225  ASP A CA    1 
ATOM   1675  C C     . ASP A 1 225 ? -17.493 55.706  97.823  1.00 33.93  ? 225  ASP A C     1 
ATOM   1676  O O     . ASP A 1 225 ? -16.665 56.521  98.309  1.00 32.87  ? 225  ASP A O     1 
ATOM   1677  C CB    . ASP A 1 225 ? -19.965 56.124  98.083  1.00 35.32  ? 225  ASP A CB    1 
ATOM   1678  C CG    . ASP A 1 225 ? -19.753 56.987  99.304  1.00 40.18  ? 225  ASP A CG    1 
ATOM   1679  O OD1   . ASP A 1 225 ? -19.850 58.233  99.159  1.00 56.17  ? 225  ASP A OD1   1 
ATOM   1680  O OD2   . ASP A 1 225 ? -19.492 56.426  100.398 1.00 54.67  ? 225  ASP A OD2   1 
ATOM   1681  N N     . ARG A 1 226 ? -17.331 54.392  97.950  1.00 33.19  ? 226  ARG A N     1 
ATOM   1682  C CA    . ARG A 1 226 ? -16.125 53.885  98.568  1.00 34.57  ? 226  ARG A CA    1 
ATOM   1683  C C     . ARG A 1 226 ? -14.887 54.148  97.687  1.00 33.85  ? 226  ARG A C     1 
ATOM   1684  O O     . ARG A 1 226 ? -13.821 54.428  98.186  1.00 30.49  ? 226  ARG A O     1 
ATOM   1685  C CB    . ARG A 1 226 ? -16.198 52.410  98.934  1.00 32.26  ? 226  ARG A CB    1 
ATOM   1686  C CG    . ARG A 1 226 ? -14.861 51.956  99.490  1.00 36.48  ? 226  ARG A CG    1 
ATOM   1687  C CD    . ARG A 1 226 ? -14.872 51.052  100.682 1.00 44.93  ? 226  ARG A CD    1 
ATOM   1688  N NE    . ARG A 1 226 ? -16.191 50.859  101.255 1.00 47.16  ? 226  ARG A NE    1 
ATOM   1689  C CZ    . ARG A 1 226 ? -16.643 49.677  101.646 1.00 47.43  ? 226  ARG A CZ    1 
ATOM   1690  N NH1   . ARG A 1 226 ? -15.871 48.605  101.538 1.00 44.91  ? 226  ARG A NH1   1 
ATOM   1691  N NH2   . ARG A 1 226 ? -17.870 49.570  102.145 1.00 47.67  ? 226  ARG A NH2   1 
ATOM   1692  N N     . LEU A 1 227 ? -15.061 54.055  96.382  1.00 35.23  ? 227  LEU A N     1 
ATOM   1693  C CA    . LEU A 1 227 ? -13.983 54.317  95.456  1.00 36.05  ? 227  LEU A CA    1 
ATOM   1694  C C     . LEU A 1 227 ? -13.548 55.765  95.579  1.00 33.54  ? 227  LEU A C     1 
ATOM   1695  O O     . LEU A 1 227 ? -12.375 56.065  95.568  1.00 31.60  ? 227  LEU A O     1 
ATOM   1696  C CB    . LEU A 1 227 ? -14.436 54.019  94.027  1.00 36.97  ? 227  LEU A CB    1 
ATOM   1697  C CG    . LEU A 1 227 ? -13.441 53.467  93.009  1.00 41.74  ? 227  LEU A CG    1 
ATOM   1698  C CD1   . LEU A 1 227 ? -13.852 53.888  91.598  1.00 49.65  ? 227  LEU A CD1   1 
ATOM   1699  C CD2   . LEU A 1 227 ? -12.023 53.930  93.244  1.00 44.06  ? 227  LEU A CD2   1 
ATOM   1700  N N     . ARG A 1 228 ? -14.521 56.657  95.697  1.00 35.34  ? 228  ARG A N     1 
ATOM   1701  C CA    . ARG A 1 228 ? -14.263 58.075  95.875  1.00 35.66  ? 228  ARG A CA    1 
ATOM   1702  C C     . ARG A 1 228 ? -13.379 58.313  97.093  1.00 33.69  ? 228  ARG A C     1 
ATOM   1703  O O     . ARG A 1 228 ? -12.423 59.069  97.022  1.00 33.77  ? 228  ARG A O     1 
ATOM   1704  C CB    . ARG A 1 228 ? -15.589 58.802  96.029  1.00 34.42  ? 228  ARG A CB    1 
ATOM   1705  C CG    . ARG A 1 228 ? -15.509 60.286  96.049  1.00 35.73  ? 228  ARG A CG    1 
ATOM   1706  C CD    . ARG A 1 228 ? -16.824 60.877  96.514  1.00 41.58  ? 228  ARG A CD    1 
ATOM   1707  N NE    . ARG A 1 228 ? -16.752 61.295  97.918  1.00 50.20  ? 228  ARG A NE    1 
ATOM   1708  C CZ    . ARG A 1 228 ? -17.034 60.535  98.975  1.00 51.63  ? 228  ARG A CZ    1 
ATOM   1709  N NH1   . ARG A 1 228 ? -17.432 59.287  98.845  1.00 51.68  ? 228  ARG A NH1   1 
ATOM   1710  N NH2   . ARG A 1 228 ? -16.909 61.038  100.192 1.00 55.54  ? 228  ARG A NH2   1 
ATOM   1711  N N     . ILE A 1 229 ? -13.701 57.657  98.199  1.00 34.31  ? 229  ILE A N     1 
ATOM   1712  C CA    . ILE A 1 229 ? -12.971 57.843  99.467  1.00 34.99  ? 229  ILE A CA    1 
ATOM   1713  C C     . ILE A 1 229 ? -11.562 57.235  99.379  1.00 33.44  ? 229  ILE A C     1 
ATOM   1714  O O     . ILE A 1 229 ? -10.590 57.828  99.862  1.00 33.42  ? 229  ILE A O     1 
ATOM   1715  C CB    . ILE A 1 229 ? -13.728 57.208  100.709 1.00 34.68  ? 229  ILE A CB    1 
ATOM   1716  C CG1   . ILE A 1 229 ? -15.025 57.947  101.004 1.00 38.71  ? 229  ILE A CG1   1 
ATOM   1717  C CG2   . ILE A 1 229 ? -12.891 57.278  101.982 1.00 37.92  ? 229  ILE A CG2   1 
ATOM   1718  C CD1   . ILE A 1 229 ? -15.994 57.171  101.859 1.00 38.72  ? 229  ILE A CD1   1 
ATOM   1719  N N     . LEU A 1 230 ? -11.453 56.041  98.793  1.00 31.18  ? 230  LEU A N     1 
ATOM   1720  C CA    . LEU A 1 230 ? -10.157 55.376  98.707  1.00 32.58  ? 230  LEU A CA    1 
ATOM   1721  C C     . LEU A 1 230 ? -9.191  56.147  97.784  1.00 32.93  ? 230  LEU A C     1 
ATOM   1722  O O     . LEU A 1 230 ? -8.002  56.212  98.068  1.00 34.50  ? 230  LEU A O     1 
ATOM   1723  C CB    . LEU A 1 230 ? -10.288 53.902  98.280  1.00 29.75  ? 230  LEU A CB    1 
ATOM   1724  C CG    . LEU A 1 230 ? -10.967 52.902  99.225  1.00 31.77  ? 230  LEU A CG    1 
ATOM   1725  C CD1   . LEU A 1 230 ? -11.170 51.590  98.557  1.00 30.74  ? 230  LEU A CD1   1 
ATOM   1726  C CD2   . LEU A 1 230 ? -10.209 52.700  100.504 1.00 34.59  ? 230  LEU A CD2   1 
ATOM   1727  N N     . MET A 1 231 ? -9.699  56.767  96.724  1.00 32.38  ? 231  MET A N     1 
ATOM   1728  C CA    . MET A 1 231 ? -8.841  57.528  95.804  1.00 33.38  ? 231  MET A CA    1 
ATOM   1729  C C     . MET A 1 231 ? -8.412  58.852  96.386  1.00 34.09  ? 231  MET A C     1 
ATOM   1730  O O     . MET A 1 231 ? -7.346  59.396  96.073  1.00 35.46  ? 231  MET A O     1 
ATOM   1731  C CB    . MET A 1 231 ? -9.574  57.805  94.487  1.00 33.22  ? 231  MET A CB    1 
ATOM   1732  C CG    . MET A 1 231 ? -9.966  56.542  93.738  1.00 33.98  ? 231  MET A CG    1 
ATOM   1733  S SD    . MET A 1 231 ? -8.575  55.459  93.407  1.00 30.49  ? 231  MET A SD    1 
ATOM   1734  C CE    . MET A 1 231 ? -7.619  56.522  92.323  1.00 31.62  ? 231  MET A CE    1 
ATOM   1735  N N     . LEU A 1 232 ? -9.279  59.395  97.214  1.00 35.17  ? 232  LEU A N     1 
ATOM   1736  C CA    . LEU A 1 232 ? -8.997  60.633  97.913  1.00 35.89  ? 232  LEU A CA    1 
ATOM   1737  C C     . LEU A 1 232 ? -8.021  60.398  99.068  1.00 34.63  ? 232  LEU A C     1 
ATOM   1738  O O     . LEU A 1 232 ? -6.988  61.060  99.177  1.00 34.29  ? 232  LEU A O     1 
ATOM   1739  C CB    . LEU A 1 232 ? -10.320 61.235  98.418  1.00 37.55  ? 232  LEU A CB    1 
ATOM   1740  C CG    . LEU A 1 232 ? -10.221 62.614  99.080  1.00 39.59  ? 232  LEU A CG    1 
ATOM   1741  C CD1   . LEU A 1 232 ? -9.709  63.685  98.088  1.00 42.05  ? 232  LEU A CD1   1 
ATOM   1742  C CD2   . LEU A 1 232 ? -11.577 63.009  99.694  1.00 38.56  ? 232  LEU A CD2   1 
ATOM   1743  N N     . ARG A 1 233 ? -8.337  59.427  99.919  1.00 34.55  ? 233  ARG A N     1 
ATOM   1744  C CA    . ARG A 1 233 ? -7.589  59.225  101.153 1.00 33.97  ? 233  ARG A CA    1 
ATOM   1745  C C     . ARG A 1 233 ? -6.423  58.267  101.057 1.00 33.74  ? 233  ARG A C     1 
ATOM   1746  O O     . ARG A 1 233 ? -5.556  58.281  101.930 1.00 36.80  ? 233  ARG A O     1 
ATOM   1747  C CB    . ARG A 1 233 ? -8.516  58.747  102.276 1.00 35.03  ? 233  ARG A CB    1 
ATOM   1748  C CG    . ARG A 1 233 ? -9.443  59.837  102.841 1.00 41.03  ? 233  ARG A CG    1 
ATOM   1749  C CD    . ARG A 1 233 ? -8.676  60.975  103.559 1.00 48.75  ? 233  ARG A CD    1 
ATOM   1750  N NE    . ARG A 1 233 ? -7.680  60.466  104.510 1.00 50.48  ? 233  ARG A NE    1 
ATOM   1751  C CZ    . ARG A 1 233 ? -7.956  60.002  105.724 1.00 48.25  ? 233  ARG A CZ    1 
ATOM   1752  N NH1   . ARG A 1 233 ? -9.195  59.974  106.176 1.00 50.70  ? 233  ARG A NH1   1 
ATOM   1753  N NH2   . ARG A 1 233 ? -6.972  59.553  106.484 1.00 49.33  ? 233  ARG A NH2   1 
ATOM   1754  N N     . LYS A 1 234 ? -6.403  57.400  100.053 1.00 31.71  ? 234  LYS A N     1 
ATOM   1755  C CA    . LYS A 1 234 ? -5.342  56.403  99.951  1.00 32.71  ? 234  LYS A CA    1 
ATOM   1756  C C     . LYS A 1 234 ? -4.513  56.549  98.711  1.00 29.85  ? 234  LYS A C     1 
ATOM   1757  O O     . LYS A 1 234 ? -3.339  56.190  98.705  1.00 28.58  ? 234  LYS A O     1 
ATOM   1758  C CB    . LYS A 1 234 ? -5.925  54.988  99.949  1.00 32.34  ? 234  LYS A CB    1 
ATOM   1759  C CG    . LYS A 1 234 ? -6.577  54.566  101.232 1.00 39.48  ? 234  LYS A CG    1 
ATOM   1760  C CD    . LYS A 1 234 ? -6.428  53.067  101.414 1.00 41.27  ? 234  LYS A CD    1 
ATOM   1761  C CE    . LYS A 1 234 ? -4.998  52.675  101.898 1.00 51.02  ? 234  LYS A CE    1 
ATOM   1762  N NZ    . LYS A 1 234 ? -4.654  51.252  101.555 1.00 49.93  ? 234  LYS A NZ    1 
ATOM   1763  N N     . HIS A 1 235 ? -5.124  57.062  97.648  1.00 28.74  ? 235  HIS A N     1 
ATOM   1764  C CA    . HIS A 1 235 ? -4.479  57.068  96.350  1.00 28.30  ? 235  HIS A CA    1 
ATOM   1765  C C     . HIS A 1 235 ? -4.569  58.400  95.648  1.00 26.47  ? 235  HIS A C     1 
ATOM   1766  O O     . HIS A 1 235 ? -4.859  58.432  94.462  1.00 25.22  ? 235  HIS A O     1 
ATOM   1767  C CB    . HIS A 1 235 ? -5.055  55.940  95.482  1.00 27.54  ? 235  HIS A CB    1 
ATOM   1768  C CG    . HIS A 1 235 ? -4.842  54.587  96.086  1.00 29.52  ? 235  HIS A CG    1 
ATOM   1769  N ND1   . HIS A 1 235 ? -3.582  54.052  96.269  1.00 34.19  ? 235  HIS A ND1   1 
ATOM   1770  C CD2   . HIS A 1 235 ? -5.710  53.713  96.653  1.00 30.98  ? 235  HIS A CD2   1 
ATOM   1771  C CE1   . HIS A 1 235 ? -3.692  52.874  96.858  1.00 33.14  ? 235  HIS A CE1   1 
ATOM   1772  N NE2   . HIS A 1 235 ? -4.973  52.647  97.106  1.00 31.07  ? 235  HIS A NE2   1 
ATOM   1773  N N     . PRO A 1 236 ? -4.264  59.499  96.371  1.00 23.57  ? 236  PRO A N     1 
ATOM   1774  C CA    . PRO A 1 236 ? -4.303  60.787  95.708  1.00 25.47  ? 236  PRO A CA    1 
ATOM   1775  C C     . PRO A 1 236 ? -3.199  60.848  94.671  1.00 25.66  ? 236  PRO A C     1 
ATOM   1776  O O     . PRO A 1 236 ? -2.256  60.068  94.757  1.00 26.55  ? 236  PRO A O     1 
ATOM   1777  C CB    . PRO A 1 236 ? -4.076  61.766  96.860  1.00 27.13  ? 236  PRO A CB    1 
ATOM   1778  C CG    . PRO A 1 236 ? -3.302  60.988  97.852  1.00 21.15  ? 236  PRO A CG    1 
ATOM   1779  C CD    . PRO A 1 236 ? -3.864  59.642  97.784  1.00 22.08  ? 236  PRO A CD    1 
ATOM   1780  N N     . ARG A 1 237 ? -3.350  61.712  93.669  1.00 24.43  ? 237  ARG A N     1 
ATOM   1781  C CA    . ARG A 1 237 ? -2.372  61.855  92.571  1.00 25.58  ? 237  ARG A CA    1 
ATOM   1782  C C     . ARG A 1 237 ? -1.981  60.550  91.846  1.00 24.10  ? 237  ARG A C     1 
ATOM   1783  O O     . ARG A 1 237 ? -0.837  60.355  91.477  1.00 24.39  ? 237  ARG A O     1 
ATOM   1784  C CB    . ARG A 1 237 ? -1.124  62.592  93.063  1.00 24.39  ? 237  ARG A CB    1 
ATOM   1785  C CG    . ARG A 1 237 ? -1.475  63.847  93.826  1.00 25.39  ? 237  ARG A CG    1 
ATOM   1786  C CD    . ARG A 1 237 ? -0.223  64.663  94.142  1.00 28.91  ? 237  ARG A CD    1 
ATOM   1787  N NE    . ARG A 1 237 ? 0.737   63.886  94.933  1.00 28.55  ? 237  ARG A NE    1 
ATOM   1788  C CZ    . ARG A 1 237 ? 1.996   64.240  95.129  1.00 26.66  ? 237  ARG A CZ    1 
ATOM   1789  N NH1   . ARG A 1 237 ? 2.443   65.381  94.652  1.00 29.03  ? 237  ARG A NH1   1 
ATOM   1790  N NH2   . ARG A 1 237 ? 2.798   63.472  95.854  1.00 32.58  ? 237  ARG A NH2   1 
ATOM   1791  N N     . SER A 1 238 ? -2.971  59.700  91.622  1.00 25.03  ? 238  SER A N     1 
ATOM   1792  C CA    . SER A 1 238 ? -2.806  58.419  90.957  1.00 24.62  ? 238  SER A CA    1 
ATOM   1793  C C     . SER A 1 238 ? -3.642  58.333  89.720  1.00 22.17  ? 238  SER A C     1 
ATOM   1794  O O     . SER A 1 238 ? -4.565  59.103  89.534  1.00 22.78  ? 238  SER A O     1 
ATOM   1795  C CB    . SER A 1 238 ? -3.219  57.285  91.907  1.00 24.39  ? 238  SER A CB    1 
ATOM   1796  O OG    . SER A 1 238 ? -4.606  57.292  92.126  1.00 28.53  ? 238  SER A OG    1 
ATOM   1797  N N     . LEU A 1 239 ? -3.327  57.375  88.868  1.00 22.82  ? 239  LEU A N     1 
ATOM   1798  C CA    . LEU A 1 239 ? -4.135  57.111  87.700  1.00 23.41  ? 239  LEU A CA    1 
ATOM   1799  C C     . LEU A 1 239 ? -4.883  55.778  87.837  1.00 24.42  ? 239  LEU A C     1 
ATOM   1800  O O     . LEU A 1 239 ? -4.308  54.754  88.255  1.00 24.71  ? 239  LEU A O     1 
ATOM   1801  C CB    . LEU A 1 239 ? -3.252  57.064  86.470  1.00 23.41  ? 239  LEU A CB    1 
ATOM   1802  C CG    . LEU A 1 239 ? -3.956  56.826  85.148  1.00 22.21  ? 239  LEU A CG    1 
ATOM   1803  C CD1   . LEU A 1 239 ? -4.708  58.076  84.669  1.00 24.24  ? 239  LEU A CD1   1 
ATOM   1804  C CD2   . LEU A 1 239 ? -2.961  56.368  84.109  1.00 26.45  ? 239  LEU A CD2   1 
ATOM   1805  N N     . LEU A 1 240 ? -6.158  55.813  87.442  1.00 24.15  ? 240  LEU A N     1 
ATOM   1806  C CA    . LEU A 1 240 ? -6.984  54.623  87.280  1.00 26.93  ? 240  LEU A CA    1 
ATOM   1807  C C     . LEU A 1 240 ? -7.053  54.303  85.797  1.00 25.66  ? 240  LEU A C     1 
ATOM   1808  O O     . LEU A 1 240 ? -7.394  55.166  85.004  1.00 26.23  ? 240  LEU A O     1 
ATOM   1809  C CB    . LEU A 1 240 ? -8.403  54.918  87.796  1.00 28.06  ? 240  LEU A CB    1 
ATOM   1810  C CG    . LEU A 1 240 ? -9.217  53.879  88.525  1.00 32.93  ? 240  LEU A CG    1 
ATOM   1811  C CD1   . LEU A 1 240 ? -8.419  53.191  89.622  1.00 41.12  ? 240  LEU A CD1   1 
ATOM   1812  C CD2   . LEU A 1 240 ? -10.435 54.598  89.141  1.00 35.48  ? 240  LEU A CD2   1 
ATOM   1813  N N     . ILE A 1 241 ? -6.708  53.079  85.428  1.00 25.99  ? 241  ILE A N     1 
ATOM   1814  C CA    . ILE A 1 241 ? -6.803  52.628  84.055  1.00 26.45  ? 241  ILE A CA    1 
ATOM   1815  C C     . ILE A 1 241 ? -7.918  51.597  83.908  1.00 25.46  ? 241  ILE A C     1 
ATOM   1816  O O     . ILE A 1 241 ? -7.866  50.548  84.525  1.00 24.84  ? 241  ILE A O     1 
ATOM   1817  C CB    . ILE A 1 241 ? -5.487  52.029  83.553  1.00 25.82  ? 241  ILE A CB    1 
ATOM   1818  C CG1   . ILE A 1 241 ? -4.332  52.969  83.865  1.00 26.18  ? 241  ILE A CG1   1 
ATOM   1819  C CG2   . ILE A 1 241 ? -5.583  51.764  82.035  1.00 24.81  ? 241  ILE A CG2   1 
ATOM   1820  C CD1   . ILE A 1 241 ? -2.965  52.421  83.479  1.00 29.85  ? 241  ILE A CD1   1 
ATOM   1821  N N     . LEU A 1 242 ? -8.908  51.929  83.072  1.00 25.23  ? 242  LEU A N     1 
ATOM   1822  C CA    . LEU A 1 242 ? -10.093 51.092  82.841  1.00 26.37  ? 242  LEU A CA    1 
ATOM   1823  C C     . LEU A 1 242 ? -10.049 50.473  81.452  1.00 26.50  ? 242  LEU A C     1 
ATOM   1824  O O     . LEU A 1 242 ? -10.101 51.176  80.454  1.00 25.49  ? 242  LEU A O     1 
ATOM   1825  C CB    . LEU A 1 242 ? -11.362 51.919  82.989  1.00 25.67  ? 242  LEU A CB    1 
ATOM   1826  C CG    . LEU A 1 242 ? -11.491 52.740  84.272  1.00 28.64  ? 242  LEU A CG    1 
ATOM   1827  C CD1   . LEU A 1 242 ? -12.803 53.540  84.204  1.00 28.08  ? 242  LEU A CD1   1 
ATOM   1828  C CD2   . LEU A 1 242 ? -11.424 51.852  85.488  1.00 22.63  ? 242  LEU A CD2   1 
ATOM   1829  N N     . ASP A 1 243 ? -9.908  49.160  81.393  1.00 29.86  ? 243  ASP A N     1 
ATOM   1830  C CA    . ASP A 1 243 ? -9.700  48.489  80.119  1.00 30.84  ? 243  ASP A CA    1 
ATOM   1831  C C     . ASP A 1 243 ? -11.007 47.983  79.561  1.00 30.64  ? 243  ASP A C     1 
ATOM   1832  O O     . ASP A 1 243 ? -11.647 47.154  80.163  1.00 31.86  ? 243  ASP A O     1 
ATOM   1833  C CB    . ASP A 1 243 ? -8.680  47.353  80.258  1.00 33.30  ? 243  ASP A CB    1 
ATOM   1834  C CG    . ASP A 1 243 ? -8.351  46.687  78.927  1.00 33.16  ? 243  ASP A CG    1 
ATOM   1835  O OD1   . ASP A 1 243 ? -8.185  47.393  77.910  1.00 41.61  ? 243  ASP A OD1   1 
ATOM   1836  O OD2   . ASP A 1 243 ? -8.236  45.448  78.907  1.00 40.55  ? 243  ASP A OD2   1 
ATOM   1837  N N     . ASP A 1 244 ? -11.374 48.499  78.385  1.00 30.68  ? 244  ASP A N     1 
ATOM   1838  C CA    . ASP A 1 244 ? -12.537 48.046  77.616  1.00 31.08  ? 244  ASP A CA    1 
ATOM   1839  C C     . ASP A 1 244 ? -13.917 48.376  78.235  1.00 31.89  ? 244  ASP A C     1 
ATOM   1840  O O     . ASP A 1 244 ? -14.669 47.496  78.701  1.00 30.71  ? 244  ASP A O     1 
ATOM   1841  C CB    . ASP A 1 244 ? -12.449 46.564  77.290  1.00 31.61  ? 244  ASP A CB    1 
ATOM   1842  C CG    . ASP A 1 244 ? -13.358 46.190  76.133  1.00 33.44  ? 244  ASP A CG    1 
ATOM   1843  O OD1   . ASP A 1 244 ? -13.612 47.093  75.276  1.00 32.07  ? 244  ASP A OD1   1 
ATOM   1844  O OD2   . ASP A 1 244 ? -13.798 44.997  76.082  1.00 37.34  ? 244  ASP A OD2   1 
ATOM   1845  N N     . VAL A 1 245 ? -14.210 49.666  78.257  1.00 31.78  ? 245  VAL A N     1 
ATOM   1846  C CA    . VAL A 1 245 ? -15.462 50.178  78.764  1.00 31.78  ? 245  VAL A CA    1 
ATOM   1847  C C     . VAL A 1 245 ? -16.421 50.172  77.597  1.00 31.70  ? 245  VAL A C     1 
ATOM   1848  O O     . VAL A 1 245 ? -16.084 50.702  76.534  1.00 30.49  ? 245  VAL A O     1 
ATOM   1849  C CB    . VAL A 1 245 ? -15.319 51.621  79.307  1.00 30.45  ? 245  VAL A CB    1 
ATOM   1850  C CG1   . VAL A 1 245 ? -16.706 52.206  79.734  1.00 26.78  ? 245  VAL A CG1   1 
ATOM   1851  C CG2   . VAL A 1 245 ? -14.351 51.630  80.461  1.00 32.15  ? 245  VAL A CG2   1 
ATOM   1852  N N     . TRP A 1 246 ? -17.605 49.575  77.790  1.00 31.29  ? 246  TRP A N     1 
ATOM   1853  C CA    . TRP A 1 246 ? -18.618 49.465  76.712  1.00 32.51  ? 246  TRP A CA    1 
ATOM   1854  C C     . TRP A 1 246 ? -19.783 50.429  76.857  1.00 32.09  ? 246  TRP A C     1 
ATOM   1855  O O     . TRP A 1 246 ? -20.489 50.710  75.884  1.00 31.44  ? 246  TRP A O     1 
ATOM   1856  C CB    . TRP A 1 246 ? -19.213 48.069  76.668  1.00 33.48  ? 246  TRP A CB    1 
ATOM   1857  C CG    . TRP A 1 246 ? -18.334 47.048  76.038  1.00 31.90  ? 246  TRP A CG    1 
ATOM   1858  C CD1   . TRP A 1 246 ? -17.128 46.673  76.451  1.00 31.76  ? 246  TRP A CD1   1 
ATOM   1859  C CD2   . TRP A 1 246 ? -18.636 46.268  74.880  1.00 34.34  ? 246  TRP A CD2   1 
ATOM   1860  N NE1   . TRP A 1 246 ? -16.635 45.687  75.653  1.00 34.89  ? 246  TRP A NE1   1 
ATOM   1861  C CE2   . TRP A 1 246 ? -17.541 45.416  74.669  1.00 38.78  ? 246  TRP A CE2   1 
ATOM   1862  C CE3   . TRP A 1 246 ? -19.738 46.198  74.010  1.00 33.73  ? 246  TRP A CE3   1 
ATOM   1863  C CZ2   . TRP A 1 246 ? -17.491 44.496  73.615  1.00 36.01  ? 246  TRP A CZ2   1 
ATOM   1864  C CZ3   . TRP A 1 246 ? -19.701 45.296  72.971  1.00 35.55  ? 246  TRP A CZ3   1 
ATOM   1865  C CH2   . TRP A 1 246 ? -18.582 44.454  72.777  1.00 38.88  ? 246  TRP A CH2   1 
ATOM   1866  N N     . ASP A 1 247 ? -20.011 50.920  78.065  1.00 32.60  ? 247  ASP A N     1 
ATOM   1867  C CA    . ASP A 1 247 ? -21.184 51.741  78.316  1.00 33.93  ? 247  ASP A CA    1 
ATOM   1868  C C     . ASP A 1 247 ? -20.875 52.987  79.129  1.00 33.59  ? 247  ASP A C     1 
ATOM   1869  O O     . ASP A 1 247 ? -20.084 52.951  80.062  1.00 32.00  ? 247  ASP A O     1 
ATOM   1870  C CB    . ASP A 1 247 ? -22.218 50.898  79.041  1.00 34.71  ? 247  ASP A CB    1 
ATOM   1871  C CG    . ASP A 1 247 ? -22.813 49.855  78.134  1.00 36.92  ? 247  ASP A CG    1 
ATOM   1872  O OD1   . ASP A 1 247 ? -23.586 50.254  77.257  1.00 46.02  ? 247  ASP A OD1   1 
ATOM   1873  O OD2   . ASP A 1 247 ? -22.469 48.672  78.263  1.00 41.11  ? 247  ASP A OD2   1 
ATOM   1874  N N     . SER A 1 248 ? -21.522 54.090  78.765  1.00 32.24  ? 248  SER A N     1 
ATOM   1875  C CA    . SER A 1 248 ? -21.356 55.349  79.481  1.00 32.28  ? 248  SER A CA    1 
ATOM   1876  C C     . SER A 1 248 ? -21.819 55.269  80.956  1.00 31.94  ? 248  SER A C     1 
ATOM   1877  O O     . SER A 1 248 ? -21.260 55.969  81.824  1.00 28.92  ? 248  SER A O     1 
ATOM   1878  C CB    . SER A 1 248 ? -22.040 56.507  78.728  1.00 32.92  ? 248  SER A CB    1 
ATOM   1879  O OG    . SER A 1 248 ? -23.453 56.373  78.747  1.00 35.11  ? 248  SER A OG    1 
ATOM   1880  N N     . TRP A 1 249 ? -22.822 54.415  81.229  1.00 32.42  ? 249  TRP A N     1 
ATOM   1881  C CA    . TRP A 1 249 ? -23.285 54.193  82.598  1.00 32.11  ? 249  TRP A CA    1 
ATOM   1882  C C     . TRP A 1 249 ? -22.189 53.573  83.441  1.00 32.38  ? 249  TRP A C     1 
ATOM   1883  O O     . TRP A 1 249 ? -22.065 53.860  84.618  1.00 33.11  ? 249  TRP A O     1 
ATOM   1884  C CB    . TRP A 1 249 ? -24.623 53.399  82.662  1.00 34.64  ? 249  TRP A CB    1 
ATOM   1885  C CG    . TRP A 1 249 ? -24.561 51.920  82.383  1.00 32.55  ? 249  TRP A CG    1 
ATOM   1886  C CD1   . TRP A 1 249 ? -24.887 51.291  81.222  1.00 32.68  ? 249  TRP A CD1   1 
ATOM   1887  C CD2   . TRP A 1 249 ? -24.163 50.896  83.299  1.00 31.79  ? 249  TRP A CD2   1 
ATOM   1888  N NE1   . TRP A 1 249 ? -24.682 49.933  81.346  1.00 34.15  ? 249  TRP A NE1   1 
ATOM   1889  C CE2   . TRP A 1 249 ? -24.235 49.664  82.609  1.00 29.23  ? 249  TRP A CE2   1 
ATOM   1890  C CE3   . TRP A 1 249 ? -23.730 50.902  84.633  1.00 33.20  ? 249  TRP A CE3   1 
ATOM   1891  C CZ2   . TRP A 1 249 ? -23.903 48.446  83.204  1.00 32.64  ? 249  TRP A CZ2   1 
ATOM   1892  C CZ3   . TRP A 1 249 ? -23.399 49.685  85.227  1.00 37.00  ? 249  TRP A CZ3   1 
ATOM   1893  C CH2   . TRP A 1 249 ? -23.483 48.474  84.508  1.00 33.53  ? 249  TRP A CH2   1 
ATOM   1894  N N     . VAL A 1 250 ? -21.352 52.746  82.834  1.00 33.20  ? 250  VAL A N     1 
ATOM   1895  C CA    . VAL A 1 250 ? -20.247 52.133  83.590  1.00 32.75  ? 250  VAL A CA    1 
ATOM   1896  C C     . VAL A 1 250 ? -19.235 53.183  84.028  1.00 31.62  ? 250  VAL A C     1 
ATOM   1897  O O     . VAL A 1 250 ? -18.697 53.093  85.125  1.00 29.27  ? 250  VAL A O     1 
ATOM   1898  C CB    . VAL A 1 250 ? -19.519 51.069  82.771  1.00 32.04  ? 250  VAL A CB    1 
ATOM   1899  C CG1   . VAL A 1 250 ? -18.305 50.596  83.511  1.00 32.88  ? 250  VAL A CG1   1 
ATOM   1900  C CG2   . VAL A 1 250 ? -20.470 49.927  82.448  1.00 35.62  ? 250  VAL A CG2   1 
ATOM   1901  N N     . LEU A 1 251 ? -18.962 54.138  83.144  1.00 30.96  ? 251  LEU A N     1 
ATOM   1902  C CA    . LEU A 1 251 ? -18.032 55.230  83.404  1.00 33.49  ? 251  LEU A CA    1 
ATOM   1903  C C     . LEU A 1 251 ? -18.467 56.149  84.537  1.00 35.69  ? 251  LEU A C     1 
ATOM   1904  O O     . LEU A 1 251 ? -17.623 56.626  85.294  1.00 35.44  ? 251  LEU A O     1 
ATOM   1905  C CB    . LEU A 1 251 ? -17.825 56.041  82.106  1.00 33.35  ? 251  LEU A CB    1 
ATOM   1906  C CG    . LEU A 1 251 ? -16.414 56.502  81.745  1.00 35.07  ? 251  LEU A CG    1 
ATOM   1907  C CD1   . LEU A 1 251 ? -15.422 55.351  81.722  1.00 32.10  ? 251  LEU A CD1   1 
ATOM   1908  C CD2   . LEU A 1 251 ? -16.410 57.224  80.429  1.00 31.86  ? 251  LEU A CD2   1 
ATOM   1909  N N     . LYS A 1 252 ? -19.784 56.361  84.665  1.00 37.05  ? 252  LYS A N     1 
ATOM   1910  C CA    . LYS A 1 252 ? -20.389 57.124  85.764  1.00 37.85  ? 252  LYS A CA    1 
ATOM   1911  C C     . LYS A 1 252 ? -20.116 56.522  87.150  1.00 37.38  ? 252  LYS A C     1 
ATOM   1912  O O     . LYS A 1 252 ? -20.030 57.270  88.150  1.00 36.93  ? 252  LYS A O     1 
ATOM   1913  C CB    . LYS A 1 252 ? -21.917 57.228  85.553  1.00 40.31  ? 252  LYS A CB    1 
ATOM   1914  C CG    . LYS A 1 252 ? -22.424 58.600  85.178  1.00 44.95  ? 252  LYS A CG    1 
ATOM   1915  C CD    . LYS A 1 252 ? -22.666 59.421  86.434  1.00 48.75  ? 252  LYS A CD    1 
ATOM   1916  C CE    . LYS A 1 252 ? -22.415 60.884  86.195  1.00 52.91  ? 252  LYS A CE    1 
ATOM   1917  N NZ    . LYS A 1 252 ? -22.670 61.707  87.403  1.00 52.96  ? 252  LYS A NZ    1 
ATOM   1918  N N     . ALA A 1 253 ? -20.022 55.184  87.208  1.00 34.71  ? 253  ALA A N     1 
ATOM   1919  C CA    . ALA A 1 253 ? -19.638 54.477  88.440  1.00 36.05  ? 253  ALA A CA    1 
ATOM   1920  C C     . ALA A 1 253 ? -18.246 54.870  88.936  1.00 35.55  ? 253  ALA A C     1 
ATOM   1921  O O     . ALA A 1 253 ? -17.951 54.761  90.124  1.00 36.46  ? 253  ALA A O     1 
ATOM   1922  C CB    . ALA A 1 253 ? -19.685 52.978  88.204  1.00 35.71  ? 253  ALA A CB    1 
ATOM   1923  N N     . PHE A 1 254 ? -17.403 55.322  88.007  1.00 36.19  ? 254  PHE A N     1 
ATOM   1924  C CA    . PHE A 1 254 ? -16.027 55.772  88.276  1.00 36.48  ? 254  PHE A CA    1 
ATOM   1925  C C     . PHE A 1 254 ? -15.852 57.279  88.311  1.00 36.67  ? 254  PHE A C     1 
ATOM   1926  O O     . PHE A 1 254 ? -14.748 57.762  88.394  1.00 36.32  ? 254  PHE A O     1 
ATOM   1927  C CB    . PHE A 1 254 ? -15.115 55.214  87.174  1.00 36.11  ? 254  PHE A CB    1 
ATOM   1928  C CG    . PHE A 1 254 ? -15.008 53.717  87.192  1.00 33.43  ? 254  PHE A CG    1 
ATOM   1929  C CD1   . PHE A 1 254 ? -14.185 53.092  88.100  1.00 27.85  ? 254  PHE A CD1   1 
ATOM   1930  C CD2   . PHE A 1 254 ? -15.744 52.937  86.314  1.00 35.26  ? 254  PHE A CD2   1 
ATOM   1931  C CE1   . PHE A 1 254 ? -14.074 51.696  88.115  1.00 33.33  ? 254  PHE A CE1   1 
ATOM   1932  C CE2   . PHE A 1 254 ? -15.640 51.542  86.333  1.00 34.90  ? 254  PHE A CE2   1 
ATOM   1933  C CZ    . PHE A 1 254 ? -14.804 50.930  87.235  1.00 27.73  ? 254  PHE A CZ    1 
ATOM   1934  N N     . ASP A 1 255 ? -16.941 58.022  88.232  1.00 38.15  ? 255  ASP A N     1 
ATOM   1935  C CA    . ASP A 1 255 ? -16.875 59.473  88.138  1.00 38.91  ? 255  ASP A CA    1 
ATOM   1936  C C     . ASP A 1 255 ? -16.770 60.100  89.526  1.00 40.37  ? 255  ASP A C     1 
ATOM   1937  O O     . ASP A 1 255 ? -17.744 60.650  90.036  1.00 41.39  ? 255  ASP A O     1 
ATOM   1938  C CB    . ASP A 1 255 ? -18.121 59.966  87.402  1.00 40.80  ? 255  ASP A CB    1 
ATOM   1939  C CG    . ASP A 1 255 ? -18.065 61.446  87.065  1.00 40.57  ? 255  ASP A CG    1 
ATOM   1940  O OD1   . ASP A 1 255 ? -17.034 62.090  87.341  1.00 49.05  ? 255  ASP A OD1   1 
ATOM   1941  O OD2   . ASP A 1 255 ? -19.074 61.952  86.534  1.00 45.23  ? 255  ASP A OD2   1 
ATOM   1942  N N     . SER A 1 256 ? -15.579 60.026  90.123  1.00 39.89  ? 256  SER A N     1 
ATOM   1943  C CA    . SER A 1 256 ? -15.393 60.390  91.525  1.00 39.63  ? 256  SER A CA    1 
ATOM   1944  C C     . SER A 1 256 ? -14.155 61.252  91.767  1.00 39.55  ? 256  SER A C     1 
ATOM   1945  O O     . SER A 1 256 ? -13.398 61.014  92.721  1.00 38.34  ? 256  SER A O     1 
ATOM   1946  C CB    . SER A 1 256 ? -15.322 59.114  92.369  1.00 42.02  ? 256  SER A CB    1 
ATOM   1947  O OG    . SER A 1 256 ? -16.495 58.342  92.198  1.00 44.53  ? 256  SER A OG    1 
ATOM   1948  N N     . GLN A 1 257 ? -13.986 62.275  90.917  1.00 38.12  ? 257  GLN A N     1 
ATOM   1949  C CA    . GLN A 1 257 ? -12.888 63.253  91.020  1.00 36.05  ? 257  GLN A CA    1 
ATOM   1950  C C     . GLN A 1 257 ? -11.505 62.588  90.830  1.00 33.96  ? 257  GLN A C     1 
ATOM   1951  O O     . GLN A 1 257 ? -10.553 62.923  91.529  1.00 32.44  ? 257  GLN A O     1 
ATOM   1952  C CB    . GLN A 1 257 ? -12.959 63.997  92.373  1.00 37.48  ? 257  GLN A CB    1 
ATOM   1953  C CG    . GLN A 1 257 ? -14.211 64.894  92.608  1.00 43.92  ? 257  GLN A CG    1 
ATOM   1954  C CD    . GLN A 1 257 ? -15.545 64.109  92.737  1.00 51.30  ? 257  GLN A CD    1 
ATOM   1955  O OE1   . GLN A 1 257 ? -15.837 63.485  93.769  1.00 54.30  ? 257  GLN A OE1   1 
ATOM   1956  N NE2   . GLN A 1 257 ? -16.355 64.162  91.688  1.00 46.82  ? 257  GLN A NE2   1 
ATOM   1957  N N     . CYS A 1 258 ? -11.431 61.639  89.889  1.00 32.28  ? 258  CYS A N     1 
ATOM   1958  C CA    . CYS A 1 258 ? -10.240 60.819  89.605  1.00 30.63  ? 258  CYS A CA    1 
ATOM   1959  C C     . CYS A 1 258 ? -9.600  61.231  88.300  1.00 27.58  ? 258  CYS A C     1 
ATOM   1960  O O     . CYS A 1 258 ? -10.217 61.902  87.482  1.00 26.43  ? 258  CYS A O     1 
ATOM   1961  C CB    . CYS A 1 258 ? -10.626 59.334  89.438  1.00 28.28  ? 258  CYS A CB    1 
ATOM   1962  S SG    . CYS A 1 258 ? -11.347 58.577  90.870  1.00 43.38  ? 258  CYS A SG    1 
ATOM   1963  N N     . GLN A 1 259 ? -8.373  60.770  88.104  1.00 27.83  ? 259  GLN A N     1 
ATOM   1964  C CA    . GLN A 1 259 ? -7.706  60.817  86.812  1.00 28.51  ? 259  GLN A CA    1 
ATOM   1965  C C     . GLN A 1 259 ? -7.798  59.449  86.183  1.00 27.89  ? 259  GLN A C     1 
ATOM   1966  O O     . GLN A 1 259 ? -7.364  58.441  86.771  1.00 26.12  ? 259  GLN A O     1 
ATOM   1967  C CB    . GLN A 1 259 ? -6.279  61.226  86.976  1.00 28.14  ? 259  GLN A CB    1 
ATOM   1968  C CG    . GLN A 1 259 ? -6.144  62.636  87.517  1.00 30.44  ? 259  GLN A CG    1 
ATOM   1969  C CD    . GLN A 1 259 ? -4.718  62.972  87.865  1.00 29.68  ? 259  GLN A CD    1 
ATOM   1970  O OE1   . GLN A 1 259 ? -4.059  63.647  87.109  1.00 36.36  ? 259  GLN A OE1   1 
ATOM   1971  N NE2   . GLN A 1 259 ? -4.244  62.511  89.011  1.00 30.54  ? 259  GLN A NE2   1 
ATOM   1972  N N     . ILE A 1 260 ? -8.380  59.407  84.993  1.00 26.87  ? 260  ILE A N     1 
ATOM   1973  C CA    . ILE A 1 260 ? -8.748  58.125  84.391  1.00 28.60  ? 260  ILE A CA    1 
ATOM   1974  C C     . ILE A 1 260 ? -8.259  57.991  82.953  1.00 26.22  ? 260  ILE A C     1 
ATOM   1975  O O     . ILE A 1 260 ? -8.422  58.880  82.158  1.00 25.37  ? 260  ILE A O     1 
ATOM   1976  C CB    . ILE A 1 260 ? -10.292 57.857  84.524  1.00 27.90  ? 260  ILE A CB    1 
ATOM   1977  C CG1   . ILE A 1 260 ? -10.649 57.709  86.009  1.00 27.94  ? 260  ILE A CG1   1 
ATOM   1978  C CG2   . ILE A 1 260 ? -10.711 56.616  83.714  1.00 29.71  ? 260  ILE A CG2   1 
ATOM   1979  C CD1   . ILE A 1 260 ? -12.091 57.324  86.302  1.00 32.68  ? 260  ILE A CD1   1 
ATOM   1980  N N     . LEU A 1 261 ? -7.585  56.886  82.684  1.00 26.02  ? 261  LEU A N     1 
ATOM   1981  C CA    . LEU A 1 261 ? -7.266  56.464  81.337  1.00 26.72  ? 261  LEU A CA    1 
ATOM   1982  C C     . LEU A 1 261 ? -8.147  55.263  81.083  1.00 26.35  ? 261  LEU A C     1 
ATOM   1983  O O     . LEU A 1 261 ? -8.265  54.403  81.927  1.00 24.75  ? 261  LEU A O     1 
ATOM   1984  C CB    . LEU A 1 261 ? -5.787  56.062  81.231  1.00 25.45  ? 261  LEU A CB    1 
ATOM   1985  C CG    . LEU A 1 261 ? -5.271  55.534  79.884  1.00 27.91  ? 261  LEU A CG    1 
ATOM   1986  C CD1   . LEU A 1 261 ? -5.368  56.607  78.764  1.00 25.28  ? 261  LEU A CD1   1 
ATOM   1987  C CD2   . LEU A 1 261 ? -3.830  55.023  80.056  1.00 25.14  ? 261  LEU A CD2   1 
ATOM   1988  N N     . LEU A 1 262 ? -8.800  55.242  79.934  1.00 27.41  ? 262  LEU A N     1 
ATOM   1989  C CA    . LEU A 1 262 ? -9.673  54.127  79.567  1.00 27.89  ? 262  LEU A CA    1 
ATOM   1990  C C     . LEU A 1 262 ? -9.489  53.758  78.116  1.00 27.12  ? 262  LEU A C     1 
ATOM   1991  O O     . LEU A 1 262 ? -9.060  54.594  77.296  1.00 27.32  ? 262  LEU A O     1 
ATOM   1992  C CB    . LEU A 1 262 ? -11.147 54.458  79.813  1.00 28.38  ? 262  LEU A CB    1 
ATOM   1993  C CG    . LEU A 1 262 ? -11.788 55.582  78.993  1.00 30.30  ? 262  LEU A CG    1 
ATOM   1994  C CD1   . LEU A 1 262 ? -13.049 55.062  78.288  1.00 32.34  ? 262  LEU A CD1   1 
ATOM   1995  C CD2   . LEU A 1 262 ? -12.099 56.855  79.810  1.00 29.86  ? 262  LEU A CD2   1 
ATOM   1996  N N     . THR A 1 263 ? -9.782  52.500  77.812  1.00 28.70  ? 263  THR A N     1 
ATOM   1997  C CA    . THR A 1 263 ? -9.835  52.022  76.443  1.00 28.61  ? 263  THR A CA    1 
ATOM   1998  C C     . THR A 1 263 ? -11.259 51.650  76.129  1.00 27.01  ? 263  THR A C     1 
ATOM   1999  O O     . THR A 1 263 ? -12.038 51.277  77.018  1.00 23.96  ? 263  THR A O     1 
ATOM   2000  C CB    . THR A 1 263 ? -8.904  50.816  76.196  1.00 28.59  ? 263  THR A CB    1 
ATOM   2001  O OG1   . THR A 1 263 ? -9.372  49.673  76.922  1.00 27.82  ? 263  THR A OG1   1 
ATOM   2002  C CG2   . THR A 1 263 ? -7.480  51.135  76.609  1.00 29.63  ? 263  THR A CG2   1 
ATOM   2003  N N     . THR A 1 264 ? -11.614 51.800  74.862  1.00 27.03  ? 264  THR A N     1 
ATOM   2004  C CA    . THR A 1 264 ? -12.982 51.566  74.406  1.00 30.46  ? 264  THR A CA    1 
ATOM   2005  C C     . THR A 1 264 ? -13.045 51.363  72.908  1.00 31.15  ? 264  THR A C     1 
ATOM   2006  O O     . THR A 1 264 ? -12.263 51.966  72.166  1.00 28.27  ? 264  THR A O     1 
ATOM   2007  C CB    . THR A 1 264 ? -13.914 52.780  74.764  1.00 30.52  ? 264  THR A CB    1 
ATOM   2008  O OG1   . THR A 1 264 ? -15.267 52.462  74.433  1.00 30.38  ? 264  THR A OG1   1 
ATOM   2009  C CG2   . THR A 1 264 ? -13.529 54.091  74.012  1.00 34.56  ? 264  THR A CG2   1 
ATOM   2010  N N     . ARG A 1 265 ? -14.007 50.561  72.456  1.00 33.60  ? 265  ARG A N     1 
ATOM   2011  C CA    . ARG A 1 265 ? -14.338 50.512  71.019  1.00 36.35  ? 265  ARG A CA    1 
ATOM   2012  C C     . ARG A 1 265 ? -15.272 51.661  70.633  1.00 36.74  ? 265  ARG A C     1 
ATOM   2013  O O     . ARG A 1 265 ? -15.405 51.965  69.469  1.00 38.45  ? 265  ARG A O     1 
ATOM   2014  C CB    . ARG A 1 265 ? -14.998 49.199  70.636  1.00 35.80  ? 265  ARG A CB    1 
ATOM   2015  C CG    . ARG A 1 265 ? -14.214 47.954  71.061  1.00 42.08  ? 265  ARG A CG    1 
ATOM   2016  C CD    . ARG A 1 265 ? -15.096 46.696  70.909  1.00 43.06  ? 265  ARG A CD    1 
ATOM   2017  N NE    . ARG A 1 265 ? -14.620 45.603  71.740  1.00 53.06  ? 265  ARG A NE    1 
ATOM   2018  C CZ    . ARG A 1 265 ? -14.892 44.307  71.547  1.00 63.56  ? 265  ARG A CZ    1 
ATOM   2019  N NH1   . ARG A 1 265 ? -15.656 43.901  70.521  1.00 58.65  ? 265  ARG A NH1   1 
ATOM   2020  N NH2   . ARG A 1 265 ? -14.375 43.403  72.393  1.00 64.19  ? 265  ARG A NH2   1 
ATOM   2021  N N     . ASP A 1 266 ? -15.937 52.273  71.613  1.00 38.00  ? 266  ASP A N     1 
ATOM   2022  C CA    . ASP A 1 266 ? -16.939 53.316  71.358  1.00 38.29  ? 266  ASP A CA    1 
ATOM   2023  C C     . ASP A 1 266 ? -16.585 54.614  72.089  1.00 38.48  ? 266  ASP A C     1 
ATOM   2024  O O     . ASP A 1 266 ? -16.822 54.746  73.292  1.00 35.55  ? 266  ASP A O     1 
ATOM   2025  C CB    . ASP A 1 266 ? -18.337 52.842  71.784  1.00 38.95  ? 266  ASP A CB    1 
ATOM   2026  C CG    . ASP A 1 266 ? -19.428 53.886  71.534  1.00 40.30  ? 266  ASP A CG    1 
ATOM   2027  O OD1   . ASP A 1 266 ? -19.121 54.999  71.040  1.00 41.67  ? 266  ASP A OD1   1 
ATOM   2028  O OD2   . ASP A 1 266 ? -20.610 53.585  71.839  1.00 47.77  ? 266  ASP A OD2   1 
ATOM   2029  N N     . LYS A 1 267 ? -16.077 55.587  71.337  1.00 39.96  ? 267  LYS A N     1 
ATOM   2030  C CA    . LYS A 1 267 ? -15.699 56.881  71.894  1.00 40.30  ? 267  LYS A CA    1 
ATOM   2031  C C     . LYS A 1 267 ? -16.827 57.638  72.602  1.00 40.11  ? 267  LYS A C     1 
ATOM   2032  O O     . LYS A 1 267 ? -16.547 58.538  73.414  1.00 40.12  ? 267  LYS A O     1 
ATOM   2033  C CB    . LYS A 1 267 ? -15.025 57.770  70.854  1.00 40.79  ? 267  LYS A CB    1 
ATOM   2034  C CG    . LYS A 1 267 ? -15.906 58.263  69.740  1.00 47.71  ? 267  LYS A CG    1 
ATOM   2035  C CD    . LYS A 1 267 ? -15.103 59.088  68.742  1.00 44.04  ? 267  LYS A CD    1 
ATOM   2036  C CE    . LYS A 1 267 ? -15.899 59.340  67.475  1.00 50.67  ? 267  LYS A CE    1 
ATOM   2037  N NZ    . LYS A 1 267 ? -15.025 59.744  66.313  1.00 53.83  ? 267  LYS A NZ    1 
ATOM   2038  N N     . SER A 1 268 ? -18.081 57.259  72.356  1.00 37.97  ? 268  SER A N     1 
ATOM   2039  C CA    . SER A 1 268 ? -19.219 57.944  72.973  1.00 37.39  ? 268  SER A CA    1 
ATOM   2040  C C     . SER A 1 268 ? -19.475 57.530  74.421  1.00 35.91  ? 268  SER A C     1 
ATOM   2041  O O     . SER A 1 268 ? -20.362 58.082  75.050  1.00 37.12  ? 268  SER A O     1 
ATOM   2042  C CB    . SER A 1 268 ? -20.495 57.755  72.123  1.00 38.69  ? 268  SER A CB    1 
ATOM   2043  O OG    . SER A 1 268 ? -21.189 56.578  72.490  1.00 41.27  ? 268  SER A OG    1 
ATOM   2044  N N     . VAL A 1 269 ? -18.708 56.581  74.965  1.00 34.17  ? 269  VAL A N     1 
ATOM   2045  C CA    . VAL A 1 269 ? -18.912 56.150  76.362  1.00 35.30  ? 269  VAL A CA    1 
ATOM   2046  C C     . VAL A 1 269 ? -18.646 57.252  77.389  1.00 34.51  ? 269  VAL A C     1 
ATOM   2047  O O     . VAL A 1 269 ? -18.995 57.115  78.553  1.00 34.22  ? 269  VAL A O     1 
ATOM   2048  C CB    . VAL A 1 269 ? -18.089 54.889  76.753  1.00 35.24  ? 269  VAL A CB    1 
ATOM   2049  C CG1   . VAL A 1 269 ? -18.547 53.695  75.896  1.00 40.58  ? 269  VAL A CG1   1 
ATOM   2050  C CG2   . VAL A 1 269 ? -16.587 55.134  76.676  1.00 33.63  ? 269  VAL A CG2   1 
ATOM   2051  N N     . THR A 1 270 ? -18.053 58.350  76.947  1.00 33.20  ? 270  THR A N     1 
ATOM   2052  C CA    . THR A 1 270 ? -17.721 59.449  77.833  1.00 35.57  ? 270  THR A CA    1 
ATOM   2053  C C     . THR A 1 270 ? -18.799 60.574  77.859  1.00 36.58  ? 270  THR A C     1 
ATOM   2054  O O     . THR A 1 270 ? -18.609 61.649  78.456  1.00 34.41  ? 270  THR A O     1 
ATOM   2055  C CB    . THR A 1 270 ? -16.328 59.934  77.456  1.00 36.23  ? 270  THR A CB    1 
ATOM   2056  O OG1   . THR A 1 270 ? -15.663 60.466  78.615  1.00 47.66  ? 270  THR A OG1   1 
ATOM   2057  C CG2   . THR A 1 270 ? -16.370 60.920  76.294  1.00 32.95  ? 270  THR A CG2   1 
ATOM   2058  N N     . ASP A 1 271 ? -19.951 60.299  77.238  1.00 37.49  ? 271  ASP A N     1 
ATOM   2059  C CA    . ASP A 1 271 ? -21.013 61.320  77.073  1.00 38.70  ? 271  ASP A CA    1 
ATOM   2060  C C     . ASP A 1 271 ? -21.766 61.679  78.356  1.00 37.81  ? 271  ASP A C     1 
ATOM   2061  O O     . ASP A 1 271 ? -22.245 62.804  78.491  1.00 37.04  ? 271  ASP A O     1 
ATOM   2062  C CB    . ASP A 1 271 ? -22.039 60.901  76.005  1.00 39.03  ? 271  ASP A CB    1 
ATOM   2063  C CG    . ASP A 1 271 ? -21.562 61.153  74.583  1.00 39.16  ? 271  ASP A CG    1 
ATOM   2064  O OD1   . ASP A 1 271 ? -20.410 61.597  74.376  1.00 43.91  ? 271  ASP A OD1   1 
ATOM   2065  O OD2   . ASP A 1 271 ? -22.352 60.878  73.654  1.00 51.47  ? 271  ASP A OD2   1 
ATOM   2066  N N     . SER A 1 272 ? -21.863 60.744  79.292  1.00 39.11  ? 272  SER A N     1 
ATOM   2067  C CA    . SER A 1 272 ? -22.597 61.010  80.546  1.00 41.50  ? 272  SER A CA    1 
ATOM   2068  C C     . SER A 1 272 ? -21.700 61.611  81.628  1.00 43.11  ? 272  SER A C     1 
ATOM   2069  O O     . SER A 1 272 ? -22.126 61.826  82.761  1.00 43.85  ? 272  SER A O     1 
ATOM   2070  C CB    . SER A 1 272 ? -23.197 59.731  81.101  1.00 41.03  ? 272  SER A CB    1 
ATOM   2071  O OG    . SER A 1 272 ? -22.187 59.006  81.751  1.00 36.54  ? 272  SER A OG    1 
ATOM   2072  N N     . VAL A 1 273 ? -20.454 61.877  81.264  1.00 43.14  ? 273  VAL A N     1 
ATOM   2073  C CA    . VAL A 1 273 ? -19.424 62.210  82.217  1.00 42.10  ? 273  VAL A CA    1 
ATOM   2074  C C     . VAL A 1 273 ? -18.841 63.581  81.829  1.00 41.65  ? 273  VAL A C     1 
ATOM   2075  O O     . VAL A 1 273 ? -18.906 64.006  80.678  1.00 39.46  ? 273  VAL A O     1 
ATOM   2076  C CB    . VAL A 1 273 ? -18.431 61.011  82.300  1.00 42.18  ? 273  VAL A CB    1 
ATOM   2077  C CG1   . VAL A 1 273 ? -17.037 61.342  81.803  1.00 40.79  ? 273  VAL A CG1   1 
ATOM   2078  C CG2   . VAL A 1 273 ? -18.455 60.395  83.701  1.00 41.98  ? 273  VAL A CG2   1 
ATOM   2079  N N     . MET A 1 274 ? -18.307 64.285  82.818  1.00 42.61  ? 274  MET A N     1 
ATOM   2080  C CA    . MET A 1 274 ? -17.878 65.666  82.644  1.00 42.60  ? 274  MET A CA    1 
ATOM   2081  C C     . MET A 1 274 ? -16.459 65.882  83.071  1.00 41.76  ? 274  MET A C     1 
ATOM   2082  O O     . MET A 1 274 ? -15.902 65.082  83.823  1.00 46.30  ? 274  MET A O     1 
ATOM   2083  C CB    . MET A 1 274 ? -18.712 66.533  83.579  1.00 45.76  ? 274  MET A CB    1 
ATOM   2084  C CG    . MET A 1 274 ? -19.246 67.769  82.985  1.00 49.99  ? 274  MET A CG    1 
ATOM   2085  S SD    . MET A 1 274 ? -20.899 67.466  82.409  1.00 63.99  ? 274  MET A SD    1 
ATOM   2086  C CE    . MET A 1 274 ? -20.804 68.406  80.883  1.00 61.79  ? 274  MET A CE    1 
ATOM   2087  N N     . GLY A 1 275 ? -15.908 67.015  82.658  1.00 39.13  ? 275  GLY A N     1 
ATOM   2088  C CA    . GLY A 1 275 ? -14.553 67.424  83.016  1.00 36.26  ? 275  GLY A CA    1 
ATOM   2089  C C     . GLY A 1 275 ? -13.722 67.399  81.753  1.00 33.90  ? 275  GLY A C     1 
ATOM   2090  O O     . GLY A 1 275 ? -14.264 67.201  80.671  1.00 32.00  ? 275  GLY A O     1 
ATOM   2091  N N     . PRO A 1 276 ? -12.400 67.621  81.875  1.00 32.60  ? 276  PRO A N     1 
ATOM   2092  C CA    . PRO A 1 276 ? -11.459 67.560  80.743  1.00 30.64  ? 276  PRO A CA    1 
ATOM   2093  C C     . PRO A 1 276 ? -11.465 66.184  80.105  1.00 29.92  ? 276  PRO A C     1 
ATOM   2094  O O     . PRO A 1 276 ? -11.439 65.185  80.820  1.00 28.80  ? 276  PRO A O     1 
ATOM   2095  C CB    . PRO A 1 276 ? -10.095 67.833  81.396  1.00 30.04  ? 276  PRO A CB    1 
ATOM   2096  C CG    . PRO A 1 276 ? -10.408 68.518  82.652  1.00 31.77  ? 276  PRO A CG    1 
ATOM   2097  C CD    . PRO A 1 276 ? -11.725 67.984  83.128  1.00 31.86  ? 276  PRO A CD    1 
ATOM   2098  N N     . LYS A 1 277 ? -11.523 66.147  78.777  1.00 28.40  ? 277  LYS A N     1 
ATOM   2099  C CA    . LYS A 1 277 ? -11.609 64.908  78.022  1.00 29.27  ? 277  LYS A CA    1 
ATOM   2100  C C     . LYS A 1 277 ? -10.643 64.975  76.856  1.00 29.09  ? 277  LYS A C     1 
ATOM   2101  O O     . LYS A 1 277 ? -10.736 65.877  76.012  1.00 31.57  ? 277  LYS A O     1 
ATOM   2102  C CB    . LYS A 1 277 ? -13.009 64.690  77.485  1.00 30.28  ? 277  LYS A CB    1 
ATOM   2103  C CG    . LYS A 1 277 ? -14.119 64.409  78.548  1.00 29.12  ? 277  LYS A CG    1 
ATOM   2104  C CD    . LYS A 1 277 ? -15.448 64.568  77.851  1.00 34.04  ? 277  LYS A CD    1 
ATOM   2105  C CE    . LYS A 1 277 ? -16.616 64.395  78.775  1.00 38.73  ? 277  LYS A CE    1 
ATOM   2106  N NZ    . LYS A 1 277 ? -17.864 64.215  77.995  1.00 31.80  ? 277  LYS A NZ    1 
ATOM   2107  N N     . TYR A 1 278 ? -9.713  64.030  76.819  1.00 27.52  ? 278  TYR A N     1 
ATOM   2108  C CA    . TYR A 1 278 ? -8.751  63.908  75.736  1.00 29.13  ? 278  TYR A CA    1 
ATOM   2109  C C     . TYR A 1 278 ? -8.939  62.547  75.100  1.00 29.96  ? 278  TYR A C     1 
ATOM   2110  O O     . TYR A 1 278 ? -9.367  61.592  75.745  1.00 31.21  ? 278  TYR A O     1 
ATOM   2111  C CB    . TYR A 1 278 ? -7.322  64.084  76.241  1.00 30.63  ? 278  TYR A CB    1 
ATOM   2112  C CG    . TYR A 1 278 ? -7.156  65.344  77.049  1.00 32.81  ? 278  TYR A CG    1 
ATOM   2113  C CD1   . TYR A 1 278 ? -6.885  66.572  76.430  1.00 32.84  ? 278  TYR A CD1   1 
ATOM   2114  C CD2   . TYR A 1 278 ? -7.308  65.316  78.427  1.00 31.28  ? 278  TYR A CD2   1 
ATOM   2115  C CE1   . TYR A 1 278 ? -6.754  67.735  77.189  1.00 33.36  ? 278  TYR A CE1   1 
ATOM   2116  C CE2   . TYR A 1 278 ? -7.198  66.446  79.188  1.00 29.66  ? 278  TYR A CE2   1 
ATOM   2117  C CZ    . TYR A 1 278 ? -6.917  67.647  78.583  1.00 38.35  ? 278  TYR A CZ    1 
ATOM   2118  O OH    . TYR A 1 278 ? -6.812  68.741  79.396  1.00 38.31  ? 278  TYR A OH    1 
ATOM   2119  N N     . VAL A 1 279 ? -8.656  62.482  73.811  1.00 30.72  ? 279  VAL A N     1 
ATOM   2120  C CA    . VAL A 1 279 ? -8.935  61.307  73.011  1.00 31.25  ? 279  VAL A CA    1 
ATOM   2121  C C     . VAL A 1 279 ? -7.741  60.965  72.127  1.00 30.00  ? 279  VAL A C     1 
ATOM   2122  O O     . VAL A 1 279 ? -7.094  61.853  71.577  1.00 31.50  ? 279  VAL A O     1 
ATOM   2123  C CB    . VAL A 1 279 ? -10.137 61.562  72.112  1.00 33.99  ? 279  VAL A CB    1 
ATOM   2124  C CG1   . VAL A 1 279 ? -10.415 60.336  71.258  1.00 40.28  ? 279  VAL A CG1   1 
ATOM   2125  C CG2   . VAL A 1 279 ? -11.365 61.927  72.946  1.00 33.99  ? 279  VAL A CG2   1 
ATOM   2126  N N     . VAL A 1 280 ? -7.431  59.676  72.038  1.00 30.21  ? 280  VAL A N     1 
ATOM   2127  C CA    . VAL A 1 280 ? -6.395  59.163  71.157  1.00 30.30  ? 280  VAL A CA    1 
ATOM   2128  C C     . VAL A 1 280 ? -7.019  58.053  70.322  1.00 28.98  ? 280  VAL A C     1 
ATOM   2129  O O     . VAL A 1 280 ? -7.252  56.959  70.824  1.00 27.29  ? 280  VAL A O     1 
ATOM   2130  C CB    . VAL A 1 280 ? -5.143  58.611  71.947  1.00 31.50  ? 280  VAL A CB    1 
ATOM   2131  C CG1   . VAL A 1 280 ? -4.079  58.113  70.992  1.00 28.54  ? 280  VAL A CG1   1 
ATOM   2132  C CG2   . VAL A 1 280 ? -4.555  59.679  72.862  1.00 29.37  ? 280  VAL A CG2   1 
ATOM   2133  N N     . PRO A 1 281 ? -7.280  58.338  69.039  1.00 30.73  ? 281  PRO A N     1 
ATOM   2134  C CA    . PRO A 1 281 ? -7.725  57.264  68.133  1.00 32.03  ? 281  PRO A CA    1 
ATOM   2135  C C     . PRO A 1 281 ? -6.581  56.319  67.765  1.00 31.57  ? 281  PRO A C     1 
ATOM   2136  O O     . PRO A 1 281 ? -5.466  56.767  67.471  1.00 32.10  ? 281  PRO A O     1 
ATOM   2137  C CB    . PRO A 1 281 ? -8.261  58.006  66.893  1.00 31.91  ? 281  PRO A CB    1 
ATOM   2138  C CG    . PRO A 1 281 ? -7.893  59.444  67.043  1.00 32.09  ? 281  PRO A CG    1 
ATOM   2139  C CD    . PRO A 1 281 ? -7.145  59.640  68.358  1.00 29.61  ? 281  PRO A CD    1 
ATOM   2140  N N     . VAL A 1 282 ? -6.855  55.024  67.807  1.00 32.91  ? 282  VAL A N     1 
ATOM   2141  C CA    . VAL A 1 282 ? -5.901  54.017  67.364  1.00 33.78  ? 282  VAL A CA    1 
ATOM   2142  C C     . VAL A 1 282 ? -6.365  53.451  66.025  1.00 35.00  ? 282  VAL A C     1 
ATOM   2143  O O     . VAL A 1 282 ? -7.525  53.070  65.851  1.00 34.20  ? 282  VAL A O     1 
ATOM   2144  C CB    . VAL A 1 282 ? -5.761  52.867  68.368  1.00 32.50  ? 282  VAL A CB    1 
ATOM   2145  C CG1   . VAL A 1 282 ? -4.719  51.869  67.893  1.00 28.76  ? 282  VAL A CG1   1 
ATOM   2146  C CG2   . VAL A 1 282 ? -5.403  53.409  69.765  1.00 29.95  ? 282  VAL A CG2   1 
ATOM   2147  N N     . GLU A 1 283 ? -5.423  53.402  65.095  1.00 38.52  ? 283  GLU A N     1 
ATOM   2148  C CA    . GLU A 1 283 ? -5.646  52.869  63.752  1.00 41.51  ? 283  GLU A CA    1 
ATOM   2149  C C     . GLU A 1 283 ? -6.042  51.400  63.858  1.00 40.60  ? 283  GLU A C     1 
ATOM   2150  O O     . GLU A 1 283 ? -5.547  50.674  64.730  1.00 39.01  ? 283  GLU A O     1 
ATOM   2151  C CB    . GLU A 1 283 ? -4.412  53.100  62.822  1.00 43.98  ? 283  GLU A CB    1 
ATOM   2152  C CG    . GLU A 1 283 ? -3.111  53.747  63.468  1.00 51.68  ? 283  GLU A CG    1 
ATOM   2153  C CD    . GLU A 1 283 ? -1.976  52.763  63.730  1.00 57.60  ? 283  GLU A CD    1 
ATOM   2154  O OE1   . GLU A 1 283 ? -2.232  51.542  63.829  1.00 68.44  ? 283  GLU A OE1   1 
ATOM   2155  O OE2   . GLU A 1 283 ? -0.814  53.215  63.828  1.00 58.39  ? 283  GLU A OE2   1 
ATOM   2156  N N     . SER A 1 284 ? -6.971  51.016  62.986  1.00 40.20  ? 284  SER A N     1 
ATOM   2157  C CA    . SER A 1 284 ? -7.626  49.724  63.008  1.00 42.08  ? 284  SER A CA    1 
ATOM   2158  C C     . SER A 1 284 ? -6.673  48.629  62.635  1.00 40.61  ? 284  SER A C     1 
ATOM   2159  O O     . SER A 1 284 ? -6.830  47.491  63.048  1.00 41.37  ? 284  SER A O     1 
ATOM   2160  C CB    . SER A 1 284 ? -8.815  49.770  62.025  1.00 43.08  ? 284  SER A CB    1 
ATOM   2161  O OG    . SER A 1 284 ? -8.520  50.532  60.845  1.00 41.61  ? 284  SER A OG    1 
ATOM   2162  N N     . SER A 1 285 ? -5.671  49.010  61.865  1.00 40.52  ? 285  SER A N     1 
ATOM   2163  C CA    . SER A 1 285 ? -4.651  48.107  61.393  1.00 41.10  ? 285  SER A CA    1 
ATOM   2164  C C     . SER A 1 285 ? -3.259  48.552  61.818  1.00 39.68  ? 285  SER A C     1 
ATOM   2165  O O     . SER A 1 285 ? -2.899  49.720  61.697  1.00 41.11  ? 285  SER A O     1 
ATOM   2166  C CB    . SER A 1 285 ? -4.718  48.020  59.860  1.00 41.80  ? 285  SER A CB    1 
ATOM   2167  O OG    . SER A 1 285 ? -3.487  47.547  59.343  1.00 47.86  ? 285  SER A OG    1 
ATOM   2168  N N     . LEU A 1 286 ? -2.494  47.601  62.338  1.00 37.47  ? 286  LEU A N     1 
ATOM   2169  C CA    . LEU A 1 286 ? -1.055  47.743  62.500  1.00 37.55  ? 286  LEU A CA    1 
ATOM   2170  C C     . LEU A 1 286 ? -0.472  47.847  61.080  1.00 37.08  ? 286  LEU A C     1 
ATOM   2171  O O     . LEU A 1 286 ? -0.967  47.208  60.148  1.00 36.17  ? 286  LEU A O     1 
ATOM   2172  C CB    . LEU A 1 286 ? -0.485  46.496  63.179  1.00 35.71  ? 286  LEU A CB    1 
ATOM   2173  C CG    . LEU A 1 286 ? 0.457   46.606  64.371  1.00 38.95  ? 286  LEU A CG    1 
ATOM   2174  C CD1   . LEU A 1 286 ? 1.327   45.370  64.374  1.00 39.99  ? 286  LEU A CD1   1 
ATOM   2175  C CD2   . LEU A 1 286 ? 1.296   47.846  64.339  1.00 37.71  ? 286  LEU A CD2   1 
ATOM   2176  N N     . GLY A 1 287 ? 0.565   48.641  60.886  1.00 35.97  ? 287  GLY A N     1 
ATOM   2177  C CA    . GLY A 1 287 ? 1.117   48.755  59.522  1.00 36.00  ? 287  GLY A CA    1 
ATOM   2178  C C     . GLY A 1 287 ? 1.954   47.521  59.168  1.00 35.65  ? 287  GLY A C     1 
ATOM   2179  O O     . GLY A 1 287 ? 2.403   46.787  60.062  1.00 33.92  ? 287  GLY A O     1 
ATOM   2180  N N     . LYS A 1 288 ? 2.151   47.312  57.866  1.00 34.16  ? 288  LYS A N     1 
ATOM   2181  C CA    . LYS A 1 288 ? 2.984   46.231  57.313  1.00 35.15  ? 288  LYS A CA    1 
ATOM   2182  C C     . LYS A 1 288 ? 4.315   46.035  58.013  1.00 32.72  ? 288  LYS A C     1 
ATOM   2183  O O     . LYS A 1 288 ? 4.704   44.915  58.325  1.00 30.73  ? 288  LYS A O     1 
ATOM   2184  C CB    . LYS A 1 288 ? 3.417   46.519  55.880  1.00 36.32  ? 288  LYS A CB    1 
ATOM   2185  C CG    . LYS A 1 288 ? 2.355   46.784  54.914  1.00 45.59  ? 288  LYS A CG    1 
ATOM   2186  C CD    . LYS A 1 288 ? 2.936   46.612  53.540  1.00 44.69  ? 288  LYS A CD    1 
ATOM   2187  C CE    . LYS A 1 288 ? 2.115   47.333  52.499  1.00 55.46  ? 288  LYS A CE    1 
ATOM   2188  N NZ    . LYS A 1 288 ? 2.898   47.390  51.223  1.00 55.81  ? 288  LYS A NZ    1 
ATOM   2189  N N     . GLU A 1 289 ? 5.056   47.124  58.171  1.00 31.33  ? 289  GLU A N     1 
ATOM   2190  C CA    . GLU A 1 289 ? 6.407   47.025  58.735  1.00 31.36  ? 289  GLU A CA    1 
ATOM   2191  C C     . GLU A 1 289 ? 6.423   46.564  60.179  1.00 28.26  ? 289  GLU A C     1 
ATOM   2192  O O     . GLU A 1 289 ? 7.266   45.767  60.573  1.00 26.89  ? 289  GLU A O     1 
ATOM   2193  C CB    . GLU A 1 289 ? 7.182   48.334  58.574  1.00 32.86  ? 289  GLU A CB    1 
ATOM   2194  C CG    . GLU A 1 289 ? 7.784   48.425  57.187  1.00 40.75  ? 289  GLU A CG    1 
ATOM   2195  C CD    . GLU A 1 289 ? 8.883   47.362  56.920  1.00 46.28  ? 289  GLU A CD    1 
ATOM   2196  O OE1   . GLU A 1 289 ? 9.805   47.225  57.766  1.00 51.59  ? 289  GLU A OE1   1 
ATOM   2197  O OE2   . GLU A 1 289 ? 8.838   46.691  55.856  1.00 43.69  ? 289  GLU A OE2   1 
ATOM   2198  N N     . LYS A 1 290 ? 5.479   47.063  60.955  1.00 27.93  ? 290  LYS A N     1 
ATOM   2199  C CA    . LYS A 1 290 ? 5.356   46.671  62.348  1.00 28.62  ? 290  LYS A CA    1 
ATOM   2200  C C     . LYS A 1 290 ? 4.878   45.220  62.468  1.00 27.94  ? 290  LYS A C     1 
ATOM   2201  O O     . LYS A 1 290 ? 5.344   44.469  63.344  1.00 24.98  ? 290  LYS A O     1 
ATOM   2202  C CB    . LYS A 1 290 ? 4.463   47.659  63.101  1.00 26.14  ? 290  LYS A CB    1 
ATOM   2203  C CG    . LYS A 1 290 ? 5.240   48.906  63.580  1.00 32.96  ? 290  LYS A CG    1 
ATOM   2204  C CD    . LYS A 1 290 ? 6.185   48.612  64.792  1.00 30.36  ? 290  LYS A CD    1 
ATOM   2205  C CE    . LYS A 1 290 ? 7.336   49.621  64.812  1.00 30.58  ? 290  LYS A CE    1 
ATOM   2206  N NZ    . LYS A 1 290 ? 8.244   49.489  65.983  1.00 26.31  ? 290  LYS A NZ    1 
ATOM   2207  N N     . GLY A 1 291 ? 3.989   44.813  61.563  1.00 28.15  ? 291  GLY A N     1 
ATOM   2208  C CA    . GLY A 1 291 ? 3.562   43.418  61.473  1.00 26.87  ? 291  GLY A CA    1 
ATOM   2209  C C     . GLY A 1 291 ? 4.712   42.509  61.127  1.00 24.71  ? 291  GLY A C     1 
ATOM   2210  O O     . GLY A 1 291 ? 4.906   41.501  61.784  1.00 24.88  ? 291  GLY A O     1 
ATOM   2211  N N     . LEU A 1 292 ? 5.493   42.872  60.104  1.00 25.35  ? 292  LEU A N     1 
ATOM   2212  C CA    . LEU A 1 292 ? 6.729   42.137  59.762  1.00 26.60  ? 292  LEU A CA    1 
ATOM   2213  C C     . LEU A 1 292 ? 7.705   42.070  60.942  1.00 26.33  ? 292  LEU A C     1 
ATOM   2214  O O     . LEU A 1 292 ? 8.350   41.051  61.145  1.00 24.22  ? 292  LEU A O     1 
ATOM   2215  C CB    . LEU A 1 292 ? 7.472   42.782  58.605  1.00 27.55  ? 292  LEU A CB    1 
ATOM   2216  C CG    . LEU A 1 292 ? 6.925   42.598  57.198  1.00 28.82  ? 292  LEU A CG    1 
ATOM   2217  C CD1   . LEU A 1 292 ? 7.678   43.518  56.274  1.00 24.36  ? 292  LEU A CD1   1 
ATOM   2218  C CD2   . LEU A 1 292 ? 7.014   41.129  56.752  1.00 29.69  ? 292  LEU A CD2   1 
ATOM   2219  N N     . GLU A 1 293 ? 7.839   43.177  61.679  1.00 27.37  ? 293  GLU A N     1 
ATOM   2220  C CA    . GLU A 1 293 ? 8.731   43.234  62.829  1.00 28.76  ? 293  GLU A CA    1 
ATOM   2221  C C     . GLU A 1 293 ? 8.308   42.223  63.893  1.00 28.97  ? 293  GLU A C     1 
ATOM   2222  O O     . GLU A 1 293 ? 9.172   41.578  64.511  1.00 29.01  ? 293  GLU A O     1 
ATOM   2223  C CB    . GLU A 1 293 ? 8.772   44.625  63.494  1.00 29.65  ? 293  GLU A CB    1 
ATOM   2224  C CG    . GLU A 1 293 ? 9.964   44.773  64.434  1.00 29.98  ? 293  GLU A CG    1 
ATOM   2225  C CD    . GLU A 1 293 ? 9.957   46.052  65.261  1.00 35.57  ? 293  GLU A CD    1 
ATOM   2226  O OE1   . GLU A 1 293 ? 9.218   47.013  64.909  1.00 39.30  ? 293  GLU A OE1   1 
ATOM   2227  O OE2   . GLU A 1 293 ? 10.711  46.079  66.269  1.00 38.56  ? 293  GLU A OE2   1 
ATOM   2228  N N     . ILE A 1 294 ? 6.998   42.099  64.123  1.00 26.79  ? 294  ILE A N     1 
ATOM   2229  C CA    . ILE A 1 294 ? 6.510   41.101  65.072  1.00 27.60  ? 294  ILE A CA    1 
ATOM   2230  C C     . ILE A 1 294 ? 6.936   39.703  64.634  1.00 27.09  ? 294  ILE A C     1 
ATOM   2231  O O     . ILE A 1 294 ? 7.447   38.921  65.461  1.00 28.10  ? 294  ILE A O     1 
ATOM   2232  C CB    . ILE A 1 294 ? 4.963   41.142  65.268  1.00 26.37  ? 294  ILE A CB    1 
ATOM   2233  C CG1   . ILE A 1 294 ? 4.524   42.372  66.057  1.00 25.72  ? 294  ILE A CG1   1 
ATOM   2234  C CG2   . ILE A 1 294 ? 4.461   39.881  66.016  1.00 27.76  ? 294  ILE A CG2   1 
ATOM   2235  C CD1   . ILE A 1 294 ? 2.992   42.715  65.935  1.00 29.82  ? 294  ILE A CD1   1 
ATOM   2236  N N     . LEU A 1 295 ? 6.691   39.375  63.359  1.00 26.48  ? 295  LEU A N     1 
ATOM   2237  C CA    . LEU A 1 295 ? 7.123   38.096  62.793  1.00 27.86  ? 295  LEU A CA    1 
ATOM   2238  C C     . LEU A 1 295 ? 8.614   37.848  63.013  1.00 26.60  ? 295  LEU A C     1 
ATOM   2239  O O     . LEU A 1 295 ? 8.983   36.764  63.432  1.00 27.91  ? 295  LEU A O     1 
ATOM   2240  C CB    . LEU A 1 295 ? 6.858   37.992  61.278  1.00 29.49  ? 295  LEU A CB    1 
ATOM   2241  C CG    . LEU A 1 295 ? 5.448   37.798  60.740  1.00 30.71  ? 295  LEU A CG    1 
ATOM   2242  C CD1   . LEU A 1 295 ? 5.504   37.616  59.200  1.00 29.97  ? 295  LEU A CD1   1 
ATOM   2243  C CD2   . LEU A 1 295 ? 4.749   36.630  61.438  1.00 31.37  ? 295  LEU A CD2   1 
ATOM   2244  N N     . SER A 1 296 ? 9.442   38.842  62.691  1.00 26.09  ? 296  SER A N     1 
ATOM   2245  C CA    . SER A 1 296 ? 10.886  38.695  62.757  1.00 27.94  ? 296  SER A CA    1 
ATOM   2246  C C     . SER A 1 296 ? 11.351  38.415  64.189  1.00 29.64  ? 296  SER A C     1 
ATOM   2247  O O     . SER A 1 296 ? 12.305  37.673  64.401  1.00 30.35  ? 296  SER A O     1 
ATOM   2248  C CB    . SER A 1 296 ? 11.587  39.928  62.227  1.00 26.84  ? 296  SER A CB    1 
ATOM   2249  O OG    . SER A 1 296 ? 11.466  40.984  63.126  1.00 31.88  ? 296  SER A OG    1 
ATOM   2250  N N     . LEU A 1 297 ? 10.674  39.008  65.172  1.00 29.72  ? 297  LEU A N     1 
ATOM   2251  C CA    . LEU A 1 297 ? 11.025  38.783  66.566  1.00 29.38  ? 297  LEU A CA    1 
ATOM   2252  C C     . LEU A 1 297 ? 10.609  37.396  67.019  1.00 29.42  ? 297  LEU A C     1 
ATOM   2253  O O     . LEU A 1 297 ? 11.314  36.762  67.785  1.00 32.97  ? 297  LEU A O     1 
ATOM   2254  C CB    . LEU A 1 297 ? 10.402  39.829  67.493  1.00 29.23  ? 297  LEU A CB    1 
ATOM   2255  C CG    . LEU A 1 297 ? 10.908  41.262  67.394  1.00 31.45  ? 297  LEU A CG    1 
ATOM   2256  C CD1   . LEU A 1 297 ? 10.040  42.156  68.292  1.00 30.43  ? 297  LEU A CD1   1 
ATOM   2257  C CD2   . LEU A 1 297 ? 12.410  41.379  67.724  1.00 36.15  ? 297  LEU A CD2   1 
ATOM   2258  N N     . PHE A 1 298 ? 9.456   36.928  66.560  1.00 28.73  ? 298  PHE A N     1 
ATOM   2259  C CA    . PHE A 1 298 ? 9.019   35.557  66.847  1.00 29.01  ? 298  PHE A CA    1 
ATOM   2260  C C     . PHE A 1 298 ? 9.988   34.527  66.246  1.00 29.31  ? 298  PHE A C     1 
ATOM   2261  O O     . PHE A 1 298 ? 10.284  33.533  66.903  1.00 30.45  ? 298  PHE A O     1 
ATOM   2262  C CB    . PHE A 1 298 ? 7.580   35.256  66.343  1.00 29.08  ? 298  PHE A CB    1 
ATOM   2263  C CG    . PHE A 1 298 ? 6.495   35.495  67.355  1.00 23.07  ? 298  PHE A CG    1 
ATOM   2264  C CD1   . PHE A 1 298 ? 6.256   34.572  68.358  1.00 29.67  ? 298  PHE A CD1   1 
ATOM   2265  C CD2   . PHE A 1 298 ? 5.683   36.619  67.276  1.00 24.19  ? 298  PHE A CD2   1 
ATOM   2266  C CE1   . PHE A 1 298 ? 5.280   34.791  69.315  1.00 28.11  ? 298  PHE A CE1   1 
ATOM   2267  C CE2   . PHE A 1 298 ? 4.690   36.852  68.210  1.00 28.18  ? 298  PHE A CE2   1 
ATOM   2268  C CZ    . PHE A 1 298 ? 4.489   35.928  69.243  1.00 31.97  ? 298  PHE A CZ    1 
ATOM   2269  N N     . VAL A 1 299 ? 10.450  34.742  65.009  1.00 31.04  ? 299  VAL A N     1 
ATOM   2270  C CA    . VAL A 1 299 ? 11.316  33.748  64.322  1.00 32.14  ? 299  VAL A CA    1 
ATOM   2271  C C     . VAL A 1 299 ? 12.822  34.030  64.468  1.00 33.19  ? 299  VAL A C     1 
ATOM   2272  O O     . VAL A 1 299 ? 13.657  33.273  63.956  1.00 33.33  ? 299  VAL A O     1 
ATOM   2273  C CB    . VAL A 1 299 ? 10.942  33.608  62.841  1.00 30.76  ? 299  VAL A CB    1 
ATOM   2274  C CG1   . VAL A 1 299 ? 9.453   33.155  62.710  1.00 30.87  ? 299  VAL A CG1   1 
ATOM   2275  C CG2   . VAL A 1 299 ? 11.207  34.902  62.100  1.00 30.90  ? 299  VAL A CG2   1 
ATOM   2276  N N     . ASN A 1 300 ? 13.157  35.121  65.156  1.00 35.83  ? 300  ASN A N     1 
ATOM   2277  C CA    . ASN A 1 300 ? 14.544  35.452  65.453  1.00 37.48  ? 300  ASN A CA    1 
ATOM   2278  C C     . ASN A 1 300 ? 15.380  35.632  64.186  1.00 39.52  ? 300  ASN A C     1 
ATOM   2279  O O     . ASN A 1 300 ? 16.412  34.971  64.007  1.00 39.53  ? 300  ASN A O     1 
ATOM   2280  C CB    . ASN A 1 300 ? 15.143  34.364  66.370  1.00 37.99  ? 300  ASN A CB    1 
ATOM   2281  C CG    . ASN A 1 300 ? 16.454  34.788  67.052  1.00 40.27  ? 300  ASN A CG    1 
ATOM   2282  O OD1   . ASN A 1 300 ? 16.747  35.976  67.222  1.00 49.88  ? 300  ASN A OD1   1 
ATOM   2283  N ND2   . ASN A 1 300 ? 17.234  33.801  67.462  1.00 44.58  ? 300  ASN A ND2   1 
ATOM   2284  N N     . MET A 1 301 ? 14.918  36.512  63.298  1.00 40.43  ? 301  MET A N     1 
ATOM   2285  C CA    . MET A 1 301 ? 15.743  36.974  62.185  1.00 40.79  ? 301  MET A CA    1 
ATOM   2286  C C     . MET A 1 301 ? 15.527  38.449  61.979  1.00 39.98  ? 301  MET A C     1 
ATOM   2287  O O     . MET A 1 301 ? 14.545  39.014  62.448  1.00 40.73  ? 301  MET A O     1 
ATOM   2288  C CB    . MET A 1 301 ? 15.493  36.171  60.873  1.00 41.03  ? 301  MET A CB    1 
ATOM   2289  C CG    . MET A 1 301 ? 14.383  35.142  60.886  1.00 44.32  ? 301  MET A CG    1 
ATOM   2290  S SD    . MET A 1 301 ? 14.137  34.260  59.303  1.00 42.83  ? 301  MET A SD    1 
ATOM   2291  C CE    . MET A 1 301 ? 13.462  32.684  59.809  1.00 37.64  ? 301  MET A CE    1 
ATOM   2292  N N     . LYS A 1 302 ? 16.471  39.072  61.299  1.00 40.12  ? 302  LYS A N     1 
ATOM   2293  C CA    . LYS A 1 302 ? 16.304  40.434  60.865  1.00 42.17  ? 302  LYS A CA    1 
ATOM   2294  C C     . LYS A 1 302 ? 15.138  40.488  59.869  1.00 39.61  ? 302  LYS A C     1 
ATOM   2295  O O     . LYS A 1 302 ? 14.882  39.522  59.147  1.00 37.11  ? 302  LYS A O     1 
ATOM   2296  C CB    . LYS A 1 302 ? 17.612  40.924  60.237  1.00 44.31  ? 302  LYS A CB    1 
ATOM   2297  C CG    . LYS A 1 302 ? 18.806  40.964  61.208  1.00 48.03  ? 302  LYS A CG    1 
ATOM   2298  C CD    . LYS A 1 302 ? 20.110  41.313  60.446  1.00 47.86  ? 302  LYS A CD    1 
ATOM   2299  C CE    . LYS A 1 302 ? 21.204  41.854  61.399  1.00 56.00  ? 302  LYS A CE    1 
ATOM   2300  N NZ    . LYS A 1 302 ? 22.530  42.066  60.708  1.00 57.54  ? 302  LYS A NZ    1 
ATOM   2301  N N     . LYS A 1 303 ? 14.437  41.617  59.873  1.00 39.53  ? 303  LYS A N     1 
ATOM   2302  C CA    . LYS A 1 303 ? 13.303  41.850  58.998  1.00 39.23  ? 303  LYS A CA    1 
ATOM   2303  C C     . LYS A 1 303 ? 13.684  41.597  57.536  1.00 38.68  ? 303  LYS A C     1 
ATOM   2304  O O     . LYS A 1 303 ? 12.946  40.922  56.815  1.00 38.53  ? 303  LYS A O     1 
ATOM   2305  C CB    . LYS A 1 303 ? 12.790  43.282  59.177  1.00 38.79  ? 303  LYS A CB    1 
ATOM   2306  C CG    . LYS A 1 303 ? 11.295  43.380  59.326  1.00 41.35  ? 303  LYS A CG    1 
ATOM   2307  C CD    . LYS A 1 303 ? 10.804  44.804  59.180  1.00 42.07  ? 303  LYS A CD    1 
ATOM   2308  C CE    . LYS A 1 303 ? 11.167  45.673  60.363  1.00 47.96  ? 303  LYS A CE    1 
ATOM   2309  N NZ    . LYS A 1 303 ? 10.951  47.113  60.030  1.00 48.94  ? 303  LYS A NZ    1 
ATOM   2310  N N     . ALA A 1 304 ? 14.848  42.122  57.128  1.00 37.95  ? 304  ALA A N     1 
ATOM   2311  C CA    . ALA A 1 304 ? 15.359  42.010  55.752  1.00 37.16  ? 304  ALA A CA    1 
ATOM   2312  C C     . ALA A 1 304 ? 15.729  40.582  55.332  1.00 37.43  ? 304  ALA A C     1 
ATOM   2313  O O     . ALA A 1 304 ? 15.943  40.302  54.157  1.00 36.93  ? 304  ALA A O     1 
ATOM   2314  C CB    . ALA A 1 304 ? 16.602  42.884  55.594  1.00 36.86  ? 304  ALA A CB    1 
ATOM   2315  N N     . ASP A 1 305 ? 15.852  39.686  56.305  1.00 37.33  ? 305  ASP A N     1 
ATOM   2316  C CA    . ASP A 1 305 ? 16.164  38.276  56.049  1.00 35.64  ? 305  ASP A CA    1 
ATOM   2317  C C     . ASP A 1 305 ? 14.945  37.388  56.081  1.00 34.80  ? 305  ASP A C     1 
ATOM   2318  O O     . ASP A 1 305 ? 15.067  36.163  56.029  1.00 33.55  ? 305  ASP A O     1 
ATOM   2319  C CB    . ASP A 1 305 ? 17.067  37.698  57.145  1.00 36.37  ? 305  ASP A CB    1 
ATOM   2320  C CG    . ASP A 1 305 ? 18.437  38.305  57.166  1.00 40.01  ? 305  ASP A CG    1 
ATOM   2321  O OD1   . ASP A 1 305 ? 18.858  38.922  56.156  1.00 43.36  ? 305  ASP A OD1   1 
ATOM   2322  O OD2   . ASP A 1 305 ? 19.090  38.155  58.218  1.00 48.28  ? 305  ASP A OD2   1 
ATOM   2323  N N     . LEU A 1 306 ? 13.767  37.983  56.227  1.00 34.08  ? 306  LEU A N     1 
ATOM   2324  C CA    . LEU A 1 306 ? 12.553  37.194  56.191  1.00 32.97  ? 306  LEU A CA    1 
ATOM   2325  C C     . LEU A 1 306 ? 12.332  36.650  54.783  1.00 30.46  ? 306  LEU A C     1 
ATOM   2326  O O     . LEU A 1 306 ? 12.673  37.291  53.793  1.00 31.07  ? 306  LEU A O     1 
ATOM   2327  C CB    . LEU A 1 306 ? 11.333  37.991  56.676  1.00 33.15  ? 306  LEU A CB    1 
ATOM   2328  C CG    . LEU A 1 306 ? 11.274  38.313  58.176  1.00 32.07  ? 306  LEU A CG    1 
ATOM   2329  C CD1   . LEU A 1 306 ? 10.057  39.171  58.445  1.00 29.33  ? 306  LEU A CD1   1 
ATOM   2330  C CD2   . LEU A 1 306 ? 11.246  37.056  59.058  1.00 27.70  ? 306  LEU A CD2   1 
ATOM   2331  N N     . PRO A 1 307 ? 11.758  35.453  54.683  1.00 30.15  ? 307  PRO A N     1 
ATOM   2332  C CA    . PRO A 1 307 ? 11.360  34.985  53.357  1.00 31.99  ? 307  PRO A CA    1 
ATOM   2333  C C     . PRO A 1 307 ? 10.256  35.815  52.699  1.00 32.66  ? 307  PRO A C     1 
ATOM   2334  O O     . PRO A 1 307 ? 9.664   36.683  53.349  1.00 31.85  ? 307  PRO A O     1 
ATOM   2335  C CB    . PRO A 1 307 ? 10.902  33.544  53.603  1.00 31.96  ? 307  PRO A CB    1 
ATOM   2336  C CG    . PRO A 1 307 ? 10.917  33.314  55.060  1.00 29.54  ? 307  PRO A CG    1 
ATOM   2337  C CD    . PRO A 1 307 ? 11.509  34.470  55.753  1.00 27.44  ? 307  PRO A CD    1 
ATOM   2338  N N     . GLU A 1 308 ? 10.036  35.545  51.410  1.00 33.07  ? 308  GLU A N     1 
ATOM   2339  C CA    . GLU A 1 308 ? 9.079   36.262  50.552  1.00 35.01  ? 308  GLU A CA    1 
ATOM   2340  C C     . GLU A 1 308 ? 7.643   36.136  51.007  1.00 33.20  ? 308  GLU A C     1 
ATOM   2341  O O     . GLU A 1 308 ? 6.852   37.038  50.786  1.00 33.72  ? 308  GLU A O     1 
ATOM   2342  C CB    . GLU A 1 308 ? 9.148   35.688  49.119  1.00 36.66  ? 308  GLU A CB    1 
ATOM   2343  C CG    . GLU A 1 308 ? 10.252  36.237  48.266  1.00 42.58  ? 308  GLU A CG    1 
ATOM   2344  C CD    . GLU A 1 308 ? 10.082  35.907  46.777  1.00 39.85  ? 308  GLU A CD    1 
ATOM   2345  O OE1   . GLU A 1 308 ? 9.081   35.261  46.393  1.00 44.21  ? 308  GLU A OE1   1 
ATOM   2346  O OE2   . GLU A 1 308 ? 10.966  36.304  46.001  1.00 44.24  ? 308  GLU A OE2   1 
ATOM   2347  N N     . GLN A 1 309 ? 7.318   34.987  51.594  1.00 32.60  ? 309  GLN A N     1 
ATOM   2348  C CA    . GLN A 1 309 ? 5.974   34.700  52.097  1.00 30.85  ? 309  GLN A CA    1 
ATOM   2349  C C     . GLN A 1 309 ? 5.563   35.655  53.202  1.00 30.63  ? 309  GLN A C     1 
ATOM   2350  O O     . GLN A 1 309 ? 4.370   35.880  53.415  1.00 28.70  ? 309  GLN A O     1 
ATOM   2351  C CB    . GLN A 1 309 ? 5.905   33.271  52.633  1.00 30.70  ? 309  GLN A CB    1 
ATOM   2352  C CG    . GLN A 1 309 ? 5.935   32.174  51.561  1.00 29.49  ? 309  GLN A CG    1 
ATOM   2353  C CD    . GLN A 1 309 ? 7.325   31.590  51.300  1.00 28.99  ? 309  GLN A CD    1 
ATOM   2354  O OE1   . GLN A 1 309 ? 8.315   31.944  51.963  1.00 30.24  ? 309  GLN A OE1   1 
ATOM   2355  N NE2   . GLN A 1 309 ? 7.403   30.696  50.318  1.00 24.51  ? 309  GLN A NE2   1 
ATOM   2356  N N     . ALA A 1 310 ? 6.543   36.188  53.930  1.00 29.46  ? 310  ALA A N     1 
ATOM   2357  C CA    . ALA A 1 310 ? 6.278   37.007  55.098  1.00 28.84  ? 310  ALA A CA    1 
ATOM   2358  C C     . ALA A 1 310 ? 5.339   38.195  54.792  1.00 28.32  ? 310  ALA A C     1 
ATOM   2359  O O     . ALA A 1 310 ? 4.424   38.464  55.535  1.00 27.25  ? 310  ALA A O     1 
ATOM   2360  C CB    . ALA A 1 310 ? 7.607   37.464  55.698  1.00 28.08  ? 310  ALA A CB    1 
ATOM   2361  N N     . HIS A 1 311 ? 5.547   38.830  53.645  1.00 29.85  ? 311  HIS A N     1 
ATOM   2362  C CA    . HIS A 1 311 ? 4.779   40.009  53.202  1.00 30.75  ? 311  HIS A CA    1 
ATOM   2363  C C     . HIS A 1 311 ? 3.349   39.641  52.787  1.00 29.92  ? 311  HIS A C     1 
ATOM   2364  O O     . HIS A 1 311 ? 2.420   40.372  53.076  1.00 29.09  ? 311  HIS A O     1 
ATOM   2365  C CB    . HIS A 1 311 ? 5.590   40.660  52.082  1.00 32.69  ? 311  HIS A CB    1 
ATOM   2366  C CG    . HIS A 1 311 ? 7.068   40.499  52.294  1.00 38.95  ? 311  HIS A CG    1 
ATOM   2367  N ND1   . HIS A 1 311 ? 7.819   39.538  51.643  1.00 40.61  ? 311  HIS A ND1   1 
ATOM   2368  C CD2   . HIS A 1 311 ? 7.908   41.093  53.175  1.00 39.74  ? 311  HIS A CD2   1 
ATOM   2369  C CE1   . HIS A 1 311 ? 9.067   39.591  52.074  1.00 39.36  ? 311  HIS A CE1   1 
ATOM   2370  N NE2   . HIS A 1 311 ? 9.150   40.524  53.003  1.00 39.12  ? 311  HIS A NE2   1 
ATOM   2371  N N     . SER A 1 312 ? 3.203   38.472  52.174  1.00 28.96  ? 312  SER A N     1 
ATOM   2372  C CA    . SER A 1 312 ? 1.922   37.859  51.895  1.00 28.68  ? 312  SER A CA    1 
ATOM   2373  C C     . SER A 1 312 ? 1.144   37.438  53.155  1.00 27.65  ? 312  SER A C     1 
ATOM   2374  O O     . SER A 1 312 ? -0.070  37.596  53.226  1.00 25.18  ? 312  SER A O     1 
ATOM   2375  C CB    . SER A 1 312 ? 2.153   36.653  50.970  1.00 28.47  ? 312  SER A CB    1 
ATOM   2376  O OG    . SER A 1 312 ? 2.663   37.080  49.718  1.00 32.78  ? 312  SER A OG    1 
ATOM   2377  N N     . ILE A 1 313 ? 1.858   36.907  54.142  1.00 28.42  ? 313  ILE A N     1 
ATOM   2378  C CA    . ILE A 1 313 ? 1.275   36.522  55.406  1.00 29.06  ? 313  ILE A CA    1 
ATOM   2379  C C     . ILE A 1 313 ? 0.736   37.738  56.147  1.00 29.08  ? 313  ILE A C     1 
ATOM   2380  O O     . ILE A 1 313 ? -0.351  37.695  56.698  1.00 28.64  ? 313  ILE A O     1 
ATOM   2381  C CB    . ILE A 1 313 ? 2.309   35.748  56.278  1.00 29.70  ? 313  ILE A CB    1 
ATOM   2382  C CG1   . ILE A 1 313 ? 2.564   34.372  55.656  1.00 31.06  ? 313  ILE A CG1   1 
ATOM   2383  C CG2   . ILE A 1 313 ? 1.794   35.594  57.721  1.00 29.48  ? 313  ILE A CG2   1 
ATOM   2384  C CD1   . ILE A 1 313 ? 3.637   33.558  56.348  1.00 31.04  ? 313  ILE A CD1   1 
ATOM   2385  N N     . ILE A 1 314 ? 1.497   38.815  56.153  1.00 28.79  ? 314  ILE A N     1 
ATOM   2386  C CA    . ILE A 1 314 ? 1.068   40.052  56.787  1.00 29.94  ? 314  ILE A CA    1 
ATOM   2387  C C     . ILE A 1 314 ? -0.188  40.610  56.128  1.00 30.01  ? 314  ILE A C     1 
ATOM   2388  O O     . ILE A 1 314 ? -1.128  40.983  56.830  1.00 32.77  ? 314  ILE A O     1 
ATOM   2389  C CB    . ILE A 1 314 ? 2.262   41.077  56.818  1.00 29.46  ? 314  ILE A CB    1 
ATOM   2390  C CG1   . ILE A 1 314 ? 3.314   40.621  57.843  1.00 29.78  ? 314  ILE A CG1   1 
ATOM   2391  C CG2   . ILE A 1 314 ? 1.802   42.523  57.093  1.00 29.23  ? 314  ILE A CG2   1 
ATOM   2392  C CD1   . ILE A 1 314 ? 2.782   40.155  59.201  1.00 29.77  ? 314  ILE A CD1   1 
ATOM   2393  N N     . LYS A 1 315 ? -0.213  40.634  54.801  1.00 30.67  ? 315  LYS A N     1 
ATOM   2394  C CA    . LYS A 1 315 ? -1.406  41.004  54.037  1.00 32.80  ? 315  LYS A CA    1 
ATOM   2395  C C     . LYS A 1 315 ? -2.626  40.139  54.450  1.00 33.08  ? 315  LYS A C     1 
ATOM   2396  O O     . LYS A 1 315 ? -3.722  40.671  54.656  1.00 33.74  ? 315  LYS A O     1 
ATOM   2397  C CB    . LYS A 1 315 ? -1.123  40.911  52.526  1.00 32.16  ? 315  LYS A CB    1 
ATOM   2398  C CG    . LYS A 1 315 ? -2.284  41.374  51.615  1.00 33.25  ? 315  LYS A CG    1 
ATOM   2399  C CD    . LYS A 1 315 ? -2.213  40.786  50.244  1.00 37.19  ? 315  LYS A CD    1 
ATOM   2400  C CE    . LYS A 1 315 ? -2.643  39.328  50.205  1.00 43.66  ? 315  LYS A CE    1 
ATOM   2401  N NZ    . LYS A 1 315 ? -3.921  39.096  49.501  1.00 48.26  ? 315  LYS A NZ    1 
ATOM   2402  N N     . GLU A 1 316 ? -2.420  38.829  54.607  1.00 33.13  ? 316  GLU A N     1 
ATOM   2403  C CA    . GLU A 1 316 ? -3.483  37.925  55.067  1.00 33.36  ? 316  GLU A CA    1 
ATOM   2404  C C     . GLU A 1 316 ? -3.924  38.144  56.507  1.00 33.55  ? 316  GLU A C     1 
ATOM   2405  O O     . GLU A 1 316 ? -5.030  37.770  56.859  1.00 34.63  ? 316  GLU A O     1 
ATOM   2406  C CB    . GLU A 1 316 ? -3.074  36.459  54.891  1.00 33.53  ? 316  GLU A CB    1 
ATOM   2407  C CG    . GLU A 1 316 ? -2.899  35.996  53.454  1.00 33.73  ? 316  GLU A CG    1 
ATOM   2408  C CD    . GLU A 1 316 ? -4.112  36.258  52.536  1.00 38.03  ? 316  GLU A CD    1 
ATOM   2409  O OE1   . GLU A 1 316 ? -5.268  36.365  53.017  1.00 38.08  ? 316  GLU A OE1   1 
ATOM   2410  O OE2   . GLU A 1 316 ? -3.896  36.343  51.313  1.00 33.67  ? 316  GLU A OE2   1 
ATOM   2411  N N     . CYS A 1 317 ? -3.072  38.745  57.332  1.00 33.40  ? 317  CYS A N     1 
ATOM   2412  C CA    . CYS A 1 317 ? -3.408  39.028  58.725  1.00 35.01  ? 317  CYS A CA    1 
ATOM   2413  C C     . CYS A 1 317 ? -4.275  40.269  58.932  1.00 36.02  ? 317  CYS A C     1 
ATOM   2414  O O     . CYS A 1 317 ? -4.767  40.490  60.049  1.00 34.94  ? 317  CYS A O     1 
ATOM   2415  C CB    . CYS A 1 317 ? -2.130  39.161  59.552  1.00 33.74  ? 317  CYS A CB    1 
ATOM   2416  S SG    . CYS A 1 317 ? -1.309  37.598  59.783  1.00 32.77  ? 317  CYS A SG    1 
ATOM   2417  N N     . LYS A 1 318 ? -4.388  41.079  57.875  1.00 37.77  ? 318  LYS A N     1 
ATOM   2418  C CA    . LYS A 1 318 ? -5.265  42.268  57.798  1.00 39.26  ? 318  LYS A CA    1 
ATOM   2419  C C     . LYS A 1 318 ? -5.019  43.275  58.931  1.00 38.98  ? 318  LYS A C     1 
ATOM   2420  O O     . LYS A 1 318 ? -5.958  43.873  59.471  1.00 39.41  ? 318  LYS A O     1 
ATOM   2421  C CB    . LYS A 1 318 ? -6.746  41.851  57.718  1.00 41.17  ? 318  LYS A CB    1 
ATOM   2422  C CG    . LYS A 1 318 ? -7.083  40.813  56.626  1.00 45.62  ? 318  LYS A CG    1 
ATOM   2423  C CD    . LYS A 1 318 ? -7.228  41.408  55.249  1.00 44.42  ? 318  LYS A CD    1 
ATOM   2424  C CE    . LYS A 1 318 ? -7.828  40.412  54.249  1.00 48.85  ? 318  LYS A CE    1 
ATOM   2425  N NZ    . LYS A 1 318 ? -6.808  39.580  53.522  1.00 47.80  ? 318  LYS A NZ    1 
ATOM   2426  N N     . GLY A 1 319 ? -3.748  43.444  59.293  1.00 38.03  ? 319  GLY A N     1 
ATOM   2427  C CA    . GLY A 1 319 ? -3.373  44.390  60.342  1.00 37.38  ? 319  GLY A CA    1 
ATOM   2428  C C     . GLY A 1 319 ? -3.650  44.035  61.805  1.00 35.38  ? 319  GLY A C     1 
ATOM   2429  O O     . GLY A 1 319 ? -3.342  44.845  62.674  1.00 34.55  ? 319  GLY A O     1 
ATOM   2430  N N     . SER A 1 320 ? -4.210  42.858  62.099  1.00 32.40  ? 320  SER A N     1 
ATOM   2431  C CA    . SER A 1 320 ? -4.477  42.493  63.502  1.00 32.99  ? 320  SER A CA    1 
ATOM   2432  C C     . SER A 1 320 ? -3.223  41.952  64.220  1.00 30.65  ? 320  SER A C     1 
ATOM   2433  O O     . SER A 1 320 ? -2.735  40.894  63.865  1.00 31.32  ? 320  SER A O     1 
ATOM   2434  C CB    . SER A 1 320 ? -5.585  41.448  63.581  1.00 35.05  ? 320  SER A CB    1 
ATOM   2435  O OG    . SER A 1 320 ? -5.743  41.022  64.926  1.00 38.64  ? 320  SER A OG    1 
ATOM   2436  N N     . PRO A 1 321 ? -2.689  42.687  65.220  1.00 30.21  ? 321  PRO A N     1 
ATOM   2437  C CA    . PRO A 1 321 ? -1.545  42.178  65.970  1.00 29.03  ? 321  PRO A CA    1 
ATOM   2438  C C     . PRO A 1 321 ? -1.735  40.847  66.709  1.00 28.87  ? 321  PRO A C     1 
ATOM   2439  O O     . PRO A 1 321 ? -0.745  40.119  66.884  1.00 28.73  ? 321  PRO A O     1 
ATOM   2440  C CB    . PRO A 1 321 ? -1.206  43.326  66.945  1.00 29.77  ? 321  PRO A CB    1 
ATOM   2441  C CG    . PRO A 1 321 ? -2.387  44.176  67.012  1.00 29.20  ? 321  PRO A CG    1 
ATOM   2442  C CD    . PRO A 1 321 ? -3.070  44.042  65.679  1.00 30.84  ? 321  PRO A CD    1 
ATOM   2443  N N     . LEU A 1 322 ? -2.952  40.512  67.146  1.00 27.76  ? 322  LEU A N     1 
ATOM   2444  C CA    . LEU A 1 322 ? -3.196  39.179  67.720  1.00 27.48  ? 322  LEU A CA    1 
ATOM   2445  C C     . LEU A 1 322 ? -2.998  38.083  66.669  1.00 26.93  ? 322  LEU A C     1 
ATOM   2446  O O     . LEU A 1 322 ? -2.370  37.073  66.951  1.00 26.10  ? 322  LEU A O     1 
ATOM   2447  C CB    . LEU A 1 322 ? -4.591  39.050  68.363  1.00 28.74  ? 322  LEU A CB    1 
ATOM   2448  C CG    . LEU A 1 322 ? -4.992  37.675  68.983  1.00 29.53  ? 322  LEU A CG    1 
ATOM   2449  C CD1   . LEU A 1 322 ? -3.997  37.095  69.961  1.00 26.76  ? 322  LEU A CD1   1 
ATOM   2450  C CD2   . LEU A 1 322 ? -6.304  37.777  69.673  1.00 29.30  ? 322  LEU A CD2   1 
ATOM   2451  N N     . VAL A 1 323 ? -3.520  38.286  65.462  1.00 26.15  ? 323  VAL A N     1 
ATOM   2452  C CA    . VAL A 1 323 ? -3.380  37.317  64.375  1.00 26.55  ? 323  VAL A CA    1 
ATOM   2453  C C     . VAL A 1 323 ? -1.903  37.219  63.966  1.00 26.28  ? 323  VAL A C     1 
ATOM   2454  O O     . VAL A 1 323 ? -1.363  36.124  63.833  1.00 26.16  ? 323  VAL A O     1 
ATOM   2455  C CB    . VAL A 1 323 ? -4.211  37.729  63.135  1.00 27.27  ? 323  VAL A CB    1 
ATOM   2456  C CG1   . VAL A 1 323 ? -4.037  36.731  61.987  1.00 27.44  ? 323  VAL A CG1   1 
ATOM   2457  C CG2   . VAL A 1 323 ? -5.668  37.843  63.485  1.00 33.55  ? 323  VAL A CG2   1 
ATOM   2458  N N     . VAL A 1 324 ? -1.242  38.365  63.765  1.00 25.33  ? 324  VAL A N     1 
ATOM   2459  C CA    . VAL A 1 324 ? 0.168   38.337  63.428  1.00 25.65  ? 324  VAL A CA    1 
ATOM   2460  C C     . VAL A 1 324 ? 0.923   37.546  64.470  1.00 25.32  ? 324  VAL A C     1 
ATOM   2461  O O     . VAL A 1 324 ? 1.764   36.738  64.118  1.00 28.86  ? 324  VAL A O     1 
ATOM   2462  C CB    . VAL A 1 324 ? 0.804   39.724  63.296  1.00 27.18  ? 324  VAL A CB    1 
ATOM   2463  C CG1   . VAL A 1 324 ? 2.273   39.578  62.900  1.00 28.05  ? 324  VAL A CG1   1 
ATOM   2464  C CG2   . VAL A 1 324 ? 0.061   40.590  62.271  1.00 28.27  ? 324  VAL A CG2   1 
ATOM   2465  N N     . SER A 1 325 ? 0.583   37.711  65.741  1.00 26.01  ? 325  SER A N     1 
ATOM   2466  C CA    . SER A 1 325 ? 1.263   36.996  66.838  1.00 25.43  ? 325  SER A CA    1 
ATOM   2467  C C     . SER A 1 325 ? 1.040   35.484  66.860  1.00 24.78  ? 325  SER A C     1 
ATOM   2468  O O     . SER A 1 325 ? 1.970   34.710  67.030  1.00 25.46  ? 325  SER A O     1 
ATOM   2469  C CB    . SER A 1 325 ? 0.859   37.611  68.178  1.00 27.37  ? 325  SER A CB    1 
ATOM   2470  O OG    . SER A 1 325 ? 1.398   38.912  68.283  1.00 27.09  ? 325  SER A OG    1 
ATOM   2471  N N     . LEU A 1 326 ? -0.191  35.073  66.627  1.00 24.93  ? 326  LEU A N     1 
ATOM   2472  C CA    . LEU A 1 326 ? -0.547  33.648  66.466  1.00 25.27  ? 326  LEU A CA    1 
ATOM   2473  C C     . LEU A 1 326 ? 0.240   32.948  65.364  1.00 23.86  ? 326  LEU A C     1 
ATOM   2474  O O     . LEU A 1 326 ? 0.719   31.833  65.545  1.00 23.57  ? 326  LEU A O     1 
ATOM   2475  C CB    . LEU A 1 326 ? -2.049  33.499  66.174  1.00 24.99  ? 326  LEU A CB    1 
ATOM   2476  C CG    . LEU A 1 326 ? -2.974  33.752  67.381  1.00 28.48  ? 326  LEU A CG    1 
ATOM   2477  C CD1   . LEU A 1 326 ? -4.439  34.006  66.941  1.00 26.04  ? 326  LEU A CD1   1 
ATOM   2478  C CD2   . LEU A 1 326 ? -2.902  32.584  68.326  1.00 28.82  ? 326  LEU A CD2   1 
ATOM   2479  N N     . ILE A 1 327 ? 0.338   33.610  64.219  1.00 24.88  ? 327  ILE A N     1 
ATOM   2480  C CA    . ILE A 1 327 ? 1.058   33.115  63.065  1.00 25.20  ? 327  ILE A CA    1 
ATOM   2481  C C     . ILE A 1 327 ? 2.578   33.145  63.297  1.00 25.12  ? 327  ILE A C     1 
ATOM   2482  O O     . ILE A 1 327 ? 3.281   32.228  62.915  1.00 25.27  ? 327  ILE A O     1 
ATOM   2483  C CB    . ILE A 1 327 ? 0.656   33.935  61.809  1.00 26.00  ? 327  ILE A CB    1 
ATOM   2484  C CG1   . ILE A 1 327 ? -0.849  33.776  61.506  1.00 31.92  ? 327  ILE A CG1   1 
ATOM   2485  C CG2   . ILE A 1 327 ? 1.459   33.541  60.602  1.00 28.22  ? 327  ILE A CG2   1 
ATOM   2486  C CD1   . ILE A 1 327 ? -1.313  32.346  61.243  1.00 35.05  ? 327  ILE A CD1   1 
ATOM   2487  N N     . GLY A 1 328 ? 3.077   34.210  63.891  1.00 26.01  ? 328  GLY A N     1 
ATOM   2488  C CA    . GLY A 1 328 ? 4.495   34.312  64.249  1.00 27.43  ? 328  GLY A CA    1 
ATOM   2489  C C     . GLY A 1 328 ? 4.957   33.197  65.171  1.00 28.10  ? 328  GLY A C     1 
ATOM   2490  O O     . GLY A 1 328 ? 6.051   32.634  64.990  1.00 27.71  ? 328  GLY A O     1 
ATOM   2491  N N     . ALA A 1 329 ? 4.120   32.869  66.146  1.00 28.48  ? 329  ALA A N     1 
ATOM   2492  C CA    . ALA A 1 329 ? 4.387   31.770  67.101  1.00 29.81  ? 329  ALA A CA    1 
ATOM   2493  C C     . ALA A 1 329 ? 4.409   30.421  66.401  1.00 31.07  ? 329  ALA A C     1 
ATOM   2494  O O     . ALA A 1 329 ? 5.263   29.594  66.688  1.00 30.52  ? 329  ALA A O     1 
ATOM   2495  C CB    . ALA A 1 329 ? 3.349   31.770  68.195  1.00 28.45  ? 329  ALA A CB    1 
ATOM   2496  N N     . LEU A 1 330 ? 3.461   30.202  65.481  1.00 31.96  ? 330  LEU A N     1 
ATOM   2497  C CA    . LEU A 1 330 ? 3.470   29.005  64.610  1.00 31.71  ? 330  LEU A CA    1 
ATOM   2498  C C     . LEU A 1 330 ? 4.733   28.869  63.762  1.00 31.92  ? 330  LEU A C     1 
ATOM   2499  O O     . LEU A 1 330 ? 5.283   27.776  63.626  1.00 31.78  ? 330  LEU A O     1 
ATOM   2500  C CB    . LEU A 1 330 ? 2.293   29.032  63.637  1.00 32.85  ? 330  LEU A CB    1 
ATOM   2501  C CG    . LEU A 1 330 ? 0.949   28.420  64.016  1.00 34.47  ? 330  LEU A CG    1 
ATOM   2502  C CD1   . LEU A 1 330 ? -0.027  28.696  62.881  1.00 36.35  ? 330  LEU A CD1   1 
ATOM   2503  C CD2   . LEU A 1 330 ? 1.065   26.941  64.275  1.00 34.35  ? 330  LEU A CD2   1 
ATOM   2504  N N     . LEU A 1 331 ? 5.148   29.974  63.150  1.00 31.06  ? 331  LEU A N     1 
ATOM   2505  C CA    . LEU A 1 331 ? 6.344   29.984  62.311  1.00 31.42  ? 331  LEU A CA    1 
ATOM   2506  C C     . LEU A 1 331 ? 7.596   29.737  63.171  1.00 30.72  ? 331  LEU A C     1 
ATOM   2507  O O     . LEU A 1 331 ? 8.496   29.042  62.726  1.00 30.40  ? 331  LEU A O     1 
ATOM   2508  C CB    . LEU A 1 331 ? 6.442   31.281  61.463  1.00 29.41  ? 331  LEU A CB    1 
ATOM   2509  C CG    . LEU A 1 331 ? 5.380   31.461  60.363  1.00 30.00  ? 331  LEU A CG    1 
ATOM   2510  C CD1   . LEU A 1 331 ? 5.313   32.874  59.828  1.00 33.63  ? 331  LEU A CD1   1 
ATOM   2511  C CD2   . LEU A 1 331 ? 5.603   30.514  59.237  1.00 30.93  ? 331  LEU A CD2   1 
ATOM   2512  N N     . ARG A 1 332 ? 7.648   30.275  64.389  1.00 30.91  ? 332  ARG A N     1 
ATOM   2513  C CA    . ARG A 1 332 ? 8.733   29.966  65.303  1.00 33.43  ? 332  ARG A CA    1 
ATOM   2514  C C     . ARG A 1 332 ? 8.773   28.466  65.637  1.00 35.17  ? 332  ARG A C     1 
ATOM   2515  O O     . ARG A 1 332 ? 9.846   27.837  65.671  1.00 33.15  ? 332  ARG A O     1 
ATOM   2516  C CB    . ARG A 1 332 ? 8.559   30.759  66.585  1.00 31.95  ? 332  ARG A CB    1 
ATOM   2517  C CG    . ARG A 1 332 ? 9.593   30.424  67.666  1.00 32.21  ? 332  ARG A CG    1 
ATOM   2518  C CD    . ARG A 1 332 ? 9.109   30.855  69.025  1.00 35.26  ? 332  ARG A CD    1 
ATOM   2519  N NE    . ARG A 1 332 ? 7.899   30.133  69.410  1.00 37.29  ? 332  ARG A NE    1 
ATOM   2520  C CZ    . ARG A 1 332 ? 6.945   30.634  70.192  1.00 38.55  ? 332  ARG A CZ    1 
ATOM   2521  N NH1   . ARG A 1 332 ? 7.032   31.880  70.679  1.00 33.38  ? 332  ARG A NH1   1 
ATOM   2522  N NH2   . ARG A 1 332 ? 5.897   29.881  70.492  1.00 41.23  ? 332  ARG A NH2   1 
ATOM   2523  N N     . ASP A 1 333 ? 7.587   27.915  65.882  1.00 37.22  ? 333  ASP A N     1 
ATOM   2524  C CA    . ASP A 1 333 ? 7.418   26.522  66.323  1.00 39.43  ? 333  ASP A CA    1 
ATOM   2525  C C     . ASP A 1 333 ? 7.609   25.477  65.261  1.00 41.67  ? 333  ASP A C     1 
ATOM   2526  O O     . ASP A 1 333 ? 7.949   24.343  65.586  1.00 41.15  ? 333  ASP A O     1 
ATOM   2527  C CB    . ASP A 1 333 ? 6.022   26.313  66.914  1.00 38.37  ? 333  ASP A CB    1 
ATOM   2528  C CG    . ASP A 1 333 ? 5.866   26.975  68.254  1.00 40.95  ? 333  ASP A CG    1 
ATOM   2529  O OD1   . ASP A 1 333 ? 6.914   27.317  68.835  1.00 44.82  ? 333  ASP A OD1   1 
ATOM   2530  O OD2   . ASP A 1 333 ? 4.715   27.167  68.718  1.00 39.04  ? 333  ASP A OD2   1 
ATOM   2531  N N     . PHE A 1 334 ? 7.342   25.852  64.009  1.00 43.88  ? 334  PHE A N     1 
ATOM   2532  C CA    . PHE A 1 334 ? 7.451   24.961  62.837  1.00 42.98  ? 334  PHE A CA    1 
ATOM   2533  C C     . PHE A 1 334 ? 8.128   25.743  61.717  1.00 43.15  ? 334  PHE A C     1 
ATOM   2534  O O     . PHE A 1 334 ? 7.448   26.165  60.782  1.00 41.78  ? 334  PHE A O     1 
ATOM   2535  C CB    . PHE A 1 334 ? 6.071   24.454  62.395  1.00 44.71  ? 334  PHE A CB    1 
ATOM   2536  C CG    . PHE A 1 334 ? 5.292   23.791  63.493  1.00 46.01  ? 334  PHE A CG    1 
ATOM   2537  C CD1   . PHE A 1 334 ? 5.501   22.456  63.808  1.00 49.80  ? 334  PHE A CD1   1 
ATOM   2538  C CD2   . PHE A 1 334 ? 4.365   24.513  64.237  1.00 46.02  ? 334  PHE A CD2   1 
ATOM   2539  C CE1   . PHE A 1 334 ? 4.793   21.853  64.850  1.00 47.66  ? 334  PHE A CE1   1 
ATOM   2540  C CE2   . PHE A 1 334 ? 3.670   23.926  65.278  1.00 44.47  ? 334  PHE A CE2   1 
ATOM   2541  C CZ    . PHE A 1 334 ? 3.877   22.595  65.582  1.00 46.08  ? 334  PHE A CZ    1 
ATOM   2542  N N     . PRO A 1 335 ? 9.473   25.923  61.819  1.00 43.46  ? 335  PRO A N     1 
ATOM   2543  C CA    . PRO A 1 335 ? 10.339  26.957  61.194  1.00 43.99  ? 335  PRO A CA    1 
ATOM   2544  C C     . PRO A 1 335 ? 10.523  27.038  59.668  1.00 45.50  ? 335  PRO A C     1 
ATOM   2545  O O     . PRO A 1 335 ? 10.909  28.122  59.145  1.00 47.60  ? 335  PRO A O     1 
ATOM   2546  C CB    . PRO A 1 335 ? 11.717  26.672  61.833  1.00 44.24  ? 335  PRO A CB    1 
ATOM   2547  C CG    . PRO A 1 335 ? 11.441  25.793  63.024  1.00 44.12  ? 335  PRO A CG    1 
ATOM   2548  C CD    . PRO A 1 335 ? 10.260  25.009  62.679  1.00 42.50  ? 335  PRO A CD    1 
ATOM   2549  N N     . ASN A 1 336 ? 10.330  25.938  58.955  1.00 43.81  ? 336  ASN A N     1 
ATOM   2550  C CA    . ASN A 1 336 ? 10.564  25.981  57.508  1.00 44.53  ? 336  ASN A CA    1 
ATOM   2551  C C     . ASN A 1 336 ? 9.262   25.709  56.745  1.00 43.14  ? 336  ASN A C     1 
ATOM   2552  O O     . ASN A 1 336 ? 9.270   25.023  55.749  1.00 41.40  ? 336  ASN A O     1 
ATOM   2553  C CB    . ASN A 1 336 ? 11.711  25.017  57.115  1.00 45.34  ? 336  ASN A CB    1 
ATOM   2554  C CG    . ASN A 1 336 ? 13.102  25.533  57.563  1.00 47.56  ? 336  ASN A CG    1 
ATOM   2555  O OD1   . ASN A 1 336 ? 13.536  26.616  57.154  1.00 42.51  ? 336  ASN A OD1   1 
ATOM   2556  N ND2   . ASN A 1 336 ? 13.795  24.755  58.400  1.00 49.01  ? 336  ASN A ND2   1 
ATOM   2557  N N     . ARG A 1 337 ? 8.157   26.280  57.232  1.00 42.49  ? 337  ARG A N     1 
ATOM   2558  C CA    . ARG A 1 337 ? 6.812   26.002  56.709  1.00 42.06  ? 337  ARG A CA    1 
ATOM   2559  C C     . ARG A 1 337 ? 6.050   27.263  56.250  1.00 38.10  ? 337  ARG A C     1 
ATOM   2560  O O     . ARG A 1 337 ? 4.825   27.301  56.257  1.00 35.48  ? 337  ARG A O     1 
ATOM   2561  C CB    . ARG A 1 337 ? 6.022   25.183  57.732  1.00 43.47  ? 337  ARG A CB    1 
ATOM   2562  C CG    . ARG A 1 337 ? 6.626   23.787  57.936  1.00 51.11  ? 337  ARG A CG    1 
ATOM   2563  C CD    . ARG A 1 337 ? 5.585   22.688  57.813  1.00 60.39  ? 337  ARG A CD    1 
ATOM   2564  N NE    . ARG A 1 337 ? 4.873   22.458  59.069  1.00 66.89  ? 337  ARG A NE    1 
ATOM   2565  C CZ    . ARG A 1 337 ? 3.811   21.665  59.203  1.00 70.45  ? 337  ARG A CZ    1 
ATOM   2566  N NH1   . ARG A 1 337 ? 3.299   21.013  58.155  1.00 72.91  ? 337  ARG A NH1   1 
ATOM   2567  N NH2   . ARG A 1 337 ? 3.256   21.518  60.396  1.00 70.34  ? 337  ARG A NH2   1 
ATOM   2568  N N     . TRP A 1 338 ? 6.812   28.256  55.806  1.00 36.70  ? 338  TRP A N     1 
ATOM   2569  C CA    . TRP A 1 338 ? 6.307   29.561  55.402  1.00 36.73  ? 338  TRP A CA    1 
ATOM   2570  C C     . TRP A 1 338 ? 5.286   29.479  54.281  1.00 35.17  ? 338  TRP A C     1 
ATOM   2571  O O     . TRP A 1 338 ? 4.275   30.152  54.306  1.00 32.81  ? 338  TRP A O     1 
ATOM   2572  C CB    . TRP A 1 338 ? 7.491   30.425  54.982  1.00 35.22  ? 338  TRP A CB    1 
ATOM   2573  C CG    . TRP A 1 338 ? 8.292   30.884  56.167  1.00 38.21  ? 338  TRP A CG    1 
ATOM   2574  C CD1   . TRP A 1 338 ? 9.264   30.182  56.833  1.00 38.15  ? 338  TRP A CD1   1 
ATOM   2575  C CD2   . TRP A 1 338 ? 8.168   32.137  56.846  1.00 36.24  ? 338  TRP A CD2   1 
ATOM   2576  N NE1   . TRP A 1 338 ? 9.761   30.929  57.873  1.00 36.36  ? 338  TRP A NE1   1 
ATOM   2577  C CE2   . TRP A 1 338 ? 9.107   32.131  57.912  1.00 37.02  ? 338  TRP A CE2   1 
ATOM   2578  C CE3   . TRP A 1 338 ? 7.358   33.267  56.658  1.00 33.62  ? 338  TRP A CE3   1 
ATOM   2579  C CZ2   . TRP A 1 338 ? 9.268   33.214  58.783  1.00 33.86  ? 338  TRP A CZ2   1 
ATOM   2580  C CZ3   . TRP A 1 338 ? 7.530   34.349  57.512  1.00 36.92  ? 338  TRP A CZ3   1 
ATOM   2581  C CH2   . TRP A 1 338 ? 8.477   34.308  58.575  1.00 35.82  ? 338  TRP A CH2   1 
ATOM   2582  N N     . GLU A 1 339 ? 5.573   28.651  53.286  1.00 37.04  ? 339  GLU A N     1 
ATOM   2583  C CA    . GLU A 1 339 ? 4.656   28.411  52.169  1.00 37.11  ? 339  GLU A CA    1 
ATOM   2584  C C     . GLU A 1 339 ? 3.408   27.645  52.619  1.00 35.77  ? 339  GLU A C     1 
ATOM   2585  O O     . GLU A 1 339 ? 2.301   28.010  52.261  1.00 32.84  ? 339  GLU A O     1 
ATOM   2586  C CB    . GLU A 1 339 ? 5.390   27.641  51.061  1.00 37.12  ? 339  GLU A CB    1 
ATOM   2587  C CG    . GLU A 1 339 ? 4.576   27.385  49.813  1.00 37.01  ? 339  GLU A CG    1 
ATOM   2588  C CD    . GLU A 1 339 ? 5.300   26.455  48.848  1.00 43.36  ? 339  GLU A CD    1 
ATOM   2589  O OE1   . GLU A 1 339 ? 6.560   26.538  48.763  1.00 48.78  ? 339  GLU A OE1   1 
ATOM   2590  O OE2   . GLU A 1 339 ? 4.616   25.642  48.180  1.00 43.50  ? 339  GLU A OE2   1 
ATOM   2591  N N     . TYR A 1 340 ? 3.608   26.597  53.414  1.00 36.71  ? 340  TYR A N     1 
ATOM   2592  C CA    . TYR A 1 340 ? 2.508   25.810  53.944  1.00 36.79  ? 340  TYR A CA    1 
ATOM   2593  C C     . TYR A 1 340 ? 1.475   26.656  54.721  1.00 35.90  ? 340  TYR A C     1 
ATOM   2594  O O     . TYR A 1 340 ? 0.287   26.567  54.452  1.00 34.70  ? 340  TYR A O     1 
ATOM   2595  C CB    . TYR A 1 340 ? 3.054   24.663  54.795  1.00 39.44  ? 340  TYR A CB    1 
ATOM   2596  C CG    . TYR A 1 340 ? 1.964   23.902  55.481  1.00 38.94  ? 340  TYR A CG    1 
ATOM   2597  C CD1   . TYR A 1 340 ? 1.122   23.070  54.761  1.00 45.21  ? 340  TYR A CD1   1 
ATOM   2598  C CD2   . TYR A 1 340 ? 1.750   24.039  56.842  1.00 42.92  ? 340  TYR A CD2   1 
ATOM   2599  C CE1   . TYR A 1 340 ? 0.101   22.385  55.383  1.00 48.30  ? 340  TYR A CE1   1 
ATOM   2600  C CE2   . TYR A 1 340 ? 0.729   23.365  57.474  1.00 44.86  ? 340  TYR A CE2   1 
ATOM   2601  C CZ    . TYR A 1 340 ? -0.086  22.539  56.742  1.00 45.33  ? 340  TYR A CZ    1 
ATOM   2602  O OH    . TYR A 1 340 ? -1.087  21.858  57.372  1.00 48.05  ? 340  TYR A OH    1 
ATOM   2603  N N     . TYR A 1 341 ? 1.944   27.494  55.645  1.00 36.03  ? 341  TYR A N     1 
ATOM   2604  C CA    . TYR A 1 341 ? 1.058   28.325  56.440  1.00 35.58  ? 341  TYR A CA    1 
ATOM   2605  C C     . TYR A 1 341 ? 0.489   29.521  55.679  1.00 33.83  ? 341  TYR A C     1 
ATOM   2606  O O     . TYR A 1 341 ? -0.651  29.900  55.931  1.00 33.34  ? 341  TYR A O     1 
ATOM   2607  C CB    . TYR A 1 341 ? 1.762   28.751  57.711  1.00 37.47  ? 341  TYR A CB    1 
ATOM   2608  C CG    . TYR A 1 341 ? 2.024   27.590  58.649  1.00 39.23  ? 341  TYR A CG    1 
ATOM   2609  C CD1   . TYR A 1 341 ? 0.988   26.741  59.048  1.00 38.90  ? 341  TYR A CD1   1 
ATOM   2610  C CD2   . TYR A 1 341 ? 3.302   27.354  59.157  1.00 42.33  ? 341  TYR A CD2   1 
ATOM   2611  C CE1   . TYR A 1 341 ? 1.213   25.696  59.907  1.00 38.18  ? 341  TYR A CE1   1 
ATOM   2612  C CE2   . TYR A 1 341 ? 3.536   26.304  60.032  1.00 42.88  ? 341  TYR A CE2   1 
ATOM   2613  C CZ    . TYR A 1 341 ? 2.481   25.479  60.396  1.00 40.24  ? 341  TYR A CZ    1 
ATOM   2614  O OH    . TYR A 1 341 ? 2.704   24.433  61.242  1.00 44.18  ? 341  TYR A OH    1 
ATOM   2615  N N     . LEU A 1 342 ? 1.231   30.090  54.728  1.00 33.77  ? 342  LEU A N     1 
ATOM   2616  C CA    . LEU A 1 342 ? 0.644   31.105  53.817  1.00 34.19  ? 342  LEU A CA    1 
ATOM   2617  C C     . LEU A 1 342 ? -0.584  30.541  53.072  1.00 35.14  ? 342  LEU A C     1 
ATOM   2618  O O     . LEU A 1 342 ? -1.624  31.197  52.959  1.00 33.49  ? 342  LEU A O     1 
ATOM   2619  C CB    . LEU A 1 342 ? 1.690   31.624  52.807  1.00 32.49  ? 342  LEU A CB    1 
ATOM   2620  C CG    . LEU A 1 342 ? 1.278   32.618  51.696  1.00 32.44  ? 342  LEU A CG    1 
ATOM   2621  C CD1   . LEU A 1 342 ? 0.510   33.849  52.198  1.00 27.10  ? 342  LEU A CD1   1 
ATOM   2622  C CD2   . LEU A 1 342 ? 2.503   33.079  50.923  1.00 33.81  ? 342  LEU A CD2   1 
ATOM   2623  N N     . LYS A 1 343 ? -0.455  29.322  52.557  1.00 36.96  ? 343  LYS A N     1 
ATOM   2624  C CA    . LYS A 1 343 ? -1.546  28.664  51.825  1.00 37.74  ? 343  LYS A CA    1 
ATOM   2625  C C     . LYS A 1 343 ? -2.785  28.363  52.682  1.00 35.89  ? 343  LYS A C     1 
ATOM   2626  O O     . LYS A 1 343 ? -3.923  28.574  52.249  1.00 32.35  ? 343  LYS A O     1 
ATOM   2627  C CB    . LYS A 1 343 ? -1.030  27.390  51.154  1.00 37.87  ? 343  LYS A CB    1 
ATOM   2628  C CG    . LYS A 1 343 ? -0.509  27.645  49.763  1.00 44.12  ? 343  LYS A CG    1 
ATOM   2629  C CD    . LYS A 1 343 ? 0.430   26.548  49.272  1.00 43.73  ? 343  LYS A CD    1 
ATOM   2630  C CE    . LYS A 1 343 ? 0.936   26.861  47.865  1.00 46.30  ? 343  LYS A CE    1 
ATOM   2631  N NZ    . LYS A 1 343 ? 1.832   25.777  47.342  1.00 45.59  ? 343  LYS A NZ    1 
ATOM   2632  N N     . GLN A 1 344 ? -2.561  27.856  53.888  1.00 36.71  ? 344  GLN A N     1 
ATOM   2633  C CA    . GLN A 1 344 ? -3.649  27.661  54.844  1.00 40.07  ? 344  GLN A CA    1 
ATOM   2634  C C     . GLN A 1 344 ? -4.404  28.957  55.194  1.00 40.12  ? 344  GLN A C     1 
ATOM   2635  O O     . GLN A 1 344 ? -5.627  28.951  55.328  1.00 40.85  ? 344  GLN A O     1 
ATOM   2636  C CB    . GLN A 1 344 ? -3.097  26.986  56.095  1.00 40.55  ? 344  GLN A CB    1 
ATOM   2637  C CG    . GLN A 1 344 ? -2.669  25.556  55.825  1.00 43.07  ? 344  GLN A CG    1 
ATOM   2638  C CD    . GLN A 1 344 ? -2.848  24.683  57.015  1.00 46.72  ? 344  GLN A CD    1 
ATOM   2639  O OE1   . GLN A 1 344 ? -2.645  25.110  58.154  1.00 61.19  ? 344  GLN A OE1   1 
ATOM   2640  N NE2   . GLN A 1 344 ? -3.235  23.440  56.773  1.00 59.20  ? 344  GLN A NE2   1 
ATOM   2641  N N     . LEU A 1 345 ? -3.668  30.056  55.327  1.00 40.37  ? 345  LEU A N     1 
ATOM   2642  C CA    . LEU A 1 345 ? -4.249  31.368  55.549  1.00 40.92  ? 345  LEU A CA    1 
ATOM   2643  C C     . LEU A 1 345 ? -5.017  31.887  54.356  1.00 41.05  ? 345  LEU A C     1 
ATOM   2644  O O     . LEU A 1 345 ? -6.025  32.531  54.538  1.00 41.32  ? 345  LEU A O     1 
ATOM   2645  C CB    . LEU A 1 345 ? -3.147  32.366  55.880  1.00 40.98  ? 345  LEU A CB    1 
ATOM   2646  C CG    . LEU A 1 345 ? -2.703  32.526  57.323  1.00 40.84  ? 345  LEU A CG    1 
ATOM   2647  C CD1   . LEU A 1 345 ? -1.619  33.614  57.357  1.00 41.52  ? 345  LEU A CD1   1 
ATOM   2648  C CD2   . LEU A 1 345 ? -3.877  32.902  58.257  1.00 42.19  ? 345  LEU A CD2   1 
ATOM   2649  N N     . GLN A 1 346 ? -4.530  31.627  53.147  1.00 43.02  ? 346  GLN A N     1 
ATOM   2650  C CA    . GLN A 1 346 ? -5.227  32.016  51.910  1.00 45.18  ? 346  GLN A CA    1 
ATOM   2651  C C     . GLN A 1 346 ? -6.432  31.122  51.600  1.00 47.80  ? 346  GLN A C     1 
ATOM   2652  O O     . GLN A 1 346 ? -7.406  31.585  51.009  1.00 48.43  ? 346  GLN A O     1 
ATOM   2653  C CB    . GLN A 1 346 ? -4.265  31.992  50.716  1.00 43.34  ? 346  GLN A CB    1 
ATOM   2654  C CG    . GLN A 1 346 ? -3.171  33.045  50.772  1.00 43.59  ? 346  GLN A CG    1 
ATOM   2655  C CD    . GLN A 1 346 ? -2.102  32.847  49.706  1.00 44.20  ? 346  GLN A CD    1 
ATOM   2656  O OE1   . GLN A 1 346 ? -1.761  31.715  49.332  1.00 43.04  ? 346  GLN A OE1   1 
ATOM   2657  N NE2   . GLN A 1 346 ? -1.567  33.951  49.212  1.00 37.51  ? 346  GLN A NE2   1 
ATOM   2658  N N     . ASN A 1 347 ? -6.353  29.847  51.981  1.00 50.25  ? 347  ASN A N     1 
ATOM   2659  C CA    . ASN A 1 347 ? -7.443  28.885  51.764  1.00 51.46  ? 347  ASN A CA    1 
ATOM   2660  C C     . ASN A 1 347 ? -8.210  28.675  53.054  1.00 52.25  ? 347  ASN A C     1 
ATOM   2661  O O     . ASN A 1 347 ? -7.991  27.687  53.757  1.00 53.03  ? 347  ASN A O     1 
ATOM   2662  C CB    . ASN A 1 347 ? -6.872  27.562  51.243  1.00 52.89  ? 347  ASN A CB    1 
ATOM   2663  C CG    . ASN A 1 347 ? -6.264  27.697  49.847  1.00 57.12  ? 347  ASN A CG    1 
ATOM   2664  O OD1   . ASN A 1 347 ? -6.987  27.750  48.849  1.00 60.28  ? 347  ASN A OD1   1 
ATOM   2665  N ND2   . ASN A 1 347 ? -4.932  27.755  49.774  1.00 58.29  ? 347  ASN A ND2   1 
ATOM   2666  N N     . LYS A 1 348 ? -9.105  29.619  53.357  1.00 52.86  ? 348  LYS A N     1 
ATOM   2667  C CA    . LYS A 1 348 ? -9.769  29.688  54.670  1.00 53.63  ? 348  LYS A CA    1 
ATOM   2668  C C     . LYS A 1 348 ? -10.899 28.680  54.777  1.00 54.37  ? 348  LYS A C     1 
ATOM   2669  O O     . LYS A 1 348 ? -11.872 28.764  54.037  1.00 55.06  ? 348  LYS A O     1 
ATOM   2670  C CB    . LYS A 1 348 ? -10.291 31.112  54.951  1.00 53.25  ? 348  LYS A CB    1 
ATOM   2671  C CG    . LYS A 1 348 ? -9.275  31.985  55.689  1.00 54.42  ? 348  LYS A CG    1 
ATOM   2672  C CD    . LYS A 1 348 ? -9.523  33.493  55.584  1.00 55.08  ? 348  LYS A CD    1 
ATOM   2673  C CE    . LYS A 1 348 ? -8.182  34.258  55.602  1.00 54.85  ? 348  LYS A CE    1 
ATOM   2674  N NZ    . LYS A 1 348 ? -8.316  35.719  55.780  1.00 55.29  ? 348  LYS A NZ    1 
ATOM   2675  N N     . GLN A 1 349 ? -10.762 27.733  55.705  1.00 54.99  ? 349  GLN A N     1 
ATOM   2676  C CA    . GLN A 1 349 ? -11.699 26.603  55.827  1.00 56.08  ? 349  GLN A CA    1 
ATOM   2677  C C     . GLN A 1 349 ? -12.676 26.693  57.005  1.00 55.44  ? 349  GLN A C     1 
ATOM   2678  O O     . GLN A 1 349 ? -13.667 25.957  57.040  1.00 55.53  ? 349  GLN A O     1 
ATOM   2679  C CB    . GLN A 1 349 ? -10.921 25.275  55.886  1.00 56.80  ? 349  GLN A CB    1 
ATOM   2680  C CG    . GLN A 1 349 ? -10.408 24.803  54.512  1.00 58.00  ? 349  GLN A CG    1 
ATOM   2681  C CD    . GLN A 1 349 ? -9.433  23.632  54.595  1.00 58.57  ? 349  GLN A CD    1 
ATOM   2682  O OE1   . GLN A 1 349 ? -8.743  23.450  55.596  1.00 63.23  ? 349  GLN A OE1   1 
ATOM   2683  N NE2   . GLN A 1 349 ? -9.364  22.842  53.526  1.00 62.49  ? 349  GLN A NE2   1 
ATOM   2684  N N     . PHE A 1 350 ? -12.415 27.592  57.952  1.00 54.85  ? 350  PHE A N     1 
ATOM   2685  C CA    . PHE A 1 350 ? -13.229 27.679  59.166  1.00 57.15  ? 350  PHE A CA    1 
ATOM   2686  C C     . PHE A 1 350 ? -14.622 28.282  58.909  1.00 59.04  ? 350  PHE A C     1 
ATOM   2687  O O     . PHE A 1 350 ? -14.757 29.223  58.133  1.00 58.85  ? 350  PHE A O     1 
ATOM   2688  C CB    . PHE A 1 350 ? -12.505 28.493  60.245  1.00 53.00  ? 350  PHE A CB    1 
ATOM   2689  C CG    . PHE A 1 350 ? -13.121 28.354  61.598  1.00 51.08  ? 350  PHE A CG    1 
ATOM   2690  C CD1   . PHE A 1 350 ? -12.876 27.230  62.365  1.00 44.96  ? 350  PHE A CD1   1 
ATOM   2691  C CD2   . PHE A 1 350 ? -13.994 29.317  62.084  1.00 41.72  ? 350  PHE A CD2   1 
ATOM   2692  C CE1   . PHE A 1 350 ? -13.462 27.092  63.612  1.00 43.99  ? 350  PHE A CE1   1 
ATOM   2693  C CE2   . PHE A 1 350 ? -14.583 29.178  63.326  1.00 40.48  ? 350  PHE A CE2   1 
ATOM   2694  C CZ    . PHE A 1 350 ? -14.311 28.072  64.086  1.00 43.15  ? 350  PHE A CZ    1 
ATOM   2695  N N     . LYS A 1 351 ? -15.643 27.758  59.592  1.00 63.81  ? 351  LYS A N     1 
ATOM   2696  C CA    . LYS A 1 351 ? -17.045 28.127  59.330  1.00 67.94  ? 351  LYS A CA    1 
ATOM   2697  C C     . LYS A 1 351 ? -17.714 28.907  60.475  1.00 70.42  ? 351  LYS A C     1 
ATOM   2698  O O     . LYS A 1 351 ? -18.097 28.337  61.502  1.00 71.03  ? 351  LYS A O     1 
ATOM   2699  C CB    . LYS A 1 351 ? -17.866 26.876  58.980  1.00 67.32  ? 351  LYS A CB    1 
ATOM   2700  C CG    . LYS A 1 351 ? -17.714 26.474  57.521  1.00 70.70  ? 351  LYS A CG    1 
ATOM   2701  C CD    . LYS A 1 351 ? -17.797 24.966  57.313  1.00 70.34  ? 351  LYS A CD    1 
ATOM   2702  C CE    . LYS A 1 351 ? -17.073 24.551  56.032  1.00 71.42  ? 351  LYS A CE    1 
ATOM   2703  N NZ    . LYS A 1 351 ? -17.173 23.084  55.786  1.00 72.30  ? 351  LYS A NZ    1 
ATOM   2704  N N     . ARG A 1 352 ? -17.864 30.213  60.261  1.00 73.30  ? 352  ARG A N     1 
ATOM   2705  C CA    . ARG A 1 352 ? -18.592 31.088  61.177  1.00 75.71  ? 352  ARG A CA    1 
ATOM   2706  C C     . ARG A 1 352 ? -20.104 30.958  61.037  1.00 77.76  ? 352  ARG A C     1 
ATOM   2707  O O     . ARG A 1 352 ? -20.698 31.363  60.030  1.00 76.58  ? 352  ARG A O     1 
ATOM   2708  C CB    . ARG A 1 352 ? -18.221 32.555  60.951  1.00 76.39  ? 352  ARG A CB    1 
ATOM   2709  C CG    . ARG A 1 352 ? -17.148 33.050  61.845  1.00 74.39  ? 352  ARG A CG    1 
ATOM   2710  C CD    . ARG A 1 352 ? -17.652 33.342  63.232  1.00 70.82  ? 352  ARG A CD    1 
ATOM   2711  N NE    . ARG A 1 352 ? -16.525 33.706  64.083  1.00 69.39  ? 352  ARG A NE    1 
ATOM   2712  C CZ    . ARG A 1 352 ? -16.524 33.679  65.408  1.00 67.51  ? 352  ARG A CZ    1 
ATOM   2713  N NH1   . ARG A 1 352 ? -17.606 33.323  66.087  1.00 69.60  ? 352  ARG A NH1   1 
ATOM   2714  N NH2   . ARG A 1 352 ? -15.427 34.025  66.057  1.00 70.28  ? 352  ARG A NH2   1 
ATOM   2715  N N     . ILE A 1 353 ? -20.709 30.420  62.084  1.00 80.74  ? 353  ILE A N     1 
ATOM   2716  C CA    . ILE A 1 353 ? -22.153 30.353  62.224  1.00 82.86  ? 353  ILE A CA    1 
ATOM   2717  C C     . ILE A 1 353 ? -22.691 31.729  62.638  1.00 85.08  ? 353  ILE A C     1 
ATOM   2718  O O     . ILE A 1 353 ? -23.529 32.308  61.941  1.00 85.60  ? 353  ILE A O     1 
ATOM   2719  C CB    . ILE A 1 353 ? -22.527 29.288  63.285  1.00 83.39  ? 353  ILE A CB    1 
ATOM   2720  C CG1   . ILE A 1 353 ? -22.047 27.899  62.804  1.00 83.00  ? 353  ILE A CG1   1 
ATOM   2721  C CG2   . ILE A 1 353 ? -24.016 29.389  63.650  1.00 80.95  ? 353  ILE A CG2   1 
ATOM   2722  C CD1   . ILE A 1 353 ? -21.765 26.894  63.928  1.00 84.29  ? 353  ILE A CD1   1 
ATOM   2723  N N     . ARG A 1 354 ? -22.199 32.241  63.770  1.00 87.07  ? 354  ARG A N     1 
ATOM   2724  C CA    . ARG A 1 354 ? -22.591 33.557  64.286  1.00 87.77  ? 354  ARG A CA    1 
ATOM   2725  C C     . ARG A 1 354 ? -21.862 34.628  63.474  1.00 88.37  ? 354  ARG A C     1 
ATOM   2726  O O     . ARG A 1 354 ? -20.991 35.344  63.987  1.00 87.95  ? 354  ARG A O     1 
ATOM   2727  C CB    . ARG A 1 354 ? -22.263 33.657  65.780  1.00 88.66  ? 354  ARG A CB    1 
ATOM   2728  C CG    . ARG A 1 354 ? -22.949 34.803  66.512  1.00 89.79  ? 354  ARG A CG    1 
ATOM   2729  C CD    . ARG A 1 354 ? -22.595 34.783  68.004  1.00 91.81  ? 354  ARG A CD    1 
ATOM   2730  N NE    . ARG A 1 354 ? -23.142 35.929  68.738  1.00 96.28  ? 354  ARG A NE    1 
ATOM   2731  C CZ    . ARG A 1 354 ? -22.850 36.233  70.006  1.00 99.95  ? 354  ARG A CZ    1 
ATOM   2732  N NH1   . ARG A 1 354 ? -22.008 35.481  70.717  1.00 103.35 ? 354  ARG A NH1   1 
ATOM   2733  N NH2   . ARG A 1 354 ? -23.405 37.302  70.574  1.00 101.41 ? 354  ARG A NH2   1 
ATOM   2734  N N     . LYS A 1 355 ? -22.267 34.733  62.205  1.00 88.92  ? 355  LYS A N     1 
ATOM   2735  C CA    . LYS A 1 355 ? -21.471 35.344  61.116  1.00 88.63  ? 355  LYS A CA    1 
ATOM   2736  C C     . LYS A 1 355 ? -20.856 36.706  61.422  1.00 88.51  ? 355  LYS A C     1 
ATOM   2737  O O     . LYS A 1 355 ? -19.663 36.810  61.731  1.00 88.70  ? 355  LYS A O     1 
ATOM   2738  C CB    . LYS A 1 355 ? -22.333 35.462  59.847  1.00 89.53  ? 355  LYS A CB    1 
ATOM   2739  C CG    . LYS A 1 355 ? -22.550 34.160  59.107  1.00 90.27  ? 355  LYS A CG    1 
ATOM   2740  C CD    . LYS A 1 355 ? -21.909 34.187  57.732  1.00 92.98  ? 355  LYS A CD    1 
ATOM   2741  C CE    . LYS A 1 355 ? -22.288 32.945  56.929  1.00 94.11  ? 355  LYS A CE    1 
ATOM   2742  N NZ    . LYS A 1 355 ? -22.451 33.227  55.475  1.00 95.55  ? 355  LYS A NZ    1 
ATOM   2743  N N     . SER A 1 356 ? -21.682 37.746  61.327  1.00 88.18  ? 356  SER A N     1 
ATOM   2744  C CA    . SER A 1 356 ? -21.211 39.126  61.405  1.00 86.67  ? 356  SER A CA    1 
ATOM   2745  C C     . SER A 1 356 ? -20.898 39.533  62.850  1.00 84.54  ? 356  SER A C     1 
ATOM   2746  O O     . SER A 1 356 ? -21.157 38.784  63.800  1.00 83.15  ? 356  SER A O     1 
ATOM   2747  C CB    . SER A 1 356 ? -22.266 40.069  60.795  1.00 87.57  ? 356  SER A CB    1 
ATOM   2748  O OG    . SER A 1 356 ? -21.707 41.330  60.460  1.00 87.76  ? 356  SER A OG    1 
ATOM   2749  N N     . SER A 1 357 ? -20.338 40.727  62.996  1.00 82.28  ? 357  SER A N     1 
ATOM   2750  C CA    . SER A 1 357 ? -20.063 41.289  64.309  1.00 81.46  ? 357  SER A CA    1 
ATOM   2751  C C     . SER A 1 357 ? -19.799 42.790  64.191  1.00 80.19  ? 357  SER A C     1 
ATOM   2752  O O     . SER A 1 357 ? -20.315 43.447  63.282  1.00 80.53  ? 357  SER A O     1 
ATOM   2753  C CB    . SER A 1 357 ? -18.857 40.590  64.931  1.00 81.67  ? 357  SER A CB    1 
ATOM   2754  O OG    . SER A 1 357 ? -18.421 41.273  66.098  1.00 86.62  ? 357  SER A OG    1 
ATOM   2755  N N     . SER A 1 358 ? -19.021 43.320  65.137  1.00 77.33  ? 358  SER A N     1 
ATOM   2756  C CA    . SER A 1 358 ? -18.364 44.621  64.998  1.00 74.16  ? 358  SER A CA    1 
ATOM   2757  C C     . SER A 1 358 ? -16.908 44.376  64.588  1.00 70.48  ? 358  SER A C     1 
ATOM   2758  O O     . SER A 1 358 ? -16.015 45.194  64.836  1.00 67.99  ? 358  SER A O     1 
ATOM   2759  C CB    . SER A 1 358 ? -18.408 45.352  66.332  1.00 74.45  ? 358  SER A CB    1 
ATOM   2760  O OG    . SER A 1 358 ? -17.756 44.582  67.329  1.00 79.71  ? 358  SER A OG    1 
ATOM   2761  N N     . TYR A 1 359 ? -16.685 43.235  63.945  1.00 67.05  ? 359  TYR A N     1 
ATOM   2762  C CA    . TYR A 1 359 ? -15.354 42.687  63.781  1.00 65.24  ? 359  TYR A CA    1 
ATOM   2763  C C     . TYR A 1 359 ? -15.375 41.684  62.622  1.00 62.08  ? 359  TYR A C     1 
ATOM   2764  O O     . TYR A 1 359 ? -16.344 40.953  62.435  1.00 59.86  ? 359  TYR A O     1 
ATOM   2765  C CB    . TYR A 1 359 ? -14.878 42.020  65.095  1.00 64.01  ? 359  TYR A CB    1 
ATOM   2766  C CG    . TYR A 1 359 ? -13.454 41.543  65.029  1.00 63.67  ? 359  TYR A CG    1 
ATOM   2767  C CD1   . TYR A 1 359 ? -12.399 42.430  65.213  1.00 66.19  ? 359  TYR A CD1   1 
ATOM   2768  C CD2   . TYR A 1 359 ? -13.150 40.212  64.745  1.00 61.62  ? 359  TYR A CD2   1 
ATOM   2769  C CE1   . TYR A 1 359 ? -11.044 42.001  65.126  1.00 67.00  ? 359  TYR A CE1   1 
ATOM   2770  C CE2   . TYR A 1 359 ? -11.804 39.767  64.651  1.00 62.02  ? 359  TYR A CE2   1 
ATOM   2771  C CZ    . TYR A 1 359 ? -10.757 40.673  64.841  1.00 62.45  ? 359  TYR A CZ    1 
ATOM   2772  O OH    . TYR A 1 359 ? -9.433  40.267  64.762  1.00 60.12  ? 359  TYR A OH    1 
ATOM   2773  N N     . ASP A 1 360 ? -14.309 41.695  61.827  1.00 61.90  ? 360  ASP A N     1 
ATOM   2774  C CA    . ASP A 1 360 ? -14.071 40.675  60.804  1.00 60.12  ? 360  ASP A CA    1 
ATOM   2775  C C     . ASP A 1 360 ? -13.231 39.542  61.390  1.00 57.20  ? 360  ASP A C     1 
ATOM   2776  O O     . ASP A 1 360 ? -12.044 39.723  61.654  1.00 55.40  ? 360  ASP A O     1 
ATOM   2777  C CB    . ASP A 1 360 ? -13.291 41.252  59.608  1.00 61.02  ? 360  ASP A CB    1 
ATOM   2778  C CG    . ASP A 1 360 ? -13.906 42.524  59.031  1.00 63.53  ? 360  ASP A CG    1 
ATOM   2779  O OD1   . ASP A 1 360 ? -15.143 42.594  58.893  1.00 58.79  ? 360  ASP A OD1   1 
ATOM   2780  O OD2   . ASP A 1 360 ? -13.127 43.445  58.693  1.00 65.83  ? 360  ASP A OD2   1 
ATOM   2781  N N     . TYR A 1 361 ? -13.849 38.383  61.580  1.00 55.20  ? 361  TYR A N     1 
ATOM   2782  C CA    . TYR A 1 361 ? -13.206 37.249  62.225  1.00 54.25  ? 361  TYR A CA    1 
ATOM   2783  C C     . TYR A 1 361 ? -12.290 36.443  61.321  1.00 51.22  ? 361  TYR A C     1 
ATOM   2784  O O     . TYR A 1 361 ? -11.417 35.731  61.796  1.00 52.19  ? 361  TYR A O     1 
ATOM   2785  C CB    . TYR A 1 361 ? -14.270 36.316  62.784  1.00 55.99  ? 361  TYR A CB    1 
ATOM   2786  C CG    . TYR A 1 361 ? -14.873 36.833  64.057  1.00 59.86  ? 361  TYR A CG    1 
ATOM   2787  C CD1   . TYR A 1 361 ? -14.087 36.986  65.202  1.00 62.76  ? 361  TYR A CD1   1 
ATOM   2788  C CD2   . TYR A 1 361 ? -16.227 37.167  64.129  1.00 62.96  ? 361  TYR A CD2   1 
ATOM   2789  C CE1   . TYR A 1 361 ? -14.625 37.479  66.389  1.00 57.99  ? 361  TYR A CE1   1 
ATOM   2790  C CE2   . TYR A 1 361 ? -16.777 37.645  65.309  1.00 61.52  ? 361  TYR A CE2   1 
ATOM   2791  C CZ    . TYR A 1 361 ? -15.967 37.799  66.436  1.00 59.85  ? 361  TYR A CZ    1 
ATOM   2792  O OH    . TYR A 1 361 ? -16.505 38.282  67.602  1.00 60.63  ? 361  TYR A OH    1 
ATOM   2793  N N     . GLU A 1 362 ? -12.509 36.549  60.027  1.00 47.51  ? 362  GLU A N     1 
ATOM   2794  C CA    . GLU A 1 362 ? -11.953 35.612  59.036  1.00 46.58  ? 362  GLU A CA    1 
ATOM   2795  C C     . GLU A 1 362 ? -10.519 35.168  59.348  1.00 41.30  ? 362  GLU A C     1 
ATOM   2796  O O     . GLU A 1 362 ? -10.216 33.969  59.470  1.00 38.75  ? 362  GLU A O     1 
ATOM   2797  C CB    . GLU A 1 362 ? -11.967 36.265  57.643  1.00 45.59  ? 362  GLU A CB    1 
ATOM   2798  C CG    . GLU A 1 362 ? -13.304 36.821  57.187  1.00 52.37  ? 362  GLU A CG    1 
ATOM   2799  C CD    . GLU A 1 362 ? -13.986 35.944  56.158  1.00 57.45  ? 362  GLU A CD    1 
ATOM   2800  O OE1   . GLU A 1 362 ? -13.676 34.730  56.101  1.00 67.85  ? 362  GLU A OE1   1 
ATOM   2801  O OE2   . GLU A 1 362 ? -14.831 36.467  55.397  1.00 65.17  ? 362  GLU A OE2   1 
ATOM   2802  N N     . ALA A 1 363 ? -9.637  36.153  59.457  1.00 39.02  ? 363  ALA A N     1 
ATOM   2803  C CA    . ALA A 1 363 ? -8.203  35.893  59.635  1.00 38.41  ? 363  ALA A CA    1 
ATOM   2804  C C     . ALA A 1 363 ? -7.905  35.399  61.042  1.00 34.03  ? 363  ALA A C     1 
ATOM   2805  O O     . ALA A 1 363 ? -7.132  34.472  61.214  1.00 32.55  ? 363  ALA A O     1 
ATOM   2806  C CB    . ALA A 1 363 ? -7.378  37.130  59.302  1.00 38.07  ? 363  ALA A CB    1 
ATOM   2807  N N     . LEU A 1 364 ? -8.538  35.986  62.042  1.00 33.66  ? 364  LEU A N     1 
ATOM   2808  C CA    . LEU A 1 364 ? -8.362  35.505  63.416  1.00 33.93  ? 364  LEU A CA    1 
ATOM   2809  C C     . LEU A 1 364 ? -8.839  34.058  63.614  1.00 31.07  ? 364  LEU A C     1 
ATOM   2810  O O     . LEU A 1 364 ? -8.150  33.250  64.221  1.00 27.08  ? 364  LEU A O     1 
ATOM   2811  C CB    . LEU A 1 364 ? -9.055  36.441  64.398  1.00 34.04  ? 364  LEU A CB    1 
ATOM   2812  C CG    . LEU A 1 364 ? -8.920  35.921  65.832  1.00 38.08  ? 364  LEU A CG    1 
ATOM   2813  C CD1   . LEU A 1 364 ? -7.530  36.091  66.379  1.00 34.22  ? 364  LEU A CD1   1 
ATOM   2814  C CD2   . LEU A 1 364 ? -9.926  36.590  66.664  1.00 39.82  ? 364  LEU A CD2   1 
ATOM   2815  N N     . ASP A 1 365 ? -10.023 33.742  63.101  1.00 31.08  ? 365  ASP A N     1 
ATOM   2816  C CA    . ASP A 1 365 ? -10.554 32.369  63.172  1.00 31.25  ? 365  ASP A CA    1 
ATOM   2817  C C     . ASP A 1 365 ? -9.621  31.368  62.546  1.00 30.43  ? 365  ASP A C     1 
ATOM   2818  O O     . ASP A 1 365 ? -9.339  30.341  63.127  1.00 32.23  ? 365  ASP A O     1 
ATOM   2819  C CB    . ASP A 1 365 ? -11.890 32.251  62.464  1.00 33.38  ? 365  ASP A CB    1 
ATOM   2820  C CG    . ASP A 1 365 ? -13.008 32.903  63.219  1.00 33.92  ? 365  ASP A CG    1 
ATOM   2821  O OD1   . ASP A 1 365 ? -12.799 33.371  64.357  1.00 38.84  ? 365  ASP A OD1   1 
ATOM   2822  O OD2   . ASP A 1 365 ? -14.101 32.959  62.649  1.00 37.14  ? 365  ASP A OD2   1 
ATOM   2823  N N     . GLU A 1 366 ? -9.115  31.695  61.373  1.00 28.58  ? 366  GLU A N     1 
ATOM   2824  C CA    . GLU A 1 366 ? -8.230  30.793  60.657  1.00 29.41  ? 366  GLU A CA    1 
ATOM   2825  C C     . GLU A 1 366 ? -6.889  30.603  61.367  1.00 29.09  ? 366  GLU A C     1 
ATOM   2826  O O     . GLU A 1 366 ? -6.374  29.485  61.433  1.00 28.90  ? 366  GLU A O     1 
ATOM   2827  C CB    . GLU A 1 366 ? -8.004  31.282  59.204  1.00 28.27  ? 366  GLU A CB    1 
ATOM   2828  C CG    . GLU A 1 366 ? -7.648  30.157  58.240  1.00 29.88  ? 366  GLU A CG    1 
ATOM   2829  C CD    . GLU A 1 366 ? -8.730  29.037  58.172  1.00 40.69  ? 366  GLU A CD    1 
ATOM   2830  O OE1   . GLU A 1 366 ? -9.958  29.322  58.342  1.00 33.88  ? 366  GLU A OE1   1 
ATOM   2831  O OE2   . GLU A 1 366 ? -8.341  27.859  57.949  1.00 40.72  ? 366  GLU A OE2   1 
ATOM   2832  N N     . ALA A 1 367 ? -6.310  31.705  61.845  1.00 28.36  ? 367  ALA A N     1 
ATOM   2833  C CA    . ALA A 1 367 ? -5.063  31.658  62.622  1.00 28.57  ? 367  ALA A CA    1 
ATOM   2834  C C     . ALA A 1 367 ? -5.224  30.838  63.903  1.00 26.68  ? 367  ALA A C     1 
ATOM   2835  O O     . ALA A 1 367 ? -4.383  30.019  64.216  1.00 25.87  ? 367  ALA A O     1 
ATOM   2836  C CB    . ALA A 1 367 ? -4.587  33.064  62.958  1.00 29.34  ? 367  ALA A CB    1 
ATOM   2837  N N     . MET A 1 368 ? -6.313  31.061  64.630  1.00 25.57  ? 368  MET A N     1 
ATOM   2838  C CA    . MET A 1 368 ? -6.616  30.274  65.802  1.00 26.28  ? 368  MET A CA    1 
ATOM   2839  C C     . MET A 1 368 ? -6.772  28.803  65.405  1.00 27.71  ? 368  MET A C     1 
ATOM   2840  O O     . MET A 1 368 ? -6.228  27.919  66.035  1.00 26.93  ? 368  MET A O     1 
ATOM   2841  C CB    . MET A 1 368 ? -7.889  30.790  66.480  1.00 25.18  ? 368  MET A CB    1 
ATOM   2842  C CG    . MET A 1 368 ? -7.703  32.081  67.311  1.00 25.65  ? 368  MET A CG    1 
ATOM   2843  S SD    . MET A 1 368 ? -6.708  31.802  68.792  1.00 25.63  ? 368  MET A SD    1 
ATOM   2844  C CE    . MET A 1 368 ? -7.768  30.653  69.707  1.00 22.61  ? 368  MET A CE    1 
ATOM   2845  N N     . SER A 1 369 ? -7.500  28.552  64.331  1.00 27.77  ? 369  SER A N     1 
ATOM   2846  C CA    . SER A 1 369 ? -7.785  27.181  63.912  1.00 28.48  ? 369  SER A CA    1 
ATOM   2847  C C     . SER A 1 369 ? -6.512  26.404  63.551  1.00 28.76  ? 369  SER A C     1 
ATOM   2848  O O     . SER A 1 369 ? -6.328  25.260  63.962  1.00 26.98  ? 369  SER A O     1 
ATOM   2849  C CB    . SER A 1 369 ? -8.777  27.209  62.763  1.00 27.20  ? 369  SER A CB    1 
ATOM   2850  O OG    . SER A 1 369 ? -9.170  25.901  62.447  1.00 35.96  ? 369  SER A OG    1 
ATOM   2851  N N     . ILE A 1 370 ? -5.613  27.052  62.819  1.00 28.81  ? 370  ILE A N     1 
ATOM   2852  C CA    . ILE A 1 370 ? -4.337  26.456  62.471  1.00 29.17  ? 370  ILE A CA    1 
ATOM   2853  C C     . ILE A 1 370 ? -3.476  26.246  63.713  1.00 28.50  ? 370  ILE A C     1 
ATOM   2854  O O     . ILE A 1 370 ? -2.856  25.196  63.863  1.00 29.19  ? 370  ILE A O     1 
ATOM   2855  C CB    . ILE A 1 370 ? -3.578  27.331  61.474  1.00 30.19  ? 370  ILE A CB    1 
ATOM   2856  C CG1   . ILE A 1 370 ? -4.353  27.442  60.149  1.00 32.16  ? 370  ILE A CG1   1 
ATOM   2857  C CG2   . ILE A 1 370 ? -2.188  26.772  61.219  1.00 30.58  ? 370  ILE A CG2   1 
ATOM   2858  C CD1   . ILE A 1 370 ? -3.977  28.676  59.333  1.00 30.57  ? 370  ILE A CD1   1 
ATOM   2859  N N     . SER A 1 371 ? -3.411  27.255  64.582  1.00 28.50  ? 371  SER A N     1 
ATOM   2860  C CA    . SER A 1 371 ? -2.591  27.161  65.803  1.00 29.01  ? 371  SER A CA    1 
ATOM   2861  C C     . SER A 1 371 ? -3.068  26.035  66.713  1.00 29.40  ? 371  SER A C     1 
ATOM   2862  O O     . SER A 1 371 ? -2.277  25.247  67.209  1.00 29.71  ? 371  SER A O     1 
ATOM   2863  C CB    . SER A 1 371 ? -2.603  28.467  66.583  1.00 29.27  ? 371  SER A CB    1 
ATOM   2864  O OG    . SER A 1 371 ? -1.486  28.500  67.467  1.00 33.62  ? 371  SER A OG    1 
ATOM   2865  N N     . VAL A 1 372 ? -4.376  25.971  66.929  1.00 29.64  ? 372  VAL A N     1 
ATOM   2866  C CA    . VAL A 1 372 ? -4.974  24.916  67.758  1.00 30.94  ? 372  VAL A CA    1 
ATOM   2867  C C     . VAL A 1 372 ? -4.699  23.514  67.142  1.00 32.29  ? 372  VAL A C     1 
ATOM   2868  O O     . VAL A 1 372 ? -4.335  22.573  67.849  1.00 31.79  ? 372  VAL A O     1 
ATOM   2869  C CB    . VAL A 1 372 ? -6.501  25.171  67.967  1.00 28.95  ? 372  VAL A CB    1 
ATOM   2870  C CG1   . VAL A 1 372 ? -7.167  23.974  68.588  1.00 31.06  ? 372  VAL A CG1   1 
ATOM   2871  C CG2   . VAL A 1 372 ? -6.722  26.397  68.836  1.00 27.92  ? 372  VAL A CG2   1 
ATOM   2872  N N     . GLU A 1 373 ? -4.821  23.419  65.823  1.00 34.39  ? 373  GLU A N     1 
ATOM   2873  C CA    . GLU A 1 373 ? -4.531  22.188  65.088  1.00 34.44  ? 373  GLU A CA    1 
ATOM   2874  C C     . GLU A 1 373 ? -3.111  21.660  65.301  1.00 33.88  ? 373  GLU A C     1 
ATOM   2875  O O     . GLU A 1 373 ? -2.911  20.459  65.343  1.00 34.04  ? 373  GLU A O     1 
ATOM   2876  C CB    . GLU A 1 373 ? -4.799  22.401  63.581  1.00 34.95  ? 373  GLU A CB    1 
ATOM   2877  C CG    . GLU A 1 373 ? -4.622  21.143  62.692  1.00 39.09  ? 373  GLU A CG    1 
ATOM   2878  C CD    . GLU A 1 373 ? -5.573  19.987  63.034  1.00 55.04  ? 373  GLU A CD    1 
ATOM   2879  O OE1   . GLU A 1 373 ? -6.520  20.180  63.843  1.00 66.09  ? 373  GLU A OE1   1 
ATOM   2880  O OE2   . GLU A 1 373 ? -5.374  18.874  62.482  1.00 62.48  ? 373  GLU A OE2   1 
ATOM   2881  N N     . MET A 1 374 ? -2.149  22.560  65.451  1.00 34.14  ? 374  MET A N     1 
ATOM   2882  C CA    . MET A 1 374 ? -0.743  22.192  65.603  1.00 34.32  ? 374  MET A CA    1 
ATOM   2883  C C     . MET A 1 374 ? -0.325  21.908  67.034  1.00 34.88  ? 374  MET A C     1 
ATOM   2884  O O     . MET A 1 374 ? 0.832   21.577  67.263  1.00 34.01  ? 374  MET A O     1 
ATOM   2885  C CB    . MET A 1 374 ? 0.144   23.296  65.029  1.00 34.31  ? 374  MET A CB    1 
ATOM   2886  C CG    . MET A 1 374 ? -0.097  23.539  63.557  1.00 37.40  ? 374  MET A CG    1 
ATOM   2887  S SD    . MET A 1 374 ? 0.272   22.067  62.577  1.00 43.35  ? 374  MET A SD    1 
ATOM   2888  C CE    . MET A 1 374 ? -1.015  22.118  61.318  1.00 45.51  ? 374  MET A CE    1 
ATOM   2889  N N     . LEU A 1 375 ? -1.249  22.039  67.988  1.00 35.39  ? 375  LEU A N     1 
ATOM   2890  C CA    . LEU A 1 375 ? -0.984  21.668  69.389  1.00 35.64  ? 375  LEU A CA    1 
ATOM   2891  C C     . LEU A 1 375 ? -0.651  20.196  69.486  1.00 35.43  ? 375  LEU A C     1 
ATOM   2892  O O     . LEU A 1 375 ? -1.316  19.371  68.882  1.00 35.81  ? 375  LEU A O     1 
ATOM   2893  C CB    . LEU A 1 375 ? -2.187  21.956  70.290  1.00 33.62  ? 375  LEU A CB    1 
ATOM   2894  C CG    . LEU A 1 375 ? -2.511  23.419  70.633  1.00 33.12  ? 375  LEU A CG    1 
ATOM   2895  C CD1   . LEU A 1 375 ? -3.861  23.522  71.323  1.00 32.96  ? 375  LEU A CD1   1 
ATOM   2896  C CD2   . LEU A 1 375 ? -1.441  24.088  71.496  1.00 33.20  ? 375  LEU A CD2   1 
ATOM   2897  N N     . ARG A 1 376 ? 0.398   19.858  70.225  1.00 37.06  ? 376  ARG A N     1 
ATOM   2898  C CA    . ARG A 1 376 ? 0.754   18.456  70.382  1.00 38.83  ? 376  ARG A CA    1 
ATOM   2899  C C     . ARG A 1 376 ? -0.430  17.765  71.024  1.00 39.29  ? 376  ARG A C     1 
ATOM   2900  O O     . ARG A 1 376 ? -1.149  18.361  71.823  1.00 38.60  ? 376  ARG A O     1 
ATOM   2901  C CB    . ARG A 1 376 ? 2.013   18.247  71.224  1.00 38.66  ? 376  ARG A CB    1 
ATOM   2902  C CG    . ARG A 1 376 ? 1.818   18.531  72.671  1.00 41.24  ? 376  ARG A CG    1 
ATOM   2903  C CD    . ARG A 1 376 ? 3.066   18.260  73.445  1.00 42.09  ? 376  ARG A CD    1 
ATOM   2904  N NE    . ARG A 1 376 ? 2.756   18.110  74.862  1.00 44.16  ? 376  ARG A NE    1 
ATOM   2905  C CZ    . ARG A 1 376 ? 3.326   18.803  75.833  1.00 52.25  ? 376  ARG A CZ    1 
ATOM   2906  N NH1   . ARG A 1 376 ? 4.279   19.689  75.554  1.00 61.85  ? 376  ARG A NH1   1 
ATOM   2907  N NH2   . ARG A 1 376 ? 2.958   18.599  77.095  1.00 48.30  ? 376  ARG A NH2   1 
ATOM   2908  N N     . GLU A 1 377 ? -0.609  16.498  70.679  1.00 39.91  ? 377  GLU A N     1 
ATOM   2909  C CA    . GLU A 1 377 ? -1.870  15.829  70.896  1.00 41.35  ? 377  GLU A CA    1 
ATOM   2910  C C     . GLU A 1 377 ? -2.280  15.678  72.352  1.00 40.11  ? 377  GLU A C     1 
ATOM   2911  O O     . GLU A 1 377 ? -3.471  15.643  72.643  1.00 38.56  ? 377  GLU A O     1 
ATOM   2912  C CB    . GLU A 1 377 ? -1.894  14.465  70.206  1.00 42.34  ? 377  GLU A CB    1 
ATOM   2913  C CG    . GLU A 1 377 ? -2.020  14.577  68.689  1.00 50.74  ? 377  GLU A CG    1 
ATOM   2914  C CD    . GLU A 1 377 ? -3.381  15.116  68.238  1.00 58.61  ? 377  GLU A CD    1 
ATOM   2915  O OE1   . GLU A 1 377 ? -4.426  14.607  68.708  1.00 57.40  ? 377  GLU A OE1   1 
ATOM   2916  O OE2   . GLU A 1 377 ? -3.394  16.047  67.403  1.00 60.45  ? 377  GLU A OE2   1 
ATOM   2917  N N     . ASP A 1 378 ? -1.317  15.604  73.265  1.00 40.48  ? 378  ASP A N     1 
ATOM   2918  C CA    . ASP A 1 378 ? -1.664  15.435  74.686  1.00 41.04  ? 378  ASP A CA    1 
ATOM   2919  C C     . ASP A 1 378 ? -2.036  16.738  75.415  1.00 40.74  ? 378  ASP A C     1 
ATOM   2920  O O     . ASP A 1 378 ? -2.349  16.690  76.608  1.00 40.49  ? 378  ASP A O     1 
ATOM   2921  C CB    . ASP A 1 378 ? -0.645  14.577  75.500  1.00 42.18  ? 378  ASP A CB    1 
ATOM   2922  C CG    . ASP A 1 378 ? 0.788   14.624  74.970  1.00 51.97  ? 378  ASP A CG    1 
ATOM   2923  O OD1   . ASP A 1 378 ? 1.181   15.560  74.234  1.00 61.48  ? 378  ASP A OD1   1 
ATOM   2924  O OD2   . ASP A 1 378 ? 1.546   13.688  75.310  1.00 60.52  ? 378  ASP A OD2   1 
ATOM   2925  N N     . ILE A 1 379 ? -2.057  17.885  74.715  1.00 38.73  ? 379  ILE A N     1 
ATOM   2926  C CA    . ILE A 1 379 ? -2.623  19.114  75.298  1.00 37.16  ? 379  ILE A CA    1 
ATOM   2927  C C     . ILE A 1 379 ? -3.820  19.737  74.552  1.00 34.94  ? 379  ILE A C     1 
ATOM   2928  O O     . ILE A 1 379 ? -4.402  20.690  75.051  1.00 34.15  ? 379  ILE A O     1 
ATOM   2929  C CB    . ILE A 1 379 ? -1.554  20.192  75.596  1.00 38.26  ? 379  ILE A CB    1 
ATOM   2930  C CG1   . ILE A 1 379 ? -0.958  20.750  74.303  1.00 35.42  ? 379  ILE A CG1   1 
ATOM   2931  C CG2   . ILE A 1 379 ? -0.477  19.632  76.595  1.00 37.30  ? 379  ILE A CG2   1 
ATOM   2932  C CD1   . ILE A 1 379 ? 0.114   21.744  74.551  1.00 35.42  ? 379  ILE A CD1   1 
ATOM   2933  N N     . LYS A 1 380 ? -4.183  19.194  73.387  1.00 34.08  ? 380  LYS A N     1 
ATOM   2934  C CA    . LYS A 1 380 ? -5.329  19.673  72.605  1.00 35.01  ? 380  LYS A CA    1 
ATOM   2935  C C     . LYS A 1 380 ? -6.636  19.683  73.394  1.00 33.92  ? 380  LYS A C     1 
ATOM   2936  O O     . LYS A 1 380 ? -7.425  20.622  73.299  1.00 34.55  ? 380  LYS A O     1 
ATOM   2937  C CB    . LYS A 1 380 ? -5.539  18.820  71.333  1.00 35.71  ? 380  LYS A CB    1 
ATOM   2938  C CG    . LYS A 1 380 ? -4.727  19.264  70.101  1.00 39.82  ? 380  LYS A CG    1 
ATOM   2939  C CD    . LYS A 1 380 ? -5.187  18.562  68.792  1.00 39.00  ? 380  LYS A CD    1 
ATOM   2940  C CE    . LYS A 1 380 ? -4.308  18.994  67.598  1.00 40.49  ? 380  LYS A CE    1 
ATOM   2941  N NZ    . LYS A 1 380 ? -4.973  18.807  66.265  1.00 42.46  ? 380  LYS A NZ    1 
ATOM   2942  N N     . ASP A 1 381 ? -6.876  18.630  74.163  1.00 32.92  ? 381  ASP A N     1 
ATOM   2943  C CA    . ASP A 1 381 ? -8.081  18.568  74.985  1.00 33.13  ? 381  ASP A CA    1 
ATOM   2944  C C     . ASP A 1 381 ? -8.051  19.553  76.142  1.00 31.40  ? 381  ASP A C     1 
ATOM   2945  O O     . ASP A 1 381 ? -9.082  20.169  76.477  1.00 28.25  ? 381  ASP A O     1 
ATOM   2946  C CB    . ASP A 1 381 ? -8.353  17.143  75.471  1.00 35.66  ? 381  ASP A CB    1 
ATOM   2947  C CG    . ASP A 1 381 ? -8.936  16.252  74.373  1.00 40.79  ? 381  ASP A CG    1 
ATOM   2948  O OD1   . ASP A 1 381 ? -9.342  16.765  73.295  1.00 46.12  ? 381  ASP A OD1   1 
ATOM   2949  O OD2   . ASP A 1 381 ? -8.987  15.032  74.594  1.00 50.27  ? 381  ASP A OD2   1 
ATOM   2950  N N     . TYR A 1 382 ? -6.894  19.740  76.754  1.00 30.19  ? 382  TYR A N     1 
ATOM   2951  C CA    . TYR A 1 382 ? -6.800  20.790  77.748  1.00 29.59  ? 382  TYR A CA    1 
ATOM   2952  C C     . TYR A 1 382 ? -7.196  22.155  77.170  1.00 28.79  ? 382  TYR A C     1 
ATOM   2953  O O     . TYR A 1 382 ? -7.923  22.905  77.803  1.00 29.56  ? 382  TYR A O     1 
ATOM   2954  C CB    . TYR A 1 382 ? -5.427  20.851  78.352  1.00 31.94  ? 382  TYR A CB    1 
ATOM   2955  C CG    . TYR A 1 382 ? -5.066  19.642  79.182  1.00 32.69  ? 382  TYR A CG    1 
ATOM   2956  C CD1   . TYR A 1 382 ? -5.919  19.164  80.173  1.00 38.33  ? 382  TYR A CD1   1 
ATOM   2957  C CD2   . TYR A 1 382 ? -3.860  18.989  78.986  1.00 38.13  ? 382  TYR A CD2   1 
ATOM   2958  C CE1   . TYR A 1 382 ? -5.579  18.063  80.939  1.00 39.17  ? 382  TYR A CE1   1 
ATOM   2959  C CE2   . TYR A 1 382 ? -3.510  17.888  79.736  1.00 37.80  ? 382  TYR A CE2   1 
ATOM   2960  C CZ    . TYR A 1 382 ? -4.369  17.429  80.708  1.00 38.05  ? 382  TYR A CZ    1 
ATOM   2961  O OH    . TYR A 1 382 ? -4.006  16.341  81.450  1.00 43.08  ? 382  TYR A OH    1 
ATOM   2962  N N     . TYR A 1 383 ? -6.737  22.490  75.976  1.00 28.78  ? 383  TYR A N     1 
ATOM   2963  C CA    . TYR A 1 383 ? -7.104  23.795  75.387  1.00 28.69  ? 383  TYR A CA    1 
ATOM   2964  C C     . TYR A 1 383 ? -8.606  23.920  75.097  1.00 27.41  ? 383  TYR A C     1 
ATOM   2965  O O     . TYR A 1 383 ? -9.219  24.997  75.304  1.00 26.47  ? 383  TYR A O     1 
ATOM   2966  C CB    . TYR A 1 383 ? -6.355  24.118  74.085  1.00 27.94  ? 383  TYR A CB    1 
ATOM   2967  C CG    . TYR A 1 383 ? -6.456  25.593  73.769  1.00 27.86  ? 383  TYR A CG    1 
ATOM   2968  C CD1   . TYR A 1 383 ? -5.877  26.547  74.620  1.00 26.31  ? 383  TYR A CD1   1 
ATOM   2969  C CD2   . TYR A 1 383 ? -7.112  26.046  72.635  1.00 25.39  ? 383  TYR A CD2   1 
ATOM   2970  C CE1   . TYR A 1 383 ? -5.960  27.926  74.353  1.00 25.76  ? 383  TYR A CE1   1 
ATOM   2971  C CE2   . TYR A 1 383 ? -7.196  27.428  72.350  1.00 27.76  ? 383  TYR A CE2   1 
ATOM   2972  C CZ    . TYR A 1 383 ? -6.623  28.355  73.212  1.00 27.66  ? 383  TYR A CZ    1 
ATOM   2973  O OH    . TYR A 1 383 ? -6.734  29.698  72.939  1.00 19.67  ? 383  TYR A OH    1 
ATOM   2974  N N     . THR A 1 384 ? -9.187  22.829  74.628  1.00 26.39  ? 384  THR A N     1 
ATOM   2975  C CA    . THR A 1 384 ? -10.618 22.782  74.413  1.00 26.87  ? 384  THR A CA    1 
ATOM   2976  C C     . THR A 1 384 ? -11.357 23.103  75.711  1.00 27.06  ? 384  THR A C     1 
ATOM   2977  O O     . THR A 1 384 ? -12.336 23.870  75.710  1.00 25.15  ? 384  THR A O     1 
ATOM   2978  C CB    . THR A 1 384 ? -11.048 21.423  73.821  1.00 27.10  ? 384  THR A CB    1 
ATOM   2979  O OG1   . THR A 1 384 ? -10.428 21.270  72.535  1.00 26.25  ? 384  THR A OG1   1 
ATOM   2980  C CG2   . THR A 1 384 ? -12.589 21.322  73.685  1.00 25.98  ? 384  THR A CG2   1 
ATOM   2981  N N     . ASP A 1 385 ? -10.888 22.547  76.820  1.00 26.48  ? 385  ASP A N     1 
ATOM   2982  C CA    . ASP A 1 385 ? -11.510 22.817  78.115  1.00 28.06  ? 385  ASP A CA    1 
ATOM   2983  C C     . ASP A 1 385 ? -11.633 24.324  78.391  1.00 27.82  ? 385  ASP A C     1 
ATOM   2984  O O     . ASP A 1 385 ? -12.593 24.779  78.980  1.00 26.39  ? 385  ASP A O     1 
ATOM   2985  C CB    . ASP A 1 385 ? -10.708 22.150  79.244  1.00 28.83  ? 385  ASP A CB    1 
ATOM   2986  C CG    . ASP A 1 385 ? -11.042 20.685  79.423  1.00 30.84  ? 385  ASP A CG    1 
ATOM   2987  O OD1   . ASP A 1 385 ? -11.999 20.200  78.792  1.00 36.20  ? 385  ASP A OD1   1 
ATOM   2988  O OD2   . ASP A 1 385 ? -10.353 20.011  80.212  1.00 34.60  ? 385  ASP A OD2   1 
ATOM   2989  N N     . LEU A 1 386 ? -10.650 25.101  77.953  1.00 29.37  ? 386  LEU A N     1 
ATOM   2990  C CA    . LEU A 1 386 ? -10.644 26.528  78.220  1.00 29.45  ? 386  LEU A CA    1 
ATOM   2991  C C     . LEU A 1 386 ? -11.747 27.279  77.490  1.00 29.58  ? 386  LEU A C     1 
ATOM   2992  O O     . LEU A 1 386 ? -11.934 28.461  77.714  1.00 30.42  ? 386  LEU A O     1 
ATOM   2993  C CB    . LEU A 1 386 ? -9.290  27.132  77.882  1.00 30.03  ? 386  LEU A CB    1 
ATOM   2994  C CG    . LEU A 1 386 ? -8.172  26.479  78.686  1.00 29.48  ? 386  LEU A CG    1 
ATOM   2995  C CD1   . LEU A 1 386 ? -6.869  27.108  78.290  1.00 34.12  ? 386  LEU A CD1   1 
ATOM   2996  C CD2   . LEU A 1 386 ? -8.393  26.602  80.186  1.00 30.43  ? 386  LEU A CD2   1 
ATOM   2997  N N     . SER A 1 387 ? -12.503 26.586  76.645  1.00 29.89  ? 387  SER A N     1 
ATOM   2998  C CA    . SER A 1 387 ? -13.721 27.155  76.058  1.00 30.24  ? 387  SER A CA    1 
ATOM   2999  C C     . SER A 1 387 ? -14.756 27.620  77.086  1.00 31.88  ? 387  SER A C     1 
ATOM   3000  O O     . SER A 1 387 ? -15.642 28.407  76.741  1.00 31.71  ? 387  SER A O     1 
ATOM   3001  C CB    . SER A 1 387 ? -14.387 26.157  75.114  1.00 29.21  ? 387  SER A CB    1 
ATOM   3002  O OG    . SER A 1 387 ? -13.505 25.786  74.080  1.00 30.22  ? 387  SER A OG    1 
ATOM   3003  N N     . ILE A 1 388 ? -14.674 27.123  78.329  1.00 34.16  ? 388  ILE A N     1 
ATOM   3004  C CA    . ILE A 1 388 ? -15.594 27.549  79.402  1.00 34.64  ? 388  ILE A CA    1 
ATOM   3005  C C     . ILE A 1 388 ? -15.141 28.796  80.137  1.00 34.99  ? 388  ILE A C     1 
ATOM   3006  O O     . ILE A 1 388 ? -15.892 29.287  80.999  1.00 34.84  ? 388  ILE A O     1 
ATOM   3007  C CB    . ILE A 1 388 ? -15.889 26.429  80.456  1.00 33.88  ? 388  ILE A CB    1 
ATOM   3008  C CG1   . ILE A 1 388 ? -14.657 26.080  81.292  1.00 37.96  ? 388  ILE A CG1   1 
ATOM   3009  C CG2   . ILE A 1 388 ? -16.444 25.205  79.767  1.00 38.02  ? 388  ILE A CG2   1 
ATOM   3010  C CD1   . ILE A 1 388 ? -14.982 25.302  82.577  1.00 37.37  ? 388  ILE A CD1   1 
ATOM   3011  N N     . LEU A 1 389 ? -13.931 29.298  79.815  1.00 35.21  ? 389  LEU A N     1 
ATOM   3012  C CA    . LEU A 1 389 ? -13.474 30.587  80.330  1.00 35.09  ? 389  LEU A CA    1 
ATOM   3013  C C     . LEU A 1 389 ? -14.297 31.707  79.696  1.00 34.53  ? 389  LEU A C     1 
ATOM   3014  O O     . LEU A 1 389 ? -14.599 31.682  78.509  1.00 35.89  ? 389  LEU A O     1 
ATOM   3015  C CB    . LEU A 1 389 ? -12.006 30.878  80.037  1.00 35.37  ? 389  LEU A CB    1 
ATOM   3016  C CG    . LEU A 1 389 ? -10.881 30.092  80.680  1.00 41.94  ? 389  LEU A CG    1 
ATOM   3017  C CD1   . LEU A 1 389 ? -9.552  30.844  80.517  1.00 39.75  ? 389  LEU A CD1   1 
ATOM   3018  C CD2   . LEU A 1 389 ? -11.191 29.814  82.133  1.00 49.34  ? 389  LEU A CD2   1 
ATOM   3019  N N     . GLN A 1 390 ? -14.652 32.683  80.513  1.00 35.23  ? 390  GLN A N     1 
ATOM   3020  C CA    . GLN A 1 390 ? -15.553 33.740  80.114  1.00 34.50  ? 390  GLN A CA    1 
ATOM   3021  C C     . GLN A 1 390 ? -14.739 34.942  79.740  1.00 32.63  ? 390  GLN A C     1 
ATOM   3022  O O     . GLN A 1 390 ? -13.572 35.069  80.130  1.00 31.44  ? 390  GLN A O     1 
ATOM   3023  C CB    . GLN A 1 390 ? -16.470 34.150  81.255  1.00 34.89  ? 390  GLN A CB    1 
ATOM   3024  C CG    . GLN A 1 390 ? -17.332 33.071  81.813  1.00 36.69  ? 390  GLN A CG    1 
ATOM   3025  C CD    . GLN A 1 390 ? -17.827 33.467  83.180  1.00 34.79  ? 390  GLN A CD    1 
ATOM   3026  O OE1   . GLN A 1 390 ? -18.756 34.250  83.304  1.00 31.58  ? 390  GLN A OE1   1 
ATOM   3027  N NE2   . GLN A 1 390 ? -17.171 32.958  84.221  1.00 38.40  ? 390  GLN A NE2   1 
ATOM   3028  N N     . LYS A 1 391 ? -15.369 35.845  79.005  1.00 30.82  ? 391  LYS A N     1 
ATOM   3029  C CA    . LYS A 1 391 ? -14.704 37.093  78.660  1.00 31.80  ? 391  LYS A CA    1 
ATOM   3030  C C     . LYS A 1 391 ? -14.527 37.894  79.938  1.00 31.27  ? 391  LYS A C     1 
ATOM   3031  O O     . LYS A 1 391 ? -15.363 37.831  80.832  1.00 29.93  ? 391  LYS A O     1 
ATOM   3032  C CB    . LYS A 1 391 ? -15.499 37.883  77.652  1.00 32.28  ? 391  LYS A CB    1 
ATOM   3033  C CG    . LYS A 1 391 ? -15.747 37.148  76.350  1.00 32.83  ? 391  LYS A CG    1 
ATOM   3034  C CD    . LYS A 1 391 ? -16.458 38.053  75.375  1.00 32.40  ? 391  LYS A CD    1 
ATOM   3035  C CE    . LYS A 1 391 ? -16.927 37.301  74.150  1.00 35.45  ? 391  LYS A CE    1 
ATOM   3036  N NZ    . LYS A 1 391 ? -17.421 38.245  73.130  1.00 34.45  ? 391  LYS A NZ    1 
ATOM   3037  N N     . ASP A 1 392 ? -13.405 38.595  80.038  1.00 31.85  ? 392  ASP A N     1 
ATOM   3038  C CA    . ASP A 1 392 ? -13.141 39.501  81.140  1.00 32.97  ? 392  ASP A CA    1 
ATOM   3039  C C     . ASP A 1 392 ? -13.113 38.845  82.524  1.00 34.18  ? 392  ASP A C     1 
ATOM   3040  O O     . ASP A 1 392 ? -13.385 39.512  83.526  1.00 34.12  ? 392  ASP A O     1 
ATOM   3041  C CB    . ASP A 1 392 ? -14.148 40.678  81.102  1.00 33.54  ? 392  ASP A CB    1 
ATOM   3042  C CG    . ASP A 1 392 ? -14.187 41.349  79.747  1.00 36.98  ? 392  ASP A CG    1 
ATOM   3043  O OD1   . ASP A 1 392 ? -13.226 42.069  79.435  1.00 35.02  ? 392  ASP A OD1   1 
ATOM   3044  O OD2   . ASP A 1 392 ? -15.168 41.157  78.994  1.00 41.85  ? 392  ASP A OD2   1 
ATOM   3045  N N     . VAL A 1 393 ? -12.762 37.561  82.574  1.00 32.30  ? 393  VAL A N     1 
ATOM   3046  C CA    . VAL A 1 393 ? -12.547 36.859  83.835  1.00 32.49  ? 393  VAL A CA    1 
ATOM   3047  C C     . VAL A 1 393 ? -11.132 36.281  83.811  1.00 33.01  ? 393  VAL A C     1 
ATOM   3048  O O     . VAL A 1 393 ? -10.803 35.484  82.915  1.00 33.67  ? 393  VAL A O     1 
ATOM   3049  C CB    . VAL A 1 393 ? -13.615 35.713  84.053  1.00 33.72  ? 393  VAL A CB    1 
ATOM   3050  C CG1   . VAL A 1 393 ? -13.331 34.912  85.326  1.00 36.81  ? 393  VAL A CG1   1 
ATOM   3051  C CG2   . VAL A 1 393 ? -15.033 36.285  84.100  1.00 32.31  ? 393  VAL A CG2   1 
ATOM   3052  N N     . LYS A 1 394 ? -10.306 36.681  84.781  1.00 34.26  ? 394  LYS A N     1 
ATOM   3053  C CA    . LYS A 1 394 ? -8.944  36.139  84.948  1.00 34.29  ? 394  LYS A CA    1 
ATOM   3054  C C     . LYS A 1 394 ? -8.998  35.072  86.032  1.00 34.48  ? 394  LYS A C     1 
ATOM   3055  O O     . LYS A 1 394 ? -9.301  35.363  87.179  1.00 36.29  ? 394  LYS A O     1 
ATOM   3056  C CB    . LYS A 1 394 ? -7.916  37.215  85.294  1.00 33.71  ? 394  LYS A CB    1 
ATOM   3057  C CG    . LYS A 1 394 ? -7.956  38.405  84.331  1.00 38.68  ? 394  LYS A CG    1 
ATOM   3058  C CD    . LYS A 1 394 ? -6.824  39.448  84.483  1.00 35.17  ? 394  LYS A CD    1 
ATOM   3059  C CE    . LYS A 1 394 ? -6.995  40.487  83.315  1.00 34.88  ? 394  LYS A CE    1 
ATOM   3060  N NZ    . LYS A 1 394 ? -5.849  41.449  83.061  1.00 41.14  ? 394  LYS A NZ    1 
ATOM   3061  N N     . VAL A 1 395 ? -8.705  33.838  85.644  1.00 34.49  ? 395  VAL A N     1 
ATOM   3062  C CA    . VAL A 1 395 ? -8.923  32.656  86.464  1.00 35.53  ? 395  VAL A CA    1 
ATOM   3063  C C     . VAL A 1 395 ? -7.639  32.199  87.152  1.00 35.56  ? 395  VAL A C     1 
ATOM   3064  O O     . VAL A 1 395 ? -6.610  32.021  86.480  1.00 32.91  ? 395  VAL A O     1 
ATOM   3065  C CB    . VAL A 1 395 ? -9.399  31.498  85.558  1.00 36.75  ? 395  VAL A CB    1 
ATOM   3066  C CG1   . VAL A 1 395 ? -9.638  30.208  86.339  1.00 39.11  ? 395  VAL A CG1   1 
ATOM   3067  C CG2   . VAL A 1 395 ? -10.670 31.920  84.836  1.00 44.34  ? 395  VAL A CG2   1 
ATOM   3068  N N     . PRO A 1 396 ? -7.710  31.941  88.472  1.00 35.84  ? 396  PRO A N     1 
ATOM   3069  C CA    . PRO A 1 396 ? -6.523  31.521  89.192  1.00 34.23  ? 396  PRO A CA    1 
ATOM   3070  C C     . PRO A 1 396 ? -6.203  30.084  88.858  1.00 33.22  ? 396  PRO A C     1 
ATOM   3071  O O     . PRO A 1 396 ? -7.112  29.300  88.550  1.00 31.39  ? 396  PRO A O     1 
ATOM   3072  C CB    . PRO A 1 396 ? -6.920  31.638  90.676  1.00 32.87  ? 396  PRO A CB    1 
ATOM   3073  C CG    . PRO A 1 396 ? -8.386  31.669  90.734  1.00 34.81  ? 396  PRO A CG    1 
ATOM   3074  C CD    . PRO A 1 396 ? -8.909  31.973  89.335  1.00 37.00  ? 396  PRO A CD    1 
ATOM   3075  N N     . THR A 1 397 ? -4.920  29.749  88.952  1.00 31.73  ? 397  THR A N     1 
ATOM   3076  C CA    . THR A 1 397 ? -4.419  28.404  88.657  1.00 32.68  ? 397  THR A CA    1 
ATOM   3077  C C     . THR A 1 397 ? -5.216  27.270  89.296  1.00 31.29  ? 397  THR A C     1 
ATOM   3078  O O     . THR A 1 397 ? -5.442  26.215  88.665  1.00 28.67  ? 397  THR A O     1 
ATOM   3079  C CB    . THR A 1 397 ? -2.993  28.225  89.180  1.00 32.41  ? 397  THR A CB    1 
ATOM   3080  O OG1   . THR A 1 397 ? -2.133  29.184  88.557  1.00 33.23  ? 397  THR A OG1   1 
ATOM   3081  C CG2   . THR A 1 397 ? -2.491  26.793  88.926  1.00 34.10  ? 397  THR A CG2   1 
ATOM   3082  N N     . LYS A 1 398 ? -5.588  27.477  90.562  1.00 31.61  ? 398  LYS A N     1 
ATOM   3083  C CA    . LYS A 1 398 ? -6.273  26.456  91.374  1.00 31.47  ? 398  LYS A CA    1 
ATOM   3084  C C     . LYS A 1 398 ? -7.552  25.967  90.727  1.00 30.67  ? 398  LYS A C     1 
ATOM   3085  O O     . LYS A 1 398 ? -7.884  24.784  90.823  1.00 29.69  ? 398  LYS A O     1 
ATOM   3086  C CB    . LYS A 1 398 ? -6.579  27.003  92.771  1.00 33.35  ? 398  LYS A CB    1 
ATOM   3087  C CG    . LYS A 1 398 ? -7.275  26.041  93.726  1.00 35.84  ? 398  LYS A CG    1 
ATOM   3088  C CD    . LYS A 1 398 ? -6.521  24.740  93.905  1.00 43.11  ? 398  LYS A CD    1 
ATOM   3089  C CE    . LYS A 1 398 ? -6.919  24.029  95.206  1.00 45.45  ? 398  LYS A CE    1 
ATOM   3090  N NZ    . LYS A 1 398 ? -6.579  22.563  95.157  1.00 49.82  ? 398  LYS A NZ    1 
ATOM   3091  N N     . VAL A 1 399 ? -8.261  26.861  90.034  1.00 31.94  ? 399  VAL A N     1 
ATOM   3092  C CA    . VAL A 1 399 ? -9.489  26.491  89.313  1.00 32.16  ? 399  VAL A CA    1 
ATOM   3093  C C     . VAL A 1 399 ? -9.193  25.445  88.229  1.00 32.23  ? 399  VAL A C     1 
ATOM   3094  O O     . VAL A 1 399 ? -9.960  24.490  88.046  1.00 34.79  ? 399  VAL A O     1 
ATOM   3095  C CB    . VAL A 1 399 ? -10.249 27.733  88.748  1.00 32.92  ? 399  VAL A CB    1 
ATOM   3096  C CG1   . VAL A 1 399 ? -11.384 27.329  87.760  1.00 31.88  ? 399  VAL A CG1   1 
ATOM   3097  C CG2   . VAL A 1 399 ? -10.834 28.568  89.882  1.00 32.25  ? 399  VAL A CG2   1 
ATOM   3098  N N     . LEU A 1 400 ? -8.053  25.580  87.561  1.00 32.47  ? 400  LEU A N     1 
ATOM   3099  C CA    . LEU A 1 400 ? -7.660  24.632  86.506  1.00 33.14  ? 400  LEU A CA    1 
ATOM   3100  C C     . LEU A 1 400 ? -7.034  23.348  87.058  1.00 31.96  ? 400  LEU A C     1 
ATOM   3101  O O     . LEU A 1 400 ? -7.175  22.292  86.481  1.00 32.00  ? 400  LEU A O     1 
ATOM   3102  C CB    . LEU A 1 400 ? -6.735  25.323  85.510  1.00 33.94  ? 400  LEU A CB    1 
ATOM   3103  C CG    . LEU A 1 400 ? -7.403  26.551  84.904  1.00 37.86  ? 400  LEU A CG    1 
ATOM   3104  C CD1   . LEU A 1 400 ? -6.400  27.533  84.391  1.00 43.23  ? 400  LEU A CD1   1 
ATOM   3105  C CD2   . LEU A 1 400 ? -8.394  26.127  83.816  1.00 39.57  ? 400  LEU A CD2   1 
ATOM   3106  N N     . CYS A 1 401 ? -6.345  23.439  88.178  1.00 33.17  ? 401  CYS A N     1 
ATOM   3107  C CA    . CYS A 1 401 ? -5.968  22.252  88.931  1.00 33.92  ? 401  CYS A CA    1 
ATOM   3108  C C     . CYS A 1 401 ? -7.156  21.358  89.215  1.00 34.60  ? 401  CYS A C     1 
ATOM   3109  O O     . CYS A 1 401 ? -7.066  20.135  89.106  1.00 36.19  ? 401  CYS A O     1 
ATOM   3110  C CB    . CYS A 1 401 ? -5.389  22.639  90.282  1.00 32.66  ? 401  CYS A CB    1 
ATOM   3111  S SG    . CYS A 1 401 ? -3.733  23.287  90.162  1.00 35.24  ? 401  CYS A SG    1 
ATOM   3112  N N     . ILE A 1 402 ? -8.253  21.985  89.629  1.00 34.77  ? 402  ILE A N     1 
ATOM   3113  C CA    . ILE A 1 402 ? -9.484  21.270  89.965  1.00 34.96  ? 402  ILE A CA    1 
ATOM   3114  C C     . ILE A 1 402 ? -10.084 20.637  88.711  1.00 34.40  ? 402  ILE A C     1 
ATOM   3115  O O     . ILE A 1 402 ? -10.374 19.429  88.692  1.00 33.32  ? 402  ILE A O     1 
ATOM   3116  C CB    . ILE A 1 402 ? -10.493 22.204  90.701  1.00 35.75  ? 402  ILE A CB    1 
ATOM   3117  C CG1   . ILE A 1 402 ? -10.121 22.287  92.187  1.00 36.28  ? 402  ILE A CG1   1 
ATOM   3118  C CG2   . ILE A 1 402 ? -11.922 21.716  90.561  1.00 36.55  ? 402  ILE A CG2   1 
ATOM   3119  C CD1   . ILE A 1 402 ? -10.781 23.383  92.956  1.00 36.51  ? 402  ILE A CD1   1 
ATOM   3120  N N     . LEU A 1 403 ? -10.239 21.454  87.662  1.00 35.84  ? 403  LEU A N     1 
ATOM   3121  C CA    . LEU A 1 403 ? -10.772 21.005  86.364  1.00 34.54  ? 403  LEU A CA    1 
ATOM   3122  C C     . LEU A 1 403 ? -10.000 19.787  85.865  1.00 34.29  ? 403  LEU A C     1 
ATOM   3123  O O     . LEU A 1 403 ? -10.586 18.828  85.359  1.00 33.95  ? 403  LEU A O     1 
ATOM   3124  C CB    . LEU A 1 403 ? -10.672 22.122  85.303  1.00 34.87  ? 403  LEU A CB    1 
ATOM   3125  C CG    . LEU A 1 403 ? -11.810 22.422  84.315  1.00 36.62  ? 403  LEU A CG    1 
ATOM   3126  C CD1   . LEU A 1 403 ? -11.265 23.090  83.037  1.00 32.63  ? 403  LEU A CD1   1 
ATOM   3127  C CD2   . LEU A 1 403 ? -12.643 21.237  83.948  1.00 33.35  ? 403  LEU A CD2   1 
ATOM   3128  N N     . TRP A 1 404 ? -8.676  19.848  85.970  1.00 34.23  ? 404  TRP A N     1 
ATOM   3129  C CA    . TRP A 1 404 ? -7.825  18.829  85.369  1.00 34.30  ? 404  TRP A CA    1 
ATOM   3130  C C     . TRP A 1 404 ? -7.290  17.800  86.362  1.00 35.41  ? 404  TRP A C     1 
ATOM   3131  O O     . TRP A 1 404 ? -6.572  16.883  85.967  1.00 35.28  ? 404  TRP A O     1 
ATOM   3132  C CB    . TRP A 1 404 ? -6.687  19.509  84.616  1.00 34.08  ? 404  TRP A CB    1 
ATOM   3133  C CG    . TRP A 1 404 ? -7.180  20.349  83.448  1.00 34.21  ? 404  TRP A CG    1 
ATOM   3134  C CD1   . TRP A 1 404 ? -8.308  20.137  82.699  1.00 32.40  ? 404  TRP A CD1   1 
ATOM   3135  C CD2   . TRP A 1 404 ? -6.533  21.495  82.876  1.00 28.26  ? 404  TRP A CD2   1 
ATOM   3136  N NE1   . TRP A 1 404 ? -8.404  21.088  81.701  1.00 33.98  ? 404  TRP A NE1   1 
ATOM   3137  C CE2   . TRP A 1 404 ? -7.331  21.932  81.789  1.00 34.25  ? 404  TRP A CE2   1 
ATOM   3138  C CE3   . TRP A 1 404 ? -5.348  22.172  83.153  1.00 32.97  ? 404  TRP A CE3   1 
ATOM   3139  C CZ2   . TRP A 1 404 ? -6.992  23.035  81.001  1.00 33.23  ? 404  TRP A CZ2   1 
ATOM   3140  C CZ3   . TRP A 1 404 ? -5.005  23.262  82.367  1.00 34.04  ? 404  TRP A CZ3   1 
ATOM   3141  C CH2   . TRP A 1 404 ? -5.828  23.687  81.305  1.00 33.59  ? 404  TRP A CH2   1 
ATOM   3142  N N     . ASP A 1 405 ? -7.649  17.928  87.638  1.00 37.48  ? 405  ASP A N     1 
ATOM   3143  C CA    . ASP A 1 405 ? -7.142  17.019  88.679  1.00 38.75  ? 405  ASP A CA    1 
ATOM   3144  C C     . ASP A 1 405 ? -5.627  16.946  88.691  1.00 39.45  ? 405  ASP A C     1 
ATOM   3145  O O     . ASP A 1 405 ? -5.051  15.848  88.802  1.00 39.74  ? 405  ASP A O     1 
ATOM   3146  C CB    . ASP A 1 405 ? -7.582  15.561  88.434  1.00 41.43  ? 405  ASP A CB    1 
ATOM   3147  C CG    . ASP A 1 405 ? -9.024  15.336  88.676  1.00 47.13  ? 405  ASP A CG    1 
ATOM   3148  O OD1   . ASP A 1 405 ? -9.474  15.705  89.794  1.00 51.58  ? 405  ASP A OD1   1 
ATOM   3149  O OD2   . ASP A 1 405 ? -9.690  14.775  87.757  1.00 53.36  ? 405  ASP A OD2   1 
ATOM   3150  N N     . MET A 1 406 ? -4.963  18.084  88.543  1.00 39.64  ? 406  MET A N     1 
ATOM   3151  C CA    . MET A 1 406 ? -3.516  18.087  88.432  1.00 39.80  ? 406  MET A CA    1 
ATOM   3152  C C     . MET A 1 406 ? -2.933  19.003  89.444  1.00 38.02  ? 406  MET A C     1 
ATOM   3153  O O     . MET A 1 406 ? -3.605  19.897  89.928  1.00 38.14  ? 406  MET A O     1 
ATOM   3154  C CB    . MET A 1 406 ? -3.094  18.587  87.078  1.00 40.53  ? 406  MET A CB    1 
ATOM   3155  C CG    . MET A 1 406 ? -3.377  17.652  85.940  1.00 43.96  ? 406  MET A CG    1 
ATOM   3156  S SD    . MET A 1 406 ? -2.630  18.241  84.411  1.00 44.28  ? 406  MET A SD    1 
ATOM   3157  C CE    . MET A 1 406 ? -2.596  19.977  84.626  1.00 42.97  ? 406  MET A CE    1 
ATOM   3158  N N     . GLU A 1 407 ? -1.663  18.784  89.736  1.00 39.77  ? 407  GLU A N     1 
ATOM   3159  C CA    . GLU A 1 407 ? -0.901  19.655  90.600  1.00 40.50  ? 407  GLU A CA    1 
ATOM   3160  C C     . GLU A 1 407 ? -0.459  20.904  89.881  1.00 37.77  ? 407  GLU A C     1 
ATOM   3161  O O     . GLU A 1 407 ? -0.232  20.885  88.677  1.00 36.57  ? 407  GLU A O     1 
ATOM   3162  C CB    . GLU A 1 407 ? 0.304   18.909  91.116  1.00 42.57  ? 407  GLU A CB    1 
ATOM   3163  C CG    . GLU A 1 407 ? -0.117  17.739  91.974  1.00 49.23  ? 407  GLU A CG    1 
ATOM   3164  C CD    . GLU A 1 407 ? 1.040   17.076  92.633  1.00 53.07  ? 407  GLU A CD    1 
ATOM   3165  O OE1   . GLU A 1 407 ? 2.198   17.402  92.257  1.00 65.80  ? 407  GLU A OE1   1 
ATOM   3166  O OE2   . GLU A 1 407 ? 0.788   16.242  93.536  1.00 68.34  ? 407  GLU A OE2   1 
ATOM   3167  N N     . THR A 1 408 ? -0.327  21.971  90.666  1.00 36.92  ? 408  THR A N     1 
ATOM   3168  C CA    . THR A 1 408 ? 0.030   23.312  90.239  1.00 38.85  ? 408  THR A CA    1 
ATOM   3169  C C     . THR A 1 408 ? 1.155   23.417  89.220  1.00 37.19  ? 408  THR A C     1 
ATOM   3170  O O     . THR A 1 408 ? 1.004   24.105  88.231  1.00 36.18  ? 408  THR A O     1 
ATOM   3171  C CB    . THR A 1 408 ? 0.479   24.095  91.482  1.00 39.55  ? 408  THR A CB    1 
ATOM   3172  O OG1   . THR A 1 408 ? -0.604  24.140  92.410  1.00 43.29  ? 408  THR A OG1   1 
ATOM   3173  C CG2   . THR A 1 408 ? 0.934   25.489  91.155  1.00 37.25  ? 408  THR A CG2   1 
ATOM   3174  N N     . GLU A 1 409 ? 2.277   22.751  89.472  1.00 37.36  ? 409  GLU A N     1 
ATOM   3175  C CA    . GLU A 1 409 ? 3.425   22.817  88.565  1.00 38.87  ? 409  GLU A CA    1 
ATOM   3176  C C     . GLU A 1 409 ? 3.045   22.314  87.168  1.00 37.89  ? 409  GLU A C     1 
ATOM   3177  O O     . GLU A 1 409 ? 3.343   22.949  86.158  1.00 37.47  ? 409  GLU A O     1 
ATOM   3178  C CB    . GLU A 1 409 ? 4.621   22.011  89.088  1.00 40.22  ? 409  GLU A CB    1 
ATOM   3179  C CG    . GLU A 1 409 ? 5.203   22.489  90.438  1.00 45.35  ? 409  GLU A CG    1 
ATOM   3180  C CD    . GLU A 1 409 ? 4.503   21.872  91.678  1.00 48.70  ? 409  GLU A CD    1 
ATOM   3181  O OE1   . GLU A 1 409 ? 3.320   21.461  91.584  1.00 47.17  ? 409  GLU A OE1   1 
ATOM   3182  O OE2   . GLU A 1 409 ? 5.144   21.817  92.753  1.00 48.42  ? 409  GLU A OE2   1 
ATOM   3183  N N     . GLU A 1 410 ? 2.362   21.182  87.130  1.00 37.33  ? 410  GLU A N     1 
ATOM   3184  C CA    . GLU A 1 410 ? 1.953   20.547  85.870  1.00 38.47  ? 410  GLU A CA    1 
ATOM   3185  C C     . GLU A 1 410 ? 0.938   21.384  85.092  1.00 36.31  ? 410  GLU A C     1 
ATOM   3186  O O     . GLU A 1 410 ? 1.050   21.506  83.877  1.00 36.75  ? 410  GLU A O     1 
ATOM   3187  C CB    . GLU A 1 410 ? 1.365   19.151  86.134  1.00 38.81  ? 410  GLU A CB    1 
ATOM   3188  C CG    . GLU A 1 410 ? 1.427   18.209  84.924  1.00 43.77  ? 410  GLU A CG    1 
ATOM   3189  C CD    . GLU A 1 410 ? 0.478   16.997  85.039  1.00 47.06  ? 410  GLU A CD    1 
ATOM   3190  O OE1   . GLU A 1 410 ? 0.169   16.571  86.178  1.00 59.55  ? 410  GLU A OE1   1 
ATOM   3191  O OE2   . GLU A 1 410 ? 0.040   16.477  83.984  1.00 53.31  ? 410  GLU A OE2   1 
ATOM   3192  N N     . VAL A 1 411 ? -0.032  21.959  85.805  1.00 34.24  ? 411  VAL A N     1 
ATOM   3193  C CA    . VAL A 1 411 ? -1.014  22.868  85.230  1.00 34.90  ? 411  VAL A CA    1 
ATOM   3194  C C     . VAL A 1 411 ? -0.314  24.090  84.634  1.00 34.70  ? 411  VAL A C     1 
ATOM   3195  O O     . VAL A 1 411 ? -0.533  24.429  83.495  1.00 32.83  ? 411  VAL A O     1 
ATOM   3196  C CB    . VAL A 1 411 ? -2.058  23.353  86.297  1.00 36.08  ? 411  VAL A CB    1 
ATOM   3197  C CG1   . VAL A 1 411 ? -2.948  24.490  85.759  1.00 35.09  ? 411  VAL A CG1   1 
ATOM   3198  C CG2   . VAL A 1 411 ? -2.941  22.205  86.811  1.00 32.25  ? 411  VAL A CG2   1 
ATOM   3199  N N     . GLU A 1 412 ? 0.552   24.719  85.410  1.00 34.67  ? 412  GLU A N     1 
ATOM   3200  C CA    . GLU A 1 412 ? 1.214   25.937  84.990  1.00 35.45  ? 412  GLU A CA    1 
ATOM   3201  C C     . GLU A 1 412 ? 2.131   25.701  83.790  1.00 32.94  ? 412  GLU A C     1 
ATOM   3202  O O     . GLU A 1 412 ? 2.161   26.540  82.887  1.00 30.81  ? 412  GLU A O     1 
ATOM   3203  C CB    . GLU A 1 412 ? 1.952   26.579  86.179  1.00 37.75  ? 412  GLU A CB    1 
ATOM   3204  C CG    . GLU A 1 412 ? 0.990   27.108  87.273  1.00 38.46  ? 412  GLU A CG    1 
ATOM   3205  C CD    . GLU A 1 412 ? 1.700   27.763  88.451  1.00 39.41  ? 412  GLU A CD    1 
ATOM   3206  O OE1   . GLU A 1 412 ? 2.937   27.627  88.557  1.00 41.89  ? 412  GLU A OE1   1 
ATOM   3207  O OE2   . GLU A 1 412 ? 0.995   28.403  89.275  1.00 47.11  ? 412  GLU A OE2   1 
ATOM   3208  N N     . ASP A 1 413 ? 2.808   24.547  83.750  1.00 30.97  ? 413  ASP A N     1 
ATOM   3209  C CA    . ASP A 1 413 ? 3.600   24.153  82.582  1.00 32.25  ? 413  ASP A CA    1 
ATOM   3210  C C     . ASP A 1 413 ? 2.762   24.019  81.306  1.00 31.35  ? 413  ASP A C     1 
ATOM   3211  O O     . ASP A 1 413 ? 3.138   24.529  80.255  1.00 33.40  ? 413  ASP A O     1 
ATOM   3212  C CB    . ASP A 1 413 ? 4.366   22.860  82.862  1.00 31.72  ? 413  ASP A CB    1 
ATOM   3213  C CG    . ASP A 1 413 ? 5.503   23.045  83.892  1.00 36.47  ? 413  ASP A CG    1 
ATOM   3214  O OD1   . ASP A 1 413 ? 5.877   24.202  84.224  1.00 39.93  ? 413  ASP A OD1   1 
ATOM   3215  O OD2   . ASP A 1 413 ? 6.035   22.017  84.373  1.00 41.12  ? 413  ASP A OD2   1 
ATOM   3216  N N     . ILE A 1 414 ? 1.633   23.336  81.403  1.00 30.35  ? 414  ILE A N     1 
ATOM   3217  C CA    . ILE A 1 414 ? 0.717   23.207  80.285  1.00 30.17  ? 414  ILE A CA    1 
ATOM   3218  C C     . ILE A 1 414 ? 0.224   24.568  79.801  1.00 29.92  ? 414  ILE A C     1 
ATOM   3219  O O     . ILE A 1 414 ? 0.290   24.843  78.614  1.00 30.52  ? 414  ILE A O     1 
ATOM   3220  C CB    . ILE A 1 414 ? -0.479  22.303  80.655  1.00 29.89  ? 414  ILE A CB    1 
ATOM   3221  C CG1   . ILE A 1 414 ? -0.012  20.844  80.740  1.00 28.46  ? 414  ILE A CG1   1 
ATOM   3222  C CG2   . ILE A 1 414 ? -1.604  22.430  79.615  1.00 32.53  ? 414  ILE A CG2   1 
ATOM   3223  C CD1   . ILE A 1 414 ? -0.911  19.952  81.611  1.00 31.22  ? 414  ILE A CD1   1 
ATOM   3224  N N     . LEU A 1 415 ? -0.218  25.420  80.724  1.00 29.57  ? 415  LEU A N     1 
ATOM   3225  C CA    . LEU A 1 415 ? -0.715  26.753  80.383  1.00 30.12  ? 415  LEU A CA    1 
ATOM   3226  C C     . LEU A 1 415 ? 0.337   27.680  79.762  1.00 31.95  ? 415  LEU A C     1 
ATOM   3227  O O     . LEU A 1 415 ? -0.019  28.511  78.912  1.00 32.23  ? 415  LEU A O     1 
ATOM   3228  C CB    . LEU A 1 415 ? -1.385  27.431  81.587  1.00 28.93  ? 415  LEU A CB    1 
ATOM   3229  C CG    . LEU A 1 415 ? -2.525  26.644  82.233  1.00 28.73  ? 415  LEU A CG    1 
ATOM   3230  C CD1   . LEU A 1 415 ? -2.981  27.309  83.515  1.00 32.14  ? 415  LEU A CD1   1 
ATOM   3231  C CD2   . LEU A 1 415 ? -3.672  26.447  81.293  1.00 30.25  ? 415  LEU A CD2   1 
ATOM   3232  N N     . GLN A 1 416 ? 1.605   27.527  80.157  1.00 33.78  ? 416  GLN A N     1 
ATOM   3233  C CA    . GLN A 1 416 ? 2.726   28.320  79.608  1.00 33.14  ? 416  GLN A CA    1 
ATOM   3234  C C     . GLN A 1 416 ? 2.935   28.005  78.119  1.00 33.06  ? 416  GLN A C     1 
ATOM   3235  O O     . GLN A 1 416 ? 3.238   28.888  77.302  1.00 31.20  ? 416  GLN A O     1 
ATOM   3236  C CB    . GLN A 1 416 ? 3.986   28.015  80.397  1.00 35.15  ? 416  GLN A CB    1 
ATOM   3237  C CG    . GLN A 1 416 ? 5.305   28.573  79.847  1.00 38.51  ? 416  GLN A CG    1 
ATOM   3238  C CD    . GLN A 1 416 ? 5.619   29.982  80.322  1.00 52.27  ? 416  GLN A CD    1 
ATOM   3239  O OE1   . GLN A 1 416 ? 4.957   30.948  79.924  1.00 63.90  ? 416  GLN A OE1   1 
ATOM   3240  N NE2   . GLN A 1 416 ? 6.662   30.113  81.153  1.00 52.23  ? 416  GLN A NE2   1 
ATOM   3241  N N     . GLU A 1 417 ? 2.736   26.740  77.763  1.00 33.45  ? 417  GLU A N     1 
ATOM   3242  C CA    . GLU A 1 417 ? 2.749   26.346  76.365  1.00 33.76  ? 417  GLU A CA    1 
ATOM   3243  C C     . GLU A 1 417 ? 1.696   27.100  75.557  1.00 31.19  ? 417  GLU A C     1 
ATOM   3244  O O     . GLU A 1 417 ? 1.961   27.497  74.440  1.00 30.69  ? 417  GLU A O     1 
ATOM   3245  C CB    . GLU A 1 417 ? 2.526   24.849  76.245  1.00 34.71  ? 417  GLU A CB    1 
ATOM   3246  C CG    . GLU A 1 417 ? 3.622   24.026  76.931  1.00 42.66  ? 417  GLU A CG    1 
ATOM   3247  C CD    . GLU A 1 417 ? 3.577   22.546  76.557  1.00 43.63  ? 417  GLU A CD    1 
ATOM   3248  O OE1   . GLU A 1 417 ? 3.829   22.237  75.363  1.00 49.00  ? 417  GLU A OE1   1 
ATOM   3249  O OE2   . GLU A 1 417 ? 3.306   21.706  77.463  1.00 46.64  ? 417  GLU A OE2   1 
ATOM   3250  N N     . PHE A 1 418 ? 0.504   27.292  76.114  1.00 30.10  ? 418  PHE A N     1 
ATOM   3251  C CA    . PHE A 1 418 ? -0.529  28.080  75.419  1.00 29.43  ? 418  PHE A CA    1 
ATOM   3252  C C     . PHE A 1 418 ? -0.160  29.551  75.367  1.00 27.04  ? 418  PHE A C     1 
ATOM   3253  O O     . PHE A 1 418 ? -0.305  30.200  74.319  1.00 26.12  ? 418  PHE A O     1 
ATOM   3254  C CB    . PHE A 1 418 ? -1.863  27.898  76.078  1.00 27.62  ? 418  PHE A CB    1 
ATOM   3255  C CG    . PHE A 1 418 ? -2.340  26.455  76.145  1.00 30.82  ? 418  PHE A CG    1 
ATOM   3256  C CD1   . PHE A 1 418 ? -2.169  25.584  75.068  1.00 27.10  ? 418  PHE A CD1   1 
ATOM   3257  C CD2   . PHE A 1 418 ? -3.028  25.996  77.281  1.00 29.78  ? 418  PHE A CD2   1 
ATOM   3258  C CE1   . PHE A 1 418 ? -2.639  24.275  75.129  1.00 28.21  ? 418  PHE A CE1   1 
ATOM   3259  C CE2   . PHE A 1 418 ? -3.510  24.676  77.358  1.00 30.21  ? 418  PHE A CE2   1 
ATOM   3260  C CZ    . PHE A 1 418 ? -3.319  23.807  76.279  1.00 26.61  ? 418  PHE A CZ    1 
ATOM   3261  N N     . VAL A 1 419 ? 0.345   30.052  76.485  1.00 27.02  ? 419  VAL A N     1 
ATOM   3262  C CA    . VAL A 1 419 ? 0.728   31.442  76.624  1.00 27.98  ? 419  VAL A CA    1 
ATOM   3263  C C     . VAL A 1 419 ? 1.816   31.787  75.621  1.00 27.82  ? 419  VAL A C     1 
ATOM   3264  O O     . VAL A 1 419 ? 1.717   32.806  74.930  1.00 29.38  ? 419  VAL A O     1 
ATOM   3265  C CB    . VAL A 1 419 ? 1.183   31.781  78.092  1.00 28.28  ? 419  VAL A CB    1 
ATOM   3266  C CG1   . VAL A 1 419 ? 1.614   33.242  78.181  1.00 31.27  ? 419  VAL A CG1   1 
ATOM   3267  C CG2   . VAL A 1 419 ? 0.050   31.529  79.138  1.00 27.19  ? 419  VAL A CG2   1 
ATOM   3268  N N     . ASN A 1 420 ? 2.827   30.917  75.521  1.00 28.23  ? 420  ASN A N     1 
ATOM   3269  C CA    . ASN A 1 420 ? 3.951   31.095  74.595  1.00 30.83  ? 420  ASN A CA    1 
ATOM   3270  C C     . ASN A 1 420 ? 3.535   31.055  73.124  1.00 30.01  ? 420  ASN A C     1 
ATOM   3271  O O     . ASN A 1 420 ? 4.261   31.568  72.279  1.00 30.13  ? 420  ASN A O     1 
ATOM   3272  C CB    . ASN A 1 420 ? 5.020   30.017  74.845  1.00 32.82  ? 420  ASN A CB    1 
ATOM   3273  C CG    . ASN A 1 420 ? 5.858   30.279  76.098  1.00 41.62  ? 420  ASN A CG    1 
ATOM   3274  O OD1   . ASN A 1 420 ? 6.467   29.344  76.652  1.00 48.61  ? 420  ASN A OD1   1 
ATOM   3275  N ND2   . ASN A 1 420 ? 5.920   31.538  76.537  1.00 38.68  ? 420  ASN A ND2   1 
ATOM   3276  N N     . LYS A 1 421 ? 2.378   30.465  72.827  1.00 30.01  ? 421  LYS A N     1 
ATOM   3277  C CA    . LYS A 1 421 ? 1.804   30.458  71.466  1.00 29.81  ? 421  LYS A CA    1 
ATOM   3278  C C     . LYS A 1 421 ? 0.773   31.582  71.191  1.00 28.40  ? 421  LYS A C     1 
ATOM   3279  O O     . LYS A 1 421 ? 0.192   31.606  70.111  1.00 28.13  ? 421  LYS A O     1 
ATOM   3280  C CB    . LYS A 1 421 ? 1.177   29.096  71.214  1.00 29.30  ? 421  LYS A CB    1 
ATOM   3281  C CG    . LYS A 1 421 ? 2.184   27.979  71.206  1.00 30.32  ? 421  LYS A CG    1 
ATOM   3282  C CD    . LYS A 1 421 ? 1.550   26.576  71.188  1.00 34.54  ? 421  LYS A CD    1 
ATOM   3283  C CE    . LYS A 1 421 ? 2.573   25.506  70.742  1.00 37.22  ? 421  LYS A CE    1 
ATOM   3284  N NZ    . LYS A 1 421 ? 2.651   25.373  69.246  1.00 37.37  ? 421  LYS A NZ    1 
ATOM   3285  N N     . SER A 1 422 ? 0.600   32.516  72.147  1.00 28.84  ? 422  SER A N     1 
ATOM   3286  C CA    . SER A 1 422 ? -0.450  33.612  72.137  1.00 27.91  ? 422  SER A CA    1 
ATOM   3287  C C     . SER A 1 422 ? -1.887  33.116  72.146  1.00 25.26  ? 422  SER A C     1 
ATOM   3288  O O     . SER A 1 422 ? -2.804  33.807  71.711  1.00 26.45  ? 422  SER A O     1 
ATOM   3289  C CB    . SER A 1 422 ? -0.280  34.610  70.984  1.00 27.06  ? 422  SER A CB    1 
ATOM   3290  O OG    . SER A 1 422 ? 0.927   35.319  71.118  1.00 36.43  ? 422  SER A OG    1 
ATOM   3291  N N     . LEU A 1 423 ? -2.078  31.919  72.661  1.00 25.45  ? 423  LEU A N     1 
ATOM   3292  C CA    . LEU A 1 423 ? -3.388  31.289  72.754  1.00 25.94  ? 423  LEU A CA    1 
ATOM   3293  C C     . LEU A 1 423 ? -4.048  31.532  74.114  1.00 27.25  ? 423  LEU A C     1 
ATOM   3294  O O     . LEU A 1 423 ? -5.187  31.130  74.335  1.00 28.12  ? 423  LEU A O     1 
ATOM   3295  C CB    . LEU A 1 423 ? -3.241  29.798  72.537  1.00 24.05  ? 423  LEU A CB    1 
ATOM   3296  C CG    . LEU A 1 423 ? -2.934  29.379  71.118  1.00 22.52  ? 423  LEU A CG    1 
ATOM   3297  C CD1   . LEU A 1 423 ? -2.493  27.915  71.104  1.00 21.37  ? 423  LEU A CD1   1 
ATOM   3298  C CD2   . LEU A 1 423 ? -4.135  29.616  70.177  1.00 25.11  ? 423  LEU A CD2   1 
ATOM   3299  N N     . LEU A 1 424 ? -3.316  32.181  75.004  1.00 25.78  ? 424  LEU A N     1 
ATOM   3300  C CA    . LEU A 1 424 ? -3.693  32.370  76.383  1.00 26.77  ? 424  LEU A CA    1 
ATOM   3301  C C     . LEU A 1 424 ? -2.780  33.459  76.944  1.00 26.83  ? 424  LEU A C     1 
ATOM   3302  O O     . LEU A 1 424 ? -1.689  33.661  76.439  1.00 28.50  ? 424  LEU A O     1 
ATOM   3303  C CB    . LEU A 1 424 ? -3.556  31.057  77.188  1.00 26.40  ? 424  LEU A CB    1 
ATOM   3304  C CG    . LEU A 1 424 ? -4.176  31.026  78.597  1.00 23.14  ? 424  LEU A CG    1 
ATOM   3305  C CD1   . LEU A 1 424 ? -5.714  31.165  78.616  1.00 26.51  ? 424  LEU A CD1   1 
ATOM   3306  C CD2   . LEU A 1 424 ? -3.757  29.800  79.323  1.00 24.65  ? 424  LEU A CD2   1 
ATOM   3307  N N     . PHE A 1 425 ? -3.265  34.183  77.948  1.00 27.37  ? 425  PHE A N     1 
ATOM   3308  C CA    . PHE A 1 425 ? -2.517  35.247  78.603  1.00 28.12  ? 425  PHE A CA    1 
ATOM   3309  C C     . PHE A 1 425 ? -2.458  34.943  80.076  1.00 28.85  ? 425  PHE A C     1 
ATOM   3310  O O     . PHE A 1 425 ? -3.316  34.223  80.603  1.00 29.51  ? 425  PHE A O     1 
ATOM   3311  C CB    . PHE A 1 425 ? -3.147  36.613  78.292  1.00 30.68  ? 425  PHE A CB    1 
ATOM   3312  C CG    . PHE A 1 425 ? -3.237  36.866  76.821  1.00 29.53  ? 425  PHE A CG    1 
ATOM   3313  C CD1   . PHE A 1 425 ? -4.304  36.375  76.090  1.00 33.08  ? 425  PHE A CD1   1 
ATOM   3314  C CD2   . PHE A 1 425 ? -2.183  37.443  76.154  1.00 24.49  ? 425  PHE A CD2   1 
ATOM   3315  C CE1   . PHE A 1 425 ? -4.360  36.517  74.711  1.00 34.53  ? 425  PHE A CE1   1 
ATOM   3316  C CE2   . PHE A 1 425 ? -2.214  37.583  74.786  1.00 37.07  ? 425  PHE A CE2   1 
ATOM   3317  C CZ    . PHE A 1 425 ? -3.316  37.140  74.050  1.00 30.60  ? 425  PHE A CZ    1 
ATOM   3318  N N     . CYS A 1 426 ? -1.400  35.423  80.716  1.00 29.56  ? 426  CYS A N     1 
ATOM   3319  C CA    . CYS A 1 426 ? -1.158  35.187  82.138  1.00 30.07  ? 426  CYS A CA    1 
ATOM   3320  C C     . CYS A 1 426 ? -0.684  36.452  82.773  1.00 30.67  ? 426  CYS A C     1 
ATOM   3321  O O     . CYS A 1 426 ? 0.285   37.020  82.306  1.00 31.99  ? 426  CYS A O     1 
ATOM   3322  C CB    . CYS A 1 426 ? -0.125  34.086  82.332  1.00 29.87  ? 426  CYS A CB    1 
ATOM   3323  S SG    . CYS A 1 426 ? 0.260   33.627  84.091  1.00 29.93  ? 426  CYS A SG    1 
ATOM   3324  N N     . ASP A 1 427 ? -1.390  36.927  83.806  1.00 34.06  ? 427  ASP A N     1 
ATOM   3325  C CA    . ASP A 1 427 ? -0.946  38.095  84.623  1.00 35.79  ? 427  ASP A CA    1 
ATOM   3326  C C     . ASP A 1 427 ? -0.328  37.508  85.903  1.00 36.16  ? 427  ASP A C     1 
ATOM   3327  O O     . ASP A 1 427 ? -0.954  36.687  86.593  1.00 33.73  ? 427  ASP A O     1 
ATOM   3328  C CB    . ASP A 1 427 ? -2.118  39.052  84.999  1.00 38.21  ? 427  ASP A CB    1 
ATOM   3329  C CG    . ASP A 1 427 ? -2.536  40.040  83.856  1.00 43.28  ? 427  ASP A CG    1 
ATOM   3330  O OD1   . ASP A 1 427 ? -1.920  40.106  82.757  1.00 42.77  ? 427  ASP A OD1   1 
ATOM   3331  O OD2   . ASP A 1 427 ? -3.545  40.748  84.068  1.00 47.85  ? 427  ASP A OD2   1 
ATOM   3332  N N     . ARG A 1 428 ? 0.903   37.912  86.188  1.00 38.31  ? 428  ARG A N     1 
ATOM   3333  C CA    . ARG A 1 428 ? 1.634   37.413  87.328  1.00 40.24  ? 428  ARG A CA    1 
ATOM   3334  C C     . ARG A 1 428 ? 1.818   38.552  88.331  1.00 42.14  ? 428  ARG A C     1 
ATOM   3335  O O     . ARG A 1 428 ? 2.369   39.608  87.989  1.00 42.64  ? 428  ARG A O     1 
ATOM   3336  C CB    . ARG A 1 428 ? 2.980   36.844  86.912  1.00 37.44  ? 428  ARG A CB    1 
ATOM   3337  C CG    . ARG A 1 428 ? 2.882   35.670  85.987  1.00 30.48  ? 428  ARG A CG    1 
ATOM   3338  C CD    . ARG A 1 428 ? 2.752   36.108  84.520  1.00 32.34  ? 428  ARG A CD    1 
ATOM   3339  N NE    . ARG A 1 428 ? 3.955   36.818  84.091  1.00 24.61  ? 428  ARG A NE    1 
ATOM   3340  C CZ    . ARG A 1 428 ? 4.166   37.308  82.881  1.00 33.15  ? 428  ARG A CZ    1 
ATOM   3341  N NH1   . ARG A 1 428 ? 3.250   37.189  81.929  1.00 34.54  ? 428  ARG A NH1   1 
ATOM   3342  N NH2   . ARG A 1 428 ? 5.309   37.938  82.628  1.00 40.92  ? 428  ARG A NH2   1 
ATOM   3343  N N     . ASN A 1 429 ? 1.323   38.337  89.545  1.00 45.46  ? 429  ASN A N     1 
ATOM   3344  C CA    . ASN A 1 429 ? 1.701   39.167  90.678  1.00 47.33  ? 429  ASN A CA    1 
ATOM   3345  C C     . ASN A 1 429 ? 2.407   38.303  91.713  1.00 48.26  ? 429  ASN A C     1 
ATOM   3346  O O     . ASN A 1 429 ? 1.780   37.739  92.587  1.00 48.18  ? 429  ASN A O     1 
ATOM   3347  C CB    . ASN A 1 429 ? 0.501   39.899  91.296  1.00 47.89  ? 429  ASN A CB    1 
ATOM   3348  C CG    . ASN A 1 429 ? 0.937   41.013  92.259  1.00 51.28  ? 429  ASN A CG    1 
ATOM   3349  O OD1   . ASN A 1 429 ? 0.388   41.149  93.345  1.00 62.51  ? 429  ASN A OD1   1 
ATOM   3350  N ND2   . ASN A 1 429 ? 1.937   41.801  91.864  1.00 57.74  ? 429  ASN A ND2   1 
ATOM   3351  N N     . GLY A 1 430 ? 3.723   38.179  91.562  1.00 51.26  ? 430  GLY A N     1 
ATOM   3352  C CA    . GLY A 1 430 ? 4.511   37.265  92.361  1.00 52.16  ? 430  GLY A CA    1 
ATOM   3353  C C     . GLY A 1 430 ? 4.032   35.836  92.184  1.00 53.31  ? 430  GLY A C     1 
ATOM   3354  O O     . GLY A 1 430 ? 4.067   35.277  91.073  1.00 52.14  ? 430  GLY A O     1 
ATOM   3355  N N     . LYS A 1 431 ? 3.566   35.262  93.287  1.00 54.07  ? 431  LYS A N     1 
ATOM   3356  C CA    . LYS A 1 431 ? 3.184   33.856  93.319  1.00 55.38  ? 431  LYS A CA    1 
ATOM   3357  C C     . LYS A 1 431 ? 1.753   33.607  92.787  1.00 53.55  ? 431  LYS A C     1 
ATOM   3358  O O     . LYS A 1 431 ? 1.426   32.496  92.391  1.00 54.13  ? 431  LYS A O     1 
ATOM   3359  C CB    . LYS A 1 431 ? 3.379   33.272  94.736  1.00 57.41  ? 431  LYS A CB    1 
ATOM   3360  C CG    . LYS A 1 431 ? 2.753   34.076  95.905  1.00 60.57  ? 431  LYS A CG    1 
ATOM   3361  C CD    . LYS A 1 431 ? 2.901   33.321  97.253  1.00 59.19  ? 431  LYS A CD    1 
ATOM   3362  C CE    . LYS A 1 431 ? 1.811   33.735  98.262  1.00 62.06  ? 431  LYS A CE    1 
ATOM   3363  N NZ    . LYS A 1 431 ? 2.238   33.603  99.690  1.00 59.81  ? 431  LYS A NZ    1 
ATOM   3364  N N     . SER A 1 432 ? 0.913   34.634  92.771  1.00 51.68  ? 432  SER A N     1 
ATOM   3365  C CA    . SER A 1 432 ? -0.434  34.515  92.210  1.00 51.81  ? 432  SER A CA    1 
ATOM   3366  C C     . SER A 1 432 ? -0.461  34.618  90.667  1.00 48.15  ? 432  SER A C     1 
ATOM   3367  O O     . SER A 1 432 ? -0.039  35.639  90.103  1.00 46.36  ? 432  SER A O     1 
ATOM   3368  C CB    . SER A 1 432 ? -1.372  35.550  92.863  1.00 54.62  ? 432  SER A CB    1 
ATOM   3369  O OG    . SER A 1 432 ? -1.599  35.222  94.243  1.00 61.42  ? 432  SER A OG    1 
ATOM   3370  N N     . PHE A 1 433 ? -0.921  33.537  90.015  1.00 44.21  ? 433  PHE A N     1 
ATOM   3371  C CA    . PHE A 1 433 ? -1.007  33.433  88.542  1.00 43.08  ? 433  PHE A CA    1 
ATOM   3372  C C     . PHE A 1 433 ? -2.477  33.408  88.118  1.00 39.64  ? 433  PHE A C     1 
ATOM   3373  O O     . PHE A 1 433 ? -3.268  32.637  88.671  1.00 35.91  ? 433  PHE A O     1 
ATOM   3374  C CB    . PHE A 1 433 ? -0.362  32.124  88.059  1.00 42.43  ? 433  PHE A CB    1 
ATOM   3375  C CG    . PHE A 1 433 ? 1.145   32.163  87.924  1.00 42.75  ? 433  PHE A CG    1 
ATOM   3376  C CD1   . PHE A 1 433 ? 1.931   33.071  88.626  1.00 44.41  ? 433  PHE A CD1   1 
ATOM   3377  C CD2   . PHE A 1 433 ? 1.779   31.239  87.118  1.00 42.34  ? 433  PHE A CD2   1 
ATOM   3378  C CE1   . PHE A 1 433 ? 3.307   33.080  88.483  1.00 42.37  ? 433  PHE A CE1   1 
ATOM   3379  C CE2   . PHE A 1 433 ? 3.148   31.244  86.976  1.00 44.41  ? 433  PHE A CE2   1 
ATOM   3380  C CZ    . PHE A 1 433 ? 3.912   32.171  87.652  1.00 44.19  ? 433  PHE A CZ    1 
ATOM   3381  N N     . ARG A 1 434 ? -2.844  34.253  87.155  1.00 38.81  ? 434  ARG A N     1 
ATOM   3382  C CA    . ARG A 1 434 ? -4.213  34.280  86.646  1.00 39.59  ? 434  ARG A CA    1 
ATOM   3383  C C     . ARG A 1 434 ? -4.215  34.308  85.115  1.00 36.12  ? 434  ARG A C     1 
ATOM   3384  O O     . ARG A 1 434 ? -3.433  35.029  84.480  1.00 33.39  ? 434  ARG A O     1 
ATOM   3385  C CB    . ARG A 1 434 ? -5.009  35.428  87.246  1.00 40.86  ? 434  ARG A CB    1 
ATOM   3386  C CG    . ARG A 1 434 ? -5.418  35.184  88.735  1.00 46.80  ? 434  ARG A CG    1 
ATOM   3387  C CD    . ARG A 1 434 ? -6.098  36.398  89.338  1.00 47.00  ? 434  ARG A CD    1 
ATOM   3388  N NE    . ARG A 1 434 ? -5.184  37.529  89.310  1.00 63.80  ? 434  ARG A NE    1 
ATOM   3389  C CZ    . ARG A 1 434 ? -5.503  38.782  88.980  1.00 75.04  ? 434  ARG A CZ    1 
ATOM   3390  N NH1   . ARG A 1 434 ? -6.745  39.126  88.636  1.00 79.65  ? 434  ARG A NH1   1 
ATOM   3391  N NH2   . ARG A 1 434 ? -4.554  39.710  88.988  1.00 77.55  ? 434  ARG A NH2   1 
ATOM   3392  N N     . TYR A 1 435 ? -5.101  33.497  84.543  1.00 34.33  ? 435  TYR A N     1 
ATOM   3393  C CA    . TYR A 1 435 ? -5.104  33.229  83.122  1.00 32.40  ? 435  TYR A CA    1 
ATOM   3394  C C     . TYR A 1 435 ? -6.368  33.769  82.478  1.00 31.42  ? 435  TYR A C     1 
ATOM   3395  O O     . TYR A 1 435 ? -7.457  33.693  83.048  1.00 28.88  ? 435  TYR A O     1 
ATOM   3396  C CB    . TYR A 1 435 ? -4.997  31.737  82.899  1.00 29.59  ? 435  TYR A CB    1 
ATOM   3397  C CG    . TYR A 1 435 ? -3.733  31.147  83.466  1.00 29.27  ? 435  TYR A CG    1 
ATOM   3398  C CD1   . TYR A 1 435 ? -2.574  31.148  82.732  1.00 27.55  ? 435  TYR A CD1   1 
ATOM   3399  C CD2   . TYR A 1 435 ? -3.683  30.629  84.773  1.00 32.56  ? 435  TYR A CD2   1 
ATOM   3400  C CE1   . TYR A 1 435 ? -1.405  30.614  83.235  1.00 29.64  ? 435  TYR A CE1   1 
ATOM   3401  C CE2   . TYR A 1 435 ? -2.509  30.108  85.293  1.00 30.02  ? 435  TYR A CE2   1 
ATOM   3402  C CZ    . TYR A 1 435 ? -1.368  30.091  84.505  1.00 32.66  ? 435  TYR A CZ    1 
ATOM   3403  O OH    . TYR A 1 435 ? -0.182  29.550  84.950  1.00 31.35  ? 435  TYR A OH    1 
ATOM   3404  N N     . TYR A 1 436 ? -6.206  34.325  81.283  1.00 29.99  ? 436  TYR A N     1 
ATOM   3405  C CA    . TYR A 1 436 ? -7.337  34.823  80.536  1.00 29.53  ? 436  TYR A CA    1 
ATOM   3406  C C     . TYR A 1 436 ? -7.119  34.737  79.030  1.00 30.96  ? 436  TYR A C     1 
ATOM   3407  O O     . TYR A 1 436 ? -5.991  34.550  78.541  1.00 30.33  ? 436  TYR A O     1 
ATOM   3408  C CB    . TYR A 1 436 ? -7.658  36.253  80.959  1.00 28.27  ? 436  TYR A CB    1 
ATOM   3409  C CG    . TYR A 1 436 ? -6.505  37.227  80.766  1.00 27.07  ? 436  TYR A CG    1 
ATOM   3410  C CD1   . TYR A 1 436 ? -5.444  37.267  81.666  1.00 27.77  ? 436  TYR A CD1   1 
ATOM   3411  C CD2   . TYR A 1 436 ? -6.486  38.104  79.683  1.00 28.54  ? 436  TYR A CD2   1 
ATOM   3412  C CE1   . TYR A 1 436 ? -4.414  38.165  81.527  1.00 28.57  ? 436  TYR A CE1   1 
ATOM   3413  C CE2   . TYR A 1 436 ? -5.452  39.004  79.516  1.00 26.90  ? 436  TYR A CE2   1 
ATOM   3414  C CZ    . TYR A 1 436 ? -4.417  39.032  80.438  1.00 32.16  ? 436  TYR A CZ    1 
ATOM   3415  O OH    . TYR A 1 436 ? -3.380  39.913  80.258  1.00 34.07  ? 436  TYR A OH    1 
ATOM   3416  N N     . LEU A 1 437 ? -8.244  34.866  78.317  1.00 31.53  ? 437  LEU A N     1 
ATOM   3417  C CA    . LEU A 1 437 ? -8.299  34.866  76.869  1.00 30.89  ? 437  LEU A CA    1 
ATOM   3418  C C     . LEU A 1 437 ? -8.724  36.237  76.392  1.00 31.70  ? 437  LEU A C     1 
ATOM   3419  O O     . LEU A 1 437 ? -9.503  36.930  77.080  1.00 31.81  ? 437  LEU A O     1 
ATOM   3420  C CB    . LEU A 1 437 ? -9.335  33.862  76.381  1.00 31.71  ? 437  LEU A CB    1 
ATOM   3421  C CG    . LEU A 1 437 ? -8.955  32.395  76.525  1.00 32.33  ? 437  LEU A CG    1 
ATOM   3422  C CD1   . LEU A 1 437 ? -10.174 31.554  76.338  1.00 31.95  ? 437  LEU A CD1   1 
ATOM   3423  C CD2   . LEU A 1 437 ? -7.881  32.060  75.528  1.00 30.42  ? 437  LEU A CD2   1 
ATOM   3424  N N     . HIS A 1 438 ? -8.260  36.615  75.204  1.00 29.47  ? 438  HIS A N     1 
ATOM   3425  C CA    . HIS A 1 438 ? -8.799  37.804  74.552  1.00 29.17  ? 438  HIS A CA    1 
ATOM   3426  C C     . HIS A 1 438 ? -10.243 37.485  74.161  1.00 28.86  ? 438  HIS A C     1 
ATOM   3427  O O     . HIS A 1 438 ? -10.542 36.354  73.791  1.00 28.42  ? 438  HIS A O     1 
ATOM   3428  C CB    . HIS A 1 438 ? -7.954  38.195  73.334  1.00 29.80  ? 438  HIS A CB    1 
ATOM   3429  C CG    . HIS A 1 438 ? -8.223  39.578  72.831  1.00 31.32  ? 438  HIS A CG    1 
ATOM   3430  N ND1   . HIS A 1 438 ? -9.206  39.848  71.906  1.00 30.50  ? 438  HIS A ND1   1 
ATOM   3431  C CD2   . HIS A 1 438 ? -7.634  40.764  73.109  1.00 34.75  ? 438  HIS A CD2   1 
ATOM   3432  C CE1   . HIS A 1 438 ? -9.229  41.144  71.652  1.00 35.75  ? 438  HIS A CE1   1 
ATOM   3433  N NE2   . HIS A 1 438 ? -8.280  41.724  72.362  1.00 30.52  ? 438  HIS A NE2   1 
ATOM   3434  N N     . ASP A 1 439 ? -11.134 38.469  74.264  1.00 29.46  ? 439  ASP A N     1 
ATOM   3435  C CA    . ASP A 1 439 ? -12.556 38.322  73.830  1.00 29.57  ? 439  ASP A CA    1 
ATOM   3436  C C     . ASP A 1 439 ? -12.712 37.601  72.519  1.00 28.80  ? 439  ASP A C     1 
ATOM   3437  O O     . ASP A 1 439 ? -13.609 36.776  72.360  1.00 28.97  ? 439  ASP A O     1 
ATOM   3438  C CB    . ASP A 1 439 ? -13.248 39.694  73.680  1.00 27.48  ? 439  ASP A CB    1 
ATOM   3439  C CG    . ASP A 1 439 ? -13.538 40.338  75.021  1.00 37.28  ? 439  ASP A CG    1 
ATOM   3440  O OD1   . ASP A 1 439 ? -12.957 39.868  76.026  1.00 40.75  ? 439  ASP A OD1   1 
ATOM   3441  O OD2   . ASP A 1 439 ? -14.345 41.299  75.082  1.00 47.71  ? 439  ASP A OD2   1 
ATOM   3442  N N     . LEU A 1 440 ? -11.852 37.949  71.567  1.00 28.35  ? 440  LEU A N     1 
ATOM   3443  C CA    . LEU A 1 440 ? -11.921 37.371  70.234  1.00 28.45  ? 440  LEU A CA    1 
ATOM   3444  C C     . LEU A 1 440 ? -11.595 35.877  70.221  1.00 27.29  ? 440  LEU A C     1 
ATOM   3445  O O     . LEU A 1 440 ? -12.042 35.149  69.339  1.00 26.90  ? 440  LEU A O     1 
ATOM   3446  C CB    . LEU A 1 440 ? -10.968 38.106  69.312  1.00 28.88  ? 440  LEU A CB    1 
ATOM   3447  C CG    . LEU A 1 440 ? -11.205 39.574  68.999  1.00 36.96  ? 440  LEU A CG    1 
ATOM   3448  C CD1   . LEU A 1 440 ? -10.034 40.147  68.146  1.00 38.12  ? 440  LEU A CD1   1 
ATOM   3449  C CD2   . LEU A 1 440 ? -12.517 39.759  68.305  1.00 33.71  ? 440  LEU A CD2   1 
ATOM   3450  N N     . GLN A 1 441 ? -10.802 35.439  71.197  1.00 27.44  ? 441  GLN A N     1 
ATOM   3451  C CA    . GLN A 1 441 ? -10.457 34.036  71.363  1.00 27.08  ? 441  GLN A CA    1 
ATOM   3452  C C     . GLN A 1 441 ? -11.561 33.270  72.066  1.00 27.81  ? 441  GLN A C     1 
ATOM   3453  O O     . GLN A 1 441 ? -11.803 32.115  71.751  1.00 26.12  ? 441  GLN A O     1 
ATOM   3454  C CB    . GLN A 1 441 ? -9.167  33.915  72.123  1.00 27.43  ? 441  GLN A CB    1 
ATOM   3455  C CG    . GLN A 1 441 ? -7.966  34.514  71.380  1.00 27.44  ? 441  GLN A CG    1 
ATOM   3456  C CD    . GLN A 1 441 ? -6.731  34.453  72.212  1.00 24.00  ? 441  GLN A CD    1 
ATOM   3457  O OE1   . GLN A 1 441 ? -6.751  34.860  73.360  1.00 26.55  ? 441  GLN A OE1   1 
ATOM   3458  N NE2   . GLN A 1 441 ? -5.641  33.892  71.655  1.00 27.15  ? 441  GLN A NE2   1 
ATOM   3459  N N     . VAL A 1 442 ? -12.250 33.921  72.998  1.00 28.37  ? 442  VAL A N     1 
ATOM   3460  C CA    . VAL A 1 442 ? -13.464 33.337  73.601  1.00 27.58  ? 442  VAL A CA    1 
ATOM   3461  C C     . VAL A 1 442 ? -14.498 33.060  72.499  1.00 29.09  ? 442  VAL A C     1 
ATOM   3462  O O     . VAL A 1 442 ? -15.035 31.954  72.413  1.00 27.39  ? 442  VAL A O     1 
ATOM   3463  C CB    . VAL A 1 442 ? -14.051 34.248  74.672  1.00 26.67  ? 442  VAL A CB    1 
ATOM   3464  C CG1   . VAL A 1 442 ? -15.357 33.643  75.255  1.00 29.14  ? 442  VAL A CG1   1 
ATOM   3465  C CG2   . VAL A 1 442 ? -13.040 34.503  75.789  1.00 25.67  ? 442  VAL A CG2   1 
ATOM   3466  N N     . ASP A 1 443 ? -14.727 34.046  71.624  1.00 31.00  ? 443  ASP A N     1 
ATOM   3467  C CA    . ASP A 1 443 ? -15.642 33.906  70.464  1.00 30.95  ? 443  ASP A CA    1 
ATOM   3468  C C     . ASP A 1 443 ? -15.287 32.738  69.554  1.00 30.81  ? 443  ASP A C     1 
ATOM   3469  O O     . ASP A 1 443 ? -16.151 31.982  69.140  1.00 32.27  ? 443  ASP A O     1 
ATOM   3470  C CB    . ASP A 1 443 ? -15.649 35.190  69.607  1.00 34.05  ? 443  ASP A CB    1 
ATOM   3471  C CG    . ASP A 1 443 ? -16.237 36.405  70.339  1.00 40.20  ? 443  ASP A CG    1 
ATOM   3472  O OD1   . ASP A 1 443 ? -16.956 36.225  71.347  1.00 43.90  ? 443  ASP A OD1   1 
ATOM   3473  O OD2   . ASP A 1 443 ? -15.972 37.544  69.900  1.00 39.53  ? 443  ASP A OD2   1 
ATOM   3474  N N     . PHE A 1 444 ? -14.007 32.600  69.246  1.00 29.62  ? 444  PHE A N     1 
ATOM   3475  C CA    . PHE A 1 444 ? -13.531 31.473  68.463  1.00 29.32  ? 444  PHE A CA    1 
ATOM   3476  C C     . PHE A 1 444 ? -13.818 30.111  69.097  1.00 28.91  ? 444  PHE A C     1 
ATOM   3477  O O     . PHE A 1 444 ? -14.286 29.235  68.423  1.00 27.20  ? 444  PHE A O     1 
ATOM   3478  C CB    . PHE A 1 444 ? -12.025 31.599  68.165  1.00 29.38  ? 444  PHE A CB    1 
ATOM   3479  C CG    . PHE A 1 444 ? -11.464 30.388  67.515  1.00 27.97  ? 444  PHE A CG    1 
ATOM   3480  C CD1   . PHE A 1 444 ? -11.630 30.190  66.144  1.00 31.86  ? 444  PHE A CD1   1 
ATOM   3481  C CD2   . PHE A 1 444 ? -10.836 29.403  68.276  1.00 27.91  ? 444  PHE A CD2   1 
ATOM   3482  C CE1   . PHE A 1 444 ? -11.147 29.040  65.538  1.00 29.48  ? 444  PHE A CE1   1 
ATOM   3483  C CE2   . PHE A 1 444 ? -10.352 28.269  67.687  1.00 26.99  ? 444  PHE A CE2   1 
ATOM   3484  C CZ    . PHE A 1 444 ? -10.521 28.077  66.307  1.00 23.17  ? 444  PHE A CZ    1 
ATOM   3485  N N     . LEU A 1 445 ? -13.509 29.936  70.380  1.00 29.77  ? 445  LEU A N     1 
ATOM   3486  C CA    . LEU A 1 445 ? -13.667 28.642  71.054  1.00 29.75  ? 445  LEU A CA    1 
ATOM   3487  C C     . LEU A 1 445 ? -15.128 28.280  71.257  1.00 30.86  ? 445  LEU A C     1 
ATOM   3488  O O     . LEU A 1 445 ? -15.515 27.115  71.202  1.00 32.16  ? 445  LEU A O     1 
ATOM   3489  C CB    . LEU A 1 445 ? -12.963 28.676  72.415  1.00 28.59  ? 445  LEU A CB    1 
ATOM   3490  C CG    . LEU A 1 445 ? -11.435 28.743  72.335  1.00 31.26  ? 445  LEU A CG    1 
ATOM   3491  C CD1   . LEU A 1 445 ? -10.832 29.063  73.696  1.00 33.40  ? 445  LEU A CD1   1 
ATOM   3492  C CD2   . LEU A 1 445 ? -10.877 27.436  71.789  1.00 29.71  ? 445  LEU A CD2   1 
ATOM   3493  N N     . THR A 1 446 ? -15.929 29.302  71.527  1.00 32.60  ? 446  THR A N     1 
ATOM   3494  C CA    . THR A 1 446 ? -17.357 29.151  71.717  1.00 34.23  ? 446  THR A CA    1 
ATOM   3495  C C     . THR A 1 446 ? -18.003 28.651  70.428  1.00 35.20  ? 446  THR A C     1 
ATOM   3496  O O     . THR A 1 446 ? -18.818 27.732  70.436  1.00 34.59  ? 446  THR A O     1 
ATOM   3497  C CB    . THR A 1 446 ? -17.960 30.499  72.194  1.00 34.21  ? 446  THR A CB    1 
ATOM   3498  O OG1   . THR A 1 446 ? -17.782 30.583  73.601  1.00 34.73  ? 446  THR A OG1   1 
ATOM   3499  C CG2   . THR A 1 446 ? -19.451 30.625  71.885  1.00 36.06  ? 446  THR A CG2   1 
ATOM   3500  N N     . GLU A 1 447 ? -17.589 29.259  69.323  1.00 35.87  ? 447  GLU A N     1 
ATOM   3501  C CA    . GLU A 1 447 ? -17.984 28.856  67.972  1.00 35.93  ? 447  GLU A CA    1 
ATOM   3502  C C     . GLU A 1 447 ? -17.408 27.458  67.601  1.00 35.36  ? 447  GLU A C     1 
ATOM   3503  O O     . GLU A 1 447 ? -18.174 26.540  67.311  1.00 35.90  ? 447  GLU A O     1 
ATOM   3504  C CB    . GLU A 1 447 ? -17.547 29.982  67.008  1.00 37.36  ? 447  GLU A CB    1 
ATOM   3505  C CG    . GLU A 1 447 ? -17.899 29.814  65.541  1.00 41.05  ? 447  GLU A CG    1 
ATOM   3506  C CD    . GLU A 1 447 ? -19.382 30.004  65.224  1.00 45.77  ? 447  GLU A CD    1 
ATOM   3507  O OE1   . GLU A 1 447 ? -20.027 30.924  65.766  1.00 43.88  ? 447  GLU A OE1   1 
ATOM   3508  O OE2   . GLU A 1 447 ? -19.880 29.239  64.384  1.00 48.50  ? 447  GLU A OE2   1 
ATOM   3509  N N     . LYS A 1 448 ? -16.085 27.283  67.662  1.00 32.87  ? 448  LYS A N     1 
ATOM   3510  C CA    . LYS A 1 448 ? -15.469 25.963  67.417  1.00 32.98  ? 448  LYS A CA    1 
ATOM   3511  C C     . LYS A 1 448 ? -16.085 24.810  68.229  1.00 32.63  ? 448  LYS A C     1 
ATOM   3512  O O     . LYS A 1 448 ? -16.346 23.749  67.684  1.00 32.72  ? 448  LYS A O     1 
ATOM   3513  C CB    . LYS A 1 448 ? -13.961 26.021  67.694  1.00 32.43  ? 448  LYS A CB    1 
ATOM   3514  C CG    . LYS A 1 448 ? -13.200 24.798  67.247  1.00 32.20  ? 448  LYS A CG    1 
ATOM   3515  C CD    . LYS A 1 448 ? -11.798 24.769  67.846  1.00 34.46  ? 448  LYS A CD    1 
ATOM   3516  C CE    . LYS A 1 448 ? -11.094 23.415  67.570  1.00 35.13  ? 448  LYS A CE    1 
ATOM   3517  N NZ    . LYS A 1 448 ? -11.677 22.257  68.363  1.00 34.70  ? 448  LYS A NZ    1 
ATOM   3518  N N     . ASN A 1 449 ? -16.296 25.005  69.526  1.00 33.25  ? 449  ASN A N     1 
ATOM   3519  C CA    . ASN A 1 449 ? -16.648 23.912  70.422  1.00 33.43  ? 449  ASN A CA    1 
ATOM   3520  C C     . ASN A 1 449 ? -18.030 24.025  70.987  1.00 33.21  ? 449  ASN A C     1 
ATOM   3521  O O     . ASN A 1 449 ? -18.307 23.461  72.052  1.00 32.21  ? 449  ASN A O     1 
ATOM   3522  C CB    . ASN A 1 449 ? -15.652 23.851  71.560  1.00 32.94  ? 449  ASN A CB    1 
ATOM   3523  C CG    . ASN A 1 449 ? -14.267 23.638  71.065  1.00 33.94  ? 449  ASN A CG    1 
ATOM   3524  O OD1   . ASN A 1 449 ? -14.059 22.778  70.211  1.00 34.81  ? 449  ASN A OD1   1 
ATOM   3525  N ND2   . ASN A 1 449 ? -13.301 24.449  71.547  1.00 24.74  ? 449  ASN A ND2   1 
ATOM   3526  N N     . CYS A 1 450 ? -18.894 24.720  70.259  1.00 36.22  ? 450  CYS A N     1 
ATOM   3527  C CA    . CYS A 1 450 ? -20.269 24.979  70.668  1.00 36.84  ? 450  CYS A CA    1 
ATOM   3528  C C     . CYS A 1 450 ? -21.002 23.748  71.204  1.00 36.35  ? 450  CYS A C     1 
ATOM   3529  O O     . CYS A 1 450 ? -21.635 23.838  72.264  1.00 36.72  ? 450  CYS A O     1 
ATOM   3530  C CB    . CYS A 1 450 ? -21.050 25.567  69.491  1.00 38.33  ? 450  CYS A CB    1 
ATOM   3531  S SG    . CYS A 1 450 ? -22.807 25.730  69.805  1.00 50.45  ? 450  CYS A SG    1 
ATOM   3532  N N     . SER A 1 451 ? -20.869 22.622  70.498  1.00 36.06  ? 451  SER A N     1 
ATOM   3533  C CA    . SER A 1 451 ? -21.563 21.364  70.820  1.00 38.08  ? 451  SER A CA    1 
ATOM   3534  C C     . SER A 1 451 ? -21.040 20.628  72.056  1.00 37.80  ? 451  SER A C     1 
ATOM   3535  O O     . SER A 1 451 ? -21.733 19.756  72.609  1.00 39.42  ? 451  SER A O     1 
ATOM   3536  C CB    . SER A 1 451 ? -21.510 20.426  69.608  1.00 38.43  ? 451  SER A CB    1 
ATOM   3537  O OG    . SER A 1 451 ? -22.181 21.029  68.518  1.00 42.80  ? 451  SER A OG    1 
ATOM   3538  N N     . GLN A 1 452 ? -19.831 20.955  72.479  1.00 36.14  ? 452  GLN A N     1 
ATOM   3539  C CA    . GLN A 1 452 ? -19.240 20.345  73.665  1.00 36.61  ? 452  GLN A CA    1 
ATOM   3540  C C     . GLN A 1 452 ? -19.467 21.195  74.908  1.00 34.50  ? 452  GLN A C     1 
ATOM   3541  O O     . GLN A 1 452 ? -19.190 20.725  76.018  1.00 33.62  ? 452  GLN A O     1 
ATOM   3542  C CB    . GLN A 1 452 ? -17.724 20.220  73.497  1.00 36.96  ? 452  GLN A CB    1 
ATOM   3543  C CG    . GLN A 1 452 ? -17.240 19.198  72.504  1.00 42.12  ? 452  GLN A CG    1 
ATOM   3544  C CD    . GLN A 1 452 ? -15.721 19.120  72.506  1.00 42.60  ? 452  GLN A CD    1 
ATOM   3545  O OE1   . GLN A 1 452 ? -15.116 18.698  73.501  1.00 43.84  ? 452  GLN A OE1   1 
ATOM   3546  N NE2   . GLN A 1 452 ? -15.096 19.551  71.403  1.00 47.79  ? 452  GLN A NE2   1 
ATOM   3547  N N     . LEU A 1 453 ? -19.940 22.431  74.723  1.00 33.17  ? 453  LEU A N     1 
ATOM   3548  C CA    . LEU A 1 453 ? -19.842 23.461  75.779  1.00 33.66  ? 453  LEU A CA    1 
ATOM   3549  C C     . LEU A 1 453 ? -20.556 23.055  77.060  1.00 32.33  ? 453  LEU A C     1 
ATOM   3550  O O     . LEU A 1 453 ? -19.996 23.189  78.132  1.00 33.06  ? 453  LEU A O     1 
ATOM   3551  C CB    . LEU A 1 453 ? -20.306 24.854  75.282  1.00 34.70  ? 453  LEU A CB    1 
ATOM   3552  C CG    . LEU A 1 453 ? -19.345 25.677  74.388  1.00 32.78  ? 453  LEU A CG    1 
ATOM   3553  C CD1   . LEU A 1 453 ? -19.975 27.015  73.975  1.00 38.17  ? 453  LEU A CD1   1 
ATOM   3554  C CD2   . LEU A 1 453 ? -18.026 25.932  75.042  1.00 36.79  ? 453  LEU A CD2   1 
ATOM   3555  N N     . GLN A 1 454 ? -21.757 22.495  76.933  1.00 33.34  ? 454  GLN A N     1 
ATOM   3556  C CA    . GLN A 1 454 ? -22.510 21.961  78.090  1.00 34.26  ? 454  GLN A CA    1 
ATOM   3557  C C     . GLN A 1 454 ? -21.742 20.905  78.909  1.00 32.87  ? 454  GLN A C     1 
ATOM   3558  O O     . GLN A 1 454 ? -21.719 20.974  80.164  1.00 32.62  ? 454  GLN A O     1 
ATOM   3559  C CB    . GLN A 1 454 ? -23.895 21.407  77.663  1.00 33.49  ? 454  GLN A CB    1 
ATOM   3560  C CG    . GLN A 1 454 ? -25.029 22.425  77.830  1.00 38.93  ? 454  GLN A CG    1 
ATOM   3561  C CD    . GLN A 1 454 ? -26.452 21.864  77.575  1.00 42.30  ? 454  GLN A CD    1 
ATOM   3562  O OE1   . GLN A 1 454 ? -27.274 22.535  76.942  1.00 48.10  ? 454  GLN A OE1   1 
ATOM   3563  N NE2   . GLN A 1 454 ? -26.744 20.654  78.087  1.00 37.65  ? 454  GLN A NE2   1 
ATOM   3564  N N     . ASP A 1 455 ? -21.116 19.952  78.205  1.00 31.91  ? 455  ASP A N     1 
ATOM   3565  C CA    . ASP A 1 455 ? -20.342 18.870  78.835  1.00 32.94  ? 455  ASP A CA    1 
ATOM   3566  C C     . ASP A 1 455 ? -19.117 19.396  79.519  1.00 31.67  ? 455  ASP A C     1 
ATOM   3567  O O     . ASP A 1 455 ? -18.708 18.833  80.529  1.00 30.09  ? 455  ASP A O     1 
ATOM   3568  C CB    . ASP A 1 455 ? -19.896 17.825  77.802  1.00 34.32  ? 455  ASP A CB    1 
ATOM   3569  C CG    . ASP A 1 455 ? -20.956 16.773  77.519  1.00 43.14  ? 455  ASP A CG    1 
ATOM   3570  O OD1   . ASP A 1 455 ? -21.782 16.465  78.425  1.00 49.35  ? 455  ASP A OD1   1 
ATOM   3571  O OD2   . ASP A 1 455 ? -20.944 16.237  76.384  1.00 50.59  ? 455  ASP A OD2   1 
ATOM   3572  N N     . LEU A 1 456 ? -18.540 20.476  78.979  1.00 31.61  ? 456  LEU A N     1 
ATOM   3573  C CA    . LEU A 1 456 ? -17.375 21.130  79.583  1.00 31.78  ? 456  LEU A CA    1 
ATOM   3574  C C     . LEU A 1 456 ? -17.742 21.832  80.887  1.00 30.11  ? 456  LEU A C     1 
ATOM   3575  O O     . LEU A 1 456 ? -17.055 21.695  81.908  1.00 28.86  ? 456  LEU A O     1 
ATOM   3576  C CB    . LEU A 1 456 ? -16.778 22.152  78.586  1.00 34.16  ? 456  LEU A CB    1 
ATOM   3577  C CG    . LEU A 1 456 ? -16.088 21.623  77.322  1.00 37.82  ? 456  LEU A CG    1 
ATOM   3578  C CD1   . LEU A 1 456 ? -15.745 22.714  76.292  1.00 36.52  ? 456  LEU A CD1   1 
ATOM   3579  C CD2   . LEU A 1 456 ? -14.826 20.827  77.730  1.00 39.68  ? 456  LEU A CD2   1 
ATOM   3580  N N     . HIS A 1 457 ? -18.856 22.572  80.848  1.00 31.64  ? 457  HIS A N     1 
ATOM   3581  C CA    . HIS A 1 457 ? -19.434 23.172  82.049  1.00 31.12  ? 457  HIS A CA    1 
ATOM   3582  C C     . HIS A 1 457 ? -19.782 22.129  83.109  1.00 31.44  ? 457  HIS A C     1 
ATOM   3583  O O     . HIS A 1 457 ? -19.457 22.327  84.277  1.00 31.86  ? 457  HIS A O     1 
ATOM   3584  C CB    . HIS A 1 457 ? -20.651 24.055  81.694  1.00 30.62  ? 457  HIS A CB    1 
ATOM   3585  C CG    . HIS A 1 457 ? -20.281 25.403  81.150  1.00 30.34  ? 457  HIS A CG    1 
ATOM   3586  N ND1   . HIS A 1 457 ? -19.663 26.365  81.913  1.00 24.04  ? 457  HIS A ND1   1 
ATOM   3587  C CD2   . HIS A 1 457 ? -20.475 25.965  79.929  1.00 33.54  ? 457  HIS A CD2   1 
ATOM   3588  C CE1   . HIS A 1 457 ? -19.465 27.451  81.185  1.00 34.05  ? 457  HIS A CE1   1 
ATOM   3589  N NE2   . HIS A 1 457 ? -19.939 27.231  79.972  1.00 32.73  ? 457  HIS A NE2   1 
ATOM   3590  N N     . LYS A 1 458 ? -20.419 21.029  82.699  1.00 32.97  ? 458  LYS A N     1 
ATOM   3591  C CA    . LYS A 1 458 ? -20.669 19.875  83.576  1.00 33.75  ? 458  LYS A CA    1 
ATOM   3592  C C     . LYS A 1 458 ? -19.390 19.279  84.171  1.00 33.38  ? 458  LYS A C     1 
ATOM   3593  O O     . LYS A 1 458 ? -19.389 18.862  85.320  1.00 33.62  ? 458  LYS A O     1 
ATOM   3594  C CB    . LYS A 1 458 ? -21.469 18.787  82.833  1.00 31.52  ? 458  LYS A CB    1 
ATOM   3595  C CG    . LYS A 1 458 ? -21.750 17.551  83.691  1.00 36.94  ? 458  LYS A CG    1 
ATOM   3596  C CD    . LYS A 1 458 ? -22.870 16.637  83.148  1.00 37.33  ? 458  LYS A CD    1 
ATOM   3597  C CE    . LYS A 1 458 ? -23.466 15.800  84.295  1.00 44.03  ? 458  LYS A CE    1 
ATOM   3598  N NZ    . LYS A 1 458 ? -24.218 14.589  83.874  1.00 49.13  ? 458  LYS A NZ    1 
ATOM   3599  N N     . LYS A 1 459 ? -18.321 19.253  83.379  1.00 34.67  ? 459  LYS A N     1 
ATOM   3600  C CA    . LYS A 1 459 ? -17.002 18.781  83.827  1.00 36.57  ? 459  LYS A CA    1 
ATOM   3601  C C     . LYS A 1 459 ? -16.462 19.555  85.028  1.00 34.75  ? 459  LYS A C     1 
ATOM   3602  O O     . LYS A 1 459 ? -15.991 18.961  85.993  1.00 33.32  ? 459  LYS A O     1 
ATOM   3603  C CB    . LYS A 1 459 ? -15.975 18.858  82.676  1.00 37.92  ? 459  LYS A CB    1 
ATOM   3604  C CG    . LYS A 1 459 ? -14.733 18.027  82.940  1.00 38.26  ? 459  LYS A CG    1 
ATOM   3605  C CD    . LYS A 1 459 ? -13.664 18.259  81.875  1.00 42.45  ? 459  LYS A CD    1 
ATOM   3606  C CE    . LYS A 1 459 ? -12.324 17.633  82.308  1.00 49.90  ? 459  LYS A CE    1 
ATOM   3607  N NZ    . LYS A 1 459 ? -11.317 17.635  81.208  1.00 52.96  ? 459  LYS A NZ    1 
ATOM   3608  N N     . ILE A 1 460 ? -16.528 20.883  84.959  1.00 33.99  ? 460  ILE A N     1 
ATOM   3609  C CA    . ILE A 1 460 ? -16.000 21.712  86.040  1.00 33.35  ? 460  ILE A CA    1 
ATOM   3610  C C     . ILE A 1 460 ? -16.799 21.522  87.336  1.00 32.42  ? 460  ILE A C     1 
ATOM   3611  O O     . ILE A 1 460 ? -16.224 21.517  88.441  1.00 32.60  ? 460  ILE A O     1 
ATOM   3612  C CB    . ILE A 1 460 ? -15.846 23.227  85.642  1.00 31.79  ? 460  ILE A CB    1 
ATOM   3613  C CG1   . ILE A 1 460 ? -15.022 23.972  86.692  1.00 31.38  ? 460  ILE A CG1   1 
ATOM   3614  C CG2   . ILE A 1 460 ? -17.179 23.928  85.409  1.00 31.94  ? 460  ILE A CG2   1 
ATOM   3615  C CD1   . ILE A 1 460 ? -14.293 25.164  86.143  1.00 32.61  ? 460  ILE A CD1   1 
ATOM   3616  N N     . ILE A 1 461 ? -18.106 21.323  87.209  1.00 31.89  ? 461  ILE A N     1 
ATOM   3617  C CA    . ILE A 1 461 ? -18.950 21.092  88.393  1.00 33.31  ? 461  ILE A CA    1 
ATOM   3618  C C     . ILE A 1 461 ? -18.644 19.727  89.026  1.00 33.91  ? 461  ILE A C     1 
ATOM   3619  O O     . ILE A 1 461 ? -18.534 19.605  90.246  1.00 33.49  ? 461  ILE A O     1 
ATOM   3620  C CB    . ILE A 1 461 ? -20.454 21.187  88.047  1.00 31.62  ? 461  ILE A CB    1 
ATOM   3621  C CG1   . ILE A 1 461 ? -20.821 22.611  87.557  1.00 30.34  ? 461  ILE A CG1   1 
ATOM   3622  C CG2   . ILE A 1 461 ? -21.342 20.717  89.232  1.00 32.46  ? 461  ILE A CG2   1 
ATOM   3623  C CD1   . ILE A 1 461 ? -20.375 23.756  88.411  1.00 29.24  ? 461  ILE A CD1   1 
ATOM   3624  N N     . THR A 1 462 ? -18.518 18.715  88.171  1.00 36.17  ? 462  THR A N     1 
ATOM   3625  C CA    . THR A 1 462 ? -18.126 17.368  88.576  1.00 36.76  ? 462  THR A CA    1 
ATOM   3626  C C     . THR A 1 462 ? -16.783 17.378  89.321  1.00 36.75  ? 462  THR A C     1 
ATOM   3627  O O     . THR A 1 462 ? -16.652 16.783  90.391  1.00 37.88  ? 462  THR A O     1 
ATOM   3628  C CB    . THR A 1 462 ? -18.088 16.458  87.311  1.00 39.27  ? 462  THR A CB    1 
ATOM   3629  O OG1   . THR A 1 462 ? -19.319 16.599  86.582  1.00 41.61  ? 462  THR A OG1   1 
ATOM   3630  C CG2   . THR A 1 462 ? -17.914 14.996  87.683  1.00 40.98  ? 462  THR A CG2   1 
ATOM   3631  N N     . GLN A 1 463 ? -15.813 18.111  88.779  1.00 36.04  ? 463  GLN A N     1 
ATOM   3632  C CA    . GLN A 1 463 ? -14.483 18.188  89.369  1.00 35.29  ? 463  GLN A CA    1 
ATOM   3633  C C     . GLN A 1 463 ? -14.489 19.031  90.620  1.00 34.56  ? 463  GLN A C     1 
ATOM   3634  O O     . GLN A 1 463 ? -13.790 18.712  91.583  1.00 32.92  ? 463  GLN A O     1 
ATOM   3635  C CB    . GLN A 1 463 ? -13.504 18.708  88.326  1.00 38.40  ? 463  GLN A CB    1 
ATOM   3636  C CG    . GLN A 1 463 ? -13.324 17.707  87.171  1.00 38.00  ? 463  GLN A CG    1 
ATOM   3637  C CD    . GLN A 1 463 ? -12.715 16.410  87.650  1.00 42.30  ? 463  GLN A CD    1 
ATOM   3638  O OE1   . GLN A 1 463 ? -13.196 15.308  87.332  1.00 38.68  ? 463  GLN A OE1   1 
ATOM   3639  N NE2   . GLN A 1 463 ? -11.659 16.531  88.449  1.00 41.66  ? 463  GLN A NE2   1 
ATOM   3640  N N     . PHE A 1 464 ? -15.276 20.106  90.618  1.00 34.62  ? 464  PHE A N     1 
ATOM   3641  C CA    . PHE A 1 464 ? -15.418 20.945  91.810  1.00 35.95  ? 464  PHE A CA    1 
ATOM   3642  C C     . PHE A 1 464 ? -15.953 20.133  93.003  1.00 36.72  ? 464  PHE A C     1 
ATOM   3643  O O     . PHE A 1 464 ? -15.488 20.288  94.117  1.00 38.06  ? 464  PHE A O     1 
ATOM   3644  C CB    . PHE A 1 464 ? -16.304 22.170  91.523  1.00 33.76  ? 464  PHE A CB    1 
ATOM   3645  C CG    . PHE A 1 464 ? -16.712 22.902  92.751  1.00 32.02  ? 464  PHE A CG    1 
ATOM   3646  C CD1   . PHE A 1 464 ? -17.844 22.506  93.471  1.00 29.50  ? 464  PHE A CD1   1 
ATOM   3647  C CD2   . PHE A 1 464 ? -15.935 23.938  93.240  1.00 33.48  ? 464  PHE A CD2   1 
ATOM   3648  C CE1   . PHE A 1 464 ? -18.188 23.144  94.638  1.00 29.71  ? 464  PHE A CE1   1 
ATOM   3649  C CE2   . PHE A 1 464 ? -16.278 24.591  94.415  1.00 31.06  ? 464  PHE A CE2   1 
ATOM   3650  C CZ    . PHE A 1 464 ? -17.411 24.195  95.113  1.00 33.91  ? 464  PHE A CZ    1 
ATOM   3651  N N     . GLN A 1 465 ? -16.928 19.275  92.757  1.00 39.83  ? 465  GLN A N     1 
ATOM   3652  C CA    . GLN A 1 465 ? -17.528 18.441  93.802  1.00 43.38  ? 465  GLN A CA    1 
ATOM   3653  C C     . GLN A 1 465 ? -16.599 17.353  94.402  1.00 46.46  ? 465  GLN A C     1 
ATOM   3654  O O     . GLN A 1 465 ? -17.004 16.660  95.339  1.00 48.39  ? 465  GLN A O     1 
ATOM   3655  C CB    . GLN A 1 465 ? -18.831 17.811  93.265  1.00 43.86  ? 465  GLN A CB    1 
ATOM   3656  C CG    . GLN A 1 465 ? -19.971 18.834  92.994  1.00 43.03  ? 465  GLN A CG    1 
ATOM   3657  C CD    . GLN A 1 465 ? -21.259 18.248  92.325  1.00 47.59  ? 465  GLN A CD    1 
ATOM   3658  O OE1   . GLN A 1 465 ? -21.234 17.186  91.659  1.00 51.89  ? 465  GLN A OE1   1 
ATOM   3659  N NE2   . GLN A 1 465 ? -22.386 18.968  92.490  1.00 46.53  ? 465  GLN A NE2   1 
ATOM   3660  N N     . ARG A 1 466 ? -15.362 17.223  93.898  1.00 49.05  ? 466  ARG A N     1 
ATOM   3661  C CA    . ARG A 1 466 ? -14.343 16.326  94.501  1.00 50.21  ? 466  ARG A CA    1 
ATOM   3662  C C     . ARG A 1 466 ? -13.263 17.076  95.302  1.00 50.39  ? 466  ARG A C     1 
ATOM   3663  O O     . ARG A 1 466 ? -12.446 16.451  95.992  1.00 50.13  ? 466  ARG A O     1 
ATOM   3664  C CB    . ARG A 1 466 ? -13.658 15.502  93.415  1.00 51.68  ? 466  ARG A CB    1 
ATOM   3665  C CG    . ARG A 1 466 ? -14.541 15.199  92.252  1.00 54.90  ? 466  ARG A CG    1 
ATOM   3666  C CD    . ARG A 1 466 ? -14.096 13.963  91.555  1.00 59.24  ? 466  ARG A CD    1 
ATOM   3667  N NE    . ARG A 1 466 ? -15.145 13.499  90.663  1.00 69.97  ? 466  ARG A NE    1 
ATOM   3668  C CZ    . ARG A 1 466 ? -15.271 12.246  90.235  1.00 75.93  ? 466  ARG A CZ    1 
ATOM   3669  N NH1   . ARG A 1 466 ? -14.399 11.303  90.598  1.00 78.10  ? 466  ARG A NH1   1 
ATOM   3670  N NH2   . ARG A 1 466 ? -16.278 11.938  89.430  1.00 75.40  ? 466  ARG A NH2   1 
ATOM   3671  N N     . TYR A 1 467 ? -13.232 18.402  95.180  1.00 50.69  ? 467  TYR A N     1 
ATOM   3672  C CA    . TYR A 1 467 ? -12.288 19.225  95.925  1.00 50.49  ? 467  TYR A CA    1 
ATOM   3673  C C     . TYR A 1 467 ? -12.990 20.073  96.982  1.00 50.34  ? 467  TYR A C     1 
ATOM   3674  O O     . TYR A 1 467 ? -12.389 20.415  98.009  1.00 49.47  ? 467  TYR A O     1 
ATOM   3675  C CB    . TYR A 1 467 ? -11.501 20.104  94.956  1.00 53.07  ? 467  TYR A CB    1 
ATOM   3676  C CG    . TYR A 1 467 ? -10.391 19.356  94.218  1.00 54.52  ? 467  TYR A CG    1 
ATOM   3677  C CD1   . TYR A 1 467 ? -10.667 18.601  93.070  1.00 56.06  ? 467  TYR A CD1   1 
ATOM   3678  C CD2   . TYR A 1 467 ? -9.063  19.416  94.664  1.00 57.78  ? 467  TYR A CD2   1 
ATOM   3679  C CE1   . TYR A 1 467 ? -9.649  17.921  92.378  1.00 57.68  ? 467  TYR A CE1   1 
ATOM   3680  C CE2   . TYR A 1 467 ? -8.029  18.741  93.979  1.00 57.91  ? 467  TYR A CE2   1 
ATOM   3681  C CZ    . TYR A 1 467 ? -8.329  17.995  92.838  1.00 58.74  ? 467  TYR A CZ    1 
ATOM   3682  O OH    . TYR A 1 467 ? -7.318  17.334  92.156  1.00 58.99  ? 467  TYR A OH    1 
ATOM   3683  N N     . HIS A 1 468 ? -14.254 20.413  96.729  1.00 49.01  ? 468  HIS A N     1 
ATOM   3684  C CA    . HIS A 1 468 ? -14.988 21.304  97.602  1.00 47.76  ? 468  HIS A CA    1 
ATOM   3685  C C     . HIS A 1 468 ? -16.432 20.859  97.840  1.00 45.60  ? 468  HIS A C     1 
ATOM   3686  O O     . HIS A 1 468 ? -16.990 19.989  97.150  1.00 43.02  ? 468  HIS A O     1 
ATOM   3687  C CB    . HIS A 1 468 ? -15.007 22.709  96.989  1.00 48.48  ? 468  HIS A CB    1 
ATOM   3688  C CG    . HIS A 1 468 ? -13.672 23.387  96.947  1.00 51.89  ? 468  HIS A CG    1 
ATOM   3689  N ND1   . HIS A 1 468 ? -13.059 23.896  98.073  1.00 52.32  ? 468  HIS A ND1   1 
ATOM   3690  C CD2   . HIS A 1 468 ? -12.858 23.689  95.905  1.00 51.69  ? 468  HIS A CD2   1 
ATOM   3691  C CE1   . HIS A 1 468 ? -11.911 24.458  97.730  1.00 53.15  ? 468  HIS A CE1   1 
ATOM   3692  N NE2   . HIS A 1 468 ? -11.765 24.345  96.420  1.00 50.31  ? 468  HIS A NE2   1 
ATOM   3693  N N     . GLN A 1 469 ? -17.002 21.476  98.864  1.00 45.89  ? 469  GLN A N     1 
ATOM   3694  C CA    . GLN A 1 469 ? -18.430 21.585  99.043  1.00 46.98  ? 469  GLN A CA    1 
ATOM   3695  C C     . GLN A 1 469 ? -18.721 23.084  99.132  1.00 44.72  ? 469  GLN A C     1 
ATOM   3696  O O     . GLN A 1 469 ? -17.887 23.857  99.617  1.00 41.92  ? 469  GLN A O     1 
ATOM   3697  C CB    . GLN A 1 469 ? -18.856 20.895  100.335 1.00 47.64  ? 469  GLN A CB    1 
ATOM   3698  C CG    . GLN A 1 469 ? -18.660 19.373  100.334 1.00 49.96  ? 469  GLN A CG    1 
ATOM   3699  C CD    . GLN A 1 469 ? -18.673 18.787  101.749 1.00 53.43  ? 469  GLN A CD    1 
ATOM   3700  O OE1   . GLN A 1 469 ? -17.959 19.267  102.647 1.00 66.56  ? 469  GLN A OE1   1 
ATOM   3701  N NE2   . GLN A 1 469 ? -19.503 17.763  101.960 1.00 58.51  ? 469  GLN A NE2   1 
ATOM   3702  N N     . PRO A 1 470 ? -19.888 23.515  98.639  1.00 44.95  ? 470  PRO A N     1 
ATOM   3703  C CA    . PRO A 1 470 ? -20.295 24.910  98.817  1.00 45.56  ? 470  PRO A CA    1 
ATOM   3704  C C     . PRO A 1 470 ? -20.056 25.481  100.228 1.00 45.12  ? 470  PRO A C     1 
ATOM   3705  O O     . PRO A 1 470 ? -19.534 26.593  100.360 1.00 45.13  ? 470  PRO A O     1 
ATOM   3706  C CB    . PRO A 1 470 ? -21.793 24.867  98.519  1.00 45.73  ? 470  PRO A CB    1 
ATOM   3707  C CG    . PRO A 1 470 ? -21.944 23.725  97.549  1.00 47.64  ? 470  PRO A CG    1 
ATOM   3708  C CD    . PRO A 1 470 ? -20.863 22.734  97.851  1.00 45.29  ? 470  PRO A CD    1 
ATOM   3709  N N     . HIS A 1 471 ? -20.438 24.729  101.265 1.00 46.12  ? 471  HIS A N     1 
ATOM   3710  C CA    . HIS A 1 471 ? -20.282 25.179  102.678 1.00 47.47  ? 471  HIS A CA    1 
ATOM   3711  C C     . HIS A 1 471 ? -18.827 25.186  103.175 1.00 47.52  ? 471  HIS A C     1 
ATOM   3712  O O     . HIS A 1 471 ? -18.508 25.791  104.201 1.00 47.26  ? 471  HIS A O     1 
ATOM   3713  C CB    . HIS A 1 471 ? -21.138 24.322  103.633 1.00 48.29  ? 471  HIS A CB    1 
ATOM   3714  C CG    . HIS A 1 471 ? -20.780 22.864  103.640 1.00 52.80  ? 471  HIS A CG    1 
ATOM   3715  N ND1   . HIS A 1 471 ? -21.307 21.962  102.738 1.00 56.95  ? 471  HIS A ND1   1 
ATOM   3716  C CD2   . HIS A 1 471 ? -19.957 22.150  104.447 1.00 52.86  ? 471  HIS A CD2   1 
ATOM   3717  C CE1   . HIS A 1 471 ? -20.825 20.756  102.989 1.00 54.32  ? 471  HIS A CE1   1 
ATOM   3718  N NE2   . HIS A 1 471 ? -19.996 20.843  104.015 1.00 51.37  ? 471  HIS A NE2   1 
ATOM   3719  N N     . THR A 1 472 ? -17.960 24.515  102.420 1.00 48.50  ? 472  THR A N     1 
ATOM   3720  C CA    . THR A 1 472 ? -16.528 24.367  102.722 1.00 47.97  ? 472  THR A CA    1 
ATOM   3721  C C     . THR A 1 472 ? -15.667 25.548  102.206 1.00 49.21  ? 472  THR A C     1 
ATOM   3722  O O     . THR A 1 472 ? -14.465 25.624  102.464 1.00 49.68  ? 472  THR A O     1 
ATOM   3723  C CB    . THR A 1 472 ? -16.041 23.009  102.106 1.00 47.84  ? 472  THR A CB    1 
ATOM   3724  O OG1   . THR A 1 472 ? -16.156 21.972  103.089 1.00 50.31  ? 472  THR A OG1   1 
ATOM   3725  C CG2   . THR A 1 472 ? -14.608 23.050  101.549 1.00 49.22  ? 472  THR A CG2   1 
ATOM   3726  N N     . LEU A 1 473 ? -16.285 26.468  101.477 1.00 48.09  ? 473  LEU A N     1 
ATOM   3727  C CA    . LEU A 1 473 ? -15.572 27.564  100.827 1.00 47.17  ? 473  LEU A CA    1 
ATOM   3728  C C     . LEU A 1 473 ? -15.209 28.692  101.790 1.00 46.43  ? 473  LEU A C     1 
ATOM   3729  O O     . LEU A 1 473 ? -16.066 29.158  102.531 1.00 47.08  ? 473  LEU A O     1 
ATOM   3730  C CB    . LEU A 1 473 ? -16.475 28.117  99.718  1.00 47.83  ? 473  LEU A CB    1 
ATOM   3731  C CG    . LEU A 1 473 ? -15.835 28.955  98.629  1.00 46.28  ? 473  LEU A CG    1 
ATOM   3732  C CD1   . LEU A 1 473 ? -14.846 28.112  97.830  1.00 47.07  ? 473  LEU A CD1   1 
ATOM   3733  C CD2   . LEU A 1 473 ? -16.925 29.420  97.714  1.00 47.94  ? 473  LEU A CD2   1 
ATOM   3734  N N     . SER A 1 474 ? -13.958 29.162  101.739 1.00 45.02  ? 474  SER A N     1 
ATOM   3735  C CA    . SER A 1 474 ? -13.451 30.194  102.660 1.00 46.40  ? 474  SER A CA    1 
ATOM   3736  C C     . SER A 1 474 ? -12.516 31.187  101.947 1.00 44.95  ? 474  SER A C     1 
ATOM   3737  O O     . SER A 1 474 ? -11.684 30.753  101.179 1.00 43.08  ? 474  SER A O     1 
ATOM   3738  C CB    . SER A 1 474 ? -12.673 29.515  103.797 1.00 49.24  ? 474  SER A CB    1 
ATOM   3739  O OG    . SER A 1 474 ? -11.543 28.788  103.296 1.00 53.22  ? 474  SER A OG    1 
ATOM   3740  N N     . PRO A 1 475 ? -12.604 32.508  102.244 1.00 46.60  ? 475  PRO A N     1 
ATOM   3741  C CA    . PRO A 1 475 ? -11.911 33.518  101.426 1.00 47.43  ? 475  PRO A CA    1 
ATOM   3742  C C     . PRO A 1 475 ? -10.374 33.576  101.514 1.00 48.71  ? 475  PRO A C     1 
ATOM   3743  O O     . PRO A 1 475 ? -9.747  34.368  100.791 1.00 49.32  ? 475  PRO A O     1 
ATOM   3744  C CB    . PRO A 1 475 ? -12.514 34.862  101.881 1.00 46.92  ? 475  PRO A CB    1 
ATOM   3745  C CG    . PRO A 1 475 ? -13.507 34.555  102.882 1.00 47.39  ? 475  PRO A CG    1 
ATOM   3746  C CD    . PRO A 1 475 ? -13.332 33.145  103.349 1.00 49.26  ? 475  PRO A CD    1 
ATOM   3747  N N     . ASP A 1 476 ? -9.769  32.792  102.398 1.00 48.28  ? 476  ASP A N     1 
ATOM   3748  C CA    . ASP A 1 476 ? -8.307  32.649  102.382 1.00 47.68  ? 476  ASP A CA    1 
ATOM   3749  C C     . ASP A 1 476 ? -7.853  31.886  101.130 1.00 47.78  ? 476  ASP A C     1 
ATOM   3750  O O     . ASP A 1 476 ? -6.740  32.098  100.654 1.00 49.66  ? 476  ASP A O     1 
ATOM   3751  C CB    . ASP A 1 476 ? -7.786  31.976  103.658 1.00 45.50  ? 476  ASP A CB    1 
ATOM   3752  C CG    . ASP A 1 476 ? -8.584  30.741  104.029 1.00 47.78  ? 476  ASP A CG    1 
ATOM   3753  O OD1   . ASP A 1 476 ? -9.818  30.886  104.295 1.00 46.88  ? 476  ASP A OD1   1 
ATOM   3754  O OD2   . ASP A 1 476 ? -7.972  29.636  104.056 1.00 47.90  ? 476  ASP A OD2   1 
ATOM   3755  N N     . GLN A 1 477 ? -8.698  31.004  100.593 1.00 47.37  ? 477  GLN A N     1 
ATOM   3756  C CA    . GLN A 1 477 ? -8.268  30.172  99.473  1.00 47.75  ? 477  GLN A CA    1 
ATOM   3757  C C     . GLN A 1 477 ? -8.452  30.905  98.120  1.00 46.29  ? 477  GLN A C     1 
ATOM   3758  O O     . GLN A 1 477 ? -9.402  31.681  97.928  1.00 43.70  ? 477  GLN A O     1 
ATOM   3759  C CB    . GLN A 1 477 ? -8.913  28.795  99.567  1.00 47.87  ? 477  GLN A CB    1 
ATOM   3760  C CG    . GLN A 1 477 ? -10.384 28.774  99.298  1.00 55.64  ? 477  GLN A CG    1 
ATOM   3761  C CD    . GLN A 1 477 ? -11.123 27.737  100.132 1.00 54.07  ? 477  GLN A CD    1 
ATOM   3762  O OE1   . GLN A 1 477 ? -12.192 28.025  100.668 1.00 59.94  ? 477  GLN A OE1   1 
ATOM   3763  N NE2   . GLN A 1 477 ? -10.562 26.523  100.235 1.00 57.48  ? 477  GLN A NE2   1 
ATOM   3764  N N     . GLU A 1 478 ? -7.502  30.680  97.209  1.00 45.92  ? 478  GLU A N     1 
ATOM   3765  C CA    . GLU A 1 478 ? -7.290  31.537  96.016  1.00 45.56  ? 478  GLU A CA    1 
ATOM   3766  C C     . GLU A 1 478 ? -8.466  31.526  94.999  1.00 42.90  ? 478  GLU A C     1 
ATOM   3767  O O     . GLU A 1 478 ? -8.670  32.514  94.264  1.00 40.72  ? 478  GLU A O     1 
ATOM   3768  C CB    . GLU A 1 478 ? -5.957  31.140  95.317  1.00 46.56  ? 478  GLU A CB    1 
ATOM   3769  C CG    . GLU A 1 478 ? -6.066  30.728  93.802  1.00 50.71  ? 478  GLU A CG    1 
ATOM   3770  C CD    . GLU A 1 478 ? -4.742  30.193  93.180  1.00 51.84  ? 478  GLU A CD    1 
ATOM   3771  O OE1   . GLU A 1 478 ? -3.662  30.707  93.548  1.00 66.26  ? 478  GLU A OE1   1 
ATOM   3772  O OE2   . GLU A 1 478 ? -4.784  29.293  92.295  1.00 41.76  ? 478  GLU A OE2   1 
ATOM   3773  N N     . ASP A 1 479 ? -9.203  30.405  94.965  1.00 39.50  ? 479  ASP A N     1 
ATOM   3774  C CA    . ASP A 1 479 ? -10.313 30.184  94.026  1.00 39.81  ? 479  ASP A CA    1 
ATOM   3775  C C     . ASP A 1 479 ? -11.684 30.532  94.639  1.00 39.42  ? 479  ASP A C     1 
ATOM   3776  O O     . ASP A 1 479 ? -12.721 30.350  94.000  1.00 36.75  ? 479  ASP A O     1 
ATOM   3777  C CB    . ASP A 1 479 ? -10.316 28.719  93.530  1.00 37.90  ? 479  ASP A CB    1 
ATOM   3778  C CG    . ASP A 1 479 ? -10.165 27.710  94.678  1.00 38.33  ? 479  ASP A CG    1 
ATOM   3779  O OD1   . ASP A 1 479 ? -9.758  28.164  95.761  1.00 38.08  ? 479  ASP A OD1   1 
ATOM   3780  O OD2   . ASP A 1 479 ? -10.421 26.486  94.508  1.00 31.45  ? 479  ASP A OD2   1 
ATOM   3781  N N     . CYS A 1 480 ? -11.688 31.036  95.871  1.00 38.98  ? 480  CYS A N     1 
ATOM   3782  C CA    . CYS A 1 480 ? -12.928 31.185  96.633  1.00 37.65  ? 480  CYS A CA    1 
ATOM   3783  C C     . CYS A 1 480 ? -13.949 32.052  95.928  1.00 33.62  ? 480  CYS A C     1 
ATOM   3784  O O     . CYS A 1 480 ? -15.097 31.673  95.776  1.00 33.73  ? 480  CYS A O     1 
ATOM   3785  C CB    . CYS A 1 480 ? -12.635 31.794  98.024  1.00 38.51  ? 480  CYS A CB    1 
ATOM   3786  S SG    . CYS A 1 480 ? -14.099 32.319  98.938  1.00 41.92  ? 480  CYS A SG    1 
ATOM   3787  N N     . MET A 1 481 ? -13.521 33.235  95.542  1.00 30.01  ? 481  MET A N     1 
ATOM   3788  C CA    . MET A 1 481 ? -14.405 34.179  94.904  1.00 32.48  ? 481  MET A CA    1 
ATOM   3789  C C     . MET A 1 481 ? -14.794 33.724  93.497  1.00 33.63  ? 481  MET A C     1 
ATOM   3790  O O     . MET A 1 481 ? -15.806 34.171  92.969  1.00 33.52  ? 481  MET A O     1 
ATOM   3791  C CB    . MET A 1 481 ? -13.737 35.556  94.808  1.00 35.21  ? 481  MET A CB    1 
ATOM   3792  C CG    . MET A 1 481 ? -13.588 36.278  96.132  1.00 41.15  ? 481  MET A CG    1 
ATOM   3793  S SD    . MET A 1 481 ? -15.142 36.416  97.034  1.00 54.07  ? 481  MET A SD    1 
ATOM   3794  C CE    . MET A 1 481 ? -16.174 37.206  95.817  1.00 56.04  ? 481  MET A CE    1 
ATOM   3795  N N     . TYR A 1 482 ? -13.955 32.898  92.865  1.00 31.93  ? 482  TYR A N     1 
ATOM   3796  C CA    . TYR A 1 482 ? -14.316 32.350  91.586  1.00 31.70  ? 482  TYR A CA    1 
ATOM   3797  C C     . TYR A 1 482 ? -15.598 31.543  91.764  1.00 31.28  ? 482  TYR A C     1 
ATOM   3798  O O     . TYR A 1 482 ? -16.540 31.692  90.993  1.00 31.29  ? 482  TYR A O     1 
ATOM   3799  C CB    . TYR A 1 482 ? -13.224 31.474  90.962  1.00 30.73  ? 482  TYR A CB    1 
ATOM   3800  C CG    . TYR A 1 482 ? -13.649 31.015  89.587  1.00 31.22  ? 482  TYR A CG    1 
ATOM   3801  C CD1   . TYR A 1 482 ? -14.445 29.872  89.417  1.00 28.20  ? 482  TYR A CD1   1 
ATOM   3802  C CD2   . TYR A 1 482 ? -13.320 31.770  88.449  1.00 30.56  ? 482  TYR A CD2   1 
ATOM   3803  C CE1   . TYR A 1 482 ? -14.874 29.467  88.123  1.00 25.73  ? 482  TYR A CE1   1 
ATOM   3804  C CE2   . TYR A 1 482 ? -13.753 31.377  87.153  1.00 29.91  ? 482  TYR A CE2   1 
ATOM   3805  C CZ    . TYR A 1 482 ? -14.519 30.236  87.014  1.00 30.72  ? 482  TYR A CZ    1 
ATOM   3806  O OH    . TYR A 1 482 ? -14.948 29.890  85.761  1.00 34.94  ? 482  TYR A OH    1 
ATOM   3807  N N     . TRP A 1 483 ? -15.625 30.693  92.776  1.00 30.95  ? 483  TRP A N     1 
ATOM   3808  C CA    . TRP A 1 483 ? -16.747 29.783  92.949  1.00 30.32  ? 483  TRP A CA    1 
ATOM   3809  C C     . TRP A 1 483 ? -17.994 30.503  93.452  1.00 29.16  ? 483  TRP A C     1 
ATOM   3810  O O     . TRP A 1 483 ? -19.076 30.248  92.962  1.00 31.19  ? 483  TRP A O     1 
ATOM   3811  C CB    . TRP A 1 483 ? -16.374 28.627  93.841  1.00 31.06  ? 483  TRP A CB    1 
ATOM   3812  C CG    . TRP A 1 483 ? -15.273 27.772  93.302  1.00 32.15  ? 483  TRP A CG    1 
ATOM   3813  C CD1   . TRP A 1 483 ? -14.069 27.494  93.916  1.00 35.19  ? 483  TRP A CD1   1 
ATOM   3814  C CD2   . TRP A 1 483 ? -15.264 27.042  92.068  1.00 35.18  ? 483  TRP A CD2   1 
ATOM   3815  N NE1   . TRP A 1 483 ? -13.326 26.643  93.133  1.00 34.24  ? 483  TRP A NE1   1 
ATOM   3816  C CE2   . TRP A 1 483 ? -14.029 26.366  91.990  1.00 30.21  ? 483  TRP A CE2   1 
ATOM   3817  C CE3   . TRP A 1 483 ? -16.175 26.905  91.010  1.00 35.00  ? 483  TRP A CE3   1 
ATOM   3818  C CZ2   . TRP A 1 483 ? -13.697 25.558  90.923  1.00 31.40  ? 483  TRP A CZ2   1 
ATOM   3819  C CZ3   . TRP A 1 483 ? -15.835 26.106  89.959  1.00 33.28  ? 483  TRP A CZ3   1 
ATOM   3820  C CH2   . TRP A 1 483 ? -14.606 25.439  89.919  1.00 32.61  ? 483  TRP A CH2   1 
ATOM   3821  N N     . TYR A 1 484 ? -17.866 31.444  94.379  1.00 31.16  ? 484  TYR A N     1 
ATOM   3822  C CA    . TYR A 1 484 ? -19.046 32.253  94.771  1.00 31.18  ? 484  TYR A CA    1 
ATOM   3823  C C     . TYR A 1 484 ? -19.636 32.969  93.568  1.00 31.16  ? 484  TYR A C     1 
ATOM   3824  O O     . TYR A 1 484 ? -20.852 33.031  93.401  1.00 31.88  ? 484  TYR A O     1 
ATOM   3825  C CB    . TYR A 1 484 ? -18.718 33.283  95.873  1.00 31.89  ? 484  TYR A CB    1 
ATOM   3826  C CG    . TYR A 1 484 ? -18.812 32.688  97.263  1.00 34.42  ? 484  TYR A CG    1 
ATOM   3827  C CD1   . TYR A 1 484 ? -20.047 32.329  97.809  1.00 30.11  ? 484  TYR A CD1   1 
ATOM   3828  C CD2   . TYR A 1 484 ? -17.670 32.453  98.024  1.00 37.18  ? 484  TYR A CD2   1 
ATOM   3829  C CE1   . TYR A 1 484 ? -20.143 31.767  99.075  1.00 31.64  ? 484  TYR A CE1   1 
ATOM   3830  C CE2   . TYR A 1 484 ? -17.765 31.877  99.304  1.00 36.64  ? 484  TYR A CE2   1 
ATOM   3831  C CZ    . TYR A 1 484 ? -19.002 31.543  99.815  1.00 29.60  ? 484  TYR A CZ    1 
ATOM   3832  O OH    . TYR A 1 484 ? -19.087 30.990  101.069 1.00 34.70  ? 484  TYR A OH    1 
ATOM   3833  N N     . ASN A 1 485 ? -18.761 33.494  92.723  1.00 31.58  ? 485  ASN A N     1 
ATOM   3834  C CA    . ASN A 1 485 ? -19.174 34.239  91.556  1.00 30.05  ? 485  ASN A CA    1 
ATOM   3835  C C     . ASN A 1 485 ? -19.756 33.383  90.426  1.00 29.23  ? 485  ASN A C     1 
ATOM   3836  O O     . ASN A 1 485 ? -20.678 33.830  89.721  1.00 28.19  ? 485  ASN A O     1 
ATOM   3837  C CB    . ASN A 1 485 ? -18.001 35.070  91.025  1.00 28.35  ? 485  ASN A CB    1 
ATOM   3838  C CG    . ASN A 1 485 ? -17.652 36.261  91.929  1.00 34.87  ? 485  ASN A CG    1 
ATOM   3839  O OD1   . ASN A 1 485 ? -18.413 36.636  92.828  1.00 36.71  ? 485  ASN A OD1   1 
ATOM   3840  N ND2   . ASN A 1 485 ? -16.504 36.890  91.653  1.00 32.12  ? 485  ASN A ND2   1 
ATOM   3841  N N     . PHE A 1 486 ? -19.225 32.166  90.253  1.00 28.17  ? 486  PHE A N     1 
ATOM   3842  C CA    . PHE A 1 486 ? -19.436 31.413  89.019  1.00 27.57  ? 486  PHE A CA    1 
ATOM   3843  C C     . PHE A 1 486 ? -19.868 29.972  89.183  1.00 27.28  ? 486  PHE A C     1 
ATOM   3844  O O     . PHE A 1 486 ? -20.025 29.282  88.171  1.00 29.01  ? 486  PHE A O     1 
ATOM   3845  C CB    . PHE A 1 486 ? -18.177 31.442  88.142  1.00 27.92  ? 486  PHE A CB    1 
ATOM   3846  C CG    . PHE A 1 486 ? -17.708 32.835  87.801  1.00 27.99  ? 486  PHE A CG    1 
ATOM   3847  C CD1   . PHE A 1 486 ? -18.549 33.711  87.132  1.00 32.80  ? 486  PHE A CD1   1 
ATOM   3848  C CD2   . PHE A 1 486 ? -16.465 33.269  88.159  1.00 23.66  ? 486  PHE A CD2   1 
ATOM   3849  C CE1   . PHE A 1 486 ? -18.157 34.998  86.854  1.00 31.43  ? 486  PHE A CE1   1 
ATOM   3850  C CE2   . PHE A 1 486 ? -16.059 34.548  87.875  1.00 31.04  ? 486  PHE A CE2   1 
ATOM   3851  C CZ    . PHE A 1 486 ? -16.911 35.420  87.216  1.00 32.65  ? 486  PHE A CZ    1 
ATOM   3852  N N     . LEU A 1 487 ? -20.106 29.502  90.404  1.00 26.46  ? 487  LEU A N     1 
ATOM   3853  C CA    . LEU A 1 487 ? -20.555 28.110  90.580  1.00 28.36  ? 487  LEU A CA    1 
ATOM   3854  C C     . LEU A 1 487 ? -21.932 27.895  89.938  1.00 27.36  ? 487  LEU A C     1 
ATOM   3855  O O     . LEU A 1 487 ? -22.162 26.942  89.183  1.00 30.26  ? 487  LEU A O     1 
ATOM   3856  C CB    . LEU A 1 487 ? -20.649 27.722  92.058  1.00 28.95  ? 487  LEU A CB    1 
ATOM   3857  C CG    . LEU A 1 487 ? -20.078 26.390  92.530  1.00 32.67  ? 487  LEU A CG    1 
ATOM   3858  C CD1   . LEU A 1 487 ? -20.783 25.954  93.820  1.00 37.79  ? 487  LEU A CD1   1 
ATOM   3859  C CD2   . LEU A 1 487 ? -20.150 25.313  91.503  1.00 40.53  ? 487  LEU A CD2   1 
ATOM   3860  N N     . ALA A 1 488 ? -22.836 28.810  90.245  1.00 27.59  ? 488  ALA A N     1 
ATOM   3861  C CA    . ALA A 1 488 ? -24.181 28.773  89.716  1.00 28.60  ? 488  ALA A CA    1 
ATOM   3862  C C     . ALA A 1 488 ? -24.196 28.982  88.205  1.00 28.49  ? 488  ALA A C     1 
ATOM   3863  O O     . ALA A 1 488 ? -24.955 28.306  87.476  1.00 29.73  ? 488  ALA A O     1 
ATOM   3864  C CB    . ALA A 1 488 ? -25.040 29.802  90.397  1.00 28.59  ? 488  ALA A CB    1 
ATOM   3865  N N     . TYR A 1 489 ? -23.350 29.894  87.751  1.00 27.99  ? 489  TYR A N     1 
ATOM   3866  C CA    . TYR A 1 489 ? -23.170 30.130  86.338  1.00 28.14  ? 489  TYR A CA    1 
ATOM   3867  C C     . TYR A 1 489 ? -22.801 28.852  85.587  1.00 28.24  ? 489  TYR A C     1 
ATOM   3868  O O     . TYR A 1 489 ? -23.379 28.572  84.566  1.00 27.64  ? 489  TYR A O     1 
ATOM   3869  C CB    . TYR A 1 489 ? -22.101 31.200  86.129  1.00 27.62  ? 489  TYR A CB    1 
ATOM   3870  C CG    . TYR A 1 489 ? -21.608 31.259  84.725  1.00 30.77  ? 489  TYR A CG    1 
ATOM   3871  C CD1   . TYR A 1 489 ? -22.322 31.950  83.761  1.00 32.68  ? 489  TYR A CD1   1 
ATOM   3872  C CD2   . TYR A 1 489 ? -20.425 30.606  84.342  1.00 30.43  ? 489  TYR A CD2   1 
ATOM   3873  C CE1   . TYR A 1 489 ? -21.879 32.003  82.435  1.00 34.40  ? 489  TYR A CE1   1 
ATOM   3874  C CE2   . TYR A 1 489 ? -19.978 30.658  83.028  1.00 31.44  ? 489  TYR A CE2   1 
ATOM   3875  C CZ    . TYR A 1 489 ? -20.714 31.359  82.081  1.00 31.13  ? 489  TYR A CZ    1 
ATOM   3876  O OH    . TYR A 1 489 ? -20.301 31.444  80.775  1.00 34.85  ? 489  TYR A OH    1 
ATOM   3877  N N     . HIS A 1 490 ? -21.825 28.101  86.084  1.00 28.87  ? 490  HIS A N     1 
ATOM   3878  C CA    . HIS A 1 490 ? -21.375 26.891  85.426  1.00 28.39  ? 490  HIS A CA    1 
ATOM   3879  C C     . HIS A 1 490 ? -22.429 25.793  85.471  1.00 29.40  ? 490  HIS A C     1 
ATOM   3880  O O     . HIS A 1 490 ? -22.636 25.110  84.480  1.00 30.88  ? 490  HIS A O     1 
ATOM   3881  C CB    . HIS A 1 490 ? -20.079 26.417  86.072  1.00 28.76  ? 490  HIS A CB    1 
ATOM   3882  C CG    . HIS A 1 490 ? -18.882 27.227  85.687  1.00 29.18  ? 490  HIS A CG    1 
ATOM   3883  N ND1   . HIS A 1 490 ? -18.416 27.294  84.392  1.00 32.24  ? 490  HIS A ND1   1 
ATOM   3884  C CD2   . HIS A 1 490 ? -18.016 27.948  86.436  1.00 34.50  ? 490  HIS A CD2   1 
ATOM   3885  C CE1   . HIS A 1 490 ? -17.332 28.045  84.354  1.00 33.92  ? 490  HIS A CE1   1 
ATOM   3886  N NE2   . HIS A 1 490 ? -17.076 28.469  85.579  1.00 32.67  ? 490  HIS A NE2   1 
ATOM   3887  N N     . MET A 1 491 ? -23.102 25.633  86.608  1.00 29.95  ? 491  MET A N     1 
ATOM   3888  C CA    . MET A 1 491 ? -24.198 24.645  86.723  1.00 30.14  ? 491  MET A CA    1 
ATOM   3889  C C     . MET A 1 491 ? -25.314 24.949  85.734  1.00 31.03  ? 491  MET A C     1 
ATOM   3890  O O     . MET A 1 491 ? -25.854 24.055  85.087  1.00 32.34  ? 491  MET A O     1 
ATOM   3891  C CB    . MET A 1 491 ? -24.787 24.632  88.138  1.00 29.43  ? 491  MET A CB    1 
ATOM   3892  C CG    . MET A 1 491 ? -23.835 24.142  89.200  1.00 30.35  ? 491  MET A CG    1 
ATOM   3893  S SD    . MET A 1 491 ? -24.565 24.214  90.829  1.00 30.79  ? 491  MET A SD    1 
ATOM   3894  C CE    . MET A 1 491 ? -23.419 23.267  91.827  1.00 28.24  ? 491  MET A CE    1 
ATOM   3895  N N     . ALA A 1 492 ? -25.658 26.225  85.613  1.00 31.52  ? 492  ALA A N     1 
ATOM   3896  C CA    . ALA A 1 492 ? -26.759 26.644  84.746  1.00 31.73  ? 492  ALA A CA    1 
ATOM   3897  C C     . ALA A 1 492 ? -26.371 26.492  83.282  1.00 32.81  ? 492  ALA A C     1 
ATOM   3898  O O     . ALA A 1 492 ? -27.202 26.106  82.433  1.00 34.77  ? 492  ALA A O     1 
ATOM   3899  C CB    . ALA A 1 492 ? -27.161 28.076  85.045  1.00 32.33  ? 492  ALA A CB    1 
ATOM   3900  N N     . SER A 1 493 ? -25.113 26.794  82.976  1.00 33.16  ? 493  SER A N     1 
ATOM   3901  C CA    . SER A 1 493 ? -24.585 26.572  81.628  1.00 32.47  ? 493  SER A CA    1 
ATOM   3902  C C     . SER A 1 493 ? -24.492 25.070  81.285  1.00 31.92  ? 493  SER A C     1 
ATOM   3903  O O     . SER A 1 493 ? -24.608 24.707  80.121  1.00 31.56  ? 493  SER A O     1 
ATOM   3904  C CB    . SER A 1 493 ? -23.229 27.249  81.459  1.00 32.00  ? 493  SER A CB    1 
ATOM   3905  O OG    . SER A 1 493 ? -23.301 28.631  81.745  1.00 31.84  ? 493  SER A OG    1 
ATOM   3906  N N     . ALA A 1 494 ? -24.277 24.230  82.299  1.00 32.30  ? 494  ALA A N     1 
ATOM   3907  C CA    . ALA A 1 494 ? -24.261 22.772  82.157  1.00 32.87  ? 494  ALA A CA    1 
ATOM   3908  C C     . ALA A 1 494 ? -25.660 22.169  82.109  1.00 34.08  ? 494  ALA A C     1 
ATOM   3909  O O     . ALA A 1 494 ? -25.801 20.951  82.027  1.00 34.26  ? 494  ALA A O     1 
ATOM   3910  C CB    . ALA A 1 494 ? -23.506 22.169  83.335  1.00 32.63  ? 494  ALA A CB    1 
ATOM   3911  N N     . LYS A 1 495 ? -26.681 23.028  82.219  1.00 36.63  ? 495  LYS A N     1 
ATOM   3912  C CA    . LYS A 1 495 ? -28.089 22.655  82.435  1.00 36.67  ? 495  LYS A CA    1 
ATOM   3913  C C     . LYS A 1 495 ? -28.303 21.689  83.601  1.00 37.23  ? 495  LYS A C     1 
ATOM   3914  O O     . LYS A 1 495 ? -29.191 20.851  83.538  1.00 37.12  ? 495  LYS A O     1 
ATOM   3915  C CB    . LYS A 1 495 ? -28.742 22.081  81.165  1.00 38.17  ? 495  LYS A CB    1 
ATOM   3916  C CG    . LYS A 1 495 ? -28.701 22.975  79.925  1.00 43.73  ? 495  LYS A CG    1 
ATOM   3917  C CD    . LYS A 1 495 ? -29.660 24.163  79.987  1.00 50.39  ? 495  LYS A CD    1 
ATOM   3918  C CE    . LYS A 1 495 ? -29.480 25.084  78.754  1.00 54.65  ? 495  LYS A CE    1 
ATOM   3919  N NZ    . LYS A 1 495 ? -30.513 26.169  78.623  1.00 54.78  ? 495  LYS A NZ    1 
ATOM   3920  N N     . MET A 1 496 ? -27.503 21.807  84.661  1.00 37.59  ? 496  MET A N     1 
ATOM   3921  C CA    . MET A 1 496 ? -27.613 20.896  85.807  1.00 38.61  ? 496  MET A CA    1 
ATOM   3922  C C     . MET A 1 496 ? -28.611 21.505  86.801  1.00 38.19  ? 496  MET A C     1 
ATOM   3923  O O     . MET A 1 496 ? -28.217 22.091  87.822  1.00 36.33  ? 496  MET A O     1 
ATOM   3924  C CB    . MET A 1 496 ? -26.250 20.694  86.440  1.00 38.72  ? 496  MET A CB    1 
ATOM   3925  C CG    . MET A 1 496 ? -25.226 20.063  85.529  1.00 39.77  ? 496  MET A CG    1 
ATOM   3926  S SD    . MET A 1 496 ? -23.554 20.032  86.240  1.00 42.00  ? 496  MET A SD    1 
ATOM   3927  C CE    . MET A 1 496 ? -23.639 18.496  87.157  1.00 39.51  ? 496  MET A CE    1 
ATOM   3928  N N     . HIS A 1 497 ? -29.902 21.398  86.457  1.00 38.75  ? 497  HIS A N     1 
ATOM   3929  C CA    . HIS A 1 497 ? -30.986 21.991  87.275  1.00 39.47  ? 497  HIS A CA    1 
ATOM   3930  C C     . HIS A 1 497 ? -31.057 21.412  88.690  1.00 38.27  ? 497  HIS A C     1 
ATOM   3931  O O     . HIS A 1 497 ? -31.345 22.132  89.654  1.00 37.98  ? 497  HIS A O     1 
ATOM   3932  C CB    . HIS A 1 497 ? -32.405 21.930  86.638  1.00 41.72  ? 497  HIS A CB    1 
ATOM   3933  C CG    . HIS A 1 497 ? -32.482 21.223  85.328  1.00 49.29  ? 497  HIS A CG    1 
ATOM   3934  N ND1   . HIS A 1 497 ? -32.462 21.902  84.120  1.00 55.86  ? 497  HIS A ND1   1 
ATOM   3935  C CD2   . HIS A 1 497 ? -32.591 19.902  85.029  1.00 57.14  ? 497  HIS A CD2   1 
ATOM   3936  C CE1   . HIS A 1 497 ? -32.541 21.026  83.133  1.00 58.66  ? 497  HIS A CE1   1 
ATOM   3937  N NE2   . HIS A 1 497 ? -32.616 19.805  83.658  1.00 61.68  ? 497  HIS A NE2   1 
ATOM   3938  N N     . LYS A 1 498 ? -30.778 20.124  88.825  1.00 36.52  ? 498  LYS A N     1 
ATOM   3939  C CA    . LYS A 1 498 ? -30.801 19.511  90.127  1.00 37.35  ? 498  LYS A CA    1 
ATOM   3940  C C     . LYS A 1 498 ? -29.744 20.121  91.055  1.00 35.71  ? 498  LYS A C     1 
ATOM   3941  O O     . LYS A 1 498 ? -30.029 20.487  92.175  1.00 35.53  ? 498  LYS A O     1 
ATOM   3942  C CB    . LYS A 1 498 ? -30.551 18.014  89.985  1.00 37.96  ? 498  LYS A CB    1 
ATOM   3943  C CG    . LYS A 1 498 ? -31.081 17.222  91.124  1.00 41.63  ? 498  LYS A CG    1 
ATOM   3944  C CD    . LYS A 1 498 ? -30.381 15.895  91.300  1.00 43.73  ? 498  LYS A CD    1 
ATOM   3945  C CE    . LYS A 1 498 ? -31.315 14.917  92.056  1.00 51.22  ? 498  LYS A CE    1 
ATOM   3946  N NZ    . LYS A 1 498 ? -30.596 14.146  93.114  1.00 51.70  ? 498  LYS A NZ    1 
ATOM   3947  N N     . GLU A 1 499 ? -28.515 20.193  90.573  1.00 34.33  ? 499  GLU A N     1 
ATOM   3948  C CA    . GLU A 1 499 ? -27.397 20.720  91.341  1.00 33.19  ? 499  GLU A CA    1 
ATOM   3949  C C     . GLU A 1 499 ? -27.582 22.219  91.634  1.00 30.73  ? 499  GLU A C     1 
ATOM   3950  O O     . GLU A 1 499 ? -27.299 22.688  92.737  1.00 31.26  ? 499  GLU A O     1 
ATOM   3951  C CB    . GLU A 1 499 ? -26.084 20.474  90.581  1.00 35.01  ? 499  GLU A CB    1 
ATOM   3952  C CG    . GLU A 1 499 ? -25.600 19.013  90.621  1.00 39.24  ? 499  GLU A CG    1 
ATOM   3953  C CD    . GLU A 1 499 ? -26.211 18.086  89.542  1.00 46.57  ? 499  GLU A CD    1 
ATOM   3954  O OE1   . GLU A 1 499 ? -27.157 18.480  88.791  1.00 42.46  ? 499  GLU A OE1   1 
ATOM   3955  O OE2   . GLU A 1 499 ? -25.709 16.933  89.453  1.00 51.50  ? 499  GLU A OE2   1 
ATOM   3956  N N     . LEU A 1 500 ? -28.082 22.951  90.648  1.00 28.55  ? 500  LEU A N     1 
ATOM   3957  C CA    . LEU A 1 500 ? -28.336 24.370  90.804  1.00 30.16  ? 500  LEU A CA    1 
ATOM   3958  C C     . LEU A 1 500 ? -29.358 24.628  91.916  1.00 29.72  ? 500  LEU A C     1 
ATOM   3959  O O     . LEU A 1 500 ? -29.187 25.523  92.741  1.00 27.81  ? 500  LEU A O     1 
ATOM   3960  C CB    . LEU A 1 500 ? -28.810 24.963  89.475  1.00 29.67  ? 500  LEU A CB    1 
ATOM   3961  C CG    . LEU A 1 500 ? -28.985 26.481  89.421  1.00 28.65  ? 500  LEU A CG    1 
ATOM   3962  C CD1   . LEU A 1 500 ? -27.669 27.216  89.583  1.00 28.74  ? 500  LEU A CD1   1 
ATOM   3963  C CD2   . LEU A 1 500 ? -29.651 26.869  88.119  1.00 31.76  ? 500  LEU A CD2   1 
ATOM   3964  N N     . CYS A 1 501 ? -30.419 23.827  91.935  1.00 31.24  ? 501  CYS A N     1 
ATOM   3965  C CA    . CYS A 1 501 ? -31.418 23.911  92.984  1.00 30.40  ? 501  CYS A CA    1 
ATOM   3966  C C     . CYS A 1 501 ? -30.823 23.556  94.333  1.00 29.45  ? 501  CYS A C     1 
ATOM   3967  O O     . CYS A 1 501 ? -31.020 24.287  95.298  1.00 27.78  ? 501  CYS A O     1 
ATOM   3968  C CB    . CYS A 1 501 ? -32.640 23.028  92.661  1.00 31.97  ? 501  CYS A CB    1 
ATOM   3969  S SG    . CYS A 1 501 ? -33.568 23.665  91.221  1.00 33.19  ? 501  CYS A SG    1 
ATOM   3970  N N     . ALA A 1 502 ? -30.073 22.460  94.400  1.00 29.23  ? 502  ALA A N     1 
ATOM   3971  C CA    . ALA A 1 502 ? -29.475 22.039  95.669  1.00 29.58  ? 502  ALA A CA    1 
ATOM   3972  C C     . ALA A 1 502 ? -28.511 23.096  96.207  1.00 28.67  ? 502  ALA A C     1 
ATOM   3973  O O     . ALA A 1 502 ? -28.379 23.264  97.409  1.00 28.79  ? 502  ALA A O     1 
ATOM   3974  C CB    . ALA A 1 502 ? -28.770 20.702  95.496  1.00 29.16  ? 502  ALA A CB    1 
ATOM   3975  N N     . LEU A 1 503 ? -27.844 23.821  95.318  1.00 29.64  ? 503  LEU A N     1 
ATOM   3976  C CA    . LEU A 1 503 ? -26.943 24.911  95.736  1.00 28.58  ? 503  LEU A CA    1 
ATOM   3977  C C     . LEU A 1 503 ? -27.707 26.160  96.205  1.00 27.23  ? 503  LEU A C     1 
ATOM   3978  O O     . LEU A 1 503 ? -27.493 26.647  97.327  1.00 26.20  ? 503  LEU A O     1 
ATOM   3979  C CB    . LEU A 1 503 ? -26.023 25.280  94.580  1.00 27.59  ? 503  LEU A CB    1 
ATOM   3980  C CG    . LEU A 1 503 ? -25.163 26.491  94.898  1.00 26.59  ? 503  LEU A CG    1 
ATOM   3981  C CD1   . LEU A 1 503 ? -24.093 26.083  95.894  1.00 21.47  ? 503  LEU A CD1   1 
ATOM   3982  C CD2   . LEU A 1 503 ? -24.586 27.045  93.611  1.00 29.21  ? 503  LEU A CD2   1 
ATOM   3983  N N     . MET A 1 504 ? -28.598 26.664  95.348  1.00 25.44  ? 504  MET A N     1 
ATOM   3984  C CA    . MET A 1 504 ? -29.238 27.973  95.555  1.00 28.32  ? 504  MET A CA    1 
ATOM   3985  C C     . MET A 1 504 ? -30.500 27.951  96.456  1.00 27.09  ? 504  MET A C     1 
ATOM   3986  O O     . MET A 1 504 ? -30.829 28.940  97.107  1.00 25.68  ? 504  MET A O     1 
ATOM   3987  C CB    . MET A 1 504 ? -29.556 28.614  94.186  1.00 28.09  ? 504  MET A CB    1 
ATOM   3988  C CG    . MET A 1 504 ? -28.332 28.888  93.319  1.00 29.40  ? 504  MET A CG    1 
ATOM   3989  S SD    . MET A 1 504 ? -28.784 29.789  91.821  1.00 33.67  ? 504  MET A SD    1 
ATOM   3990  C CE    . MET A 1 504 ? -28.972 31.449  92.511  1.00 33.74  ? 504  MET A CE    1 
ATOM   3991  N N     . PHE A 1 505 ? -31.205 26.832  96.520  1.00 27.77  ? 505  PHE A N     1 
ATOM   3992  C CA    . PHE A 1 505 ? -32.408 26.759  97.358  1.00 28.02  ? 505  PHE A CA    1 
ATOM   3993  C C     . PHE A 1 505 ? -31.976 26.360  98.765  1.00 28.70  ? 505  PHE A C     1 
ATOM   3994  O O     . PHE A 1 505 ? -32.355 25.306  99.267  1.00 29.80  ? 505  PHE A O     1 
ATOM   3995  C CB    . PHE A 1 505 ? -33.438 25.756  96.826  1.00 28.09  ? 505  PHE A CB    1 
ATOM   3996  C CG    . PHE A 1 505 ? -34.027 26.098  95.461  1.00 30.25  ? 505  PHE A CG    1 
ATOM   3997  C CD1   . PHE A 1 505 ? -33.827 27.333  94.849  1.00 23.65  ? 505  PHE A CD1   1 
ATOM   3998  C CD2   . PHE A 1 505 ? -34.841 25.172  94.817  1.00 29.66  ? 505  PHE A CD2   1 
ATOM   3999  C CE1   . PHE A 1 505 ? -34.393 27.613  93.611  1.00 29.10  ? 505  PHE A CE1   1 
ATOM   4000  C CE2   . PHE A 1 505 ? -35.401 25.456  93.588  1.00 25.30  ? 505  PHE A CE2   1 
ATOM   4001  C CZ    . PHE A 1 505 ? -35.179 26.674  92.985  1.00 27.25  ? 505  PHE A CZ    1 
ATOM   4002  N N     . SER A 1 506 ? -31.204 27.229  99.409  1.00 28.54  ? 506  SER A N     1 
ATOM   4003  C CA    . SER A 1 506 ? -30.435 26.846  100.593 1.00 29.19  ? 506  SER A CA    1 
ATOM   4004  C C     . SER A 1 506 ? -30.168 28.081  101.435 1.00 28.29  ? 506  SER A C     1 
ATOM   4005  O O     . SER A 1 506 ? -29.508 29.014  100.964 1.00 27.73  ? 506  SER A O     1 
ATOM   4006  C CB    . SER A 1 506 ? -29.100 26.213  100.116 1.00 31.08  ? 506  SER A CB    1 
ATOM   4007  O OG    . SER A 1 506 ? -28.151 25.956  101.140 1.00 27.57  ? 506  SER A OG    1 
ATOM   4008  N N     . LEU A 1 507 ? -30.705 28.087  102.657 1.00 28.14  ? 507  LEU A N     1 
ATOM   4009  C CA    . LEU A 1 507 ? -30.447 29.170  103.627 1.00 28.06  ? 507  LEU A CA    1 
ATOM   4010  C C     . LEU A 1 507 ? -28.959 29.321  103.939 1.00 27.85  ? 507  LEU A C     1 
ATOM   4011  O O     . LEU A 1 507 ? -28.488 30.432  104.156 1.00 26.39  ? 507  LEU A O     1 
ATOM   4012  C CB    . LEU A 1 507 ? -31.218 28.922  104.926 1.00 27.13  ? 507  LEU A CB    1 
ATOM   4013  C CG    . LEU A 1 507 ? -32.737 29.036  104.851 1.00 27.14  ? 507  LEU A CG    1 
ATOM   4014  C CD1   . LEU A 1 507 ? -33.368 28.768  106.225 1.00 25.81  ? 507  LEU A CD1   1 
ATOM   4015  C CD2   . LEU A 1 507 ? -33.162 30.401  104.320 1.00 27.64  ? 507  LEU A CD2   1 
ATOM   4016  N N     . ASP A 1 508 ? -28.247 28.193  103.968 1.00 27.93  ? 508  ASP A N     1 
ATOM   4017  C CA    . ASP A 1 508 ? -26.815 28.148  104.265 1.00 27.12  ? 508  ASP A CA    1 
ATOM   4018  C C     . ASP A 1 508 ? -26.029 28.904  103.205 1.00 25.88  ? 508  ASP A C     1 
ATOM   4019  O O     . ASP A 1 508 ? -25.111 29.635  103.531 1.00 26.09  ? 508  ASP A O     1 
ATOM   4020  C CB    . ASP A 1 508 ? -26.310 26.693  104.289 1.00 27.08  ? 508  ASP A CB    1 
ATOM   4021  C CG    . ASP A 1 508 ? -26.677 25.952  105.570 1.00 33.83  ? 508  ASP A CG    1 
ATOM   4022  O OD1   . ASP A 1 508 ? -27.036 26.614  106.574 1.00 34.39  ? 508  ASP A OD1   1 
ATOM   4023  O OD2   . ASP A 1 508 ? -26.571 24.704  105.579 1.00 35.08  ? 508  ASP A OD2   1 
ATOM   4024  N N     . TRP A 1 509 ? -26.381 28.672  101.947 1.00 24.77  ? 509  TRP A N     1 
ATOM   4025  C CA    . TRP A 1 509 ? -25.740 29.315  100.826 1.00 26.05  ? 509  TRP A CA    1 
ATOM   4026  C C     . TRP A 1 509 ? -26.059 30.783  100.798 1.00 26.04  ? 509  TRP A C     1 
ATOM   4027  O O     . TRP A 1 509 ? -25.197 31.589  100.515 1.00 25.69  ? 509  TRP A O     1 
ATOM   4028  C CB    . TRP A 1 509 ? -26.155 28.648  99.494  1.00 26.27  ? 509  TRP A CB    1 
ATOM   4029  C CG    . TRP A 1 509 ? -25.492 29.272  98.282  1.00 27.21  ? 509  TRP A CG    1 
ATOM   4030  C CD1   . TRP A 1 509 ? -26.087 30.057  97.315  1.00 28.34  ? 509  TRP A CD1   1 
ATOM   4031  C CD2   . TRP A 1 509 ? -24.115 29.191  97.937  1.00 29.53  ? 509  TRP A CD2   1 
ATOM   4032  N NE1   . TRP A 1 509 ? -25.151 30.458  96.390  1.00 24.90  ? 509  TRP A NE1   1 
ATOM   4033  C CE2   . TRP A 1 509 ? -23.935 29.943  96.741  1.00 26.43  ? 509  TRP A CE2   1 
ATOM   4034  C CE3   . TRP A 1 509 ? -23.005 28.548  98.513  1.00 29.88  ? 509  TRP A CE3   1 
ATOM   4035  C CZ2   . TRP A 1 509 ? -22.686 30.082  96.114  1.00 27.35  ? 509  TRP A CZ2   1 
ATOM   4036  C CZ3   . TRP A 1 509 ? -21.754 28.687  97.887  1.00 32.55  ? 509  TRP A CZ3   1 
ATOM   4037  C CH2   . TRP A 1 509 ? -21.613 29.448  96.687  1.00 29.34  ? 509  TRP A CH2   1 
ATOM   4038  N N     . ILE A 1 510 ? -27.303 31.132  101.080 1.00 26.42  ? 510  ILE A N     1 
ATOM   4039  C CA    . ILE A 1 510 ? -27.696 32.537  101.145 1.00 27.75  ? 510  ILE A CA    1 
ATOM   4040  C C     . ILE A 1 510 ? -26.920 33.255  102.246 1.00 26.39  ? 510  ILE A C     1 
ATOM   4041  O O     . ILE A 1 510 ? -26.380 34.344  102.013 1.00 24.26  ? 510  ILE A O     1 
ATOM   4042  C CB    . ILE A 1 510 ? -29.225 32.690  101.332 1.00 28.01  ? 510  ILE A CB    1 
ATOM   4043  C CG1   . ILE A 1 510 ? -29.919 32.311  100.028 1.00 33.46  ? 510  ILE A CG1   1 
ATOM   4044  C CG2   . ILE A 1 510 ? -29.591 34.136  101.750 1.00 28.39  ? 510  ILE A CG2   1 
ATOM   4045  C CD1   . ILE A 1 510 ? -31.403 32.329  100.097 1.00 34.16  ? 510  ILE A CD1   1 
ATOM   4046  N N     . LYS A 1 511 ? -26.859 32.646  103.426 1.00 25.28  ? 511  LYS A N     1 
ATOM   4047  C CA    . LYS A 1 511 ? -26.073 33.180  104.515 1.00 26.55  ? 511  LYS A CA    1 
ATOM   4048  C C     . LYS A 1 511 ? -24.590 33.361  104.113 1.00 26.39  ? 511  LYS A C     1 
ATOM   4049  O O     . LYS A 1 511 ? -24.036 34.433  104.272 1.00 28.00  ? 511  LYS A O     1 
ATOM   4050  C CB    . LYS A 1 511 ? -26.172 32.277  105.751 1.00 26.58  ? 511  LYS A CB    1 
ATOM   4051  C CG    . LYS A 1 511 ? -25.314 32.756  106.916 1.00 27.28  ? 511  LYS A CG    1 
ATOM   4052  C CD    . LYS A 1 511 ? -25.578 31.999  108.205 1.00 28.61  ? 511  LYS A CD    1 
ATOM   4053  C CE    . LYS A 1 511 ? -24.788 32.622  109.340 1.00 32.47  ? 511  LYS A CE    1 
ATOM   4054  N NZ    . LYS A 1 511 ? -25.290 32.118  110.641 1.00 42.13  ? 511  LYS A NZ    1 
ATOM   4055  N N     . ALA A 1 512 ? -23.968 32.310  103.589 1.00 26.43  ? 512  ALA A N     1 
ATOM   4056  C CA    . ALA A 1 512 ? -22.541 32.339  103.274 1.00 26.82  ? 512  ALA A CA    1 
ATOM   4057  C C     . ALA A 1 512 ? -22.238 33.383  102.211 1.00 27.48  ? 512  ALA A C     1 
ATOM   4058  O O     . ALA A 1 512 ? -21.348 34.223  102.369 1.00 29.31  ? 512  ALA A O     1 
ATOM   4059  C CB    . ALA A 1 512 ? -22.058 30.957  102.830 1.00 24.82  ? 512  ALA A CB    1 
ATOM   4060  N N     . LYS A 1 513 ? -22.998 33.352  101.122 1.00 27.96  ? 513  LYS A N     1 
ATOM   4061  C CA    . LYS A 1 513 ? -22.751 34.277  100.020 1.00 26.71  ? 513  LYS A CA    1 
ATOM   4062  C C     . LYS A 1 513 ? -23.112 35.725  100.338 1.00 26.95  ? 513  LYS A C     1 
ATOM   4063  O O     . LYS A 1 513 ? -22.351 36.631  100.018 1.00 26.96  ? 513  LYS A O     1 
ATOM   4064  C CB    . LYS A 1 513 ? -23.422 33.797  98.730  1.00 25.90  ? 513  LYS A CB    1 
ATOM   4065  C CG    . LYS A 1 513 ? -22.939 34.557  97.521  1.00 26.92  ? 513  LYS A CG    1 
ATOM   4066  C CD    . LYS A 1 513 ? -23.401 33.982  96.173  1.00 25.79  ? 513  LYS A CD    1 
ATOM   4067  C CE    . LYS A 1 513 ? -23.172 35.070  95.079  1.00 27.33  ? 513  LYS A CE    1 
ATOM   4068  N NZ    . LYS A 1 513 ? -23.208 34.527  93.732  1.00 29.02  ? 513  LYS A NZ    1 
ATOM   4069  N N     . THR A 1 514 ? -24.239 35.963  100.981 1.00 26.66  ? 514  THR A N     1 
ATOM   4070  C CA    . THR A 1 514 ? -24.599 37.335  101.321 1.00 28.71  ? 514  THR A CA    1 
ATOM   4071  C C     . THR A 1 514 ? -23.682 37.984  102.365 1.00 28.79  ? 514  THR A C     1 
ATOM   4072  O O     . THR A 1 514 ? -23.456 39.185  102.324 1.00 30.11  ? 514  THR A O     1 
ATOM   4073  C CB    . THR A 1 514 ? -26.052 37.467  101.788 1.00 29.49  ? 514  THR A CB    1 
ATOM   4074  O OG1   . THR A 1 514 ? -26.278 36.713  103.006 1.00 21.01  ? 514  THR A OG1   1 
ATOM   4075  C CG2   . THR A 1 514 ? -27.004 37.071  100.656 1.00 29.07  ? 514  THR A CG2   1 
ATOM   4076  N N     . GLU A 1 515 ? -23.156 37.191  103.287 1.00 29.95  ? 515  GLU A N     1 
ATOM   4077  C CA    . GLU A 1 515 ? -22.241 37.721  104.305 1.00 31.64  ? 515  GLU A CA    1 
ATOM   4078  C C     . GLU A 1 515 ? -20.889 38.150  103.742 1.00 33.00  ? 515  GLU A C     1 
ATOM   4079  O O     . GLU A 1 515 ? -20.204 38.989  104.353 1.00 35.43  ? 515  GLU A O     1 
ATOM   4080  C CB    . GLU A 1 515 ? -22.065 36.730  105.459 1.00 26.86  ? 515  GLU A CB    1 
ATOM   4081  C CG    . GLU A 1 515 ? -23.335 36.665  106.325 1.00 34.66  ? 515  GLU A CG    1 
ATOM   4082  C CD    . GLU A 1 515 ? -23.190 35.834  107.595 1.00 33.16  ? 515  GLU A CD    1 
ATOM   4083  O OE1   . GLU A 1 515 ? -22.166 35.144  107.754 1.00 35.91  ? 515  GLU A OE1   1 
ATOM   4084  O OE2   . GLU A 1 515 ? -24.123 35.873  108.428 1.00 38.89  ? 515  GLU A OE2   1 
ATOM   4085  N N     . LEU A 1 516 ? -20.519 37.596  102.582 1.00 33.64  ? 516  LEU A N     1 
ATOM   4086  C CA    . LEU A 1 516 ? -19.346 38.070  101.828 1.00 33.36  ? 516  LEU A CA    1 
ATOM   4087  C C     . LEU A 1 516 ? -19.602 39.229  100.850 1.00 32.93  ? 516  LEU A C     1 
ATOM   4088  O O     . LEU A 1 516 ? -18.853 40.208  100.836 1.00 33.81  ? 516  LEU A O     1 
ATOM   4089  C CB    . LEU A 1 516 ? -18.723 36.931  101.024 1.00 35.49  ? 516  LEU A CB    1 
ATOM   4090  C CG    . LEU A 1 516 ? -17.698 36.030  101.672 1.00 44.91  ? 516  LEU A CG    1 
ATOM   4091  C CD1   . LEU A 1 516 ? -17.281 34.934  100.687 1.00 49.24  ? 516  LEU A CD1   1 
ATOM   4092  C CD2   . LEU A 1 516 ? -16.486 36.860  102.119 1.00 49.27  ? 516  LEU A CD2   1 
ATOM   4093  N N     . VAL A 1 517 ? -20.621 39.092  100.000 1.00 31.50  ? 517  VAL A N     1 
ATOM   4094  C CA    . VAL A 1 517 ? -20.811 40.018  98.871  1.00 29.39  ? 517  VAL A CA    1 
ATOM   4095  C C     . VAL A 1 517 ? -22.181 40.701  98.827  1.00 28.04  ? 517  VAL A C     1 
ATOM   4096  O O     . VAL A 1 517 ? -22.461 41.476  97.915  1.00 29.49  ? 517  VAL A O     1 
ATOM   4097  C CB    . VAL A 1 517 ? -20.504 39.335  97.506  1.00 27.80  ? 517  VAL A CB    1 
ATOM   4098  C CG1   . VAL A 1 517 ? -19.065 38.993  97.423  1.00 31.05  ? 517  VAL A CG1   1 
ATOM   4099  C CG2   . VAL A 1 517 ? -21.332 38.072  97.305  1.00 29.92  ? 517  VAL A CG2   1 
ATOM   4100  N N     . GLY A 1 518 ? -23.021 40.437  99.817  1.00 27.70  ? 518  GLY A N     1 
ATOM   4101  C CA    . GLY A 1 518 ? -24.379 40.959  99.826  1.00 28.65  ? 518  GLY A CA    1 
ATOM   4102  C C     . GLY A 1 518 ? -25.305 40.204  98.904  1.00 27.41  ? 518  GLY A C     1 
ATOM   4103  O O     . GLY A 1 518 ? -24.923 39.175  98.358  1.00 26.32  ? 518  GLY A O     1 
ATOM   4104  N N     . PRO A 1 519 ? -26.542 40.705  98.740  1.00 28.82  ? 519  PRO A N     1 
ATOM   4105  C CA    . PRO A 1 519 ? -27.602 39.993  98.003  1.00 28.77  ? 519  PRO A CA    1 
ATOM   4106  C C     . PRO A 1 519 ? -27.708 40.232  96.506  1.00 27.84  ? 519  PRO A C     1 
ATOM   4107  O O     . PRO A 1 519 ? -28.412 39.482  95.850  1.00 28.60  ? 519  PRO A O     1 
ATOM   4108  C CB    . PRO A 1 519 ? -28.882 40.518  98.663  1.00 30.69  ? 519  PRO A CB    1 
ATOM   4109  C CG    . PRO A 1 519 ? -28.535 41.960  99.035  1.00 29.76  ? 519  PRO A CG    1 
ATOM   4110  C CD    . PRO A 1 519 ? -27.031 41.981  99.304  1.00 31.75  ? 519  PRO A CD    1 
ATOM   4111  N N     . ALA A 1 520 ? -27.059 41.257  95.965  1.00 26.71  ? 520  ALA A N     1 
ATOM   4112  C CA    . ALA A 1 520 ? -27.373 41.712  94.618  1.00 27.49  ? 520  ALA A CA    1 
ATOM   4113  C C     . ALA A 1 520 ? -27.109 40.651  93.514  1.00 28.01  ? 520  ALA A C     1 
ATOM   4114  O O     . ALA A 1 520 ? -27.978 40.379  92.698  1.00 25.19  ? 520  ALA A O     1 
ATOM   4115  C CB    . ALA A 1 520 ? -26.649 43.013  94.324  1.00 27.27  ? 520  ALA A CB    1 
ATOM   4116  N N     . HIS A 1 521 ? -25.916 40.056  93.503  1.00 29.49  ? 521  HIS A N     1 
ATOM   4117  C CA    . HIS A 1 521 ? -25.604 39.062  92.507  1.00 29.50  ? 521  HIS A CA    1 
ATOM   4118  C C     . HIS A 1 521 ? -26.522 37.864  92.642  1.00 30.89  ? 521  HIS A C     1 
ATOM   4119  O O     . HIS A 1 521 ? -26.986 37.339  91.644  1.00 31.50  ? 521  HIS A O     1 
ATOM   4120  C CB    . HIS A 1 521 ? -24.154 38.590  92.604  1.00 29.17  ? 521  HIS A CB    1 
ATOM   4121  C CG    . HIS A 1 521 ? -23.759 37.684  91.479  1.00 30.81  ? 521  HIS A CG    1 
ATOM   4122  N ND1   . HIS A 1 521 ? -22.857 36.653  91.622  1.00 29.36  ? 521  HIS A ND1   1 
ATOM   4123  C CD2   . HIS A 1 521 ? -24.176 37.646  90.189  1.00 31.18  ? 521  HIS A CD2   1 
ATOM   4124  C CE1   . HIS A 1 521 ? -22.721 36.032  90.464  1.00 30.40  ? 521  HIS A CE1   1 
ATOM   4125  N NE2   . HIS A 1 521 ? -23.513 36.612  89.577  1.00 30.85  ? 521  HIS A NE2   1 
ATOM   4126  N N     . LEU A 1 522 ? -26.756 37.420  93.878  1.00 31.21  ? 522  LEU A N     1 
ATOM   4127  C CA    . LEU A 1 522 ? -27.618 36.279  94.136  1.00 31.00  ? 522  LEU A CA    1 
ATOM   4128  C C     . LEU A 1 522 ? -28.974 36.469  93.559  1.00 30.05  ? 522  LEU A C     1 
ATOM   4129  O O     . LEU A 1 522 ? -29.525 35.570  92.921  1.00 29.91  ? 522  LEU A O     1 
ATOM   4130  C CB    . LEU A 1 522 ? -27.802 36.024  95.628  1.00 31.14  ? 522  LEU A CB    1 
ATOM   4131  C CG    . LEU A 1 522 ? -27.083 34.809  96.207  1.00 35.35  ? 522  LEU A CG    1 
ATOM   4132  C CD1   . LEU A 1 522 ? -27.371 34.757  97.702  1.00 37.37  ? 522  LEU A CD1   1 
ATOM   4133  C CD2   . LEU A 1 522 ? -27.491 33.485  95.510  1.00 31.45  ? 522  LEU A CD2   1 
ATOM   4134  N N     . ILE A 1 523 ? -29.542 37.635  93.830  1.00 31.42  ? 523  ILE A N     1 
ATOM   4135  C CA    . ILE A 1 523 ? -30.835 38.004  93.268  1.00 32.12  ? 523  ILE A CA    1 
ATOM   4136  C C     . ILE A 1 523 ? -30.834 37.913  91.737  1.00 34.14  ? 523  ILE A C     1 
ATOM   4137  O O     . ILE A 1 523 ? -31.767 37.363  91.152  1.00 36.07  ? 523  ILE A O     1 
ATOM   4138  C CB    . ILE A 1 523 ? -31.251 39.403  93.757  1.00 32.00  ? 523  ILE A CB    1 
ATOM   4139  C CG1   . ILE A 1 523 ? -31.783 39.317  95.201  1.00 29.24  ? 523  ILE A CG1   1 
ATOM   4140  C CG2   . ILE A 1 523 ? -32.293 40.036  92.838  1.00 34.58  ? 523  ILE A CG2   1 
ATOM   4141  C CD1   . ILE A 1 523 ? -31.881 40.683  95.893  1.00 29.26  ? 523  ILE A CD1   1 
ATOM   4142  N N     . HIS A 1 524 ? -29.790 38.448  91.103  1.00 34.55  ? 524  HIS A N     1 
ATOM   4143  C CA    . HIS A 1 524 ? -29.653 38.382  89.643  1.00 34.17  ? 524  HIS A CA    1 
ATOM   4144  C C     . HIS A 1 524 ? -29.509 36.939  89.157  1.00 33.71  ? 524  HIS A C     1 
ATOM   4145  O O     . HIS A 1 524 ? -30.069 36.611  88.130  1.00 35.67  ? 524  HIS A O     1 
ATOM   4146  C CB    . HIS A 1 524 ? -28.508 39.270  89.168  1.00 34.48  ? 524  HIS A CB    1 
ATOM   4147  C CG    . HIS A 1 524 ? -28.094 39.034  87.753  1.00 37.11  ? 524  HIS A CG    1 
ATOM   4148  N ND1   . HIS A 1 524 ? -28.727 39.619  86.675  1.00 44.02  ? 524  HIS A ND1   1 
ATOM   4149  C CD2   . HIS A 1 524 ? -27.082 38.296  87.241  1.00 40.85  ? 524  HIS A CD2   1 
ATOM   4150  C CE1   . HIS A 1 524 ? -28.124 39.244  85.560  1.00 42.29  ? 524  HIS A CE1   1 
ATOM   4151  N NE2   . HIS A 1 524 ? -27.126 38.437  85.874  1.00 44.44  ? 524  HIS A NE2   1 
ATOM   4152  N N     . GLU A 1 525 ? -28.797 36.079  89.890  1.00 33.48  ? 525  GLU A N     1 
ATOM   4153  C CA    . GLU A 1 525 ? -28.651 34.683  89.491  1.00 32.12  ? 525  GLU A CA    1 
ATOM   4154  C C     . GLU A 1 525 ? -29.980 33.955  89.511  1.00 32.18  ? 525  GLU A C     1 
ATOM   4155  O O     . GLU A 1 525 ? -30.250 33.117  88.642  1.00 32.46  ? 525  GLU A O     1 
ATOM   4156  C CB    . GLU A 1 525 ? -27.695 33.950  90.398  1.00 32.65  ? 525  GLU A CB    1 
ATOM   4157  C CG    . GLU A 1 525 ? -26.278 34.400  90.260  1.00 30.45  ? 525  GLU A CG    1 
ATOM   4158  C CD    . GLU A 1 525 ? -25.396 33.736  91.284  1.00 33.70  ? 525  GLU A CD    1 
ATOM   4159  O OE1   . GLU A 1 525 ? -25.695 33.889  92.492  1.00 33.40  ? 525  GLU A OE1   1 
ATOM   4160  O OE2   . GLU A 1 525 ? -24.421 33.052  90.878  1.00 34.38  ? 525  GLU A OE2   1 
ATOM   4161  N N     . PHE A 1 526 ? -30.817 34.243  90.503  1.00 31.93  ? 526  PHE A N     1 
ATOM   4162  C CA    . PHE A 1 526 ? -32.164 33.648  90.535  1.00 32.96  ? 526  PHE A CA    1 
ATOM   4163  C C     . PHE A 1 526 ? -32.981 34.027  89.291  1.00 34.60  ? 526  PHE A C     1 
ATOM   4164  O O     . PHE A 1 526 ? -33.685 33.203  88.744  1.00 33.66  ? 526  PHE A O     1 
ATOM   4165  C CB    . PHE A 1 526 ? -32.957 34.040  91.784  1.00 30.50  ? 526  PHE A CB    1 
ATOM   4166  C CG    . PHE A 1 526 ? -32.642 33.188  92.985  1.00 34.85  ? 526  PHE A CG    1 
ATOM   4167  C CD1   . PHE A 1 526 ? -33.073 31.870  93.042  1.00 31.70  ? 526  PHE A CD1   1 
ATOM   4168  C CD2   . PHE A 1 526 ? -31.904 33.702  94.051  1.00 31.15  ? 526  PHE A CD2   1 
ATOM   4169  C CE1   . PHE A 1 526 ? -32.781 31.084  94.124  1.00 31.24  ? 526  PHE A CE1   1 
ATOM   4170  C CE2   . PHE A 1 526 ? -31.591 32.910  95.143  1.00 30.89  ? 526  PHE A CE2   1 
ATOM   4171  C CZ    . PHE A 1 526 ? -32.035 31.598  95.178  1.00 31.63  ? 526  PHE A CZ    1 
ATOM   4172  N N     . VAL A 1 527 ? -32.886 35.283  88.873  1.00 35.51  ? 527  VAL A N     1 
ATOM   4173  C CA    . VAL A 1 527 ? -33.607 35.784  87.713  1.00 36.74  ? 527  VAL A CA    1 
ATOM   4174  C C     . VAL A 1 527 ? -33.047 35.189  86.418  1.00 38.28  ? 527  VAL A C     1 
ATOM   4175  O O     . VAL A 1 527 ? -33.802 34.632  85.621  1.00 38.59  ? 527  VAL A O     1 
ATOM   4176  C CB    . VAL A 1 527 ? -33.533 37.353  87.678  1.00 39.27  ? 527  VAL A CB    1 
ATOM   4177  C CG1   . VAL A 1 527 ? -34.019 37.923  86.339  1.00 36.76  ? 527  VAL A CG1   1 
ATOM   4178  C CG2   . VAL A 1 527 ? -34.338 37.941  88.835  1.00 38.33  ? 527  VAL A CG2   1 
ATOM   4179  N N     . GLU A 1 528 ? -31.721 35.303  86.251  1.00 38.14  ? 528  GLU A N     1 
ATOM   4180  C CA    . GLU A 1 528 ? -30.990 34.873  85.045  1.00 36.98  ? 528  GLU A CA    1 
ATOM   4181  C C     . GLU A 1 528 ? -31.128 33.385  84.725  1.00 38.12  ? 528  GLU A C     1 
ATOM   4182  O O     . GLU A 1 528 ? -31.175 33.010  83.567  1.00 37.34  ? 528  GLU A O     1 
ATOM   4183  C CB    . GLU A 1 528 ? -29.504 35.210  85.222  1.00 37.92  ? 528  GLU A CB    1 
ATOM   4184  C CG    . GLU A 1 528 ? -28.678 35.281  83.929  1.00 41.94  ? 528  GLU A CG    1 
ATOM   4185  C CD    . GLU A 1 528 ? -29.205 36.361  82.953  1.00 55.17  ? 528  GLU A CD    1 
ATOM   4186  O OE1   . GLU A 1 528 ? -30.173 37.084  83.309  1.00 55.33  ? 528  GLU A OE1   1 
ATOM   4187  O OE2   . GLU A 1 528 ? -28.656 36.484  81.831  1.00 57.42  ? 528  GLU A OE2   1 
ATOM   4188  N N     . TYR A 1 529 ? -31.139 32.531  85.748  1.00 37.50  ? 529  TYR A N     1 
ATOM   4189  C CA    . TYR A 1 529 ? -31.032 31.077  85.535  1.00 37.73  ? 529  TYR A CA    1 
ATOM   4190  C C     . TYR A 1 529 ? -32.334 30.348  85.725  1.00 37.15  ? 529  TYR A C     1 
ATOM   4191  O O     . TYR A 1 529 ? -32.378 29.127  85.642  1.00 35.97  ? 529  TYR A O     1 
ATOM   4192  C CB    . TYR A 1 529 ? -30.032 30.455  86.495  1.00 36.70  ? 529  TYR A CB    1 
ATOM   4193  C CG    . TYR A 1 529 ? -28.697 31.110  86.475  1.00 37.15  ? 529  TYR A CG    1 
ATOM   4194  C CD1   . TYR A 1 529 ? -28.169 31.634  85.290  1.00 35.43  ? 529  TYR A CD1   1 
ATOM   4195  C CD2   . TYR A 1 529 ? -27.938 31.189  87.635  1.00 34.91  ? 529  TYR A CD2   1 
ATOM   4196  C CE1   . TYR A 1 529 ? -26.927 32.235  85.274  1.00 35.63  ? 529  TYR A CE1   1 
ATOM   4197  C CE2   . TYR A 1 529 ? -26.690 31.778  87.619  1.00 37.13  ? 529  TYR A CE2   1 
ATOM   4198  C CZ    . TYR A 1 529 ? -26.201 32.308  86.447  1.00 32.84  ? 529  TYR A CZ    1 
ATOM   4199  O OH    . TYR A 1 529 ? -24.967 32.895  86.450  1.00 42.01  ? 529  TYR A OH    1 
ATOM   4200  N N     . ARG A 1 530 ? -33.386 31.098  86.013  1.00 38.18  ? 530  ARG A N     1 
ATOM   4201  C CA    . ARG A 1 530 ? -34.704 30.532  86.215  1.00 40.09  ? 530  ARG A CA    1 
ATOM   4202  C C     . ARG A 1 530 ? -35.229 29.790  84.978  1.00 40.42  ? 530  ARG A C     1 
ATOM   4203  O O     . ARG A 1 530 ? -35.960 28.814  85.118  1.00 38.56  ? 530  ARG A O     1 
ATOM   4204  C CB    . ARG A 1 530 ? -35.668 31.638  86.615  1.00 39.99  ? 530  ARG A CB    1 
ATOM   4205  C CG    . ARG A 1 530 ? -37.041 31.153  87.063  1.00 42.66  ? 530  ARG A CG    1 
ATOM   4206  C CD    . ARG A 1 530 ? -37.902 32.337  87.516  1.00 43.76  ? 530  ARG A CD    1 
ATOM   4207  N NE    . ARG A 1 530 ? -37.582 32.731  88.891  1.00 49.17  ? 530  ARG A NE    1 
ATOM   4208  C CZ    . ARG A 1 530 ? -37.464 33.986  89.351  1.00 49.45  ? 530  ARG A CZ    1 
ATOM   4209  N NH1   . ARG A 1 530 ? -37.613 35.053  88.557  1.00 47.96  ? 530  ARG A NH1   1 
ATOM   4210  N NH2   . ARG A 1 530 ? -37.175 34.170  90.641  1.00 46.04  ? 530  ARG A NH2   1 
ATOM   4211  N N     . HIS A 1 531 ? -34.811 30.229  83.784  1.00 41.44  ? 531  HIS A N     1 
ATOM   4212  C CA    . HIS A 1 531 ? -35.278 29.652  82.520  1.00 43.52  ? 531  HIS A CA    1 
ATOM   4213  C C     . HIS A 1 531 ? -34.903 28.182  82.279  1.00 44.36  ? 531  HIS A C     1 
ATOM   4214  O O     . HIS A 1 531 ? -35.518 27.540  81.434  1.00 43.52  ? 531  HIS A O     1 
ATOM   4215  C CB    . HIS A 1 531 ? -34.757 30.482  81.345  1.00 44.22  ? 531  HIS A CB    1 
ATOM   4216  C CG    . HIS A 1 531 ? -33.299 30.297  81.074  1.00 47.35  ? 531  HIS A CG    1 
ATOM   4217  N ND1   . HIS A 1 531 ? -32.363 31.264  81.363  1.00 51.25  ? 531  HIS A ND1   1 
ATOM   4218  C CD2   . HIS A 1 531 ? -32.614 29.261  80.532  1.00 52.41  ? 531  HIS A CD2   1 
ATOM   4219  C CE1   . HIS A 1 531 ? -31.161 30.830  81.014  1.00 51.52  ? 531  HIS A CE1   1 
ATOM   4220  N NE2   . HIS A 1 531 ? -31.284 29.616  80.510  1.00 47.88  ? 531  HIS A NE2   1 
ATOM   4221  N N     . ILE A 1 532 ? -33.877 27.669  82.969  1.00 45.02  ? 532  ILE A N     1 
ATOM   4222  C CA    . ILE A 1 532 ? -33.488 26.263  82.824  1.00 44.23  ? 532  ILE A CA    1 
ATOM   4223  C C     . ILE A 1 532 ? -34.298 25.336  83.727  1.00 44.56  ? 532  ILE A C     1 
ATOM   4224  O O     . ILE A 1 532 ? -34.111 24.122  83.682  1.00 45.62  ? 532  ILE A O     1 
ATOM   4225  C CB    . ILE A 1 532 ? -31.973 26.027  83.078  1.00 45.12  ? 532  ILE A CB    1 
ATOM   4226  C CG1   . ILE A 1 532 ? -31.590 26.180  84.551  1.00 43.68  ? 532  ILE A CG1   1 
ATOM   4227  C CG2   . ILE A 1 532 ? -31.133 26.963  82.260  1.00 45.72  ? 532  ILE A CG2   1 
ATOM   4228  C CD1   . ILE A 1 532 ? -30.499 25.219  84.932  1.00 42.87  ? 532  ILE A CD1   1 
ATOM   4229  N N     . LEU A 1 533 ? -35.193 25.899  84.539  1.00 44.46  ? 533  LEU A N     1 
ATOM   4230  C CA    . LEU A 1 533 ? -35.869 25.119  85.580  1.00 45.11  ? 533  LEU A CA    1 
ATOM   4231  C C     . LEU A 1 533 ? -37.260 24.628  85.139  1.00 44.63  ? 533  LEU A C     1 
ATOM   4232  O O     . LEU A 1 533 ? -37.939 25.277  84.336  1.00 43.91  ? 533  LEU A O     1 
ATOM   4233  C CB    . LEU A 1 533 ? -35.983 25.950  86.883  1.00 44.91  ? 533  LEU A CB    1 
ATOM   4234  C CG    . LEU A 1 533 ? -34.675 26.463  87.501  1.00 42.43  ? 533  LEU A CG    1 
ATOM   4235  C CD1   . LEU A 1 533 ? -34.921 27.316  88.758  1.00 38.00  ? 533  LEU A CD1   1 
ATOM   4236  C CD2   . LEU A 1 533 ? -33.732 25.313  87.815  1.00 42.02  ? 533  LEU A CD2   1 
ATOM   4237  N N     . ASP A 1 534 ? -37.688 23.483  85.671  1.00 45.29  ? 534  ASP A N     1 
ATOM   4238  C CA    . ASP A 1 534 ? -39.064 23.029  85.447  1.00 46.95  ? 534  ASP A CA    1 
ATOM   4239  C C     . ASP A 1 534 ? -40.018 23.937  86.227  1.00 48.09  ? 534  ASP A C     1 
ATOM   4240  O O     . ASP A 1 534 ? -39.563 24.858  86.938  1.00 47.29  ? 534  ASP A O     1 
ATOM   4241  C CB    . ASP A 1 534 ? -39.258 21.531  85.780  1.00 47.34  ? 534  ASP A CB    1 
ATOM   4242  C CG    . ASP A 1 534 ? -39.063 21.203  87.248  1.00 51.19  ? 534  ASP A CG    1 
ATOM   4243  O OD1   . ASP A 1 534 ? -39.116 22.108  88.115  1.00 57.17  ? 534  ASP A OD1   1 
ATOM   4244  O OD2   . ASP A 1 534 ? -38.864 20.007  87.531  1.00 52.30  ? 534  ASP A OD2   1 
ATOM   4245  N N     . GLU A 1 535 ? -41.324 23.682  86.085  1.00 48.59  ? 535  GLU A N     1 
ATOM   4246  C CA    . GLU A 1 535 ? -42.381 24.542  86.656  1.00 49.03  ? 535  GLU A CA    1 
ATOM   4247  C C     . GLU A 1 535 ? -42.325 24.629  88.188  1.00 47.82  ? 535  GLU A C     1 
ATOM   4248  O O     . GLU A 1 535 ? -42.480 25.708  88.779  1.00 45.03  ? 535  GLU A O     1 
ATOM   4249  C CB    . GLU A 1 535 ? -43.780 24.042  86.253  1.00 50.97  ? 535  GLU A CB    1 
ATOM   4250  C CG    . GLU A 1 535 ? -44.189 24.369  84.812  1.00 57.41  ? 535  GLU A CG    1 
ATOM   4251  C CD    . GLU A 1 535 ? -43.781 23.296  83.813  1.00 62.45  ? 535  GLU A CD    1 
ATOM   4252  O OE1   . GLU A 1 535 ? -42.559 23.049  83.659  1.00 62.62  ? 535  GLU A OE1   1 
ATOM   4253  O OE2   . GLU A 1 535 ? -44.690 22.709  83.179  1.00 66.98  ? 535  GLU A OE2   1 
ATOM   4254  N N     . LYS A 1 536 ? -42.076 23.479  88.808  1.00 48.20  ? 536  LYS A N     1 
ATOM   4255  C CA    . LYS A 1 536 ? -42.031 23.329  90.267  1.00 48.87  ? 536  LYS A CA    1 
ATOM   4256  C C     . LYS A 1 536 ? -40.863 24.126  90.866  1.00 46.98  ? 536  LYS A C     1 
ATOM   4257  O O     . LYS A 1 536 ? -41.030 24.869  91.829  1.00 46.40  ? 536  LYS A O     1 
ATOM   4258  C CB    . LYS A 1 536 ? -41.847 21.852  90.689  1.00 50.59  ? 536  LYS A CB    1 
ATOM   4259  C CG    . LYS A 1 536 ? -42.740 20.807  89.988  1.00 56.19  ? 536  LYS A CG    1 
ATOM   4260  C CD    . LYS A 1 536 ? -42.348 20.679  88.533  1.00 57.64  ? 536  LYS A CD    1 
ATOM   4261  C CE    . LYS A 1 536 ? -42.783 19.426  87.882  1.00 61.23  ? 536  LYS A CE    1 
ATOM   4262  N NZ    . LYS A 1 536 ? -42.292 19.466  86.465  1.00 63.35  ? 536  LYS A NZ    1 
ATOM   4263  N N     . ASP A 1 537 ? -39.673 23.930  90.298  1.00 45.59  ? 537  ASP A N     1 
ATOM   4264  C CA    . ASP A 1 537 ? -38.459 24.583  90.799  1.00 45.80  ? 537  ASP A CA    1 
ATOM   4265  C C     . ASP A 1 537 ? -38.440 26.072  90.466  1.00 44.11  ? 537  ASP A C     1 
ATOM   4266  O O     . ASP A 1 537 ? -37.890 26.884  91.210  1.00 42.00  ? 537  ASP A O     1 
ATOM   4267  C CB    . ASP A 1 537 ? -37.215 23.888  90.249  1.00 45.89  ? 537  ASP A CB    1 
ATOM   4268  C CG    . ASP A 1 537 ? -36.936 22.550  90.943  1.00 49.81  ? 537  ASP A CG    1 
ATOM   4269  O OD1   . ASP A 1 537 ? -37.259 22.434  92.159  1.00 41.65  ? 537  ASP A OD1   1 
ATOM   4270  O OD2   . ASP A 1 537 ? -36.387 21.633  90.269  1.00 50.11  ? 537  ASP A OD2   1 
ATOM   4271  N N     . CYS A 1 538 ? -39.043 26.421  89.336  1.00 45.49  ? 538  CYS A N     1 
ATOM   4272  C CA    . CYS A 1 538 ? -39.250 27.817  88.969  1.00 45.11  ? 538  CYS A CA    1 
ATOM   4273  C C     . CYS A 1 538 ? -40.041 28.612  90.046  1.00 44.10  ? 538  CYS A C     1 
ATOM   4274  O O     . CYS A 1 538 ? -39.710 29.769  90.351  1.00 43.09  ? 538  CYS A O     1 
ATOM   4275  C CB    . CYS A 1 538 ? -39.984 27.866  87.620  1.00 46.79  ? 538  CYS A CB    1 
ATOM   4276  S SG    . CYS A 1 538 ? -40.125 29.504  86.945  1.00 55.18  ? 538  CYS A SG    1 
ATOM   4277  N N     . ALA A 1 539 ? -41.085 27.998  90.603  1.00 42.96  ? 539  ALA A N     1 
ATOM   4278  C CA    . ALA A 1 539 ? -41.858 28.607  91.687  1.00 41.91  ? 539  ALA A CA    1 
ATOM   4279  C C     . ALA A 1 539 ? -40.993 28.798  92.949  1.00 41.81  ? 539  ALA A C     1 
ATOM   4280  O O     . ALA A 1 539 ? -40.944 29.898  93.517  1.00 41.48  ? 539  ALA A O     1 
ATOM   4281  C CB    . ALA A 1 539 ? -43.095 27.772  92.002  1.00 41.73  ? 539  ALA A CB    1 
ATOM   4282  N N     . VAL A 1 540 ? -40.287 27.745  93.367  1.00 40.00  ? 540  VAL A N     1 
ATOM   4283  C CA    . VAL A 1 540 ? -39.376 27.847  94.515  1.00 38.26  ? 540  VAL A CA    1 
ATOM   4284  C C     . VAL A 1 540 ? -38.299 28.902  94.251  1.00 37.44  ? 540  VAL A C     1 
ATOM   4285  O O     . VAL A 1 540 ? -37.970 29.704  95.116  1.00 36.76  ? 540  VAL A O     1 
ATOM   4286  C CB    . VAL A 1 540 ? -38.739 26.502  94.879  1.00 39.34  ? 540  VAL A CB    1 
ATOM   4287  C CG1   . VAL A 1 540 ? -37.626 26.690  95.901  1.00 39.83  ? 540  VAL A CG1   1 
ATOM   4288  C CG2   . VAL A 1 540 ? -39.791 25.555  95.428  1.00 38.97  ? 540  VAL A CG2   1 
ATOM   4289  N N     . SER A 1 541 ? -37.753 28.932  93.049  1.00 37.56  ? 541  SER A N     1 
ATOM   4290  C CA    . SER A 1 541 ? -36.859 30.020  92.687  1.00 36.93  ? 541  SER A CA    1 
ATOM   4291  C C     . SER A 1 541 ? -37.448 31.363  93.087  1.00 37.04  ? 541  SER A C     1 
ATOM   4292  O O     . SER A 1 541 ? -36.759 32.192  93.695  1.00 36.79  ? 541  SER A O     1 
ATOM   4293  C CB    . SER A 1 541 ? -36.583 30.024  91.192  1.00 35.60  ? 541  SER A CB    1 
ATOM   4294  O OG    . SER A 1 541 ? -35.595 31.005  90.856  1.00 38.65  ? 541  SER A OG    1 
ATOM   4295  N N     . GLU A 1 542 ? -38.714 31.579  92.738  1.00 38.37  ? 542  GLU A N     1 
ATOM   4296  C CA    . GLU A 1 542 ? -39.380 32.860  92.979  1.00 39.80  ? 542  GLU A CA    1 
ATOM   4297  C C     . GLU A 1 542 ? -39.565 33.135  94.484  1.00 38.17  ? 542  GLU A C     1 
ATOM   4298  O O     . GLU A 1 542 ? -39.420 34.282  94.934  1.00 39.08  ? 542  GLU A O     1 
ATOM   4299  C CB    . GLU A 1 542 ? -40.718 32.937  92.228  1.00 41.47  ? 542  GLU A CB    1 
ATOM   4300  C CG    . GLU A 1 542 ? -40.536 33.064  90.710  1.00 45.04  ? 542  GLU A CG    1 
ATOM   4301  C CD    . GLU A 1 542 ? -41.823 32.905  89.919  1.00 47.73  ? 542  GLU A CD    1 
ATOM   4302  O OE1   . GLU A 1 542 ? -42.916 32.775  90.534  1.00 59.28  ? 542  GLU A OE1   1 
ATOM   4303  O OE2   . GLU A 1 542 ? -41.739 32.921  88.666  1.00 62.13  ? 542  GLU A OE2   1 
ATOM   4304  N N     . ASN A 1 543 ? -39.867 32.090  95.257  1.00 35.65  ? 543  ASN A N     1 
ATOM   4305  C CA    . ASN A 1 543 ? -39.828 32.175  96.736  1.00 34.97  ? 543  ASN A CA    1 
ATOM   4306  C C     . ASN A 1 543 ? -38.549 32.764  97.270  1.00 33.57  ? 543  ASN A C     1 
ATOM   4307  O O     . ASN A 1 543 ? -38.545 33.702  98.077  1.00 32.56  ? 543  ASN A O     1 
ATOM   4308  C CB    . ASN A 1 543 ? -39.909 30.792  97.383  1.00 34.35  ? 543  ASN A CB    1 
ATOM   4309  C CG    . ASN A 1 543 ? -41.289 30.209  97.352  1.00 41.75  ? 543  ASN A CG    1 
ATOM   4310  O OD1   . ASN A 1 543 ? -41.557 29.190  98.013  1.00 43.42  ? 543  ASN A OD1   1 
ATOM   4311  N ND2   . ASN A 1 543 ? -42.197 30.858  96.611  1.00 34.21  ? 543  ASN A ND2   1 
ATOM   4312  N N     . PHE A 1 544 ? -37.435 32.170  96.851  1.00 33.63  ? 544  PHE A N     1 
ATOM   4313  C CA    . PHE A 1 544 ? -36.144 32.627  97.320  1.00 32.81  ? 544  PHE A CA    1 
ATOM   4314  C C     . PHE A 1 544 ? -35.821 34.009  96.859  1.00 33.05  ? 544  PHE A C     1 
ATOM   4315  O O     . PHE A 1 544 ? -35.211 34.770  97.634  1.00 32.04  ? 544  PHE A O     1 
ATOM   4316  C CB    . PHE A 1 544 ? -35.015 31.684  96.925  1.00 30.88  ? 544  PHE A CB    1 
ATOM   4317  C CG    . PHE A 1 544 ? -34.898 30.513  97.830  1.00 30.04  ? 544  PHE A CG    1 
ATOM   4318  C CD1   . PHE A 1 544 ? -35.708 29.407  97.652  1.00 24.81  ? 544  PHE A CD1   1 
ATOM   4319  C CD2   . PHE A 1 544 ? -33.985 30.516  98.875  1.00 33.08  ? 544  PHE A CD2   1 
ATOM   4320  C CE1   . PHE A 1 544 ? -35.617 28.325  98.507  1.00 31.58  ? 544  PHE A CE1   1 
ATOM   4321  C CE2   . PHE A 1 544 ? -33.893 29.433  99.732  1.00 29.98  ? 544  PHE A CE2   1 
ATOM   4322  C CZ    . PHE A 1 544 ? -34.711 28.340  99.543  1.00 30.93  ? 544  PHE A CZ    1 
ATOM   4323  N N     . GLN A 1 545 ? -36.184 34.335  95.615  1.00 34.49  ? 545  GLN A N     1 
ATOM   4324  C CA    . GLN A 1 545 ? -35.859 35.656  95.066  1.00 36.36  ? 545  GLN A CA    1 
ATOM   4325  C C     . GLN A 1 545 ? -36.554 36.786  95.821  1.00 34.94  ? 545  GLN A C     1 
ATOM   4326  O O     . GLN A 1 545 ? -35.972 37.865  96.004  1.00 35.72  ? 545  GLN A O     1 
ATOM   4327  C CB    . GLN A 1 545 ? -36.232 35.790  93.587  1.00 39.45  ? 545  GLN A CB    1 
ATOM   4328  C CG    . GLN A 1 545 ? -36.314 37.294  93.191  1.00 40.80  ? 545  GLN A CG    1 
ATOM   4329  C CD    . GLN A 1 545 ? -36.188 37.558  91.719  1.00 44.50  ? 545  GLN A CD    1 
ATOM   4330  O OE1   . GLN A 1 545 ? -36.247 36.642  90.896  1.00 52.77  ? 545  GLN A OE1   1 
ATOM   4331  N NE2   . GLN A 1 545 ? -36.016 38.825  91.373  1.00 50.59  ? 545  GLN A NE2   1 
ATOM   4332  N N     . GLU A 1 546 ? -37.801 36.547  96.197  1.00 35.16  ? 546  GLU A N     1 
ATOM   4333  C CA    . GLU A 1 546 ? -38.609 37.555  96.858  1.00 38.49  ? 546  GLU A CA    1 
ATOM   4334  C C     . GLU A 1 546 ? -38.196 37.704  98.326  1.00 37.01  ? 546  GLU A C     1 
ATOM   4335  O O     . GLU A 1 546 ? -38.287 38.792  98.894  1.00 37.25  ? 546  GLU A O     1 
ATOM   4336  C CB    . GLU A 1 546 ? -40.101 37.217  96.737  1.00 38.37  ? 546  GLU A CB    1 
ATOM   4337  C CG    . GLU A 1 546 ? -40.570 36.119  97.649  1.00 46.64  ? 546  GLU A CG    1 
ATOM   4338  C CD    . GLU A 1 546 ? -41.972 35.617  97.327  1.00 48.35  ? 546  GLU A CD    1 
ATOM   4339  O OE1   . GLU A 1 546 ? -42.359 35.613  96.117  1.00 55.44  ? 546  GLU A OE1   1 
ATOM   4340  O OE2   . GLU A 1 546 ? -42.667 35.201  98.299  1.00 57.96  ? 546  GLU A OE2   1 
ATOM   4341  N N     . PHE A 1 547 ? -37.745 36.596  98.920  1.00 35.39  ? 547  PHE A N     1 
ATOM   4342  C CA    . PHE A 1 547 ? -37.130 36.577  100.263 1.00 34.60  ? 547  PHE A CA    1 
ATOM   4343  C C     . PHE A 1 547 ? -35.890 37.450  100.310 1.00 34.27  ? 547  PHE A C     1 
ATOM   4344  O O     . PHE A 1 547 ? -35.657 38.167  101.281 1.00 33.64  ? 547  PHE A O     1 
ATOM   4345  C CB    . PHE A 1 547 ? -36.797 35.117  100.680 1.00 33.79  ? 547  PHE A CB    1 
ATOM   4346  C CG    . PHE A 1 547 ? -35.885 34.982  101.902 1.00 33.05  ? 547  PHE A CG    1 
ATOM   4347  C CD1   . PHE A 1 547 ? -36.351 35.261  103.182 1.00 29.82  ? 547  PHE A CD1   1 
ATOM   4348  C CD2   . PHE A 1 547 ? -34.587 34.524  101.772 1.00 32.91  ? 547  PHE A CD2   1 
ATOM   4349  C CE1   . PHE A 1 547 ? -35.513 35.123  104.310 1.00 33.20  ? 547  PHE A CE1   1 
ATOM   4350  C CE2   . PHE A 1 547 ? -33.747 34.380  102.897 1.00 32.38  ? 547  PHE A CE2   1 
ATOM   4351  C CZ    . PHE A 1 547 ? -34.214 34.689  104.160 1.00 29.81  ? 547  PHE A CZ    1 
ATOM   4352  N N     . LEU A 1 548 ? -35.099 37.409  99.245  1.00 35.19  ? 548  LEU A N     1 
ATOM   4353  C CA    . LEU A 1 548 ? -33.888 38.212  99.165  1.00 36.82  ? 548  LEU A CA    1 
ATOM   4354  C C     . LEU A 1 548 ? -34.152 39.668  98.853  1.00 38.11  ? 548  LEU A C     1 
ATOM   4355  O O     . LEU A 1 548 ? -33.414 40.557  99.320  1.00 36.93  ? 548  LEU A O     1 
ATOM   4356  C CB    . LEU A 1 548 ? -32.940 37.664  98.082  1.00 38.00  ? 548  LEU A CB    1 
ATOM   4357  C CG    . LEU A 1 548 ? -32.334 36.293  98.368  1.00 38.29  ? 548  LEU A CG    1 
ATOM   4358  C CD1   . LEU A 1 548 ? -31.689 35.733  97.117  1.00 38.97  ? 548  LEU A CD1   1 
ATOM   4359  C CD2   . LEU A 1 548 ? -31.328 36.345  99.505  1.00 42.10  ? 548  LEU A CD2   1 
ATOM   4360  N N     . SER A 1 549 ? -35.135 39.915  98.001  1.00 39.45  ? 549  SER A N     1 
ATOM   4361  C CA    . SER A 1 549 ? -35.447 41.287  97.608  1.00 39.85  ? 549  SER A CA    1 
ATOM   4362  C C     . SER A 1 549 ? -36.044 42.010  98.826  1.00 39.82  ? 549  SER A C     1 
ATOM   4363  O O     . SER A 1 549 ? -35.657 43.138  99.149  1.00 41.95  ? 549  SER A O     1 
ATOM   4364  C CB    . SER A 1 549 ? -36.405 41.311  96.424  1.00 39.75  ? 549  SER A CB    1 
ATOM   4365  O OG    . SER A 1 549 ? -37.712 40.964  96.848  1.00 46.41  ? 549  SER A OG    1 
ATOM   4366  N N     . LEU A 1 550 ? -36.968 41.336  99.511  1.00 38.42  ? 550  LEU A N     1 
ATOM   4367  C CA    . LEU A 1 550 ? -37.621 41.873  100.724 1.00 36.17  ? 550  LEU A CA    1 
ATOM   4368  C C     . LEU A 1 550 ? -36.590 42.271  101.782 1.00 35.61  ? 550  LEU A C     1 
ATOM   4369  O O     . LEU A 1 550 ? -36.691 43.328  102.431 1.00 34.87  ? 550  LEU A O     1 
ATOM   4370  C CB    . LEU A 1 550 ? -38.574 40.819  101.294 1.00 35.50  ? 550  LEU A CB    1 
ATOM   4371  C CG    . LEU A 1 550 ? -39.540 41.123  102.444 1.00 41.98  ? 550  LEU A CG    1 
ATOM   4372  C CD1   . LEU A 1 550 ? -40.725 40.173  102.397 1.00 50.20  ? 550  LEU A CD1   1 
ATOM   4373  C CD2   . LEU A 1 550 ? -38.900 41.031  103.804 1.00 49.69  ? 550  LEU A CD2   1 
ATOM   4374  N N     . ASN A 1 551 ? -35.573 41.427  101.937 1.00 33.26  ? 551  ASN A N     1 
ATOM   4375  C CA    . ASN A 1 551 ? -34.622 41.552  103.027 1.00 32.72  ? 551  ASN A CA    1 
ATOM   4376  C C     . ASN A 1 551 ? -33.286 42.059  102.538 1.00 33.47  ? 551  ASN A C     1 
ATOM   4377  O O     . ASN A 1 551 ? -32.294 42.015  103.282 1.00 33.67  ? 551  ASN A O     1 
ATOM   4378  C CB    . ASN A 1 551 ? -34.493 40.182  103.747 1.00 33.43  ? 551  ASN A CB    1 
ATOM   4379  C CG    . ASN A 1 551 ? -35.788 39.771  104.480 1.00 30.76  ? 551  ASN A CG    1 
ATOM   4380  O OD1   . ASN A 1 551 ? -36.247 40.503  105.349 1.00 37.95  ? 551  ASN A OD1   1 
ATOM   4381  N ND2   . ASN A 1 551 ? -36.366 38.614  104.147 1.00 21.10  ? 551  ASN A ND2   1 
ATOM   4382  N N     . GLY A 1 552 ? -33.260 42.609  101.317 1.00 35.64  ? 552  GLY A N     1 
ATOM   4383  C CA    . GLY A 1 552 ? -32.004 42.940  100.624 1.00 33.71  ? 552  GLY A CA    1 
ATOM   4384  C C     . GLY A 1 552 ? -31.189 44.030  101.270 1.00 34.29  ? 552  GLY A C     1 
ATOM   4385  O O     . GLY A 1 552 ? -29.962 44.048  101.181 1.00 33.12  ? 552  GLY A O     1 
ATOM   4386  N N     . HIS A 1 553 ? -31.878 44.962  101.904 1.00 35.21  ? 553  HIS A N     1 
ATOM   4387  C CA    . HIS A 1 553 ? -31.223 46.042  102.665 1.00 34.30  ? 553  HIS A CA    1 
ATOM   4388  C C     . HIS A 1 553 ? -30.497 45.535  103.920 1.00 34.70  ? 553  HIS A C     1 
ATOM   4389  O O     . HIS A 1 553 ? -29.669 46.250  104.492 1.00 35.66  ? 553  HIS A O     1 
ATOM   4390  C CB    . HIS A 1 553 ? -32.259 47.106  103.070 1.00 34.78  ? 553  HIS A CB    1 
ATOM   4391  C CG    . HIS A 1 553 ? -33.459 46.548  103.779 1.00 34.04  ? 553  HIS A CG    1 
ATOM   4392  N ND1   . HIS A 1 553 ? -33.738 46.814  105.105 1.00 32.02  ? 553  HIS A ND1   1 
ATOM   4393  C CD2   . HIS A 1 553 ? -34.448 45.735  103.343 1.00 35.32  ? 553  HIS A CD2   1 
ATOM   4394  C CE1   . HIS A 1 553 ? -34.847 46.185  105.454 1.00 39.22  ? 553  HIS A CE1   1 
ATOM   4395  N NE2   . HIS A 1 553 ? -35.298 45.522  104.403 1.00 39.28  ? 553  HIS A NE2   1 
ATOM   4396  N N     . LEU A 1 554 ? -30.830 44.320  104.369 1.00 33.71  ? 554  LEU A N     1 
ATOM   4397  C CA    . LEU A 1 554 ? -30.274 43.762  105.618 1.00 32.66  ? 554  LEU A CA    1 
ATOM   4398  C C     . LEU A 1 554 ? -29.101 42.815  105.380 1.00 30.75  ? 554  LEU A C     1 
ATOM   4399  O O     . LEU A 1 554 ? -28.201 42.666  106.226 1.00 28.56  ? 554  LEU A O     1 
ATOM   4400  C CB    . LEU A 1 554 ? -31.344 42.957  106.374 1.00 33.43  ? 554  LEU A CB    1 
ATOM   4401  C CG    . LEU A 1 554 ? -32.643 43.635  106.819 1.00 37.13  ? 554  LEU A CG    1 
ATOM   4402  C CD1   . LEU A 1 554 ? -33.485 42.639  107.584 1.00 32.96  ? 554  LEU A CD1   1 
ATOM   4403  C CD2   . LEU A 1 554 ? -32.370 44.869  107.689 1.00 41.52  ? 554  LEU A CD2   1 
ATOM   4404  N N     . LEU A 1 555 ? -29.131 42.140  104.239 1.00 31.62  ? 555  LEU A N     1 
ATOM   4405  C CA    . LEU A 1 555 ? -28.221 41.036  103.987 1.00 31.50  ? 555  LEU A CA    1 
ATOM   4406  C C     . LEU A 1 555 ? -26.823 41.534  103.667 1.00 30.91  ? 555  LEU A C     1 
ATOM   4407  O O     . LEU A 1 555 ? -26.631 42.417  102.833 1.00 29.96  ? 555  LEU A O     1 
ATOM   4408  C CB    . LEU A 1 555 ? -28.762 40.146  102.860 1.00 32.67  ? 555  LEU A CB    1 
ATOM   4409  C CG    . LEU A 1 555 ? -30.115 39.479  103.147 1.00 30.18  ? 555  LEU A CG    1 
ATOM   4410  C CD1   . LEU A 1 555 ? -30.765 39.027  101.857 1.00 30.06  ? 555  LEU A CD1   1 
ATOM   4411  C CD2   . LEU A 1 555 ? -29.964 38.299  104.108 1.00 29.69  ? 555  LEU A CD2   1 
ATOM   4412  N N     . GLY A 1 556 ? -25.849 40.969  104.367 1.00 32.13  ? 556  GLY A N     1 
ATOM   4413  C CA    . GLY A 1 556 ? -24.444 41.344  104.202 1.00 33.88  ? 556  GLY A CA    1 
ATOM   4414  C C     . GLY A 1 556 ? -24.015 42.555  105.008 1.00 34.93  ? 556  GLY A C     1 
ATOM   4415  O O     . GLY A 1 556 ? -22.876 43.019  104.875 1.00 32.89  ? 556  GLY A O     1 
ATOM   4416  N N     . ARG A 1 557 ? -24.918 43.082  105.830 1.00 38.78  ? 557  ARG A N     1 
ATOM   4417  C CA    . ARG A 1 557 ? -24.611 44.238  106.687 1.00 40.69  ? 557  ARG A CA    1 
ATOM   4418  C C     . ARG A 1 557 ? -24.408 43.803  108.122 1.00 41.21  ? 557  ARG A C     1 
ATOM   4419  O O     . ARG A 1 557 ? -25.264 43.191  108.734 1.00 41.17  ? 557  ARG A O     1 
ATOM   4420  C CB    . ARG A 1 557 ? -25.706 45.281  106.585 1.00 41.56  ? 557  ARG A CB    1 
ATOM   4421  C CG    . ARG A 1 557 ? -25.716 45.929  105.222 1.00 43.28  ? 557  ARG A CG    1 
ATOM   4422  C CD    . ARG A 1 557 ? -26.962 46.684  104.997 1.00 46.40  ? 557  ARG A CD    1 
ATOM   4423  N NE    . ARG A 1 557 ? -27.161 46.995  103.587 1.00 56.54  ? 557  ARG A NE    1 
ATOM   4424  C CZ    . ARG A 1 557 ? -26.689 48.076  102.968 1.00 64.33  ? 557  ARG A CZ    1 
ATOM   4425  N NH1   . ARG A 1 557 ? -25.955 48.982  103.617 1.00 68.43  ? 557  ARG A NH1   1 
ATOM   4426  N NH2   . ARG A 1 557 ? -26.952 48.240  101.679 1.00 64.68  ? 557  ARG A NH2   1 
ATOM   4427  N N     . GLN A 1 558 ? -23.236 44.128  108.630 1.00 41.97  ? 558  GLN A N     1 
ATOM   4428  C CA    . GLN A 1 558 ? -22.832 43.807  109.974 1.00 43.47  ? 558  GLN A CA    1 
ATOM   4429  C C     . GLN A 1 558 ? -23.517 44.807  110.928 1.00 43.38  ? 558  GLN A C     1 
ATOM   4430  O O     . GLN A 1 558 ? -23.603 45.990  110.601 1.00 43.97  ? 558  GLN A O     1 
ATOM   4431  C CB    . GLN A 1 558 ? -21.312 43.924  110.040 1.00 44.30  ? 558  GLN A CB    1 
ATOM   4432  C CG    . GLN A 1 558 ? -20.659 43.179  111.155 1.00 51.31  ? 558  GLN A CG    1 
ATOM   4433  C CD    . GLN A 1 558 ? -20.233 41.792  110.774 1.00 56.96  ? 558  GLN A CD    1 
ATOM   4434  O OE1   . GLN A 1 558 ? -20.708 40.811  111.360 1.00 62.57  ? 558  GLN A OE1   1 
ATOM   4435  N NE2   . GLN A 1 558 ? -19.315 41.689  109.799 1.00 55.56  ? 558  GLN A NE2   1 
ATOM   4436  N N     . PRO A 1 559 ? -24.049 44.334  112.081 1.00 41.48  ? 559  PRO A N     1 
ATOM   4437  C CA    . PRO A 1 559 ? -24.177 42.939  112.508 1.00 39.59  ? 559  PRO A CA    1 
ATOM   4438  C C     . PRO A 1 559 ? -25.179 42.159  111.666 1.00 37.39  ? 559  PRO A C     1 
ATOM   4439  O O     . PRO A 1 559 ? -26.285 42.621  111.381 1.00 36.69  ? 559  PRO A O     1 
ATOM   4440  C CB    . PRO A 1 559 ? -24.647 43.037  113.976 1.00 40.36  ? 559  PRO A CB    1 
ATOM   4441  C CG    . PRO A 1 559 ? -25.298 44.343  114.067 1.00 42.51  ? 559  PRO A CG    1 
ATOM   4442  C CD    . PRO A 1 559 ? -24.549 45.253  113.113 1.00 43.12  ? 559  PRO A CD    1 
ATOM   4443  N N     . PHE A 1 560 ? -24.769 40.966  111.283 1.00 36.46  ? 560  PHE A N     1 
ATOM   4444  C CA    . PHE A 1 560 ? -25.466 40.190  110.253 1.00 33.91  ? 560  PHE A CA    1 
ATOM   4445  C C     . PHE A 1 560 ? -26.838 39.715  110.746 1.00 33.01  ? 560  PHE A C     1 
ATOM   4446  O O     . PHE A 1 560 ? -26.956 39.279  111.890 1.00 32.13  ? 560  PHE A O     1 
ATOM   4447  C CB    . PHE A 1 560 ? -24.605 38.973  109.891 1.00 32.10  ? 560  PHE A CB    1 
ATOM   4448  C CG    . PHE A 1 560 ? -23.352 39.306  109.141 1.00 31.38  ? 560  PHE A CG    1 
ATOM   4449  C CD1   . PHE A 1 560 ? -23.334 40.303  108.177 1.00 35.02  ? 560  PHE A CD1   1 
ATOM   4450  C CD2   . PHE A 1 560 ? -22.196 38.585  109.363 1.00 33.21  ? 560  PHE A CD2   1 
ATOM   4451  C CE1   . PHE A 1 560 ? -22.172 40.587  107.461 1.00 31.24  ? 560  PHE A CE1   1 
ATOM   4452  C CE2   . PHE A 1 560 ? -21.048 38.856  108.656 1.00 37.07  ? 560  PHE A CE2   1 
ATOM   4453  C CZ    . PHE A 1 560 ? -21.043 39.868  107.686 1.00 31.25  ? 560  PHE A CZ    1 
ATOM   4454  N N     . PRO A 1 561 ? -27.871 39.787  109.886 1.00 31.81  ? 561  PRO A N     1 
ATOM   4455  C CA    . PRO A 1 561 ? -29.185 39.348  110.325 1.00 29.41  ? 561  PRO A CA    1 
ATOM   4456  C C     . PRO A 1 561 ? -29.242 37.823  110.544 1.00 28.80  ? 561  PRO A C     1 
ATOM   4457  O O     . PRO A 1 561 ? -28.422 37.057  110.016 1.00 28.59  ? 561  PRO A O     1 
ATOM   4458  C CB    . PRO A 1 561 ? -30.100 39.774  109.182 1.00 30.32  ? 561  PRO A CB    1 
ATOM   4459  C CG    . PRO A 1 561 ? -29.249 39.802  107.992 1.00 31.83  ? 561  PRO A CG    1 
ATOM   4460  C CD    . PRO A 1 561 ? -27.878 40.215  108.472 1.00 32.73  ? 561  PRO A CD    1 
ATOM   4461  N N     . ASN A 1 562 ? -30.199 37.405  111.357 1.00 27.74  ? 562  ASN A N     1 
ATOM   4462  C CA    . ASN A 1 562 ? -30.505 35.995  111.589 1.00 26.56  ? 562  ASN A CA    1 
ATOM   4463  C C     . ASN A 1 562 ? -31.367 35.512  110.455 1.00 25.22  ? 562  ASN A C     1 
ATOM   4464  O O     . ASN A 1 562 ? -32.543 35.835  110.379 1.00 23.26  ? 562  ASN A O     1 
ATOM   4465  C CB    . ASN A 1 562 ? -31.214 35.828  112.949 1.00 24.43  ? 562  ASN A CB    1 
ATOM   4466  C CG    . ASN A 1 562 ? -31.538 34.376  113.282 1.00 25.89  ? 562  ASN A CG    1 
ATOM   4467  O OD1   . ASN A 1 562 ? -31.626 33.525  112.393 1.00 22.99  ? 562  ASN A OD1   1 
ATOM   4468  N ND2   . ASN A 1 562 ? -31.746 34.093  114.570 1.00 24.41  ? 562  ASN A ND2   1 
ATOM   4469  N N     . ILE A 1 563 ? -30.770 34.737  109.564 1.00 25.82  ? 563  ILE A N     1 
ATOM   4470  C CA    . ILE A 1 563 ? -31.442 34.295  108.360 1.00 27.12  ? 563  ILE A CA    1 
ATOM   4471  C C     . ILE A 1 563 ? -32.594 33.341  108.645 1.00 25.66  ? 563  ILE A C     1 
ATOM   4472  O O     . ILE A 1 563 ? -33.572 33.333  107.936 1.00 21.70  ? 563  ILE A O     1 
ATOM   4473  C CB    . ILE A 1 563 ? -30.428 33.745  107.375 1.00 29.43  ? 563  ILE A CB    1 
ATOM   4474  C CG1   . ILE A 1 563 ? -29.689 34.952  106.794 1.00 36.04  ? 563  ILE A CG1   1 
ATOM   4475  C CG2   . ILE A 1 563 ? -31.079 33.011  106.210 1.00 29.27  ? 563  ILE A CG2   1 
ATOM   4476  C CD1   . ILE A 1 563 ? -28.366 34.649  106.336 1.00 44.33  ? 563  ILE A CD1   1 
ATOM   4477  N N     . VAL A 1 564 ? -32.487 32.566  109.713 1.00 25.33  ? 564  VAL A N     1 
ATOM   4478  C CA    . VAL A 1 564 ? -33.591 31.691  110.139 1.00 25.29  ? 564  VAL A CA    1 
ATOM   4479  C C     . VAL A 1 564 ? -34.811 32.490  110.629 1.00 23.08  ? 564  VAL A C     1 
ATOM   4480  O O     . VAL A 1 564 ? -35.913 32.190  110.235 1.00 26.06  ? 564  VAL A O     1 
ATOM   4481  C CB    . VAL A 1 564 ? -33.105 30.657  111.221 1.00 26.02  ? 564  VAL A CB    1 
ATOM   4482  C CG1   . VAL A 1 564 ? -34.278 29.992  111.979 1.00 24.70  ? 564  VAL A CG1   1 
ATOM   4483  C CG2   . VAL A 1 564 ? -32.201 29.636  110.559 1.00 21.74  ? 564  VAL A CG2   1 
ATOM   4484  N N     . GLN A 1 565 ? -34.599 33.505  111.462 1.00 19.69  ? 565  GLN A N     1 
ATOM   4485  C CA    . GLN A 1 565 ? -35.655 34.406  111.874 1.00 21.54  ? 565  GLN A CA    1 
ATOM   4486  C C     . GLN A 1 565 ? -36.318 35.079  110.678 1.00 21.54  ? 565  GLN A C     1 
ATOM   4487  O O     . GLN A 1 565 ? -37.538 35.090  110.589 1.00 22.83  ? 565  GLN A O     1 
ATOM   4488  C CB    . GLN A 1 565 ? -35.159 35.440  112.900 1.00 20.94  ? 565  GLN A CB    1 
ATOM   4489  C CG    . GLN A 1 565 ? -36.257 36.382  113.516 1.00 17.62  ? 565  GLN A CG    1 
ATOM   4490  C CD    . GLN A 1 565 ? -37.360 35.674  114.323 1.00 20.64  ? 565  GLN A CD    1 
ATOM   4491  O OE1   . GLN A 1 565 ? -37.121 34.680  114.994 1.00 18.40  ? 565  GLN A OE1   1 
ATOM   4492  N NE2   . GLN A 1 565 ? -38.561 36.241  114.308 1.00 20.39  ? 565  GLN A NE2   1 
ATOM   4493  N N     . LEU A 1 566 ? -35.527 35.614  109.761 1.00 22.38  ? 566  LEU A N     1 
ATOM   4494  C CA    . LEU A 1 566 ? -36.053 36.248  108.543 1.00 23.50  ? 566  LEU A CA    1 
ATOM   4495  C C     . LEU A 1 566 ? -36.882 35.293  107.711 1.00 24.05  ? 566  LEU A C     1 
ATOM   4496  O O     . LEU A 1 566 ? -37.947 35.661  107.187 1.00 24.92  ? 566  LEU A O     1 
ATOM   4497  C CB    . LEU A 1 566 ? -34.919 36.797  107.701 1.00 22.34  ? 566  LEU A CB    1 
ATOM   4498  C CG    . LEU A 1 566 ? -34.237 38.030  108.299 1.00 27.23  ? 566  LEU A CG    1 
ATOM   4499  C CD1   . LEU A 1 566 ? -33.007 38.376  107.486 1.00 22.10  ? 566  LEU A CD1   1 
ATOM   4500  C CD2   . LEU A 1 566 ? -35.195 39.212  108.387 1.00 28.26  ? 566  LEU A CD2   1 
ATOM   4501  N N     . GLY A 1 567 ? -36.410 34.058  107.598 1.00 24.44  ? 567  GLY A N     1 
ATOM   4502  C CA    . GLY A 1 567 ? -37.116 33.031  106.856 1.00 24.73  ? 567  GLY A CA    1 
ATOM   4503  C C     . GLY A 1 567 ? -38.408 32.591  107.491 1.00 23.80  ? 567  GLY A C     1 
ATOM   4504  O O     . GLY A 1 567 ? -39.322 32.140  106.814 1.00 24.03  ? 567  GLY A O     1 
ATOM   4505  N N     . LEU A 1 568 ? -38.478 32.691  108.802 1.00 24.24  ? 568  LEU A N     1 
ATOM   4506  C CA    . LEU A 1 568 ? -39.712 32.376  109.521 1.00 24.60  ? 568  LEU A CA    1 
ATOM   4507  C C     . LEU A 1 568 ? -40.809 33.447  109.345 1.00 24.83  ? 568  LEU A C     1 
ATOM   4508  O O     . LEU A 1 568 ? -41.939 33.229  109.775 1.00 23.36  ? 568  LEU A O     1 
ATOM   4509  C CB    . LEU A 1 568 ? -39.415 32.137  111.001 1.00 23.41  ? 568  LEU A CB    1 
ATOM   4510  C CG    . LEU A 1 568 ? -38.708 30.849  111.419 1.00 25.74  ? 568  LEU A CG    1 
ATOM   4511  C CD1   . LEU A 1 568 ? -38.327 30.945  112.868 1.00 23.74  ? 568  LEU A CD1   1 
ATOM   4512  C CD2   . LEU A 1 568 ? -39.578 29.605  111.192 1.00 26.40  ? 568  LEU A CD2   1 
ATOM   4513  N N     . CYS A 1 569 ? -40.449 34.584  108.735 1.00 27.26  ? 569  CYS A N     1 
ATOM   4514  C CA    . CYS A 1 569 ? -41.372 35.651  108.389 1.00 28.97  ? 569  CYS A CA    1 
ATOM   4515  C C     . CYS A 1 569 ? -41.896 35.525  106.959 1.00 32.34  ? 569  CYS A C     1 
ATOM   4516  O O     . CYS A 1 569 ? -42.646 36.386  106.498 1.00 34.98  ? 569  CYS A O     1 
ATOM   4517  C CB    . CYS A 1 569 ? -40.673 37.000  108.511 1.00 30.09  ? 569  CYS A CB    1 
ATOM   4518  S SG    . CYS A 1 569 ? -40.180 37.377  110.180 1.00 29.15  ? 569  CYS A SG    1 
ATOM   4519  N N     . GLU A 1 570 ? -41.463 34.494  106.240 1.00 32.14  ? 570  GLU A N     1 
ATOM   4520  C CA    . GLU A 1 570 ? -41.983 34.226  104.917 1.00 33.11  ? 570  GLU A CA    1 
ATOM   4521  C C     . GLU A 1 570 ? -43.306 33.472  105.001 1.00 32.64  ? 570  GLU A C     1 
ATOM   4522  O O     . GLU A 1 570 ? -43.575 32.790  106.001 1.00 29.85  ? 570  GLU A O     1 
ATOM   4523  C CB    . GLU A 1 570 ? -40.971 33.411  104.107 1.00 33.31  ? 570  GLU A CB    1 
ATOM   4524  C CG    . GLU A 1 570 ? -39.748 34.236  103.680 1.00 37.37  ? 570  GLU A CG    1 
ATOM   4525  C CD    . GLU A 1 570 ? -40.131 35.530  103.002 1.00 41.43  ? 570  GLU A CD    1 
ATOM   4526  O OE1   . GLU A 1 570 ? -40.848 35.456  101.982 1.00 49.04  ? 570  GLU A OE1   1 
ATOM   4527  O OE2   . GLU A 1 570 ? -39.735 36.613  103.486 1.00 41.56  ? 570  GLU A OE2   1 
ATOM   4528  N N     . PRO A 1 571 ? -44.126 33.566  103.932 1.00 35.01  ? 571  PRO A N     1 
ATOM   4529  C CA    . PRO A 1 571 ? -45.398 32.831  103.928 1.00 36.48  ? 571  PRO A CA    1 
ATOM   4530  C C     . PRO A 1 571 ? -45.162 31.346  104.187 1.00 37.98  ? 571  PRO A C     1 
ATOM   4531  O O     . PRO A 1 571 ? -44.157 30.788  103.727 1.00 39.56  ? 571  PRO A O     1 
ATOM   4532  C CB    . PRO A 1 571 ? -45.938 33.048  102.516 1.00 36.09  ? 571  PRO A CB    1 
ATOM   4533  C CG    . PRO A 1 571 ? -45.215 34.224  101.965 1.00 37.69  ? 571  PRO A CG    1 
ATOM   4534  C CD    . PRO A 1 571 ? -43.914 34.342  102.696 1.00 35.68  ? 571  PRO A CD    1 
ATOM   4535  N N     . GLU A 1 572 ? -46.068 30.716  104.917 1.00 38.70  ? 572  GLU A N     1 
ATOM   4536  C CA    . GLU A 1 572 ? -45.894 29.326  105.334 1.00 40.69  ? 572  GLU A CA    1 
ATOM   4537  C C     . GLU A 1 572 ? -45.904 28.340  104.152 1.00 41.01  ? 572  GLU A C     1 
ATOM   4538  O O     . GLU A 1 572 ? -45.525 27.181  104.308 1.00 41.47  ? 572  GLU A O     1 
ATOM   4539  C CB    . GLU A 1 572 ? -46.968 28.940  106.370 1.00 41.16  ? 572  GLU A CB    1 
ATOM   4540  C CG    . GLU A 1 572 ? -46.470 27.929  107.391 1.00 46.33  ? 572  GLU A CG    1 
ATOM   4541  C CD    . GLU A 1 572 ? -47.517 26.900  107.799 1.00 46.72  ? 572  GLU A CD    1 
ATOM   4542  O OE1   . GLU A 1 572 ? -48.409 27.222  108.617 1.00 54.82  ? 572  GLU A OE1   1 
ATOM   4543  O OE2   . GLU A 1 572 ? -47.423 25.752  107.305 1.00 60.04  ? 572  GLU A OE2   1 
ATOM   4544  N N     . THR A 1 573 ? -46.349 28.813  102.987 1.00 41.71  ? 573  THR A N     1 
ATOM   4545  C CA    . THR A 1 573 ? -46.319 28.044  101.748 1.00 41.11  ? 573  THR A CA    1 
ATOM   4546  C C     . THR A 1 573 ? -44.908 28.023  101.175 1.00 41.87  ? 573  THR A C     1 
ATOM   4547  O O     . THR A 1 573 ? -44.528 27.057  100.502 1.00 43.82  ? 573  THR A O     1 
ATOM   4548  C CB    . THR A 1 573 ? -47.283 28.648  100.715 1.00 43.20  ? 573  THR A CB    1 
ATOM   4549  O OG1   . THR A 1 573 ? -46.934 30.018  100.456 1.00 44.11  ? 573  THR A OG1   1 
ATOM   4550  C CG2   . THR A 1 573 ? -48.744 28.561  101.233 1.00 44.09  ? 573  THR A CG2   1 
ATOM   4551  N N     . SER A 1 574 ? -44.147 29.090  101.464 1.00 39.98  ? 574  SER A N     1 
ATOM   4552  C CA    . SER A 1 574 ? -42.773 29.297  100.962 1.00 36.49  ? 574  SER A CA    1 
ATOM   4553  C C     . SER A 1 574 ? -41.816 28.198  101.420 1.00 34.92  ? 574  SER A C     1 
ATOM   4554  O O     . SER A 1 574 ? -41.849 27.774  102.566 1.00 34.67  ? 574  SER A O     1 
ATOM   4555  C CB    . SER A 1 574 ? -42.234 30.643  101.461 1.00 36.10  ? 574  SER A CB    1 
ATOM   4556  O OG    . SER A 1 574 ? -41.095 31.086  100.732 1.00 37.09  ? 574  SER A OG    1 
ATOM   4557  N N     . GLU A 1 575 ? -40.965 27.738  100.516 1.00 35.06  ? 575  GLU A N     1 
ATOM   4558  C CA    . GLU A 1 575 ? -39.900 26.766  100.852 1.00 33.44  ? 575  GLU A CA    1 
ATOM   4559  C C     . GLU A 1 575 ? -38.822 27.390  101.754 1.00 29.94  ? 575  GLU A C     1 
ATOM   4560  O O     . GLU A 1 575 ? -38.081 26.697  102.436 1.00 30.22  ? 575  GLU A O     1 
ATOM   4561  C CB    . GLU A 1 575 ? -39.212 26.217  99.582  1.00 33.73  ? 575  GLU A CB    1 
ATOM   4562  C CG    . GLU A 1 575 ? -39.220 24.691  99.480  1.00 45.80  ? 575  GLU A CG    1 
ATOM   4563  C CD    . GLU A 1 575 ? -38.332 24.000  100.510 1.00 54.91  ? 575  GLU A CD    1 
ATOM   4564  O OE1   . GLU A 1 575 ? -37.084 24.141  100.411 1.00 50.54  ? 575  GLU A OE1   1 
ATOM   4565  O OE2   . GLU A 1 575 ? -38.891 23.304  101.400 1.00 57.94  ? 575  GLU A OE2   1 
ATOM   4566  N N     . VAL A 1 576 ? -38.712 28.709  101.721 1.00 28.76  ? 576  VAL A N     1 
ATOM   4567  C CA    . VAL A 1 576 ? -37.813 29.414  102.610 1.00 27.89  ? 576  VAL A CA    1 
ATOM   4568  C C     . VAL A 1 576 ? -38.307 29.250  104.041 1.00 27.34  ? 576  VAL A C     1 
ATOM   4569  O O     . VAL A 1 576 ? -37.548 28.864  104.920 1.00 27.02  ? 576  VAL A O     1 
ATOM   4570  C CB    . VAL A 1 576 ? -37.727 30.870  102.260 1.00 26.27  ? 576  VAL A CB    1 
ATOM   4571  C CG1   . VAL A 1 576 ? -36.833 31.608  103.282 1.00 26.52  ? 576  VAL A CG1   1 
ATOM   4572  C CG2   . VAL A 1 576 ? -37.205 31.012  100.827 1.00 24.48  ? 576  VAL A CG2   1 
ATOM   4573  N N     . TYR A 1 577 ? -39.592 29.515  104.270 1.00 27.38  ? 577  TYR A N     1 
ATOM   4574  C CA    . TYR A 1 577 ? -40.189 29.293  105.591 1.00 27.48  ? 577  TYR A CA    1 
ATOM   4575  C C     . TYR A 1 577 ? -40.047 27.860  106.046 1.00 27.27  ? 577  TYR A C     1 
ATOM   4576  O O     . TYR A 1 577 ? -39.746 27.597  107.206 1.00 26.60  ? 577  TYR A O     1 
ATOM   4577  C CB    . TYR A 1 577 ? -41.681 29.644  105.641 1.00 28.41  ? 577  TYR A CB    1 
ATOM   4578  C CG    . TYR A 1 577 ? -42.300 29.287  106.976 1.00 26.49  ? 577  TYR A CG    1 
ATOM   4579  C CD1   . TYR A 1 577 ? -42.833 28.016  107.213 1.00 27.25  ? 577  TYR A CD1   1 
ATOM   4580  C CD2   . TYR A 1 577 ? -42.307 30.203  108.016 1.00 27.91  ? 577  TYR A CD2   1 
ATOM   4581  C CE1   . TYR A 1 577 ? -43.391 27.679  108.466 1.00 26.94  ? 577  TYR A CE1   1 
ATOM   4582  C CE2   . TYR A 1 577 ? -42.840 29.881  109.259 1.00 27.81  ? 577  TYR A CE2   1 
ATOM   4583  C CZ    . TYR A 1 577 ? -43.389 28.634  109.479 1.00 26.05  ? 577  TYR A CZ    1 
ATOM   4584  O OH    . TYR A 1 577 ? -43.935 28.352  110.719 1.00 29.91  ? 577  TYR A OH    1 
ATOM   4585  N N     . GLN A 1 578 ? -40.309 26.918  105.146 1.00 29.35  ? 578  GLN A N     1 
ATOM   4586  C CA    . GLN A 1 578 ? -40.232 25.506  105.516 1.00 29.37  ? 578  GLN A CA    1 
ATOM   4587  C C     . GLN A 1 578 ? -38.815 25.124  105.889 1.00 29.25  ? 578  GLN A C     1 
ATOM   4588  O O     . GLN A 1 578 ? -38.598 24.430  106.881 1.00 30.95  ? 578  GLN A O     1 
ATOM   4589  C CB    . GLN A 1 578 ? -40.764 24.603  104.397 1.00 30.98  ? 578  GLN A CB    1 
ATOM   4590  C CG    . GLN A 1 578 ? -42.267 24.799  104.105 1.00 34.39  ? 578  GLN A CG    1 
ATOM   4591  C CD    . GLN A 1 578 ? -43.137 24.564  105.324 1.00 40.07  ? 578  GLN A CD    1 
ATOM   4592  O OE1   . GLN A 1 578 ? -42.916 23.622  106.082 1.00 41.66  ? 578  GLN A OE1   1 
ATOM   4593  N NE2   . GLN A 1 578 ? -44.122 25.438  105.535 1.00 44.90  ? 578  GLN A NE2   1 
ATOM   4594  N N     . GLN A 1 579 ? -37.833 25.600  105.122 1.00 30.30  ? 579  GLN A N     1 
ATOM   4595  C CA    . GLN A 1 579 ? -36.438 25.401  105.521 1.00 29.98  ? 579  GLN A CA    1 
ATOM   4596  C C     . GLN A 1 579 ? -36.082 26.106  106.830 1.00 30.80  ? 579  GLN A C     1 
ATOM   4597  O O     . GLN A 1 579 ? -35.358 25.549  107.659 1.00 31.31  ? 579  GLN A O     1 
ATOM   4598  C CB    . GLN A 1 579 ? -35.462 25.824  104.437 1.00 30.16  ? 579  GLN A CB    1 
ATOM   4599  C CG    . GLN A 1 579 ? -35.073 24.718  103.460 1.00 29.82  ? 579  GLN A CG    1 
ATOM   4600  C CD    . GLN A 1 579 ? -34.025 25.198  102.449 1.00 30.53  ? 579  GLN A CD    1 
ATOM   4601  O OE1   . GLN A 1 579 ? -33.021 25.834  102.807 1.00 26.05  ? 579  GLN A OE1   1 
ATOM   4602  N NE2   . GLN A 1 579 ? -34.271 24.912  101.182 1.00 22.33  ? 579  GLN A NE2   1 
ATOM   4603  N N     . ALA A 1 580 ? -36.572 27.335  107.010 1.00 30.86  ? 580  ALA A N     1 
ATOM   4604  C CA    . ALA A 1 580 ? -36.300 28.088  108.248 1.00 29.66  ? 580  ALA A CA    1 
ATOM   4605  C C     . ALA A 1 580 ? -36.915 27.371  109.457 1.00 29.16  ? 580  ALA A C     1 
ATOM   4606  O O     . ALA A 1 580 ? -36.294 27.280  110.520 1.00 27.82  ? 580  ALA A O     1 
ATOM   4607  C CB    . ALA A 1 580 ? -36.792 29.503  108.144 1.00 27.79  ? 580  ALA A CB    1 
ATOM   4608  N N     . LYS A 1 581 ? -38.113 26.828  109.274 1.00 31.12  ? 581  LYS A N     1 
ATOM   4609  C CA    . LYS A 1 581 ? -38.793 26.057  110.336 1.00 33.60  ? 581  LYS A CA    1 
ATOM   4610  C C     . LYS A 1 581 ? -37.979 24.844  110.782 1.00 35.37  ? 581  LYS A C     1 
ATOM   4611  O O     . LYS A 1 581 ? -37.940 24.529  111.989 1.00 34.60  ? 581  LYS A O     1 
ATOM   4612  C CB    . LYS A 1 581 ? -40.165 25.569  109.867 1.00 32.65  ? 581  LYS A CB    1 
ATOM   4613  C CG    . LYS A 1 581 ? -41.035 24.975  110.952 1.00 34.86  ? 581  LYS A CG    1 
ATOM   4614  C CD    . LYS A 1 581 ? -41.769 26.089  111.690 1.00 46.32  ? 581  LYS A CD    1 
ATOM   4615  C CE    . LYS A 1 581 ? -42.379 25.674  113.047 1.00 46.77  ? 581  LYS A CE    1 
ATOM   4616  N NZ    . LYS A 1 581 ? -42.124 26.749  114.051 1.00 45.67  ? 581  LYS A NZ    1 
ATOM   4617  N N     . LEU A 1 582 ? -37.360 24.152  109.812 1.00 36.69  ? 582  LEU A N     1 
ATOM   4618  C CA    . LEU A 1 582 ? -36.556 22.960  110.107 1.00 37.47  ? 582  LEU A CA    1 
ATOM   4619  C C     . LEU A 1 582 ? -35.323 23.312  110.902 1.00 37.32  ? 582  LEU A C     1 
ATOM   4620  O O     . LEU A 1 582 ? -35.005 22.639  111.876 1.00 37.55  ? 582  LEU A O     1 
ATOM   4621  C CB    . LEU A 1 582 ? -36.137 22.205  108.835 1.00 36.97  ? 582  LEU A CB    1 
ATOM   4622  C CG    . LEU A 1 582 ? -37.162 21.214  108.278 1.00 44.92  ? 582  LEU A CG    1 
ATOM   4623  C CD1   . LEU A 1 582 ? -36.678 20.600  106.972 1.00 45.99  ? 582  LEU A CD1   1 
ATOM   4624  C CD2   . LEU A 1 582 ? -37.497 20.111  109.294 1.00 49.14  ? 582  LEU A CD2   1 
ATOM   4625  N N     . GLN A 1 583 ? -34.628 24.363  110.484 1.00 38.73  ? 583  GLN A N     1 
ATOM   4626  C CA    . GLN A 1 583 ? -33.433 24.807  111.195 1.00 40.44  ? 583  GLN A CA    1 
ATOM   4627  C C     . GLN A 1 583 ? -33.720 25.275  112.611 1.00 40.44  ? 583  GLN A C     1 
ATOM   4628  O O     . GLN A 1 583 ? -32.927 25.022  113.513 1.00 41.39  ? 583  GLN A O     1 
ATOM   4629  C CB    . GLN A 1 583 ? -32.696 25.910  110.433 1.00 39.06  ? 583  GLN A CB    1 
ATOM   4630  C CG    . GLN A 1 583 ? -31.959 25.373  109.235 1.00 43.81  ? 583  GLN A CG    1 
ATOM   4631  C CD    . GLN A 1 583 ? -30.832 26.279  108.752 1.00 43.98  ? 583  GLN A CD    1 
ATOM   4632  O OE1   . GLN A 1 583 ? -30.237 27.040  109.526 1.00 47.87  ? 583  GLN A OE1   1 
ATOM   4633  N NE2   . GLN A 1 583 ? -30.530 26.181  107.463 1.00 40.92  ? 583  GLN A NE2   1 
ATOM   4634  N N     . ALA A 1 584 ? -34.835 25.979  112.794 1.00 41.22  ? 584  ALA A N     1 
ATOM   4635  C CA    . ALA A 1 584 ? -35.233 26.461  114.108 1.00 43.95  ? 584  ALA A CA    1 
ATOM   4636  C C     . ALA A 1 584 ? -35.362 25.290  115.081 1.00 47.13  ? 584  ALA A C     1 
ATOM   4637  O O     . ALA A 1 584 ? -34.783 25.321  116.156 1.00 48.73  ? 584  ALA A O     1 
ATOM   4638  C CB    . ALA A 1 584 ? -36.534 27.233  114.019 1.00 42.20  ? 584  ALA A CB    1 
ATOM   4639  N N     . LYS A 1 585 ? -36.114 24.265  114.689 1.00 50.46  ? 585  LYS A N     1 
ATOM   4640  C CA    . LYS A 1 585 ? -36.180 23.006  115.449 1.00 53.98  ? 585  LYS A CA    1 
ATOM   4641  C C     . LYS A 1 585 ? -34.813 22.352  115.651 1.00 56.12  ? 585  LYS A C     1 
ATOM   4642  O O     . LYS A 1 585 ? -34.439 22.024  116.773 1.00 54.76  ? 585  LYS A O     1 
ATOM   4643  C CB    . LYS A 1 585 ? -37.102 21.990  114.763 1.00 54.84  ? 585  LYS A CB    1 
ATOM   4644  C CG    . LYS A 1 585 ? -38.561 22.153  115.115 1.00 58.99  ? 585  LYS A CG    1 
ATOM   4645  C CD    . LYS A 1 585 ? -38.871 21.558  116.481 1.00 63.66  ? 585  LYS A CD    1 
ATOM   4646  C CE    . LYS A 1 585 ? -40.264 21.956  116.950 1.00 62.29  ? 585  LYS A CE    1 
ATOM   4647  N NZ    . LYS A 1 585 ? -40.614 21.243  118.198 1.00 62.02  ? 585  LYS A NZ    1 
ATOM   4648  N N     . GLN A 1 586 ? -34.077 22.155  114.559 1.00 60.04  ? 586  GLN A N     1 
ATOM   4649  C CA    . GLN A 1 586 ? -32.818 21.408  114.625 1.00 62.88  ? 586  GLN A CA    1 
ATOM   4650  C C     . GLN A 1 586 ? -31.790 22.182  115.452 1.00 66.53  ? 586  GLN A C     1 
ATOM   4651  O O     . GLN A 1 586 ? -30.851 21.594  115.985 1.00 68.99  ? 586  GLN A O     1 
ATOM   4652  C CB    . GLN A 1 586 ? -32.288 21.031  113.221 1.00 63.03  ? 586  GLN A CB    1 
ATOM   4653  C CG    . GLN A 1 586 ? -31.196 21.953  112.609 1.00 65.59  ? 586  GLN A CG    1 
ATOM   4654  C CD    . GLN A 1 586 ? -31.005 21.761  111.089 1.00 66.14  ? 586  GLN A CD    1 
ATOM   4655  O OE1   . GLN A 1 586 ? -30.110 22.360  110.482 1.00 71.19  ? 586  GLN A OE1   1 
ATOM   4656  N NE2   . GLN A 1 586 ? -31.852 20.936  110.477 1.00 71.56  ? 586  GLN A NE2   1 
ATOM   4657  N N     . MET B 1 1   ? 30.981  62.397  48.059  1.00 35.52  ? 1    MET B N     1 
ATOM   4658  C CA    . MET B 1 1   ? 30.373  63.710  48.421  1.00 33.68  ? 1    MET B CA    1 
ATOM   4659  C C     . MET B 1 1   ? 31.068  64.213  49.687  1.00 33.24  ? 1    MET B C     1 
ATOM   4660  O O     . MET B 1 1   ? 31.844  63.494  50.291  1.00 32.10  ? 1    MET B O     1 
ATOM   4661  C CB    . MET B 1 1   ? 28.849  63.579  48.608  1.00 32.82  ? 1    MET B CB    1 
ATOM   4662  C CG    . MET B 1 1   ? 28.419  62.577  49.664  1.00 32.19  ? 1    MET B CG    1 
ATOM   4663  S SD    . MET B 1 1   ? 26.638  62.453  49.903  1.00 33.20  ? 1    MET B SD    1 
ATOM   4664  C CE    . MET B 1 1   ? 26.101  61.702  48.359  1.00 27.55  ? 1    MET B CE    1 
ATOM   4665  N N     . ASP B 1 2   ? 30.794  65.453  50.073  1.00 33.43  ? 2    ASP B N     1 
ATOM   4666  C CA    . ASP B 1 2   ? 31.345  66.024  51.308  1.00 31.82  ? 2    ASP B CA    1 
ATOM   4667  C C     . ASP B 1 2   ? 30.927  65.182  52.514  1.00 27.72  ? 2    ASP B C     1 
ATOM   4668  O O     . ASP B 1 2   ? 29.907  64.523  52.477  1.00 23.72  ? 2    ASP B O     1 
ATOM   4669  C CB    . ASP B 1 2   ? 30.831  67.457  51.479  1.00 33.14  ? 2    ASP B CB    1 
ATOM   4670  C CG    . ASP B 1 2   ? 31.316  68.408  50.374  1.00 36.41  ? 2    ASP B CG    1 
ATOM   4671  O OD1   . ASP B 1 2   ? 32.303  68.090  49.657  1.00 35.71  ? 2    ASP B OD1   1 
ATOM   4672  O OD2   . ASP B 1 2   ? 30.686  69.482  50.231  1.00 45.20  ? 2    ASP B OD2   1 
ATOM   4673  N N     . ALA B 1 3   ? 31.712  65.199  53.577  1.00 29.05  ? 3    ALA B N     1 
ATOM   4674  C CA    . ALA B 1 3   ? 31.345  64.468  54.797  1.00 29.76  ? 3    ALA B CA    1 
ATOM   4675  C C     . ALA B 1 3   ? 30.013  64.956  55.368  1.00 30.41  ? 3    ALA B C     1 
ATOM   4676  O O     . ALA B 1 3   ? 29.188  64.137  55.780  1.00 29.36  ? 3    ALA B O     1 
ATOM   4677  C CB    . ALA B 1 3   ? 32.435  64.581  55.843  1.00 32.03  ? 3    ALA B CB    1 
ATOM   4678  N N     . LYS B 1 4   ? 29.796  66.281  55.378  1.00 29.68  ? 4    LYS B N     1 
ATOM   4679  C CA    . LYS B 1 4   ? 28.545  66.853  55.918  1.00 27.90  ? 4    LYS B CA    1 
ATOM   4680  C C     . LYS B 1 4   ? 27.361  66.098  55.347  1.00 23.74  ? 4    LYS B C     1 
ATOM   4681  O O     . LYS B 1 4   ? 26.501  65.625  56.090  1.00 24.80  ? 4    LYS B O     1 
ATOM   4682  C CB    . LYS B 1 4   ? 28.383  68.339  55.565  1.00 28.00  ? 4    LYS B CB    1 
ATOM   4683  C CG    . LYS B 1 4   ? 29.051  69.368  56.476  1.00 33.54  ? 4    LYS B CG    1 
ATOM   4684  C CD    . LYS B 1 4   ? 28.525  70.793  56.151  1.00 32.60  ? 4    LYS B CD    1 
ATOM   4685  C CE    . LYS B 1 4   ? 29.315  71.959  56.789  1.00 36.21  ? 4    LYS B CE    1 
ATOM   4686  N NZ    . LYS B 1 4   ? 30.815  71.787  56.851  1.00 33.44  ? 4    LYS B NZ    1 
ATOM   4687  N N     . ALA B 1 5   ? 27.319  66.023  54.019  1.00 22.62  ? 5    ALA B N     1 
ATOM   4688  C CA    . ALA B 1 5   ? 26.235  65.372  53.266  1.00 22.82  ? 5    ALA B CA    1 
ATOM   4689  C C     . ALA B 1 5   ? 26.143  63.864  53.530  1.00 21.22  ? 5    ALA B C     1 
ATOM   4690  O O     . ALA B 1 5   ? 25.058  63.333  53.668  1.00 20.34  ? 5    ALA B O     1 
ATOM   4691  C CB    . ALA B 1 5   ? 26.426  65.610  51.779  1.00 21.62  ? 5    ALA B CB    1 
ATOM   4692  N N     . ARG B 1 6   ? 27.280  63.175  53.537  1.00 20.35  ? 6    ARG B N     1 
ATOM   4693  C CA    . ARG B 1 6   ? 27.287  61.762  53.862  1.00 24.42  ? 6    ARG B CA    1 
ATOM   4694  C C     . ARG B 1 6   ? 26.675  61.535  55.238  1.00 23.23  ? 6    ARG B C     1 
ATOM   4695  O O     . ARG B 1 6   ? 25.810  60.695  55.407  1.00 22.15  ? 6    ARG B O     1 
ATOM   4696  C CB    . ARG B 1 6   ? 28.704  61.221  53.901  1.00 23.86  ? 6    ARG B CB    1 
ATOM   4697  C CG    . ARG B 1 6   ? 29.437  61.200  52.598  1.00 27.99  ? 6    ARG B CG    1 
ATOM   4698  C CD    . ARG B 1 6   ? 30.802  60.511  52.800  1.00 35.23  ? 6    ARG B CD    1 
ATOM   4699  N NE    . ARG B 1 6   ? 31.845  61.147  51.989  1.00 41.28  ? 6    ARG B NE    1 
ATOM   4700  C CZ    . ARG B 1 6   ? 32.964  61.666  52.474  1.00 40.15  ? 6    ARG B CZ    1 
ATOM   4701  N NH1   . ARG B 1 6   ? 33.223  61.613  53.776  1.00 43.58  ? 6    ARG B NH1   1 
ATOM   4702  N NH2   . ARG B 1 6   ? 33.845  62.228  51.643  1.00 50.69  ? 6    ARG B NH2   1 
ATOM   4703  N N     . ASN B 1 7   ? 27.151  62.293  56.218  1.00 21.67  ? 7    ASN B N     1 
ATOM   4704  C CA    . ASN B 1 7   ? 26.700  62.138  57.590  1.00 23.77  ? 7    ASN B CA    1 
ATOM   4705  C C     . ASN B 1 7   ? 25.250  62.435  57.789  1.00 22.10  ? 7    ASN B C     1 
ATOM   4706  O O     . ASN B 1 7   ? 24.615  61.849  58.665  1.00 24.40  ? 7    ASN B O     1 
ATOM   4707  C CB    . ASN B 1 7   ? 27.492  63.044  58.525  1.00 21.15  ? 7    ASN B CB    1 
ATOM   4708  C CG    . ASN B 1 7   ? 28.905  62.659  58.600  1.00 21.75  ? 7    ASN B CG    1 
ATOM   4709  O OD1   . ASN B 1 7   ? 29.251  61.507  58.339  1.00 27.85  ? 7    ASN B OD1   1 
ATOM   4710  N ND2   . ASN B 1 7   ? 29.770  63.625  58.936  1.00 20.81  ? 7    ASN B ND2   1 
ATOM   4711  N N     . CYS B 1 8   ? 24.749  63.393  57.023  1.00 23.44  ? 8    CYS B N     1 
ATOM   4712  C CA    . CYS B 1 8   ? 23.343  63.761  57.077  1.00 24.11  ? 8    CYS B CA    1 
ATOM   4713  C C     . CYS B 1 8   ? 22.529  62.628  56.477  1.00 25.39  ? 8    CYS B C     1 
ATOM   4714  O O     . CYS B 1 8   ? 21.510  62.201  57.035  1.00 28.66  ? 8    CYS B O     1 
ATOM   4715  C CB    . CYS B 1 8   ? 23.131  65.066  56.304  1.00 21.38  ? 8    CYS B CB    1 
ATOM   4716  S SG    . CYS B 1 8   ? 21.473  65.702  56.329  1.00 28.28  ? 8    CYS B SG    1 
ATOM   4717  N N     . LEU B 1 9   ? 22.968  62.156  55.313  1.00 28.16  ? 9    LEU B N     1 
ATOM   4718  C CA    . LEU B 1 9   ? 22.313  61.036  54.651  1.00 28.87  ? 9    LEU B CA    1 
ATOM   4719  C C     . LEU B 1 9   ? 22.352  59.809  55.577  1.00 28.44  ? 9    LEU B C     1 
ATOM   4720  O O     . LEU B 1 9   ? 21.340  59.140  55.769  1.00 27.47  ? 9    LEU B O     1 
ATOM   4721  C CB    . LEU B 1 9   ? 22.970  60.768  53.293  1.00 27.18  ? 9    LEU B CB    1 
ATOM   4722  C CG    . LEU B 1 9   ? 22.408  59.644  52.406  1.00 32.81  ? 9    LEU B CG    1 
ATOM   4723  C CD1   . LEU B 1 9   ? 20.869  59.622  52.351  1.00 31.25  ? 9    LEU B CD1   1 
ATOM   4724  C CD2   . LEU B 1 9   ? 22.999  59.728  50.976  1.00 34.01  ? 9    LEU B CD2   1 
ATOM   4725  N N     . LEU B 1 10  ? 23.505  59.558  56.186  1.00 30.62  ? 10   LEU B N     1 
ATOM   4726  C CA    . LEU B 1 10  ? 23.667  58.448  57.130  1.00 32.40  ? 10   LEU B CA    1 
ATOM   4727  C C     . LEU B 1 10  ? 22.745  58.565  58.324  1.00 33.36  ? 10   LEU B C     1 
ATOM   4728  O O     . LEU B 1 10  ? 22.123  57.600  58.714  1.00 32.25  ? 10   LEU B O     1 
ATOM   4729  C CB    . LEU B 1 10  ? 25.102  58.380  57.641  1.00 32.39  ? 10   LEU B CB    1 
ATOM   4730  C CG    . LEU B 1 10  ? 26.180  57.892  56.681  1.00 31.16  ? 10   LEU B CG    1 
ATOM   4731  C CD1   . LEU B 1 10  ? 27.510  58.078  57.351  1.00 35.86  ? 10   LEU B CD1   1 
ATOM   4732  C CD2   . LEU B 1 10  ? 25.967  56.451  56.265  1.00 30.73  ? 10   LEU B CD2   1 
ATOM   4733  N N     . GLN B 1 11  ? 22.659  59.752  58.906  1.00 37.11  ? 11   GLN B N     1 
ATOM   4734  C CA    . GLN B 1 11  ? 21.786  59.971  60.058  1.00 39.78  ? 11   GLN B CA    1 
ATOM   4735  C C     . GLN B 1 11  ? 20.305  59.659  59.792  1.00 42.70  ? 11   GLN B C     1 
ATOM   4736  O O     . GLN B 1 11  ? 19.619  59.108  60.647  1.00 41.85  ? 11   GLN B O     1 
ATOM   4737  C CB    . GLN B 1 11  ? 21.911  61.420  60.517  1.00 39.87  ? 11   GLN B CB    1 
ATOM   4738  C CG    . GLN B 1 11  ? 21.008  61.788  61.681  1.00 40.25  ? 11   GLN B CG    1 
ATOM   4739  C CD    . GLN B 1 11  ? 21.200  63.224  62.147  1.00 41.96  ? 11   GLN B CD    1 
ATOM   4740  O OE1   . GLN B 1 11  ? 20.222  63.900  62.502  1.00 40.07  ? 11   GLN B OE1   1 
ATOM   4741  N NE2   . GLN B 1 11  ? 22.464  63.694  62.169  1.00 38.75  ? 11   GLN B NE2   1 
ATOM   4742  N N     . HIS B 1 12  ? 19.801  60.049  58.626  1.00 45.65  ? 12   HIS B N     1 
ATOM   4743  C CA    . HIS B 1 12  ? 18.358  59.995  58.377  1.00 47.36  ? 12   HIS B CA    1 
ATOM   4744  C C     . HIS B 1 12  ? 17.933  58.806  57.509  1.00 49.59  ? 12   HIS B C     1 
ATOM   4745  O O     . HIS B 1 12  ? 16.781  58.677  57.139  1.00 49.47  ? 12   HIS B O     1 
ATOM   4746  C CB    . HIS B 1 12  ? 17.909  61.318  57.777  1.00 47.38  ? 12   HIS B CB    1 
ATOM   4747  C CG    . HIS B 1 12  ? 18.058  62.468  58.719  1.00 46.31  ? 12   HIS B CG    1 
ATOM   4748  N ND1   . HIS B 1 12  ? 18.798  63.590  58.416  1.00 48.37  ? 12   HIS B ND1   1 
ATOM   4749  C CD2   . HIS B 1 12  ? 17.577  62.657  59.970  1.00 41.08  ? 12   HIS B CD2   1 
ATOM   4750  C CE1   . HIS B 1 12  ? 18.748  64.433  59.433  1.00 47.63  ? 12   HIS B CE1   1 
ATOM   4751  N NE2   . HIS B 1 12  ? 18.014  63.890  60.388  1.00 46.68  ? 12   HIS B NE2   1 
ATOM   4752  N N     . ARG B 1 13  ? 18.891  57.936  57.231  1.00 52.74  ? 13   ARG B N     1 
ATOM   4753  C CA    . ARG B 1 13  ? 18.688  56.685  56.526  1.00 53.90  ? 13   ARG B CA    1 
ATOM   4754  C C     . ARG B 1 13  ? 17.586  55.806  57.128  1.00 56.16  ? 13   ARG B C     1 
ATOM   4755  O O     . ARG B 1 13  ? 16.938  55.059  56.403  1.00 55.92  ? 13   ARG B O     1 
ATOM   4756  C CB    . ARG B 1 13  ? 20.017  55.932  56.545  1.00 54.32  ? 13   ARG B CB    1 
ATOM   4757  C CG    . ARG B 1 13  ? 20.040  54.601  55.855  1.00 55.36  ? 13   ARG B CG    1 
ATOM   4758  C CD    . ARG B 1 13  ? 21.461  54.035  55.851  1.00 54.74  ? 13   ARG B CD    1 
ATOM   4759  N NE    . ARG B 1 13  ? 21.579  52.956  54.875  1.00 54.64  ? 13   ARG B NE    1 
ATOM   4760  C CZ    . ARG B 1 13  ? 22.717  52.553  54.307  1.00 59.00  ? 13   ARG B CZ    1 
ATOM   4761  N NH1   . ARG B 1 13  ? 23.891  53.088  54.643  1.00 60.18  ? 13   ARG B NH1   1 
ATOM   4762  N NH2   . ARG B 1 13  ? 22.684  51.575  53.406  1.00 61.00  ? 13   ARG B NH2   1 
ATOM   4763  N N     . GLU B 1 14  ? 17.387  55.870  58.445  1.00 58.85  ? 14   GLU B N     1 
ATOM   4764  C CA    . GLU B 1 14  ? 16.290  55.123  59.077  1.00 57.80  ? 14   GLU B CA    1 
ATOM   4765  C C     . GLU B 1 14  ? 14.966  55.693  58.583  1.00 56.50  ? 14   GLU B C     1 
ATOM   4766  O O     . GLU B 1 14  ? 14.096  54.955  58.125  1.00 55.08  ? 14   GLU B O     1 
ATOM   4767  C CB    . GLU B 1 14  ? 16.357  55.191  60.622  1.00 59.79  ? 14   GLU B CB    1 
ATOM   4768  C CG    . GLU B 1 14  ? 15.208  54.445  61.370  1.00 63.17  ? 14   GLU B CG    1 
ATOM   4769  C CD    . GLU B 1 14  ? 13.883  55.254  61.478  1.00 76.86  ? 14   GLU B CD    1 
ATOM   4770  O OE1   . GLU B 1 14  ? 13.851  56.251  62.242  1.00 81.21  ? 14   GLU B OE1   1 
ATOM   4771  O OE2   . GLU B 1 14  ? 12.869  54.888  60.817  1.00 79.66  ? 14   GLU B OE2   1 
ATOM   4772  N N     . ALA B 1 15  ? 14.826  57.010  58.689  1.00 56.02  ? 15   ALA B N     1 
ATOM   4773  C CA    . ALA B 1 15  ? 13.567  57.677  58.388  1.00 56.48  ? 15   ALA B CA    1 
ATOM   4774  C C     . ALA B 1 15  ? 13.226  57.599  56.897  1.00 56.35  ? 15   ALA B C     1 
ATOM   4775  O O     . ALA B 1 15  ? 12.062  57.482  56.535  1.00 57.16  ? 15   ALA B O     1 
ATOM   4776  C CB    . ALA B 1 15  ? 13.611  59.128  58.862  1.00 56.87  ? 15   ALA B CB    1 
ATOM   4777  N N     . LEU B 1 16  ? 14.253  57.656  56.048  1.00 55.80  ? 16   LEU B N     1 
ATOM   4778  C CA    . LEU B 1 16  ? 14.101  57.476  54.610  1.00 55.30  ? 16   LEU B CA    1 
ATOM   4779  C C     . LEU B 1 16  ? 13.716  56.054  54.246  1.00 54.52  ? 16   LEU B C     1 
ATOM   4780  O O     . LEU B 1 16  ? 13.044  55.835  53.245  1.00 56.00  ? 16   LEU B O     1 
ATOM   4781  C CB    . LEU B 1 16  ? 15.391  57.845  53.868  1.00 54.07  ? 16   LEU B CB    1 
ATOM   4782  C CG    . LEU B 1 16  ? 15.769  59.321  53.839  1.00 50.76  ? 16   LEU B CG    1 
ATOM   4783  C CD1   . LEU B 1 16  ? 17.248  59.488  53.456  1.00 53.41  ? 16   LEU B CD1   1 
ATOM   4784  C CD2   . LEU B 1 16  ? 14.862  60.070  52.880  1.00 49.14  ? 16   LEU B CD2   1 
ATOM   4785  N N     . GLU B 1 17  ? 14.149  55.088  55.037  1.00 54.77  ? 17   GLU B N     1 
ATOM   4786  C CA    . GLU B 1 17  ? 13.780  53.689  54.796  1.00 56.34  ? 17   GLU B CA    1 
ATOM   4787  C C     . GLU B 1 17  ? 12.327  53.401  55.173  1.00 55.57  ? 17   GLU B C     1 
ATOM   4788  O O     . GLU B 1 17  ? 11.616  52.741  54.427  1.00 53.89  ? 17   GLU B O     1 
ATOM   4789  C CB    . GLU B 1 17  ? 14.725  52.748  55.534  1.00 56.35  ? 17   GLU B CB    1 
ATOM   4790  C CG    . GLU B 1 17  ? 16.060  52.561  54.821  1.00 57.31  ? 17   GLU B CG    1 
ATOM   4791  C CD    . GLU B 1 17  ? 17.130  51.930  55.707  1.00 58.52  ? 17   GLU B CD    1 
ATOM   4792  O OE1   . GLU B 1 17  ? 16.814  51.531  56.855  1.00 65.31  ? 17   GLU B OE1   1 
ATOM   4793  O OE2   . GLU B 1 17  ? 18.292  51.837  55.248  1.00 57.98  ? 17   GLU B OE2   1 
ATOM   4794  N N     . LYS B 1 18  ? 11.900  53.931  56.317  1.00 56.72  ? 18   LYS B N     1 
ATOM   4795  C CA    . LYS B 1 18  ? 10.554  53.710  56.865  1.00 58.26  ? 18   LYS B CA    1 
ATOM   4796  C C     . LYS B 1 18  ? 9.412   54.289  56.004  1.00 59.39  ? 18   LYS B C     1 
ATOM   4797  O O     . LYS B 1 18  ? 8.289   53.772  56.042  1.00 59.04  ? 18   LYS B O     1 
ATOM   4798  C CB    . LYS B 1 18  ? 10.487  54.289  58.294  1.00 58.90  ? 18   LYS B CB    1 
ATOM   4799  C CG    . LYS B 1 18  ? 9.160   54.098  59.039  1.00 56.83  ? 18   LYS B CG    1 
ATOM   4800  C CD    . LYS B 1 18  ? 8.971   55.131  60.159  1.00 59.82  ? 18   LYS B CD    1 
ATOM   4801  C CE    . LYS B 1 18  ? 7.503   55.210  60.602  1.00 65.01  ? 18   LYS B CE    1 
ATOM   4802  N NZ    . LYS B 1 18  ? 7.245   56.230  61.663  1.00 62.74  ? 18   LYS B NZ    1 
ATOM   4803  N N     . ASP B 1 19  ? 9.700   55.338  55.227  1.00 59.27  ? 19   ASP B N     1 
ATOM   4804  C CA    . ASP B 1 19  ? 8.657   56.096  54.533  1.00 58.70  ? 19   ASP B CA    1 
ATOM   4805  C C     . ASP B 1 19  ? 8.755   56.069  52.987  1.00 59.54  ? 19   ASP B C     1 
ATOM   4806  O O     . ASP B 1 19  ? 7.742   55.819  52.316  1.00 60.52  ? 19   ASP B O     1 
ATOM   4807  C CB    . ASP B 1 19  ? 8.638   57.537  55.059  1.00 58.39  ? 19   ASP B CB    1 
ATOM   4808  C CG    . ASP B 1 19  ? 8.380   57.617  56.572  1.00 63.60  ? 19   ASP B CG    1 
ATOM   4809  O OD1   . ASP B 1 19  ? 7.267   57.249  57.014  1.00 66.73  ? 19   ASP B OD1   1 
ATOM   4810  O OD2   . ASP B 1 19  ? 9.289   58.056  57.328  1.00 66.29  ? 19   ASP B OD2   1 
ATOM   4811  N N     . ILE B 1 20  ? 9.936   56.302  52.401  1.00 59.10  ? 20   ILE B N     1 
ATOM   4812  C CA    . ILE B 1 20  ? 9.979   56.518  50.934  1.00 58.30  ? 20   ILE B CA    1 
ATOM   4813  C C     . ILE B 1 20  ? 9.609   55.291  50.111  1.00 57.60  ? 20   ILE B C     1 
ATOM   4814  O O     . ILE B 1 20  ? 9.995   54.171  50.434  1.00 57.45  ? 20   ILE B O     1 
ATOM   4815  C CB    . ILE B 1 20  ? 11.311  57.175  50.359  1.00 57.76  ? 20   ILE B CB    1 
ATOM   4816  C CG1   . ILE B 1 20  ? 12.384  56.138  50.003  1.00 59.26  ? 20   ILE B CG1   1 
ATOM   4817  C CG2   . ILE B 1 20  ? 11.824  58.288  51.271  1.00 58.07  ? 20   ILE B CG2   1 
ATOM   4818  C CD1   . ILE B 1 20  ? 13.608  56.725  49.319  1.00 57.88  ? 20   ILE B CD1   1 
ATOM   4819  N N     . LYS B 1 21  ? 8.794   55.542  49.085  1.00 58.74  ? 21   LYS B N     1 
ATOM   4820  C CA    . LYS B 1 21  ? 8.605   54.651  47.942  1.00 57.09  ? 21   LYS B CA    1 
ATOM   4821  C C     . LYS B 1 21  ? 9.581   55.177  46.892  1.00 55.67  ? 21   LYS B C     1 
ATOM   4822  O O     . LYS B 1 21  ? 9.835   56.379  46.835  1.00 56.71  ? 21   LYS B O     1 
ATOM   4823  C CB    . LYS B 1 21  ? 7.161   54.712  47.418  1.00 57.06  ? 21   LYS B CB    1 
ATOM   4824  C CG    . LYS B 1 21  ? 6.097   54.585  48.500  1.00 59.40  ? 21   LYS B CG    1 
ATOM   4825  C CD    . LYS B 1 21  ? 4.666   54.638  47.941  1.00 58.22  ? 21   LYS B CD    1 
ATOM   4826  C CE    . LYS B 1 21  ? 3.678   53.942  48.879  1.00 54.14  ? 21   LYS B CE    1 
ATOM   4827  N NZ    . LYS B 1 21  ? 2.258   54.073  48.381  1.00 64.10  ? 21   LYS B NZ    1 
ATOM   4828  N N     . THR B 1 22  ? 10.083  54.290  46.040  1.00 54.48  ? 22   THR B N     1 
ATOM   4829  C CA    . THR B 1 22  ? 11.313  54.537  45.286  1.00 52.79  ? 22   THR B CA    1 
ATOM   4830  C C     . THR B 1 22  ? 11.189  54.690  43.772  1.00 51.45  ? 22   THR B C     1 
ATOM   4831  O O     . THR B 1 22  ? 12.091  55.214  43.139  1.00 51.07  ? 22   THR B O     1 
ATOM   4832  C CB    . THR B 1 22  ? 12.319  53.396  45.560  1.00 54.33  ? 22   THR B CB    1 
ATOM   4833  O OG1   . THR B 1 22  ? 11.696  52.121  45.311  1.00 51.50  ? 22   THR B OG1   1 
ATOM   4834  C CG2   . THR B 1 22  ? 12.835  53.450  47.022  1.00 55.40  ? 22   THR B CG2   1 
ATOM   4835  N N     . SER B 1 23  ? 10.094  54.232  43.176  1.00 52.46  ? 23   SER B N     1 
ATOM   4836  C CA    . SER B 1 23  ? 9.957   54.214  41.691  1.00 51.43  ? 23   SER B CA    1 
ATOM   4837  C C     . SER B 1 23  ? 10.255  55.550  40.953  1.00 48.76  ? 23   SER B C     1 
ATOM   4838  O O     . SER B 1 23  ? 11.139  55.622  40.087  1.00 44.34  ? 23   SER B O     1 
ATOM   4839  C CB    . SER B 1 23  ? 8.559   53.677  41.286  1.00 52.58  ? 23   SER B CB    1 
ATOM   4840  O OG    . SER B 1 23  ? 7.522   54.107  42.176  1.00 52.55  ? 23   SER B OG    1 
ATOM   4841  N N     . TYR B 1 24  ? 9.528   56.604  41.311  1.00 47.97  ? 24   TYR B N     1 
ATOM   4842  C CA    . TYR B 1 24  ? 9.610   57.893  40.578  1.00 46.77  ? 24   TYR B CA    1 
ATOM   4843  C C     . TYR B 1 24  ? 10.857  58.736  40.916  1.00 45.44  ? 24   TYR B C     1 
ATOM   4844  O O     . TYR B 1 24  ? 11.412  59.414  40.046  1.00 42.96  ? 24   TYR B O     1 
ATOM   4845  C CB    . TYR B 1 24  ? 8.329   58.684  40.808  1.00 45.95  ? 24   TYR B CB    1 
ATOM   4846  C CG    . TYR B 1 24  ? 7.095   57.990  40.279  1.00 45.90  ? 24   TYR B CG    1 
ATOM   4847  C CD1   . TYR B 1 24  ? 6.700   58.130  38.948  1.00 50.70  ? 24   TYR B CD1   1 
ATOM   4848  C CD2   . TYR B 1 24  ? 6.317   57.214  41.104  1.00 43.01  ? 24   TYR B CD2   1 
ATOM   4849  C CE1   . TYR B 1 24  ? 5.555   57.487  38.463  1.00 51.41  ? 24   TYR B CE1   1 
ATOM   4850  C CE2   . TYR B 1 24  ? 5.189   56.564  40.639  1.00 43.99  ? 24   TYR B CE2   1 
ATOM   4851  C CZ    . TYR B 1 24  ? 4.801   56.702  39.322  1.00 50.19  ? 24   TYR B CZ    1 
ATOM   4852  O OH    . TYR B 1 24  ? 3.650   56.049  38.876  1.00 51.46  ? 24   TYR B OH    1 
ATOM   4853  N N     . ILE B 1 25  ? 11.315  58.672  42.169  1.00 46.29  ? 25   ILE B N     1 
ATOM   4854  C CA    . ILE B 1 25  ? 12.625  59.235  42.535  1.00 45.13  ? 25   ILE B CA    1 
ATOM   4855  C C     . ILE B 1 25  ? 13.642  58.717  41.548  1.00 45.58  ? 25   ILE B C     1 
ATOM   4856  O O     . ILE B 1 25  ? 14.374  59.489  40.908  1.00 46.32  ? 25   ILE B O     1 
ATOM   4857  C CB    . ILE B 1 25  ? 13.067  58.830  43.971  1.00 44.32  ? 25   ILE B CB    1 
ATOM   4858  C CG1   . ILE B 1 25  ? 12.237  59.569  45.010  1.00 39.87  ? 25   ILE B CG1   1 
ATOM   4859  C CG2   . ILE B 1 25  ? 14.588  59.130  44.213  1.00 46.50  ? 25   ILE B CG2   1 
ATOM   4860  C CD1   . ILE B 1 25  ? 12.241  58.922  46.346  1.00 44.82  ? 25   ILE B CD1   1 
ATOM   4861  N N     . MET B 1 26  ? 13.677  57.397  41.404  1.00 48.18  ? 26   MET B N     1 
ATOM   4862  C CA    . MET B 1 26  ? 14.679  56.744  40.540  1.00 49.77  ? 26   MET B CA    1 
ATOM   4863  C C     . MET B 1 26  ? 14.633  57.309  39.103  1.00 50.04  ? 26   MET B C     1 
ATOM   4864  O O     . MET B 1 26  ? 15.677  57.546  38.510  1.00 51.04  ? 26   MET B O     1 
ATOM   4865  C CB    . MET B 1 26  ? 14.528  55.206  40.597  1.00 49.62  ? 26   MET B CB    1 
ATOM   4866  C CG    . MET B 1 26  ? 14.736  54.607  42.003  1.00 47.38  ? 26   MET B CG    1 
ATOM   4867  S SD    . MET B 1 26  ? 14.989  52.795  42.124  1.00 49.73  ? 26   MET B SD    1 
ATOM   4868  C CE    . MET B 1 26  ? 13.362  52.131  42.455  1.00 46.63  ? 26   MET B CE    1 
ATOM   4869  N N     . ASP B 1 27  ? 13.431  57.591  38.590  1.00 52.38  ? 27   ASP B N     1 
ATOM   4870  C CA    . ASP B 1 27  ? 13.253  58.280  37.284  1.00 52.98  ? 27   ASP B CA    1 
ATOM   4871  C C     . ASP B 1 27  ? 13.934  59.645  37.237  1.00 53.37  ? 27   ASP B C     1 
ATOM   4872  O O     . ASP B 1 27  ? 14.660  59.942  36.299  1.00 53.55  ? 27   ASP B O     1 
ATOM   4873  C CB    . ASP B 1 27  ? 11.772  58.538  36.951  1.00 54.35  ? 27   ASP B CB    1 
ATOM   4874  C CG    . ASP B 1 27  ? 10.910  57.273  36.901  1.00 58.41  ? 27   ASP B CG    1 
ATOM   4875  O OD1   . ASP B 1 27  ? 11.354  56.178  37.291  1.00 66.29  ? 27   ASP B OD1   1 
ATOM   4876  O OD2   . ASP B 1 27  ? 9.746   57.392  36.466  1.00 62.25  ? 27   ASP B OD2   1 
ATOM   4877  N N     . HIS B 1 28  ? 13.666  60.490  38.232  1.00 53.53  ? 28   HIS B N     1 
ATOM   4878  C CA    . HIS B 1 28  ? 14.205  61.858  38.240  1.00 53.38  ? 28   HIS B CA    1 
ATOM   4879  C C     . HIS B 1 28  ? 15.710  61.855  38.228  1.00 54.47  ? 28   HIS B C     1 
ATOM   4880  O O     . HIS B 1 28  ? 16.326  62.655  37.531  1.00 55.85  ? 28   HIS B O     1 
ATOM   4881  C CB    . HIS B 1 28  ? 13.741  62.637  39.462  1.00 52.59  ? 28   HIS B CB    1 
ATOM   4882  C CG    . HIS B 1 28  ? 12.259  62.661  39.624  1.00 51.92  ? 28   HIS B CG    1 
ATOM   4883  N ND1   . HIS B 1 28  ? 11.400  62.697  38.549  1.00 52.20  ? 28   HIS B ND1   1 
ATOM   4884  C CD2   . HIS B 1 28  ? 11.483  62.676  40.729  1.00 46.31  ? 28   HIS B CD2   1 
ATOM   4885  C CE1   . HIS B 1 28  ? 10.156  62.708  38.986  1.00 55.72  ? 28   HIS B CE1   1 
ATOM   4886  N NE2   . HIS B 1 28  ? 10.178  62.696  40.306  1.00 50.84  ? 28   HIS B NE2   1 
ATOM   4887  N N     . MET B 1 29  ? 16.301  60.956  39.013  1.00 56.57  ? 29   MET B N     1 
ATOM   4888  C CA    . MET B 1 29  ? 17.760  60.787  39.050  1.00 57.49  ? 29   MET B CA    1 
ATOM   4889  C C     . MET B 1 29  ? 18.269  60.108  37.775  1.00 59.39  ? 29   MET B C     1 
ATOM   4890  O O     . MET B 1 29  ? 19.290  60.527  37.233  1.00 57.72  ? 29   MET B O     1 
ATOM   4891  C CB    . MET B 1 29  ? 18.185  59.984  40.278  1.00 56.30  ? 29   MET B CB    1 
ATOM   4892  C CG    . MET B 1 29  ? 17.785  60.620  41.597  1.00 55.73  ? 29   MET B CG    1 
ATOM   4893  S SD    . MET B 1 29  ? 18.349  59.707  43.037  1.00 55.90  ? 29   MET B SD    1 
ATOM   4894  C CE    . MET B 1 29  ? 20.121  59.883  42.821  1.00 51.20  ? 29   MET B CE    1 
ATOM   4895  N N     . ILE B 1 30  ? 17.562  59.070  37.302  1.00 63.03  ? 30   ILE B N     1 
ATOM   4896  C CA    . ILE B 1 30  ? 17.854  58.462  35.982  1.00 65.08  ? 30   ILE B CA    1 
ATOM   4897  C C     . ILE B 1 30  ? 17.926  59.569  34.918  1.00 66.65  ? 30   ILE B C     1 
ATOM   4898  O O     . ILE B 1 30  ? 18.943  59.715  34.231  1.00 68.28  ? 30   ILE B O     1 
ATOM   4899  C CB    . ILE B 1 30  ? 16.823  57.338  35.577  1.00 65.97  ? 30   ILE B CB    1 
ATOM   4900  C CG1   . ILE B 1 30  ? 17.226  55.983  36.182  1.00 67.48  ? 30   ILE B CG1   1 
ATOM   4901  C CG2   . ILE B 1 30  ? 16.719  57.182  34.048  1.00 65.40  ? 30   ILE B CG2   1 
ATOM   4902  C CD1   . ILE B 1 30  ? 16.094  54.913  36.209  1.00 67.06  ? 30   ILE B CD1   1 
ATOM   4903  N N     . SER B 1 31  ? 16.867  60.368  34.821  1.00 67.21  ? 31   SER B N     1 
ATOM   4904  C CA    . SER B 1 31  ? 16.854  61.524  33.925  1.00 68.08  ? 31   SER B CA    1 
ATOM   4905  C C     . SER B 1 31  ? 17.985  62.512  34.214  1.00 68.80  ? 31   SER B C     1 
ATOM   4906  O O     . SER B 1 31  ? 18.685  62.928  33.293  1.00 70.85  ? 31   SER B O     1 
ATOM   4907  C CB    . SER B 1 31  ? 15.513  62.247  33.995  1.00 68.55  ? 31   SER B CB    1 
ATOM   4908  O OG    . SER B 1 31  ? 15.671  63.594  33.591  1.00 69.27  ? 31   SER B OG    1 
ATOM   4909  N N     . ASP B 1 32  ? 18.169  62.892  35.478  1.00 69.73  ? 32   ASP B N     1 
ATOM   4910  C CA    . ASP B 1 32  ? 19.308  63.764  35.862  1.00 70.35  ? 32   ASP B CA    1 
ATOM   4911  C C     . ASP B 1 32  ? 20.688  63.152  35.515  1.00 69.31  ? 32   ASP B C     1 
ATOM   4912  O O     . ASP B 1 32  ? 21.671  63.874  35.347  1.00 66.44  ? 32   ASP B O     1 
ATOM   4913  C CB    . ASP B 1 32  ? 19.257  64.124  37.362  1.00 71.63  ? 32   ASP B CB    1 
ATOM   4914  C CG    . ASP B 1 32  ? 18.176  65.159  37.700  1.00 74.71  ? 32   ASP B CG    1 
ATOM   4915  O OD1   . ASP B 1 32  ? 17.571  65.755  36.771  1.00 78.24  ? 32   ASP B OD1   1 
ATOM   4916  O OD2   . ASP B 1 32  ? 17.937  65.377  38.913  1.00 72.55  ? 32   ASP B OD2   1 
ATOM   4917  N N     . GLY B 1 33  ? 20.741  61.822  35.432  1.00 70.08  ? 33   GLY B N     1 
ATOM   4918  C CA    . GLY B 1 33  ? 21.920  61.095  34.962  1.00 69.28  ? 33   GLY B CA    1 
ATOM   4919  C C     . GLY B 1 33  ? 22.877  60.646  36.056  1.00 68.64  ? 33   GLY B C     1 
ATOM   4920  O O     . GLY B 1 33  ? 24.061  60.441  35.790  1.00 68.64  ? 33   GLY B O     1 
ATOM   4921  N N     . PHE B 1 34  ? 22.369  60.487  37.277  1.00 67.21  ? 34   PHE B N     1 
ATOM   4922  C CA    . PHE B 1 34  ? 23.179  60.050  38.414  1.00 66.86  ? 34   PHE B CA    1 
ATOM   4923  C C     . PHE B 1 34  ? 22.784  58.629  38.889  1.00 67.18  ? 34   PHE B C     1 
ATOM   4924  O O     . PHE B 1 34  ? 23.266  58.164  39.924  1.00 67.26  ? 34   PHE B O     1 
ATOM   4925  C CB    . PHE B 1 34  ? 23.059  61.046  39.584  1.00 65.43  ? 34   PHE B CB    1 
ATOM   4926  C CG    . PHE B 1 34  ? 23.418  62.480  39.237  1.00 60.60  ? 34   PHE B CG    1 
ATOM   4927  C CD1   . PHE B 1 34  ? 24.737  62.871  39.084  1.00 61.19  ? 34   PHE B CD1   1 
ATOM   4928  C CD2   . PHE B 1 34  ? 22.430  63.448  39.113  1.00 62.66  ? 34   PHE B CD2   1 
ATOM   4929  C CE1   . PHE B 1 34  ? 25.069  64.205  38.785  1.00 61.04  ? 34   PHE B CE1   1 
ATOM   4930  C CE2   . PHE B 1 34  ? 22.754  64.777  38.809  1.00 60.04  ? 34   PHE B CE2   1 
ATOM   4931  C CZ    . PHE B 1 34  ? 24.076  65.148  38.645  1.00 62.61  ? 34   PHE B CZ    1 
ATOM   4932  N N     . LEU B 1 35  ? 21.910  57.954  38.139  1.00 67.35  ? 35   LEU B N     1 
ATOM   4933  C CA    . LEU B 1 35  ? 21.472  56.588  38.466  1.00 67.80  ? 35   LEU B CA    1 
ATOM   4934  C C     . LEU B 1 35  ? 21.303  55.765  37.174  1.00 68.94  ? 35   LEU B C     1 
ATOM   4935  O O     . LEU B 1 35  ? 21.185  56.339  36.083  1.00 70.79  ? 35   LEU B O     1 
ATOM   4936  C CB    . LEU B 1 35  ? 20.161  56.622  39.255  1.00 67.60  ? 35   LEU B CB    1 
ATOM   4937  C CG    . LEU B 1 35  ? 19.603  55.289  39.794  1.00 68.88  ? 35   LEU B CG    1 
ATOM   4938  C CD1   . LEU B 1 35  ? 20.395  54.837  41.018  1.00 72.93  ? 35   LEU B CD1   1 
ATOM   4939  C CD2   . LEU B 1 35  ? 18.114  55.367  40.132  1.00 69.43  ? 35   LEU B CD2   1 
ATOM   4940  N N     . THR B 1 36  ? 21.319  54.433  37.301  1.00 68.71  ? 36   THR B N     1 
ATOM   4941  C CA    . THR B 1 36  ? 21.205  53.511  36.156  1.00 67.63  ? 36   THR B CA    1 
ATOM   4942  C C     . THR B 1 36  ? 20.001  52.551  36.235  1.00 67.79  ? 36   THR B C     1 
ATOM   4943  O O     . THR B 1 36  ? 19.310  52.450  37.256  1.00 66.39  ? 36   THR B O     1 
ATOM   4944  C CB    . THR B 1 36  ? 22.503  52.655  35.982  1.00 67.73  ? 36   THR B CB    1 
ATOM   4945  O OG1   . THR B 1 36  ? 22.607  51.701  37.046  1.00 60.25  ? 36   THR B OG1   1 
ATOM   4946  C CG2   . THR B 1 36  ? 23.761  53.545  35.955  1.00 66.76  ? 36   THR B CG2   1 
ATOM   4947  N N     . ILE B 1 37  ? 19.774  51.855  35.122  1.00 68.55  ? 37   ILE B N     1 
ATOM   4948  C CA    . ILE B 1 37  ? 18.720  50.842  34.992  1.00 68.08  ? 37   ILE B CA    1 
ATOM   4949  C C     . ILE B 1 37  ? 19.081  49.582  35.788  1.00 67.77  ? 37   ILE B C     1 
ATOM   4950  O O     . ILE B 1 37  ? 18.204  48.917  36.342  1.00 67.93  ? 37   ILE B O     1 
ATOM   4951  C CB    . ILE B 1 37  ? 18.482  50.468  33.481  1.00 68.13  ? 37   ILE B CB    1 
ATOM   4952  C CG1   . ILE B 1 37  ? 17.917  51.661  32.697  1.00 66.14  ? 37   ILE B CG1   1 
ATOM   4953  C CG2   . ILE B 1 37  ? 17.578  49.239  33.325  1.00 68.78  ? 37   ILE B CG2   1 
ATOM   4954  C CD1   . ILE B 1 37  ? 16.512  52.065  33.087  1.00 67.48  ? 37   ILE B CD1   1 
ATOM   4955  N N     . SER B 1 38  ? 20.367  49.249  35.832  1.00 67.71  ? 38   SER B N     1 
ATOM   4956  C CA    . SER B 1 38  ? 20.838  48.102  36.614  1.00 67.71  ? 38   SER B CA    1 
ATOM   4957  C C     . SER B 1 38  ? 20.534  48.294  38.102  1.00 66.92  ? 38   SER B C     1 
ATOM   4958  O O     . SER B 1 38  ? 20.140  47.353  38.795  1.00 65.75  ? 38   SER B O     1 
ATOM   4959  C CB    . SER B 1 38  ? 22.343  47.889  36.397  1.00 67.61  ? 38   SER B CB    1 
ATOM   4960  O OG    . SER B 1 38  ? 23.059  49.111  36.494  1.00 69.54  ? 38   SER B OG    1 
ATOM   4961  N N     . GLU B 1 39  ? 20.717  49.525  38.576  1.00 67.28  ? 39   GLU B N     1 
ATOM   4962  C CA    . GLU B 1 39  ? 20.446  49.869  39.963  1.00 67.23  ? 39   GLU B CA    1 
ATOM   4963  C C     . GLU B 1 39  ? 18.948  49.785  40.275  1.00 67.20  ? 39   GLU B C     1 
ATOM   4964  O O     . GLU B 1 39  ? 18.549  49.174  41.267  1.00 63.88  ? 39   GLU B O     1 
ATOM   4965  C CB    . GLU B 1 39  ? 20.989  51.262  40.274  1.00 66.65  ? 39   GLU B CB    1 
ATOM   4966  C CG    . GLU B 1 39  ? 22.513  51.339  40.218  1.00 66.51  ? 39   GLU B CG    1 
ATOM   4967  C CD    . GLU B 1 39  ? 23.079  52.505  41.005  1.00 66.74  ? 39   GLU B CD    1 
ATOM   4968  O OE1   . GLU B 1 39  ? 23.227  52.376  42.245  1.00 55.69  ? 39   GLU B OE1   1 
ATOM   4969  O OE2   . GLU B 1 39  ? 23.390  53.542  40.376  1.00 67.86  ? 39   GLU B OE2   1 
ATOM   4970  N N     . GLU B 1 40  ? 18.129  50.390  39.415  1.00 68.66  ? 40   GLU B N     1 
ATOM   4971  C CA    . GLU B 1 40  ? 16.669  50.330  39.554  1.00 69.20  ? 40   GLU B CA    1 
ATOM   4972  C C     . GLU B 1 40  ? 16.176  48.883  39.577  1.00 68.63  ? 40   GLU B C     1 
ATOM   4973  O O     . GLU B 1 40  ? 15.362  48.495  40.414  1.00 66.99  ? 40   GLU B O     1 
ATOM   4974  C CB    . GLU B 1 40  ? 15.976  51.080  38.408  1.00 69.88  ? 40   GLU B CB    1 
ATOM   4975  C CG    . GLU B 1 40  ? 14.478  51.315  38.661  1.00 70.07  ? 40   GLU B CG    1 
ATOM   4976  C CD    . GLU B 1 40  ? 13.668  51.582  37.398  1.00 72.05  ? 40   GLU B CD    1 
ATOM   4977  O OE1   . GLU B 1 40  ? 14.156  51.293  36.276  1.00 76.93  ? 40   GLU B OE1   1 
ATOM   4978  O OE2   . GLU B 1 40  ? 12.526  52.083  37.545  1.00 72.70  ? 40   GLU B OE2   1 
ATOM   4979  N N     . GLU B 1 41  ? 16.681  48.095  38.637  1.00 69.23  ? 41   GLU B N     1 
ATOM   4980  C CA    . GLU B 1 41  ? 16.393  46.667  38.578  1.00 69.19  ? 41   GLU B CA    1 
ATOM   4981  C C     . GLU B 1 41  ? 16.758  46.002  39.914  1.00 67.95  ? 41   GLU B C     1 
ATOM   4982  O O     . GLU B 1 41  ? 16.000  45.170  40.429  1.00 66.28  ? 41   GLU B O     1 
ATOM   4983  C CB    . GLU B 1 41  ? 17.186  46.047  37.421  1.00 69.70  ? 41   GLU B CB    1 
ATOM   4984  C CG    . GLU B 1 41  ? 16.632  44.753  36.850  1.00 69.75  ? 41   GLU B CG    1 
ATOM   4985  C CD    . GLU B 1 41  ? 17.346  44.368  35.560  1.00 71.16  ? 41   GLU B CD    1 
ATOM   4986  O OE1   . GLU B 1 41  ? 17.229  45.127  34.567  1.00 73.62  ? 41   GLU B OE1   1 
ATOM   4987  O OE2   . GLU B 1 41  ? 18.034  43.321  35.544  1.00 73.94  ? 41   GLU B OE2   1 
ATOM   4988  N N     . LYS B 1 42  ? 17.907  46.404  40.469  1.00 66.92  ? 42   LYS B N     1 
ATOM   4989  C CA    . LYS B 1 42  ? 18.399  45.894  41.757  1.00 66.75  ? 42   LYS B CA    1 
ATOM   4990  C C     . LYS B 1 42  ? 17.587  46.365  42.974  1.00 65.66  ? 42   LYS B C     1 
ATOM   4991  O O     . LYS B 1 42  ? 17.439  45.620  43.946  1.00 64.08  ? 42   LYS B O     1 
ATOM   4992  C CB    . LYS B 1 42  ? 19.877  46.266  41.960  1.00 66.34  ? 42   LYS B CB    1 
ATOM   4993  C CG    . LYS B 1 42  ? 20.548  45.454  43.056  1.00 66.53  ? 42   LYS B CG    1 
ATOM   4994  C CD    . LYS B 1 42  ? 22.042  45.717  43.142  1.00 66.51  ? 42   LYS B CD    1 
ATOM   4995  C CE    . LYS B 1 42  ? 22.697  44.741  44.118  1.00 62.54  ? 42   LYS B CE    1 
ATOM   4996  N NZ    . LYS B 1 42  ? 24.130  45.037  44.359  1.00 57.41  ? 42   LYS B NZ    1 
ATOM   4997  N N     . VAL B 1 43  ? 17.079  47.597  42.927  1.00 65.53  ? 43   VAL B N     1 
ATOM   4998  C CA    . VAL B 1 43  ? 16.309  48.161  44.047  1.00 66.52  ? 43   VAL B CA    1 
ATOM   4999  C C     . VAL B 1 43  ? 14.866  47.635  44.064  1.00 66.08  ? 43   VAL B C     1 
ATOM   5000  O O     . VAL B 1 43  ? 14.321  47.338  45.130  1.00 65.36  ? 43   VAL B O     1 
ATOM   5001  C CB    . VAL B 1 43  ? 16.314  49.717  44.028  1.00 66.86  ? 43   VAL B CB    1 
ATOM   5002  C CG1   . VAL B 1 43  ? 15.304  50.285  45.035  1.00 68.15  ? 43   VAL B CG1   1 
ATOM   5003  C CG2   . VAL B 1 43  ? 17.710  50.246  44.320  1.00 66.06  ? 43   VAL B CG2   1 
ATOM   5004  N N     . ARG B 1 44  ? 14.265  47.533  42.881  1.00 65.80  ? 44   ARG B N     1 
ATOM   5005  C CA    . ARG B 1 44  ? 12.938  46.955  42.711  1.00 66.06  ? 44   ARG B CA    1 
ATOM   5006  C C     . ARG B 1 44  ? 12.925  45.494  43.148  1.00 64.70  ? 44   ARG B C     1 
ATOM   5007  O O     . ARG B 1 44  ? 11.971  45.045  43.763  1.00 65.38  ? 44   ARG B O     1 
ATOM   5008  C CB    . ARG B 1 44  ? 12.528  47.062  41.246  1.00 67.28  ? 44   ARG B CB    1 
ATOM   5009  C CG    . ARG B 1 44  ? 11.138  46.545  40.929  1.00 68.29  ? 44   ARG B CG    1 
ATOM   5010  C CD    . ARG B 1 44  ? 10.713  47.088  39.578  1.00 71.53  ? 44   ARG B CD    1 
ATOM   5011  N NE    . ARG B 1 44  ? 9.580   46.366  39.009  1.00 75.36  ? 44   ARG B NE    1 
ATOM   5012  C CZ    . ARG B 1 44  ? 9.034   46.658  37.833  1.00 81.53  ? 44   ARG B CZ    1 
ATOM   5013  N NH1   . ARG B 1 44  ? 9.524   47.662  37.100  1.00 86.34  ? 44   ARG B NH1   1 
ATOM   5014  N NH2   . ARG B 1 44  ? 7.992   45.957  37.388  1.00 79.26  ? 44   ARG B NH2   1 
ATOM   5015  N N     . ASN B 1 45  ? 13.996  44.770  42.815  1.00 63.13  ? 45   ASN B N     1 
ATOM   5016  C CA    . ASN B 1 45  ? 14.278  43.421  43.318  1.00 61.61  ? 45   ASN B CA    1 
ATOM   5017  C C     . ASN B 1 45  ? 13.785  43.168  44.744  1.00 60.20  ? 45   ASN B C     1 
ATOM   5018  O O     . ASN B 1 45  ? 13.204  42.124  45.017  1.00 59.30  ? 45   ASN B O     1 
ATOM   5019  C CB    . ASN B 1 45  ? 15.795  43.177  43.251  1.00 61.77  ? 45   ASN B CB    1 
ATOM   5020  C CG    . ASN B 1 45  ? 16.180  41.706  43.360  1.00 63.29  ? 45   ASN B CG    1 
ATOM   5021  O OD1   . ASN B 1 45  ? 15.329  40.823  43.471  1.00 68.05  ? 45   ASN B OD1   1 
ATOM   5022  N ND2   . ASN B 1 45  ? 17.482  41.440  43.322  1.00 60.77  ? 45   ASN B ND2   1 
ATOM   5023  N N     . GLU B 1 46  ? 14.002  44.134  45.638  1.00 60.67  ? 46   GLU B N     1 
ATOM   5024  C CA    . GLU B 1 46  ? 13.728  43.969  47.083  1.00 60.61  ? 46   GLU B CA    1 
ATOM   5025  C C     . GLU B 1 46  ? 12.231  43.942  47.414  1.00 59.38  ? 46   GLU B C     1 
ATOM   5026  O O     . GLU B 1 46  ? 11.489  44.769  46.921  1.00 56.42  ? 46   GLU B O     1 
ATOM   5027  C CB    . GLU B 1 46  ? 14.378  45.091  47.903  1.00 60.20  ? 46   GLU B CB    1 
ATOM   5028  C CG    . GLU B 1 46  ? 15.870  45.246  47.709  1.00 57.34  ? 46   GLU B CG    1 
ATOM   5029  C CD    . GLU B 1 46  ? 16.683  44.197  48.427  1.00 57.71  ? 46   GLU B CD    1 
ATOM   5030  O OE1   . GLU B 1 46  ? 16.856  44.301  49.663  1.00 52.61  ? 46   GLU B OE1   1 
ATOM   5031  O OE2   . GLU B 1 46  ? 17.172  43.278  47.741  1.00 59.08  ? 46   GLU B OE2   1 
ATOM   5032  N N     . PRO B 1 47  ? 11.807  43.030  48.310  1.00 60.60  ? 47   PRO B N     1 
ATOM   5033  C CA    . PRO B 1 47  ? 10.386  42.674  48.455  1.00 60.47  ? 47   PRO B CA    1 
ATOM   5034  C C     . PRO B 1 47  ? 9.483   43.759  49.056  1.00 60.57  ? 47   PRO B C     1 
ATOM   5035  O O     . PRO B 1 47  ? 8.311   43.865  48.668  1.00 62.75  ? 47   PRO B O     1 
ATOM   5036  C CB    . PRO B 1 47  ? 10.415  41.446  49.381  1.00 61.41  ? 47   PRO B CB    1 
ATOM   5037  C CG    . PRO B 1 47  ? 11.851  41.088  49.563  1.00 62.71  ? 47   PRO B CG    1 
ATOM   5038  C CD    . PRO B 1 47  ? 12.644  42.306  49.281  1.00 61.17  ? 47   PRO B CD    1 
ATOM   5039  N N     . THR B 1 48  ? 10.022  44.548  49.985  1.00 59.09  ? 48   THR B N     1 
ATOM   5040  C CA    . THR B 1 48  ? 9.242   45.571  50.679  1.00 56.81  ? 48   THR B CA    1 
ATOM   5041  C C     . THR B 1 48  ? 9.766   46.976  50.426  1.00 56.19  ? 48   THR B C     1 
ATOM   5042  O O     . THR B 1 48  ? 10.901  47.168  49.958  1.00 56.28  ? 48   THR B O     1 
ATOM   5043  C CB    . THR B 1 48  ? 9.184   45.327  52.217  1.00 57.48  ? 48   THR B CB    1 
ATOM   5044  O OG1   . THR B 1 48  ? 10.473  45.543  52.813  1.00 51.98  ? 48   THR B OG1   1 
ATOM   5045  C CG2   . THR B 1 48  ? 8.708   43.925  52.517  1.00 55.20  ? 48   THR B CG2   1 
ATOM   5046  N N     . GLN B 1 49  ? 8.916   47.949  50.759  1.00 55.30  ? 49   GLN B N     1 
ATOM   5047  C CA    . GLN B 1 49  ? 9.157   49.384  50.518  1.00 54.97  ? 49   GLN B CA    1 
ATOM   5048  C C     . GLN B 1 49  ? 10.338  49.923  51.351  1.00 54.49  ? 49   GLN B C     1 
ATOM   5049  O O     . GLN B 1 49  ? 11.052  50.849  50.912  1.00 53.37  ? 49   GLN B O     1 
ATOM   5050  C CB    . GLN B 1 49  ? 7.859   50.147  50.839  1.00 54.72  ? 49   GLN B CB    1 
ATOM   5051  C CG    . GLN B 1 49  ? 7.903   51.663  50.759  1.00 54.86  ? 49   GLN B CG    1 
ATOM   5052  C CD    . GLN B 1 49  ? 6.661   52.293  51.387  1.00 55.40  ? 49   GLN B CD    1 
ATOM   5053  O OE1   . GLN B 1 49  ? 5.582   52.255  50.805  1.00 59.06  ? 49   GLN B OE1   1 
ATOM   5054  N NE2   . GLN B 1 49  ? 6.809   52.857  52.582  1.00 48.49  ? 49   GLN B NE2   1 
ATOM   5055  N N     . GLN B 1 50  ? 10.518  49.338  52.544  1.00 52.51  ? 50   GLN B N     1 
ATOM   5056  C CA    . GLN B 1 50  ? 11.632  49.663  53.442  1.00 52.48  ? 50   GLN B CA    1 
ATOM   5057  C C     . GLN B 1 50  ? 12.981  49.137  52.951  1.00 50.02  ? 50   GLN B C     1 
ATOM   5058  O O     . GLN B 1 50  ? 14.025  49.757  53.180  1.00 49.47  ? 50   GLN B O     1 
ATOM   5059  C CB    . GLN B 1 50  ? 11.385  49.092  54.840  1.00 52.58  ? 50   GLN B CB    1 
ATOM   5060  C CG    . GLN B 1 50  ? 10.598  50.003  55.780  1.00 56.69  ? 50   GLN B CG    1 
ATOM   5061  C CD    . GLN B 1 50  ? 11.155  50.000  57.214  1.00 57.44  ? 50   GLN B CD    1 
ATOM   5062  O OE1   . GLN B 1 50  ? 12.329  49.695  57.435  1.00 64.39  ? 50   GLN B OE1   1 
ATOM   5063  N NE2   . GLN B 1 50  ? 10.318  50.372  58.182  1.00 66.93  ? 50   GLN B NE2   1 
ATOM   5064  N N     . GLN B 1 51  ? 12.944  47.981  52.301  1.00 46.69  ? 51   GLN B N     1 
ATOM   5065  C CA    . GLN B 1 51  ? 14.126  47.371  51.753  1.00 46.15  ? 51   GLN B CA    1 
ATOM   5066  C C     . GLN B 1 51  ? 14.525  48.102  50.499  1.00 43.93  ? 51   GLN B C     1 
ATOM   5067  O O     . GLN B 1 51  ? 15.703  48.348  50.295  1.00 41.50  ? 51   GLN B O     1 
ATOM   5068  C CB    . GLN B 1 51  ? 13.895  45.879  51.528  1.00 46.91  ? 51   GLN B CB    1 
ATOM   5069  C CG    . GLN B 1 51  ? 13.823  45.121  52.875  1.00 47.93  ? 51   GLN B CG    1 
ATOM   5070  C CD    . GLN B 1 51  ? 13.355  43.702  52.748  1.00 45.93  ? 51   GLN B CD    1 
ATOM   5071  O OE1   . GLN B 1 51  ? 12.178  43.411  52.957  1.00 50.92  ? 51   GLN B OE1   1 
ATOM   5072  N NE2   . GLN B 1 51  ? 14.269  42.800  52.419  1.00 44.22  ? 51   GLN B NE2   1 
ATOM   5073  N N     . ARG B 1 52  ? 13.540  48.520  49.704  1.00 44.97  ? 52   ARG B N     1 
ATOM   5074  C CA    . ARG B 1 52  ? 13.792  49.286  48.460  1.00 44.09  ? 52   ARG B CA    1 
ATOM   5075  C C     . ARG B 1 52  ? 14.539  50.622  48.690  1.00 42.46  ? 52   ARG B C     1 
ATOM   5076  O O     . ARG B 1 52  ? 15.533  50.939  48.016  1.00 38.86  ? 52   ARG B O     1 
ATOM   5077  C CB    . ARG B 1 52  ? 12.485  49.497  47.721  1.00 43.05  ? 52   ARG B CB    1 
ATOM   5078  C CG    . ARG B 1 52  ? 11.966  48.210  47.106  1.00 47.87  ? 52   ARG B CG    1 
ATOM   5079  C CD    . ARG B 1 52  ? 10.588  48.347  46.513  1.00 46.76  ? 52   ARG B CD    1 
ATOM   5080  N NE    . ARG B 1 52  ? 10.267  47.219  45.635  1.00 51.38  ? 52   ARG B NE    1 
ATOM   5081  C CZ    . ARG B 1 52  ? 9.321   47.225  44.688  1.00 55.75  ? 52   ARG B CZ    1 
ATOM   5082  N NH1   . ARG B 1 52  ? 8.579   48.304  44.445  1.00 51.28  ? 52   ARG B NH1   1 
ATOM   5083  N NH2   . ARG B 1 52  ? 9.120   46.134  43.963  1.00 54.62  ? 52   ARG B NH2   1 
ATOM   5084  N N     . ALA B 1 53  ? 14.066  51.373  49.674  1.00 43.07  ? 53   ALA B N     1 
ATOM   5085  C CA    . ALA B 1 53  ? 14.764  52.555  50.170  1.00 43.67  ? 53   ALA B CA    1 
ATOM   5086  C C     . ALA B 1 53  ? 16.192  52.240  50.613  1.00 43.93  ? 53   ALA B C     1 
ATOM   5087  O O     . ALA B 1 53  ? 17.156  52.778  50.045  1.00 44.59  ? 53   ALA B O     1 
ATOM   5088  C CB    . ALA B 1 53  ? 13.977  53.158  51.322  1.00 45.82  ? 53   ALA B CB    1 
ATOM   5089  N N     . ALA B 1 54  ? 16.325  51.347  51.608  1.00 45.38  ? 54   ALA B N     1 
ATOM   5090  C CA    . ALA B 1 54  ? 17.636  50.906  52.129  1.00 42.46  ? 54   ALA B CA    1 
ATOM   5091  C C     . ALA B 1 54  ? 18.650  50.617  51.012  1.00 41.20  ? 54   ALA B C     1 
ATOM   5092  O O     . ALA B 1 54  ? 19.782  51.098  51.044  1.00 41.22  ? 54   ALA B O     1 
ATOM   5093  C CB    . ALA B 1 54  ? 17.469  49.659  53.026  1.00 43.46  ? 54   ALA B CB    1 
ATOM   5094  N N     . MET B 1 55  ? 18.231  49.851  50.013  1.00 40.39  ? 55   MET B N     1 
ATOM   5095  C CA    . MET B 1 55  ? 19.112  49.482  48.917  1.00 39.75  ? 55   MET B CA    1 
ATOM   5096  C C     . MET B 1 55  ? 19.602  50.704  48.203  1.00 37.17  ? 55   MET B C     1 
ATOM   5097  O O     . MET B 1 55  ? 20.798  50.846  48.055  1.00 29.36  ? 55   MET B O     1 
ATOM   5098  C CB    . MET B 1 55  ? 18.396  48.574  47.920  1.00 41.21  ? 55   MET B CB    1 
ATOM   5099  C CG    . MET B 1 55  ? 19.246  48.014  46.775  1.00 44.33  ? 55   MET B CG    1 
ATOM   5100  S SD    . MET B 1 55  ? 20.491  46.775  47.199  1.00 60.05  ? 55   MET B SD    1 
ATOM   5101  C CE    . MET B 1 55  ? 19.838  45.968  48.670  1.00 58.56  ? 55   MET B CE    1 
ATOM   5102  N N     . LEU B 1 56  ? 18.668  51.582  47.786  1.00 39.13  ? 56   LEU B N     1 
ATOM   5103  C CA    . LEU B 1 56  ? 18.985  52.774  46.955  1.00 39.48  ? 56   LEU B CA    1 
ATOM   5104  C C     . LEU B 1 56  ? 19.830  53.835  47.676  1.00 38.77  ? 56   LEU B C     1 
ATOM   5105  O O     . LEU B 1 56  ? 20.728  54.460  47.075  1.00 31.61  ? 56   LEU B O     1 
ATOM   5106  C CB    . LEU B 1 56  ? 17.692  53.433  46.434  1.00 40.94  ? 56   LEU B CB    1 
ATOM   5107  C CG    . LEU B 1 56  ? 17.841  54.853  45.852  1.00 38.85  ? 56   LEU B CG    1 
ATOM   5108  C CD1   . LEU B 1 56  ? 18.724  54.881  44.620  1.00 38.27  ? 56   LEU B CD1   1 
ATOM   5109  C CD2   . LEU B 1 56  ? 16.490  55.468  45.559  1.00 40.03  ? 56   LEU B CD2   1 
ATOM   5110  N N     . ILE B 1 57  ? 19.503  54.060  48.952  1.00 41.40  ? 57   ILE B N     1 
ATOM   5111  C CA    . ILE B 1 57  ? 20.291  54.957  49.816  1.00 43.79  ? 57   ILE B CA    1 
ATOM   5112  C C     . ILE B 1 57  ? 21.738  54.504  49.938  1.00 44.53  ? 57   ILE B C     1 
ATOM   5113  O O     . ILE B 1 57  ? 22.665  55.292  49.763  1.00 44.20  ? 57   ILE B O     1 
ATOM   5114  C CB    . ILE B 1 57  ? 19.654  55.066  51.213  1.00 44.47  ? 57   ILE B CB    1 
ATOM   5115  C CG1   . ILE B 1 57  ? 18.324  55.827  51.092  1.00 42.67  ? 57   ILE B CG1   1 
ATOM   5116  C CG2   . ILE B 1 57  ? 20.615  55.757  52.201  1.00 42.84  ? 57   ILE B CG2   1 
ATOM   5117  C CD1   . ILE B 1 57  ? 17.470  55.755  52.316  1.00 44.21  ? 57   ILE B CD1   1 
ATOM   5118  N N     . LYS B 1 58  ? 21.921  53.220  50.231  1.00 49.21  ? 58   LYS B N     1 
ATOM   5119  C CA    . LYS B 1 58  ? 23.257  52.581  50.221  1.00 49.83  ? 58   LYS B CA    1 
ATOM   5120  C C     . LYS B 1 58  ? 24.056  53.031  48.982  1.00 51.08  ? 58   LYS B C     1 
ATOM   5121  O O     . LYS B 1 58  ? 25.232  53.380  49.071  1.00 52.53  ? 58   LYS B O     1 
ATOM   5122  C CB    . LYS B 1 58  ? 23.096  51.049  50.244  1.00 48.89  ? 58   LYS B CB    1 
ATOM   5123  C CG    . LYS B 1 58  ? 24.352  50.258  50.505  1.00 51.85  ? 58   LYS B CG    1 
ATOM   5124  C CD    . LYS B 1 58  ? 24.034  48.807  50.925  1.00 51.36  ? 58   LYS B CD    1 
ATOM   5125  C CE    . LYS B 1 58  ? 25.315  48.060  51.302  1.00 54.07  ? 58   LYS B CE    1 
ATOM   5126  N NZ    . LYS B 1 58  ? 25.066  46.816  52.106  1.00 55.43  ? 58   LYS B NZ    1 
ATOM   5127  N N     . MET B 1 59  ? 23.386  53.083  47.838  1.00 51.63  ? 59   MET B N     1 
ATOM   5128  C CA    . MET B 1 59  ? 24.062  53.310  46.564  1.00 52.85  ? 59   MET B CA    1 
ATOM   5129  C C     . MET B 1 59  ? 24.511  54.772  46.404  1.00 53.24  ? 59   MET B C     1 
ATOM   5130  O O     . MET B 1 59  ? 25.619  55.027  45.932  1.00 54.29  ? 59   MET B O     1 
ATOM   5131  C CB    . MET B 1 59  ? 23.159  52.875  45.394  1.00 54.16  ? 59   MET B CB    1 
ATOM   5132  C CG    . MET B 1 59  ? 22.239  51.664  45.718  1.00 54.01  ? 59   MET B CG    1 
ATOM   5133  S SD    . MET B 1 59  ? 21.167  51.036  44.393  1.00 56.17  ? 59   MET B SD    1 
ATOM   5134  C CE    . MET B 1 59  ? 21.935  49.428  44.073  1.00 57.83  ? 59   MET B CE    1 
ATOM   5135  N N     . ILE B 1 60  ? 23.657  55.716  46.820  1.00 52.42  ? 60   ILE B N     1 
ATOM   5136  C CA    . ILE B 1 60  ? 23.887  57.166  46.620  1.00 51.07  ? 60   ILE B CA    1 
ATOM   5137  C C     . ILE B 1 60  ? 25.025  57.721  47.482  1.00 50.20  ? 60   ILE B C     1 
ATOM   5138  O O     . ILE B 1 60  ? 25.749  58.640  47.057  1.00 48.15  ? 60   ILE B O     1 
ATOM   5139  C CB    . ILE B 1 60  ? 22.570  57.986  46.872  1.00 52.66  ? 60   ILE B CB    1 
ATOM   5140  C CG1   . ILE B 1 60  ? 21.619  57.840  45.681  1.00 51.60  ? 60   ILE B CG1   1 
ATOM   5141  C CG2   . ILE B 1 60  ? 22.841  59.488  47.104  1.00 51.18  ? 60   ILE B CG2   1 
ATOM   5142  C CD1   . ILE B 1 60  ? 20.191  58.208  46.008  1.00 49.83  ? 60   ILE B CD1   1 
ATOM   5143  N N     . LEU B 1 61  ? 25.180  57.144  48.677  1.00 49.71  ? 61   LEU B N     1 
ATOM   5144  C CA    . LEU B 1 61  ? 26.242  57.505  49.619  1.00 49.26  ? 61   LEU B CA    1 
ATOM   5145  C C     . LEU B 1 61  ? 27.620  57.489  48.971  1.00 50.76  ? 61   LEU B C     1 
ATOM   5146  O O     . LEU B 1 61  ? 28.524  58.234  49.367  1.00 49.97  ? 61   LEU B O     1 
ATOM   5147  C CB    . LEU B 1 61  ? 26.214  56.552  50.815  1.00 47.42  ? 61   LEU B CB    1 
ATOM   5148  C CG    . LEU B 1 61  ? 25.121  56.827  51.852  1.00 40.38  ? 61   LEU B CG    1 
ATOM   5149  C CD1   . LEU B 1 61  ? 24.791  55.605  52.689  1.00 33.83  ? 61   LEU B CD1   1 
ATOM   5150  C CD2   . LEU B 1 61  ? 25.556  57.973  52.746  1.00 42.45  ? 61   LEU B CD2   1 
ATOM   5151  N N     . LYS B 1 62  ? 27.774  56.638  47.964  1.00 52.52  ? 62   LYS B N     1 
ATOM   5152  C CA    . LYS B 1 62  ? 29.046  56.494  47.278  1.00 53.27  ? 62   LYS B CA    1 
ATOM   5153  C C     . LYS B 1 62  ? 29.204  57.512  46.135  1.00 53.81  ? 62   LYS B C     1 
ATOM   5154  O O     . LYS B 1 62  ? 30.299  57.662  45.590  1.00 54.75  ? 62   LYS B O     1 
ATOM   5155  C CB    . LYS B 1 62  ? 29.204  55.040  46.817  1.00 53.75  ? 62   LYS B CB    1 
ATOM   5156  C CG    . LYS B 1 62  ? 29.310  54.067  48.020  1.00 57.52  ? 62   LYS B CG    1 
ATOM   5157  C CD    . LYS B 1 62  ? 28.600  52.725  47.806  1.00 56.93  ? 62   LYS B CD    1 
ATOM   5158  C CE    . LYS B 1 62  ? 28.365  51.998  49.141  1.00 62.86  ? 62   LYS B CE    1 
ATOM   5159  N NZ    . LYS B 1 62  ? 28.122  50.518  48.994  1.00 64.50  ? 62   LYS B NZ    1 
ATOM   5160  N N     . LYS B 1 63  ? 28.132  58.247  45.816  1.00 53.19  ? 63   LYS B N     1 
ATOM   5161  C CA    . LYS B 1 63  ? 28.149  59.219  44.706  1.00 51.14  ? 63   LYS B CA    1 
ATOM   5162  C C     . LYS B 1 63  ? 28.559  60.643  45.130  1.00 49.39  ? 63   LYS B C     1 
ATOM   5163  O O     . LYS B 1 63  ? 28.898  60.900  46.289  1.00 47.37  ? 63   LYS B O     1 
ATOM   5164  C CB    . LYS B 1 63  ? 26.783  59.260  44.019  1.00 52.39  ? 63   LYS B CB    1 
ATOM   5165  C CG    . LYS B 1 63  ? 26.194  57.904  43.670  1.00 53.45  ? 63   LYS B CG    1 
ATOM   5166  C CD    . LYS B 1 63  ? 24.842  58.088  43.002  1.00 53.05  ? 63   LYS B CD    1 
ATOM   5167  C CE    . LYS B 1 63  ? 24.150  56.768  42.756  1.00 54.71  ? 63   LYS B CE    1 
ATOM   5168  N NZ    . LYS B 1 63  ? 24.873  55.928  41.763  1.00 60.52  ? 63   LYS B NZ    1 
ATOM   5169  N N     . ASP B 1 64  ? 28.515  61.562  44.167  1.00 47.35  ? 64   ASP B N     1 
ATOM   5170  C CA    . ASP B 1 64  ? 29.043  62.917  44.332  1.00 46.88  ? 64   ASP B CA    1 
ATOM   5171  C C     . ASP B 1 64  ? 28.023  63.925  44.905  1.00 44.51  ? 64   ASP B C     1 
ATOM   5172  O O     . ASP B 1 64  ? 26.869  63.592  45.164  1.00 42.38  ? 64   ASP B O     1 
ATOM   5173  C CB    . ASP B 1 64  ? 29.614  63.431  42.989  1.00 47.37  ? 64   ASP B CB    1 
ATOM   5174  C CG    . ASP B 1 64  ? 28.532  63.641  41.923  1.00 51.92  ? 64   ASP B CG    1 
ATOM   5175  O OD1   . ASP B 1 64  ? 27.931  62.637  41.465  1.00 51.91  ? 64   ASP B OD1   1 
ATOM   5176  O OD2   . ASP B 1 64  ? 28.298  64.810  41.537  1.00 55.76  ? 64   ASP B OD2   1 
ATOM   5177  N N     . ASN B 1 65  ? 28.501  65.153  45.112  1.00 44.23  ? 65   ASN B N     1 
ATOM   5178  C CA    . ASN B 1 65  ? 27.726  66.234  45.710  1.00 42.85  ? 65   ASN B CA    1 
ATOM   5179  C C     . ASN B 1 65  ? 26.456  66.576  44.941  1.00 43.02  ? 65   ASN B C     1 
ATOM   5180  O O     . ASN B 1 65  ? 25.378  66.751  45.538  1.00 41.95  ? 65   ASN B O     1 
ATOM   5181  C CB    . ASN B 1 65  ? 28.608  67.473  45.872  1.00 41.70  ? 65   ASN B CB    1 
ATOM   5182  C CG    . ASN B 1 65  ? 29.476  67.396  47.099  1.00 38.28  ? 65   ASN B CG    1 
ATOM   5183  O OD1   . ASN B 1 65  ? 29.111  66.749  48.077  1.00 28.80  ? 65   ASN B OD1   1 
ATOM   5184  N ND2   . ASN B 1 65  ? 30.614  68.069  47.072  1.00 36.91  ? 65   ASN B ND2   1 
ATOM   5185  N N     . ASP B 1 66  ? 26.576  66.620  43.616  1.00 42.98  ? 66   ASP B N     1 
ATOM   5186  C CA    . ASP B 1 66  ? 25.443  66.960  42.753  1.00 40.55  ? 66   ASP B CA    1 
ATOM   5187  C C     . ASP B 1 66  ? 24.365  65.904  42.833  1.00 36.73  ? 66   ASP B C     1 
ATOM   5188  O O     . ASP B 1 66  ? 23.181  66.225  42.773  1.00 32.83  ? 66   ASP B O     1 
ATOM   5189  C CB    . ASP B 1 66  ? 25.916  67.179  41.312  1.00 41.92  ? 66   ASP B CB    1 
ATOM   5190  C CG    . ASP B 1 66  ? 26.970  68.263  41.224  1.00 44.96  ? 66   ASP B CG    1 
ATOM   5191  O OD1   . ASP B 1 66  ? 26.659  69.415  41.584  1.00 35.78  ? 66   ASP B OD1   1 
ATOM   5192  O OD2   . ASP B 1 66  ? 28.131  67.950  40.851  1.00 62.79  ? 66   ASP B OD2   1 
ATOM   5193  N N     . SER B 1 67  ? 24.773  64.650  43.027  1.00 36.47  ? 67   SER B N     1 
ATOM   5194  C CA    . SER B 1 67  ? 23.817  63.535  43.197  1.00 36.31  ? 67   SER B CA    1 
ATOM   5195  C C     . SER B 1 67  ? 23.017  63.592  44.508  1.00 35.70  ? 67   SER B C     1 
ATOM   5196  O O     . SER B 1 67  ? 21.858  63.193  44.548  1.00 34.91  ? 67   SER B O     1 
ATOM   5197  C CB    . SER B 1 67  ? 24.540  62.202  43.108  1.00 34.95  ? 67   SER B CB    1 
ATOM   5198  O OG    . SER B 1 67  ? 25.521  62.273  42.103  1.00 42.82  ? 67   SER B OG    1 
ATOM   5199  N N     . TYR B 1 68  ? 23.650  64.065  45.586  1.00 35.82  ? 68   TYR B N     1 
ATOM   5200  C CA    . TYR B 1 68  ? 22.928  64.332  46.835  1.00 34.08  ? 68   TYR B CA    1 
ATOM   5201  C C     . TYR B 1 68  ? 21.723  65.256  46.563  1.00 32.28  ? 68   TYR B C     1 
ATOM   5202  O O     . TYR B 1 68  ? 20.580  64.931  46.892  1.00 30.50  ? 68   TYR B O     1 
ATOM   5203  C CB    . TYR B 1 68  ? 23.877  64.972  47.846  1.00 31.68  ? 68   TYR B CB    1 
ATOM   5204  C CG    . TYR B 1 68  ? 23.272  65.227  49.201  1.00 32.63  ? 68   TYR B CG    1 
ATOM   5205  C CD1   . TYR B 1 68  ? 22.506  66.387  49.458  1.00 20.32  ? 68   TYR B CD1   1 
ATOM   5206  C CD2   . TYR B 1 68  ? 23.463  64.316  50.234  1.00 29.18  ? 68   TYR B CD2   1 
ATOM   5207  C CE1   . TYR B 1 68  ? 21.973  66.627  50.709  1.00 24.12  ? 68   TYR B CE1   1 
ATOM   5208  C CE2   . TYR B 1 68  ? 22.932  64.541  51.498  1.00 32.87  ? 68   TYR B CE2   1 
ATOM   5209  C CZ    . TYR B 1 68  ? 22.195  65.691  51.737  1.00 29.73  ? 68   TYR B CZ    1 
ATOM   5210  O OH    . TYR B 1 68  ? 21.688  65.864  53.000  1.00 26.76  ? 68   TYR B OH    1 
ATOM   5211  N N     . VAL B 1 69  ? 21.994  66.390  45.923  1.00 31.82  ? 69   VAL B N     1 
ATOM   5212  C CA    . VAL B 1 69  ? 20.955  67.385  45.614  1.00 31.67  ? 69   VAL B CA    1 
ATOM   5213  C C     . VAL B 1 69  ? 19.898  66.871  44.642  1.00 31.76  ? 69   VAL B C     1 
ATOM   5214  O O     . VAL B 1 69  ? 18.699  67.160  44.803  1.00 27.85  ? 69   VAL B O     1 
ATOM   5215  C CB    . VAL B 1 69  ? 21.572  68.713  45.062  1.00 32.78  ? 69   VAL B CB    1 
ATOM   5216  C CG1   . VAL B 1 69  ? 20.458  69.727  44.662  1.00 27.84  ? 69   VAL B CG1   1 
ATOM   5217  C CG2   . VAL B 1 69  ? 22.542  69.318  46.088  1.00 31.64  ? 69   VAL B CG2   1 
ATOM   5218  N N     . SER B 1 70  ? 20.346  66.116  43.639  1.00 31.78  ? 70   SER B N     1 
ATOM   5219  C CA    . SER B 1 70  ? 19.448  65.407  42.712  1.00 32.27  ? 70   SER B CA    1 
ATOM   5220  C C     . SER B 1 70  ? 18.455  64.507  43.451  1.00 31.96  ? 70   SER B C     1 
ATOM   5221  O O     . SER B 1 70  ? 17.255  64.528  43.193  1.00 30.49  ? 70   SER B O     1 
ATOM   5222  C CB    . SER B 1 70  ? 20.290  64.546  41.743  1.00 34.16  ? 70   SER B CB    1 
ATOM   5223  O OG    . SER B 1 70  ? 19.487  63.798  40.852  1.00 39.44  ? 70   SER B OG    1 
ATOM   5224  N N     . PHE B 1 71  ? 18.973  63.713  44.384  1.00 30.52  ? 71   PHE B N     1 
ATOM   5225  C CA    . PHE B 1 71  ? 18.115  62.917  45.242  1.00 29.13  ? 71   PHE B CA    1 
ATOM   5226  C C     . PHE B 1 71  ? 17.170  63.804  46.100  1.00 29.15  ? 71   PHE B C     1 
ATOM   5227  O O     . PHE B 1 71  ? 15.963  63.563  46.143  1.00 26.68  ? 71   PHE B O     1 
ATOM   5228  C CB    . PHE B 1 71  ? 19.004  62.048  46.089  1.00 27.93  ? 71   PHE B CB    1 
ATOM   5229  C CG    . PHE B 1 71  ? 18.289  61.145  47.002  1.00 21.37  ? 71   PHE B CG    1 
ATOM   5230  C CD1   . PHE B 1 71  ? 17.268  60.328  46.541  1.00 26.16  ? 71   PHE B CD1   1 
ATOM   5231  C CD2   . PHE B 1 71  ? 18.711  61.014  48.329  1.00 25.49  ? 71   PHE B CD2   1 
ATOM   5232  C CE1   . PHE B 1 71  ? 16.614  59.461  47.416  1.00 25.67  ? 71   PHE B CE1   1 
ATOM   5233  C CE2   . PHE B 1 71  ? 18.076  60.128  49.202  1.00 28.32  ? 71   PHE B CE2   1 
ATOM   5234  C CZ    . PHE B 1 71  ? 17.027  59.353  48.743  1.00 28.90  ? 71   PHE B CZ    1 
ATOM   5235  N N     . TYR B 1 72  ? 17.729  64.839  46.744  1.00 28.82  ? 72   TYR B N     1 
ATOM   5236  C CA    . TYR B 1 72  ? 16.950  65.823  47.509  1.00 27.42  ? 72   TYR B CA    1 
ATOM   5237  C C     . TYR B 1 72  ? 15.778  66.407  46.665  1.00 25.92  ? 72   TYR B C     1 
ATOM   5238  O O     . TYR B 1 72  ? 14.641  66.512  47.115  1.00 23.49  ? 72   TYR B O     1 
ATOM   5239  C CB    . TYR B 1 72  ? 17.901  66.949  48.016  1.00 29.12  ? 72   TYR B CB    1 
ATOM   5240  C CG    . TYR B 1 72  ? 17.200  68.176  48.568  1.00 29.05  ? 72   TYR B CG    1 
ATOM   5241  C CD1   . TYR B 1 72  ? 16.678  68.188  49.870  1.00 36.46  ? 72   TYR B CD1   1 
ATOM   5242  C CD2   . TYR B 1 72  ? 17.028  69.314  47.779  1.00 32.91  ? 72   TYR B CD2   1 
ATOM   5243  C CE1   . TYR B 1 72  ? 16.010  69.311  50.375  1.00 36.58  ? 72   TYR B CE1   1 
ATOM   5244  C CE2   . TYR B 1 72  ? 16.366  70.447  48.265  1.00 33.88  ? 72   TYR B CE2   1 
ATOM   5245  C CZ    . TYR B 1 72  ? 15.859  70.445  49.565  1.00 40.78  ? 72   TYR B CZ    1 
ATOM   5246  O OH    . TYR B 1 72  ? 15.206  71.574  50.052  1.00 41.23  ? 72   TYR B OH    1 
ATOM   5247  N N     . ASN B 1 73  ? 16.086  66.781  45.433  1.00 25.47  ? 73   ASN B N     1 
ATOM   5248  C CA    . ASN B 1 73  ? 15.120  67.351  44.534  1.00 27.99  ? 73   ASN B CA    1 
ATOM   5249  C C     . ASN B 1 73  ? 14.101  66.355  44.029  1.00 28.18  ? 73   ASN B C     1 
ATOM   5250  O O     . ASN B 1 73  ? 12.910  66.685  43.878  1.00 27.64  ? 73   ASN B O     1 
ATOM   5251  C CB    . ASN B 1 73  ? 15.835  68.059  43.384  1.00 26.47  ? 73   ASN B CB    1 
ATOM   5252  C CG    . ASN B 1 73  ? 16.261  69.446  43.777  1.00 27.88  ? 73   ASN B CG    1 
ATOM   5253  O OD1   . ASN B 1 73  ? 15.458  70.213  44.316  1.00 36.62  ? 73   ASN B OD1   1 
ATOM   5254  N ND2   . ASN B 1 73  ? 17.515  69.771  43.559  1.00 34.15  ? 73   ASN B ND2   1 
ATOM   5255  N N     . ALA B 1 74  ? 14.569  65.135  43.808  1.00 29.93  ? 74   ALA B N     1 
ATOM   5256  C CA    . ALA B 1 74  ? 13.689  64.031  43.435  1.00 29.56  ? 74   ALA B CA    1 
ATOM   5257  C C     . ALA B 1 74  ? 12.697  63.799  44.562  1.00 30.04  ? 74   ALA B C     1 
ATOM   5258  O O     . ALA B 1 74  ? 11.490  63.691  44.312  1.00 31.83  ? 74   ALA B O     1 
ATOM   5259  C CB    . ALA B 1 74  ? 14.506  62.789  43.138  1.00 28.41  ? 74   ALA B CB    1 
ATOM   5260  N N     . LEU B 1 75  ? 13.183  63.819  45.804  1.00 28.58  ? 75   LEU B N     1 
ATOM   5261  C CA    . LEU B 1 75  ? 12.289  63.735  46.974  1.00 31.55  ? 75   LEU B CA    1 
ATOM   5262  C C     . LEU B 1 75  ? 11.240  64.870  47.057  1.00 31.98  ? 75   LEU B C     1 
ATOM   5263  O O     . LEU B 1 75  ? 10.081  64.642  47.416  1.00 30.51  ? 75   LEU B O     1 
ATOM   5264  C CB    . LEU B 1 75  ? 13.081  63.662  48.297  1.00 28.55  ? 75   LEU B CB    1 
ATOM   5265  C CG    . LEU B 1 75  ? 14.008  62.466  48.572  1.00 31.33  ? 75   LEU B CG    1 
ATOM   5266  C CD1   . LEU B 1 75  ? 14.869  62.778  49.772  1.00 23.05  ? 75   LEU B CD1   1 
ATOM   5267  C CD2   . LEU B 1 75  ? 13.265  61.139  48.797  1.00 26.11  ? 75   LEU B CD2   1 
ATOM   5268  N N     . LEU B 1 76  ? 11.644  66.095  46.757  1.00 34.07  ? 76   LEU B N     1 
ATOM   5269  C CA    . LEU B 1 76  ? 10.699  67.213  46.784  1.00 36.59  ? 76   LEU B CA    1 
ATOM   5270  C C     . LEU B 1 76  ? 9.636   67.065  45.706  1.00 39.41  ? 76   LEU B C     1 
ATOM   5271  O O     . LEU B 1 76  ? 8.429   67.113  45.991  1.00 40.10  ? 76   LEU B O     1 
ATOM   5272  C CB    . LEU B 1 76  ? 11.426  68.552  46.615  1.00 36.19  ? 76   LEU B CB    1 
ATOM   5273  C CG    . LEU B 1 76  ? 12.169  69.054  47.842  1.00 36.87  ? 76   LEU B CG    1 
ATOM   5274  C CD1   . LEU B 1 76  ? 12.676  70.440  47.554  1.00 33.59  ? 76   LEU B CD1   1 
ATOM   5275  C CD2   . LEU B 1 76  ? 11.273  69.039  49.109  1.00 38.70  ? 76   LEU B CD2   1 
ATOM   5276  N N     . HIS B 1 77  ? 10.115  66.899  44.474  1.00 42.67  ? 77   HIS B N     1 
ATOM   5277  C CA    . HIS B 1 77  ? 9.299   66.621  43.291  1.00 41.13  ? 77   HIS B CA    1 
ATOM   5278  C C     . HIS B 1 77  ? 8.251   65.537  43.552  1.00 42.58  ? 77   HIS B C     1 
ATOM   5279  O O     . HIS B 1 77  ? 7.133   65.602  43.040  1.00 47.69  ? 77   HIS B O     1 
ATOM   5280  C CB    . HIS B 1 77  ? 10.260  66.216  42.145  1.00 42.62  ? 77   HIS B CB    1 
ATOM   5281  C CG    . HIS B 1 77  ? 9.602   65.967  40.814  1.00 46.61  ? 77   HIS B CG    1 
ATOM   5282  N ND1   . HIS B 1 77  ? 8.621   65.014  40.623  1.00 60.61  ? 77   HIS B ND1   1 
ATOM   5283  C CD2   . HIS B 1 77  ? 9.842   66.502  39.592  1.00 54.99  ? 77   HIS B CD2   1 
ATOM   5284  C CE1   . HIS B 1 77  ? 8.249   65.010  39.354  1.00 58.33  ? 77   HIS B CE1   1 
ATOM   5285  N NE2   . HIS B 1 77  ? 8.982   65.895  38.704  1.00 54.96  ? 77   HIS B NE2   1 
ATOM   5286  N N     . GLU B 1 78  ? 8.599   64.552  44.361  1.00 42.77  ? 78   GLU B N     1 
ATOM   5287  C CA    . GLU B 1 78  ? 7.717   63.422  44.625  1.00 41.17  ? 78   GLU B CA    1 
ATOM   5288  C C     . GLU B 1 78  ? 6.867   63.544  45.876  1.00 40.46  ? 78   GLU B C     1 
ATOM   5289  O O     . GLU B 1 78  ? 6.069   62.665  46.138  1.00 40.36  ? 78   GLU B O     1 
ATOM   5290  C CB    . GLU B 1 78  ? 8.541   62.116  44.671  1.00 39.51  ? 78   GLU B CB    1 
ATOM   5291  C CG    . GLU B 1 78  ? 8.951   61.626  43.298  1.00 35.33  ? 78   GLU B CG    1 
ATOM   5292  C CD    . GLU B 1 78  ? 7.793   61.597  42.306  1.00 37.55  ? 78   GLU B CD    1 
ATOM   5293  O OE1   . GLU B 1 78  ? 6.730   61.012  42.616  1.00 34.42  ? 78   GLU B OE1   1 
ATOM   5294  O OE2   . GLU B 1 78  ? 7.951   62.176  41.217  1.00 34.70  ? 78   GLU B OE2   1 
ATOM   5295  N N     . GLY B 1 79  ? 7.043   64.614  46.645  1.00 42.69  ? 79   GLY B N     1 
ATOM   5296  C CA    . GLY B 1 79  ? 6.169   64.935  47.785  1.00 43.71  ? 79   GLY B CA    1 
ATOM   5297  C C     . GLY B 1 79  ? 6.637   64.587  49.188  1.00 45.15  ? 79   GLY B C     1 
ATOM   5298  O O     . GLY B 1 79  ? 5.875   64.680  50.154  1.00 45.28  ? 79   GLY B O     1 
ATOM   5299  N N     . TYR B 1 80  ? 7.891   64.197  49.326  1.00 46.49  ? 80   TYR B N     1 
ATOM   5300  C CA    . TYR B 1 80  ? 8.421   63.840  50.634  1.00 46.66  ? 80   TYR B CA    1 
ATOM   5301  C C     . TYR B 1 80  ? 8.992   65.081  51.296  1.00 48.83  ? 80   TYR B C     1 
ATOM   5302  O O     . TYR B 1 80  ? 10.206  65.212  51.466  1.00 49.36  ? 80   TYR B O     1 
ATOM   5303  C CB    . TYR B 1 80  ? 9.503   62.780  50.512  1.00 45.40  ? 80   TYR B CB    1 
ATOM   5304  C CG    . TYR B 1 80  ? 9.039   61.495  49.909  1.00 36.84  ? 80   TYR B CG    1 
ATOM   5305  C CD1   . TYR B 1 80  ? 8.357   60.557  50.660  1.00 39.49  ? 80   TYR B CD1   1 
ATOM   5306  C CD2   . TYR B 1 80  ? 9.307   61.208  48.577  1.00 44.92  ? 80   TYR B CD2   1 
ATOM   5307  C CE1   . TYR B 1 80  ? 7.954   59.350  50.098  1.00 40.50  ? 80   TYR B CE1   1 
ATOM   5308  C CE2   . TYR B 1 80  ? 8.907   60.027  48.005  1.00 44.55  ? 80   TYR B CE2   1 
ATOM   5309  C CZ    . TYR B 1 80  ? 8.237   59.097  48.766  1.00 45.59  ? 80   TYR B CZ    1 
ATOM   5310  O OH    . TYR B 1 80  ? 7.854   57.919  48.155  1.00 48.96  ? 80   TYR B OH    1 
ATOM   5311  N N     . LYS B 1 81  ? 8.084   65.967  51.687  1.00 50.97  ? 81   LYS B N     1 
ATOM   5312  C CA    . LYS B 1 81  ? 8.412   67.293  52.171  1.00 51.68  ? 81   LYS B CA    1 
ATOM   5313  C C     . LYS B 1 81  ? 9.344   67.227  53.399  1.00 51.94  ? 81   LYS B C     1 
ATOM   5314  O O     . LYS B 1 81  ? 10.350  67.942  53.485  1.00 51.49  ? 81   LYS B O     1 
ATOM   5315  C CB    . LYS B 1 81  ? 7.088   68.001  52.492  1.00 52.85  ? 81   LYS B CB    1 
ATOM   5316  C CG    . LYS B 1 81  ? 7.181   69.421  53.072  1.00 54.86  ? 81   LYS B CG    1 
ATOM   5317  C CD    . LYS B 1 81  ? 5.771   69.980  53.260  1.00 55.83  ? 81   LYS B CD    1 
ATOM   5318  C CE    . LYS B 1 81  ? 5.472   70.416  54.699  1.00 62.28  ? 81   LYS B CE    1 
ATOM   5319  N NZ    . LYS B 1 81  ? 3.993   70.310  55.004  1.00 57.37  ? 81   LYS B NZ    1 
ATOM   5320  N N     . ASP B 1 82  ? 9.031   66.334  54.326  1.00 51.60  ? 82   ASP B N     1 
ATOM   5321  C CA    . ASP B 1 82  ? 9.695   66.358  55.636  1.00 52.57  ? 82   ASP B CA    1 
ATOM   5322  C C     . ASP B 1 82  ? 10.966  65.516  55.669  1.00 50.07  ? 82   ASP B C     1 
ATOM   5323  O O     . ASP B 1 82  ? 11.865  65.810  56.428  1.00 51.51  ? 82   ASP B O     1 
ATOM   5324  C CB    . ASP B 1 82  ? 8.704   65.950  56.740  1.00 54.25  ? 82   ASP B CB    1 
ATOM   5325  C CG    . ASP B 1 82  ? 7.389   66.731  56.651  1.00 62.01  ? 82   ASP B CG    1 
ATOM   5326  O OD1   . ASP B 1 82  ? 7.395   67.957  56.930  1.00 62.82  ? 82   ASP B OD1   1 
ATOM   5327  O OD2   . ASP B 1 82  ? 6.364   66.120  56.259  1.00 73.46  ? 82   ASP B OD2   1 
ATOM   5328  N N     . LEU B 1 83  ? 11.039  64.482  54.839  1.00 48.67  ? 83   LEU B N     1 
ATOM   5329  C CA    . LEU B 1 83  ? 12.278  63.723  54.654  1.00 47.79  ? 83   LEU B CA    1 
ATOM   5330  C C     . LEU B 1 83  ? 13.349  64.517  53.916  1.00 45.40  ? 83   LEU B C     1 
ATOM   5331  O O     . LEU B 1 83  ? 14.531  64.368  54.205  1.00 42.81  ? 83   LEU B O     1 
ATOM   5332  C CB    . LEU B 1 83  ? 12.003  62.420  53.896  1.00 48.14  ? 83   LEU B CB    1 
ATOM   5333  C CG    . LEU B 1 83  ? 11.081  61.429  54.617  1.00 48.99  ? 83   LEU B CG    1 
ATOM   5334  C CD1   . LEU B 1 83  ? 10.848  60.210  53.755  1.00 46.42  ? 83   LEU B CD1   1 
ATOM   5335  C CD2   . LEU B 1 83  ? 11.653  61.049  55.976  1.00 49.07  ? 83   LEU B CD2   1 
ATOM   5336  N N     . ALA B 1 84  ? 12.934  65.331  52.945  1.00 45.28  ? 84   ALA B N     1 
ATOM   5337  C CA    . ALA B 1 84  ? 13.850  66.249  52.273  1.00 45.67  ? 84   ALA B CA    1 
ATOM   5338  C C     . ALA B 1 84  ? 14.265  67.352  53.230  1.00 45.03  ? 84   ALA B C     1 
ATOM   5339  O O     . ALA B 1 84  ? 15.392  67.843  53.151  1.00 45.44  ? 84   ALA B O     1 
ATOM   5340  C CB    . ALA B 1 84  ? 13.218  66.835  51.020  1.00 45.38  ? 84   ALA B CB    1 
ATOM   5341  N N     . ALA B 1 85  ? 13.362  67.732  54.140  1.00 45.95  ? 85   ALA B N     1 
ATOM   5342  C CA    . ALA B 1 85  ? 13.674  68.725  55.198  1.00 45.77  ? 85   ALA B CA    1 
ATOM   5343  C C     . ALA B 1 85  ? 14.806  68.241  56.062  1.00 44.87  ? 85   ALA B C     1 
ATOM   5344  O O     . ALA B 1 85  ? 15.661  69.018  56.478  1.00 45.15  ? 85   ALA B O     1 
ATOM   5345  C CB    . ALA B 1 85  ? 12.442  69.004  56.069  1.00 46.40  ? 85   ALA B CB    1 
ATOM   5346  N N     . LEU B 1 86  ? 14.795  66.940  56.328  1.00 44.04  ? 86   LEU B N     1 
ATOM   5347  C CA    . LEU B 1 86  ? 15.846  66.306  57.083  1.00 42.55  ? 86   LEU B CA    1 
ATOM   5348  C C     . LEU B 1 86  ? 17.149  66.232  56.305  1.00 41.57  ? 86   LEU B C     1 
ATOM   5349  O O     . LEU B 1 86  ? 18.215  66.098  56.903  1.00 41.61  ? 86   LEU B O     1 
ATOM   5350  C CB    . LEU B 1 86  ? 15.419  64.898  57.493  1.00 43.77  ? 86   LEU B CB    1 
ATOM   5351  C CG    . LEU B 1 86  ? 14.143  64.744  58.334  1.00 46.35  ? 86   LEU B CG    1 
ATOM   5352  C CD1   . LEU B 1 86  ? 14.133  63.385  59.032  1.00 43.23  ? 86   LEU B CD1   1 
ATOM   5353  C CD2   . LEU B 1 86  ? 13.992  65.894  59.354  1.00 48.53  ? 86   LEU B CD2   1 
ATOM   5354  N N     . LEU B 1 87  ? 17.078  66.281  54.980  1.00 39.53  ? 87   LEU B N     1 
ATOM   5355  C CA    . LEU B 1 87  ? 18.297  66.240  54.160  1.00 39.76  ? 87   LEU B CA    1 
ATOM   5356  C C     . LEU B 1 87  ? 18.802  67.632  53.831  1.00 38.01  ? 87   LEU B C     1 
ATOM   5357  O O     . LEU B 1 87  ? 19.980  67.795  53.602  1.00 33.13  ? 87   LEU B O     1 
ATOM   5358  C CB    . LEU B 1 87  ? 18.089  65.449  52.860  1.00 40.39  ? 87   LEU B CB    1 
ATOM   5359  C CG    . LEU B 1 87  ? 18.028  63.912  52.875  1.00 38.42  ? 87   LEU B CG    1 
ATOM   5360  C CD1   . LEU B 1 87  ? 18.159  63.415  51.453  1.00 41.42  ? 87   LEU B CD1   1 
ATOM   5361  C CD2   . LEU B 1 87  ? 19.096  63.243  53.749  1.00 40.37  ? 87   LEU B CD2   1 
ATOM   5362  N N     . HIS B 1 88  ? 17.893  68.615  53.803  1.00 39.47  ? 88   HIS B N     1 
ATOM   5363  C CA    . HIS B 1 88  ? 18.198  70.009  53.455  1.00 40.94  ? 88   HIS B CA    1 
ATOM   5364  C C     . HIS B 1 88  ? 19.448  70.536  54.157  1.00 41.24  ? 88   HIS B C     1 
ATOM   5365  O O     . HIS B 1 88  ? 20.243  71.308  53.610  1.00 39.63  ? 88   HIS B O     1 
ATOM   5366  C CB    . HIS B 1 88  ? 17.016  70.911  53.833  1.00 41.68  ? 88   HIS B CB    1 
ATOM   5367  C CG    . HIS B 1 88  ? 17.226  72.353  53.485  1.00 38.87  ? 88   HIS B CG    1 
ATOM   5368  N ND1   . HIS B 1 88  ? 16.887  72.876  52.258  1.00 44.59  ? 88   HIS B ND1   1 
ATOM   5369  C CD2   . HIS B 1 88  ? 17.767  73.372  54.190  1.00 43.86  ? 88   HIS B CD2   1 
ATOM   5370  C CE1   . HIS B 1 88  ? 17.190  74.161  52.227  1.00 47.12  ? 88   HIS B CE1   1 
ATOM   5371  N NE2   . HIS B 1 88  ? 17.731  74.487  53.387  1.00 46.90  ? 88   HIS B NE2   1 
ATOM   5372  N N     . ASP B 1 89  ? 19.575  70.105  55.394  1.00 41.28  ? 89   ASP B N     1 
ATOM   5373  C CA    . ASP B 1 89  ? 20.688  70.427  56.247  1.00 41.67  ? 89   ASP B CA    1 
ATOM   5374  C C     . ASP B 1 89  ? 22.068  70.133  55.633  1.00 40.72  ? 89   ASP B C     1 
ATOM   5375  O O     . ASP B 1 89  ? 23.027  70.901  55.804  1.00 38.80  ? 89   ASP B O     1 
ATOM   5376  C CB    . ASP B 1 89  ? 20.501  69.590  57.518  1.00 44.78  ? 89   ASP B CB    1 
ATOM   5377  C CG    . ASP B 1 89  ? 21.640  69.713  58.451  1.00 49.94  ? 89   ASP B CG    1 
ATOM   5378  O OD1   . ASP B 1 89  ? 22.103  70.865  58.617  1.00 59.44  ? 89   ASP B OD1   1 
ATOM   5379  O OD2   . ASP B 1 89  ? 22.056  68.668  59.016  1.00 61.85  ? 89   ASP B OD2   1 
ATOM   5380  N N     . GLY B 1 90  ? 22.164  69.004  54.940  1.00 37.53  ? 90   GLY B N     1 
ATOM   5381  C CA    . GLY B 1 90  ? 23.445  68.489  54.498  1.00 36.07  ? 90   GLY B CA    1 
ATOM   5382  C C     . GLY B 1 90  ? 23.773  68.877  53.080  1.00 33.23  ? 90   GLY B C     1 
ATOM   5383  O O     . GLY B 1 90  ? 24.785  68.426  52.561  1.00 30.08  ? 90   GLY B O     1 
ATOM   5384  N N     . ILE B 1 91  ? 22.922  69.700  52.455  1.00 33.00  ? 91   ILE B N     1 
ATOM   5385  C CA    . ILE B 1 91  ? 23.120  70.091  51.072  1.00 34.32  ? 91   ILE B CA    1 
ATOM   5386  C C     . ILE B 1 91  ? 24.477  70.756  50.966  1.00 35.94  ? 91   ILE B C     1 
ATOM   5387  O O     . ILE B 1 91  ? 24.779  71.676  51.738  1.00 38.26  ? 91   ILE B O     1 
ATOM   5388  C CB    . ILE B 1 91  ? 22.037  71.060  50.562  1.00 33.69  ? 91   ILE B CB    1 
ATOM   5389  C CG1   . ILE B 1 91  ? 20.731  70.309  50.316  1.00 30.03  ? 91   ILE B CG1   1 
ATOM   5390  C CG2   . ILE B 1 91  ? 22.479  71.731  49.247  1.00 34.16  ? 91   ILE B CG2   1 
ATOM   5391  C CD1   . ILE B 1 91  ? 19.524  71.207  50.285  1.00 35.86  ? 91   ILE B CD1   1 
ATOM   5392  N N     . PRO B 1 92  ? 25.332  70.255  50.062  1.00 35.66  ? 92   PRO B N     1 
ATOM   5393  C CA    . PRO B 1 92  ? 26.590  70.987  49.856  1.00 37.97  ? 92   PRO B CA    1 
ATOM   5394  C C     . PRO B 1 92  ? 26.346  72.364  49.188  1.00 37.99  ? 92   PRO B C     1 
ATOM   5395  O O     . PRO B 1 92  ? 25.628  72.442  48.188  1.00 32.83  ? 92   PRO B O     1 
ATOM   5396  C CB    . PRO B 1 92  ? 27.400  70.044  48.950  1.00 38.47  ? 92   PRO B CB    1 
ATOM   5397  C CG    . PRO B 1 92  ? 26.683  68.692  49.027  1.00 35.97  ? 92   PRO B CG    1 
ATOM   5398  C CD    . PRO B 1 92  ? 25.255  69.029  49.251  1.00 32.38  ? 92   PRO B CD    1 
ATOM   5399  N N     . VAL B 1 93  ? 26.928  73.423  49.761  1.00 39.73  ? 93   VAL B N     1 
ATOM   5400  C CA    . VAL B 1 93  ? 26.757  74.793  49.247  1.00 41.53  ? 93   VAL B CA    1 
ATOM   5401  C C     . VAL B 1 93  ? 27.152  74.930  47.763  1.00 42.67  ? 93   VAL B C     1 
ATOM   5402  O O     . VAL B 1 93  ? 26.437  75.571  46.988  1.00 41.90  ? 93   VAL B O     1 
ATOM   5403  C CB    . VAL B 1 93  ? 27.543  75.822  50.081  1.00 40.47  ? 93   VAL B CB    1 
ATOM   5404  C CG1   . VAL B 1 93  ? 27.410  77.214  49.486  1.00 39.39  ? 93   VAL B CG1   1 
ATOM   5405  C CG2   . VAL B 1 93  ? 27.046  75.838  51.527  1.00 43.45  ? 93   VAL B CG2   1 
ATOM   5406  N N     . VAL B 1 94  ? 28.259  74.301  47.364  1.00 44.43  ? 94   VAL B N     1 
ATOM   5407  C CA    . VAL B 1 94  ? 28.727  74.358  45.962  1.00 47.38  ? 94   VAL B CA    1 
ATOM   5408  C C     . VAL B 1 94  ? 27.716  73.741  44.942  1.00 49.63  ? 94   VAL B C     1 
ATOM   5409  O O     . VAL B 1 94  ? 27.790  74.000  43.739  1.00 49.71  ? 94   VAL B O     1 
ATOM   5410  C CB    . VAL B 1 94  ? 30.142  73.701  45.799  1.00 47.49  ? 94   VAL B CB    1 
ATOM   5411  C CG1   . VAL B 1 94  ? 30.621  73.781  44.344  1.00 45.24  ? 94   VAL B CG1   1 
ATOM   5412  C CG2   . VAL B 1 94  ? 31.178  74.367  46.743  1.00 48.22  ? 94   VAL B CG2   1 
ATOM   5413  N N     . SER B 1 95  ? 26.772  72.945  45.432  1.00 51.12  ? 95   SER B N     1 
ATOM   5414  C CA    . SER B 1 95  ? 25.811  72.258  44.583  1.00 52.19  ? 95   SER B CA    1 
ATOM   5415  C C     . SER B 1 95  ? 24.402  72.806  44.755  1.00 54.42  ? 95   SER B C     1 
ATOM   5416  O O     . SER B 1 95  ? 23.443  72.187  44.293  1.00 55.70  ? 95   SER B O     1 
ATOM   5417  C CB    . SER B 1 95  ? 25.820  70.778  44.945  1.00 49.96  ? 95   SER B CB    1 
ATOM   5418  O OG    . SER B 1 95  ? 27.145  70.318  45.063  1.00 45.29  ? 95   SER B OG    1 
ATOM   5419  N N     . SER B 1 96  ? 24.289  73.980  45.377  1.00 58.35  ? 96   SER B N     1 
ATOM   5420  C CA    . SER B 1 96  ? 23.020  74.460  45.954  1.00 61.44  ? 96   SER B CA    1 
ATOM   5421  C C     . SER B 1 96  ? 21.894  74.678  44.937  1.00 64.98  ? 96   SER B C     1 
ATOM   5422  O O     . SER B 1 96  ? 20.727  74.373  45.227  1.00 66.27  ? 96   SER B O     1 
ATOM   5423  C CB    . SER B 1 96  ? 23.236  75.733  46.796  1.00 61.38  ? 96   SER B CB    1 
ATOM   5424  O OG    . SER B 1 96  ? 23.454  75.410  48.162  1.00 59.91  ? 96   SER B OG    1 
ATOM   5425  N N     . SER B 1 97  ? 22.231  75.215  43.766  1.00 67.62  ? 97   SER B N     1 
ATOM   5426  C CA    . SER B 1 97  ? 21.276  75.262  42.650  1.00 69.33  ? 97   SER B CA    1 
ATOM   5427  C C     . SER B 1 97  ? 21.992  74.864  41.368  1.00 70.77  ? 97   SER B C     1 
ATOM   5428  O O     . SER B 1 97  ? 22.865  75.588  40.887  1.00 70.67  ? 97   SER B O     1 
ATOM   5429  C CB    . SER B 1 97  ? 20.647  76.653  42.506  1.00 69.92  ? 97   SER B CB    1 
ATOM   5430  O OG    . SER B 1 97  ? 19.608  76.654  41.539  1.00 71.48  ? 97   SER B OG    1 
ATOM   5431  N N     . SER B 1 98  ? 21.626  73.704  40.829  1.00 72.37  ? 98   SER B N     1 
ATOM   5432  C CA    . SER B 1 98  ? 22.266  73.178  39.622  1.00 74.28  ? 98   SER B CA    1 
ATOM   5433  C C     . SER B 1 98  ? 21.878  73.994  38.370  1.00 76.10  ? 98   SER B C     1 
ATOM   5434  O O     . SER B 1 98  ? 20.902  74.766  38.387  1.00 75.58  ? 98   SER B O     1 
ATOM   5435  C CB    . SER B 1 98  ? 21.916  71.689  39.435  1.00 74.04  ? 98   SER B CB    1 
ATOM   5436  O OG    . SER B 1 98  ? 20.519  71.500  39.286  1.00 71.27  ? 98   SER B OG    1 
ATOM   5437  N N     . GLY B 1 99  ? 22.654  73.814  37.297  1.00 76.91  ? 99   GLY B N     1 
ATOM   5438  C CA    . GLY B 1 99  ? 22.412  74.489  36.014  1.00 77.82  ? 99   GLY B CA    1 
ATOM   5439  C C     . GLY B 1 99  ? 21.029  74.258  35.408  1.00 79.22  ? 99   GLY B C     1 
ATOM   5440  O O     . GLY B 1 99  ? 20.562  75.055  34.585  1.00 80.01  ? 99   GLY B O     1 
ATOM   5441  N N     . LYS B 1 100 ? 20.372  73.171  35.812  1.00 79.76  ? 100  LYS B N     1 
ATOM   5442  C CA    . LYS B 1 100 ? 19.001  72.887  35.385  1.00 79.39  ? 100  LYS B CA    1 
ATOM   5443  C C     . LYS B 1 100 ? 18.005  73.902  35.999  1.00 79.92  ? 100  LYS B C     1 
ATOM   5444  O O     . LYS B 1 100 ? 17.207  74.516  35.271  1.00 80.07  ? 100  LYS B O     1 
ATOM   5445  C CB    . LYS B 1 100 ? 18.630  71.434  35.735  1.00 79.31  ? 100  LYS B CB    1 
ATOM   5446  C CG    . LYS B 1 100 ? 17.574  70.822  34.823  1.00 80.03  ? 100  LYS B CG    1 
ATOM   5447  C CD    . LYS B 1 100 ? 17.895  69.370  34.458  1.00 79.22  ? 100  LYS B CD    1 
ATOM   5448  C CE    . LYS B 1 100 ? 16.887  68.821  33.445  1.00 80.92  ? 100  LYS B CE    1 
ATOM   5449  N NZ    . LYS B 1 100 ? 17.405  67.665  32.650  1.00 77.91  ? 100  LYS B NZ    1 
ATOM   5450  N N     . ASP B 1 101 ? 18.080  74.092  37.322  1.00 78.85  ? 101  ASP B N     1 
ATOM   5451  C CA    . ASP B 1 101 ? 17.207  75.042  38.051  1.00 77.65  ? 101  ASP B CA    1 
ATOM   5452  C C     . ASP B 1 101 ? 17.312  76.489  37.542  1.00 76.87  ? 101  ASP B C     1 
ATOM   5453  O O     . ASP B 1 101 ? 16.301  77.187  37.410  1.00 75.15  ? 101  ASP B O     1 
ATOM   5454  C CB    . ASP B 1 101 ? 17.534  75.040  39.553  1.00 77.37  ? 101  ASP B CB    1 
ATOM   5455  C CG    . ASP B 1 101 ? 17.019  73.806  40.273  1.00 76.70  ? 101  ASP B CG    1 
ATOM   5456  O OD1   . ASP B 1 101 ? 17.011  72.702  39.681  1.00 71.05  ? 101  ASP B OD1   1 
ATOM   5457  O OD2   . ASP B 1 101 ? 16.626  73.950  41.452  1.00 76.55  ? 101  ASP B OD2   1 
ATOM   5458  N N     . SER B 1 102 ? 18.550  76.916  37.279  1.00 76.46  ? 102  SER B N     1 
ATOM   5459  C CA    . SER B 1 102 ? 18.888  78.301  36.879  1.00 75.12  ? 102  SER B CA    1 
ATOM   5460  C C     . SER B 1 102 ? 17.998  78.923  35.785  1.00 73.88  ? 102  SER B C     1 
ATOM   5461  O O     . SER B 1 102 ? 17.409  79.991  35.980  1.00 72.00  ? 102  SER B O     1 
ATOM   5462  C CB    . SER B 1 102 ? 20.351  78.347  36.413  1.00 75.00  ? 102  SER B CB    1 
ATOM   5463  O OG    . SER B 1 102 ? 20.555  77.477  35.314  1.00 70.26  ? 102  SER B OG    1 
ATOM   5464  N N     . VAL B 1 103 ? 17.917  78.249  34.640  1.00 73.31  ? 103  VAL B N     1 
ATOM   5465  C CA    . VAL B 1 103 ? 17.160  78.758  33.491  1.00 72.15  ? 103  VAL B CA    1 
ATOM   5466  C C     . VAL B 1 103 ? 15.756  78.141  33.408  1.00 71.14  ? 103  VAL B C     1 
ATOM   5467  O O     . VAL B 1 103 ? 14.901  78.654  32.671  1.00 72.39  ? 103  VAL B O     1 
ATOM   5468  C CB    . VAL B 1 103 ? 17.925  78.538  32.143  1.00 72.83  ? 103  VAL B CB    1 
ATOM   5469  C CG1   . VAL B 1 103 ? 17.350  79.430  31.031  1.00 72.73  ? 103  VAL B CG1   1 
ATOM   5470  C CG2   . VAL B 1 103 ? 19.418  78.827  32.314  1.00 74.73  ? 103  VAL B CG2   1 
ATOM   5471  N N     . SER B 1 104 ? 15.505  77.060  34.154  1.00 68.00  ? 104  SER B N     1 
ATOM   5472  C CA    . SER B 1 104 ? 14.167  76.456  34.152  1.00 65.26  ? 104  SER B CA    1 
ATOM   5473  C C     . SER B 1 104 ? 13.177  77.321  34.944  1.00 63.16  ? 104  SER B C     1 
ATOM   5474  O O     . SER B 1 104 ? 12.043  77.504  34.523  1.00 65.64  ? 104  SER B O     1 
ATOM   5475  C CB    . SER B 1 104 ? 14.177  74.999  34.679  1.00 65.93  ? 104  SER B CB    1 
ATOM   5476  O OG    . SER B 1 104 ? 14.399  74.931  36.080  1.00 60.37  ? 104  SER B OG    1 
ATOM   5477  N N     . GLY B 1 105 ? 13.617  77.866  36.075  1.00 59.23  ? 105  GLY B N     1 
ATOM   5478  C CA    . GLY B 1 105 ? 12.721  78.564  37.002  1.00 54.98  ? 105  GLY B CA    1 
ATOM   5479  C C     . GLY B 1 105 ? 11.997  77.611  37.948  1.00 50.75  ? 105  GLY B C     1 
ATOM   5480  O O     . GLY B 1 105 ? 11.047  78.014  38.628  1.00 46.32  ? 105  GLY B O     1 
ATOM   5481  N N     . ILE B 1 106 ? 12.445  76.349  37.984  1.00 48.31  ? 106  ILE B N     1 
ATOM   5482  C CA    . ILE B 1 106 ? 11.896  75.344  38.896  1.00 46.10  ? 106  ILE B CA    1 
ATOM   5483  C C     . ILE B 1 106 ? 12.859  75.094  40.062  1.00 43.34  ? 106  ILE B C     1 
ATOM   5484  O O     . ILE B 1 106 ? 13.904  74.446  39.906  1.00 42.68  ? 106  ILE B O     1 
ATOM   5485  C CB    . ILE B 1 106 ? 11.545  74.029  38.163  1.00 46.71  ? 106  ILE B CB    1 
ATOM   5486  C CG1   . ILE B 1 106 ? 10.674  74.300  36.933  1.00 49.45  ? 106  ILE B CG1   1 
ATOM   5487  C CG2   . ILE B 1 106 ? 10.752  73.072  39.071  1.00 46.84  ? 106  ILE B CG2   1 
ATOM   5488  C CD1   . ILE B 1 106 ? 10.406  73.024  36.095  1.00 47.45  ? 106  ILE B CD1   1 
ATOM   5489  N N     . THR B 1 107 ? 12.496  75.645  41.220  1.00 39.57  ? 107  THR B N     1 
ATOM   5490  C CA    . THR B 1 107 ? 13.287  75.552  42.421  1.00 36.75  ? 107  THR B CA    1 
ATOM   5491  C C     . THR B 1 107 ? 12.671  74.541  43.397  1.00 34.79  ? 107  THR B C     1 
ATOM   5492  O O     . THR B 1 107 ? 11.644  73.922  43.114  1.00 33.33  ? 107  THR B O     1 
ATOM   5493  C CB    . THR B 1 107 ? 13.349  76.905  43.071  1.00 36.02  ? 107  THR B CB    1 
ATOM   5494  O OG1   . THR B 1 107 ? 12.025  77.291  43.400  1.00 28.54  ? 107  THR B OG1   1 
ATOM   5495  C CG2   . THR B 1 107 ? 14.001  77.951  42.111  1.00 36.66  ? 107  THR B CG2   1 
ATOM   5496  N N     . SER B 1 108 ? 13.328  74.369  44.541  1.00 33.03  ? 108  SER B N     1 
ATOM   5497  C CA    . SER B 1 108 ? 12.825  73.558  45.649  1.00 32.25  ? 108  SER B CA    1 
ATOM   5498  C C     . SER B 1 108 ? 11.525  74.113  46.171  1.00 30.70  ? 108  SER B C     1 
ATOM   5499  O O     . SER B 1 108 ? 10.583  73.346  46.426  1.00 30.32  ? 108  SER B O     1 
ATOM   5500  C CB    . SER B 1 108 ? 13.871  73.540  46.771  1.00 31.13  ? 108  SER B CB    1 
ATOM   5501  O OG    . SER B 1 108 ? 15.040  72.889  46.316  1.00 34.84  ? 108  SER B OG    1 
ATOM   5502  N N     . TYR B 1 109 ? 11.497  75.443  46.315  1.00 30.59  ? 109  TYR B N     1 
ATOM   5503  C CA    . TYR B 1 109 ? 10.299  76.218  46.623  1.00 30.22  ? 109  TYR B CA    1 
ATOM   5504  C C     . TYR B 1 109 ? 9.128   75.822  45.720  1.00 28.46  ? 109  TYR B C     1 
ATOM   5505  O O     . TYR B 1 109 ? 8.058   75.463  46.185  1.00 29.46  ? 109  TYR B O     1 
ATOM   5506  C CB    . TYR B 1 109 ? 10.641  77.720  46.499  1.00 31.33  ? 109  TYR B CB    1 
ATOM   5507  C CG    . TYR B 1 109 ? 9.472   78.630  46.780  1.00 33.81  ? 109  TYR B CG    1 
ATOM   5508  C CD1   . TYR B 1 109 ? 9.024   78.867  48.094  1.00 34.94  ? 109  TYR B CD1   1 
ATOM   5509  C CD2   . TYR B 1 109 ? 8.777   79.227  45.723  1.00 35.65  ? 109  TYR B CD2   1 
ATOM   5510  C CE1   . TYR B 1 109 ? 7.901   79.694  48.332  1.00 39.08  ? 109  TYR B CE1   1 
ATOM   5511  C CE2   . TYR B 1 109 ? 7.684   80.046  45.948  1.00 31.56  ? 109  TYR B CE2   1 
ATOM   5512  C CZ    . TYR B 1 109 ? 7.243   80.284  47.242  1.00 39.45  ? 109  TYR B CZ    1 
ATOM   5513  O OH    . TYR B 1 109 ? 6.147   81.132  47.407  1.00 43.21  ? 109  TYR B OH    1 
ATOM   5514  N N     . VAL B 1 110 ? 9.341   75.871  44.414  1.00 29.97  ? 110  VAL B N     1 
ATOM   5515  C CA    . VAL B 1 110 ? 8.284   75.507  43.452  1.00 29.04  ? 110  VAL B CA    1 
ATOM   5516  C C     . VAL B 1 110 ? 7.828   74.048  43.622  1.00 28.47  ? 110  VAL B C     1 
ATOM   5517  O O     . VAL B 1 110 ? 6.633   73.740  43.631  1.00 25.06  ? 110  VAL B O     1 
ATOM   5518  C CB    . VAL B 1 110 ? 8.744   75.725  41.987  1.00 29.06  ? 110  VAL B CB    1 
ATOM   5519  C CG1   . VAL B 1 110 ? 7.771   75.090  41.009  1.00 29.71  ? 110  VAL B CG1   1 
ATOM   5520  C CG2   . VAL B 1 110 ? 8.875   77.204  41.707  1.00 26.89  ? 110  VAL B CG2   1 
ATOM   5521  N N     . ARG B 1 111 ? 8.790   73.142  43.748  1.00 27.23  ? 111  ARG B N     1 
ATOM   5522  C CA    . ARG B 1 111 ? 8.475   71.743  43.906  1.00 29.88  ? 111  ARG B CA    1 
ATOM   5523  C C     . ARG B 1 111 ? 7.613   71.473  45.152  1.00 30.38  ? 111  ARG B C     1 
ATOM   5524  O O     . ARG B 1 111 ? 6.623   70.756  45.070  1.00 30.41  ? 111  ARG B O     1 
ATOM   5525  C CB    . ARG B 1 111 ? 9.743   70.869  43.889  1.00 28.61  ? 111  ARG B CB    1 
ATOM   5526  C CG    . ARG B 1 111 ? 10.313  70.704  42.464  1.00 34.42  ? 111  ARG B CG    1 
ATOM   5527  C CD    . ARG B 1 111 ? 11.540  69.799  42.391  1.00 37.60  ? 111  ARG B CD    1 
ATOM   5528  N NE    . ARG B 1 111 ? 12.778  70.556  42.526  1.00 50.98  ? 111  ARG B NE    1 
ATOM   5529  C CZ    . ARG B 1 111 ? 13.635  70.830  41.540  1.00 49.14  ? 111  ARG B CZ    1 
ATOM   5530  N NH1   . ARG B 1 111 ? 13.443  70.380  40.299  1.00 49.49  ? 111  ARG B NH1   1 
ATOM   5531  N NH2   . ARG B 1 111 ? 14.716  71.557  41.814  1.00 47.53  ? 111  ARG B NH2   1 
ATOM   5532  N N     . THR B 1 112 ? 7.957   72.097  46.269  1.00 31.11  ? 112  THR B N     1 
ATOM   5533  C CA    . THR B 1 112 ? 7.197   71.969  47.510  1.00 32.56  ? 112  THR B CA    1 
ATOM   5534  C C     . THR B 1 112 ? 5.807   72.578  47.444  1.00 31.85  ? 112  THR B C     1 
ATOM   5535  O O     . THR B 1 112 ? 4.831   71.918  47.779  1.00 31.90  ? 112  THR B O     1 
ATOM   5536  C CB    . THR B 1 112 ? 7.949   72.614  48.674  1.00 32.87  ? 112  THR B CB    1 
ATOM   5537  O OG1   . THR B 1 112 ? 9.297   72.135  48.687  1.00 42.74  ? 112  THR B OG1   1 
ATOM   5538  C CG2   . THR B 1 112 ? 7.276   72.271  49.984  1.00 35.69  ? 112  THR B CG2   1 
ATOM   5539  N N     . VAL B 1 113 ? 5.728   73.842  47.036  1.00 32.18  ? 113  VAL B N     1 
ATOM   5540  C CA    . VAL B 1 113 ? 4.449   74.533  46.896  1.00 31.19  ? 113  VAL B CA    1 
ATOM   5541  C C     . VAL B 1 113 ? 3.487   73.711  46.059  1.00 31.00  ? 113  VAL B C     1 
ATOM   5542  O O     . VAL B 1 113 ? 2.360   73.499  46.477  1.00 32.94  ? 113  VAL B O     1 
ATOM   5543  C CB    . VAL B 1 113 ? 4.652   75.961  46.335  1.00 31.40  ? 113  VAL B CB    1 
ATOM   5544  C CG1   . VAL B 1 113 ? 3.343   76.577  45.814  1.00 28.97  ? 113  VAL B CG1   1 
ATOM   5545  C CG2   . VAL B 1 113 ? 5.253   76.815  47.423  1.00 33.06  ? 113  VAL B CG2   1 
ATOM   5546  N N     . LEU B 1 114 ? 3.928   73.216  44.903  1.00 30.87  ? 114  LEU B N     1 
ATOM   5547  C CA    . LEU B 1 114 ? 3.005   72.509  43.980  1.00 32.64  ? 114  LEU B CA    1 
ATOM   5548  C C     . LEU B 1 114 ? 2.509   71.175  44.524  1.00 33.59  ? 114  LEU B C     1 
ATOM   5549  O O     . LEU B 1 114 ? 1.326   70.822  44.423  1.00 30.63  ? 114  LEU B O     1 
ATOM   5550  C CB    . LEU B 1 114 ? 3.649   72.254  42.620  1.00 31.48  ? 114  LEU B CB    1 
ATOM   5551  C CG    . LEU B 1 114 ? 4.027   73.478  41.783  1.00 38.98  ? 114  LEU B CG    1 
ATOM   5552  C CD1   . LEU B 1 114 ? 4.111   73.100  40.285  1.00 41.38  ? 114  LEU B CD1   1 
ATOM   5553  C CD2   . LEU B 1 114 ? 3.102   74.655  41.985  1.00 38.72  ? 114  LEU B CD2   1 
ATOM   5554  N N     . CYS B 1 115 ? 3.438   70.434  45.100  1.00 37.79  ? 115  CYS B N     1 
ATOM   5555  C CA    . CYS B 1 115 ? 3.109   69.192  45.736  1.00 37.06  ? 115  CYS B CA    1 
ATOM   5556  C C     . CYS B 1 115 ? 2.163   69.367  46.958  1.00 34.15  ? 115  CYS B C     1 
ATOM   5557  O O     . CYS B 1 115 ? 1.154   68.631  47.071  1.00 32.11  ? 115  CYS B O     1 
ATOM   5558  C CB    . CYS B 1 115 ? 4.400   68.459  46.103  1.00 41.23  ? 115  CYS B CB    1 
ATOM   5559  S SG    . CYS B 1 115 ? 4.106   66.731  46.342  1.00 54.33  ? 115  CYS B SG    1 
ATOM   5560  N N     . GLU B 1 116 ? 2.446   70.349  47.824  1.00 33.94  ? 116  GLU B N     1 
ATOM   5561  C CA    . GLU B 1 116 ? 1.482   70.771  48.847  1.00 37.37  ? 116  GLU B CA    1 
ATOM   5562  C C     . GLU B 1 116 ? 0.063   71.011  48.264  1.00 36.29  ? 116  GLU B C     1 
ATOM   5563  O O     . GLU B 1 116 ? -0.913  70.558  48.819  1.00 36.08  ? 116  GLU B O     1 
ATOM   5564  C CB    . GLU B 1 116 ? 1.981   72.021  49.585  1.00 35.52  ? 116  GLU B CB    1 
ATOM   5565  C CG    . GLU B 1 116 ? 2.729   71.672  50.883  1.00 51.15  ? 116  GLU B CG    1 
ATOM   5566  C CD    . GLU B 1 116 ? 3.533   72.826  51.498  1.00 47.86  ? 116  GLU B CD    1 
ATOM   5567  O OE1   . GLU B 1 116 ? 3.672   73.896  50.853  1.00 61.41  ? 116  GLU B OE1   1 
ATOM   5568  O OE2   . GLU B 1 116 ? 4.037   72.653  52.636  1.00 63.03  ? 116  GLU B OE2   1 
ATOM   5569  N N     . GLY B 1 117 ? -0.033  71.713  47.138  1.00 33.49  ? 117  GLY B N     1 
ATOM   5570  C CA    . GLY B 1 117 ? -1.330  71.995  46.515  1.00 31.23  ? 117  GLY B CA    1 
ATOM   5571  C C     . GLY B 1 117 ? -1.993  70.848  45.761  1.00 29.39  ? 117  GLY B C     1 
ATOM   5572  O O     . GLY B 1 117 ? -3.144  70.961  45.330  1.00 28.28  ? 117  GLY B O     1 
ATOM   5573  N N     . GLY B 1 118 ? -1.299  69.729  45.612  1.00 27.43  ? 118  GLY B N     1 
ATOM   5574  C CA    . GLY B 1 118 ? -1.832  68.599  44.830  1.00 26.62  ? 118  GLY B CA    1 
ATOM   5575  C C     . GLY B 1 118 ? -1.831  68.831  43.333  1.00 28.62  ? 118  GLY B C     1 
ATOM   5576  O O     . GLY B 1 118 ? -2.688  68.278  42.616  1.00 27.72  ? 118  GLY B O     1 
ATOM   5577  N N     . VAL B 1 119 ? -0.871  69.637  42.845  1.00 29.42  ? 119  VAL B N     1 
ATOM   5578  C CA    . VAL B 1 119 ? -0.757  69.927  41.423  1.00 27.23  ? 119  VAL B CA    1 
ATOM   5579  C C     . VAL B 1 119 ? -0.107  68.695  40.766  1.00 26.86  ? 119  VAL B C     1 
ATOM   5580  O O     . VAL B 1 119 ? 0.927   68.183  41.263  1.00 26.65  ? 119  VAL B O     1 
ATOM   5581  C CB    . VAL B 1 119 ? 0.058   71.211  41.145  1.00 26.18  ? 119  VAL B CB    1 
ATOM   5582  C CG1   . VAL B 1 119 ? 0.182   71.489  39.630  1.00 31.12  ? 119  VAL B CG1   1 
ATOM   5583  C CG2   . VAL B 1 119 ? -0.566  72.413  41.799  1.00 26.75  ? 119  VAL B CG2   1 
ATOM   5584  N N     . PRO B 1 120 ? -0.723  68.161  39.683  1.00 26.90  ? 120  PRO B N     1 
ATOM   5585  C CA    . PRO B 1 120 ? -0.153  66.974  39.022  1.00 28.91  ? 120  PRO B CA    1 
ATOM   5586  C C     . PRO B 1 120 ? 1.310   67.174  38.590  1.00 27.90  ? 120  PRO B C     1 
ATOM   5587  O O     . PRO B 1 120 ? 1.688   68.245  38.204  1.00 26.41  ? 120  PRO B O     1 
ATOM   5588  C CB    . PRO B 1 120 ? -1.058  66.770  37.795  1.00 30.62  ? 120  PRO B CB    1 
ATOM   5589  C CG    . PRO B 1 120 ? -2.355  67.381  38.210  1.00 30.86  ? 120  PRO B CG    1 
ATOM   5590  C CD    . PRO B 1 120 ? -1.979  68.572  39.052  1.00 24.07  ? 120  PRO B CD    1 
ATOM   5591  N N     . GLN B 1 121 ? 2.130   66.151  38.744  1.00 29.63  ? 121  GLN B N     1 
ATOM   5592  C CA    . GLN B 1 121 ? 3.484   66.178  38.219  1.00 31.81  ? 121  GLN B CA    1 
ATOM   5593  C C     . GLN B 1 121 ? 3.425   66.304  36.667  1.00 32.08  ? 121  GLN B C     1 
ATOM   5594  O O     . GLN B 1 121 ? 2.396   66.086  36.049  1.00 29.58  ? 121  GLN B O     1 
ATOM   5595  C CB    . GLN B 1 121 ? 4.254   64.926  38.667  1.00 29.78  ? 121  GLN B CB    1 
ATOM   5596  C CG    . GLN B 1 121 ? 4.775   64.964  40.130  1.00 37.76  ? 121  GLN B CG    1 
ATOM   5597  C CD    . GLN B 1 121 ? 3.870   64.334  41.248  1.00 44.15  ? 121  GLN B CD    1 
ATOM   5598  O OE1   . GLN B 1 121 ? 2.812   63.731  41.011  1.00 37.21  ? 121  GLN B OE1   1 
ATOM   5599  N NE2   . GLN B 1 121 ? 4.339   64.467  42.485  1.00 37.50  ? 121  GLN B NE2   1 
ATOM   5600  N N     . ARG B 1 122 ? 4.519   66.712  36.056  1.00 33.80  ? 122  ARG B N     1 
ATOM   5601  C CA    . ARG B 1 122 ? 4.619   66.679  34.606  1.00 34.12  ? 122  ARG B CA    1 
ATOM   5602  C C     . ARG B 1 122 ? 4.349   65.302  34.027  1.00 37.17  ? 122  ARG B C     1 
ATOM   5603  O O     . ARG B 1 122 ? 4.636   64.293  34.690  1.00 38.96  ? 122  ARG B O     1 
ATOM   5604  C CB    . ARG B 1 122 ? 6.008   67.090  34.161  1.00 34.62  ? 122  ARG B CB    1 
ATOM   5605  C CG    . ARG B 1 122 ? 6.163   68.555  33.997  1.00 30.58  ? 122  ARG B CG    1 
ATOM   5606  C CD    . ARG B 1 122 ? 7.609   68.895  33.760  1.00 31.96  ? 122  ARG B CD    1 
ATOM   5607  N NE    . ARG B 1 122 ? 7.775   70.326  33.629  1.00 30.34  ? 122  ARG B NE    1 
ATOM   5608  C CZ    . ARG B 1 122 ? 8.865   70.909  33.136  1.00 35.32  ? 122  ARG B CZ    1 
ATOM   5609  N NH1   . ARG B 1 122 ? 9.905   70.179  32.768  1.00 38.31  ? 122  ARG B NH1   1 
ATOM   5610  N NH2   . ARG B 1 122 ? 8.920   72.234  33.029  1.00 28.27  ? 122  ARG B NH2   1 
ATOM   5611  N N     . PRO B 1 123 ? 3.822   65.249  32.770  1.00 38.18  ? 123  PRO B N     1 
ATOM   5612  C CA    . PRO B 1 123 ? 3.685   63.950  32.107  1.00 37.17  ? 123  PRO B CA    1 
ATOM   5613  C C     . PRO B 1 123 ? 5.022   63.205  31.990  1.00 38.17  ? 123  PRO B C     1 
ATOM   5614  O O     . PRO B 1 123 ? 6.088   63.814  32.042  1.00 32.93  ? 123  PRO B O     1 
ATOM   5615  C CB    . PRO B 1 123 ? 3.119   64.291  30.702  1.00 39.07  ? 123  PRO B CB    1 
ATOM   5616  C CG    . PRO B 1 123 ? 2.901   65.759  30.632  1.00 35.80  ? 123  PRO B CG    1 
ATOM   5617  C CD    . PRO B 1 123 ? 3.324   66.377  31.942  1.00 37.58  ? 123  PRO B CD    1 
ATOM   5618  N N     . VAL B 1 124 ? 4.938   61.878  31.863  1.00 40.44  ? 124  VAL B N     1 
ATOM   5619  C CA    . VAL B 1 124 ? 6.113   61.007  31.694  1.00 40.08  ? 124  VAL B CA    1 
ATOM   5620  C C     . VAL B 1 124 ? 7.098   61.592  30.661  1.00 40.64  ? 124  VAL B C     1 
ATOM   5621  O O     . VAL B 1 124 ? 8.301   61.666  30.933  1.00 44.28  ? 124  VAL B O     1 
ATOM   5622  C CB    . VAL B 1 124 ? 5.681   59.525  31.306  1.00 42.93  ? 124  VAL B CB    1 
ATOM   5623  C CG1   . VAL B 1 124 ? 4.863   58.864  32.449  1.00 45.32  ? 124  VAL B CG1   1 
ATOM   5624  C CG2   . VAL B 1 124 ? 4.875   59.466  29.982  1.00 44.81  ? 124  VAL B CG2   1 
ATOM   5625  N N     . VAL B 1 125 ? 6.579   62.048  29.505  1.00 37.41  ? 125  VAL B N     1 
ATOM   5626  C CA    . VAL B 1 125 ? 7.364   62.831  28.531  1.00 32.98  ? 125  VAL B CA    1 
ATOM   5627  C C     . VAL B 1 125 ? 6.654   64.166  28.374  1.00 31.92  ? 125  VAL B C     1 
ATOM   5628  O O     . VAL B 1 125 ? 5.445   64.214  28.253  1.00 31.45  ? 125  VAL B O     1 
ATOM   5629  C CB    . VAL B 1 125 ? 7.511   62.111  27.166  1.00 31.21  ? 125  VAL B CB    1 
ATOM   5630  C CG1   . VAL B 1 125 ? 7.865   63.081  26.033  1.00 33.98  ? 125  VAL B CG1   1 
ATOM   5631  C CG2   . VAL B 1 125 ? 8.555   61.006  27.256  1.00 29.13  ? 125  VAL B CG2   1 
ATOM   5632  N N     . PHE B 1 126 ? 7.431   65.247  28.374  1.00 31.90  ? 126  PHE B N     1 
ATOM   5633  C CA    . PHE B 1 126 ? 6.916   66.606  28.422  1.00 29.39  ? 126  PHE B CA    1 
ATOM   5634  C C     . PHE B 1 126 ? 7.604   67.491  27.401  1.00 28.26  ? 126  PHE B C     1 
ATOM   5635  O O     . PHE B 1 126 ? 8.818   67.535  27.363  1.00 28.47  ? 126  PHE B O     1 
ATOM   5636  C CB    . PHE B 1 126 ? 7.174   67.169  29.810  1.00 29.88  ? 126  PHE B CB    1 
ATOM   5637  C CG    . PHE B 1 126 ? 6.925   68.626  29.901  1.00 29.69  ? 126  PHE B CG    1 
ATOM   5638  C CD1   . PHE B 1 126 ? 5.642   69.100  30.061  1.00 25.63  ? 126  PHE B CD1   1 
ATOM   5639  C CD2   . PHE B 1 126 ? 7.964   69.533  29.762  1.00 28.96  ? 126  PHE B CD2   1 
ATOM   5640  C CE1   . PHE B 1 126 ? 5.394   70.454  30.097  1.00 29.84  ? 126  PHE B CE1   1 
ATOM   5641  C CE2   . PHE B 1 126 ? 7.718   70.888  29.802  1.00 26.91  ? 126  PHE B CE2   1 
ATOM   5642  C CZ    . PHE B 1 126 ? 6.443   71.346  29.981  1.00 26.61  ? 126  PHE B CZ    1 
ATOM   5643  N N     . VAL B 1 127 ? 6.838   68.227  26.591  1.00 27.92  ? 127  VAL B N     1 
ATOM   5644  C CA    . VAL B 1 127 ? 7.433   69.238  25.730  1.00 26.95  ? 127  VAL B CA    1 
ATOM   5645  C C     . VAL B 1 127 ? 6.905   70.619  26.120  1.00 26.98  ? 127  VAL B C     1 
ATOM   5646  O O     . VAL B 1 127 ? 5.756   70.757  26.494  1.00 27.76  ? 127  VAL B O     1 
ATOM   5647  C CB    . VAL B 1 127 ? 7.216   68.941  24.190  1.00 27.25  ? 127  VAL B CB    1 
ATOM   5648  C CG1   . VAL B 1 127 ? 7.822   67.590  23.830  1.00 27.80  ? 127  VAL B CG1   1 
ATOM   5649  C CG2   . VAL B 1 127 ? 5.738   68.961  23.799  1.00 26.07  ? 127  VAL B CG2   1 
ATOM   5650  N N     . THR B 1 128 ? 7.772   71.633  26.018  1.00 29.47  ? 128  THR B N     1 
ATOM   5651  C CA    . THR B 1 128 ? 7.425   72.998  26.342  1.00 28.10  ? 128  THR B CA    1 
ATOM   5652  C C     . THR B 1 128 ? 6.394   73.549  25.349  1.00 29.16  ? 128  THR B C     1 
ATOM   5653  O O     . THR B 1 128 ? 6.374   73.176  24.186  1.00 31.42  ? 128  THR B O     1 
ATOM   5654  C CB    . THR B 1 128 ? 8.655   73.922  26.314  1.00 29.20  ? 128  THR B CB    1 
ATOM   5655  O OG1   . THR B 1 128 ? 9.245   73.918  25.004  1.00 29.99  ? 128  THR B OG1   1 
ATOM   5656  C CG2   . THR B 1 128 ? 9.671   73.501  27.362  1.00 28.35  ? 128  THR B CG2   1 
ATOM   5657  N N     . ARG B 1 129 ? 5.556   74.452  25.837  1.00 28.28  ? 129  ARG B N     1 
ATOM   5658  C CA    . ARG B 1 129 ? 4.556   75.126  25.049  1.00 29.77  ? 129  ARG B CA    1 
ATOM   5659  C C     . ARG B 1 129 ? 4.610   76.540  25.526  1.00 30.91  ? 129  ARG B C     1 
ATOM   5660  O O     . ARG B 1 129 ? 3.693   77.013  26.164  1.00 28.62  ? 129  ARG B O     1 
ATOM   5661  C CB    . ARG B 1 129 ? 3.148   74.508  25.262  1.00 28.57  ? 129  ARG B CB    1 
ATOM   5662  C CG    . ARG B 1 129 ? 3.054   73.057  24.756  1.00 25.50  ? 129  ARG B CG    1 
ATOM   5663  C CD    . ARG B 1 129 ? 1.655   72.467  24.939  1.00 28.42  ? 129  ARG B CD    1 
ATOM   5664  N NE    . ARG B 1 129 ? 0.753   73.000  23.919  1.00 31.38  ? 129  ARG B NE    1 
ATOM   5665  C CZ    . ARG B 1 129 ? -0.513  72.651  23.751  1.00 28.01  ? 129  ARG B CZ    1 
ATOM   5666  N NH1   . ARG B 1 129 ? -1.081  71.750  24.530  1.00 29.28  ? 129  ARG B NH1   1 
ATOM   5667  N NH2   . ARG B 1 129 ? -1.204  73.198  22.768  1.00 31.58  ? 129  ARG B NH2   1 
ATOM   5668  N N     . LYS B 1 130 ? 5.724   77.190  25.204  1.00 35.92  ? 130  LYS B N     1 
ATOM   5669  C CA    . LYS B 1 130 ? 6.164   78.433  25.839  1.00 36.58  ? 130  LYS B CA    1 
ATOM   5670  C C     . LYS B 1 130 ? 5.177   79.576  25.624  1.00 35.26  ? 130  LYS B C     1 
ATOM   5671  O O     . LYS B 1 130 ? 4.858   80.299  26.554  1.00 37.23  ? 130  LYS B O     1 
ATOM   5672  C CB    . LYS B 1 130 ? 7.541   78.798  25.279  1.00 36.67  ? 130  LYS B CB    1 
ATOM   5673  C CG    . LYS B 1 130 ? 8.291   79.828  26.059  1.00 42.78  ? 130  LYS B CG    1 
ATOM   5674  C CD    . LYS B 1 130 ? 9.515   80.418  25.249  1.00 44.34  ? 130  LYS B CD    1 
ATOM   5675  C CE    . LYS B 1 130 ? 10.893  80.022  25.891  1.00 57.18  ? 130  LYS B CE    1 
ATOM   5676  N NZ    . LYS B 1 130 ? 12.112  80.764  25.360  1.00 55.65  ? 130  LYS B NZ    1 
ATOM   5677  N N     . LYS B 1 131 ? 4.690   79.729  24.402  1.00 35.06  ? 131  LYS B N     1 
ATOM   5678  C CA    . LYS B 1 131 ? 3.776   80.816  24.072  1.00 34.35  ? 131  LYS B CA    1 
ATOM   5679  C C     . LYS B 1 131 ? 2.447   80.710  24.853  1.00 33.04  ? 131  LYS B C     1 
ATOM   5680  O O     . LYS B 1 131 ? 1.940   81.706  25.366  1.00 31.94  ? 131  LYS B O     1 
ATOM   5681  C CB    . LYS B 1 131 ? 3.520   80.835  22.569  1.00 35.33  ? 131  LYS B CB    1 
ATOM   5682  C CG    . LYS B 1 131 ? 2.623   81.976  22.109  1.00 37.77  ? 131  LYS B CG    1 
ATOM   5683  C CD    . LYS B 1 131 ? 2.537   82.046  20.588  1.00 39.18  ? 131  LYS B CD    1 
ATOM   5684  C CE    . LYS B 1 131 ? 1.549   83.145  20.122  1.00 45.52  ? 131  LYS B CE    1 
ATOM   5685  N NZ    . LYS B 1 131 ? 1.328   83.181  18.621  1.00 46.76  ? 131  LYS B NZ    1 
ATOM   5686  N N     . LEU B 1 132 ? 1.893   79.503  24.958  1.00 32.12  ? 132  LEU B N     1 
ATOM   5687  C CA    . LEU B 1 132 ? 0.675   79.306  25.737  1.00 30.99  ? 132  LEU B CA    1 
ATOM   5688  C C     . LEU B 1 132 ? 0.922   79.438  27.247  1.00 30.05  ? 132  LEU B C     1 
ATOM   5689  O O     . LEU B 1 132 ? 0.139   80.079  27.935  1.00 28.56  ? 132  LEU B O     1 
ATOM   5690  C CB    . LEU B 1 132 ? 0.025   77.958  25.433  1.00 31.33  ? 132  LEU B CB    1 
ATOM   5691  C CG    . LEU B 1 132 ? -0.697  77.807  24.086  1.00 28.64  ? 132  LEU B CG    1 
ATOM   5692  C CD1   . LEU B 1 132 ? -0.846  76.333  23.704  1.00 22.20  ? 132  LEU B CD1   1 
ATOM   5693  C CD2   . LEU B 1 132 ? -2.060  78.519  24.055  1.00 27.01  ? 132  LEU B CD2   1 
ATOM   5694  N N     . VAL B 1 133 ? 2.015   78.872  27.750  1.00 29.54  ? 133  VAL B N     1 
ATOM   5695  C CA    . VAL B 1 133 ? 2.349   78.986  29.175  1.00 29.73  ? 133  VAL B CA    1 
ATOM   5696  C C     . VAL B 1 133 ? 2.622   80.449  29.592  1.00 29.19  ? 133  VAL B C     1 
ATOM   5697  O O     . VAL B 1 133 ? 2.103   80.898  30.620  1.00 28.15  ? 133  VAL B O     1 
ATOM   5698  C CB    . VAL B 1 133 ? 3.480   78.028  29.553  1.00 30.03  ? 133  VAL B CB    1 
ATOM   5699  C CG1   . VAL B 1 133 ? 3.946   78.250  30.995  1.00 30.90  ? 133  VAL B CG1   1 
ATOM   5700  C CG2   . VAL B 1 133 ? 3.001   76.600  29.386  1.00 32.83  ? 133  VAL B CG2   1 
ATOM   5701  N N     . ASN B 1 134 ? 3.388   81.195  28.793  1.00 28.51  ? 134  ASN B N     1 
ATOM   5702  C CA    . ASN B 1 134 ? 3.579   82.635  29.030  1.00 29.26  ? 134  ASN B CA    1 
ATOM   5703  C C     . ASN B 1 134 ? 2.280   83.450  29.013  1.00 28.47  ? 134  ASN B C     1 
ATOM   5704  O O     . ASN B 1 134 ? 2.090   84.355  29.837  1.00 28.16  ? 134  ASN B O     1 
ATOM   5705  C CB    . ASN B 1 134 ? 4.540   83.239  27.992  1.00 30.76  ? 134  ASN B CB    1 
ATOM   5706  C CG    . ASN B 1 134 ? 6.009   82.818  28.204  1.00 38.18  ? 134  ASN B CG    1 
ATOM   5707  O OD1   . ASN B 1 134 ? 6.899   83.366  27.547  1.00 50.62  ? 134  ASN B OD1   1 
ATOM   5708  N ND2   . ASN B 1 134 ? 6.267   81.837  29.105  1.00 41.30  ? 134  ASN B ND2   1 
ATOM   5709  N N     . ALA B 1 135 ? 1.400   83.165  28.062  1.00 26.34  ? 135  ALA B N     1 
ATOM   5710  C CA    . ALA B 1 135 ? 0.098   83.853  28.006  1.00 27.28  ? 135  ALA B CA    1 
ATOM   5711  C C     . ALA B 1 135 ? -0.773  83.585  29.270  1.00 27.69  ? 135  ALA B C     1 
ATOM   5712  O O     . ALA B 1 135 ? -1.487  84.465  29.735  1.00 25.53  ? 135  ALA B O     1 
ATOM   5713  C CB    . ALA B 1 135 ? -0.673  83.417  26.758  1.00 27.53  ? 135  ALA B CB    1 
ATOM   5714  N N     . ILE B 1 136 ? -0.717  82.371  29.808  1.00 26.08  ? 136  ILE B N     1 
ATOM   5715  C CA    . ILE B 1 136 ? -1.451  82.047  31.041  1.00 26.79  ? 136  ILE B CA    1 
ATOM   5716  C C     . ILE B 1 136 ? -0.870  82.807  32.234  1.00 26.46  ? 136  ILE B C     1 
ATOM   5717  O O     . ILE B 1 136 ? -1.613  83.335  33.062  1.00 24.79  ? 136  ILE B O     1 
ATOM   5718  C CB    . ILE B 1 136 ? -1.445  80.517  31.338  1.00 25.46  ? 136  ILE B CB    1 
ATOM   5719  C CG1   . ILE B 1 136 ? -2.178  79.765  30.239  1.00 23.80  ? 136  ILE B CG1   1 
ATOM   5720  C CG2   . ILE B 1 136 ? -2.107  80.184  32.708  1.00 22.10  ? 136  ILE B CG2   1 
ATOM   5721  C CD1   . ILE B 1 136 ? -1.987  78.301  30.269  1.00 26.59  ? 136  ILE B CD1   1 
ATOM   5722  N N     . GLN B 1 137 ? 0.466   82.829  32.301  1.00 28.57  ? 137  GLN B N     1 
ATOM   5723  C CA    . GLN B 1 137 ? 1.221   83.474  33.358  1.00 29.37  ? 137  GLN B CA    1 
ATOM   5724  C C     . GLN B 1 137 ? 1.027   84.977  33.332  1.00 28.61  ? 137  GLN B C     1 
ATOM   5725  O O     . GLN B 1 137 ? 0.947   85.609  34.382  1.00 29.06  ? 137  GLN B O     1 
ATOM   5726  C CB    . GLN B 1 137 ? 2.709   83.118  33.220  1.00 29.67  ? 137  GLN B CB    1 
ATOM   5727  C CG    . GLN B 1 137 ? 3.062   81.657  33.580  1.00 27.82  ? 137  GLN B CG    1 
ATOM   5728  C CD    . GLN B 1 137 ? 4.522   81.329  33.308  1.00 31.15  ? 137  GLN B CD    1 
ATOM   5729  O OE1   . GLN B 1 137 ? 5.160   81.965  32.465  1.00 28.82  ? 137  GLN B OE1   1 
ATOM   5730  N NE2   . GLN B 1 137 ? 5.065   80.347  34.033  1.00 23.53  ? 137  GLN B NE2   1 
ATOM   5731  N N     . GLN B 1 138 ? 0.965   85.544  32.132  1.00 29.45  ? 138  GLN B N     1 
ATOM   5732  C CA    . GLN B 1 138 ? 0.650   86.969  31.958  1.00 30.79  ? 138  GLN B CA    1 
ATOM   5733  C C     . GLN B 1 138 ? -0.733  87.331  32.482  1.00 28.75  ? 138  GLN B C     1 
ATOM   5734  O O     . GLN B 1 138 ? -0.899  88.359  33.111  1.00 29.20  ? 138  GLN B O     1 
ATOM   5735  C CB    . GLN B 1 138 ? 0.810   87.411  30.495  1.00 31.23  ? 138  GLN B CB    1 
ATOM   5736  C CG    . GLN B 1 138 ? 2.261   87.637  30.041  1.00 41.45  ? 138  GLN B CG    1 
ATOM   5737  C CD    . GLN B 1 138 ? 3.085   88.630  30.900  1.00 51.12  ? 138  GLN B CD    1 
ATOM   5738  O OE1   . GLN B 1 138 ? 3.149   88.529  32.136  1.00 64.01  ? 138  GLN B OE1   1 
ATOM   5739  N NE2   . GLN B 1 138 ? 3.752   89.574  30.224  1.00 60.66  ? 138  GLN B NE2   1 
ATOM   5740  N N     . LYS B 1 139 ? -1.728  86.500  32.212  1.00 28.58  ? 139  LYS B N     1 
ATOM   5741  C CA    . LYS B 1 139 ? -3.087  86.717  32.761  1.00 27.39  ? 139  LYS B CA    1 
ATOM   5742  C C     . LYS B 1 139 ? -3.099  86.592  34.273  1.00 26.51  ? 139  LYS B C     1 
ATOM   5743  O O     . LYS B 1 139 ? -3.694  87.415  34.982  1.00 27.18  ? 139  LYS B O     1 
ATOM   5744  C CB    . LYS B 1 139 ? -4.107  85.699  32.205  1.00 28.74  ? 139  LYS B CB    1 
ATOM   5745  C CG    . LYS B 1 139 ? -4.296  85.657  30.687  1.00 24.10  ? 139  LYS B CG    1 
ATOM   5746  C CD    . LYS B 1 139 ? -4.383  87.014  30.102  1.00 29.56  ? 139  LYS B CD    1 
ATOM   5747  C CE    . LYS B 1 139 ? -4.807  86.950  28.655  1.00 33.52  ? 139  LYS B CE    1 
ATOM   5748  N NZ    . LYS B 1 139 ? -5.086  88.313  28.242  1.00 33.52  ? 139  LYS B NZ    1 
ATOM   5749  N N     . LEU B 1 140 ? -2.462  85.541  34.783  1.00 26.39  ? 140  LEU B N     1 
ATOM   5750  C CA    . LEU B 1 140 ? -2.381  85.355  36.241  1.00 27.39  ? 140  LEU B CA    1 
ATOM   5751  C C     . LEU B 1 140 ? -1.711  86.548  36.925  1.00 28.71  ? 140  LEU B C     1 
ATOM   5752  O O     . LEU B 1 140 ? -2.080  86.908  38.037  1.00 31.44  ? 140  LEU B O     1 
ATOM   5753  C CB    . LEU B 1 140 ? -1.629  84.077  36.627  1.00 25.73  ? 140  LEU B CB    1 
ATOM   5754  C CG    . LEU B 1 140 ? -2.354  82.776  36.325  1.00 24.23  ? 140  LEU B CG    1 
ATOM   5755  C CD1   . LEU B 1 140 ? -1.414  81.639  36.369  1.00 27.99  ? 140  LEU B CD1   1 
ATOM   5756  C CD2   . LEU B 1 140 ? -3.507  82.572  37.294  1.00 32.30  ? 140  LEU B CD2   1 
ATOM   5757  N N     . SER B 1 141 ? -0.744  87.161  36.256  1.00 27.91  ? 141  SER B N     1 
ATOM   5758  C CA    . SER B 1 141 ? -0.075  88.325  36.790  1.00 30.23  ? 141  SER B CA    1 
ATOM   5759  C C     . SER B 1 141 ? -0.922  89.601  36.762  1.00 30.51  ? 141  SER B C     1 
ATOM   5760  O O     . SER B 1 141 ? -0.564  90.583  37.406  1.00 31.02  ? 141  SER B O     1 
ATOM   5761  C CB    . SER B 1 141 ? 1.217   88.556  36.018  1.00 31.37  ? 141  SER B CB    1 
ATOM   5762  O OG    . SER B 1 141 ? 0.927   89.226  34.810  1.00 34.67  ? 141  SER B OG    1 
ATOM   5763  N N     . LYS B 1 142 ? -2.028  89.599  36.019  1.00 32.48  ? 142  LYS B N     1 
ATOM   5764  C CA    . LYS B 1 142 ? -2.965  90.718  36.025  1.00 33.20  ? 142  LYS B CA    1 
ATOM   5765  C C     . LYS B 1 142 ? -3.927  90.708  37.208  1.00 33.68  ? 142  LYS B C     1 
ATOM   5766  O O     . LYS B 1 142 ? -4.566  91.711  37.480  1.00 33.41  ? 142  LYS B O     1 
ATOM   5767  C CB    . LYS B 1 142 ? -3.755  90.762  34.708  1.00 35.52  ? 142  LYS B CB    1 
ATOM   5768  C CG    . LYS B 1 142 ? -2.945  91.354  33.567  1.00 37.39  ? 142  LYS B CG    1 
ATOM   5769  C CD    . LYS B 1 142 ? -3.578  91.106  32.223  1.00 38.17  ? 142  LYS B CD    1 
ATOM   5770  C CE    . LYS B 1 142 ? -2.839  91.912  31.157  1.00 46.00  ? 142  LYS B CE    1 
ATOM   5771  N NZ    . LYS B 1 142 ? -3.391  91.666  29.796  1.00 51.77  ? 142  LYS B NZ    1 
ATOM   5772  N N     . LEU B 1 143 ? -4.024  89.593  37.925  1.00 34.89  ? 143  LEU B N     1 
ATOM   5773  C CA    . LEU B 1 143 ? -4.969  89.487  39.059  1.00 35.07  ? 143  LEU B CA    1 
ATOM   5774  C C     . LEU B 1 143 ? -4.560  90.411  40.223  1.00 35.32  ? 143  LEU B C     1 
ATOM   5775  O O     . LEU B 1 143 ? -5.427  90.970  40.908  1.00 33.58  ? 143  LEU B O     1 
ATOM   5776  C CB    . LEU B 1 143 ? -5.125  88.043  39.544  1.00 34.12  ? 143  LEU B CB    1 
ATOM   5777  C CG    . LEU B 1 143 ? -5.762  87.045  38.564  1.00 32.05  ? 143  LEU B CG    1 
ATOM   5778  C CD1   . LEU B 1 143 ? -5.737  85.639  39.158  1.00 36.96  ? 143  LEU B CD1   1 
ATOM   5779  C CD2   . LEU B 1 143 ? -7.156  87.403  38.225  1.00 31.08  ? 143  LEU B CD2   1 
ATOM   5780  N N     . LYS B 1 144 ? -3.250  90.583  40.410  1.00 36.05  ? 144  LYS B N     1 
ATOM   5781  C CA    . LYS B 1 144 ? -2.708  91.599  41.329  1.00 37.39  ? 144  LYS B CA    1 
ATOM   5782  C C     . LYS B 1 144 ? -3.243  91.508  42.761  1.00 36.00  ? 144  LYS B C     1 
ATOM   5783  O O     . LYS B 1 144 ? -3.614  92.520  43.360  1.00 35.11  ? 144  LYS B O     1 
ATOM   5784  C CB    . LYS B 1 144 ? -2.988  92.998  40.771  1.00 39.94  ? 144  LYS B CB    1 
ATOM   5785  C CG    . LYS B 1 144 ? -2.286  93.309  39.454  1.00 45.54  ? 144  LYS B CG    1 
ATOM   5786  C CD    . LYS B 1 144 ? -0.909  93.900  39.647  1.00 51.62  ? 144  LYS B CD    1 
ATOM   5787  C CE    . LYS B 1 144 ? 0.149   92.847  39.875  1.00 57.21  ? 144  LYS B CE    1 
ATOM   5788  N NZ    . LYS B 1 144 ? 1.406   93.206  39.149  1.00 60.17  ? 144  LYS B NZ    1 
ATOM   5789  N N     . GLY B 1 145 ? -3.308  90.292  43.292  1.00 35.04  ? 145  GLY B N     1 
ATOM   5790  C CA    . GLY B 1 145 ? -3.777  90.071  44.655  1.00 35.57  ? 145  GLY B CA    1 
ATOM   5791  C C     . GLY B 1 145 ? -5.275  90.288  44.873  1.00 36.72  ? 145  GLY B C     1 
ATOM   5792  O O     . GLY B 1 145 ? -5.741  90.239  46.016  1.00 36.95  ? 145  GLY B O     1 
ATOM   5793  N N     . GLU B 1 146 ? -6.030  90.506  43.792  1.00 34.18  ? 146  GLU B N     1 
ATOM   5794  C CA    . GLU B 1 146 ? -7.459  90.752  43.877  1.00 33.95  ? 146  GLU B CA    1 
ATOM   5795  C C     . GLU B 1 146 ? -8.173  89.583  43.223  1.00 33.47  ? 146  GLU B C     1 
ATOM   5796  O O     . GLU B 1 146 ? -7.593  88.903  42.381  1.00 34.46  ? 146  GLU B O     1 
ATOM   5797  C CB    . GLU B 1 146 ? -7.843  92.069  43.177  1.00 33.91  ? 146  GLU B CB    1 
ATOM   5798  C CG    . GLU B 1 146 ? -7.213  93.325  43.813  1.00 40.37  ? 146  GLU B CG    1 
ATOM   5799  C CD    . GLU B 1 146 ? -7.680  93.567  45.247  1.00 49.44  ? 146  GLU B CD    1 
ATOM   5800  O OE1   . GLU B 1 146 ? -8.909  93.553  45.481  1.00 57.51  ? 146  GLU B OE1   1 
ATOM   5801  O OE2   . GLU B 1 146 ? -6.825  93.776  46.139  1.00 54.29  ? 146  GLU B OE2   1 
ATOM   5802  N N     . PRO B 1 147 ? -9.427  89.332  43.622  1.00 32.09  ? 147  PRO B N     1 
ATOM   5803  C CA    . PRO B 1 147 ? -10.228 88.284  42.994  1.00 31.83  ? 147  PRO B CA    1 
ATOM   5804  C C     . PRO B 1 147 ? -10.391 88.404  41.475  1.00 31.31  ? 147  PRO B C     1 
ATOM   5805  O O     . PRO B 1 147 ? -10.384 89.503  40.910  1.00 31.46  ? 147  PRO B O     1 
ATOM   5806  C CB    . PRO B 1 147 ? -11.579 88.392  43.703  1.00 30.97  ? 147  PRO B CB    1 
ATOM   5807  C CG    . PRO B 1 147 ? -11.302 89.065  44.960  1.00 30.62  ? 147  PRO B CG    1 
ATOM   5808  C CD    . PRO B 1 147 ? -10.146 89.968  44.739  1.00 31.96  ? 147  PRO B CD    1 
ATOM   5809  N N     . GLY B 1 148 ? -10.538 87.257  40.828  1.00 30.55  ? 148  GLY B N     1 
ATOM   5810  C CA    . GLY B 1 148 ? -10.657 87.226  39.386  1.00 29.37  ? 148  GLY B CA    1 
ATOM   5811  C C     . GLY B 1 148 ? -10.481 85.834  38.849  1.00 28.32  ? 148  GLY B C     1 
ATOM   5812  O O     . GLY B 1 148 ? -10.087 84.903  39.586  1.00 28.21  ? 148  GLY B O     1 
ATOM   5813  N N     . TRP B 1 149 ? -10.781 85.698  37.558  1.00 27.90  ? 149  TRP B N     1 
ATOM   5814  C CA    . TRP B 1 149 ? -10.811 84.423  36.878  1.00 28.39  ? 149  TRP B CA    1 
ATOM   5815  C C     . TRP B 1 149 ? -9.873  84.454  35.680  1.00 27.84  ? 149  TRP B C     1 
ATOM   5816  O O     . TRP B 1 149 ? -9.791  85.439  34.953  1.00 29.53  ? 149  TRP B O     1 
ATOM   5817  C CB    . TRP B 1 149 ? -12.217 84.094  36.391  1.00 28.18  ? 149  TRP B CB    1 
ATOM   5818  C CG    . TRP B 1 149 ? -13.273 84.300  37.419  1.00 28.66  ? 149  TRP B CG    1 
ATOM   5819  C CD1   . TRP B 1 149 ? -13.887 85.478  37.721  1.00 26.64  ? 149  TRP B CD1   1 
ATOM   5820  C CD2   . TRP B 1 149 ? -13.839 83.309  38.297  1.00 25.70  ? 149  TRP B CD2   1 
ATOM   5821  N NE1   . TRP B 1 149 ? -14.801 85.287  38.719  1.00 27.10  ? 149  TRP B NE1   1 
ATOM   5822  C CE2   . TRP B 1 149 ? -14.792 83.970  39.104  1.00 29.74  ? 149  TRP B CE2   1 
ATOM   5823  C CE3   . TRP B 1 149 ? -13.637 81.938  38.478  1.00 28.61  ? 149  TRP B CE3   1 
ATOM   5824  C CZ2   . TRP B 1 149 ? -15.563 83.299  40.078  1.00 27.71  ? 149  TRP B CZ2   1 
ATOM   5825  C CZ3   . TRP B 1 149 ? -14.410 81.261  39.444  1.00 28.32  ? 149  TRP B CZ3   1 
ATOM   5826  C CH2   . TRP B 1 149 ? -15.359 81.949  40.228  1.00 27.23  ? 149  TRP B CH2   1 
ATOM   5827  N N     . VAL B 1 150 ? -9.154  83.366  35.496  1.00 26.93  ? 150  VAL B N     1 
ATOM   5828  C CA    . VAL B 1 150 ? -8.377  83.142  34.301  1.00 27.55  ? 150  VAL B CA    1 
ATOM   5829  C C     . VAL B 1 150 ? -8.834  81.800  33.771  1.00 26.59  ? 150  VAL B C     1 
ATOM   5830  O O     . VAL B 1 150 ? -8.713  80.790  34.476  1.00 26.73  ? 150  VAL B O     1 
ATOM   5831  C CB    . VAL B 1 150 ? -6.885  83.148  34.617  1.00 24.80  ? 150  VAL B CB    1 
ATOM   5832  C CG1   . VAL B 1 150 ? -6.058  82.837  33.383  1.00 26.08  ? 150  VAL B CG1   1 
ATOM   5833  C CG2   . VAL B 1 150 ? -6.502  84.482  35.179  1.00 24.65  ? 150  VAL B CG2   1 
ATOM   5834  N N     . THR B 1 151 ? -9.392  81.799  32.554  1.00 27.90  ? 151  THR B N     1 
ATOM   5835  C CA    . THR B 1 151 ? -9.918  80.563  31.954  1.00 29.73  ? 151  THR B CA    1 
ATOM   5836  C C     . THR B 1 151 ? -9.059  80.069  30.762  1.00 30.39  ? 151  THR B C     1 
ATOM   5837  O O     . THR B 1 151 ? -8.804  80.791  29.809  1.00 28.25  ? 151  THR B O     1 
ATOM   5838  C CB    . THR B 1 151 ? -11.416 80.658  31.526  1.00 30.14  ? 151  THR B CB    1 
ATOM   5839  O OG1   . THR B 1 151 ? -12.230 81.034  32.641  1.00 27.35  ? 151  THR B OG1   1 
ATOM   5840  C CG2   . THR B 1 151 ? -11.912 79.327  31.049  1.00 30.80  ? 151  THR B CG2   1 
ATOM   5841  N N     . ILE B 1 152 ? -8.617  78.816  30.859  1.00 29.19  ? 152  ILE B N     1 
ATOM   5842  C CA    . ILE B 1 152 ? -7.943  78.126  29.752  1.00 29.95  ? 152  ILE B CA    1 
ATOM   5843  C C     . ILE B 1 152 ? -8.994  77.232  29.114  1.00 28.48  ? 152  ILE B C     1 
ATOM   5844  O O     . ILE B 1 152 ? -9.522  76.332  29.768  1.00 26.62  ? 152  ILE B O     1 
ATOM   5845  C CB    . ILE B 1 152 ? -6.792  77.180  30.236  1.00 29.73  ? 152  ILE B CB    1 
ATOM   5846  C CG1   . ILE B 1 152 ? -5.695  77.953  30.943  1.00 26.46  ? 152  ILE B CG1   1 
ATOM   5847  C CG2   . ILE B 1 152 ? -6.217  76.367  29.082  1.00 27.82  ? 152  ILE B CG2   1 
ATOM   5848  C CD1   . ILE B 1 152 ? -4.917  77.076  31.886  1.00 30.84  ? 152  ILE B CD1   1 
ATOM   5849  N N     . HIS B 1 153 ? -9.292  77.487  27.847  1.00 29.55  ? 153  HIS B N     1 
ATOM   5850  C CA    . HIS B 1 153 ? -10.364 76.770  27.168  1.00 32.38  ? 153  HIS B CA    1 
ATOM   5851  C C     . HIS B 1 153 ? -9.917  76.156  25.850  1.00 32.49  ? 153  HIS B C     1 
ATOM   5852  O O     . HIS B 1 153 ? -9.048  76.687  25.138  1.00 32.15  ? 153  HIS B O     1 
ATOM   5853  C CB    . HIS B 1 153 ? -11.616 77.657  26.986  1.00 32.96  ? 153  HIS B CB    1 
ATOM   5854  C CG    . HIS B 1 153 ? -11.550 78.568  25.798  1.00 37.18  ? 153  HIS B CG    1 
ATOM   5855  N ND1   . HIS B 1 153 ? -11.959 78.184  24.538  1.00 39.02  ? 153  HIS B ND1   1 
ATOM   5856  C CD2   . HIS B 1 153 ? -11.103 79.837  25.677  1.00 38.96  ? 153  HIS B CD2   1 
ATOM   5857  C CE1   . HIS B 1 153 ? -11.758 79.177  23.693  1.00 42.73  ? 153  HIS B CE1   1 
ATOM   5858  N NE2   . HIS B 1 153 ? -11.247 80.196  24.361  1.00 40.10  ? 153  HIS B NE2   1 
ATOM   5859  N N     . GLY B 1 154 ? -10.538 75.028  25.540  1.00 32.65  ? 154  GLY B N     1 
ATOM   5860  C CA    . GLY B 1 154 ? -10.193 74.232  24.382  1.00 32.95  ? 154  GLY B CA    1 
ATOM   5861  C C     . GLY B 1 154 ? -10.716 72.815  24.521  1.00 33.60  ? 154  GLY B C     1 
ATOM   5862  O O     . GLY B 1 154 ? -11.242 72.406  25.564  1.00 32.00  ? 154  GLY B O     1 
ATOM   5863  N N     . MET B 1 155 ? -10.531 72.054  23.456  1.00 36.55  ? 155  MET B N     1 
ATOM   5864  C CA    . MET B 1 155 ? -11.076 70.706  23.331  1.00 39.53  ? 155  MET B CA    1 
ATOM   5865  C C     . MET B 1 155 ? -10.522 69.728  24.387  1.00 37.96  ? 155  MET B C     1 
ATOM   5866  O O     . MET B 1 155 ? -9.435  69.898  24.899  1.00 36.39  ? 155  MET B O     1 
ATOM   5867  C CB    . MET B 1 155 ? -10.739 70.213  21.929  1.00 39.67  ? 155  MET B CB    1 
ATOM   5868  C CG    . MET B 1 155 ? -11.342 68.920  21.497  1.00 45.87  ? 155  MET B CG    1 
ATOM   5869  S SD    . MET B 1 155 ? -10.934 68.667  19.746  1.00 53.50  ? 155  MET B SD    1 
ATOM   5870  C CE    . MET B 1 155 ? -9.582  67.504  19.891  1.00 61.87  ? 155  MET B CE    1 
ATOM   5871  N N     . ALA B 1 156 ? -11.303 68.705  24.709  1.00 36.68  ? 156  ALA B N     1 
ATOM   5872  C CA    . ALA B 1 156 ? -10.859 67.640  25.590  1.00 35.48  ? 156  ALA B CA    1 
ATOM   5873  C C     . ALA B 1 156 ? -9.590  66.961  25.032  1.00 34.59  ? 156  ALA B C     1 
ATOM   5874  O O     . ALA B 1 156 ? -9.497  66.678  23.827  1.00 35.25  ? 156  ALA B O     1 
ATOM   5875  C CB    . ALA B 1 156 ? -11.973 66.637  25.790  1.00 35.24  ? 156  ALA B CB    1 
ATOM   5876  N N     . GLY B 1 157 ? -8.608  66.771  25.908  1.00 32.26  ? 157  GLY B N     1 
ATOM   5877  C CA    . GLY B 1 157 ? -7.319  66.189  25.558  1.00 31.85  ? 157  GLY B CA    1 
ATOM   5878  C C     . GLY B 1 157 ? -6.309  67.057  24.833  1.00 31.15  ? 157  GLY B C     1 
ATOM   5879  O O     . GLY B 1 157 ? -5.249  66.545  24.453  1.00 32.74  ? 157  GLY B O     1 
ATOM   5880  N N     . CYS B 1 158 ? -6.595  68.350  24.649  1.00 30.97  ? 158  CYS B N     1 
ATOM   5881  C CA    . CYS B 1 158 ? -5.653  69.268  23.952  1.00 30.57  ? 158  CYS B CA    1 
ATOM   5882  C C     . CYS B 1 158 ? -4.460  69.704  24.837  1.00 30.16  ? 158  CYS B C     1 
ATOM   5883  O O     . CYS B 1 158 ? -3.532  70.327  24.339  1.00 29.03  ? 158  CYS B O     1 
ATOM   5884  C CB    . CYS B 1 158 ? -6.393  70.499  23.355  1.00 29.82  ? 158  CYS B CB    1 
ATOM   5885  S SG    . CYS B 1 158 ? -6.983  71.730  24.571  1.00 31.06  ? 158  CYS B SG    1 
ATOM   5886  N N     . GLY B 1 159 ? -4.482  69.369  26.127  1.00 28.39  ? 159  GLY B N     1 
ATOM   5887  C CA    . GLY B 1 159 ? -3.363  69.665  27.027  1.00 27.88  ? 159  GLY B CA    1 
ATOM   5888  C C     . GLY B 1 159 ? -3.550  70.811  28.009  1.00 26.48  ? 159  GLY B C     1 
ATOM   5889  O O     . GLY B 1 159 ? -2.580  71.371  28.500  1.00 25.79  ? 159  GLY B O     1 
ATOM   5890  N N     . LYS B 1 160 ? -4.795  71.136  28.338  1.00 27.46  ? 160  LYS B N     1 
ATOM   5891  C CA    . LYS B 1 160 ? -5.094  72.273  29.219  1.00 27.25  ? 160  LYS B CA    1 
ATOM   5892  C C     . LYS B 1 160 ? -4.641  72.069  30.662  1.00 26.63  ? 160  LYS B C     1 
ATOM   5893  O O     . LYS B 1 160 ? -4.146  72.981  31.316  1.00 26.82  ? 160  LYS B O     1 
ATOM   5894  C CB    . LYS B 1 160 ? -6.599  72.547  29.218  1.00 26.82  ? 160  LYS B CB    1 
ATOM   5895  C CG    . LYS B 1 160 ? -7.195  72.809  27.876  1.00 24.96  ? 160  LYS B CG    1 
ATOM   5896  C CD    . LYS B 1 160 ? -8.686  73.175  27.964  1.00 27.01  ? 160  LYS B CD    1 
ATOM   5897  C CE    . LYS B 1 160 ? -9.567  72.023  28.505  1.00 28.95  ? 160  LYS B CE    1 
ATOM   5898  N NZ    . LYS B 1 160 ? -9.626  70.821  27.616  1.00 28.21  ? 160  LYS B NZ    1 
ATOM   5899  N N     . SER B 1 161 ? -4.807  70.870  31.188  1.00 26.40  ? 161  SER B N     1 
ATOM   5900  C CA    . SER B 1 161 ? -4.428  70.671  32.592  1.00 27.35  ? 161  SER B CA    1 
ATOM   5901  C C     . SER B 1 161 ? -2.911  70.632  32.770  1.00 26.36  ? 161  SER B C     1 
ATOM   5902  O O     . SER B 1 161 ? -2.376  71.101  33.757  1.00 26.08  ? 161  SER B O     1 
ATOM   5903  C CB    . SER B 1 161 ? -5.016  69.393  33.145  1.00 30.17  ? 161  SER B CB    1 
ATOM   5904  O OG    . SER B 1 161 ? -4.034  68.394  33.104  1.00 32.91  ? 161  SER B OG    1 
ATOM   5905  N N     . VAL B 1 162 ? -2.217  70.053  31.812  1.00 26.26  ? 162  VAL B N     1 
ATOM   5906  C CA    . VAL B 1 162 ? -0.778  70.102  31.802  1.00 26.52  ? 162  VAL B CA    1 
ATOM   5907  C C     . VAL B 1 162 ? -0.311  71.545  31.709  1.00 25.54  ? 162  VAL B C     1 
ATOM   5908  O O     . VAL B 1 162 ? 0.631   71.887  32.358  1.00 25.37  ? 162  VAL B O     1 
ATOM   5909  C CB    . VAL B 1 162 ? -0.201  69.243  30.645  1.00 27.64  ? 162  VAL B CB    1 
ATOM   5910  C CG1   . VAL B 1 162 ? 1.284   69.508  30.455  1.00 28.90  ? 162  VAL B CG1   1 
ATOM   5911  C CG2   . VAL B 1 162 ? -0.419  67.783  30.948  1.00 26.58  ? 162  VAL B CG2   1 
ATOM   5912  N N     . LEU B 1 163 ? -0.971  72.367  30.880  1.00 26.02  ? 163  LEU B N     1 
ATOM   5913  C CA    . LEU B 1 163 ? -0.667  73.806  30.745  1.00 25.83  ? 163  LEU B CA    1 
ATOM   5914  C C     . LEU B 1 163 ? -0.862  74.599  32.030  1.00 26.37  ? 163  LEU B C     1 
ATOM   5915  O O     . LEU B 1 163 ? -0.018  75.406  32.397  1.00 27.76  ? 163  LEU B O     1 
ATOM   5916  C CB    . LEU B 1 163 ? -1.556  74.423  29.670  1.00 26.69  ? 163  LEU B CB    1 
ATOM   5917  C CG    . LEU B 1 163 ? -1.132  74.208  28.221  1.00 25.60  ? 163  LEU B CG    1 
ATOM   5918  C CD1   . LEU B 1 163 ? -2.238  74.605  27.323  1.00 23.24  ? 163  LEU B CD1   1 
ATOM   5919  C CD2   . LEU B 1 163 ? 0.133   75.002  27.918  1.00 28.40  ? 163  LEU B CD2   1 
ATOM   5920  N N     . ALA B 1 164 ? -1.987  74.371  32.703  1.00 27.88  ? 164  ALA B N     1 
ATOM   5921  C CA    . ALA B 1 164 ? -2.290  75.062  33.955  1.00 27.82  ? 164  ALA B CA    1 
ATOM   5922  C C     . ALA B 1 164 ? -1.281  74.729  35.084  1.00 27.41  ? 164  ALA B C     1 
ATOM   5923  O O     . ALA B 1 164 ? -0.876  75.622  35.837  1.00 26.15  ? 164  ALA B O     1 
ATOM   5924  C CB    . ALA B 1 164 ? -3.713  74.766  34.391  1.00 27.53  ? 164  ALA B CB    1 
ATOM   5925  N N     . ALA B 1 165 ? -0.872  73.461  35.174  1.00 26.30  ? 165  ALA B N     1 
ATOM   5926  C CA    . ALA B 1 165 ? 0.177   73.073  36.091  1.00 26.94  ? 165  ALA B CA    1 
ATOM   5927  C C     . ALA B 1 165 ? 1.542   73.718  35.733  1.00 26.79  ? 165  ALA B C     1 
ATOM   5928  O O     . ALA B 1 165 ? 2.250   74.176  36.621  1.00 27.21  ? 165  ALA B O     1 
ATOM   5929  C CB    . ALA B 1 165 ? 0.269   71.531  36.203  1.00 26.58  ? 165  ALA B CB    1 
ATOM   5930  N N     . GLU B 1 166 ? 1.882   73.783  34.449  1.00 27.02  ? 166  GLU B N     1 
ATOM   5931  C CA    . GLU B 1 166 ? 3.140   74.385  34.026  1.00 26.28  ? 166  GLU B CA    1 
ATOM   5932  C C     . GLU B 1 166 ? 3.174   75.860  34.369  1.00 25.31  ? 166  GLU B C     1 
ATOM   5933  O O     . GLU B 1 166 ? 4.205   76.380  34.715  1.00 27.61  ? 166  GLU B O     1 
ATOM   5934  C CB    . GLU B 1 166 ? 3.349   74.245  32.507  1.00 28.04  ? 166  GLU B CB    1 
ATOM   5935  C CG    . GLU B 1 166 ? 4.161   73.069  32.003  1.00 32.32  ? 166  GLU B CG    1 
ATOM   5936  C CD    . GLU B 1 166 ? 5.330   72.691  32.902  1.00 37.83  ? 166  GLU B CD    1 
ATOM   5937  O OE1   . GLU B 1 166 ? 6.380   73.356  32.906  1.00 37.88  ? 166  GLU B OE1   1 
ATOM   5938  O OE2   . GLU B 1 166 ? 5.185   71.692  33.600  1.00 44.95  ? 166  GLU B OE2   1 
ATOM   5939  N N     . ALA B 1 167 ? 2.064   76.548  34.175  1.00 27.66  ? 167  ALA B N     1 
ATOM   5940  C CA    . ALA B 1 167 ? 2.017   77.996  34.378  1.00 27.81  ? 167  ALA B CA    1 
ATOM   5941  C C     . ALA B 1 167 ? 2.431   78.361  35.805  1.00 28.15  ? 167  ALA B C     1 
ATOM   5942  O O     . ALA B 1 167 ? 3.051   79.378  36.023  1.00 27.74  ? 167  ALA B O     1 
ATOM   5943  C CB    . ALA B 1 167 ? 0.659   78.532  34.057  1.00 27.39  ? 167  ALA B CB    1 
ATOM   5944  N N     . VAL B 1 168 ? 2.099   77.508  36.769  1.00 27.81  ? 168  VAL B N     1 
ATOM   5945  C CA    . VAL B 1 168 ? 2.403   77.781  38.162  1.00 27.62  ? 168  VAL B CA    1 
ATOM   5946  C C     . VAL B 1 168 ? 3.755   77.148  38.593  1.00 29.11  ? 168  VAL B C     1 
ATOM   5947  O O     . VAL B 1 168 ? 4.206   77.321  39.717  1.00 27.27  ? 168  VAL B O     1 
ATOM   5948  C CB    . VAL B 1 168 ? 1.187   77.364  39.091  1.00 26.70  ? 168  VAL B CB    1 
ATOM   5949  C CG1   . VAL B 1 168 ? -0.065  78.088  38.668  1.00 31.58  ? 168  VAL B CG1   1 
ATOM   5950  C CG2   . VAL B 1 168 ? 0.918   75.888  39.105  1.00 23.54  ? 168  VAL B CG2   1 
ATOM   5951  N N     . ARG B 1 169 ? 4.399   76.434  37.676  1.00 28.68  ? 169  ARG B N     1 
ATOM   5952  C CA    . ARG B 1 169 ? 5.665   75.772  37.939  1.00 31.42  ? 169  ARG B CA    1 
ATOM   5953  C C     . ARG B 1 169 ? 6.782   76.788  37.691  1.00 32.76  ? 169  ARG B C     1 
ATOM   5954  O O     . ARG B 1 169 ? 7.662   76.573  36.861  1.00 33.88  ? 169  ARG B O     1 
ATOM   5955  C CB    . ARG B 1 169 ? 5.764   74.541  37.036  1.00 31.37  ? 169  ARG B CB    1 
ATOM   5956  C CG    . ARG B 1 169 ? 6.630   73.419  37.506  1.00 30.62  ? 169  ARG B CG    1 
ATOM   5957  C CD    . ARG B 1 169 ? 6.375   72.133  36.697  1.00 34.09  ? 169  ARG B CD    1 
ATOM   5958  N NE    . ARG B 1 169 ? 5.535   71.201  37.450  1.00 41.11  ? 169  ARG B NE    1 
ATOM   5959  C CZ    . ARG B 1 169 ? 4.384   70.671  37.055  1.00 32.59  ? 169  ARG B CZ    1 
ATOM   5960  N NH1   . ARG B 1 169 ? 3.884   70.886  35.875  1.00 43.61  ? 169  ARG B NH1   1 
ATOM   5961  N NH2   . ARG B 1 169 ? 3.740   69.861  37.860  1.00 48.36  ? 169  ARG B NH2   1 
ATOM   5962  N N     . ASP B 1 170 ? 6.706   77.916  38.398  1.00 32.62  ? 170  ASP B N     1 
ATOM   5963  C CA    . ASP B 1 170 ? 7.577   79.033  38.156  1.00 33.79  ? 170  ASP B CA    1 
ATOM   5964  C C     . ASP B 1 170 ? 7.764   79.788  39.466  1.00 33.60  ? 170  ASP B C     1 
ATOM   5965  O O     . ASP B 1 170 ? 6.794   80.207  40.070  1.00 33.69  ? 170  ASP B O     1 
ATOM   5966  C CB    . ASP B 1 170 ? 7.018   79.957  37.062  1.00 33.70  ? 170  ASP B CB    1 
ATOM   5967  C CG    . ASP B 1 170 ? 7.971   81.120  36.757  1.00 34.41  ? 170  ASP B CG    1 
ATOM   5968  O OD1   . ASP B 1 170 ? 9.031   80.885  36.120  1.00 49.59  ? 170  ASP B OD1   1 
ATOM   5969  O OD2   . ASP B 1 170 ? 7.700   82.262  37.204  1.00 45.64  ? 170  ASP B OD2   1 
ATOM   5970  N N     . HIS B 1 171 ? 9.015   79.940  39.888  1.00 33.27  ? 171  HIS B N     1 
ATOM   5971  C CA    . HIS B 1 171 ? 9.347   80.554  41.184  1.00 33.05  ? 171  HIS B CA    1 
ATOM   5972  C C     . HIS B 1 171 ? 8.948   82.043  41.303  1.00 32.25  ? 171  HIS B C     1 
ATOM   5973  O O     . HIS B 1 171 ? 8.358   82.445  42.299  1.00 30.98  ? 171  HIS B O     1 
ATOM   5974  C CB    . HIS B 1 171 ? 10.847  80.341  41.432  1.00 34.45  ? 171  HIS B CB    1 
ATOM   5975  C CG    . HIS B 1 171 ? 11.326  80.807  42.778  1.00 37.09  ? 171  HIS B CG    1 
ATOM   5976  N ND1   . HIS B 1 171 ? 11.472  79.954  43.853  1.00 36.67  ? 171  HIS B ND1   1 
ATOM   5977  C CD2   . HIS B 1 171 ? 11.702  82.036  43.215  1.00 31.80  ? 171  HIS B CD2   1 
ATOM   5978  C CE1   . HIS B 1 171 ? 11.911  80.642  44.893  1.00 38.80  ? 171  HIS B CE1   1 
ATOM   5979  N NE2   . HIS B 1 171 ? 12.061  81.906  44.532  1.00 35.15  ? 171  HIS B NE2   1 
ATOM   5980  N N     . SER B 1 172 ? 9.243   82.857  40.294  1.00 34.16  ? 172  SER B N     1 
ATOM   5981  C CA    . SER B 1 172 ? 8.946   84.305  40.344  1.00 34.56  ? 172  SER B CA    1 
ATOM   5982  C C     . SER B 1 172 ? 7.479   84.574  40.406  1.00 34.09  ? 172  SER B C     1 
ATOM   5983  O O     . SER B 1 172 ? 7.029   85.336  41.245  1.00 34.52  ? 172  SER B O     1 
ATOM   5984  C CB    . SER B 1 172 ? 9.502   85.005  39.111  1.00 33.74  ? 172  SER B CB    1 
ATOM   5985  O OG    . SER B 1 172 ? 10.846  84.641  38.936  1.00 41.27  ? 172  SER B OG    1 
ATOM   5986  N N     . LEU B 1 173 ? 6.739   83.952  39.497  1.00 35.11  ? 173  LEU B N     1 
ATOM   5987  C CA    . LEU B 1 173 ? 5.280   84.026  39.498  1.00 36.25  ? 173  LEU B CA    1 
ATOM   5988  C C     . LEU B 1 173 ? 4.696   83.615  40.837  1.00 34.41  ? 173  LEU B C     1 
ATOM   5989  O O     . LEU B 1 173 ? 3.831   84.281  41.398  1.00 33.38  ? 173  LEU B O     1 
ATOM   5990  C CB    . LEU B 1 173 ? 4.716   83.098  38.426  1.00 36.92  ? 173  LEU B CB    1 
ATOM   5991  C CG    . LEU B 1 173 ? 3.182   83.102  38.413  1.00 39.39  ? 173  LEU B CG    1 
ATOM   5992  C CD1   . LEU B 1 173 ? 2.659   84.306  37.608  1.00 47.14  ? 173  LEU B CD1   1 
ATOM   5993  C CD2   . LEU B 1 173 ? 2.661   81.811  37.854  1.00 38.90  ? 173  LEU B CD2   1 
ATOM   5994  N N     . LEU B 1 174 ? 5.168   82.492  41.342  1.00 34.25  ? 174  LEU B N     1 
ATOM   5995  C CA    . LEU B 1 174 ? 4.622   81.924  42.580  1.00 35.49  ? 174  LEU B CA    1 
ATOM   5996  C C     . LEU B 1 174 ? 4.925   82.832  43.789  1.00 36.50  ? 174  LEU B C     1 
ATOM   5997  O O     . LEU B 1 174 ? 4.043   83.158  44.574  1.00 36.23  ? 174  LEU B O     1 
ATOM   5998  C CB    . LEU B 1 174 ? 5.220   80.533  42.808  1.00 34.34  ? 174  LEU B CB    1 
ATOM   5999  C CG    . LEU B 1 174 ? 4.360   79.298  43.063  1.00 37.89  ? 174  LEU B CG    1 
ATOM   6000  C CD1   . LEU B 1 174 ? 3.003   79.326  42.327  1.00 32.17  ? 174  LEU B CD1   1 
ATOM   6001  C CD2   . LEU B 1 174 ? 5.174   78.034  42.733  1.00 34.41  ? 174  LEU B CD2   1 
ATOM   6002  N N     . GLU B 1 175 ? 6.181   83.230  43.916  1.00 37.96  ? 175  GLU B N     1 
ATOM   6003  C CA    . GLU B 1 175 ? 6.636   84.098  44.995  1.00 39.29  ? 175  GLU B CA    1 
ATOM   6004  C C     . GLU B 1 175 ? 6.058   85.512  44.858  1.00 38.59  ? 175  GLU B C     1 
ATOM   6005  O O     . GLU B 1 175 ? 5.605   86.091  45.832  1.00 39.00  ? 175  GLU B O     1 
ATOM   6006  C CB    . GLU B 1 175 ? 8.175   84.109  44.960  1.00 40.14  ? 175  GLU B CB    1 
ATOM   6007  C CG    . GLU B 1 175 ? 8.942   84.825  46.085  1.00 41.84  ? 175  GLU B CG    1 
ATOM   6008  C CD    . GLU B 1 175 ? 10.430  85.005  45.728  1.00 46.15  ? 175  GLU B CD    1 
ATOM   6009  O OE1   . GLU B 1 175 ? 10.754  85.027  44.512  1.00 60.21  ? 175  GLU B OE1   1 
ATOM   6010  O OE2   . GLU B 1 175 ? 11.278  85.134  46.646  1.00 60.00  ? 175  GLU B OE2   1 
ATOM   6011  N N     . GLY B 1 176 ? 6.043   86.047  43.643  1.00 37.67  ? 176  GLY B N     1 
ATOM   6012  C CA    . GLY B 1 176 ? 5.512   87.393  43.399  1.00 37.80  ? 176  GLY B CA    1 
ATOM   6013  C C     . GLY B 1 176 ? 3.992   87.519  43.431  1.00 38.20  ? 176  GLY B C     1 
ATOM   6014  O O     . GLY B 1 176 ? 3.451   88.508  43.943  1.00 38.96  ? 176  GLY B O     1 
ATOM   6015  N N     . CYS B 1 177 ? 3.293   86.542  42.873  1.00 36.62  ? 177  CYS B N     1 
ATOM   6016  C CA    . CYS B 1 177 ? 1.851   86.666  42.724  1.00 33.62  ? 177  CYS B CA    1 
ATOM   6017  C C     . CYS B 1 177 ? 1.061   85.875  43.745  1.00 29.84  ? 177  CYS B C     1 
ATOM   6018  O O     . CYS B 1 177 ? -0.042  86.280  44.109  1.00 26.72  ? 177  CYS B O     1 
ATOM   6019  C CB    . CYS B 1 177 ? 1.435   86.252  41.312  1.00 33.81  ? 177  CYS B CB    1 
ATOM   6020  S SG    . CYS B 1 177 ? 2.234   87.234  40.046  1.00 44.38  ? 177  CYS B SG    1 
ATOM   6021  N N     . PHE B 1 178 ? 1.595   84.725  44.169  1.00 27.82  ? 178  PHE B N     1 
ATOM   6022  C CA    . PHE B 1 178 ? 0.833   83.791  44.994  1.00 28.32  ? 178  PHE B CA    1 
ATOM   6023  C C     . PHE B 1 178 ? 1.627   83.247  46.167  1.00 28.50  ? 178  PHE B C     1 
ATOM   6024  O O     . PHE B 1 178 ? 1.791   82.026  46.283  1.00 27.50  ? 178  PHE B O     1 
ATOM   6025  C CB    . PHE B 1 178 ? 0.307   82.598  44.162  1.00 27.70  ? 178  PHE B CB    1 
ATOM   6026  C CG    . PHE B 1 178 ? -0.460  83.010  42.943  1.00 27.36  ? 178  PHE B CG    1 
ATOM   6027  C CD1   . PHE B 1 178 ? -1.659  83.670  43.066  1.00 21.50  ? 178  PHE B CD1   1 
ATOM   6028  C CD2   . PHE B 1 178 ? 0.061   82.798  41.671  1.00 29.00  ? 178  PHE B CD2   1 
ATOM   6029  C CE1   . PHE B 1 178 ? -2.373  84.076  41.940  1.00 23.71  ? 178  PHE B CE1   1 
ATOM   6030  C CE2   . PHE B 1 178 ? -0.644  83.191  40.549  1.00 31.39  ? 178  PHE B CE2   1 
ATOM   6031  C CZ    . PHE B 1 178 ? -1.869  83.836  40.686  1.00 24.51  ? 178  PHE B CZ    1 
ATOM   6032  N N     . PRO B 1 179 ? 2.112   84.135  47.047  1.00 28.81  ? 179  PRO B N     1 
ATOM   6033  C CA    . PRO B 1 179 ? 2.818   83.697  48.257  1.00 28.02  ? 179  PRO B CA    1 
ATOM   6034  C C     . PRO B 1 179 ? 2.025   82.763  49.196  1.00 28.35  ? 179  PRO B C     1 
ATOM   6035  O O     . PRO B 1 179 ? 2.621   82.068  50.001  1.00 27.42  ? 179  PRO B O     1 
ATOM   6036  C CB    . PRO B 1 179 ? 3.182   85.012  48.951  1.00 28.37  ? 179  PRO B CB    1 
ATOM   6037  C CG    . PRO B 1 179 ? 2.370   86.043  48.298  1.00 29.34  ? 179  PRO B CG    1 
ATOM   6038  C CD    . PRO B 1 179 ? 2.096   85.601  46.924  1.00 27.83  ? 179  PRO B CD    1 
ATOM   6039  N N     . GLY B 1 180 ? 0.707   82.729  49.080  1.00 27.31  ? 180  GLY B N     1 
ATOM   6040  C CA    . GLY B 1 180 ? -0.112  81.791  49.848  1.00 28.81  ? 180  GLY B CA    1 
ATOM   6041  C C     . GLY B 1 180 ? -0.256  80.405  49.224  1.00 31.14  ? 180  GLY B C     1 
ATOM   6042  O O     . GLY B 1 180 ? -0.941  79.522  49.762  1.00 33.72  ? 180  GLY B O     1 
ATOM   6043  N N     . GLY B 1 181 ? 0.354   80.217  48.071  1.00 30.89  ? 181  GLY B N     1 
ATOM   6044  C CA    . GLY B 1 181 ? 0.397   78.931  47.439  1.00 29.13  ? 181  GLY B CA    1 
ATOM   6045  C C     . GLY B 1 181 ? -0.654  78.748  46.367  1.00 29.82  ? 181  GLY B C     1 
ATOM   6046  O O     . GLY B 1 181 ? -1.274  79.705  45.901  1.00 27.45  ? 181  GLY B O     1 
ATOM   6047  N N     . VAL B 1 182 ? -0.836  77.483  45.993  1.00 29.44  ? 182  VAL B N     1 
ATOM   6048  C CA    . VAL B 1 182 ? -1.791  77.054  44.983  1.00 29.47  ? 182  VAL B CA    1 
ATOM   6049  C C     . VAL B 1 182 ? -2.465  75.790  45.493  1.00 28.70  ? 182  VAL B C     1 
ATOM   6050  O O     . VAL B 1 182 ? -1.856  74.998  46.193  1.00 31.05  ? 182  VAL B O     1 
ATOM   6051  C CB    . VAL B 1 182 ? -1.147  76.766  43.595  1.00 28.10  ? 182  VAL B CB    1 
ATOM   6052  C CG1   . VAL B 1 182 ? -0.171  77.871  43.192  1.00 29.42  ? 182  VAL B CG1   1 
ATOM   6053  C CG2   . VAL B 1 182 ? -0.441  75.422  43.577  1.00 33.10  ? 182  VAL B CG2   1 
ATOM   6054  N N     . HIS B 1 183 ? -3.731  75.613  45.155  1.00 27.59  ? 183  HIS B N     1 
ATOM   6055  C CA    . HIS B 1 183 ? -4.421  74.362  45.440  1.00 27.70  ? 183  HIS B CA    1 
ATOM   6056  C C     . HIS B 1 183 ? -5.122  73.915  44.196  1.00 26.22  ? 183  HIS B C     1 
ATOM   6057  O O     . HIS B 1 183 ? -5.845  74.677  43.580  1.00 26.32  ? 183  HIS B O     1 
ATOM   6058  C CB    . HIS B 1 183 ? -5.392  74.521  46.597  1.00 28.51  ? 183  HIS B CB    1 
ATOM   6059  C CG    . HIS B 1 183 ? -4.701  74.746  47.908  1.00 35.30  ? 183  HIS B CG    1 
ATOM   6060  N ND1   . HIS B 1 183 ? -4.280  73.710  48.718  1.00 43.64  ? 183  HIS B ND1   1 
ATOM   6061  C CD2   . HIS B 1 183 ? -4.323  75.888  48.530  1.00 39.28  ? 183  HIS B CD2   1 
ATOM   6062  C CE1   . HIS B 1 183 ? -3.667  74.206  49.779  1.00 44.20  ? 183  HIS B CE1   1 
ATOM   6063  N NE2   . HIS B 1 183 ? -3.677  75.525  49.686  1.00 44.17  ? 183  HIS B NE2   1 
ATOM   6064  N N     . TRP B 1 184 ? -4.889  72.664  43.834  1.00 25.43  ? 184  TRP B N     1 
ATOM   6065  C CA    . TRP B 1 184 ? -5.467  72.070  42.648  1.00 26.81  ? 184  TRP B CA    1 
ATOM   6066  C C     . TRP B 1 184 ? -6.723  71.313  42.963  1.00 28.07  ? 184  TRP B C     1 
ATOM   6067  O O     . TRP B 1 184 ? -6.719  70.492  43.873  1.00 29.30  ? 184  TRP B O     1 
ATOM   6068  C CB    . TRP B 1 184 ? -4.457  71.104  42.081  1.00 27.02  ? 184  TRP B CB    1 
ATOM   6069  C CG    . TRP B 1 184 ? -4.852  70.469  40.846  1.00 26.30  ? 184  TRP B CG    1 
ATOM   6070  C CD1   . TRP B 1 184 ? -5.655  69.390  40.702  1.00 23.08  ? 184  TRP B CD1   1 
ATOM   6071  C CD2   . TRP B 1 184 ? -4.451  70.864  39.533  1.00 22.53  ? 184  TRP B CD2   1 
ATOM   6072  N NE1   . TRP B 1 184 ? -5.808  69.106  39.369  1.00 27.65  ? 184  TRP B NE1   1 
ATOM   6073  C CE2   . TRP B 1 184 ? -5.059  69.990  38.635  1.00 25.78  ? 184  TRP B CE2   1 
ATOM   6074  C CE3   . TRP B 1 184 ? -3.638  71.881  39.037  1.00 25.94  ? 184  TRP B CE3   1 
ATOM   6075  C CZ2   . TRP B 1 184 ? -4.860  70.085  37.270  1.00 30.64  ? 184  TRP B CZ2   1 
ATOM   6076  C CZ3   . TRP B 1 184 ? -3.448  71.976  37.716  1.00 24.53  ? 184  TRP B CZ3   1 
ATOM   6077  C CH2   . TRP B 1 184 ? -4.041  71.088  36.830  1.00 24.28  ? 184  TRP B CH2   1 
ATOM   6078  N N     . VAL B 1 185 ? -7.795  71.569  42.203  1.00 28.10  ? 185  VAL B N     1 
ATOM   6079  C CA    . VAL B 1 185 ? -9.034  70.829  42.356  1.00 27.98  ? 185  VAL B CA    1 
ATOM   6080  C C     . VAL B 1 185 ? -9.420  70.228  41.042  1.00 29.56  ? 185  VAL B C     1 
ATOM   6081  O O     . VAL B 1 185 ? -9.572  70.950  40.021  1.00 29.08  ? 185  VAL B O     1 
ATOM   6082  C CB    . VAL B 1 185 ? -10.196 71.737  42.827  1.00 31.68  ? 185  VAL B CB    1 
ATOM   6083  C CG1   . VAL B 1 185 ? -11.420 70.869  43.228  1.00 29.93  ? 185  VAL B CG1   1 
ATOM   6084  C CG2   . VAL B 1 185 ? -9.751  72.572  43.973  1.00 32.17  ? 185  VAL B CG2   1 
ATOM   6085  N N     . SER B 1 186 ? -9.559  68.905  41.041  1.00 29.51  ? 186  SER B N     1 
ATOM   6086  C CA    . SER B 1 186 ? -10.027 68.167  39.870  1.00 32.29  ? 186  SER B CA    1 
ATOM   6087  C C     . SER B 1 186 ? -11.549 68.044  39.929  1.00 33.23  ? 186  SER B C     1 
ATOM   6088  O O     . SER B 1 186 ? -12.081 67.417  40.844  1.00 35.29  ? 186  SER B O     1 
ATOM   6089  C CB    . SER B 1 186 ? -9.438  66.785  39.895  1.00 34.90  ? 186  SER B CB    1 
ATOM   6090  O OG    . SER B 1 186 ? -9.727  66.237  41.174  1.00 52.39  ? 186  SER B OG    1 
ATOM   6091  N N     . VAL B 1 187 ? -12.248 68.666  38.983  1.00 31.77  ? 187  VAL B N     1 
ATOM   6092  C CA    . VAL B 1 187 ? -13.687 68.812  39.091  1.00 31.92  ? 187  VAL B CA    1 
ATOM   6093  C C     . VAL B 1 187 ? -14.352 67.802  38.130  1.00 32.88  ? 187  VAL B C     1 
ATOM   6094  O O     . VAL B 1 187 ? -14.921 66.786  38.567  1.00 32.86  ? 187  VAL B O     1 
ATOM   6095  C CB    . VAL B 1 187 ? -14.138 70.304  38.798  1.00 31.55  ? 187  VAL B CB    1 
ATOM   6096  C CG1   . VAL B 1 187 ? -15.630 70.479  38.976  1.00 35.80  ? 187  VAL B CG1   1 
ATOM   6097  C CG2   . VAL B 1 187 ? -13.422 71.280  39.711  1.00 31.59  ? 187  VAL B CG2   1 
ATOM   6098  N N     . GLY B 1 188 ? -14.250 68.090  36.830  1.00 32.14  ? 188  GLY B N     1 
ATOM   6099  C CA    . GLY B 1 188 ? -14.967 67.378  35.817  1.00 33.86  ? 188  GLY B CA    1 
ATOM   6100  C C     . GLY B 1 188 ? -16.474 67.578  35.842  1.00 34.22  ? 188  GLY B C     1 
ATOM   6101  O O     . GLY B 1 188 ? -17.000 68.429  36.571  1.00 32.90  ? 188  GLY B O     1 
ATOM   6102  N N     . LYS B 1 189 ? -17.170 66.757  35.059  1.00 34.39  ? 189  LYS B N     1 
ATOM   6103  C CA    . LYS B 1 189 ? -18.621 66.813  34.978  1.00 35.57  ? 189  LYS B CA    1 
ATOM   6104  C C     . LYS B 1 189 ? -19.204 66.318  36.288  1.00 36.38  ? 189  LYS B C     1 
ATOM   6105  O O     . LYS B 1 189 ? -18.918 65.193  36.698  1.00 37.08  ? 189  LYS B O     1 
ATOM   6106  C CB    . LYS B 1 189 ? -19.122 65.954  33.821  1.00 36.77  ? 189  LYS B CB    1 
ATOM   6107  C CG    . LYS B 1 189 ? -20.627 65.953  33.633  1.00 37.45  ? 189  LYS B CG    1 
ATOM   6108  C CD    . LYS B 1 189 ? -21.177 67.341  33.411  1.00 43.53  ? 189  LYS B CD    1 
ATOM   6109  C CE    . LYS B 1 189 ? -22.649 67.285  33.021  1.00 46.64  ? 189  LYS B CE    1 
ATOM   6110  N NZ    . LYS B 1 189 ? -23.249 68.634  32.973  1.00 40.65  ? 189  LYS B NZ    1 
ATOM   6111  N N     . GLN B 1 190 ? -19.964 67.178  36.965  1.00 36.04  ? 190  GLN B N     1 
ATOM   6112  C CA    . GLN B 1 190 ? -20.535 66.862  38.267  1.00 36.08  ? 190  GLN B CA    1 
ATOM   6113  C C     . GLN B 1 190 ? -22.022 67.227  38.312  1.00 37.17  ? 190  GLN B C     1 
ATOM   6114  O O     . GLN B 1 190 ? -22.482 68.170  37.644  1.00 35.65  ? 190  GLN B O     1 
ATOM   6115  C CB    . GLN B 1 190 ? -19.832 67.641  39.384  1.00 35.13  ? 190  GLN B CB    1 
ATOM   6116  C CG    . GLN B 1 190 ? -18.341 67.255  39.691  1.00 37.60  ? 190  GLN B CG    1 
ATOM   6117  C CD    . GLN B 1 190 ? -18.108 65.761  39.870  1.00 36.25  ? 190  GLN B CD    1 
ATOM   6118  O OE1   . GLN B 1 190 ? -18.952 65.046  40.405  1.00 39.51  ? 190  GLN B OE1   1 
ATOM   6119  N NE2   . GLN B 1 190 ? -16.968 65.284  39.393  1.00 31.54  ? 190  GLN B NE2   1 
ATOM   6120  N N     . ASP B 1 191 ? -22.757 66.466  39.118  1.00 37.07  ? 191  ASP B N     1 
ATOM   6121  C CA    . ASP B 1 191 ? -24.066 66.879  39.625  1.00 38.31  ? 191  ASP B CA    1 
ATOM   6122  C C     . ASP B 1 191 ? -23.848 67.515  41.001  1.00 36.64  ? 191  ASP B C     1 
ATOM   6123  O O     . ASP B 1 191 ? -22.705 67.651  41.441  1.00 37.18  ? 191  ASP B O     1 
ATOM   6124  C CB    . ASP B 1 191 ? -25.050 65.680  39.662  1.00 39.50  ? 191  ASP B CB    1 
ATOM   6125  C CG    . ASP B 1 191 ? -24.509 64.471  40.441  1.00 45.51  ? 191  ASP B CG    1 
ATOM   6126  O OD1   . ASP B 1 191 ? -23.546 64.606  41.216  1.00 51.11  ? 191  ASP B OD1   1 
ATOM   6127  O OD2   . ASP B 1 191 ? -25.056 63.365  40.283  1.00 55.29  ? 191  ASP B OD2   1 
ATOM   6128  N N     . LYS B 1 192 ? -24.912 67.891  41.691  1.00 35.92  ? 192  LYS B N     1 
ATOM   6129  C CA    . LYS B 1 192 ? -24.792 68.539  43.008  1.00 37.61  ? 192  LYS B CA    1 
ATOM   6130  C C     . LYS B 1 192 ? -24.027 67.690  44.022  1.00 36.96  ? 192  LYS B C     1 
ATOM   6131  O O     . LYS B 1 192 ? -23.132 68.185  44.718  1.00 36.61  ? 192  LYS B O     1 
ATOM   6132  C CB    . LYS B 1 192 ? -26.162 68.826  43.646  1.00 39.06  ? 192  LYS B CB    1 
ATOM   6133  C CG    . LYS B 1 192 ? -27.059 69.763  42.915  1.00 47.96  ? 192  LYS B CG    1 
ATOM   6134  C CD    . LYS B 1 192 ? -26.540 71.189  42.887  1.00 53.54  ? 192  LYS B CD    1 
ATOM   6135  C CE    . LYS B 1 192 ? -27.506 72.092  42.079  1.00 57.30  ? 192  LYS B CE    1 
ATOM   6136  N NZ    . LYS B 1 192 ? -26.901 73.367  41.584  1.00 55.90  ? 192  LYS B NZ    1 
ATOM   6137  N N     . SER B 1 193 ? -24.395 66.424  44.121  1.00 35.55  ? 193  SER B N     1 
ATOM   6138  C CA    . SER B 1 193 ? -23.823 65.546  45.134  1.00 36.99  ? 193  SER B CA    1 
ATOM   6139  C C     . SER B 1 193 ? -22.377 65.204  44.791  1.00 32.98  ? 193  SER B C     1 
ATOM   6140  O O     . SER B 1 193 ? -21.549 65.124  45.668  1.00 31.12  ? 193  SER B O     1 
ATOM   6141  C CB    . SER B 1 193 ? -24.704 64.267  45.340  1.00 38.36  ? 193  SER B CB    1 
ATOM   6142  O OG    . SER B 1 193 ? -24.754 63.470  44.180  1.00 42.83  ? 193  SER B OG    1 
ATOM   6143  N N     . GLY B 1 194 ? -22.083 65.068  43.508  1.00 32.88  ? 194  GLY B N     1 
ATOM   6144  C CA    . GLY B 1 194 ? -20.719 64.927  43.017  1.00 32.12  ? 194  GLY B CA    1 
ATOM   6145  C C     . GLY B 1 194 ? -19.830 66.110  43.331  1.00 31.95  ? 194  GLY B C     1 
ATOM   6146  O O     . GLY B 1 194 ? -18.699 65.914  43.749  1.00 32.72  ? 194  GLY B O     1 
ATOM   6147  N N     . LEU B 1 195 ? -20.327 67.328  43.122  1.00 32.66  ? 195  LEU B N     1 
ATOM   6148  C CA    . LEU B 1 195 ? -19.581 68.533  43.480  1.00 32.77  ? 195  LEU B CA    1 
ATOM   6149  C C     . LEU B 1 195 ? -19.405 68.661  44.980  1.00 31.44  ? 195  LEU B C     1 
ATOM   6150  O O     . LEU B 1 195 ? -18.357 69.097  45.458  1.00 32.36  ? 195  LEU B O     1 
ATOM   6151  C CB    . LEU B 1 195 ? -20.263 69.817  42.962  1.00 33.21  ? 195  LEU B CB    1 
ATOM   6152  C CG    . LEU B 1 195 ? -19.469 71.118  43.281  1.00 33.64  ? 195  LEU B CG    1 
ATOM   6153  C CD1   . LEU B 1 195 ? -18.069 71.060  42.719  1.00 35.13  ? 195  LEU B CD1   1 
ATOM   6154  C CD2   . LEU B 1 195 ? -20.152 72.368  42.761  1.00 35.75  ? 195  LEU B CD2   1 
ATOM   6155  N N     . LEU B 1 196 ? -20.436 68.324  45.734  1.00 31.99  ? 196  LEU B N     1 
ATOM   6156  C CA    . LEU B 1 196 ? -20.320 68.347  47.201  1.00 32.06  ? 196  LEU B CA    1 
ATOM   6157  C C     . LEU B 1 196 ? -19.193 67.453  47.686  1.00 31.00  ? 196  LEU B C     1 
ATOM   6158  O O     . LEU B 1 196 ? -18.418 67.863  48.568  1.00 32.61  ? 196  LEU B O     1 
ATOM   6159  C CB    . LEU B 1 196 ? -21.650 67.964  47.894  1.00 31.22  ? 196  LEU B CB    1 
ATOM   6160  C CG    . LEU B 1 196 ? -21.575 67.915  49.436  1.00 29.94  ? 196  LEU B CG    1 
ATOM   6161  C CD1   . LEU B 1 196 ? -21.285 69.283  50.012  1.00 30.36  ? 196  LEU B CD1   1 
ATOM   6162  C CD2   . LEU B 1 196 ? -22.834 67.371  50.050  1.00 32.19  ? 196  LEU B CD2   1 
ATOM   6163  N N     . MET B 1 197 ? -19.079 66.244  47.134  1.00 32.35  ? 197  MET B N     1 
ATOM   6164  C CA    . MET B 1 197 ? -17.972 65.344  47.521  1.00 34.44  ? 197  MET B CA    1 
ATOM   6165  C C     . MET B 1 197 ? -16.644 66.018  47.254  1.00 31.17  ? 197  MET B C     1 
ATOM   6166  O O     . MET B 1 197 ? -15.786 65.944  48.090  1.00 31.46  ? 197  MET B O     1 
ATOM   6167  C CB    . MET B 1 197 ? -18.010 63.986  46.814  1.00 36.02  ? 197  MET B CB    1 
ATOM   6168  C CG    . MET B 1 197 ? -19.151 63.044  47.290  1.00 42.27  ? 197  MET B CG    1 
ATOM   6169  S SD    . MET B 1 197 ? -19.241 61.503  46.323  1.00 43.55  ? 197  MET B SD    1 
ATOM   6170  C CE    . MET B 1 197 ? -19.813 61.981  44.734  1.00 47.41  ? 197  MET B CE    1 
ATOM   6171  N N     . LYS B 1 198 ? -16.506 66.678  46.102  1.00 30.48  ? 198  LYS B N     1 
ATOM   6172  C CA    . LYS B 1 198 ? -15.275 67.421  45.742  1.00 31.31  ? 198  LYS B CA    1 
ATOM   6173  C C     . LYS B 1 198 ? -15.010 68.588  46.677  1.00 28.81  ? 198  LYS B C     1 
ATOM   6174  O O     . LYS B 1 198 ? -13.884 68.761  47.143  1.00 31.77  ? 198  LYS B O     1 
ATOM   6175  C CB    . LYS B 1 198 ? -15.325 67.976  44.310  1.00 31.01  ? 198  LYS B CB    1 
ATOM   6176  C CG    . LYS B 1 198 ? -15.460 66.946  43.206  1.00 35.88  ? 198  LYS B CG    1 
ATOM   6177  C CD    . LYS B 1 198 ? -14.215 66.103  43.052  1.00 34.45  ? 198  LYS B CD    1 
ATOM   6178  C CE    . LYS B 1 198 ? -14.416 65.096  41.941  1.00 33.37  ? 198  LYS B CE    1 
ATOM   6179  N NZ    . LYS B 1 198 ? -13.233 64.876  41.102  1.00 32.65  ? 198  LYS B NZ    1 
ATOM   6180  N N     . LEU B 1 199 ? -16.044 69.365  46.990  1.00 30.51  ? 199  LEU B N     1 
ATOM   6181  C CA    . LEU B 1 199 ? -15.907 70.473  47.949  1.00 29.05  ? 199  LEU B CA    1 
ATOM   6182  C C     . LEU B 1 199 ? -15.595 70.033  49.365  1.00 29.44  ? 199  LEU B C     1 
ATOM   6183  O O     . LEU B 1 199 ? -14.818 70.691  50.058  1.00 32.01  ? 199  LEU B O     1 
ATOM   6184  C CB    . LEU B 1 199 ? -17.140 71.342  47.944  1.00 26.72  ? 199  LEU B CB    1 
ATOM   6185  C CG    . LEU B 1 199 ? -17.397 72.018  46.599  1.00 33.91  ? 199  LEU B CG    1 
ATOM   6186  C CD1   . LEU B 1 199 ? -18.760 72.626  46.577  1.00 30.91  ? 199  LEU B CD1   1 
ATOM   6187  C CD2   . LEU B 1 199 ? -16.344 73.066  46.278  1.00 41.39  ? 199  LEU B CD2   1 
ATOM   6188  N N     . GLN B 1 200 ? -16.193 68.938  49.823  1.00 29.34  ? 200  GLN B N     1 
ATOM   6189  C CA    . GLN B 1 200 ? -15.870 68.403  51.148  1.00 29.81  ? 200  GLN B CA    1 
ATOM   6190  C C     . GLN B 1 200 ? -14.390 67.993  51.229  1.00 29.78  ? 200  GLN B C     1 
ATOM   6191  O O     . GLN B 1 200 ? -13.680 68.343  52.178  1.00 29.36  ? 200  GLN B O     1 
ATOM   6192  C CB    . GLN B 1 200 ? -16.773 67.217  51.480  1.00 31.15  ? 200  GLN B CB    1 
ATOM   6193  C CG    . GLN B 1 200 ? -18.194 67.607  51.782  1.00 30.63  ? 200  GLN B CG    1 
ATOM   6194  C CD    . GLN B 1 200 ? -19.108 66.424  52.054  1.00 31.53  ? 200  GLN B CD    1 
ATOM   6195  O OE1   . GLN B 1 200 ? -18.897 65.315  51.549  1.00 31.42  ? 200  GLN B OE1   1 
ATOM   6196  N NE2   . GLN B 1 200 ? -20.156 66.666  52.832  1.00 28.42  ? 200  GLN B NE2   1 
ATOM   6197  N N     . ASN B 1 201 ? -13.916 67.264  50.232  1.00 33.04  ? 201  ASN B N     1 
ATOM   6198  C CA    . ASN B 1 201 ? -12.489 66.914  50.168  1.00 31.49  ? 201  ASN B CA    1 
ATOM   6199  C C     . ASN B 1 201 ? -11.539 68.133  50.144  1.00 30.95  ? 201  ASN B C     1 
ATOM   6200  O O     . ASN B 1 201 ? -10.494 68.144  50.820  1.00 32.32  ? 201  ASN B O     1 
ATOM   6201  C CB    . ASN B 1 201 ? -12.231 66.010  48.966  1.00 32.67  ? 201  ASN B CB    1 
ATOM   6202  C CG    . ASN B 1 201 ? -10.757 65.619  48.841  1.00 39.94  ? 201  ASN B CG    1 
ATOM   6203  O OD1   . ASN B 1 201 ? -9.993  66.239  48.083  1.00 53.03  ? 201  ASN B OD1   1 
ATOM   6204  N ND2   . ASN B 1 201 ? -10.339 64.624  49.633  1.00 48.96  ? 201  ASN B ND2   1 
ATOM   6205  N N     . LEU B 1 202 ? -11.897 69.169  49.396  1.00 30.24  ? 202  LEU B N     1 
ATOM   6206  C CA    . LEU B 1 202 ? -11.111 70.401  49.347  1.00 29.36  ? 202  LEU B CA    1 
ATOM   6207  C C     . LEU B 1 202 ? -11.113 71.121  50.695  1.00 31.30  ? 202  LEU B C     1 
ATOM   6208  O O     . LEU B 1 202 ? -10.058 71.606  51.174  1.00 29.49  ? 202  LEU B O     1 
ATOM   6209  C CB    . LEU B 1 202 ? -11.615 71.341  48.263  1.00 30.56  ? 202  LEU B CB    1 
ATOM   6210  C CG    . LEU B 1 202 ? -10.923 72.694  48.048  1.00 31.47  ? 202  LEU B CG    1 
ATOM   6211  C CD1   . LEU B 1 202 ? -9.433  72.585  47.663  1.00 32.38  ? 202  LEU B CD1   1 
ATOM   6212  C CD2   . LEU B 1 202 ? -11.684 73.440  46.989  1.00 30.05  ? 202  LEU B CD2   1 
ATOM   6213  N N     . CYS B 1 203 ? -12.286 71.195  51.330  1.00 31.87  ? 203  CYS B N     1 
ATOM   6214  C CA    . CYS B 1 203 ? -12.358 71.852  52.635  1.00 33.17  ? 203  CYS B CA    1 
ATOM   6215  C C     . CYS B 1 203 ? -11.460 71.160  53.650  1.00 31.87  ? 203  CYS B C     1 
ATOM   6216  O O     . CYS B 1 203 ? -10.843 71.845  54.485  1.00 30.56  ? 203  CYS B O     1 
ATOM   6217  C CB    . CYS B 1 203 ? -13.815 71.993  53.144  1.00 35.44  ? 203  CYS B CB    1 
ATOM   6218  S SG    . CYS B 1 203 ? -14.757 73.280  52.241  1.00 37.24  ? 203  CYS B SG    1 
ATOM   6219  N N     . THR B 1 204 ? -11.357 69.831  53.558  1.00 31.70  ? 204  THR B N     1 
ATOM   6220  C CA    . THR B 1 204 ? -10.461 69.063  54.469  1.00 34.21  ? 204  THR B CA    1 
ATOM   6221  C C     . THR B 1 204 ? -8.963  69.352  54.180  1.00 34.97  ? 204  THR B C     1 
ATOM   6222  O O     . THR B 1 204 ? -8.141  69.518  55.089  1.00 34.41  ? 204  THR B O     1 
ATOM   6223  C CB    . THR B 1 204 ? -10.751 67.533  54.384  1.00 34.83  ? 204  THR B CB    1 
ATOM   6224  O OG1   . THR B 1 204 ? -12.120 67.290  54.727  1.00 36.34  ? 204  THR B OG1   1 
ATOM   6225  C CG2   . THR B 1 204 ? -9.897  66.765  55.340  1.00 33.22  ? 204  THR B CG2   1 
ATOM   6226  N N     . ARG B 1 205 ? -8.613  69.395  52.908  1.00 36.66  ? 205  ARG B N     1 
ATOM   6227  C CA    . ARG B 1 205 ? -7.257  69.730  52.501  1.00 36.93  ? 205  ARG B CA    1 
ATOM   6228  C C     . ARG B 1 205 ? -6.829  71.106  52.973  1.00 37.07  ? 205  ARG B C     1 
ATOM   6229  O O     . ARG B 1 205 ? -5.680  71.313  53.347  1.00 35.43  ? 205  ARG B O     1 
ATOM   6230  C CB    . ARG B 1 205 ? -7.151  69.667  50.991  1.00 37.96  ? 205  ARG B CB    1 
ATOM   6231  C CG    . ARG B 1 205 ? -7.054  68.236  50.490  1.00 41.69  ? 205  ARG B CG    1 
ATOM   6232  C CD    . ARG B 1 205 ? -6.336  68.177  49.192  1.00 40.51  ? 205  ARG B CD    1 
ATOM   6233  N NE    . ARG B 1 205 ? -7.250  68.454  48.126  1.00 41.36  ? 205  ARG B NE    1 
ATOM   6234  C CZ    . ARG B 1 205 ? -7.017  69.228  47.063  1.00 43.22  ? 205  ARG B CZ    1 
ATOM   6235  N NH1   . ARG B 1 205 ? -5.873  69.908  46.911  1.00 39.79  ? 205  ARG B NH1   1 
ATOM   6236  N NH2   . ARG B 1 205 ? -7.981  69.332  46.156  1.00 35.77  ? 205  ARG B NH2   1 
ATOM   6237  N N     . LEU B 1 206 ? -7.758  72.054  52.914  1.00 38.73  ? 206  LEU B N     1 
ATOM   6238  C CA    . LEU B 1 206 ? -7.443  73.458  53.179  1.00 39.64  ? 206  LEU B CA    1 
ATOM   6239  C C     . LEU B 1 206 ? -7.400  73.776  54.652  1.00 39.68  ? 206  LEU B C     1 
ATOM   6240  O O     . LEU B 1 206 ? -7.006  74.871  55.034  1.00 38.33  ? 206  LEU B O     1 
ATOM   6241  C CB    . LEU B 1 206 ? -8.485  74.386  52.545  1.00 38.19  ? 206  LEU B CB    1 
ATOM   6242  C CG    . LEU B 1 206 ? -8.515  74.456  51.031  1.00 33.38  ? 206  LEU B CG    1 
ATOM   6243  C CD1   . LEU B 1 206 ? -9.649  75.382  50.598  1.00 28.49  ? 206  LEU B CD1   1 
ATOM   6244  C CD2   . LEU B 1 206 ? -7.152  74.876  50.500  1.00 31.17  ? 206  LEU B CD2   1 
ATOM   6245  N N     . ASP B 1 207 ? -7.835  72.839  55.478  1.00 44.60  ? 207  ASP B N     1 
ATOM   6246  C CA    . ASP B 1 207 ? -7.852  73.032  56.925  1.00 48.88  ? 207  ASP B CA    1 
ATOM   6247  C C     . ASP B 1 207 ? -7.247  71.821  57.602  1.00 52.13  ? 207  ASP B C     1 
ATOM   6248  O O     . ASP B 1 207 ? -7.913  71.150  58.372  1.00 53.26  ? 207  ASP B O     1 
ATOM   6249  C CB    . ASP B 1 207 ? -9.313  73.237  57.375  1.00 48.29  ? 207  ASP B CB    1 
ATOM   6250  C CG    . ASP B 1 207 ? -9.465  73.561  58.879  1.00 48.25  ? 207  ASP B CG    1 
ATOM   6251  O OD1   . ASP B 1 207 ? -8.478  73.942  59.566  1.00 48.61  ? 207  ASP B OD1   1 
ATOM   6252  O OD2   . ASP B 1 207 ? -10.616 73.437  59.367  1.00 49.12  ? 207  ASP B OD2   1 
ATOM   6253  N N     . GLN B 1 208 ? -5.981  71.533  57.316  1.00 57.15  ? 208  GLN B N     1 
ATOM   6254  C CA    . GLN B 1 208 ? -5.353  70.313  57.847  1.00 61.47  ? 208  GLN B CA    1 
ATOM   6255  C C     . GLN B 1 208 ? -5.099  70.454  59.349  1.00 64.08  ? 208  GLN B C     1 
ATOM   6256  O O     . GLN B 1 208 ? -5.570  69.634  60.135  1.00 65.31  ? 208  GLN B O     1 
ATOM   6257  C CB    . GLN B 1 208 ? -4.070  69.955  57.070  1.00 63.07  ? 208  GLN B CB    1 
ATOM   6258  C CG    . GLN B 1 208 ? -4.342  69.040  55.849  1.00 62.76  ? 208  GLN B CG    1 
ATOM   6259  C CD    . GLN B 1 208 ? -3.214  69.025  54.807  1.00 66.10  ? 208  GLN B CD    1 
ATOM   6260  O OE1   . GLN B 1 208 ? -2.109  69.545  55.043  1.00 70.94  ? 208  GLN B OE1   1 
ATOM   6261  N NE2   . GLN B 1 208 ? -3.498  68.423  53.633  1.00 68.42  ? 208  GLN B NE2   1 
ATOM   6262  N N     . ASP B 1 209 ? -4.430  71.534  59.744  1.00 66.29  ? 209  ASP B N     1 
ATOM   6263  C CA    . ASP B 1 209 ? -4.176  71.808  61.163  1.00 68.39  ? 209  ASP B CA    1 
ATOM   6264  C C     . ASP B 1 209 ? -5.464  71.991  61.989  1.00 69.50  ? 209  ASP B C     1 
ATOM   6265  O O     . ASP B 1 209 ? -5.401  72.171  63.210  1.00 69.52  ? 209  ASP B O     1 
ATOM   6266  C CB    . ASP B 1 209 ? -3.171  72.982  61.352  1.00 70.79  ? 209  ASP B CB    1 
ATOM   6267  C CG    . ASP B 1 209 ? -3.836  74.376  61.489  1.00 76.20  ? 209  ASP B CG    1 
ATOM   6268  O OD1   . ASP B 1 209 ? -5.083  74.488  61.564  1.00 84.75  ? 209  ASP B OD1   1 
ATOM   6269  O OD2   . ASP B 1 209 ? -3.077  75.377  61.534  1.00 78.63  ? 209  ASP B OD2   1 
ATOM   6270  N N     . GLU B 1 210 ? -6.613  71.954  61.307  1.00 71.11  ? 210  GLU B N     1 
ATOM   6271  C CA    . GLU B 1 210 ? -7.948  71.878  61.932  1.00 71.78  ? 210  GLU B CA    1 
ATOM   6272  C C     . GLU B 1 210 ? -8.321  73.083  62.812  1.00 71.50  ? 210  GLU B C     1 
ATOM   6273  O O     . GLU B 1 210 ? -9.120  72.967  63.753  1.00 71.68  ? 210  GLU B O     1 
ATOM   6274  C CB    . GLU B 1 210 ? -8.138  70.541  62.661  1.00 72.97  ? 210  GLU B CB    1 
ATOM   6275  C CG    . GLU B 1 210 ? -8.926  69.533  61.820  1.00 75.20  ? 210  GLU B CG    1 
ATOM   6276  C CD    . GLU B 1 210 ? -9.014  68.159  62.460  1.00 76.58  ? 210  GLU B CD    1 
ATOM   6277  O OE1   . GLU B 1 210 ? -8.053  67.772  63.176  1.00 80.19  ? 210  GLU B OE1   1 
ATOM   6278  O OE2   . GLU B 1 210 ? -10.046 67.475  62.244  1.00 82.65  ? 210  GLU B OE2   1 
ATOM   6279  N N     . SER B 1 211 ? -7.787  74.252  62.447  1.00 70.00  ? 211  SER B N     1 
ATOM   6280  C CA    . SER B 1 211 ? -8.078  75.505  63.152  1.00 68.71  ? 211  SER B CA    1 
ATOM   6281  C C     . SER B 1 211 ? -9.522  75.981  62.950  1.00 66.59  ? 211  SER B C     1 
ATOM   6282  O O     . SER B 1 211 ? -9.948  76.952  63.578  1.00 65.18  ? 211  SER B O     1 
ATOM   6283  C CB    . SER B 1 211 ? -7.089  76.604  62.730  1.00 68.88  ? 211  SER B CB    1 
ATOM   6284  O OG    . SER B 1 211 ? -7.041  76.730  61.315  1.00 70.92  ? 211  SER B OG    1 
ATOM   6285  N N     . PHE B 1 212 ? -10.256 75.310  62.063  1.00 66.44  ? 212  PHE B N     1 
ATOM   6286  C CA    . PHE B 1 212 ? -11.675 75.576  61.844  1.00 66.89  ? 212  PHE B CA    1 
ATOM   6287  C C     . PHE B 1 212 ? -12.424 74.240  61.990  1.00 66.99  ? 212  PHE B C     1 
ATOM   6288  O O     . PHE B 1 212 ? -11.819 73.241  62.430  1.00 66.92  ? 212  PHE B O     1 
ATOM   6289  C CB    . PHE B 1 212 ? -11.885 76.282  60.486  1.00 66.78  ? 212  PHE B CB    1 
ATOM   6290  C CG    . PHE B 1 212 ? -11.209 77.638  60.410  1.00 67.68  ? 212  PHE B CG    1 
ATOM   6291  C CD1   . PHE B 1 212 ? -9.843  77.739  60.142  1.00 66.38  ? 212  PHE B CD1   1 
ATOM   6292  C CD2   . PHE B 1 212 ? -11.927 78.809  60.653  1.00 68.61  ? 212  PHE B CD2   1 
ATOM   6293  C CE1   . PHE B 1 212 ? -9.208  78.981  60.100  1.00 66.02  ? 212  PHE B CE1   1 
ATOM   6294  C CE2   . PHE B 1 212 ? -11.298 80.058  60.607  1.00 66.73  ? 212  PHE B CE2   1 
ATOM   6295  C CZ    . PHE B 1 212 ? -9.935  80.137  60.329  1.00 66.99  ? 212  PHE B CZ    1 
ATOM   6296  N N     . SER B 1 213 ? -13.714 74.213  61.634  1.00 67.04  ? 213  SER B N     1 
ATOM   6297  C CA    . SER B 1 213 ? -14.606 73.099  62.013  1.00 66.70  ? 213  SER B CA    1 
ATOM   6298  C C     . SER B 1 213 ? -14.055 71.711  61.683  1.00 66.19  ? 213  SER B C     1 
ATOM   6299  O O     . SER B 1 213 ? -13.459 71.515  60.630  1.00 66.58  ? 213  SER B O     1 
ATOM   6300  C CB    . SER B 1 213 ? -15.976 73.276  61.367  1.00 67.67  ? 213  SER B CB    1 
ATOM   6301  O OG    . SER B 1 213 ? -16.522 74.530  61.730  1.00 65.47  ? 213  SER B OG    1 
ATOM   6302  N N     . GLN B 1 214 ? -14.251 70.767  62.602  1.00 65.98  ? 214  GLN B N     1 
ATOM   6303  C CA    . GLN B 1 214 ? -13.812 69.376  62.417  1.00 65.24  ? 214  GLN B CA    1 
ATOM   6304  C C     . GLN B 1 214 ? -14.802 68.567  61.543  1.00 63.75  ? 214  GLN B C     1 
ATOM   6305  O O     . GLN B 1 214 ? -14.439 67.545  60.947  1.00 64.61  ? 214  GLN B O     1 
ATOM   6306  C CB    . GLN B 1 214 ? -13.609 68.700  63.788  1.00 66.20  ? 214  GLN B CB    1 
ATOM   6307  C CG    . GLN B 1 214 ? -13.672 67.157  63.791  1.00 68.35  ? 214  GLN B CG    1 
ATOM   6308  C CD    . GLN B 1 214 ? -13.446 66.541  65.181  1.00 68.81  ? 214  GLN B CD    1 
ATOM   6309  O OE1   . GLN B 1 214 ? -13.498 67.234  66.204  1.00 72.40  ? 214  GLN B OE1   1 
ATOM   6310  N NE2   . GLN B 1 214 ? -13.207 65.228  65.212  1.00 71.42  ? 214  GLN B NE2   1 
ATOM   6311  N N     . ARG B 1 215 ? -16.049 69.023  61.472  1.00 60.21  ? 215  ARG B N     1 
ATOM   6312  C CA    . ARG B 1 215 ? -17.048 68.368  60.651  1.00 57.78  ? 215  ARG B CA    1 
ATOM   6313  C C     . ARG B 1 215 ? -17.127 69.021  59.259  1.00 53.68  ? 215  ARG B C     1 
ATOM   6314  O O     . ARG B 1 215 ? -16.914 70.215  59.116  1.00 52.81  ? 215  ARG B O     1 
ATOM   6315  C CB    . ARG B 1 215 ? -18.409 68.371  61.362  1.00 59.55  ? 215  ARG B CB    1 
ATOM   6316  C CG    . ARG B 1 215 ? -19.261 69.654  61.195  1.00 62.66  ? 215  ARG B CG    1 
ATOM   6317  C CD    . ARG B 1 215 ? -20.735 69.327  60.862  1.00 62.46  ? 215  ARG B CD    1 
ATOM   6318  N NE    . ARG B 1 215 ? -21.312 70.315  59.944  1.00 68.09  ? 215  ARG B NE    1 
ATOM   6319  C CZ    . ARG B 1 215 ? -22.126 71.312  60.291  1.00 72.05  ? 215  ARG B CZ    1 
ATOM   6320  N NH1   . ARG B 1 215 ? -22.513 71.484  61.557  1.00 72.04  ? 215  ARG B NH1   1 
ATOM   6321  N NH2   . ARG B 1 215 ? -22.570 72.139  59.349  1.00 70.95  ? 215  ARG B NH2   1 
ATOM   6322  N N     . LEU B 1 216 ? -17.441 68.218  58.254  1.00 47.61  ? 216  LEU B N     1 
ATOM   6323  C CA    . LEU B 1 216 ? -17.523 68.669  56.870  1.00 43.67  ? 216  LEU B CA    1 
ATOM   6324  C C     . LEU B 1 216 ? -18.708 69.596  56.610  1.00 40.15  ? 216  LEU B C     1 
ATOM   6325  O O     . LEU B 1 216 ? -19.697 69.553  57.333  1.00 38.25  ? 216  LEU B O     1 
ATOM   6326  C CB    . LEU B 1 216 ? -17.631 67.452  55.959  1.00 41.94  ? 216  LEU B CB    1 
ATOM   6327  C CG    . LEU B 1 216 ? -16.449 66.493  56.061  1.00 37.88  ? 216  LEU B CG    1 
ATOM   6328  C CD1   . LEU B 1 216 ? -16.681 65.299  55.166  1.00 37.33  ? 216  LEU B CD1   1 
ATOM   6329  C CD2   . LEU B 1 216 ? -15.175 67.218  55.682  1.00 39.78  ? 216  LEU B CD2   1 
ATOM   6330  N N     . PRO B 1 217 ? -18.604 70.465  55.585  1.00 38.30  ? 217  PRO B N     1 
ATOM   6331  C CA    . PRO B 1 217 ? -19.823 71.118  55.103  1.00 37.05  ? 217  PRO B CA    1 
ATOM   6332  C C     . PRO B 1 217 ? -20.791 70.071  54.539  1.00 35.06  ? 217  PRO B C     1 
ATOM   6333  O O     . PRO B 1 217 ? -20.357 69.093  53.938  1.00 34.19  ? 217  PRO B O     1 
ATOM   6334  C CB    . PRO B 1 217 ? -19.325 72.056  53.992  1.00 35.35  ? 217  PRO B CB    1 
ATOM   6335  C CG    . PRO B 1 217 ? -17.993 71.486  53.561  1.00 37.49  ? 217  PRO B CG    1 
ATOM   6336  C CD    . PRO B 1 217 ? -17.407 70.884  54.819  1.00 38.53  ? 217  PRO B CD    1 
ATOM   6337  N N     . LEU B 1 218 ? -22.088 70.264  54.773  1.00 34.92  ? 218  LEU B N     1 
ATOM   6338  C CA    . LEU B 1 218 ? -23.080 69.222  54.521  1.00 34.36  ? 218  LEU B CA    1 
ATOM   6339  C C     . LEU B 1 218 ? -23.917 69.458  53.283  1.00 32.54  ? 218  LEU B C     1 
ATOM   6340  O O     . LEU B 1 218 ? -24.672 68.580  52.875  1.00 34.17  ? 218  LEU B O     1 
ATOM   6341  C CB    . LEU B 1 218 ? -23.972 69.074  55.746  1.00 33.12  ? 218  LEU B CB    1 
ATOM   6342  C CG    . LEU B 1 218 ? -23.272 68.633  57.052  1.00 34.52  ? 218  LEU B CG    1 
ATOM   6343  C CD1   . LEU B 1 218 ? -24.336 68.239  58.047  1.00 39.65  ? 218  LEU B CD1   1 
ATOM   6344  C CD2   . LEU B 1 218 ? -22.295 67.482  56.911  1.00 30.07  ? 218  LEU B CD2   1 
ATOM   6345  N N     . ASN B 1 219 ? -23.800 70.644  52.720  1.00 31.15  ? 219  ASN B N     1 
ATOM   6346  C CA    . ASN B 1 219 ? -24.458 70.998  51.465  1.00 33.13  ? 219  ASN B CA    1 
ATOM   6347  C C     . ASN B 1 219 ? -23.638 72.048  50.706  1.00 32.28  ? 219  ASN B C     1 
ATOM   6348  O O     . ASN B 1 219 ? -22.667 72.573  51.226  1.00 32.26  ? 219  ASN B O     1 
ATOM   6349  C CB    . ASN B 1 219 ? -25.914 71.492  51.689  1.00 33.97  ? 219  ASN B CB    1 
ATOM   6350  C CG    . ASN B 1 219 ? -26.007 72.772  52.554  1.00 35.45  ? 219  ASN B CG    1 
ATOM   6351  O OD1   . ASN B 1 219 ? -25.208 73.692  52.427  1.00 38.09  ? 219  ASN B OD1   1 
ATOM   6352  N ND2   . ASN B 1 219 ? -27.007 72.823  53.407  1.00 32.61  ? 219  ASN B ND2   1 
ATOM   6353  N N     . ILE B 1 220 ? -24.012 72.338  49.474  1.00 33.34  ? 220  ILE B N     1 
ATOM   6354  C CA    . ILE B 1 220 ? -23.188 73.220  48.655  1.00 35.34  ? 220  ILE B CA    1 
ATOM   6355  C C     . ILE B 1 220 ? -23.070 74.635  49.220  1.00 35.53  ? 220  ILE B C     1 
ATOM   6356  O O     . ILE B 1 220 ? -22.011 75.233  49.167  1.00 36.48  ? 220  ILE B O     1 
ATOM   6357  C CB    . ILE B 1 220 ? -23.656 73.228  47.194  1.00 34.26  ? 220  ILE B CB    1 
ATOM   6358  C CG1   . ILE B 1 220 ? -23.161 71.945  46.523  1.00 33.57  ? 220  ILE B CG1   1 
ATOM   6359  C CG2   . ILE B 1 220 ? -23.109 74.477  46.438  1.00 35.89  ? 220  ILE B CG2   1 
ATOM   6360  C CD1   . ILE B 1 220 ? -23.735 71.735  45.169  1.00 40.33  ? 220  ILE B CD1   1 
ATOM   6361  N N     . GLU B 1 221 ? -24.154 75.139  49.780  1.00 36.89  ? 221  GLU B N     1 
ATOM   6362  C CA    . GLU B 1 221 ? -24.192 76.457  50.374  1.00 37.05  ? 221  GLU B CA    1 
ATOM   6363  C C     . GLU B 1 221 ? -23.205 76.582  51.536  1.00 35.52  ? 221  GLU B C     1 
ATOM   6364  O O     . GLU B 1 221 ? -22.378 77.523  51.577  1.00 31.95  ? 221  GLU B O     1 
ATOM   6365  C CB    . GLU B 1 221 ? -25.612 76.738  50.846  1.00 37.57  ? 221  GLU B CB    1 
ATOM   6366  C CG    . GLU B 1 221 ? -25.878 78.147  51.312  1.00 43.17  ? 221  GLU B CG    1 
ATOM   6367  C CD    . GLU B 1 221 ? -27.265 78.333  51.963  1.00 48.03  ? 221  GLU B CD    1 
ATOM   6368  O OE1   . GLU B 1 221 ? -28.094 77.387  51.918  1.00 57.24  ? 221  GLU B OE1   1 
ATOM   6369  O OE2   . GLU B 1 221 ? -27.510 79.443  52.510  1.00 57.80  ? 221  GLU B OE2   1 
ATOM   6370  N N     . GLU B 1 222 ? -23.261 75.617  52.446  1.00 33.79  ? 222  GLU B N     1 
ATOM   6371  C CA    . GLU B 1 222 ? -22.302 75.541  53.539  1.00 34.49  ? 222  GLU B CA    1 
ATOM   6372  C C     . GLU B 1 222 ? -20.841 75.402  53.073  1.00 32.14  ? 222  GLU B C     1 
ATOM   6373  O O     . GLU B 1 222 ? -19.947 75.976  53.675  1.00 28.90  ? 222  GLU B O     1 
ATOM   6374  C CB    . GLU B 1 222 ? -22.623 74.366  54.433  1.00 34.07  ? 222  GLU B CB    1 
ATOM   6375  C CG    . GLU B 1 222 ? -23.921 74.482  55.187  1.00 39.42  ? 222  GLU B CG    1 
ATOM   6376  C CD    . GLU B 1 222 ? -24.044 73.409  56.245  1.00 39.74  ? 222  GLU B CD    1 
ATOM   6377  O OE1   . GLU B 1 222 ? -23.165 72.513  56.304  1.00 39.27  ? 222  GLU B OE1   1 
ATOM   6378  O OE2   . GLU B 1 222 ? -25.015 73.477  57.030  1.00 52.44  ? 222  GLU B OE2   1 
ATOM   6379  N N     . ALA B 1 223 ? -20.610 74.590  52.049  1.00 30.79  ? 223  ALA B N     1 
ATOM   6380  C CA    . ALA B 1 223 ? -19.272 74.370  51.503  1.00 32.74  ? 223  ALA B CA    1 
ATOM   6381  C C     . ALA B 1 223 ? -18.725 75.637  50.857  1.00 32.24  ? 223  ALA B C     1 
ATOM   6382  O O     . ALA B 1 223 ? -17.542 75.959  50.974  1.00 30.77  ? 223  ALA B O     1 
ATOM   6383  C CB    . ALA B 1 223 ? -19.304 73.229  50.458  1.00 32.82  ? 223  ALA B CB    1 
ATOM   6384  N N     . LYS B 1 224 ? -19.591 76.348  50.150  1.00 33.04  ? 224  LYS B N     1 
ATOM   6385  C CA    . LYS B 1 224 ? -19.214 77.627  49.542  1.00 33.83  ? 224  LYS B CA    1 
ATOM   6386  C C     . LYS B 1 224 ? -18.801 78.641  50.619  1.00 33.97  ? 224  LYS B C     1 
ATOM   6387  O O     . LYS B 1 224 ? -17.748 79.289  50.507  1.00 34.17  ? 224  LYS B O     1 
ATOM   6388  C CB    . LYS B 1 224 ? -20.365 78.213  48.712  1.00 32.43  ? 224  LYS B CB    1 
ATOM   6389  C CG    . LYS B 1 224 ? -20.078 79.623  48.148  1.00 33.89  ? 224  LYS B CG    1 
ATOM   6390  C CD    . LYS B 1 224 ? -21.163 80.048  47.180  1.00 36.37  ? 224  LYS B CD    1 
ATOM   6391  C CE    . LYS B 1 224 ? -20.895 81.422  46.601  1.00 39.08  ? 224  LYS B CE    1 
ATOM   6392  N NZ    . LYS B 1 224 ? -21.802 81.661  45.441  1.00 41.93  ? 224  LYS B NZ    1 
ATOM   6393  N N     . ASP B 1 225 ? -19.643 78.783  51.636  1.00 32.81  ? 225  ASP B N     1 
ATOM   6394  C CA    . ASP B 1 225 ? -19.318 79.612  52.802  1.00 34.10  ? 225  ASP B CA    1 
ATOM   6395  C C     . ASP B 1 225 ? -18.046 79.157  53.571  1.00 33.78  ? 225  ASP B C     1 
ATOM   6396  O O     . ASP B 1 225 ? -17.240 80.007  53.965  1.00 32.95  ? 225  ASP B O     1 
ATOM   6397  C CB    . ASP B 1 225 ? -20.513 79.718  53.753  1.00 35.25  ? 225  ASP B CB    1 
ATOM   6398  C CG    . ASP B 1 225 ? -20.296 80.776  54.862  1.00 40.86  ? 225  ASP B CG    1 
ATOM   6399  O OD1   . ASP B 1 225 ? -20.006 81.950  54.525  1.00 57.68  ? 225  ASP B OD1   1 
ATOM   6400  O OD2   . ASP B 1 225 ? -20.418 80.440  56.069  1.00 53.67  ? 225  ASP B OD2   1 
ATOM   6401  N N     . ARG B 1 226 ? -17.848 77.848  53.778  1.00 33.21  ? 226  ARG B N     1 
ATOM   6402  C CA    . ARG B 1 226 ? -16.619 77.400  54.416  1.00 35.04  ? 226  ARG B CA    1 
ATOM   6403  C C     . ARG B 1 226 ? -15.385 77.676  53.566  1.00 33.83  ? 226  ARG B C     1 
ATOM   6404  O O     . ARG B 1 226 ? -14.329 77.990  54.083  1.00 30.88  ? 226  ARG B O     1 
ATOM   6405  C CB    . ARG B 1 226 ? -16.605 75.917  54.818  1.00 34.36  ? 226  ARG B CB    1 
ATOM   6406  C CG    . ARG B 1 226 ? -15.282 75.670  55.610  1.00 37.66  ? 226  ARG B CG    1 
ATOM   6407  C CD    . ARG B 1 226 ? -15.300 74.761  56.829  1.00 41.82  ? 226  ARG B CD    1 
ATOM   6408  N NE    . ARG B 1 226 ? -16.611 74.513  57.419  1.00 47.51  ? 226  ARG B NE    1 
ATOM   6409  C CZ    . ARG B 1 226 ? -16.975 73.327  57.913  1.00 49.49  ? 226  ARG B CZ    1 
ATOM   6410  N NH1   . ARG B 1 226 ? -16.111 72.315  57.879  1.00 46.50  ? 226  ARG B NH1   1 
ATOM   6411  N NH2   . ARG B 1 226 ? -18.197 73.142  58.431  1.00 48.30  ? 226  ARG B NH2   1 
ATOM   6412  N N     . LEU B 1 227 ? -15.524 77.513  52.268  1.00 35.15  ? 227  LEU B N     1 
ATOM   6413  C CA    . LEU B 1 227 ? -14.430 77.772  51.358  1.00 36.30  ? 227  LEU B CA    1 
ATOM   6414  C C     . LEU B 1 227 ? -14.058 79.224  51.394  1.00 33.50  ? 227  LEU B C     1 
ATOM   6415  O O     . LEU B 1 227 ? -12.881 79.553  51.357  1.00 31.88  ? 227  LEU B O     1 
ATOM   6416  C CB    . LEU B 1 227 ? -14.826 77.374  49.934  1.00 37.67  ? 227  LEU B CB    1 
ATOM   6417  C CG    . LEU B 1 227 ? -13.659 77.366  48.957  1.00 41.14  ? 227  LEU B CG    1 
ATOM   6418  C CD1   . LEU B 1 227 ? -12.665 76.282  49.349  1.00 49.32  ? 227  LEU B CD1   1 
ATOM   6419  C CD2   . LEU B 1 227 ? -14.184 77.140  47.541  1.00 45.52  ? 227  LEU B CD2   1 
ATOM   6420  N N     . ARG B 1 228 ? -15.063 80.094  51.453  1.00 35.21  ? 228  ARG B N     1 
ATOM   6421  C CA    . ARG B 1 228 ? -14.823 81.548  51.570  1.00 35.88  ? 228  ARG B CA    1 
ATOM   6422  C C     . ARG B 1 228 ? -13.973 81.879  52.787  1.00 33.85  ? 228  ARG B C     1 
ATOM   6423  O O     . ARG B 1 228 ? -13.054 82.672  52.696  1.00 33.55  ? 228  ARG B O     1 
ATOM   6424  C CB    . ARG B 1 228 ? -16.140 82.329  51.654  1.00 35.83  ? 228  ARG B CB    1 
ATOM   6425  C CG    . ARG B 1 228 ? -15.985 83.872  51.654  1.00 35.38  ? 228  ARG B CG    1 
ATOM   6426  C CD    . ARG B 1 228 ? -17.306 84.555  52.067  1.00 41.29  ? 228  ARG B CD    1 
ATOM   6427  N NE    . ARG B 1 228 ? -17.751 84.167  53.416  1.00 49.48  ? 228  ARG B NE    1 
ATOM   6428  C CZ    . ARG B 1 228 ? -17.232 84.640  54.559  1.00 52.81  ? 228  ARG B CZ    1 
ATOM   6429  N NH1   . ARG B 1 228 ? -16.230 85.528  54.555  1.00 52.74  ? 228  ARG B NH1   1 
ATOM   6430  N NH2   . ARG B 1 228 ? -17.715 84.216  55.724  1.00 54.43  ? 228  ARG B NH2   1 
ATOM   6431  N N     . ILE B 1 229 ? -14.303 81.271  53.921  1.00 34.52  ? 229  ILE B N     1 
ATOM   6432  C CA    . ILE B 1 229 ? -13.616 81.564  55.182  1.00 35.12  ? 229  ILE B CA    1 
ATOM   6433  C C     . ILE B 1 229 ? -12.190 81.019  55.146  1.00 33.23  ? 229  ILE B C     1 
ATOM   6434  O O     . ILE B 1 229 ? -11.255 81.731  55.531  1.00 33.87  ? 229  ILE B O     1 
ATOM   6435  C CB    . ILE B 1 229 ? -14.425 81.042  56.428  1.00 34.94  ? 229  ILE B CB    1 
ATOM   6436  C CG1   . ILE B 1 229 ? -15.784 81.745  56.488  1.00 37.50  ? 229  ILE B CG1   1 
ATOM   6437  C CG2   . ILE B 1 229 ? -13.688 81.357  57.724  1.00 37.11  ? 229  ILE B CG2   1 
ATOM   6438  C CD1   . ILE B 1 229 ? -16.770 81.201  57.549  1.00 40.92  ? 229  ILE B CD1   1 
ATOM   6439  N N     . LEU B 1 230 ? -12.017 79.787  54.665  1.00 31.10  ? 230  LEU B N     1 
ATOM   6440  C CA    . LEU B 1 230 ? -10.704 79.166  54.623  1.00 32.50  ? 230  LEU B CA    1 
ATOM   6441  C C     . LEU B 1 230 ? -9.728  79.893  53.676  1.00 32.91  ? 230  LEU B C     1 
ATOM   6442  O O     . LEU B 1 230 ? -8.562  80.028  53.994  1.00 34.40  ? 230  LEU B O     1 
ATOM   6443  C CB    . LEU B 1 230 ? -10.818 77.697  54.264  1.00 29.48  ? 230  LEU B CB    1 
ATOM   6444  C CG    . LEU B 1 230 ? -11.502 76.787  55.288  1.00 32.90  ? 230  LEU B CG    1 
ATOM   6445  C CD1   . LEU B 1 230 ? -11.783 75.391  54.688  1.00 31.38  ? 230  LEU B CD1   1 
ATOM   6446  C CD2   . LEU B 1 230 ? -10.717 76.659  56.572  1.00 34.50  ? 230  LEU B CD2   1 
ATOM   6447  N N     . MET B 1 231 ? -10.215 80.406  52.550  1.00 32.73  ? 231  MET B N     1 
ATOM   6448  C CA    . MET B 1 231 ? -9.367  81.132  51.617  1.00 33.24  ? 231  MET B CA    1 
ATOM   6449  C C     . MET B 1 231 ? -9.015  82.500  52.157  1.00 33.90  ? 231  MET B C     1 
ATOM   6450  O O     . MET B 1 231 ? -7.941  83.014  51.882  1.00 35.79  ? 231  MET B O     1 
ATOM   6451  C CB    . MET B 1 231 ? -10.032 81.283  50.239  1.00 32.62  ? 231  MET B CB    1 
ATOM   6452  C CG    . MET B 1 231 ? -10.263 79.960  49.469  1.00 36.42  ? 231  MET B CG    1 
ATOM   6453  S SD    . MET B 1 231 ? -8.773  78.952  49.256  1.00 36.09  ? 231  MET B SD    1 
ATOM   6454  C CE    . MET B 1 231 ? -7.862  79.903  48.056  1.00 33.39  ? 231  MET B CE    1 
ATOM   6455  N N     . LEU B 1 232 ? -9.930  83.092  52.902  1.00 34.81  ? 232  LEU B N     1 
ATOM   6456  C CA    . LEU B 1 232 ? -9.692  84.373  53.544  1.00 35.92  ? 232  LEU B CA    1 
ATOM   6457  C C     . LEU B 1 232 ? -8.719  84.243  54.723  1.00 34.54  ? 232  LEU B C     1 
ATOM   6458  O O     . LEU B 1 232 ? -7.725  84.948  54.794  1.00 34.69  ? 232  LEU B O     1 
ATOM   6459  C CB    . LEU B 1 232 ? -11.035 84.951  54.023  1.00 36.74  ? 232  LEU B CB    1 
ATOM   6460  C CG    . LEU B 1 232 ? -11.018 86.300  54.738  1.00 37.87  ? 232  LEU B CG    1 
ATOM   6461  C CD1   . LEU B 1 232 ? -10.507 87.406  53.813  1.00 42.66  ? 232  LEU B CD1   1 
ATOM   6462  C CD2   . LEU B 1 232 ? -12.415 86.621  55.267  1.00 38.64  ? 232  LEU B CD2   1 
ATOM   6463  N N     . ARG B 1 233 ? -9.021  83.322  55.629  1.00 34.59  ? 233  ARG B N     1 
ATOM   6464  C CA    . ARG B 1 233 ? -8.317  83.212  56.907  1.00 34.22  ? 233  ARG B CA    1 
ATOM   6465  C C     . ARG B 1 233 ? -7.074  82.310  56.897  1.00 33.86  ? 233  ARG B C     1 
ATOM   6466  O O     . ARG B 1 233 ? -6.159  82.502  57.708  1.00 36.65  ? 233  ARG B O     1 
ATOM   6467  C CB    . ARG B 1 233 ? -9.327  82.730  57.965  1.00 35.62  ? 233  ARG B CB    1 
ATOM   6468  C CG    . ARG B 1 233 ? -10.405 83.773  58.342  1.00 39.03  ? 233  ARG B CG    1 
ATOM   6469  C CD    . ARG B 1 233 ? -9.783  85.042  59.018  1.00 47.90  ? 233  ARG B CD    1 
ATOM   6470  N NE    . ARG B 1 233 ? -8.560  84.677  59.734  1.00 51.58  ? 233  ARG B NE    1 
ATOM   6471  C CZ    . ARG B 1 233 ? -8.511  84.101  60.936  1.00 51.18  ? 233  ARG B CZ    1 
ATOM   6472  N NH1   . ARG B 1 233 ? -9.609  83.874  61.652  1.00 54.12  ? 233  ARG B NH1   1 
ATOM   6473  N NH2   . ARG B 1 233 ? -7.335  83.776  61.441  1.00 51.28  ? 233  ARG B NH2   1 
ATOM   6474  N N     . LYS B 1 234 ? -7.027  81.330  56.001  1.00 31.73  ? 234  LYS B N     1 
ATOM   6475  C CA    . LYS B 1 234 ? -5.914  80.392  55.982  1.00 32.65  ? 234  LYS B CA    1 
ATOM   6476  C C     . LYS B 1 234 ? -5.058  80.471  54.732  1.00 29.97  ? 234  LYS B C     1 
ATOM   6477  O O     . LYS B 1 234 ? -3.890  80.062  54.774  1.00 28.45  ? 234  LYS B O     1 
ATOM   6478  C CB    . LYS B 1 234 ? -6.420  78.949  56.170  1.00 32.84  ? 234  LYS B CB    1 
ATOM   6479  C CG    . LYS B 1 234 ? -6.668  78.554  57.626  1.00 42.12  ? 234  LYS B CG    1 
ATOM   6480  C CD    . LYS B 1 234 ? -6.872  77.021  57.773  1.00 43.28  ? 234  LYS B CD    1 
ATOM   6481  C CE    . LYS B 1 234 ? -5.603  76.286  58.258  1.00 51.94  ? 234  LYS B CE    1 
ATOM   6482  N NZ    . LYS B 1 234 ? -5.998  74.978  58.925  1.00 50.73  ? 234  LYS B NZ    1 
ATOM   6483  N N     . HIS B 1 235 ? -5.629  80.964  53.625  1.00 28.94  ? 235  HIS B N     1 
ATOM   6484  C CA    . HIS B 1 235 ? -4.954  80.907  52.329  1.00 28.10  ? 235  HIS B CA    1 
ATOM   6485  C C     . HIS B 1 235 ? -5.093  82.211  51.546  1.00 26.71  ? 235  HIS B C     1 
ATOM   6486  O O     . HIS B 1 235 ? -5.370  82.213  50.330  1.00 25.84  ? 235  HIS B O     1 
ATOM   6487  C CB    . HIS B 1 235 ? -5.455  79.691  51.546  1.00 27.43  ? 235  HIS B CB    1 
ATOM   6488  C CG    . HIS B 1 235 ? -5.324  78.401  52.302  1.00 30.06  ? 235  HIS B CG    1 
ATOM   6489  N ND1   . HIS B 1 235 ? -4.125  77.719  52.414  1.00 32.36  ? 235  HIS B ND1   1 
ATOM   6490  C CD2   . HIS B 1 235 ? -6.222  77.701  53.030  1.00 28.24  ? 235  HIS B CD2   1 
ATOM   6491  C CE1   . HIS B 1 235 ? -4.302  76.635  53.148  1.00 30.64  ? 235  HIS B CE1   1 
ATOM   6492  N NE2   . HIS B 1 235 ? -5.568  76.596  53.528  1.00 29.46  ? 235  HIS B NE2   1 
ATOM   6493  N N     . PRO B 1 236 ? -4.828  83.327  52.227  1.00 23.24  ? 236  PRO B N     1 
ATOM   6494  C CA    . PRO B 1 236 ? -4.882  84.602  51.534  1.00 25.46  ? 236  PRO B CA    1 
ATOM   6495  C C     . PRO B 1 236 ? -3.744  84.661  50.521  1.00 25.76  ? 236  PRO B C     1 
ATOM   6496  O O     . PRO B 1 236 ? -2.749  83.983  50.714  1.00 27.03  ? 236  PRO B O     1 
ATOM   6497  C CB    . PRO B 1 236 ? -4.660  85.621  52.647  1.00 23.86  ? 236  PRO B CB    1 
ATOM   6498  C CG    . PRO B 1 236 ? -3.928  84.859  53.755  1.00 24.49  ? 236  PRO B CG    1 
ATOM   6499  C CD    . PRO B 1 236 ? -4.409  83.446  53.634  1.00 23.16  ? 236  PRO B CD    1 
ATOM   6500  N N     . ARG B 1 237 ? -3.895  85.457  49.473  1.00 24.08  ? 237  ARG B N     1 
ATOM   6501  C CA    . ARG B 1 237 ? -2.908  85.562  48.392  1.00 25.43  ? 237  ARG B CA    1 
ATOM   6502  C C     . ARG B 1 237 ? -2.510  84.228  47.747  1.00 24.48  ? 237  ARG B C     1 
ATOM   6503  O O     . ARG B 1 237 ? -1.339  83.992  47.471  1.00 24.28  ? 237  ARG B O     1 
ATOM   6504  C CB    . ARG B 1 237 ? -1.639  86.248  48.886  1.00 26.12  ? 237  ARG B CB    1 
ATOM   6505  C CG    . ARG B 1 237 ? -1.887  87.416  49.788  1.00 25.74  ? 237  ARG B CG    1 
ATOM   6506  C CD    . ARG B 1 237 ? -0.589  88.202  49.973  1.00 28.00  ? 237  ARG B CD    1 
ATOM   6507  N NE    . ARG B 1 237 ? 0.420   87.470  50.747  1.00 28.77  ? 237  ARG B NE    1 
ATOM   6508  C CZ    . ARG B 1 237 ? 1.625   87.962  51.042  1.00 30.35  ? 237  ARG B CZ    1 
ATOM   6509  N NH1   . ARG B 1 237 ? 1.960   89.186  50.628  1.00 30.40  ? 237  ARG B NH1   1 
ATOM   6510  N NH2   . ARG B 1 237 ? 2.504   87.247  51.746  1.00 27.69  ? 237  ARG B NH2   1 
ATOM   6511  N N     . SER B 1 238 ? -3.481  83.353  47.504  1.00 25.06  ? 238  SER B N     1 
ATOM   6512  C CA    . SER B 1 238 ? -3.196  82.070  46.881  1.00 24.45  ? 238  SER B CA    1 
ATOM   6513  C C     . SER B 1 238 ? -4.057  81.883  45.678  1.00 22.40  ? 238  SER B C     1 
ATOM   6514  O O     . SER B 1 238 ? -5.010  82.638  45.456  1.00 23.19  ? 238  SER B O     1 
ATOM   6515  C CB    . SER B 1 238 ? -3.387  80.896  47.857  1.00 26.40  ? 238  SER B CB    1 
ATOM   6516  O OG    . SER B 1 238 ? -4.660  80.901  48.439  1.00 29.36  ? 238  SER B OG    1 
ATOM   6517  N N     . LEU B 1 239 ? -3.713  80.883  44.885  1.00 22.64  ? 239  LEU B N     1 
ATOM   6518  C CA    . LEU B 1 239 ? -4.467  80.556  43.683  1.00 23.34  ? 239  LEU B CA    1 
ATOM   6519  C C     . LEU B 1 239 ? -5.221  79.235  43.878  1.00 24.22  ? 239  LEU B C     1 
ATOM   6520  O O     . LEU B 1 239 ? -4.667  78.231  44.365  1.00 25.29  ? 239  LEU B O     1 
ATOM   6521  C CB    . LEU B 1 239 ? -3.512  80.455  42.493  1.00 22.36  ? 239  LEU B CB    1 
ATOM   6522  C CG    . LEU B 1 239 ? -4.125  80.165  41.118  1.00 24.38  ? 239  LEU B CG    1 
ATOM   6523  C CD1   . LEU B 1 239 ? -4.861  81.393  40.570  1.00 26.63  ? 239  LEU B CD1   1 
ATOM   6524  C CD2   . LEU B 1 239 ? -3.040  79.739  40.190  1.00 24.82  ? 239  LEU B CD2   1 
ATOM   6525  N N     . LEU B 1 240 ? -6.477  79.224  43.469  1.00 24.32  ? 240  LEU B N     1 
ATOM   6526  C CA    . LEU B 1 240 ? -7.224  77.992  43.341  1.00 27.06  ? 240  LEU B CA    1 
ATOM   6527  C C     . LEU B 1 240 ? -7.265  77.611  41.870  1.00 25.90  ? 240  LEU B C     1 
ATOM   6528  O O     . LEU B 1 240 ? -7.610  78.436  41.037  1.00 26.09  ? 240  LEU B O     1 
ATOM   6529  C CB    . LEU B 1 240 ? -8.627  78.218  43.876  1.00 28.60  ? 240  LEU B CB    1 
ATOM   6530  C CG    . LEU B 1 240 ? -9.455  77.122  44.509  1.00 34.16  ? 240  LEU B CG    1 
ATOM   6531  C CD1   . LEU B 1 240 ? -8.767  76.499  45.710  1.00 39.46  ? 240  LEU B CD1   1 
ATOM   6532  C CD2   . LEU B 1 240 ? -10.774 77.777  44.949  1.00 35.71  ? 240  LEU B CD2   1 
ATOM   6533  N N     . ILE B 1 241 ? -6.920  76.363  41.557  1.00 26.53  ? 241  ILE B N     1 
ATOM   6534  C CA    . ILE B 1 241 ? -6.961  75.855  40.173  1.00 26.63  ? 241  ILE B CA    1 
ATOM   6535  C C     . ILE B 1 241 ? -7.996  74.758  40.023  1.00 25.43  ? 241  ILE B C     1 
ATOM   6536  O O     . ILE B 1 241 ? -7.884  73.699  40.630  1.00 25.49  ? 241  ILE B O     1 
ATOM   6537  C CB    . ILE B 1 241 ? -5.603  75.286  39.687  1.00 26.32  ? 241  ILE B CB    1 
ATOM   6538  C CG1   . ILE B 1 241 ? -4.456  76.224  40.056  1.00 28.64  ? 241  ILE B CG1   1 
ATOM   6539  C CG2   . ILE B 1 241 ? -5.660  75.028  38.202  1.00 28.36  ? 241  ILE B CG2   1 
ATOM   6540  C CD1   . ILE B 1 241 ? -3.112  75.753  39.517  1.00 27.87  ? 241  ILE B CD1   1 
ATOM   6541  N N     . LEU B 1 242 ? -8.983  75.017  39.164  1.00 25.83  ? 242  LEU B N     1 
ATOM   6542  C CA    . LEU B 1 242 ? -10.129 74.145  38.956  1.00 26.29  ? 242  LEU B CA    1 
ATOM   6543  C C     . LEU B 1 242 ? -10.027 73.471  37.588  1.00 26.96  ? 242  LEU B C     1 
ATOM   6544  O O     . LEU B 1 242 ? -10.121 74.104  36.530  1.00 25.86  ? 242  LEU B O     1 
ATOM   6545  C CB    . LEU B 1 242 ? -11.422 74.956  39.051  1.00 28.12  ? 242  LEU B CB    1 
ATOM   6546  C CG    . LEU B 1 242 ? -11.651 75.854  40.278  1.00 27.37  ? 242  LEU B CG    1 
ATOM   6547  C CD1   . LEU B 1 242 ? -13.025 76.475  40.170  1.00 29.16  ? 242  LEU B CD1   1 
ATOM   6548  C CD2   . LEU B 1 242 ? -11.522 75.122  41.571  1.00 26.74  ? 242  LEU B CD2   1 
ATOM   6549  N N     . ASP B 1 243 ? -9.794  72.173  37.607  1.00 30.11  ? 243  ASP B N     1 
ATOM   6550  C CA    . ASP B 1 243 ? -9.554  71.447  36.389  1.00 31.00  ? 243  ASP B CA    1 
ATOM   6551  C C     . ASP B 1 243 ? -10.844 70.832  35.821  1.00 30.98  ? 243  ASP B C     1 
ATOM   6552  O O     . ASP B 1 243 ? -11.489 70.025  36.496  1.00 32.61  ? 243  ASP B O     1 
ATOM   6553  C CB    . ASP B 1 243 ? -8.516  70.363  36.655  1.00 33.85  ? 243  ASP B CB    1 
ATOM   6554  C CG    . ASP B 1 243 ? -8.098  69.654  35.395  1.00 36.00  ? 243  ASP B CG    1 
ATOM   6555  O OD1   . ASP B 1 243 ? -7.728  70.351  34.410  1.00 40.71  ? 243  ASP B OD1   1 
ATOM   6556  O OD2   . ASP B 1 243 ? -8.174  68.409  35.397  1.00 41.92  ? 243  ASP B OD2   1 
ATOM   6557  N N     . ASP B 1 244 ? -11.211 71.257  34.617  1.00 30.30  ? 244  ASP B N     1 
ATOM   6558  C CA    . ASP B 1 244 ? -12.345 70.749  33.866  1.00 30.87  ? 244  ASP B CA    1 
ATOM   6559  C C     . ASP B 1 244 ? -13.710 71.069  34.471  1.00 31.86  ? 244  ASP B C     1 
ATOM   6560  O O     . ASP B 1 244 ? -14.439 70.189  34.954  1.00 30.29  ? 244  ASP B O     1 
ATOM   6561  C CB    . ASP B 1 244 ? -12.195 69.252  33.610  1.00 32.33  ? 244  ASP B CB    1 
ATOM   6562  C CG    . ASP B 1 244 ? -13.043 68.758  32.422  1.00 31.92  ? 244  ASP B CG    1 
ATOM   6563  O OD1   . ASP B 1 244 ? -13.263 69.527  31.427  1.00 30.36  ? 244  ASP B OD1   1 
ATOM   6564  O OD2   . ASP B 1 244 ? -13.466 67.570  32.502  1.00 30.97  ? 244  ASP B OD2   1 
ATOM   6565  N N     . VAL B 1 245 ? -14.050 72.352  34.416  1.00 32.22  ? 245  VAL B N     1 
ATOM   6566  C CA    . VAL B 1 245 ? -15.368 72.826  34.822  1.00 31.86  ? 245  VAL B CA    1 
ATOM   6567  C C     . VAL B 1 245 ? -16.291 72.719  33.620  1.00 31.61  ? 245  VAL B C     1 
ATOM   6568  O O     . VAL B 1 245 ? -15.962 73.172  32.503  1.00 29.94  ? 245  VAL B O     1 
ATOM   6569  C CB    . VAL B 1 245 ? -15.333 74.283  35.283  1.00 30.44  ? 245  VAL B CB    1 
ATOM   6570  C CG1   . VAL B 1 245 ? -16.741 74.778  35.587  1.00 27.94  ? 245  VAL B CG1   1 
ATOM   6571  C CG2   . VAL B 1 245 ? -14.426 74.432  36.476  1.00 30.89  ? 245  VAL B CG2   1 
ATOM   6572  N N     . TRP B 1 246 ? -17.435 72.082  33.849  1.00 31.60  ? 246  TRP B N     1 
ATOM   6573  C CA    . TRP B 1 246 ? -18.433 71.840  32.788  1.00 32.66  ? 246  TRP B CA    1 
ATOM   6574  C C     . TRP B 1 246 ? -19.603 72.796  32.807  1.00 31.84  ? 246  TRP B C     1 
ATOM   6575  O O     . TRP B 1 246 ? -20.237 72.995  31.791  1.00 31.29  ? 246  TRP B O     1 
ATOM   6576  C CB    . TRP B 1 246 ? -18.989 70.405  32.895  1.00 34.38  ? 246  TRP B CB    1 
ATOM   6577  C CG    . TRP B 1 246 ? -18.119 69.357  32.335  1.00 30.61  ? 246  TRP B CG    1 
ATOM   6578  C CD1   . TRP B 1 246 ? -16.886 69.023  32.756  1.00 32.71  ? 246  TRP B CD1   1 
ATOM   6579  C CD2   . TRP B 1 246 ? -18.410 68.507  31.212  1.00 37.88  ? 246  TRP B CD2   1 
ATOM   6580  N NE1   . TRP B 1 246 ? -16.387 67.998  32.003  1.00 34.31  ? 246  TRP B NE1   1 
ATOM   6581  C CE2   . TRP B 1 246 ? -17.291 67.670  31.031  1.00 39.13  ? 246  TRP B CE2   1 
ATOM   6582  C CE3   . TRP B 1 246 ? -19.502 68.381  30.339  1.00 34.43  ? 246  TRP B CE3   1 
ATOM   6583  C CZ2   . TRP B 1 246 ? -17.229 66.692  30.028  1.00 36.51  ? 246  TRP B CZ2   1 
ATOM   6584  C CZ3   . TRP B 1 246 ? -19.446 67.417  29.337  1.00 36.50  ? 246  TRP B CZ3   1 
ATOM   6585  C CH2   . TRP B 1 246 ? -18.314 66.572  29.201  1.00 38.49  ? 246  TRP B CH2   1 
ATOM   6586  N N     . ASP B 1 247 ? -19.917 73.360  33.966  1.00 32.98  ? 247  ASP B N     1 
ATOM   6587  C CA    . ASP B 1 247 ? -21.149 74.122  34.114  1.00 33.97  ? 247  ASP B CA    1 
ATOM   6588  C C     . ASP B 1 247 ? -20.923 75.381  34.946  1.00 33.67  ? 247  ASP B C     1 
ATOM   6589  O O     . ASP B 1 247 ? -20.171 75.367  35.907  1.00 32.08  ? 247  ASP B O     1 
ATOM   6590  C CB    . ASP B 1 247 ? -22.240 73.211  34.693  1.00 35.60  ? 247  ASP B CB    1 
ATOM   6591  C CG    . ASP B 1 247 ? -22.591 72.035  33.769  1.00 37.88  ? 247  ASP B CG    1 
ATOM   6592  O OD1   . ASP B 1 247 ? -23.023 72.267  32.625  1.00 45.67  ? 247  ASP B OD1   1 
ATOM   6593  O OD2   . ASP B 1 247 ? -22.402 70.872  34.178  1.00 42.62  ? 247  ASP B OD2   1 
ATOM   6594  N N     . SER B 1 248 ? -21.577 76.467  34.536  1.00 32.43  ? 248  SER B N     1 
ATOM   6595  C CA    . SER B 1 248 ? -21.492 77.754  35.206  1.00 32.27  ? 248  SER B CA    1 
ATOM   6596  C C     . SER B 1 248 ? -21.927 77.705  36.672  1.00 31.70  ? 248  SER B C     1 
ATOM   6597  O O     . SER B 1 248 ? -21.407 78.453  37.512  1.00 29.81  ? 248  SER B O     1 
ATOM   6598  C CB    . SER B 1 248 ? -22.389 78.753  34.449  1.00 33.74  ? 248  SER B CB    1 
ATOM   6599  O OG    . SER B 1 248 ? -23.750 78.319  34.481  1.00 34.20  ? 248  SER B OG    1 
ATOM   6600  N N     . TRP B 1 249 ? -22.898 76.848  36.964  1.00 32.37  ? 249  TRP B N     1 
ATOM   6601  C CA    . TRP B 1 249 ? -23.413 76.706  38.311  1.00 32.06  ? 249  TRP B CA    1 
ATOM   6602  C C     . TRP B 1 249 ? -22.352 76.168  39.228  1.00 32.56  ? 249  TRP B C     1 
ATOM   6603  O O     . TRP B 1 249 ? -22.339 76.504  40.401  1.00 33.22  ? 249  TRP B O     1 
ATOM   6604  C CB    . TRP B 1 249 ? -24.703 75.858  38.346  1.00 33.12  ? 249  TRP B CB    1 
ATOM   6605  C CG    . TRP B 1 249 ? -24.553 74.369  38.133  1.00 33.56  ? 249  TRP B CG    1 
ATOM   6606  C CD1   . TRP B 1 249 ? -24.808 73.665  36.972  1.00 34.50  ? 249  TRP B CD1   1 
ATOM   6607  C CD2   . TRP B 1 249 ? -24.167 73.396  39.107  1.00 29.74  ? 249  TRP B CD2   1 
ATOM   6608  N NE1   . TRP B 1 249 ? -24.574 72.327  37.171  1.00 35.29  ? 249  TRP B NE1   1 
ATOM   6609  C CE2   . TRP B 1 249 ? -24.177 72.135  38.469  1.00 30.67  ? 249  TRP B CE2   1 
ATOM   6610  C CE3   . TRP B 1 249 ? -23.776 73.467  40.453  1.00 37.54  ? 249  TRP B CE3   1 
ATOM   6611  C CZ2   . TRP B 1 249 ? -23.848 70.967  39.133  1.00 32.98  ? 249  TRP B CZ2   1 
ATOM   6612  C CZ3   . TRP B 1 249 ? -23.419 72.296  41.105  1.00 37.35  ? 249  TRP B CZ3   1 
ATOM   6613  C CH2   . TRP B 1 249 ? -23.464 71.063  40.441  1.00 34.11  ? 249  TRP B CH2   1 
ATOM   6614  N N     . VAL B 1 250 ? -21.444 75.356  38.692  1.00 33.11  ? 250  VAL B N     1 
ATOM   6615  C CA    . VAL B 1 250 ? -20.338 74.824  39.478  1.00 32.52  ? 250  VAL B CA    1 
ATOM   6616  C C     . VAL B 1 250 ? -19.390 75.942  39.906  1.00 31.77  ? 250  VAL B C     1 
ATOM   6617  O O     . VAL B 1 250 ? -18.904 75.947  41.037  1.00 28.84  ? 250  VAL B O     1 
ATOM   6618  C CB    . VAL B 1 250 ? -19.541 73.792  38.680  1.00 32.11  ? 250  VAL B CB    1 
ATOM   6619  C CG1   . VAL B 1 250 ? -18.250 73.429  39.398  1.00 33.77  ? 250  VAL B CG1   1 
ATOM   6620  C CG2   . VAL B 1 250 ? -20.398 72.558  38.445  1.00 36.45  ? 250  VAL B CG2   1 
ATOM   6621  N N     . LEU B 1 251 ? -19.125 76.873  38.984  1.00 31.67  ? 251  LEU B N     1 
ATOM   6622  C CA    . LEU B 1 251 ? -18.264 78.024  39.262  1.00 33.93  ? 251  LEU B CA    1 
ATOM   6623  C C     . LEU B 1 251 ? -18.807 78.954  40.331  1.00 35.74  ? 251  LEU B C     1 
ATOM   6624  O O     . LEU B 1 251 ? -18.035 79.592  41.038  1.00 35.73  ? 251  LEU B O     1 
ATOM   6625  C CB    . LEU B 1 251 ? -18.037 78.861  38.008  1.00 34.41  ? 251  LEU B CB    1 
ATOM   6626  C CG    . LEU B 1 251 ? -16.883 78.413  37.111  1.00 36.01  ? 251  LEU B CG    1 
ATOM   6627  C CD1   . LEU B 1 251 ? -16.577 79.543  36.161  1.00 33.60  ? 251  LEU B CD1   1 
ATOM   6628  C CD2   . LEU B 1 251 ? -15.645 78.060  37.886  1.00 32.18  ? 251  LEU B CD2   1 
ATOM   6629  N N     . LYS B 1 252 ? -20.131 79.059  40.420  1.00 37.04  ? 252  LYS B N     1 
ATOM   6630  C CA    . LYS B 1 252 ? -20.784 79.823  41.474  1.00 37.98  ? 252  LYS B CA    1 
ATOM   6631  C C     . LYS B 1 252 ? -20.467 79.308  42.867  1.00 37.31  ? 252  LYS B C     1 
ATOM   6632  O O     . LYS B 1 252 ? -20.408 80.076  43.833  1.00 37.59  ? 252  LYS B O     1 
ATOM   6633  C CB    . LYS B 1 252 ? -22.306 79.779  41.299  1.00 39.01  ? 252  LYS B CB    1 
ATOM   6634  C CG    . LYS B 1 252 ? -22.810 80.638  40.163  1.00 44.87  ? 252  LYS B CG    1 
ATOM   6635  C CD    . LYS B 1 252 ? -24.330 80.918  40.253  1.00 46.21  ? 252  LYS B CD    1 
ATOM   6636  C CE    . LYS B 1 252 ? -25.193 79.702  39.910  1.00 52.63  ? 252  LYS B CE    1 
ATOM   6637  N NZ    . LYS B 1 252 ? -26.363 80.006  39.005  1.00 51.53  ? 252  LYS B NZ    1 
ATOM   6638  N N     . ALA B 1 253 ? -20.290 78.000  42.979  1.00 34.94  ? 253  ALA B N     1 
ATOM   6639  C CA    . ALA B 1 253 ? -19.915 77.391  44.241  1.00 36.10  ? 253  ALA B CA    1 
ATOM   6640  C C     . ALA B 1 253 ? -18.533 77.835  44.708  1.00 35.59  ? 253  ALA B C     1 
ATOM   6641  O O     . ALA B 1 253 ? -18.252 77.777  45.895  1.00 36.76  ? 253  ALA B O     1 
ATOM   6642  C CB    . ALA B 1 253 ? -20.002 75.865  44.141  1.00 35.02  ? 253  ALA B CB    1 
ATOM   6643  N N     . PHE B 1 254 ? -17.688 78.296  43.782  1.00 36.27  ? 254  PHE B N     1 
ATOM   6644  C CA    . PHE B 1 254 ? -16.339 78.818  44.086  1.00 36.29  ? 254  PHE B CA    1 
ATOM   6645  C C     . PHE B 1 254 ? -16.236 80.357  44.038  1.00 36.96  ? 254  PHE B C     1 
ATOM   6646  O O     . PHE B 1 254 ? -15.143 80.919  44.144  1.00 36.19  ? 254  PHE B O     1 
ATOM   6647  C CB    . PHE B 1 254 ? -15.339 78.230  43.081  1.00 35.50  ? 254  PHE B CB    1 
ATOM   6648  C CG    . PHE B 1 254 ? -15.189 76.738  43.188  1.00 35.31  ? 254  PHE B CG    1 
ATOM   6649  C CD1   . PHE B 1 254 ? -14.284 76.186  44.077  1.00 26.10  ? 254  PHE B CD1   1 
ATOM   6650  C CD2   . PHE B 1 254 ? -15.965 75.889  42.410  1.00 34.15  ? 254  PHE B CD2   1 
ATOM   6651  C CE1   . PHE B 1 254 ? -14.150 74.829  44.189  1.00 29.74  ? 254  PHE B CE1   1 
ATOM   6652  C CE2   . PHE B 1 254 ? -15.826 74.504  42.512  1.00 34.77  ? 254  PHE B CE2   1 
ATOM   6653  C CZ    . PHE B 1 254 ? -14.926 73.978  43.409  1.00 29.58  ? 254  PHE B CZ    1 
ATOM   6654  N N     . ASP B 1 255 ? -17.365 81.039  43.878  1.00 38.14  ? 255  ASP B N     1 
ATOM   6655  C CA    . ASP B 1 255 ? -17.357 82.495  43.755  1.00 38.96  ? 255  ASP B CA    1 
ATOM   6656  C C     . ASP B 1 255 ? -17.276 83.180  45.136  1.00 40.30  ? 255  ASP B C     1 
ATOM   6657  O O     . ASP B 1 255 ? -18.274 83.740  45.621  1.00 41.59  ? 255  ASP B O     1 
ATOM   6658  C CB    . ASP B 1 255 ? -18.613 82.949  42.987  1.00 40.10  ? 255  ASP B CB    1 
ATOM   6659  C CG    . ASP B 1 255 ? -18.547 84.403  42.561  1.00 40.10  ? 255  ASP B CG    1 
ATOM   6660  O OD1   . ASP B 1 255 ? -17.475 85.034  42.729  1.00 49.30  ? 255  ASP B OD1   1 
ATOM   6661  O OD2   . ASP B 1 255 ? -19.564 84.915  42.042  1.00 45.75  ? 255  ASP B OD2   1 
ATOM   6662  N N     . SER B 1 256 ? -16.087 83.169  45.742  1.00 39.67  ? 256  SER B N     1 
ATOM   6663  C CA    . SER B 1 256 ? -15.916 83.586  47.133  1.00 39.32  ? 256  SER B CA    1 
ATOM   6664  C C     . SER B 1 256 ? -14.721 84.530  47.380  1.00 39.58  ? 256  SER B C     1 
ATOM   6665  O O     . SER B 1 256 ? -14.005 84.398  48.383  1.00 38.09  ? 256  SER B O     1 
ATOM   6666  C CB    . SER B 1 256 ? -15.797 82.334  48.011  1.00 42.26  ? 256  SER B CB    1 
ATOM   6667  O OG    . SER B 1 256 ? -16.919 81.455  47.844  1.00 43.27  ? 256  SER B OG    1 
ATOM   6668  N N     . GLN B 1 257 ? -14.560 85.510  46.481  1.00 37.65  ? 257  GLN B N     1 
ATOM   6669  C CA    . GLN B 1 257 ? -13.497 86.513  46.529  1.00 35.97  ? 257  GLN B CA    1 
ATOM   6670  C C     . GLN B 1 257 ? -12.115 85.874  46.416  1.00 33.91  ? 257  GLN B C     1 
ATOM   6671  O O     . GLN B 1 257 ? -11.201 86.272  47.112  1.00 32.26  ? 257  GLN B O     1 
ATOM   6672  C CB    . GLN B 1 257 ? -13.564 87.403  47.778  1.00 36.36  ? 257  GLN B CB    1 
ATOM   6673  C CG    . GLN B 1 257 ? -14.731 88.340  47.800  1.00 43.57  ? 257  GLN B CG    1 
ATOM   6674  C CD    . GLN B 1 257 ? -15.987 87.640  48.230  1.00 50.64  ? 257  GLN B CD    1 
ATOM   6675  O OE1   . GLN B 1 257 ? -16.043 87.076  49.331  1.00 52.94  ? 257  GLN B OE1   1 
ATOM   6676  N NE2   . GLN B 1 257 ? -17.002 87.654  47.367  1.00 47.62  ? 257  GLN B NE2   1 
ATOM   6677  N N     . CYS B 1 258 ? -11.996 84.898  45.517  1.00 32.17  ? 258  CYS B N     1 
ATOM   6678  C CA    . CYS B 1 258 ? -10.763 84.149  45.269  1.00 30.57  ? 258  CYS B CA    1 
ATOM   6679  C C     . CYS B 1 258 ? -10.110 84.507  43.948  1.00 27.68  ? 258  CYS B C     1 
ATOM   6680  O O     . CYS B 1 258 ? -10.714 85.118  43.082  1.00 26.86  ? 258  CYS B O     1 
ATOM   6681  C CB    . CYS B 1 258 ? -11.058 82.662  45.196  1.00 31.23  ? 258  CYS B CB    1 
ATOM   6682  S SG    . CYS B 1 258 ? -11.484 81.954  46.720  1.00 44.32  ? 258  CYS B SG    1 
ATOM   6683  N N     . GLN B 1 259 ? -8.850  84.107  43.819  1.00 28.52  ? 259  GLN B N     1 
ATOM   6684  C CA    . GLN B 1 259 ? -8.126  84.144  42.559  1.00 28.62  ? 259  GLN B CA    1 
ATOM   6685  C C     . GLN B 1 259 ? -8.189  82.730  41.990  1.00 27.95  ? 259  GLN B C     1 
ATOM   6686  O O     . GLN B 1 259 ? -7.765  81.780  42.634  1.00 26.64  ? 259  GLN B O     1 
ATOM   6687  C CB    . GLN B 1 259 ? -6.668  84.535  42.782  1.00 28.93  ? 259  GLN B CB    1 
ATOM   6688  C CG    . GLN B 1 259 ? -6.469  85.970  43.195  1.00 32.15  ? 259  GLN B CG    1 
ATOM   6689  C CD    . GLN B 1 259 ? -5.029  86.277  43.519  1.00 27.19  ? 259  GLN B CD    1 
ATOM   6690  O OE1   . GLN B 1 259 ? -4.293  86.776  42.677  1.00 34.26  ? 259  GLN B OE1   1 
ATOM   6691  N NE2   . GLN B 1 259 ? -4.621  85.992  44.741  1.00 24.72  ? 259  GLN B NE2   1 
ATOM   6692  N N     . ILE B 1 260 ? -8.758  82.592  40.799  1.00 27.47  ? 260  ILE B N     1 
ATOM   6693  C CA    . ILE B 1 260 ? -9.053  81.265  40.238  1.00 28.24  ? 260  ILE B CA    1 
ATOM   6694  C C     . ILE B 1 260 ? -8.589  81.103  38.794  1.00 26.29  ? 260  ILE B C     1 
ATOM   6695  O O     . ILE B 1 260 ? -8.871  81.936  37.927  1.00 25.75  ? 260  ILE B O     1 
ATOM   6696  C CB    . ILE B 1 260 ? -10.550 80.906  40.354  1.00 26.78  ? 260  ILE B CB    1 
ATOM   6697  C CG1   . ILE B 1 260 ? -10.937 80.928  41.842  1.00 31.10  ? 260  ILE B CG1   1 
ATOM   6698  C CG2   . ILE B 1 260 ? -10.818 79.541  39.699  1.00 28.72  ? 260  ILE B CG2   1 
ATOM   6699  C CD1   . ILE B 1 260 ? -12.297 80.374  42.191  1.00 32.45  ? 260  ILE B CD1   1 
ATOM   6700  N N     . LEU B 1 261 ? -7.824  80.040  38.587  1.00 26.14  ? 261  LEU B N     1 
ATOM   6701  C CA    . LEU B 1 261 ? -7.463  79.544  37.288  1.00 26.73  ? 261  LEU B CA    1 
ATOM   6702  C C     . LEU B 1 261 ? -8.289  78.290  37.061  1.00 26.75  ? 261  LEU B C     1 
ATOM   6703  O O     . LEU B 1 261 ? -8.321  77.424  37.901  1.00 24.95  ? 261  LEU B O     1 
ATOM   6704  C CB    . LEU B 1 261 ? -6.002  79.160  37.270  1.00 25.24  ? 261  LEU B CB    1 
ATOM   6705  C CG    . LEU B 1 261 ? -5.495  78.573  35.956  1.00 23.75  ? 261  LEU B CG    1 
ATOM   6706  C CD1   . LEU B 1 261 ? -5.524  79.628  34.852  1.00 25.73  ? 261  LEU B CD1   1 
ATOM   6707  C CD2   . LEU B 1 261 ? -4.073  78.053  36.191  1.00 29.26  ? 261  LEU B CD2   1 
ATOM   6708  N N     . LEU B 1 262 ? -8.959  78.204  35.923  1.00 27.61  ? 262  LEU B N     1 
ATOM   6709  C CA    . LEU B 1 262 ? -9.735  77.030  35.601  1.00 28.08  ? 262  LEU B CA    1 
ATOM   6710  C C     . LEU B 1 262 ? -9.506  76.623  34.148  1.00 27.19  ? 262  LEU B C     1 
ATOM   6711  O O     . LEU B 1 262 ? -9.147  77.428  33.309  1.00 27.43  ? 262  LEU B O     1 
ATOM   6712  C CB    . LEU B 1 262 ? -11.227 77.268  35.854  1.00 28.90  ? 262  LEU B CB    1 
ATOM   6713  C CG    . LEU B 1 262 ? -11.877 78.432  35.081  1.00 30.37  ? 262  LEU B CG    1 
ATOM   6714  C CD1   . LEU B 1 262 ? -13.114 78.007  34.336  1.00 31.71  ? 262  LEU B CD1   1 
ATOM   6715  C CD2   . LEU B 1 262 ? -12.187 79.576  36.036  1.00 33.83  ? 262  LEU B CD2   1 
ATOM   6716  N N     . THR B 1 263 ? -9.720  75.341  33.886  1.00 29.42  ? 263  THR B N     1 
ATOM   6717  C CA    . THR B 1 263 ? -9.748  74.794  32.531  1.00 29.14  ? 263  THR B CA    1 
ATOM   6718  C C     . THR B 1 263 ? -11.179 74.330  32.216  1.00 27.35  ? 263  THR B C     1 
ATOM   6719  O O     . THR B 1 263 ? -11.907 73.873  33.105  1.00 24.07  ? 263  THR B O     1 
ATOM   6720  C CB    . THR B 1 263 ? -8.801  73.579  32.369  1.00 28.01  ? 263  THR B CB    1 
ATOM   6721  O OG1   . THR B 1 263 ? -9.255  72.511  33.208  1.00 27.77  ? 263  THR B OG1   1 
ATOM   6722  C CG2   . THR B 1 263 ? -7.368  73.935  32.697  1.00 29.87  ? 263  THR B CG2   1 
ATOM   6723  N N     . THR B 1 264 ? -11.553 74.449  30.953  1.00 26.89  ? 264  THR B N     1 
ATOM   6724  C CA    . THR B 1 264 ? -12.895 74.101  30.511  1.00 30.26  ? 264  THR B CA    1 
ATOM   6725  C C     . THR B 1 264 ? -12.930 73.874  28.984  1.00 31.37  ? 264  THR B C     1 
ATOM   6726  O O     . THR B 1 264 ? -12.144 74.469  28.217  1.00 28.61  ? 264  THR B O     1 
ATOM   6727  C CB    . THR B 1 264 ? -13.913 75.191  30.896  1.00 29.78  ? 264  THR B CB    1 
ATOM   6728  O OG1   . THR B 1 264 ? -15.245 74.764  30.568  1.00 31.26  ? 264  THR B OG1   1 
ATOM   6729  C CG2   . THR B 1 264 ? -13.606 76.519  30.162  1.00 34.57  ? 264  THR B CG2   1 
ATOM   6730  N N     . ARG B 1 265 ? -13.841 73.009  28.553  1.00 33.47  ? 265  ARG B N     1 
ATOM   6731  C CA    . ARG B 1 265 ? -14.137 72.865  27.114  1.00 36.51  ? 265  ARG B CA    1 
ATOM   6732  C C     . ARG B 1 265 ? -15.102 73.942  26.642  1.00 36.77  ? 265  ARG B C     1 
ATOM   6733  O O     . ARG B 1 265 ? -15.205 74.174  25.432  1.00 38.31  ? 265  ARG B O     1 
ATOM   6734  C CB    . ARG B 1 265 ? -14.732 71.499  26.796  1.00 36.72  ? 265  ARG B CB    1 
ATOM   6735  C CG    . ARG B 1 265 ? -14.054 70.310  27.510  1.00 42.74  ? 265  ARG B CG    1 
ATOM   6736  C CD    . ARG B 1 265 ? -14.977 69.070  27.501  1.00 42.92  ? 265  ARG B CD    1 
ATOM   6737  N NE    . ARG B 1 265 ? -14.368 67.982  28.254  1.00 53.54  ? 265  ARG B NE    1 
ATOM   6738  C CZ    . ARG B 1 265 ? -14.483 66.684  27.970  1.00 63.10  ? 265  ARG B CZ    1 
ATOM   6739  N NH1   . ARG B 1 265 ? -15.188 66.275  26.912  1.00 61.02  ? 265  ARG B NH1   1 
ATOM   6740  N NH2   . ARG B 1 265 ? -13.862 65.786  28.744  1.00 63.86  ? 265  ARG B NH2   1 
ATOM   6741  N N     . ASP B 1 266 ? -15.791 74.590  27.592  1.00 38.00  ? 266  ASP B N     1 
ATOM   6742  C CA    . ASP B 1 266 ? -16.836 75.590  27.312  1.00 38.49  ? 266  ASP B CA    1 
ATOM   6743  C C     . ASP B 1 266 ? -16.517 76.933  27.968  1.00 38.38  ? 266  ASP B C     1 
ATOM   6744  O O     . ASP B 1 266 ? -16.760 77.131  29.141  1.00 35.60  ? 266  ASP B O     1 
ATOM   6745  C CB    . ASP B 1 266 ? -18.209 75.076  27.793  1.00 38.32  ? 266  ASP B CB    1 
ATOM   6746  C CG    . ASP B 1 266 ? -19.377 75.974  27.363  1.00 41.01  ? 266  ASP B CG    1 
ATOM   6747  O OD1   . ASP B 1 266 ? -19.130 77.032  26.744  1.00 47.18  ? 266  ASP B OD1   1 
ATOM   6748  O OD2   . ASP B 1 266 ? -20.556 75.616  27.638  1.00 45.40  ? 266  ASP B OD2   1 
ATOM   6749  N N     . LYS B 1 267 ? -16.017 77.865  27.173  1.00 40.50  ? 267  LYS B N     1 
ATOM   6750  C CA    . LYS B 1 267 ? -15.732 79.240  27.616  1.00 40.46  ? 267  LYS B CA    1 
ATOM   6751  C C     . LYS B 1 267 ? -16.923 79.958  28.313  1.00 40.15  ? 267  LYS B C     1 
ATOM   6752  O O     . LYS B 1 267 ? -16.705 80.902  29.091  1.00 39.80  ? 267  LYS B O     1 
ATOM   6753  C CB    . LYS B 1 267 ? -15.217 80.036  26.400  1.00 42.10  ? 267  LYS B CB    1 
ATOM   6754  C CG    . LYS B 1 267 ? -15.416 81.553  26.428  1.00 46.06  ? 267  LYS B CG    1 
ATOM   6755  C CD    . LYS B 1 267 ? -14.472 82.278  25.490  1.00 42.71  ? 267  LYS B CD    1 
ATOM   6756  C CE    . LYS B 1 267 ? -14.716 83.783  25.558  1.00 51.46  ? 267  LYS B CE    1 
ATOM   6757  N NZ    . LYS B 1 267 ? -13.599 84.626  25.025  1.00 52.65  ? 267  LYS B NZ    1 
ATOM   6758  N N     . SER B 1 268 ? -18.159 79.496  28.073  1.00 37.89  ? 268  SER B N     1 
ATOM   6759  C CA    . SER B 1 268 ? -19.339 80.149  28.652  1.00 37.36  ? 268  SER B CA    1 
ATOM   6760  C C     . SER B 1 268 ? -19.591 79.812  30.122  1.00 36.22  ? 268  SER B C     1 
ATOM   6761  O O     . SER B 1 268 ? -20.517 80.354  30.730  1.00 37.34  ? 268  SER B O     1 
ATOM   6762  C CB    . SER B 1 268 ? -20.602 79.832  27.836  1.00 40.02  ? 268  SER B CB    1 
ATOM   6763  O OG    . SER B 1 268 ? -21.309 78.707  28.382  1.00 46.31  ? 268  SER B OG    1 
ATOM   6764  N N     . VAL B 1 269 ? -18.776 78.942  30.717  1.00 34.25  ? 269  VAL B N     1 
ATOM   6765  C CA    . VAL B 1 269 ? -18.980 78.569  32.123  1.00 35.39  ? 269  VAL B CA    1 
ATOM   6766  C C     . VAL B 1 269 ? -18.803 79.751  33.093  1.00 34.64  ? 269  VAL B C     1 
ATOM   6767  O O     . VAL B 1 269 ? -19.214 79.681  34.250  1.00 34.23  ? 269  VAL B O     1 
ATOM   6768  C CB    . VAL B 1 269 ? -18.039 77.425  32.598  1.00 35.14  ? 269  VAL B CB    1 
ATOM   6769  C CG1   . VAL B 1 269 ? -18.347 76.126  31.853  1.00 39.39  ? 269  VAL B CG1   1 
ATOM   6770  C CG2   . VAL B 1 269 ? -16.571 77.833  32.457  1.00 33.53  ? 269  VAL B CG2   1 
ATOM   6771  N N     . THR B 1 270 ? -18.209 80.840  32.617  1.00 33.53  ? 270  THR B N     1 
ATOM   6772  C CA    . THR B 1 270 ? -17.939 81.995  33.475  1.00 35.51  ? 270  THR B CA    1 
ATOM   6773  C C     . THR B 1 270 ? -19.068 83.026  33.477  1.00 36.40  ? 270  THR B C     1 
ATOM   6774  O O     . THR B 1 270 ? -18.931 84.088  34.092  1.00 35.05  ? 270  THR B O     1 
ATOM   6775  C CB    . THR B 1 270 ? -16.591 82.700  33.088  1.00 35.16  ? 270  THR B CB    1 
ATOM   6776  O OG1   . THR B 1 270 ? -16.514 82.913  31.673  1.00 37.02  ? 270  THR B OG1   1 
ATOM   6777  C CG2   . THR B 1 270 ? -15.403 81.868  33.519  1.00 32.57  ? 270  THR B CG2   1 
ATOM   6778  N N     . ASP B 1 271 ? -20.185 82.708  32.818  1.00 37.81  ? 271  ASP B N     1 
ATOM   6779  C CA    . ASP B 1 271 ? -21.270 83.682  32.599  1.00 38.76  ? 271  ASP B CA    1 
ATOM   6780  C C     . ASP B 1 271 ? -22.031 84.069  33.862  1.00 37.89  ? 271  ASP B C     1 
ATOM   6781  O O     . ASP B 1 271 ? -22.487 85.194  33.979  1.00 38.19  ? 271  ASP B O     1 
ATOM   6782  C CB    . ASP B 1 271 ? -22.245 83.177  31.528  1.00 39.80  ? 271  ASP B CB    1 
ATOM   6783  C CG    . ASP B 1 271 ? -21.675 83.275  30.128  1.00 39.12  ? 271  ASP B CG    1 
ATOM   6784  O OD1   . ASP B 1 271 ? -20.670 83.979  29.929  1.00 42.32  ? 271  ASP B OD1   1 
ATOM   6785  O OD2   . ASP B 1 271 ? -22.247 82.652  29.211  1.00 54.00  ? 271  ASP B OD2   1 
ATOM   6786  N N     . SER B 1 272 ? -22.156 83.157  34.808  1.00 39.27  ? 272  SER B N     1 
ATOM   6787  C CA    . SER B 1 272 ? -22.952 83.406  36.013  1.00 41.53  ? 272  SER B CA    1 
ATOM   6788  C C     . SER B 1 272 ? -22.096 84.034  37.113  1.00 43.45  ? 272  SER B C     1 
ATOM   6789  O O     . SER B 1 272 ? -22.545 84.188  38.261  1.00 44.07  ? 272  SER B O     1 
ATOM   6790  C CB    . SER B 1 272 ? -23.506 82.078  36.525  1.00 43.11  ? 272  SER B CB    1 
ATOM   6791  O OG    . SER B 1 272 ? -22.429 81.195  36.826  1.00 43.95  ? 272  SER B OG    1 
ATOM   6792  N N     . VAL B 1 273 ? -20.868 84.402  36.746  1.00 43.14  ? 273  VAL B N     1 
ATOM   6793  C CA    . VAL B 1 273 ? -19.856 84.806  37.684  1.00 42.18  ? 273  VAL B CA    1 
ATOM   6794  C C     . VAL B 1 273 ? -19.323 86.165  37.252  1.00 41.44  ? 273  VAL B C     1 
ATOM   6795  O O     . VAL B 1 273 ? -19.381 86.501  36.075  1.00 39.50  ? 273  VAL B O     1 
ATOM   6796  C CB    . VAL B 1 273 ? -18.787 83.648  37.754  1.00 44.08  ? 273  VAL B CB    1 
ATOM   6797  C CG1   . VAL B 1 273 ? -17.403 84.076  37.298  1.00 40.99  ? 273  VAL B CG1   1 
ATOM   6798  C CG2   . VAL B 1 273 ? -18.802 82.997  39.136  1.00 45.04  ? 273  VAL B CG2   1 
ATOM   6799  N N     . MET B 1 274 ? -18.834 86.956  38.202  1.00 42.30  ? 274  MET B N     1 
ATOM   6800  C CA    . MET B 1 274 ? -18.421 88.332  37.909  1.00 43.21  ? 274  MET B CA    1 
ATOM   6801  C C     . MET B 1 274 ? -17.059 88.679  38.469  1.00 41.77  ? 274  MET B C     1 
ATOM   6802  O O     . MET B 1 274 ? -16.514 87.952  39.289  1.00 46.06  ? 274  MET B O     1 
ATOM   6803  C CB    . MET B 1 274 ? -19.451 89.287  38.449  1.00 44.68  ? 274  MET B CB    1 
ATOM   6804  C CG    . MET B 1 274 ? -20.803 88.969  37.896  1.00 48.96  ? 274  MET B CG    1 
ATOM   6805  S SD    . MET B 1 274 ? -21.888 90.282  38.266  1.00 62.47  ? 274  MET B SD    1 
ATOM   6806  C CE    . MET B 1 274 ? -21.047 91.633  37.403  1.00 64.87  ? 274  MET B CE    1 
ATOM   6807  N N     . GLY B 1 275 ? -16.531 89.813  38.027  1.00 39.15  ? 275  GLY B N     1 
ATOM   6808  C CA    . GLY B 1 275 ? -15.199 90.268  38.413  1.00 36.44  ? 275  GLY B CA    1 
ATOM   6809  C C     . GLY B 1 275 ? -14.343 90.167  37.182  1.00 33.93  ? 275  GLY B C     1 
ATOM   6810  O O     . GLY B 1 275 ? -14.873 89.830  36.129  1.00 32.37  ? 275  GLY B O     1 
ATOM   6811  N N     . PRO B 1 276 ? -13.037 90.516  37.290  1.00 32.52  ? 276  PRO B N     1 
ATOM   6812  C CA    . PRO B 1 276 ? -12.095 90.443  36.159  1.00 30.87  ? 276  PRO B CA    1 
ATOM   6813  C C     . PRO B 1 276 ? -12.041 89.028  35.580  1.00 29.84  ? 276  PRO B C     1 
ATOM   6814  O O     . PRO B 1 276 ? -11.953 88.065  36.329  1.00 28.82  ? 276  PRO B O     1 
ATOM   6815  C CB    . PRO B 1 276 ? -10.761 90.827  36.785  1.00 31.37  ? 276  PRO B CB    1 
ATOM   6816  C CG    . PRO B 1 276 ? -11.104 91.582  38.020  1.00 31.04  ? 276  PRO B CG    1 
ATOM   6817  C CD    . PRO B 1 276 ? -12.395 91.040  38.510  1.00 30.68  ? 276  PRO B CD    1 
ATOM   6818  N N     . LYS B 1 277 ? -12.106 88.935  34.257  1.00 28.84  ? 277  LYS B N     1 
ATOM   6819  C CA    . LYS B 1 277 ? -12.124 87.667  33.510  1.00 29.74  ? 277  LYS B CA    1 
ATOM   6820  C C     . LYS B 1 277 ? -11.135 87.718  32.352  1.00 28.86  ? 277  LYS B C     1 
ATOM   6821  O O     . LYS B 1 277 ? -11.256 88.565  31.473  1.00 31.43  ? 277  LYS B O     1 
ATOM   6822  C CB    . LYS B 1 277 ? -13.516 87.379  32.925  1.00 28.55  ? 277  LYS B CB    1 
ATOM   6823  C CG    . LYS B 1 277 ? -14.552 86.858  33.921  1.00 31.05  ? 277  LYS B CG    1 
ATOM   6824  C CD    . LYS B 1 277 ? -15.919 86.902  33.256  1.00 32.26  ? 277  LYS B CD    1 
ATOM   6825  C CE    . LYS B 1 277 ? -17.029 86.620  34.219  1.00 37.22  ? 277  LYS B CE    1 
ATOM   6826  N NZ    . LYS B 1 277 ? -18.352 86.647  33.541  1.00 35.93  ? 277  LYS B NZ    1 
ATOM   6827  N N     . TYR B 1 278 ? -10.164 86.812  32.382  1.00 28.03  ? 278  TYR B N     1 
ATOM   6828  C CA    . TYR B 1 278 ? -9.146  86.687  31.367  1.00 29.33  ? 278  TYR B CA    1 
ATOM   6829  C C     . TYR B 1 278 ? -9.254  85.290  30.779  1.00 30.28  ? 278  TYR B C     1 
ATOM   6830  O O     . TYR B 1 278 ? -9.563  84.318  31.498  1.00 31.40  ? 278  TYR B O     1 
ATOM   6831  C CB    . TYR B 1 278 ? -7.759  86.902  31.984  1.00 31.46  ? 278  TYR B CB    1 
ATOM   6832  C CG    . TYR B 1 278 ? -7.664  88.178  32.792  1.00 33.68  ? 278  TYR B CG    1 
ATOM   6833  C CD1   . TYR B 1 278 ? -7.510  89.415  32.172  1.00 35.45  ? 278  TYR B CD1   1 
ATOM   6834  C CD2   . TYR B 1 278 ? -7.764  88.158  34.172  1.00 33.32  ? 278  TYR B CD2   1 
ATOM   6835  C CE1   . TYR B 1 278 ? -7.450  90.596  32.916  1.00 31.29  ? 278  TYR B CE1   1 
ATOM   6836  C CE2   . TYR B 1 278 ? -7.706  89.338  34.911  1.00 31.68  ? 278  TYR B CE2   1 
ATOM   6837  C CZ    . TYR B 1 278 ? -7.560  90.547  34.279  1.00 34.52  ? 278  TYR B CZ    1 
ATOM   6838  O OH    . TYR B 1 278 ? -7.495  91.709  35.029  1.00 36.07  ? 278  TYR B OH    1 
ATOM   6839  N N     . VAL B 1 279 ? -8.993  85.194  29.479  1.00 30.74  ? 279  VAL B N     1 
ATOM   6840  C CA    . VAL B 1 279 ? -9.168  83.957  28.722  1.00 31.34  ? 279  VAL B CA    1 
ATOM   6841  C C     . VAL B 1 279 ? -7.928  83.608  27.893  1.00 29.59  ? 279  VAL B C     1 
ATOM   6842  O O     . VAL B 1 279 ? -7.315  84.460  27.279  1.00 31.51  ? 279  VAL B O     1 
ATOM   6843  C CB    . VAL B 1 279 ? -10.432 84.021  27.816  1.00 32.84  ? 279  VAL B CB    1 
ATOM   6844  C CG1   . VAL B 1 279 ? -10.650 82.687  27.117  1.00 39.52  ? 279  VAL B CG1   1 
ATOM   6845  C CG2   . VAL B 1 279 ? -11.650 84.329  28.644  1.00 34.18  ? 279  VAL B CG2   1 
ATOM   6846  N N     . VAL B 1 280 ? -7.557  82.343  27.897  1.00 30.00  ? 280  VAL B N     1 
ATOM   6847  C CA    . VAL B 1 280 ? -6.526  81.825  27.018  1.00 30.24  ? 280  VAL B CA    1 
ATOM   6848  C C     . VAL B 1 280 ? -7.126  80.676  26.190  1.00 29.33  ? 280  VAL B C     1 
ATOM   6849  O O     . VAL B 1 280 ? -7.425  79.610  26.702  1.00 27.55  ? 280  VAL B O     1 
ATOM   6850  C CB    . VAL B 1 280 ? -5.281  81.342  27.783  1.00 31.87  ? 280  VAL B CB    1 
ATOM   6851  C CG1   . VAL B 1 280 ? -4.161  80.999  26.806  1.00 32.45  ? 280  VAL B CG1   1 
ATOM   6852  C CG2   . VAL B 1 280 ? -4.781  82.433  28.732  1.00 32.26  ? 280  VAL B CG2   1 
ATOM   6853  N N     . PRO B 1 281 ? -7.325  80.908  24.885  1.00 30.91  ? 281  PRO B N     1 
ATOM   6854  C CA    . PRO B 1 281 ? -7.723  79.798  24.029  1.00 31.87  ? 281  PRO B CA    1 
ATOM   6855  C C     . PRO B 1 281 ? -6.551  78.852  23.748  1.00 31.67  ? 281  PRO B C     1 
ATOM   6856  O O     . PRO B 1 281 ? -5.436  79.296  23.526  1.00 31.85  ? 281  PRO B O     1 
ATOM   6857  C CB    . PRO B 1 281 ? -8.156  80.483  22.721  1.00 32.51  ? 281  PRO B CB    1 
ATOM   6858  C CG    . PRO B 1 281 ? -8.048  81.963  22.957  1.00 32.92  ? 281  PRO B CG    1 
ATOM   6859  C CD    . PRO B 1 281 ? -7.152  82.163  24.136  1.00 28.93  ? 281  PRO B CD    1 
ATOM   6860  N N     . VAL B 1 282 ? -6.815  77.549  23.760  1.00 33.13  ? 282  VAL B N     1 
ATOM   6861  C CA    . VAL B 1 282 ? -5.801  76.570  23.408  1.00 33.86  ? 282  VAL B CA    1 
ATOM   6862  C C     . VAL B 1 282 ? -6.198  75.887  22.110  1.00 35.08  ? 282  VAL B C     1 
ATOM   6863  O O     . VAL B 1 282 ? -7.333  75.387  21.963  1.00 34.47  ? 282  VAL B O     1 
ATOM   6864  C CB    . VAL B 1 282 ? -5.603  75.524  24.497  1.00 30.93  ? 282  VAL B CB    1 
ATOM   6865  C CG1   . VAL B 1 282 ? -4.530  74.534  24.075  1.00 29.00  ? 282  VAL B CG1   1 
ATOM   6866  C CG2   . VAL B 1 282 ? -5.239  76.206  25.808  1.00 30.21  ? 282  VAL B CG2   1 
ATOM   6867  N N     . GLU B 1 283 ? -5.246  75.876  21.180  1.00 38.52  ? 283  GLU B N     1 
ATOM   6868  C CA    . GLU B 1 283 ? -5.434  75.257  19.872  1.00 41.32  ? 283  GLU B CA    1 
ATOM   6869  C C     . GLU B 1 283 ? -5.798  73.791  20.069  1.00 40.80  ? 283  GLU B C     1 
ATOM   6870  O O     . GLU B 1 283 ? -5.285  73.111  20.969  1.00 39.38  ? 283  GLU B O     1 
ATOM   6871  C CB    . GLU B 1 283 ? -4.203  75.410  18.947  1.00 44.26  ? 283  GLU B CB    1 
ATOM   6872  C CG    . GLU B 1 283 ? -2.879  75.981  19.586  1.00 52.80  ? 283  GLU B CG    1 
ATOM   6873  C CD    . GLU B 1 283 ? -1.926  74.926  20.132  1.00 57.60  ? 283  GLU B CD    1 
ATOM   6874  O OE1   . GLU B 1 283 ? -2.359  73.784  20.380  1.00 68.34  ? 283  GLU B OE1   1 
ATOM   6875  O OE2   . GLU B 1 283 ? -0.725  75.239  20.308  1.00 59.85  ? 283  GLU B OE2   1 
ATOM   6876  N N     . SER B 1 284 ? -6.705  73.317  19.228  1.00 40.75  ? 284  SER B N     1 
ATOM   6877  C CA    . SER B 1 284 ? -7.260  71.963  19.375  1.00 42.10  ? 284  SER B CA    1 
ATOM   6878  C C     . SER B 1 284 ? -6.211  70.910  19.048  1.00 40.90  ? 284  SER B C     1 
ATOM   6879  O O     . SER B 1 284 ? -6.295  69.787  19.513  1.00 41.11  ? 284  SER B O     1 
ATOM   6880  C CB    . SER B 1 284 ? -8.502  71.793  18.483  1.00 42.87  ? 284  SER B CB    1 
ATOM   6881  O OG    . SER B 1 284 ? -8.385  72.618  17.322  1.00 46.10  ? 284  SER B OG    1 
ATOM   6882  N N     . SER B 1 285 ? -5.229  71.302  18.235  1.00 41.15  ? 285  SER B N     1 
ATOM   6883  C CA    . SER B 1 285 ? -4.144  70.438  17.824  1.00 41.32  ? 285  SER B CA    1 
ATOM   6884  C C     . SER B 1 285 ? -2.821  70.998  18.290  1.00 39.88  ? 285  SER B C     1 
ATOM   6885  O O     . SER B 1 285 ? -2.540  72.193  18.131  1.00 41.49  ? 285  SER B O     1 
ATOM   6886  C CB    . SER B 1 285 ? -4.092  70.335  16.297  1.00 43.19  ? 285  SER B CB    1 
ATOM   6887  O OG    . SER B 1 285 ? -2.827  69.829  15.866  1.00 48.11  ? 285  SER B OG    1 
ATOM   6888  N N     . LEU B 1 286 ? -2.001  70.114  18.826  1.00 37.43  ? 286  LEU B N     1 
ATOM   6889  C CA    . LEU B 1 286 ? -0.586  70.347  18.969  1.00 37.26  ? 286  LEU B CA    1 
ATOM   6890  C C     . LEU B 1 286 ? -0.038  70.435  17.540  1.00 37.08  ? 286  LEU B C     1 
ATOM   6891  O O     . LEU B 1 286 ? -0.583  69.801  16.602  1.00 36.16  ? 286  LEU B O     1 
ATOM   6892  C CB    . LEU B 1 286 ? 0.038   69.139  19.656  1.00 36.06  ? 286  LEU B CB    1 
ATOM   6893  C CG    . LEU B 1 286 ? 0.868   69.225  20.914  1.00 37.13  ? 286  LEU B CG    1 
ATOM   6894  C CD1   . LEU B 1 286 ? 1.804   68.014  20.855  1.00 39.17  ? 286  LEU B CD1   1 
ATOM   6895  C CD2   . LEU B 1 286 ? 1.612   70.523  21.049  1.00 39.37  ? 286  LEU B CD2   1 
ATOM   6896  N N     . GLY B 1 287 ? 1.018   71.202  17.336  1.00 36.17  ? 287  GLY B N     1 
ATOM   6897  C CA    . GLY B 1 287 ? 1.585   71.265  15.972  1.00 36.05  ? 287  GLY B CA    1 
ATOM   6898  C C     . GLY B 1 287 ? 2.399   70.010  15.663  1.00 35.69  ? 287  GLY B C     1 
ATOM   6899  O O     . GLY B 1 287 ? 2.769   69.228  16.578  1.00 34.44  ? 287  GLY B O     1 
ATOM   6900  N N     . LYS B 1 288 ? 2.679   69.831  14.388  1.00 34.24  ? 288  LYS B N     1 
ATOM   6901  C CA    . LYS B 1 288 ? 3.556   68.789  13.878  1.00 34.78  ? 288  LYS B CA    1 
ATOM   6902  C C     . LYS B 1 288 ? 4.914   68.678  14.616  1.00 32.78  ? 288  LYS B C     1 
ATOM   6903  O O     . LYS B 1 288 ? 5.289   67.611  15.084  1.00 30.63  ? 288  LYS B O     1 
ATOM   6904  C CB    . LYS B 1 288 ? 3.752   69.066  12.382  1.00 36.92  ? 288  LYS B CB    1 
ATOM   6905  C CG    . LYS B 1 288 ? 4.617   68.097  11.636  1.00 43.20  ? 288  LYS B CG    1 
ATOM   6906  C CD    . LYS B 1 288 ? 3.997   66.703  11.574  1.00 48.51  ? 288  LYS B CD    1 
ATOM   6907  C CE    . LYS B 1 288 ? 3.569   66.368  10.174  1.00 54.22  ? 288  LYS B CE    1 
ATOM   6908  N NZ    . LYS B 1 288 ? 2.982   65.003  10.102  1.00 52.51  ? 288  LYS B NZ    1 
ATOM   6909  N N     . GLU B 1 289 ? 5.626   69.794  14.737  1.00 31.85  ? 289  GLU B N     1 
ATOM   6910  C CA    . GLU B 1 289 ? 6.960   69.817  15.341  1.00 31.09  ? 289  GLU B CA    1 
ATOM   6911  C C     . GLU B 1 289 ? 6.969   69.387  16.787  1.00 28.42  ? 289  GLU B C     1 
ATOM   6912  O O     . GLU B 1 289 ? 7.810   68.627  17.190  1.00 26.89  ? 289  GLU B O     1 
ATOM   6913  C CB    . GLU B 1 289 ? 7.555   71.229  15.230  1.00 31.63  ? 289  GLU B CB    1 
ATOM   6914  C CG    . GLU B 1 289 ? 8.099   71.510  13.859  1.00 39.02  ? 289  GLU B CG    1 
ATOM   6915  C CD    . GLU B 1 289 ? 9.371   70.750  13.592  1.00 43.29  ? 289  GLU B CD    1 
ATOM   6916  O OE1   . GLU B 1 289 ? 10.283  70.791  14.440  1.00 48.48  ? 289  GLU B OE1   1 
ATOM   6917  O OE2   . GLU B 1 289 ? 9.456   70.097  12.546  1.00 45.64  ? 289  GLU B OE2   1 
ATOM   6918  N N     . LYS B 1 290 ? 6.023   69.897  17.557  1.00 27.87  ? 290  LYS B N     1 
ATOM   6919  C CA    . LYS B 1 290 ? 5.877   69.525  18.946  1.00 28.90  ? 290  LYS B CA    1 
ATOM   6920  C C     . LYS B 1 290 ? 5.436   68.051  19.135  1.00 27.97  ? 290  LYS B C     1 
ATOM   6921  O O     . LYS B 1 290 ? 5.852   67.390  20.093  1.00 25.28  ? 290  LYS B O     1 
ATOM   6922  C CB    . LYS B 1 290 ? 4.888   70.493  19.646  1.00 29.83  ? 290  LYS B CB    1 
ATOM   6923  C CG    . LYS B 1 290 ? 5.515   71.864  20.035  1.00 32.06  ? 290  LYS B CG    1 
ATOM   6924  C CD    . LYS B 1 290 ? 6.442   71.715  21.241  1.00 33.33  ? 290  LYS B CD    1 
ATOM   6925  C CE    . LYS B 1 290 ? 7.380   72.869  21.401  1.00 31.68  ? 290  LYS B CE    1 
ATOM   6926  N NZ    . LYS B 1 290 ? 8.406   72.588  22.467  1.00 25.77  ? 290  LYS B NZ    1 
ATOM   6927  N N     . GLY B 1 291 ? 4.583   67.560  18.238  1.00 28.31  ? 291  GLY B N     1 
ATOM   6928  C CA    . GLY B 1 291 ? 4.211   66.130  18.177  1.00 27.07  ? 291  GLY B CA    1 
ATOM   6929  C C     . GLY B 1 291 ? 5.405   65.241  17.837  1.00 25.21  ? 291  GLY B C     1 
ATOM   6930  O O     . GLY B 1 291 ? 5.621   64.213  18.482  1.00 24.99  ? 291  GLY B O     1 
ATOM   6931  N N     . LEU B 1 292 ? 6.192   65.646  16.837  1.00 24.96  ? 292  LEU B N     1 
ATOM   6932  C CA    . LEU B 1 292 ? 7.456   64.981  16.528  1.00 26.49  ? 292  LEU B CA    1 
ATOM   6933  C C     . LEU B 1 292 ? 8.440   65.022  17.701  1.00 26.20  ? 292  LEU B C     1 
ATOM   6934  O O     . LEU B 1 292 ? 9.152   64.052  17.941  1.00 24.21  ? 292  LEU B O     1 
ATOM   6935  C CB    . LEU B 1 292 ? 8.128   65.620  15.304  1.00 25.91  ? 292  LEU B CB    1 
ATOM   6936  C CG    . LEU B 1 292 ? 7.411   65.580  13.957  1.00 29.72  ? 292  LEU B CG    1 
ATOM   6937  C CD1   . LEU B 1 292 ? 8.070   66.550  12.975  1.00 23.99  ? 292  LEU B CD1   1 
ATOM   6938  C CD2   . LEU B 1 292 ? 7.373   64.146  13.414  1.00 30.18  ? 292  LEU B CD2   1 
ATOM   6939  N N     . GLU B 1 293 ? 8.482   66.152  18.414  1.00 27.36  ? 293  GLU B N     1 
ATOM   6940  C CA    . GLU B 1 293 ? 9.348   66.317  19.573  1.00 29.02  ? 293  GLU B CA    1 
ATOM   6941  C C     . GLU B 1 293 ? 8.974   65.346  20.707  1.00 28.88  ? 293  GLU B C     1 
ATOM   6942  O O     . GLU B 1 293 ? 9.858   64.798  21.371  1.00 29.39  ? 293  GLU B O     1 
ATOM   6943  C CB    . GLU B 1 293 ? 9.290   67.768  20.087  1.00 29.98  ? 293  GLU B CB    1 
ATOM   6944  C CG    . GLU B 1 293 ? 10.511  68.157  20.927  1.00 30.84  ? 293  GLU B CG    1 
ATOM   6945  C CD    . GLU B 1 293 ? 10.314  69.376  21.829  1.00 33.73  ? 293  GLU B CD    1 
ATOM   6946  O OE1   . GLU B 1 293 ? 9.420   70.205  21.548  1.00 41.40  ? 293  GLU B OE1   1 
ATOM   6947  O OE2   . GLU B 1 293 ? 11.064  69.491  22.836  1.00 36.73  ? 293  GLU B OE2   1 
ATOM   6948  N N     . ILE B 1 294 ? 7.673   65.140  20.919  1.00 27.40  ? 294  ILE B N     1 
ATOM   6949  C CA    . ILE B 1 294 ? 7.175   64.138  21.884  1.00 27.69  ? 294  ILE B CA    1 
ATOM   6950  C C     . ILE B 1 294 ? 7.696   62.770  21.486  1.00 27.03  ? 294  ILE B C     1 
ATOM   6951  O O     . ILE B 1 294 ? 8.312   62.096  22.304  1.00 28.32  ? 294  ILE B O     1 
ATOM   6952  C CB    . ILE B 1 294 ? 5.642   64.121  21.944  1.00 26.22  ? 294  ILE B CB    1 
ATOM   6953  C CG1   . ILE B 1 294 ? 5.125   65.382  22.638  1.00 28.36  ? 294  ILE B CG1   1 
ATOM   6954  C CG2   . ILE B 1 294 ? 5.123   62.912  22.696  1.00 27.69  ? 294  ILE B CG2   1 
ATOM   6955  C CD1   . ILE B 1 294 ? 3.596   65.535  22.605  1.00 27.13  ? 294  ILE B CD1   1 
ATOM   6956  N N     . LEU B 1 295 ? 7.492   62.396  20.221  1.00 26.29  ? 295  LEU B N     1 
ATOM   6957  C CA    . LEU B 1 295 ? 8.021   61.130  19.681  1.00 27.84  ? 295  LEU B CA    1 
ATOM   6958  C C     . LEU B 1 295 ? 9.515   60.950  19.883  1.00 26.74  ? 295  LEU B C     1 
ATOM   6959  O O     . LEU B 1 295 ? 9.966   59.894  20.311  1.00 28.70  ? 295  LEU B O     1 
ATOM   6960  C CB    . LEU B 1 295 ? 7.720   60.983  18.179  1.00 28.28  ? 295  LEU B CB    1 
ATOM   6961  C CG    . LEU B 1 295 ? 6.250   60.796  17.768  1.00 27.86  ? 295  LEU B CG    1 
ATOM   6962  C CD1   . LEU B 1 295 ? 6.210   60.445  16.317  1.00 26.69  ? 295  LEU B CD1   1 
ATOM   6963  C CD2   . LEU B 1 295 ? 5.575   59.707  18.612  1.00 30.43  ? 295  LEU B CD2   1 
ATOM   6964  N N     . SER B 1 296 ? 10.280  61.979  19.575  1.00 26.15  ? 296  SER B N     1 
ATOM   6965  C CA    . SER B 1 296 ? 11.736  61.909  19.696  1.00 28.31  ? 296  SER B CA    1 
ATOM   6966  C C     . SER B 1 296 ? 12.227  61.715  21.151  1.00 29.50  ? 296  SER B C     1 
ATOM   6967  O O     . SER B 1 296 ? 13.287  61.124  21.381  1.00 30.35  ? 296  SER B O     1 
ATOM   6968  C CB    . SER B 1 296 ? 12.379  63.158  19.045  1.00 28.42  ? 296  SER B CB    1 
ATOM   6969  O OG    . SER B 1 296 ? 12.222  64.319  19.845  1.00 34.37  ? 296  SER B OG    1 
ATOM   6970  N N     . LEU B 1 297 ? 11.461  62.218  22.104  1.00 29.66  ? 297  LEU B N     1 
ATOM   6971  C CA    . LEU B 1 297 ? 11.797  62.105  23.505  1.00 29.37  ? 297  LEU B CA    1 
ATOM   6972  C C     . LEU B 1 297 ? 11.454  60.729  24.007  1.00 29.69  ? 297  LEU B C     1 
ATOM   6973  O O     . LEU B 1 297 ? 12.188  60.170  24.814  1.00 33.27  ? 297  LEU B O     1 
ATOM   6974  C CB    . LEU B 1 297 ? 11.064  63.180  24.302  1.00 28.62  ? 297  LEU B CB    1 
ATOM   6975  C CG    . LEU B 1 297 ? 11.517  64.638  24.135  1.00 30.85  ? 297  LEU B CG    1 
ATOM   6976  C CD1   . LEU B 1 297 ? 10.634  65.551  24.995  1.00 33.36  ? 297  LEU B CD1   1 
ATOM   6977  C CD2   . LEU B 1 297 ? 12.999  64.851  24.476  1.00 35.93  ? 297  LEU B CD2   1 
ATOM   6978  N N     . PHE B 1 298 ? 10.337  60.184  23.549  1.00 28.50  ? 298  PHE B N     1 
ATOM   6979  C CA    . PHE B 1 298 ? 10.012  58.809  23.850  1.00 29.29  ? 298  PHE B CA    1 
ATOM   6980  C C     . PHE B 1 298 ? 11.054  57.826  23.332  1.00 29.30  ? 298  PHE B C     1 
ATOM   6981  O O     . PHE B 1 298 ? 11.463  56.930  24.042  1.00 30.83  ? 298  PHE B O     1 
ATOM   6982  C CB    . PHE B 1 298 ? 8.660   58.433  23.262  1.00 28.23  ? 298  PHE B CB    1 
ATOM   6983  C CG    . PHE B 1 298 ? 7.556   58.661  24.200  1.00 23.87  ? 298  PHE B CG    1 
ATOM   6984  C CD1   . PHE B 1 298 ? 7.422   57.838  25.312  1.00 26.78  ? 298  PHE B CD1   1 
ATOM   6985  C CD2   . PHE B 1 298 ? 6.677   59.731  24.019  1.00 23.44  ? 298  PHE B CD2   1 
ATOM   6986  C CE1   . PHE B 1 298 ? 6.410   58.044  26.215  1.00 28.73  ? 298  PHE B CE1   1 
ATOM   6987  C CE2   . PHE B 1 298 ? 5.669   59.959  24.921  1.00 29.46  ? 298  PHE B CE2   1 
ATOM   6988  C CZ    . PHE B 1 298 ? 5.510   59.112  26.016  1.00 28.95  ? 298  PHE B CZ    1 
ATOM   6989  N N     . VAL B 1 299 ? 11.455  57.981  22.084  1.00 30.88  ? 299  VAL B N     1 
ATOM   6990  C CA    . VAL B 1 299 ? 12.359  57.018  21.450  1.00 32.00  ? 299  VAL B CA    1 
ATOM   6991  C C     . VAL B 1 299 ? 13.845  57.372  21.602  1.00 32.90  ? 299  VAL B C     1 
ATOM   6992  O O     . VAL B 1 299 ? 14.701  56.644  21.136  1.00 33.35  ? 299  VAL B O     1 
ATOM   6993  C CB    . VAL B 1 299 ? 11.996  56.780  19.961  1.00 30.12  ? 299  VAL B CB    1 
ATOM   6994  C CG1   . VAL B 1 299 ? 10.496  56.465  19.813  1.00 30.90  ? 299  VAL B CG1   1 
ATOM   6995  C CG2   . VAL B 1 299 ? 12.362  57.946  19.102  1.00 31.47  ? 299  VAL B CG2   1 
ATOM   6996  N N     . ASN B 1 300 ? 14.130  58.460  22.304  1.00 35.88  ? 300  ASN B N     1 
ATOM   6997  C CA    . ASN B 1 300 ? 15.489  58.892  22.637  1.00 37.49  ? 300  ASN B CA    1 
ATOM   6998  C C     . ASN B 1 300 ? 16.345  59.071  21.386  1.00 39.64  ? 300  ASN B C     1 
ATOM   6999  O O     . ASN B 1 300 ? 17.447  58.508  21.255  1.00 39.55  ? 300  ASN B O     1 
ATOM   7000  C CB    . ASN B 1 300 ? 16.202  57.965  23.638  1.00 38.50  ? 300  ASN B CB    1 
ATOM   7001  C CG    . ASN B 1 300 ? 17.592  58.511  24.069  1.00 40.78  ? 300  ASN B CG    1 
ATOM   7002  O OD1   . ASN B 1 300 ? 17.763  59.715  24.292  1.00 47.66  ? 300  ASN B OD1   1 
ATOM   7003  N ND2   . ASN B 1 300 ? 18.578  57.619  24.171  1.00 47.01  ? 300  ASN B ND2   1 
ATOM   7004  N N     . MET B 1 301 ? 15.825  59.851  20.450  1.00 40.42  ? 301  MET B N     1 
ATOM   7005  C CA    . MET B 1 301 ? 16.656  60.321  19.348  1.00 40.66  ? 301  MET B CA    1 
ATOM   7006  C C     . MET B 1 301 ? 16.350  61.755  18.995  1.00 39.80  ? 301  MET B C     1 
ATOM   7007  O O     . MET B 1 301 ? 15.328  62.304  19.362  1.00 40.57  ? 301  MET B O     1 
ATOM   7008  C CB    . MET B 1 301 ? 16.566  59.434  18.105  1.00 41.76  ? 301  MET B CB    1 
ATOM   7009  C CG    . MET B 1 301 ? 15.254  58.757  17.856  1.00 43.91  ? 301  MET B CG    1 
ATOM   7010  S SD    . MET B 1 301 ? 15.193  58.024  16.207  1.00 41.30  ? 301  MET B SD    1 
ATOM   7011  C CE    . MET B 1 301 ? 14.548  56.386  16.574  1.00 37.21  ? 301  MET B CE    1 
ATOM   7012  N N     . LYS B 1 302 ? 17.286  62.385  18.317  1.00 40.32  ? 302  LYS B N     1 
ATOM   7013  C CA    . LYS B 1 302 ? 17.060  63.734  17.834  1.00 42.02  ? 302  LYS B CA    1 
ATOM   7014  C C     . LYS B 1 302 ? 15.903  63.735  16.835  1.00 39.93  ? 302  LYS B C     1 
ATOM   7015  O O     . LYS B 1 302 ? 15.690  62.770  16.094  1.00 37.70  ? 302  LYS B O     1 
ATOM   7016  C CB    . LYS B 1 302 ? 18.295  64.318  17.156  1.00 42.94  ? 302  LYS B CB    1 
ATOM   7017  C CG    . LYS B 1 302 ? 19.370  64.790  18.109  1.00 49.01  ? 302  LYS B CG    1 
ATOM   7018  C CD    . LYS B 1 302 ? 20.586  65.302  17.324  1.00 48.09  ? 302  LYS B CD    1 
ATOM   7019  C CE    . LYS B 1 302 ? 21.613  65.934  18.235  1.00 53.97  ? 302  LYS B CE    1 
ATOM   7020  N NZ    . LYS B 1 302 ? 22.875  66.174  17.494  1.00 57.34  ? 302  LYS B NZ    1 
ATOM   7021  N N     . LYS B 1 303 ? 15.161  64.836  16.825  1.00 39.46  ? 303  LYS B N     1 
ATOM   7022  C CA    . LYS B 1 303 ? 14.029  64.998  15.927  1.00 39.27  ? 303  LYS B CA    1 
ATOM   7023  C C     . LYS B 1 303 ? 14.404  64.794  14.461  1.00 38.63  ? 303  LYS B C     1 
ATOM   7024  O O     . LYS B 1 303 ? 13.633  64.216  13.689  1.00 38.57  ? 303  LYS B O     1 
ATOM   7025  C CB    . LYS B 1 303 ? 13.410  66.394  16.084  1.00 38.89  ? 303  LYS B CB    1 
ATOM   7026  C CG    . LYS B 1 303 ? 12.027  66.400  16.648  1.00 41.51  ? 303  LYS B CG    1 
ATOM   7027  C CD    . LYS B 1 303 ? 11.297  67.710  16.362  1.00 41.99  ? 303  LYS B CD    1 
ATOM   7028  C CE    . LYS B 1 303 ? 12.084  68.901  16.875  1.00 48.54  ? 303  LYS B CE    1 
ATOM   7029  N NZ    . LYS B 1 303 ? 11.266  70.134  16.877  1.00 48.70  ? 303  LYS B NZ    1 
ATOM   7030  N N     . ALA B 1 304 ? 15.583  65.271  14.080  1.00 37.96  ? 304  ALA B N     1 
ATOM   7031  C CA    . ALA B 1 304 ? 16.067  65.135  12.701  1.00 37.17  ? 304  ALA B CA    1 
ATOM   7032  C C     . ALA B 1 304 ? 16.576  63.733  12.321  1.00 37.13  ? 304  ALA B C     1 
ATOM   7033  O O     . ALA B 1 304 ? 16.837  63.494  11.155  1.00 36.91  ? 304  ALA B O     1 
ATOM   7034  C CB    . ALA B 1 304 ? 17.138  66.214  12.419  1.00 37.65  ? 304  ALA B CB    1 
ATOM   7035  N N     . ASP B 1 305 ? 16.707  62.824  13.288  1.00 37.08  ? 305  ASP B N     1 
ATOM   7036  C CA    . ASP B 1 305 ? 17.133  61.450  13.044  1.00 35.57  ? 305  ASP B CA    1 
ATOM   7037  C C     . ASP B 1 305 ? 15.954  60.480  13.071  1.00 34.97  ? 305  ASP B C     1 
ATOM   7038  O O     . ASP B 1 305 ? 16.130  59.265  12.995  1.00 34.37  ? 305  ASP B O     1 
ATOM   7039  C CB    . ASP B 1 305 ? 18.187  61.109  14.078  1.00 36.39  ? 305  ASP B CB    1 
ATOM   7040  C CG    . ASP B 1 305 ? 19.393  62.039  13.982  1.00 41.77  ? 305  ASP B CG    1 
ATOM   7041  O OD1   . ASP B 1 305 ? 19.443  62.851  13.032  1.00 42.01  ? 305  ASP B OD1   1 
ATOM   7042  O OD2   . ASP B 1 305 ? 20.289  61.962  14.847  1.00 52.58  ? 305  ASP B OD2   1 
ATOM   7043  N N     . LEU B 1 306 ? 14.753  61.034  13.199  1.00 33.94  ? 306  LEU B N     1 
ATOM   7044  C CA    . LEU B 1 306 ? 13.525  60.268  13.211  1.00 33.02  ? 306  LEU B CA    1 
ATOM   7045  C C     . LEU B 1 306 ? 13.253  59.667  11.854  1.00 30.72  ? 306  LEU B C     1 
ATOM   7046  O O     . LEU B 1 306 ? 13.450  60.346  10.861  1.00 30.62  ? 306  LEU B O     1 
ATOM   7047  C CB    . LEU B 1 306 ? 12.348  61.200  13.563  1.00 32.28  ? 306  LEU B CB    1 
ATOM   7048  C CG    . LEU B 1 306 ? 12.136  61.551  15.027  1.00 30.38  ? 306  LEU B CG    1 
ATOM   7049  C CD1   . LEU B 1 306 ? 10.943  62.478  15.166  1.00 31.80  ? 306  LEU B CD1   1 
ATOM   7050  C CD2   . LEU B 1 306 ? 11.902  60.278  15.837  1.00 28.75  ? 306  LEU B CD2   1 
ATOM   7051  N N     . PRO B 1 307 ? 12.718  58.426  11.808  1.00 30.07  ? 307  PRO B N     1 
ATOM   7052  C CA    . PRO B 1 307 ? 12.457  57.861  10.492  1.00 32.18  ? 307  PRO B CA    1 
ATOM   7053  C C     . PRO B 1 307 ? 11.303  58.599  9.803   1.00 32.81  ? 307  PRO B C     1 
ATOM   7054  O O     . PRO B 1 307 ? 10.580  59.403  10.429  1.00 31.86  ? 307  PRO B O     1 
ATOM   7055  C CB    . PRO B 1 307 ? 12.057  56.418  10.787  1.00 31.10  ? 307  PRO B CB    1 
ATOM   7056  C CG    . PRO B 1 307 ? 11.517  56.465  12.143  1.00 32.08  ? 307  PRO B CG    1 
ATOM   7057  C CD    . PRO B 1 307 ? 12.273  57.527  12.883  1.00 29.44  ? 307  PRO B CD    1 
ATOM   7058  N N     . GLU B 1 308 ? 11.114  58.296  8.527   1.00 33.11  ? 308  GLU B N     1 
ATOM   7059  C CA    . GLU B 1 308 ? 10.120  59.003  7.718   1.00 34.61  ? 308  GLU B CA    1 
ATOM   7060  C C     . GLU B 1 308 ? 8.683   58.746  8.192   1.00 33.53  ? 308  GLU B C     1 
ATOM   7061  O O     . GLU B 1 308 ? 7.808   59.587  7.987   1.00 33.26  ? 308  GLU B O     1 
ATOM   7062  C CB    . GLU B 1 308 ? 10.220  58.661  6.229   1.00 36.19  ? 308  GLU B CB    1 
ATOM   7063  C CG    . GLU B 1 308 ? 9.537   57.345  5.884   1.00 41.90  ? 308  GLU B CG    1 
ATOM   7064  C CD    . GLU B 1 308 ? 9.229   57.156  4.406   1.00 41.28  ? 308  GLU B CD    1 
ATOM   7065  O OE1   . GLU B 1 308 ? 9.791   57.895  3.540   1.00 47.72  ? 308  GLU B OE1   1 
ATOM   7066  O OE2   . GLU B 1 308 ? 8.427   56.230  4.120   1.00 47.59  ? 308  GLU B OE2   1 
ATOM   7067  N N     . GLN B 1 309 ? 8.437   57.568  8.785   1.00 32.61  ? 309  GLN B N     1 
ATOM   7068  C CA    . GLN B 1 309 ? 7.109   57.193  9.271   1.00 30.78  ? 309  GLN B CA    1 
ATOM   7069  C C     . GLN B 1 309 ? 6.620   58.135  10.374  1.00 30.82  ? 309  GLN B C     1 
ATOM   7070  O O     . GLN B 1 309 ? 5.410   58.278  10.592  1.00 28.05  ? 309  GLN B O     1 
ATOM   7071  C CB    . GLN B 1 309 ? 7.090   55.771  9.848   1.00 31.64  ? 309  GLN B CB    1 
ATOM   7072  C CG    . GLN B 1 309 ? 7.126   54.640  8.830   1.00 28.79  ? 309  GLN B CG    1 
ATOM   7073  C CD    . GLN B 1 309 ? 8.503   54.443  8.227   1.00 26.34  ? 309  GLN B CD    1 
ATOM   7074  O OE1   . GLN B 1 309 ? 9.447   55.173  8.532   1.00 26.31  ? 309  GLN B OE1   1 
ATOM   7075  N NE2   . GLN B 1 309 ? 8.614   53.484  7.347   1.00 26.32  ? 309  GLN B NE2   1 
ATOM   7076  N N     . ALA B 1 310 ? 7.563   58.750  11.092  1.00 29.72  ? 310  ALA B N     1 
ATOM   7077  C CA    . ALA B 1 310 ? 7.212   59.647  12.186  1.00 28.70  ? 310  ALA B CA    1 
ATOM   7078  C C     . ALA B 1 310 ? 6.237   60.748  11.741  1.00 28.35  ? 310  ALA B C     1 
ATOM   7079  O O     . ALA B 1 310 ? 5.245   61.021  12.413  1.00 27.88  ? 310  ALA B O     1 
ATOM   7080  C CB    . ALA B 1 310 ? 8.446   60.264  12.816  1.00 28.68  ? 310  ALA B CB    1 
ATOM   7081  N N     . HIS B 1 311 ? 6.491   61.356  10.594  1.00 29.79  ? 311  HIS B N     1 
ATOM   7082  C CA    . HIS B 1 311 ? 5.633   62.442  10.108  1.00 30.44  ? 311  HIS B CA    1 
ATOM   7083  C C     . HIS B 1 311 ? 4.227   61.935  9.738   1.00 30.20  ? 311  HIS B C     1 
ATOM   7084  O O     . HIS B 1 311 ? 3.198   62.595  9.996   1.00 28.86  ? 311  HIS B O     1 
ATOM   7085  C CB    . HIS B 1 311 ? 6.279   63.126  8.915   1.00 31.15  ? 311  HIS B CB    1 
ATOM   7086  C CG    . HIS B 1 311 ? 7.632   63.679  9.219   1.00 34.73  ? 311  HIS B CG    1 
ATOM   7087  N ND1   . HIS B 1 311 ? 8.795   63.011  8.907   1.00 41.94  ? 311  HIS B ND1   1 
ATOM   7088  C CD2   . HIS B 1 311 ? 8.010   64.818  9.838   1.00 34.69  ? 311  HIS B CD2   1 
ATOM   7089  C CE1   . HIS B 1 311 ? 9.834   63.723  9.304   1.00 37.42  ? 311  HIS B CE1   1 
ATOM   7090  N NE2   . HIS B 1 311 ? 9.383   64.823  9.876   1.00 35.78  ? 311  HIS B NE2   1 
ATOM   7091  N N     . SER B 1 312 ? 4.183   60.750  9.134   1.00 29.19  ? 312  SER B N     1 
ATOM   7092  C CA    . SER B 1 312 ? 2.912   60.112  8.818   1.00 28.66  ? 312  SER B CA    1 
ATOM   7093  C C     . SER B 1 312 ? 2.139   59.721  10.107  1.00 27.88  ? 312  SER B C     1 
ATOM   7094  O O     . SER B 1 312 ? 0.916   59.892  10.201  1.00 25.22  ? 312  SER B O     1 
ATOM   7095  C CB    . SER B 1 312 ? 3.145   58.913  7.893   1.00 28.81  ? 312  SER B CB    1 
ATOM   7096  O OG    . SER B 1 312 ? 3.711   59.341  6.648   1.00 32.05  ? 312  SER B OG    1 
ATOM   7097  N N     . ILE B 1 313 ? 2.868   59.242  11.111  1.00 28.53  ? 313  ILE B N     1 
ATOM   7098  C CA    . ILE B 1 313 ? 2.275   58.906  12.399  1.00 28.91  ? 313  ILE B CA    1 
ATOM   7099  C C     . ILE B 1 313 ? 1.679   60.133  13.082  1.00 29.07  ? 313  ILE B C     1 
ATOM   7100  O O     . ILE B 1 313 ? 0.572   60.052  13.619  1.00 28.69  ? 313  ILE B O     1 
ATOM   7101  C CB    . ILE B 1 313 ? 3.292   58.183  13.343  1.00 28.29  ? 313  ILE B CB    1 
ATOM   7102  C CG1   . ILE B 1 313 ? 3.507   56.735  12.855  1.00 31.23  ? 313  ILE B CG1   1 
ATOM   7103  C CG2   . ILE B 1 313 ? 2.800   58.203  14.777  1.00 29.04  ? 313  ILE B CG2   1 
ATOM   7104  C CD1   . ILE B 1 313 ? 4.515   55.906  13.657  1.00 29.60  ? 313  ILE B CD1   1 
ATOM   7105  N N     . ILE B 1 314 ? 2.393   61.254  13.082  1.00 28.85  ? 314  ILE B N     1 
ATOM   7106  C CA    . ILE B 1 314 ? 1.837   62.495  13.645  1.00 29.83  ? 314  ILE B CA    1 
ATOM   7107  C C     . ILE B 1 314 ? 0.557   62.940  12.921  1.00 30.01  ? 314  ILE B C     1 
ATOM   7108  O O     . ILE B 1 314 ? -0.426  63.347  13.552  1.00 32.45  ? 314  ILE B O     1 
ATOM   7109  C CB    . ILE B 1 314 ? 2.846   63.672  13.616  1.00 29.15  ? 314  ILE B CB    1 
ATOM   7110  C CG1   . ILE B 1 314 ? 3.977   63.419  14.615  1.00 32.98  ? 314  ILE B CG1   1 
ATOM   7111  C CG2   . ILE B 1 314 ? 2.159   64.992  13.975  1.00 28.59  ? 314  ILE B CG2   1 
ATOM   7112  C CD1   . ILE B 1 314 ? 3.500   62.927  15.957  1.00 26.84  ? 314  ILE B CD1   1 
ATOM   7113  N N     . LYS B 1 315 ? 0.587   62.894  11.604  1.00 30.73  ? 315  LYS B N     1 
ATOM   7114  C CA    . LYS B 1 315 ? -0.596  63.184  10.799  1.00 32.89  ? 315  LYS B CA    1 
ATOM   7115  C C     . LYS B 1 315 ? -1.772  62.306  11.230  1.00 33.23  ? 315  LYS B C     1 
ATOM   7116  O O     . LYS B 1 315 ? -2.895  62.788  11.418  1.00 33.80  ? 315  LYS B O     1 
ATOM   7117  C CB    . LYS B 1 315 ? -0.310  62.950  9.317   1.00 33.73  ? 315  LYS B CB    1 
ATOM   7118  C CG    . LYS B 1 315 ? -1.436  63.404  8.372   1.00 35.34  ? 315  LYS B CG    1 
ATOM   7119  C CD    . LYS B 1 315 ? -1.007  63.390  6.896   1.00 37.80  ? 315  LYS B CD    1 
ATOM   7120  C CE    . LYS B 1 315 ? -2.223  63.192  5.943   1.00 44.72  ? 315  LYS B CE    1 
ATOM   7121  N NZ    . LYS B 1 315 ? -3.338  64.178  6.149   1.00 45.72  ? 315  LYS B NZ    1 
ATOM   7122  N N     . GLU B 1 316 ? -1.512  61.016  11.426  1.00 33.36  ? 316  GLU B N     1 
ATOM   7123  C CA    . GLU B 1 316 ? -2.571  60.103  11.910  1.00 33.47  ? 316  GLU B CA    1 
ATOM   7124  C C     . GLU B 1 316 ? -3.029  60.394  13.322  1.00 33.72  ? 316  GLU B C     1 
ATOM   7125  O O     . GLU B 1 316 ? -4.157  60.043  13.676  1.00 34.86  ? 316  GLU B O     1 
ATOM   7126  C CB    . GLU B 1 316 ? -2.175  58.611  11.838  1.00 34.92  ? 316  GLU B CB    1 
ATOM   7127  C CG    . GLU B 1 316 ? -2.027  58.021  10.440  1.00 32.03  ? 316  GLU B CG    1 
ATOM   7128  C CD    . GLU B 1 316 ? -3.214  58.325  9.516   1.00 37.96  ? 316  GLU B CD    1 
ATOM   7129  O OE1   . GLU B 1 316 ? -4.380  58.111  9.934   1.00 37.15  ? 316  GLU B OE1   1 
ATOM   7130  O OE2   . GLU B 1 316 ? -2.970  58.770  8.364   1.00 37.15  ? 316  GLU B OE2   1 
ATOM   7131  N N     . CYS B 1 317 ? -2.183  61.010  14.148  1.00 33.47  ? 317  CYS B N     1 
ATOM   7132  C CA    . CYS B 1 317 ? -2.594  61.337  15.522  1.00 34.92  ? 317  CYS B CA    1 
ATOM   7133  C C     . CYS B 1 317 ? -3.510  62.550  15.649  1.00 36.02  ? 317  CYS B C     1 
ATOM   7134  O O     . CYS B 1 317 ? -4.067  62.789  16.733  1.00 35.28  ? 317  CYS B O     1 
ATOM   7135  C CB    . CYS B 1 317 ? -1.390  61.541  16.425  1.00 33.33  ? 317  CYS B CB    1 
ATOM   7136  S SG    . CYS B 1 317 ? -0.628  60.003  16.698  1.00 37.92  ? 317  CYS B SG    1 
ATOM   7137  N N     . LYS B 1 318 ? -3.594  63.348  14.587  1.00 37.64  ? 318  LYS B N     1 
ATOM   7138  C CA    . LYS B 1 318 ? -4.509  64.498  14.513  1.00 39.31  ? 318  LYS B CA    1 
ATOM   7139  C C     . LYS B 1 318 ? -4.280  65.519  15.635  1.00 38.84  ? 318  LYS B C     1 
ATOM   7140  O O     . LYS B 1 318 ? -5.213  66.077  16.220  1.00 39.66  ? 318  LYS B O     1 
ATOM   7141  C CB    . LYS B 1 318 ? -5.960  64.015  14.461  1.00 39.69  ? 318  LYS B CB    1 
ATOM   7142  C CG    . LYS B 1 318 ? -6.254  63.408  13.096  1.00 45.16  ? 318  LYS B CG    1 
ATOM   7143  C CD    . LYS B 1 318 ? -7.627  62.793  13.011  1.00 45.04  ? 318  LYS B CD    1 
ATOM   7144  C CE    . LYS B 1 318 ? -7.736  61.770  11.864  1.00 50.23  ? 318  LYS B CE    1 
ATOM   7145  N NZ    . LYS B 1 318 ? -8.513  60.552  12.269  1.00 46.76  ? 318  LYS B NZ    1 
ATOM   7146  N N     . GLY B 1 319 ? -3.014  65.747  15.936  1.00 37.92  ? 319  GLY B N     1 
ATOM   7147  C CA    . GLY B 1 319 ? -2.630  66.715  16.942  1.00 37.61  ? 319  GLY B CA    1 
ATOM   7148  C C     . GLY B 1 319 ? -2.912  66.418  18.410  1.00 35.47  ? 319  GLY B C     1 
ATOM   7149  O O     . GLY B 1 319 ? -2.627  67.254  19.244  1.00 35.07  ? 319  GLY B O     1 
ATOM   7150  N N     . SER B 1 320 ? -3.479  65.262  18.740  1.00 32.84  ? 320  SER B N     1 
ATOM   7151  C CA    . SER B 1 320 ? -3.792  64.962  20.137  1.00 32.90  ? 320  SER B CA    1 
ATOM   7152  C C     . SER B 1 320 ? -2.541  64.510  20.909  1.00 31.04  ? 320  SER B C     1 
ATOM   7153  O O     . SER B 1 320 ? -2.032  63.439  20.657  1.00 31.65  ? 320  SER B O     1 
ATOM   7154  C CB    . SER B 1 320 ? -4.862  63.879  20.259  1.00 33.97  ? 320  SER B CB    1 
ATOM   7155  O OG    . SER B 1 320 ? -4.934  63.383  21.600  1.00 38.51  ? 320  SER B OG    1 
ATOM   7156  N N     . PRO B 1 321 ? -2.074  65.315  21.875  1.00 30.09  ? 321  PRO B N     1 
ATOM   7157  C CA    . PRO B 1 321 ? -0.915  64.907  22.677  1.00 29.47  ? 321  PRO B CA    1 
ATOM   7158  C C     . PRO B 1 321 ? -1.059  63.602  23.470  1.00 28.79  ? 321  PRO B C     1 
ATOM   7159  O O     . PRO B 1 321 ? -0.046  62.953  23.727  1.00 28.61  ? 321  PRO B O     1 
ATOM   7160  C CB    . PRO B 1 321 ? -0.722  66.082  23.653  1.00 30.55  ? 321  PRO B CB    1 
ATOM   7161  C CG    . PRO B 1 321 ? -2.039  66.778  23.688  1.00 31.35  ? 321  PRO B CG    1 
ATOM   7162  C CD    . PRO B 1 321 ? -2.601  66.627  22.307  1.00 30.12  ? 321  PRO B CD    1 
ATOM   7163  N N     . LEU B 1 322 ? -2.275  63.227  23.870  1.00 27.65  ? 322  LEU B N     1 
ATOM   7164  C CA    . LEU B 1 322 ? -2.487  61.933  24.493  1.00 27.46  ? 322  LEU B CA    1 
ATOM   7165  C C     . LEU B 1 322 ? -2.225  60.776  23.504  1.00 26.93  ? 322  LEU B C     1 
ATOM   7166  O O     . LEU B 1 322 ? -1.566  59.797  23.850  1.00 24.94  ? 322  LEU B O     1 
ATOM   7167  C CB    . LEU B 1 322 ? -3.905  61.839  25.046  1.00 30.15  ? 322  LEU B CB    1 
ATOM   7168  C CG    . LEU B 1 322 ? -4.335  60.551  25.793  1.00 30.23  ? 322  LEU B CG    1 
ATOM   7169  C CD1   . LEU B 1 322 ? -3.352  60.072  26.869  1.00 28.82  ? 322  LEU B CD1   1 
ATOM   7170  C CD2   . LEU B 1 322 ? -5.687  60.766  26.427  1.00 30.76  ? 322  LEU B CD2   1 
ATOM   7171  N N     . VAL B 1 323 ? -2.720  60.929  22.268  1.00 26.35  ? 323  VAL B N     1 
ATOM   7172  C CA    . VAL B 1 323 ? -2.542  59.925  21.222  1.00 26.87  ? 323  VAL B CA    1 
ATOM   7173  C C     . VAL B 1 323 ? -1.065  59.831  20.842  1.00 26.18  ? 323  VAL B C     1 
ATOM   7174  O O     . VAL B 1 323 ? -0.516  58.734  20.749  1.00 26.09  ? 323  VAL B O     1 
ATOM   7175  C CB    . VAL B 1 323 ? -3.403  60.234  19.965  1.00 28.78  ? 323  VAL B CB    1 
ATOM   7176  C CG1   . VAL B 1 323 ? -3.277  59.144  18.948  1.00 30.53  ? 323  VAL B CG1   1 
ATOM   7177  C CG2   . VAL B 1 323 ? -4.838  60.377  20.322  1.00 33.10  ? 323  VAL B CG2   1 
ATOM   7178  N N     . VAL B 1 324 ? -0.418  60.972  20.634  1.00 25.56  ? 324  VAL B N     1 
ATOM   7179  C CA    . VAL B 1 324 ? 0.998   60.974  20.307  1.00 25.81  ? 324  VAL B CA    1 
ATOM   7180  C C     . VAL B 1 324 ? 1.767   60.253  21.402  1.00 25.24  ? 324  VAL B C     1 
ATOM   7181  O O     . VAL B 1 324 ? 2.670   59.478  21.122  1.00 27.96  ? 324  VAL B O     1 
ATOM   7182  C CB    . VAL B 1 324 ? 1.575   62.393  20.093  1.00 27.37  ? 324  VAL B CB    1 
ATOM   7183  C CG1   . VAL B 1 324 ? 3.029   62.305  19.650  1.00 28.95  ? 324  VAL B CG1   1 
ATOM   7184  C CG2   . VAL B 1 324 ? 0.782   63.172  19.018  1.00 27.49  ? 324  VAL B CG2   1 
ATOM   7185  N N     . SER B 1 325 ? 1.384   60.479  22.651  1.00 26.21  ? 325  SER B N     1 
ATOM   7186  C CA    . SER B 1 325 ? 2.064   59.855  23.795  1.00 25.17  ? 325  SER B CA    1 
ATOM   7187  C C     . SER B 1 325 ? 1.875   58.366  23.837  1.00 25.15  ? 325  SER B C     1 
ATOM   7188  O O     . SER B 1 325 ? 2.826   57.633  24.153  1.00 25.88  ? 325  SER B O     1 
ATOM   7189  C CB    . SER B 1 325 ? 1.610   60.466  25.110  1.00 27.09  ? 325  SER B CB    1 
ATOM   7190  O OG    . SER B 1 325 ? 2.012   61.828  25.161  1.00 25.89  ? 325  SER B OG    1 
ATOM   7191  N N     . LEU B 1 326 ? 0.660   57.909  23.540  1.00 24.14  ? 326  LEU B N     1 
ATOM   7192  C CA    . LEU B 1 326 ? 0.383   56.478  23.490  1.00 25.10  ? 326  LEU B CA    1 
ATOM   7193  C C     . LEU B 1 326 ? 1.244   55.744  22.465  1.00 24.03  ? 326  LEU B C     1 
ATOM   7194  O O     . LEU B 1 326 ? 1.786   54.659  22.750  1.00 23.51  ? 326  LEU B O     1 
ATOM   7195  C CB    . LEU B 1 326 ? -1.104  56.224  23.221  1.00 26.37  ? 326  LEU B CB    1 
ATOM   7196  C CG    . LEU B 1 326 ? -2.059  56.600  24.366  1.00 27.24  ? 326  LEU B CG    1 
ATOM   7197  C CD1   . LEU B 1 326 ? -3.470  56.752  23.820  1.00 28.02  ? 326  LEU B CD1   1 
ATOM   7198  C CD2   . LEU B 1 326 ? -2.018  55.571  25.505  1.00 27.18  ? 326  LEU B CD2   1 
ATOM   7199  N N     . ILE B 1 327 ? 1.361   56.340  21.282  1.00 24.81  ? 327  ILE B N     1 
ATOM   7200  C CA    . ILE B 1 327 ? 2.164   55.807  20.209  1.00 25.06  ? 327  ILE B CA    1 
ATOM   7201  C C     . ILE B 1 327 ? 3.658   55.940  20.507  1.00 25.03  ? 327  ILE B C     1 
ATOM   7202  O O     . ILE B 1 327 ? 4.414   55.004  20.289  1.00 24.99  ? 327  ILE B O     1 
ATOM   7203  C CB    . ILE B 1 327 ? 1.870   56.507  18.874  1.00 26.74  ? 327  ILE B CB    1 
ATOM   7204  C CG1   . ILE B 1 327 ? 0.381   56.340  18.474  1.00 29.90  ? 327  ILE B CG1   1 
ATOM   7205  C CG2   . ILE B 1 327 ? 2.765   55.943  17.791  1.00 27.78  ? 327  ILE B CG2   1 
ATOM   7206  C CD1   . ILE B 1 327 ? -0.129  54.861  18.358  1.00 33.82  ? 327  ILE B CD1   1 
ATOM   7207  N N     . GLY B 1 328 ? 4.086   57.096  21.003  1.00 25.69  ? 328  GLY B N     1 
ATOM   7208  C CA    . GLY B 1 328 ? 5.488   57.293  21.407  1.00 27.20  ? 328  GLY B CA    1 
ATOM   7209  C C     . GLY B 1 328 ? 5.974   56.223  22.394  1.00 28.05  ? 328  GLY B C     1 
ATOM   7210  O O     . GLY B 1 328 ? 7.088   55.709  22.272  1.00 27.33  ? 328  GLY B O     1 
ATOM   7211  N N     . ALA B 1 329 ? 5.117   55.872  23.352  1.00 28.33  ? 329  ALA B N     1 
ATOM   7212  C CA    . ALA B 1 329 ? 5.411   54.846  24.346  1.00 29.76  ? 329  ALA B CA    1 
ATOM   7213  C C     . ALA B 1 329 ? 5.548   53.461  23.711  1.00 31.23  ? 329  ALA B C     1 
ATOM   7214  O O     . ALA B 1 329 ? 6.480   52.720  24.050  1.00 30.85  ? 329  ALA B O     1 
ATOM   7215  C CB    . ALA B 1 329 ? 4.342   54.831  25.397  1.00 29.52  ? 329  ALA B CB    1 
ATOM   7216  N N     . LEU B 1 330 ? 4.635   53.131  22.794  1.00 31.84  ? 330  LEU B N     1 
ATOM   7217  C CA    . LEU B 1 330 ? 4.718   51.918  21.999  1.00 31.51  ? 330  LEU B CA    1 
ATOM   7218  C C     . LEU B 1 330 ? 6.021   51.849  21.231  1.00 32.10  ? 330  LEU B C     1 
ATOM   7219  O O     . LEU B 1 330 ? 6.702   50.816  21.224  1.00 32.61  ? 330  LEU B O     1 
ATOM   7220  C CB    . LEU B 1 330 ? 3.557   51.857  21.006  1.00 33.55  ? 330  LEU B CB    1 
ATOM   7221  C CG    . LEU B 1 330 ? 2.209   51.377  21.555  1.00 32.75  ? 330  LEU B CG    1 
ATOM   7222  C CD1   . LEU B 1 330 ? 1.143   51.538  20.500  1.00 33.46  ? 330  LEU B CD1   1 
ATOM   7223  C CD2   . LEU B 1 330 ? 2.321   49.945  21.983  1.00 34.85  ? 330  LEU B CD2   1 
ATOM   7224  N N     . LEU B 1 331 ? 6.364   52.937  20.556  1.00 31.04  ? 331  LEU B N     1 
ATOM   7225  C CA    . LEU B 1 331 ? 7.594   52.970  19.760  1.00 31.33  ? 331  LEU B CA    1 
ATOM   7226  C C     . LEU B 1 331 ? 8.844   52.847  20.610  1.00 30.43  ? 331  LEU B C     1 
ATOM   7227  O O     . LEU B 1 331 ? 9.835   52.305  20.180  1.00 29.94  ? 331  LEU B O     1 
ATOM   7228  C CB    . LEU B 1 331 ? 7.688   54.256  18.951  1.00 31.31  ? 331  LEU B CB    1 
ATOM   7229  C CG    . LEU B 1 331 ? 6.838   54.268  17.687  1.00 30.88  ? 331  LEU B CG    1 
ATOM   7230  C CD1   . LEU B 1 331 ? 6.659   55.699  17.230  1.00 35.22  ? 331  LEU B CD1   1 
ATOM   7231  C CD2   . LEU B 1 331 ? 7.467   53.401  16.628  1.00 32.34  ? 331  LEU B CD2   1 
ATOM   7232  N N     . ARG B 1 332 ? 8.811   53.385  21.816  1.00 31.18  ? 332  ARG B N     1 
ATOM   7233  C CA    . ARG B 1 332 ? 9.912   53.183  22.764  1.00 33.68  ? 332  ARG B CA    1 
ATOM   7234  C C     . ARG B 1 332 ? 10.018  51.705  23.215  1.00 35.31  ? 332  ARG B C     1 
ATOM   7235  O O     . ARG B 1 332 ? 11.123  51.188  23.362  1.00 33.72  ? 332  ARG B O     1 
ATOM   7236  C CB    . ARG B 1 332 ? 9.733   54.128  23.968  1.00 34.14  ? 332  ARG B CB    1 
ATOM   7237  C CG    . ARG B 1 332 ? 10.771  54.019  25.116  1.00 31.50  ? 332  ARG B CG    1 
ATOM   7238  C CD    . ARG B 1 332 ? 10.185  54.501  26.433  1.00 34.80  ? 332  ARG B CD    1 
ATOM   7239  N NE    . ARG B 1 332 ? 8.983   53.695  26.713  1.00 40.59  ? 332  ARG B NE    1 
ATOM   7240  C CZ    . ARG B 1 332 ? 7.933   54.060  27.451  1.00 39.96  ? 332  ARG B CZ    1 
ATOM   7241  N NH1   . ARG B 1 332 ? 7.890   55.256  28.061  1.00 37.80  ? 332  ARG B NH1   1 
ATOM   7242  N NH2   . ARG B 1 332 ? 6.921   53.213  27.569  1.00 40.71  ? 332  ARG B NH2   1 
ATOM   7243  N N     . ASP B 1 333 ? 8.869   51.048  23.382  1.00 37.47  ? 333  ASP B N     1 
ATOM   7244  C CA    . ASP B 1 333 ? 8.773   49.677  23.897  1.00 39.58  ? 333  ASP B CA    1 
ATOM   7245  C C     . ASP B 1 333 ? 9.003   48.596  22.845  1.00 42.22  ? 333  ASP B C     1 
ATOM   7246  O O     . ASP B 1 333 ? 9.302   47.435  23.206  1.00 41.71  ? 333  ASP B O     1 
ATOM   7247  C CB    . ASP B 1 333 ? 7.389   49.429  24.511  1.00 39.61  ? 333  ASP B CB    1 
ATOM   7248  C CG    . ASP B 1 333 ? 7.113   50.286  25.733  1.00 44.69  ? 333  ASP B CG    1 
ATOM   7249  O OD1   . ASP B 1 333 ? 8.086   50.743  26.373  1.00 47.56  ? 333  ASP B OD1   1 
ATOM   7250  O OD2   . ASP B 1 333 ? 5.908   50.503  26.042  1.00 43.45  ? 333  ASP B OD2   1 
ATOM   7251  N N     . PHE B 1 334 ? 8.786   48.947  21.567  1.00 44.22  ? 334  PHE B N     1 
ATOM   7252  C CA    . PHE B 1 334 ? 8.931   48.018  20.423  1.00 43.25  ? 334  PHE B CA    1 
ATOM   7253  C C     . PHE B 1 334 ? 9.587   48.833  19.295  1.00 43.32  ? 334  PHE B C     1 
ATOM   7254  O O     . PHE B 1 334 ? 8.947   49.208  18.311  1.00 41.99  ? 334  PHE B O     1 
ATOM   7255  C CB    . PHE B 1 334 ? 7.564   47.464  20.035  1.00 44.76  ? 334  PHE B CB    1 
ATOM   7256  C CG    . PHE B 1 334 ? 6.764   46.963  21.217  1.00 47.69  ? 334  PHE B CG    1 
ATOM   7257  C CD1   . PHE B 1 334 ? 5.972   47.831  21.960  1.00 48.35  ? 334  PHE B CD1   1 
ATOM   7258  C CD2   . PHE B 1 334 ? 6.831   45.632  21.607  1.00 48.09  ? 334  PHE B CD2   1 
ATOM   7259  C CE1   . PHE B 1 334 ? 5.237   47.371  23.059  1.00 48.58  ? 334  PHE B CE1   1 
ATOM   7260  C CE2   . PHE B 1 334 ? 6.083   45.161  22.710  1.00 47.30  ? 334  PHE B CE2   1 
ATOM   7261  C CZ    . PHE B 1 334 ? 5.295   46.038  23.431  1.00 47.70  ? 334  PHE B CZ    1 
ATOM   7262  N N     . PRO B 1 335 ? 10.872  49.155  19.478  1.00 43.59  ? 335  PRO B N     1 
ATOM   7263  C CA    . PRO B 1 335 ? 11.609  50.179  18.707  1.00 44.12  ? 335  PRO B CA    1 
ATOM   7264  C C     . PRO B 1 335 ? 11.845  50.072  17.176  1.00 45.38  ? 335  PRO B C     1 
ATOM   7265  O O     . PRO B 1 335 ? 12.150  51.096  16.544  1.00 47.23  ? 335  PRO B O     1 
ATOM   7266  C CB    . PRO B 1 335 ? 12.944  50.326  19.466  1.00 44.35  ? 335  PRO B CB    1 
ATOM   7267  C CG    . PRO B 1 335 ? 12.745  49.652  20.763  1.00 44.64  ? 335  PRO B CG    1 
ATOM   7268  C CD    . PRO B 1 335 ? 11.686  48.612  20.578  1.00 43.82  ? 335  PRO B CD    1 
ATOM   7269  N N     . ASN B 1 336 ? 11.727  48.901  16.565  1.00 44.05  ? 336  ASN B N     1 
ATOM   7270  C CA    . ASN B 1 336 ? 11.969  48.827  15.120  1.00 44.73  ? 336  ASN B CA    1 
ATOM   7271  C C     . ASN B 1 336 ? 10.682  48.543  14.348  1.00 43.11  ? 336  ASN B C     1 
ATOM   7272  O O     . ASN B 1 336 ? 10.691  47.855  13.338  1.00 41.39  ? 336  ASN B O     1 
ATOM   7273  C CB    . ASN B 1 336 ? 13.080  47.799  14.813  1.00 45.67  ? 336  ASN B CB    1 
ATOM   7274  C CG    . ASN B 1 336 ? 14.497  48.347  15.091  1.00 48.15  ? 336  ASN B CG    1 
ATOM   7275  O OD1   . ASN B 1 336 ? 14.664  49.442  15.646  1.00 42.59  ? 336  ASN B OD1   1 
ATOM   7276  N ND2   . ASN B 1 336 ? 15.524  47.583  14.677  1.00 49.68  ? 336  ASN B ND2   1 
ATOM   7277  N N     . ARG B 1 337 ? 9.586   49.125  14.826  1.00 42.44  ? 337  ARG B N     1 
ATOM   7278  C CA    . ARG B 1 337 ? 8.239   48.791  14.384  1.00 42.10  ? 337  ARG B CA    1 
ATOM   7279  C C     . ARG B 1 337 ? 7.471   50.028  13.885  1.00 38.19  ? 337  ARG B C     1 
ATOM   7280  O O     . ARG B 1 337 ? 6.251   50.096  13.985  1.00 35.66  ? 337  ARG B O     1 
ATOM   7281  C CB    . ARG B 1 337 ? 7.496   48.160  15.571  1.00 43.73  ? 337  ARG B CB    1 
ATOM   7282  C CG    . ARG B 1 337 ? 8.162   46.883  16.106  1.00 52.59  ? 337  ARG B CG    1 
ATOM   7283  C CD    . ARG B 1 337 ? 7.316   45.626  15.855  1.00 61.23  ? 337  ARG B CD    1 
ATOM   7284  N NE    . ARG B 1 337 ? 6.532   45.254  17.036  1.00 67.77  ? 337  ARG B NE    1 
ATOM   7285  C CZ    . ARG B 1 337 ? 5.577   44.322  17.056  1.00 69.38  ? 337  ARG B CZ    1 
ATOM   7286  N NH1   . ARG B 1 337 ? 5.255   43.638  15.958  1.00 72.94  ? 337  ARG B NH1   1 
ATOM   7287  N NH2   . ARG B 1 337 ? 4.936   44.073  18.189  1.00 70.88  ? 337  ARG B NH2   1 
ATOM   7288  N N     . TRP B 1 338 ? 8.196   50.993  13.329  1.00 37.10  ? 338  TRP B N     1 
ATOM   7289  C CA    . TRP B 1 338 ? 7.599   52.243  12.805  1.00 36.92  ? 338  TRP B CA    1 
ATOM   7290  C C     . TRP B 1 338 ? 6.613   52.025  11.674  1.00 35.35  ? 338  TRP B C     1 
ATOM   7291  O O     . TRP B 1 338 ? 5.572   52.652  11.658  1.00 33.06  ? 338  TRP B O     1 
ATOM   7292  C CB    . TRP B 1 338 ? 8.656   53.213  12.292  1.00 36.22  ? 338  TRP B CB    1 
ATOM   7293  C CG    . TRP B 1 338 ? 9.437   53.894  13.336  1.00 36.11  ? 338  TRP B CG    1 
ATOM   7294  C CD1   . TRP B 1 338 ? 10.598  53.459  13.892  1.00 37.54  ? 338  TRP B CD1   1 
ATOM   7295  C CD2   . TRP B 1 338 ? 9.142   55.149  13.945  1.00 34.80  ? 338  TRP B CD2   1 
ATOM   7296  N NE1   . TRP B 1 338 ? 11.046  54.358  14.816  1.00 37.89  ? 338  TRP B NE1   1 
ATOM   7297  C CE2   . TRP B 1 338 ? 10.173  55.411  14.873  1.00 37.18  ? 338  TRP B CE2   1 
ATOM   7298  C CE3   . TRP B 1 338 ? 8.101   56.083  13.804  1.00 35.49  ? 338  TRP B CE3   1 
ATOM   7299  C CZ2   . TRP B 1 338 ? 10.207  56.575  15.652  1.00 34.23  ? 338  TRP B CZ2   1 
ATOM   7300  C CZ3   . TRP B 1 338 ? 8.122   57.228  14.586  1.00 35.45  ? 338  TRP B CZ3   1 
ATOM   7301  C CH2   . TRP B 1 338 ? 9.176   57.469  15.495  1.00 36.73  ? 338  TRP B CH2   1 
ATOM   7302  N N     . GLU B 1 339 ? 6.958   51.166  10.716  1.00 37.04  ? 339  GLU B N     1 
ATOM   7303  C CA    . GLU B 1 339 ? 6.035   50.844  9.631   1.00 36.77  ? 339  GLU B CA    1 
ATOM   7304  C C     . GLU B 1 339 ? 4.822   50.102  10.171  1.00 35.77  ? 339  GLU B C     1 
ATOM   7305  O O     . GLU B 1 339 ? 3.692   50.425  9.832   1.00 33.08  ? 339  GLU B O     1 
ATOM   7306  C CB    . GLU B 1 339 ? 6.688   49.980  8.565   1.00 36.69  ? 339  GLU B CB    1 
ATOM   7307  C CG    . GLU B 1 339 ? 5.821   49.864  7.302   1.00 37.69  ? 339  GLU B CG    1 
ATOM   7308  C CD    . GLU B 1 339 ? 5.505   51.230  6.681   1.00 43.57  ? 339  GLU B CD    1 
ATOM   7309  O OE1   . GLU B 1 339 ? 6.375   52.130  6.704   1.00 43.55  ? 339  GLU B OE1   1 
ATOM   7310  O OE2   . GLU B 1 339 ? 4.380   51.406  6.175   1.00 46.07  ? 339  GLU B OE2   1 
ATOM   7311  N N     . TYR B 1 340 ? 5.077   49.095  11.000  1.00 36.73  ? 340  TYR B N     1 
ATOM   7312  C CA    . TYR B 1 340 ? 4.026   48.261  11.576  1.00 36.92  ? 340  TYR B CA    1 
ATOM   7313  C C     . TYR B 1 340 ? 2.944   49.084  12.265  1.00 36.03  ? 340  TYR B C     1 
ATOM   7314  O O     . TYR B 1 340 ? 1.756   48.896  12.011  1.00 35.43  ? 340  TYR B O     1 
ATOM   7315  C CB    . TYR B 1 340 ? 4.623   47.267  12.588  1.00 38.93  ? 340  TYR B CB    1 
ATOM   7316  C CG    . TYR B 1 340 ? 3.586   46.443  13.324  1.00 39.45  ? 340  TYR B CG    1 
ATOM   7317  C CD1   . TYR B 1 340 ? 2.892   45.417  12.685  1.00 45.47  ? 340  TYR B CD1   1 
ATOM   7318  C CD2   . TYR B 1 340 ? 3.294   46.698  14.664  1.00 44.17  ? 340  TYR B CD2   1 
ATOM   7319  C CE1   . TYR B 1 340 ? 1.939   44.663  13.372  1.00 47.10  ? 340  TYR B CE1   1 
ATOM   7320  C CE2   . TYR B 1 340 ? 2.349   45.960  15.353  1.00 44.70  ? 340  TYR B CE2   1 
ATOM   7321  C CZ    . TYR B 1 340 ? 1.673   44.949  14.709  1.00 45.92  ? 340  TYR B CZ    1 
ATOM   7322  O OH    . TYR B 1 340 ? 0.738   44.235  15.422  1.00 45.83  ? 340  TYR B OH    1 
ATOM   7323  N N     . TYR B 1 341 ? 3.361   49.997  13.137  1.00 36.07  ? 341  TYR B N     1 
ATOM   7324  C CA    . TYR B 1 341 ? 2.414   50.846  13.867  1.00 35.51  ? 341  TYR B CA    1 
ATOM   7325  C C     . TYR B 1 341 ? 1.794   51.937  13.004  1.00 33.67  ? 341  TYR B C     1 
ATOM   7326  O O     . TYR B 1 341 ? 0.655   52.287  13.234  1.00 32.92  ? 341  TYR B O     1 
ATOM   7327  C CB    . TYR B 1 341 ? 3.027   51.475  15.152  1.00 37.58  ? 341  TYR B CB    1 
ATOM   7328  C CG    . TYR B 1 341 ? 3.342   50.475  16.267  1.00 39.17  ? 341  TYR B CG    1 
ATOM   7329  C CD1   . TYR B 1 341 ? 2.432   49.476  16.624  1.00 41.31  ? 341  TYR B CD1   1 
ATOM   7330  C CD2   . TYR B 1 341 ? 4.551   50.522  16.948  1.00 40.52  ? 341  TYR B CD2   1 
ATOM   7331  C CE1   . TYR B 1 341 ? 2.728   48.561  17.616  1.00 39.87  ? 341  TYR B CE1   1 
ATOM   7332  C CE2   . TYR B 1 341 ? 4.855   49.608  17.933  1.00 40.77  ? 341  TYR B CE2   1 
ATOM   7333  C CZ    . TYR B 1 341 ? 3.945   48.632  18.264  1.00 39.32  ? 341  TYR B CZ    1 
ATOM   7334  O OH    . TYR B 1 341 ? 4.257   47.719  19.243  1.00 41.79  ? 341  TYR B OH    1 
ATOM   7335  N N     . LEU B 1 342 ? 2.525   52.482  12.030  1.00 33.82  ? 342  LEU B N     1 
ATOM   7336  C CA    . LEU B 1 342 ? 1.920   53.432  11.090  1.00 34.25  ? 342  LEU B CA    1 
ATOM   7337  C C     . LEU B 1 342 ? 0.749   52.793  10.341  1.00 35.15  ? 342  LEU B C     1 
ATOM   7338  O O     . LEU B 1 342 ? -0.301  53.411  10.217  1.00 33.34  ? 342  LEU B O     1 
ATOM   7339  C CB    . LEU B 1 342 ? 2.930   53.981  10.078  1.00 34.40  ? 342  LEU B CB    1 
ATOM   7340  C CG    . LEU B 1 342 ? 2.284   54.886  9.001   1.00 32.55  ? 342  LEU B CG    1 
ATOM   7341  C CD1   . LEU B 1 342 ? 1.510   56.067  9.606   1.00 29.44  ? 342  LEU B CD1   1 
ATOM   7342  C CD2   . LEU B 1 342 ? 3.310   55.377  8.037   1.00 33.13  ? 342  LEU B CD2   1 
ATOM   7343  N N     . LYS B 1 343 ? 0.949   51.567  9.840   1.00 37.04  ? 343  LYS B N     1 
ATOM   7344  C CA    . LYS B 1 343 ? -0.092  50.818  9.130   1.00 37.70  ? 343  LYS B CA    1 
ATOM   7345  C C     . LYS B 1 343 ? -1.321  50.519  9.990   1.00 36.02  ? 343  LYS B C     1 
ATOM   7346  O O     . LYS B 1 343 ? -2.453  50.715  9.554   1.00 33.23  ? 343  LYS B O     1 
ATOM   7347  C CB    . LYS B 1 343 ? 0.484   49.527  8.525   1.00 39.47  ? 343  LYS B CB    1 
ATOM   7348  C CG    . LYS B 1 343 ? 0.879   49.692  7.046   1.00 43.71  ? 343  LYS B CG    1 
ATOM   7349  C CD    . LYS B 1 343 ? 1.864   48.615  6.543   1.00 45.08  ? 343  LYS B CD    1 
ATOM   7350  C CE    . LYS B 1 343 ? 2.210   48.808  5.045   1.00 45.50  ? 343  LYS B CE    1 
ATOM   7351  N NZ    . LYS B 1 343 ? 3.442   48.086  4.649   1.00 45.34  ? 343  LYS B NZ    1 
ATOM   7352  N N     . GLN B 1 344 ? -1.113  50.051  11.211  1.00 36.80  ? 344  GLN B N     1 
ATOM   7353  C CA    . GLN B 1 344 ? -2.228  49.856  12.146  1.00 40.13  ? 344  GLN B CA    1 
ATOM   7354  C C     . GLN B 1 344 ? -3.036  51.146  12.417  1.00 40.25  ? 344  GLN B C     1 
ATOM   7355  O O     . GLN B 1 344 ? -4.258  51.094  12.537  1.00 40.68  ? 344  GLN B O     1 
ATOM   7356  C CB    . GLN B 1 344 ? -1.718  49.259  13.451  1.00 40.31  ? 344  GLN B CB    1 
ATOM   7357  C CG    . GLN B 1 344 ? -1.239  47.834  13.295  1.00 44.21  ? 344  GLN B CG    1 
ATOM   7358  C CD    . GLN B 1 344 ? -0.919  47.194  14.621  1.00 46.91  ? 344  GLN B CD    1 
ATOM   7359  O OE1   . GLN B 1 344 ? -0.146  47.737  15.416  1.00 62.31  ? 344  GLN B OE1   1 
ATOM   7360  N NE2   . GLN B 1 344 ? -1.528  46.041  14.885  1.00 58.69  ? 344  GLN B NE2   1 
ATOM   7361  N N     . LEU B 1 345 ? -2.358  52.293  12.500  1.00 40.41  ? 345  LEU B N     1 
ATOM   7362  C CA    . LEU B 1 345 ? -3.043  53.590  12.642  1.00 40.81  ? 345  LEU B CA    1 
ATOM   7363  C C     . LEU B 1 345 ? -3.798  53.996  11.389  1.00 41.10  ? 345  LEU B C     1 
ATOM   7364  O O     . LEU B 1 345 ? -4.827  54.633  11.474  1.00 41.13  ? 345  LEU B O     1 
ATOM   7365  C CB    . LEU B 1 345 ? -2.073  54.720  12.978  1.00 41.06  ? 345  LEU B CB    1 
ATOM   7366  C CG    . LEU B 1 345 ? -1.635  54.899  14.425  1.00 40.12  ? 345  LEU B CG    1 
ATOM   7367  C CD1   . LEU B 1 345 ? -0.364  55.748  14.449  1.00 41.30  ? 345  LEU B CD1   1 
ATOM   7368  C CD2   . LEU B 1 345 ? -2.742  55.512  15.296  1.00 41.08  ? 345  LEU B CD2   1 
ATOM   7369  N N     . GLN B 1 346 ? -3.257  53.679  10.221  1.00 43.09  ? 346  GLN B N     1 
ATOM   7370  C CA    . GLN B 1 346 ? -3.927  53.994  8.963   1.00 45.21  ? 346  GLN B CA    1 
ATOM   7371  C C     . GLN B 1 346 ? -5.089  53.041  8.661   1.00 47.87  ? 346  GLN B C     1 
ATOM   7372  O O     . GLN B 1 346 ? -6.068  53.446  8.035   1.00 48.37  ? 346  GLN B O     1 
ATOM   7373  C CB    . GLN B 1 346 ? -2.924  53.970  7.812   1.00 44.89  ? 346  GLN B CB    1 
ATOM   7374  C CG    . GLN B 1 346 ? -1.952  55.153  7.797   1.00 44.07  ? 346  GLN B CG    1 
ATOM   7375  C CD    . GLN B 1 346 ? -0.872  55.001  6.743   1.00 43.81  ? 346  GLN B CD    1 
ATOM   7376  O OE1   . GLN B 1 346 ? -0.563  53.889  6.322   1.00 43.02  ? 346  GLN B OE1   1 
ATOM   7377  N NE2   . GLN B 1 346 ? -0.281  56.119  6.322   1.00 38.03  ? 346  GLN B NE2   1 
ATOM   7378  N N     . ASN B 1 347 ? -4.974  51.782  9.094   1.00 50.29  ? 347  ASN B N     1 
ATOM   7379  C CA    . ASN B 1 347 ? -6.035  50.782  8.892   1.00 51.50  ? 347  ASN B CA    1 
ATOM   7380  C C     . ASN B 1 347 ? -6.794  50.600  10.209  1.00 52.27  ? 347  ASN B C     1 
ATOM   7381  O O     . ASN B 1 347 ? -6.527  49.682  10.982  1.00 52.96  ? 347  ASN B O     1 
ATOM   7382  C CB    . ASN B 1 347 ? -5.477  49.469  8.266   1.00 53.47  ? 347  ASN B CB    1 
ATOM   7383  C CG    . ASN B 1 347 ? -5.618  48.234  9.171   1.00 57.66  ? 347  ASN B CG    1 
ATOM   7384  O OD1   . ASN B 1 347 ? -6.296  47.265  8.811   1.00 61.16  ? 347  ASN B OD1   1 
ATOM   7385  N ND2   . ASN B 1 347 ? -4.960  48.258  10.331  1.00 58.97  ? 347  ASN B ND2   1 
ATOM   7386  N N     . LYS B 1 348 ? -7.728  51.517  10.460  1.00 53.02  ? 348  LYS B N     1 
ATOM   7387  C CA    . LYS B 1 348 ? -8.420  51.604  11.756  1.00 53.66  ? 348  LYS B CA    1 
ATOM   7388  C C     . LYS B 1 348 ? -9.512  50.541  11.878  1.00 54.42  ? 348  LYS B C     1 
ATOM   7389  O O     . LYS B 1 348 ? -10.458 50.505  11.089  1.00 55.01  ? 348  LYS B O     1 
ATOM   7390  C CB    . LYS B 1 348 ? -8.977  53.015  11.995  1.00 53.26  ? 348  LYS B CB    1 
ATOM   7391  C CG    . LYS B 1 348 ? -7.872  53.993  12.347  1.00 53.11  ? 348  LYS B CG    1 
ATOM   7392  C CD    . LYS B 1 348 ? -8.282  55.456  12.302  1.00 54.83  ? 348  LYS B CD    1 
ATOM   7393  C CE    . LYS B 1 348 ? -7.035  56.345  12.152  1.00 55.03  ? 348  LYS B CE    1 
ATOM   7394  N NZ    . LYS B 1 348 ? -7.256  57.805  12.257  1.00 55.46  ? 348  LYS B NZ    1 
ATOM   7395  N N     . GLN B 1 349 ? -9.348  49.664  12.863  1.00 54.91  ? 349  GLN B N     1 
ATOM   7396  C CA    . GLN B 1 349 ? -10.203 48.497  13.029  1.00 56.11  ? 349  GLN B CA    1 
ATOM   7397  C C     . GLN B 1 349 ? -11.192 48.581  14.186  1.00 55.39  ? 349  GLN B C     1 
ATOM   7398  O O     . GLN B 1 349 ? -12.121 47.782  14.244  1.00 55.58  ? 349  GLN B O     1 
ATOM   7399  C CB    . GLN B 1 349 ? -9.329  47.252  13.212  1.00 56.29  ? 349  GLN B CB    1 
ATOM   7400  C CG    . GLN B 1 349 ? -8.701  46.756  11.923  1.00 57.62  ? 349  GLN B CG    1 
ATOM   7401  C CD    . GLN B 1 349 ? -7.648  45.694  12.173  1.00 59.03  ? 349  GLN B CD    1 
ATOM   7402  O OE1   . GLN B 1 349 ? -6.680  45.928  12.895  1.00 63.32  ? 349  GLN B OE1   1 
ATOM   7403  N NE2   . GLN B 1 349 ? -7.832  44.517  11.575  1.00 63.50  ? 349  GLN B NE2   1 
ATOM   7404  N N     . PHE B 1 350 ? -11.006 49.530  15.098  1.00 54.71  ? 350  PHE B N     1 
ATOM   7405  C CA    . PHE B 1 350 ? -11.852 49.606  16.282  1.00 56.88  ? 350  PHE B CA    1 
ATOM   7406  C C     . PHE B 1 350 ? -13.256 50.115  15.944  1.00 58.88  ? 350  PHE B C     1 
ATOM   7407  O O     . PHE B 1 350 ? -13.433 51.038  15.142  1.00 58.64  ? 350  PHE B O     1 
ATOM   7408  C CB    . PHE B 1 350 ? -11.203 50.472  17.364  1.00 52.82  ? 350  PHE B CB    1 
ATOM   7409  C CG    . PHE B 1 350 ? -11.887 50.391  18.689  1.00 49.41  ? 350  PHE B CG    1 
ATOM   7410  C CD1   . PHE B 1 350 ? -11.582 49.370  19.582  1.00 43.90  ? 350  PHE B CD1   1 
ATOM   7411  C CD2   . PHE B 1 350 ? -12.837 51.335  19.046  1.00 39.42  ? 350  PHE B CD2   1 
ATOM   7412  C CE1   . PHE B 1 350 ? -12.214 49.295  20.831  1.00 45.18  ? 350  PHE B CE1   1 
ATOM   7413  C CE2   . PHE B 1 350 ? -13.481 51.277  20.284  1.00 42.81  ? 350  PHE B CE2   1 
ATOM   7414  C CZ    . PHE B 1 350 ? -13.168 50.253  21.185  1.00 43.85  ? 350  PHE B CZ    1 
ATOM   7415  N N     . LYS B 1 351 ? -14.249 49.494  16.580  1.00 61.64  ? 351  LYS B N     1 
ATOM   7416  C CA    . LYS B 1 351 ? -15.657 49.778  16.302  1.00 63.11  ? 351  LYS B CA    1 
ATOM   7417  C C     . LYS B 1 351 ? -16.405 50.402  17.490  1.00 64.87  ? 351  LYS B C     1 
ATOM   7418  O O     . LYS B 1 351 ? -16.634 49.767  18.521  1.00 64.64  ? 351  LYS B O     1 
ATOM   7419  C CB    . LYS B 1 351 ? -16.351 48.516  15.785  1.00 62.72  ? 351  LYS B CB    1 
ATOM   7420  C CG    . LYS B 1 351 ? -15.973 48.225  14.337  1.00 60.03  ? 351  LYS B CG    1 
ATOM   7421  C CD    . LYS B 1 351 ? -15.893 46.752  14.058  1.00 61.86  ? 351  LYS B CD    1 
ATOM   7422  C CE    . LYS B 1 351 ? -15.076 46.493  12.814  1.00 62.81  ? 351  LYS B CE    1 
ATOM   7423  N NZ    . LYS B 1 351 ? -15.480 45.220  12.171  1.00 61.41  ? 351  LYS B NZ    1 
ATOM   7424  N N     . ARG B 1 352 ? -16.758 51.670  17.291  1.00 67.15  ? 352  ARG B N     1 
ATOM   7425  C CA    . ARG B 1 352 ? -17.525 52.486  18.215  1.00 68.77  ? 352  ARG B CA    1 
ATOM   7426  C C     . ARG B 1 352 ? -19.015 52.234  18.091  1.00 71.24  ? 352  ARG B C     1 
ATOM   7427  O O     . ARG B 1 352 ? -19.609 52.575  17.074  1.00 71.49  ? 352  ARG B O     1 
ATOM   7428  C CB    . ARG B 1 352 ? -17.309 53.957  17.865  1.00 68.08  ? 352  ARG B CB    1 
ATOM   7429  C CG    . ARG B 1 352 ? -16.213 54.606  18.616  1.00 64.01  ? 352  ARG B CG    1 
ATOM   7430  C CD    . ARG B 1 352 ? -16.741 55.176  19.886  1.00 51.54  ? 352  ARG B CD    1 
ATOM   7431  N NE    . ARG B 1 352 ? -15.665 55.279  20.840  1.00 50.01  ? 352  ARG B NE    1 
ATOM   7432  C CZ    . ARG B 1 352 ? -15.832 55.328  22.149  1.00 42.74  ? 352  ARG B CZ    1 
ATOM   7433  N NH1   . ARG B 1 352 ? -17.054 55.333  22.686  1.00 49.24  ? 352  ARG B NH1   1 
ATOM   7434  N NH2   . ARG B 1 352 ? -14.763 55.388  22.917  1.00 42.29  ? 352  ARG B NH2   1 
ATOM   7435  N N     . ILE B 1 353 ? -19.622 51.684  19.135  1.00 74.52  ? 353  ILE B N     1 
ATOM   7436  C CA    . ILE B 1 353 ? -21.078 51.617  19.230  1.00 76.64  ? 353  ILE B CA    1 
ATOM   7437  C C     . ILE B 1 353 ? -21.656 52.988  19.639  1.00 78.75  ? 353  ILE B C     1 
ATOM   7438  O O     . ILE B 1 353 ? -22.518 53.511  18.927  1.00 78.86  ? 353  ILE B O     1 
ATOM   7439  C CB    . ILE B 1 353 ? -21.529 50.507  20.203  1.00 77.28  ? 353  ILE B CB    1 
ATOM   7440  C CG1   . ILE B 1 353 ? -21.064 49.137  19.689  1.00 78.33  ? 353  ILE B CG1   1 
ATOM   7441  C CG2   . ILE B 1 353 ? -23.049 50.513  20.380  1.00 75.41  ? 353  ILE B CG2   1 
ATOM   7442  C CD1   . ILE B 1 353 ? -20.940 48.080  20.790  1.00 79.01  ? 353  ILE B CD1   1 
ATOM   7443  N N     . ARG B 1 354 ? -21.193 53.568  20.757  1.00 80.35  ? 354  ARG B N     1 
ATOM   7444  C CA    . ARG B 1 354 ? -21.645 54.919  21.162  1.00 81.45  ? 354  ARG B CA    1 
ATOM   7445  C C     . ARG B 1 354 ? -20.873 56.021  20.436  1.00 82.23  ? 354  ARG B C     1 
ATOM   7446  O O     . ARG B 1 354 ? -19.774 56.393  20.853  1.00 81.85  ? 354  ARG B O     1 
ATOM   7447  C CB    . ARG B 1 354 ? -21.538 55.155  22.676  1.00 82.25  ? 354  ARG B CB    1 
ATOM   7448  C CG    . ARG B 1 354 ? -22.046 56.562  23.108  1.00 82.97  ? 354  ARG B CG    1 
ATOM   7449  C CD    . ARG B 1 354 ? -21.293 57.163  24.309  1.00 83.38  ? 354  ARG B CD    1 
ATOM   7450  N NE    . ARG B 1 354 ? -21.973 56.933  25.591  1.00 89.80  ? 354  ARG B NE    1 
ATOM   7451  C CZ    . ARG B 1 354 ? -21.492 57.283  26.791  1.00 90.17  ? 354  ARG B CZ    1 
ATOM   7452  N NH1   . ARG B 1 354 ? -20.311 57.889  26.903  1.00 93.39  ? 354  ARG B NH1   1 
ATOM   7453  N NH2   . ARG B 1 354 ? -22.192 57.021  27.893  1.00 88.32  ? 354  ARG B NH2   1 
ATOM   7454  N N     . LYS B 1 355 ? -21.474 56.548  19.368  1.00 83.66  ? 355  LYS B N     1 
ATOM   7455  C CA    . LYS B 1 355 ? -20.920 57.680  18.604  1.00 84.40  ? 355  LYS B CA    1 
ATOM   7456  C C     . LYS B 1 355 ? -21.285 59.002  19.290  1.00 85.96  ? 355  LYS B C     1 
ATOM   7457  O O     . LYS B 1 355 ? -22.467 59.361  19.363  1.00 87.78  ? 355  LYS B O     1 
ATOM   7458  C CB    . LYS B 1 355 ? -21.472 57.669  17.167  1.00 84.33  ? 355  LYS B CB    1 
ATOM   7459  C CG    . LYS B 1 355 ? -21.036 58.847  16.278  1.00 83.56  ? 355  LYS B CG    1 
ATOM   7460  C CD    . LYS B 1 355 ? -22.059 59.139  15.165  1.00 82.92  ? 355  LYS B CD    1 
ATOM   7461  C CE    . LYS B 1 355 ? -23.305 59.851  15.707  1.00 79.50  ? 355  LYS B CE    1 
ATOM   7462  N NZ    . LYS B 1 355 ? -24.216 60.332  14.634  1.00 78.29  ? 355  LYS B NZ    1 
ATOM   7463  N N     . SER B 1 356 ? -20.273 59.731  19.763  1.00 85.96  ? 356  SER B N     1 
ATOM   7464  C CA    . SER B 1 356 ? -20.484 60.998  20.480  1.00 85.62  ? 356  SER B CA    1 
ATOM   7465  C C     . SER B 1 356 ? -20.676 62.241  19.583  1.00 85.62  ? 356  SER B C     1 
ATOM   7466  O O     . SER B 1 356 ? -20.530 62.196  18.348  1.00 84.97  ? 356  SER B O     1 
ATOM   7467  C CB    . SER B 1 356 ? -19.316 61.253  21.435  1.00 86.75  ? 356  SER B CB    1 
ATOM   7468  O OG    . SER B 1 356 ? -19.579 62.352  22.294  1.00 89.38  ? 356  SER B OG    1 
ATOM   7469  N N     . SER B 1 357 ? -21.002 63.352  20.243  1.00 84.63  ? 357  SER B N     1 
ATOM   7470  C CA    . SER B 1 357 ? -21.182 64.644  19.588  1.00 83.32  ? 357  SER B CA    1 
ATOM   7471  C C     . SER B 1 357 ? -19.854 65.401  19.486  1.00 81.39  ? 357  SER B C     1 
ATOM   7472  O O     . SER B 1 357 ? -19.326 65.569  18.386  1.00 80.49  ? 357  SER B O     1 
ATOM   7473  C CB    . SER B 1 357 ? -22.219 65.491  20.350  1.00 84.57  ? 357  SER B CB    1 
ATOM   7474  O OG    . SER B 1 357 ? -22.399 66.763  19.741  1.00 86.18  ? 357  SER B OG    1 
ATOM   7475  N N     . SER B 1 358 ? -19.306 65.820  20.630  1.00 78.73  ? 358  SER B N     1 
ATOM   7476  C CA    . SER B 1 358 ? -18.226 66.832  20.660  1.00 76.81  ? 358  SER B CA    1 
ATOM   7477  C C     . SER B 1 358 ? -16.754 66.346  20.627  1.00 73.43  ? 358  SER B C     1 
ATOM   7478  O O     . SER B 1 358 ? -15.854 67.155  20.871  1.00 73.48  ? 358  SER B O     1 
ATOM   7479  C CB    . SER B 1 358 ? -18.430 67.783  21.861  1.00 77.65  ? 358  SER B CB    1 
ATOM   7480  O OG    . SER B 1 358 ? -18.173 67.138  23.098  1.00 79.50  ? 358  SER B OG    1 
ATOM   7481  N N     . TYR B 1 359 ? -16.499 65.071  20.310  1.00 69.20  ? 359  TYR B N     1 
ATOM   7482  C CA    . TYR B 1 359 ? -15.111 64.555  20.220  1.00 67.55  ? 359  TYR B CA    1 
ATOM   7483  C C     . TYR B 1 359 ? -14.892 63.562  19.066  1.00 65.68  ? 359  TYR B C     1 
ATOM   7484  O O     . TYR B 1 359 ? -15.755 62.691  18.847  1.00 66.18  ? 359  TYR B O     1 
ATOM   7485  C CB    . TYR B 1 359 ? -14.679 63.883  21.541  1.00 64.89  ? 359  TYR B CB    1 
ATOM   7486  C CG    . TYR B 1 359 ? -13.200 63.548  21.542  1.00 66.30  ? 359  TYR B CG    1 
ATOM   7487  C CD1   . TYR B 1 359 ? -12.240 64.560  21.676  1.00 63.50  ? 359  TYR B CD1   1 
ATOM   7488  C CD2   . TYR B 1 359 ? -12.752 62.231  21.364  1.00 60.08  ? 359  TYR B CD2   1 
ATOM   7489  C CE1   . TYR B 1 359 ? -10.867 64.272  21.649  1.00 60.00  ? 359  TYR B CE1   1 
ATOM   7490  C CE2   . TYR B 1 359 ? -11.380 61.928  21.337  1.00 58.23  ? 359  TYR B CE2   1 
ATOM   7491  C CZ    . TYR B 1 359 ? -10.440 62.957  21.476  1.00 62.03  ? 359  TYR B CZ    1 
ATOM   7492  O OH    . TYR B 1 359 ? -9.080  62.679  21.455  1.00 59.50  ? 359  TYR B OH    1 
ATOM   7493  N N     . ASP B 1 360 ? -13.746 63.663  18.354  1.00 62.22  ? 360  ASP B N     1 
ATOM   7494  C CA    . ASP B 1 360 ? -13.386 62.622  17.381  1.00 60.23  ? 360  ASP B CA    1 
ATOM   7495  C C     . ASP B 1 360 ? -12.433 61.588  17.983  1.00 57.13  ? 360  ASP B C     1 
ATOM   7496  O O     . ASP B 1 360 ? -11.249 61.855  18.196  1.00 55.45  ? 360  ASP B O     1 
ATOM   7497  C CB    . ASP B 1 360 ? -12.797 63.180  16.093  1.00 61.32  ? 360  ASP B CB    1 
ATOM   7498  C CG    . ASP B 1 360 ? -12.487 62.082  15.102  1.00 62.30  ? 360  ASP B CG    1 
ATOM   7499  O OD1   . ASP B 1 360 ? -13.434 61.385  14.678  1.00 59.55  ? 360  ASP B OD1   1 
ATOM   7500  O OD2   . ASP B 1 360 ? -11.293 61.891  14.790  1.00 66.84  ? 360  ASP B OD2   1 
ATOM   7501  N N     . TYR B 1 361 ? -12.988 60.402  18.220  1.00 55.26  ? 361  TYR B N     1 
ATOM   7502  C CA    . TYR B 1 361 ? -12.325 59.294  18.913  1.00 54.28  ? 361  TYR B CA    1 
ATOM   7503  C C     . TYR B 1 361 ? -11.367 58.481  18.057  1.00 51.30  ? 361  TYR B C     1 
ATOM   7504  O O     . TYR B 1 361 ? -10.477 57.812  18.576  1.00 52.42  ? 361  TYR B O     1 
ATOM   7505  C CB    . TYR B 1 361 ? -13.375 58.302  19.438  1.00 54.92  ? 361  TYR B CB    1 
ATOM   7506  C CG    . TYR B 1 361 ? -14.108 58.774  20.651  1.00 57.32  ? 361  TYR B CG    1 
ATOM   7507  C CD1   . TYR B 1 361 ? -13.518 58.697  21.921  1.00 60.64  ? 361  TYR B CD1   1 
ATOM   7508  C CD2   . TYR B 1 361 ? -15.385 59.295  20.546  1.00 59.84  ? 361  TYR B CD2   1 
ATOM   7509  C CE1   . TYR B 1 361 ? -14.190 59.134  23.048  1.00 56.69  ? 361  TYR B CE1   1 
ATOM   7510  C CE2   . TYR B 1 361 ? -16.064 59.738  21.664  1.00 60.63  ? 361  TYR B CE2   1 
ATOM   7511  C CZ    . TYR B 1 361 ? -15.467 59.655  22.913  1.00 58.67  ? 361  TYR B CZ    1 
ATOM   7512  O OH    . TYR B 1 361 ? -16.162 60.105  24.004  1.00 57.21  ? 361  TYR B OH    1 
ATOM   7513  N N     . GLU B 1 362 ? -11.572 58.518  16.758  1.00 47.46  ? 362  GLU B N     1 
ATOM   7514  C CA    . GLU B 1 362 ? -10.933 57.587  15.841  1.00 46.69  ? 362  GLU B CA    1 
ATOM   7515  C C     . GLU B 1 362 ? -9.494  57.228  16.202  1.00 41.32  ? 362  GLU B C     1 
ATOM   7516  O O     . GLU B 1 362 ? -9.162  56.057  16.341  1.00 38.59  ? 362  GLU B O     1 
ATOM   7517  C CB    . GLU B 1 362 ? -10.937 58.171  14.431  1.00 45.93  ? 362  GLU B CB    1 
ATOM   7518  C CG    . GLU B 1 362 ? -11.946 57.555  13.499  1.00 52.04  ? 362  GLU B CG    1 
ATOM   7519  C CD    . GLU B 1 362 ? -11.792 58.095  12.075  1.00 53.67  ? 362  GLU B CD    1 
ATOM   7520  O OE1   . GLU B 1 362 ? -10.992 59.049  11.863  1.00 63.30  ? 362  GLU B OE1   1 
ATOM   7521  O OE2   . GLU B 1 362 ? -12.470 57.558  11.168  1.00 65.83  ? 362  GLU B OE2   1 
ATOM   7522  N N     . ALA B 1 363 ? -8.651  58.253  16.307  1.00 38.91  ? 363  ALA B N     1 
ATOM   7523  C CA    . ALA B 1 363 ? -7.235  58.073  16.529  1.00 38.15  ? 363  ALA B CA    1 
ATOM   7524  C C     . ALA B 1 363 ? -6.969  57.606  17.961  1.00 34.40  ? 363  ALA B C     1 
ATOM   7525  O O     . ALA B 1 363 ? -6.166  56.697  18.194  1.00 32.54  ? 363  ALA B O     1 
ATOM   7526  C CB    . ALA B 1 363 ? -6.518  59.360  16.257  1.00 38.05  ? 363  ALA B CB    1 
ATOM   7527  N N     . LEU B 1 364 ? -7.632  58.232  18.924  1.00 33.78  ? 364  LEU B N     1 
ATOM   7528  C CA    . LEU B 1 364 ? -7.459  57.826  20.322  1.00 33.96  ? 364  LEU B CA    1 
ATOM   7529  C C     . LEU B 1 364 ? -7.853  56.374  20.553  1.00 31.66  ? 364  LEU B C     1 
ATOM   7530  O O     . LEU B 1 364 ? -7.127  55.609  21.215  1.00 28.10  ? 364  LEU B O     1 
ATOM   7531  C CB    . LEU B 1 364 ? -8.288  58.681  21.269  1.00 32.87  ? 364  LEU B CB    1 
ATOM   7532  C CG    . LEU B 1 364 ? -8.088  58.225  22.731  1.00 37.84  ? 364  LEU B CG    1 
ATOM   7533  C CD1   . LEU B 1 364 ? -6.686  58.569  23.328  1.00 35.33  ? 364  LEU B CD1   1 
ATOM   7534  C CD2   . LEU B 1 364 ? -9.153  58.799  23.571  1.00 39.68  ? 364  LEU B CD2   1 
ATOM   7535  N N     . ASP B 1 365 ? -9.024  56.011  20.031  1.00 31.22  ? 365  ASP B N     1 
ATOM   7536  C CA    . ASP B 1 365 ? -9.520  54.655  20.132  1.00 31.20  ? 365  ASP B CA    1 
ATOM   7537  C C     . ASP B 1 365 ? -8.521  53.647  19.570  1.00 30.78  ? 365  ASP B C     1 
ATOM   7538  O O     . ASP B 1 365 ? -8.279  52.607  20.187  1.00 32.10  ? 365  ASP B O     1 
ATOM   7539  C CB    . ASP B 1 365 ? -10.824 54.521  19.351  1.00 32.13  ? 365  ASP B CB    1 
ATOM   7540  C CG    . ASP B 1 365 ? -12.065 54.880  20.163  1.00 35.73  ? 365  ASP B CG    1 
ATOM   7541  O OD1   . ASP B 1 365 ? -11.997 55.170  21.387  1.00 37.92  ? 365  ASP B OD1   1 
ATOM   7542  O OD2   . ASP B 1 365 ? -13.149 54.829  19.535  1.00 43.47  ? 365  ASP B OD2   1 
ATOM   7543  N N     . GLU B 1 366 ? -7.977  53.942  18.385  1.00 28.87  ? 366  GLU B N     1 
ATOM   7544  C CA    . GLU B 1 366 ? -7.053  53.018  17.728  1.00 29.28  ? 366  GLU B CA    1 
ATOM   7545  C C     . GLU B 1 366 ? -5.737  52.905  18.475  1.00 28.99  ? 366  GLU B C     1 
ATOM   7546  O O     . GLU B 1 366 ? -5.235  51.803  18.673  1.00 28.77  ? 366  GLU B O     1 
ATOM   7547  C CB    . GLU B 1 366 ? -6.793  53.424  16.279  1.00 29.44  ? 366  GLU B CB    1 
ATOM   7548  C CG    . GLU B 1 366 ? -6.452  52.217  15.389  1.00 32.74  ? 366  GLU B CG    1 
ATOM   7549  C CD    . GLU B 1 366 ? -7.593  51.181  15.306  1.00 38.44  ? 366  GLU B CD    1 
ATOM   7550  O OE1   . GLU B 1 366 ? -8.794  51.547  15.451  1.00 32.05  ? 366  GLU B OE1   1 
ATOM   7551  O OE2   . GLU B 1 366 ? -7.272  49.991  15.081  1.00 41.96  ? 366  GLU B OE2   1 
ATOM   7552  N N     . ALA B 1 367 ? -5.202  54.050  18.894  1.00 28.37  ? 367  ALA B N     1 
ATOM   7553  C CA    . ALA B 1 367 ? -4.008  54.102  19.711  1.00 28.66  ? 367  ALA B CA    1 
ATOM   7554  C C     . ALA B 1 367 ? -4.192  53.319  21.015  1.00 26.57  ? 367  ALA B C     1 
ATOM   7555  O O     . ALA B 1 367 ? -3.302  52.592  21.454  1.00 25.54  ? 367  ALA B O     1 
ATOM   7556  C CB    . ALA B 1 367 ? -3.639  55.564  20.014  1.00 29.39  ? 367  ALA B CB    1 
ATOM   7557  N N     . MET B 1 368 ? -5.332  53.513  21.660  1.00 25.38  ? 368  MET B N     1 
ATOM   7558  C CA    . MET B 1 368 ? -5.606  52.795  22.889  1.00 26.44  ? 368  MET B CA    1 
ATOM   7559  C C     . MET B 1 368 ? -5.676  51.267  22.602  1.00 28.06  ? 368  MET B C     1 
ATOM   7560  O O     . MET B 1 368 ? -5.107  50.428  23.322  1.00 26.84  ? 368  MET B O     1 
ATOM   7561  C CB    . MET B 1 368 ? -6.902  53.306  23.502  1.00 28.18  ? 368  MET B CB    1 
ATOM   7562  C CG    . MET B 1 368 ? -6.753  54.586  24.341  1.00 25.43  ? 368  MET B CG    1 
ATOM   7563  S SD    . MET B 1 368 ? -5.691  54.333  25.788  1.00 26.94  ? 368  MET B SD    1 
ATOM   7564  C CE    . MET B 1 368 ? -6.742  53.251  26.756  1.00 25.32  ? 368  MET B CE    1 
ATOM   7565  N N     . SER B 1 369 ? -6.328  50.927  21.505  1.00 27.53  ? 369  SER B N     1 
ATOM   7566  C CA    . SER B 1 369 ? -6.507  49.539  21.113  1.00 28.49  ? 369  SER B CA    1 
ATOM   7567  C C     . SER B 1 369 ? -5.161  48.817  20.824  1.00 29.17  ? 369  SER B C     1 
ATOM   7568  O O     . SER B 1 369 ? -4.901  47.696  21.307  1.00 26.91  ? 369  SER B O     1 
ATOM   7569  C CB    . SER B 1 369 ? -7.420  49.495  19.895  1.00 28.34  ? 369  SER B CB    1 
ATOM   7570  O OG    . SER B 1 369 ? -7.685  48.180  19.526  1.00 33.52  ? 369  SER B OG    1 
ATOM   7571  N N     . ILE B 1 370 ? -4.298  49.481  20.062  1.00 28.93  ? 370  ILE B N     1 
ATOM   7572  C CA    . ILE B 1 370 ? -2.987  48.953  19.759  1.00 29.19  ? 370  ILE B CA    1 
ATOM   7573  C C     . ILE B 1 370 ? -2.158  48.823  21.037  1.00 28.51  ? 370  ILE B C     1 
ATOM   7574  O O     . ILE B 1 370 ? -1.468  47.816  21.237  1.00 29.21  ? 370  ILE B O     1 
ATOM   7575  C CB    . ILE B 1 370 ? -2.210  49.853  18.752  1.00 27.36  ? 370  ILE B CB    1 
ATOM   7576  C CG1   . ILE B 1 370 ? -2.885  49.882  17.380  1.00 30.47  ? 370  ILE B CG1   1 
ATOM   7577  C CG2   . ILE B 1 370 ? -0.776  49.368  18.585  1.00 29.57  ? 370  ILE B CG2   1 
ATOM   7578  C CD1   . ILE B 1 370 ? -2.437  51.069  16.500  1.00 31.71  ? 370  ILE B CD1   1 
ATOM   7579  N N     . SER B 1 371 ? -2.185  49.856  21.872  1.00 28.40  ? 371  SER B N     1 
ATOM   7580  C CA    . SER B 1 371 ? -1.391  49.877  23.096  1.00 28.67  ? 371  SER B CA    1 
ATOM   7581  C C     . SER B 1 371 ? -1.822  48.762  24.071  1.00 29.38  ? 371  SER B C     1 
ATOM   7582  O O     . SER B 1 371 ? -1.008  47.996  24.596  1.00 29.41  ? 371  SER B O     1 
ATOM   7583  C CB    . SER B 1 371 ? -1.507  51.237  23.753  1.00 26.50  ? 371  SER B CB    1 
ATOM   7584  O OG    . SER B 1 371 ? -0.573  51.323  24.805  1.00 29.13  ? 371  SER B OG    1 
ATOM   7585  N N     . VAL B 1 372 ? -3.121  48.668  24.285  1.00 29.49  ? 372  VAL B N     1 
ATOM   7586  C CA    . VAL B 1 372 ? -3.677  47.605  25.106  1.00 30.88  ? 372  VAL B CA    1 
ATOM   7587  C C     . VAL B 1 372 ? -3.303  46.205  24.561  1.00 32.40  ? 372  VAL B C     1 
ATOM   7588  O O     . VAL B 1 372 ? -2.932  45.305  25.343  1.00 31.59  ? 372  VAL B O     1 
ATOM   7589  C CB    . VAL B 1 372 ? -5.204  47.765  25.217  1.00 29.78  ? 372  VAL B CB    1 
ATOM   7590  C CG1   . VAL B 1 372 ? -5.859  46.502  25.778  1.00 28.98  ? 372  VAL B CG1   1 
ATOM   7591  C CG2   . VAL B 1 372 ? -5.506  48.994  26.094  1.00 26.89  ? 372  VAL B CG2   1 
ATOM   7592  N N     . GLU B 1 373 ? -3.376  46.048  23.235  1.00 34.33  ? 373  GLU B N     1 
ATOM   7593  C CA    . GLU B 1 373 ? -3.038  44.785  22.568  1.00 34.07  ? 373  GLU B CA    1 
ATOM   7594  C C     . GLU B 1 373 ? -1.591  44.329  22.776  1.00 33.85  ? 373  GLU B C     1 
ATOM   7595  O O     . GLU B 1 373 ? -1.311  43.138  22.823  1.00 34.08  ? 373  GLU B O     1 
ATOM   7596  C CB    . GLU B 1 373 ? -3.362  44.886  21.070  1.00 35.15  ? 373  GLU B CB    1 
ATOM   7597  C CG    . GLU B 1 373 ? -3.087  43.627  20.218  1.00 39.80  ? 373  GLU B CG    1 
ATOM   7598  C CD    . GLU B 1 373 ? -3.923  42.409  20.597  1.00 54.40  ? 373  GLU B CD    1 
ATOM   7599  O OE1   . GLU B 1 373 ? -4.630  42.421  21.631  1.00 66.52  ? 373  GLU B OE1   1 
ATOM   7600  O OE2   . GLU B 1 373 ? -3.864  41.416  19.839  1.00 64.83  ? 373  GLU B OE2   1 
ATOM   7601  N N     . MET B 1 374 ? -0.687  45.283  22.925  1.00 34.19  ? 374  MET B N     1 
ATOM   7602  C CA    . MET B 1 374 ? 0.729   45.008  23.135  1.00 34.20  ? 374  MET B CA    1 
ATOM   7603  C C     . MET B 1 374 ? 1.117   44.833  24.607  1.00 35.14  ? 374  MET B C     1 
ATOM   7604  O O     . MET B 1 374 ? 2.311   44.677  24.901  1.00 34.07  ? 374  MET B O     1 
ATOM   7605  C CB    . MET B 1 374 ? 1.555   46.179  22.584  1.00 35.38  ? 374  MET B CB    1 
ATOM   7606  C CG    . MET B 1 374 ? 1.461   46.377  21.076  1.00 36.55  ? 374  MET B CG    1 
ATOM   7607  S SD    . MET B 1 374 ? 2.161   44.973  20.186  1.00 41.37  ? 374  MET B SD    1 
ATOM   7608  C CE    . MET B 1 374 ? 0.714   44.223  19.433  1.00 44.50  ? 374  MET B CE    1 
ATOM   7609  N N     . LEU B 1 375 ? 0.150   44.920  25.529  1.00 35.37  ? 375  LEU B N     1 
ATOM   7610  C CA    . LEU B 1 375 ? 0.424   44.625  26.938  1.00 35.75  ? 375  LEU B CA    1 
ATOM   7611  C C     . LEU B 1 375 ? 0.811   43.168  27.086  1.00 35.72  ? 375  LEU B C     1 
ATOM   7612  O O     . LEU B 1 375 ? 0.162   42.286  26.522  1.00 35.85  ? 375  LEU B O     1 
ATOM   7613  C CB    . LEU B 1 375 ? -0.787  44.921  27.825  1.00 35.72  ? 375  LEU B CB    1 
ATOM   7614  C CG    . LEU B 1 375 ? -1.152  46.395  28.007  1.00 31.98  ? 375  LEU B CG    1 
ATOM   7615  C CD1   . LEU B 1 375 ? -2.407  46.518  28.784  1.00 30.92  ? 375  LEU B CD1   1 
ATOM   7616  C CD2   . LEU B 1 375 ? -0.003  47.151  28.673  1.00 34.83  ? 375  LEU B CD2   1 
ATOM   7617  N N     . ARG B 1 376 ? 1.879   42.912  27.836  1.00 36.94  ? 376  ARG B N     1 
ATOM   7618  C CA    . ARG B 1 376 ? 2.292   41.537  28.061  1.00 38.95  ? 376  ARG B CA    1 
ATOM   7619  C C     . ARG B 1 376 ? 1.124   40.836  28.739  1.00 38.92  ? 376  ARG B C     1 
ATOM   7620  O O     . ARG B 1 376 ? 0.346   41.466  29.447  1.00 38.31  ? 376  ARG B O     1 
ATOM   7621  C CB    . ARG B 1 376 ? 3.621   41.442  28.827  1.00 38.61  ? 376  ARG B CB    1 
ATOM   7622  C CG    . ARG B 1 376 ? 3.602   42.044  30.189  1.00 41.55  ? 376  ARG B CG    1 
ATOM   7623  C CD    . ARG B 1 376 ? 4.925   41.837  30.915  1.00 43.21  ? 376  ARG B CD    1 
ATOM   7624  N NE    . ARG B 1 376 ? 4.637   41.729  32.340  1.00 45.12  ? 376  ARG B NE    1 
ATOM   7625  C CZ    . ARG B 1 376 ? 5.136   42.500  33.292  1.00 50.69  ? 376  ARG B CZ    1 
ATOM   7626  N NH1   . ARG B 1 376 ? 6.044   43.431  33.021  1.00 60.87  ? 376  ARG B NH1   1 
ATOM   7627  N NH2   . ARG B 1 376 ? 4.740   42.305  34.546  1.00 50.57  ? 376  ARG B NH2   1 
ATOM   7628  N N     . GLU B 1 377 ? 0.996   39.546  28.467  1.00 39.79  ? 377  GLU B N     1 
ATOM   7629  C CA    . GLU B 1 377 ? -0.240  38.821  28.679  1.00 41.17  ? 377  GLU B CA    1 
ATOM   7630  C C     . GLU B 1 377 ? -0.706  38.747  30.126  1.00 40.07  ? 377  GLU B C     1 
ATOM   7631  O O     . GLU B 1 377 ? -1.906  38.700  30.377  1.00 38.39  ? 377  GLU B O     1 
ATOM   7632  C CB    . GLU B 1 377 ? -0.112  37.412  28.082  1.00 42.20  ? 377  GLU B CB    1 
ATOM   7633  C CG    . GLU B 1 377 ? -0.120  37.405  26.555  1.00 49.26  ? 377  GLU B CG    1 
ATOM   7634  C CD    . GLU B 1 377 ? -1.426  37.937  25.974  1.00 57.28  ? 377  GLU B CD    1 
ATOM   7635  O OE1   . GLU B 1 377 ? -2.517  37.445  26.375  1.00 56.53  ? 377  GLU B OE1   1 
ATOM   7636  O OE2   . GLU B 1 377 ? -1.353  38.849  25.119  1.00 57.80  ? 377  GLU B OE2   1 
ATOM   7637  N N     . ASP B 1 378 ? 0.229   38.739  31.071  1.00 40.38  ? 378  ASP B N     1 
ATOM   7638  C CA    . ASP B 1 378 ? -0.141  38.589  32.480  1.00 41.09  ? 378  ASP B CA    1 
ATOM   7639  C C     . ASP B 1 378 ? -0.579  39.891  33.151  1.00 40.58  ? 378  ASP B C     1 
ATOM   7640  O O     . ASP B 1 378 ? -0.889  39.882  34.339  1.00 40.05  ? 378  ASP B O     1 
ATOM   7641  C CB    . ASP B 1 378 ? 1.001   37.925  33.267  1.00 43.02  ? 378  ASP B CB    1 
ATOM   7642  C CG    . ASP B 1 378 ? 2.296   38.708  33.194  1.00 49.59  ? 378  ASP B CG    1 
ATOM   7643  O OD1   . ASP B 1 378 ? 2.298   39.819  32.620  1.00 59.69  ? 378  ASP B OD1   1 
ATOM   7644  O OD2   . ASP B 1 378 ? 3.318   38.200  33.702  1.00 59.27  ? 378  ASP B OD2   1 
ATOM   7645  N N     . ILE B 1 379 ? -0.605  41.004  32.402  1.00 38.81  ? 379  ILE B N     1 
ATOM   7646  C CA    . ILE B 1 379 ? -1.184  42.258  32.911  1.00 37.22  ? 379  ILE B CA    1 
ATOM   7647  C C     . ILE B 1 379 ? -2.360  42.822  32.104  1.00 34.96  ? 379  ILE B C     1 
ATOM   7648  O O     . ILE B 1 379 ? -2.972  43.805  32.544  1.00 34.37  ? 379  ILE B O     1 
ATOM   7649  C CB    . ILE B 1 379 ? -0.101  43.389  33.122  1.00 38.13  ? 379  ILE B CB    1 
ATOM   7650  C CG1   . ILE B 1 379 ? 0.457   43.886  31.783  1.00 38.17  ? 379  ILE B CG1   1 
ATOM   7651  C CG2   . ILE B 1 379 ? 1.016   42.904  34.073  1.00 38.95  ? 379  ILE B CG2   1 
ATOM   7652  C CD1   . ILE B 1 379 ? 1.384   45.021  31.909  1.00 37.65  ? 379  ILE B CD1   1 
ATOM   7653  N N     . LYS B 1 380 ? -2.688  42.213  30.962  1.00 34.05  ? 380  LYS B N     1 
ATOM   7654  C CA    . LYS B 1 380 ? -3.865  42.605  30.172  1.00 34.76  ? 380  LYS B CA    1 
ATOM   7655  C C     . LYS B 1 380 ? -5.156  42.614  30.997  1.00 33.78  ? 380  LYS B C     1 
ATOM   7656  O O     . LYS B 1 380 ? -5.944  43.557  30.898  1.00 34.66  ? 380  LYS B O     1 
ATOM   7657  C CB    . LYS B 1 380 ? -4.064  41.674  28.961  1.00 34.06  ? 380  LYS B CB    1 
ATOM   7658  C CG    . LYS B 1 380 ? -2.992  41.799  27.890  1.00 38.57  ? 380  LYS B CG    1 
ATOM   7659  C CD    . LYS B 1 380 ? -3.370  41.027  26.617  1.00 36.93  ? 380  LYS B CD    1 
ATOM   7660  C CE    . LYS B 1 380 ? -2.667  41.584  25.384  1.00 39.83  ? 380  LYS B CE    1 
ATOM   7661  N NZ    . LYS B 1 380 ? -3.181  40.954  24.133  1.00 44.23  ? 380  LYS B NZ    1 
ATOM   7662  N N     . ASP B 1 381 ? -5.380  41.554  31.778  1.00 32.58  ? 381  ASP B N     1 
ATOM   7663  C CA    . ASP B 1 381 ? -6.574  41.420  32.597  1.00 33.07  ? 381  ASP B CA    1 
ATOM   7664  C C     . ASP B 1 381 ? -6.653  42.489  33.660  1.00 31.42  ? 381  ASP B C     1 
ATOM   7665  O O     . ASP B 1 381 ? -7.723  43.080  33.874  1.00 28.36  ? 381  ASP B O     1 
ATOM   7666  C CB    . ASP B 1 381 ? -6.615  40.028  33.262  1.00 36.31  ? 381  ASP B CB    1 
ATOM   7667  C CG    . ASP B 1 381 ? -7.121  38.919  32.313  1.00 42.91  ? 381  ASP B CG    1 
ATOM   7668  O OD1   . ASP B 1 381 ? -7.566  39.248  31.185  1.00 47.69  ? 381  ASP B OD1   1 
ATOM   7669  O OD2   . ASP B 1 381 ? -7.076  37.718  32.709  1.00 51.17  ? 381  ASP B OD2   1 
ATOM   7670  N N     . TYR B 1 382 ? -5.516  42.764  34.306  1.00 30.44  ? 382  TYR B N     1 
ATOM   7671  C CA    . TYR B 1 382 ? -5.456  43.840  35.292  1.00 29.68  ? 382  TYR B CA    1 
ATOM   7672  C C     . TYR B 1 382 ? -5.903  45.146  34.672  1.00 28.79  ? 382  TYR B C     1 
ATOM   7673  O O     . TYR B 1 382 ? -6.624  45.894  35.325  1.00 29.18  ? 382  TYR B O     1 
ATOM   7674  C CB    . TYR B 1 382 ? -4.061  44.007  35.943  1.00 31.37  ? 382  TYR B CB    1 
ATOM   7675  C CG    . TYR B 1 382 ? -3.581  42.796  36.745  1.00 33.15  ? 382  TYR B CG    1 
ATOM   7676  C CD1   . TYR B 1 382 ? -4.364  42.221  37.746  1.00 39.87  ? 382  TYR B CD1   1 
ATOM   7677  C CD2   . TYR B 1 382 ? -2.367  42.211  36.471  1.00 39.85  ? 382  TYR B CD2   1 
ATOM   7678  C CE1   . TYR B 1 382 ? -3.927  41.108  38.453  1.00 38.61  ? 382  TYR B CE1   1 
ATOM   7679  C CE2   . TYR B 1 382 ? -1.933  41.101  37.163  1.00 40.45  ? 382  TYR B CE2   1 
ATOM   7680  C CZ    . TYR B 1 382 ? -2.708  40.549  38.147  1.00 37.27  ? 382  TYR B CZ    1 
ATOM   7681  O OH    . TYR B 1 382 ? -2.204  39.441  38.804  1.00 40.26  ? 382  TYR B OH    1 
ATOM   7682  N N     . TYR B 1 383 ? -5.483  45.430  33.425  1.00 29.25  ? 383  TYR B N     1 
ATOM   7683  C CA    . TYR B 1 383 ? -5.872  46.699  32.774  1.00 28.49  ? 383  TYR B CA    1 
ATOM   7684  C C     . TYR B 1 383 ? -7.371  46.722  32.481  1.00 26.89  ? 383  TYR B C     1 
ATOM   7685  O O     . TYR B 1 383 ? -8.025  47.738  32.639  1.00 26.41  ? 383  TYR B O     1 
ATOM   7686  C CB    . TYR B 1 383 ? -5.069  47.000  31.513  1.00 26.68  ? 383  TYR B CB    1 
ATOM   7687  C CG    . TYR B 1 383 ? -5.249  48.444  31.086  1.00 27.33  ? 383  TYR B CG    1 
ATOM   7688  C CD1   . TYR B 1 383 ? -4.825  49.480  31.908  1.00 25.14  ? 383  TYR B CD1   1 
ATOM   7689  C CD2   . TYR B 1 383 ? -5.872  48.776  29.885  1.00 25.44  ? 383  TYR B CD2   1 
ATOM   7690  C CE1   . TYR B 1 383 ? -4.987  50.807  31.544  1.00 25.72  ? 383  TYR B CE1   1 
ATOM   7691  C CE2   . TYR B 1 383 ? -6.062  50.122  29.507  1.00 28.35  ? 383  TYR B CE2   1 
ATOM   7692  C CZ    . TYR B 1 383 ? -5.619  51.128  30.343  1.00 30.45  ? 383  TYR B CZ    1 
ATOM   7693  O OH    . TYR B 1 383 ? -5.794  52.455  29.996  1.00 23.94  ? 383  TYR B OH    1 
ATOM   7694  N N     . THR B 1 384 ? -7.900  45.595  32.041  1.00 26.80  ? 384  THR B N     1 
ATOM   7695  C CA    . THR B 1 384 ? -9.324  45.445  31.770  1.00 26.85  ? 384  THR B CA    1 
ATOM   7696  C C     . THR B 1 384 ? -10.142 45.745  33.026  1.00 27.15  ? 384  THR B C     1 
ATOM   7697  O O     . THR B 1 384 ? -11.186 46.435  32.950  1.00 25.09  ? 384  THR B O     1 
ATOM   7698  C CB    . THR B 1 384 ? -9.580  44.030  31.226  1.00 27.17  ? 384  THR B CB    1 
ATOM   7699  O OG1   . THR B 1 384 ? -8.901  43.921  29.975  1.00 28.32  ? 384  THR B OG1   1 
ATOM   7700  C CG2   . THR B 1 384 ? -11.075 43.728  31.027  1.00 26.96  ? 384  THR B CG2   1 
ATOM   7701  N N     . ASP B 1 385 ? -9.644  45.295  34.183  1.00 26.05  ? 385  ASP B N     1 
ATOM   7702  C CA    . ASP B 1 385 ? -10.286 45.640  35.469  1.00 28.30  ? 385  ASP B CA    1 
ATOM   7703  C C     . ASP B 1 385 ? -10.457 47.151  35.724  1.00 27.71  ? 385  ASP B C     1 
ATOM   7704  O O     . ASP B 1 385 ? -11.414 47.579  36.351  1.00 25.84  ? 385  ASP B O     1 
ATOM   7705  C CB    . ASP B 1 385 ? -9.537  45.005  36.651  1.00 29.99  ? 385  ASP B CB    1 
ATOM   7706  C CG    . ASP B 1 385 ? -9.706  43.493  36.722  1.00 32.02  ? 385  ASP B CG    1 
ATOM   7707  O OD1   . ASP B 1 385 ? -10.651 42.981  36.097  1.00 33.78  ? 385  ASP B OD1   1 
ATOM   7708  O OD2   . ASP B 1 385 ? -8.903  42.821  37.421  1.00 33.50  ? 385  ASP B OD2   1 
ATOM   7709  N N     . LEU B 1 386 ? -9.533  47.953  35.222  1.00 29.21  ? 386  LEU B N     1 
ATOM   7710  C CA    . LEU B 1 386 ? -9.604  49.393  35.414  1.00 29.59  ? 386  LEU B CA    1 
ATOM   7711  C C     . LEU B 1 386 ? -10.721 50.066  34.629  1.00 29.91  ? 386  LEU B C     1 
ATOM   7712  O O     . LEU B 1 386 ? -10.950 51.268  34.777  1.00 30.46  ? 386  LEU B O     1 
ATOM   7713  C CB    . LEU B 1 386 ? -8.264  50.010  35.082  1.00 31.20  ? 386  LEU B CB    1 
ATOM   7714  C CG    . LEU B 1 386 ? -7.116  49.517  35.977  1.00 28.27  ? 386  LEU B CG    1 
ATOM   7715  C CD1   . LEU B 1 386 ? -5.853  50.302  35.617  1.00 31.80  ? 386  LEU B CD1   1 
ATOM   7716  C CD2   . LEU B 1 386 ? -7.418  49.637  37.464  1.00 27.21  ? 386  LEU B CD2   1 
ATOM   7717  N N     . SER B 1 387 ? -11.424 49.278  33.808  1.00 29.53  ? 387  SER B N     1 
ATOM   7718  C CA    . SER B 1 387 ? -12.625 49.716  33.147  1.00 30.22  ? 387  SER B CA    1 
ATOM   7719  C C     . SER B 1 387 ? -13.743 50.190  34.110  1.00 31.87  ? 387  SER B C     1 
ATOM   7720  O O     . SER B 1 387 ? -14.658 50.888  33.690  1.00 31.98  ? 387  SER B O     1 
ATOM   7721  C CB    . SER B 1 387 ? -13.133 48.582  32.213  1.00 29.90  ? 387  SER B CB    1 
ATOM   7722  O OG    . SER B 1 387 ? -12.141 48.213  31.253  1.00 28.93  ? 387  SER B OG    1 
ATOM   7723  N N     . ILE B 1 388 ? -13.669 49.803  35.377  1.00 34.15  ? 388  ILE B N     1 
ATOM   7724  C CA    . ILE B 1 388 ? -14.624 50.263  36.399  1.00 34.95  ? 388  ILE B CA    1 
ATOM   7725  C C     . ILE B 1 388 ? -14.212 51.540  37.130  1.00 35.02  ? 388  ILE B C     1 
ATOM   7726  O O     . ILE B 1 388 ? -14.989 52.049  37.932  1.00 35.53  ? 388  ILE B O     1 
ATOM   7727  C CB    . ILE B 1 388 ? -14.906 49.163  37.439  1.00 35.47  ? 388  ILE B CB    1 
ATOM   7728  C CG1   . ILE B 1 388 ? -13.628 48.800  38.177  1.00 34.96  ? 388  ILE B CG1   1 
ATOM   7729  C CG2   . ILE B 1 388 ? -15.557 47.952  36.765  1.00 37.18  ? 388  ILE B CG2   1 
ATOM   7730  C CD1   . ILE B 1 388 ? -13.905 48.269  39.525  1.00 40.35  ? 388  ILE B CD1   1 
ATOM   7731  N N     . LEU B 1 389 ? -13.017 52.066  36.851  1.00 35.41  ? 389  LEU B N     1 
ATOM   7732  C CA    . LEU B 1 389 ? -12.641 53.406  37.301  1.00 35.47  ? 389  LEU B CA    1 
ATOM   7733  C C     . LEU B 1 389 ? -13.489 54.440  36.591  1.00 34.24  ? 389  LEU B C     1 
ATOM   7734  O O     . LEU B 1 389 ? -13.725 54.340  35.406  1.00 35.80  ? 389  LEU B O     1 
ATOM   7735  C CB    . LEU B 1 389 ? -11.173 53.733  37.003  1.00 36.68  ? 389  LEU B CB    1 
ATOM   7736  C CG    . LEU B 1 389 ? -10.051 52.851  37.556  1.00 40.56  ? 389  LEU B CG    1 
ATOM   7737  C CD1   . LEU B 1 389 ? -8.730  53.620  37.467  1.00 40.92  ? 389  LEU B CD1   1 
ATOM   7738  C CD2   . LEU B 1 389 ? -10.333 52.427  38.965  1.00 48.31  ? 389  LEU B CD2   1 
ATOM   7739  N N     . GLN B 1 390 ? -13.887 55.458  37.342  1.00 35.41  ? 390  GLN B N     1 
ATOM   7740  C CA    . GLN B 1 390 ? -14.827 56.473  36.900  1.00 34.43  ? 390  GLN B CA    1 
ATOM   7741  C C     . GLN B 1 390 ? -14.067 57.692  36.500  1.00 32.64  ? 390  GLN B C     1 
ATOM   7742  O O     . GLN B 1 390 ? -12.937 57.919  36.979  1.00 31.64  ? 390  GLN B O     1 
ATOM   7743  C CB    . GLN B 1 390 ? -15.737 56.865  38.059  1.00 33.79  ? 390  GLN B CB    1 
ATOM   7744  C CG    . GLN B 1 390 ? -16.442 55.719  38.673  1.00 36.24  ? 390  GLN B CG    1 
ATOM   7745  C CD    . GLN B 1 390 ? -16.993 56.053  40.012  1.00 36.84  ? 390  GLN B CD    1 
ATOM   7746  O OE1   . GLN B 1 390 ? -17.954 56.821  40.122  1.00 32.36  ? 390  GLN B OE1   1 
ATOM   7747  N NE2   . GLN B 1 390 ? -16.394 55.481  41.061  1.00 40.22  ? 390  GLN B NE2   1 
ATOM   7748  N N     . LYS B 1 391 ? -14.707 58.511  35.675  1.00 30.61  ? 391  LYS B N     1 
ATOM   7749  C CA    . LYS B 1 391 ? -14.119 59.779  35.303  1.00 32.04  ? 391  LYS B CA    1 
ATOM   7750  C C     . LYS B 1 391 ? -14.007 60.610  36.579  1.00 31.26  ? 391  LYS B C     1 
ATOM   7751  O O     . LYS B 1 391 ? -14.832 60.482  37.466  1.00 29.88  ? 391  LYS B O     1 
ATOM   7752  C CB    . LYS B 1 391 ? -14.970 60.473  34.255  1.00 31.74  ? 391  LYS B CB    1 
ATOM   7753  C CG    . LYS B 1 391 ? -15.147 59.675  33.031  1.00 33.70  ? 391  LYS B CG    1 
ATOM   7754  C CD    . LYS B 1 391 ? -15.891 60.463  32.004  1.00 32.19  ? 391  LYS B CD    1 
ATOM   7755  C CE    . LYS B 1 391 ? -16.063 59.660  30.774  1.00 35.20  ? 391  LYS B CE    1 
ATOM   7756  N NZ    . LYS B 1 391 ? -17.165 60.204  29.972  1.00 35.03  ? 391  LYS B NZ    1 
ATOM   7757  N N     . ASP B 1 392 ? -12.946 61.398  36.680  1.00 32.29  ? 392  ASP B N     1 
ATOM   7758  C CA    . ASP B 1 392 ? -12.789 62.372  37.740  1.00 32.94  ? 392  ASP B CA    1 
ATOM   7759  C C     . ASP B 1 392 ? -12.730 61.802  39.147  1.00 34.27  ? 392  ASP B C     1 
ATOM   7760  O O     . ASP B 1 392 ? -13.079 62.490  40.114  1.00 34.05  ? 392  ASP B O     1 
ATOM   7761  C CB    . ASP B 1 392 ? -13.925 63.394  37.597  1.00 33.30  ? 392  ASP B CB    1 
ATOM   7762  C CG    . ASP B 1 392 ? -14.065 63.856  36.145  1.00 40.61  ? 392  ASP B CG    1 
ATOM   7763  O OD1   . ASP B 1 392 ? -13.010 64.266  35.611  1.00 38.16  ? 392  ASP B OD1   1 
ATOM   7764  O OD2   . ASP B 1 392 ? -15.167 63.755  35.527  1.00 40.89  ? 392  ASP B OD2   1 
ATOM   7765  N N     . VAL B 1 393 ? -12.276 60.551  39.267  1.00 32.74  ? 393  VAL B N     1 
ATOM   7766  C CA    . VAL B 1 393 ? -12.029 59.931  40.555  1.00 32.10  ? 393  VAL B CA    1 
ATOM   7767  C C     . VAL B 1 393 ? -10.613 59.388  40.536  1.00 32.98  ? 393  VAL B C     1 
ATOM   7768  O O     . VAL B 1 393 ? -10.219 58.656  39.612  1.00 33.66  ? 393  VAL B O     1 
ATOM   7769  C CB    . VAL B 1 393 ? -13.022 58.792  40.869  1.00 32.48  ? 393  VAL B CB    1 
ATOM   7770  C CG1   . VAL B 1 393 ? -12.729 58.219  42.242  1.00 36.25  ? 393  VAL B CG1   1 
ATOM   7771  C CG2   . VAL B 1 393 ? -14.446 59.294  40.806  1.00 33.45  ? 393  VAL B CG2   1 
ATOM   7772  N N     . LYS B 1 394 ? -9.846  59.792  41.543  1.00 34.52  ? 394  LYS B N     1 
ATOM   7773  C CA    . LYS B 1 394 ? -8.465  59.391  41.733  1.00 34.55  ? 394  LYS B CA    1 
ATOM   7774  C C     . LYS B 1 394 ? -8.480  58.413  42.848  1.00 33.95  ? 394  LYS B C     1 
ATOM   7775  O O     . LYS B 1 394 ? -8.848  58.761  43.928  1.00 35.67  ? 394  LYS B O     1 
ATOM   7776  C CB    . LYS B 1 394 ? -7.608  60.620  42.053  1.00 34.16  ? 394  LYS B CB    1 
ATOM   7777  C CG    . LYS B 1 394 ? -7.701  61.679  40.943  1.00 36.08  ? 394  LYS B CG    1 
ATOM   7778  C CD    . LYS B 1 394 ? -6.605  62.761  41.038  1.00 33.78  ? 394  LYS B CD    1 
ATOM   7779  C CE    . LYS B 1 394 ? -6.738  63.748  39.869  1.00 34.14  ? 394  LYS B CE    1 
ATOM   7780  N NZ    . LYS B 1 394 ? -5.604  64.679  39.749  1.00 35.38  ? 394  LYS B NZ    1 
ATOM   7781  N N     . VAL B 1 395 ? -8.110  57.176  42.547  1.00 34.52  ? 395  VAL B N     1 
ATOM   7782  C CA    . VAL B 1 395 ? -8.288  56.012  43.430  1.00 35.22  ? 395  VAL B CA    1 
ATOM   7783  C C     . VAL B 1 395 ? -7.007  55.706  44.194  1.00 35.14  ? 395  VAL B C     1 
ATOM   7784  O O     . VAL B 1 395 ? -5.939  55.624  43.597  1.00 32.68  ? 395  VAL B O     1 
ATOM   7785  C CB    . VAL B 1 395 ? -8.752  54.784  42.575  1.00 34.67  ? 395  VAL B CB    1 
ATOM   7786  C CG1   . VAL B 1 395 ? -8.966  53.588  43.387  1.00 38.38  ? 395  VAL B CG1   1 
ATOM   7787  C CG2   . VAL B 1 395 ? -10.092 55.128  41.866  1.00 40.73  ? 395  VAL B CG2   1 
ATOM   7788  N N     . PRO B 1 396 ? -7.093  55.559  45.536  1.00 35.98  ? 396  PRO B N     1 
ATOM   7789  C CA    . PRO B 1 396 ? -5.858  55.158  46.234  1.00 34.44  ? 396  PRO B CA    1 
ATOM   7790  C C     . PRO B 1 396 ? -5.488  53.725  45.949  1.00 33.46  ? 396  PRO B C     1 
ATOM   7791  O O     . PRO B 1 396 ? -6.354  52.934  45.555  1.00 31.85  ? 396  PRO B O     1 
ATOM   7792  C CB    . PRO B 1 396 ? -6.197  55.364  47.715  1.00 33.72  ? 396  PRO B CB    1 
ATOM   7793  C CG    . PRO B 1 396 ? -7.694  55.240  47.786  1.00 36.58  ? 396  PRO B CG    1 
ATOM   7794  C CD    . PRO B 1 396 ? -8.197  55.808  46.482  1.00 34.87  ? 396  PRO B CD    1 
ATOM   7795  N N     . THR B 1 397 ? -4.199  53.432  46.114  1.00 31.94  ? 397  THR B N     1 
ATOM   7796  C CA    . THR B 1 397 ? -3.613  52.112  45.851  1.00 32.75  ? 397  THR B CA    1 
ATOM   7797  C C     . THR B 1 397 ? -4.362  50.953  46.505  1.00 31.14  ? 397  THR B C     1 
ATOM   7798  O O     . THR B 1 397 ? -4.512  49.885  45.902  1.00 28.75  ? 397  THR B O     1 
ATOM   7799  C CB    . THR B 1 397 ? -2.159  52.115  46.388  1.00 31.90  ? 397  THR B CB    1 
ATOM   7800  O OG1   . THR B 1 397 ? -1.421  53.177  45.772  1.00 33.13  ? 397  THR B OG1   1 
ATOM   7801  C CG2   . THR B 1 397 ? -1.455  50.806  46.127  1.00 35.17  ? 397  THR B CG2   1 
ATOM   7802  N N     . LYS B 1 398 ? -4.786  51.179  47.746  1.00 31.48  ? 398  LYS B N     1 
ATOM   7803  C CA    . LYS B 1 398 ? -5.424  50.160  48.588  1.00 31.90  ? 398  LYS B CA    1 
ATOM   7804  C C     . LYS B 1 398 ? -6.707  49.610  47.942  1.00 30.22  ? 398  LYS B C     1 
ATOM   7805  O O     . LYS B 1 398 ? -6.991  48.420  48.035  1.00 29.72  ? 398  LYS B O     1 
ATOM   7806  C CB    . LYS B 1 398 ? -5.633  50.759  49.998  1.00 34.21  ? 398  LYS B CB    1 
ATOM   7807  C CG    . LYS B 1 398 ? -6.328  49.883  51.048  1.00 33.13  ? 398  LYS B CG    1 
ATOM   7808  C CD    . LYS B 1 398 ? -5.661  48.545  51.264  1.00 43.09  ? 398  LYS B CD    1 
ATOM   7809  C CE    . LYS B 1 398 ? -6.128  47.943  52.582  1.00 45.19  ? 398  LYS B CE    1 
ATOM   7810  N NZ    . LYS B 1 398 ? -5.701  46.576  52.709  1.00 47.64  ? 398  LYS B NZ    1 
ATOM   7811  N N     . VAL B 1 399 ? -7.430  50.447  47.206  1.00 31.24  ? 399  VAL B N     1 
ATOM   7812  C CA    . VAL B 1 399 ? -8.610  49.963  46.462  1.00 32.77  ? 399  VAL B CA    1 
ATOM   7813  C C     . VAL B 1 399 ? -8.260  48.862  45.468  1.00 31.93  ? 399  VAL B C     1 
ATOM   7814  O O     . VAL B 1 399 ? -8.991  47.893  45.299  1.00 35.18  ? 399  VAL B O     1 
ATOM   7815  C CB    . VAL B 1 399 ? -9.334  51.118  45.743  1.00 32.32  ? 399  VAL B CB    1 
ATOM   7816  C CG1   . VAL B 1 399 ? -10.432 50.578  44.812  1.00 33.41  ? 399  VAL B CG1   1 
ATOM   7817  C CG2   . VAL B 1 399 ? -9.944  52.050  46.791  1.00 34.87  ? 399  VAL B CG2   1 
ATOM   7818  N N     . LEU B 1 400 ? -7.130  49.016  44.818  1.00 32.02  ? 400  LEU B N     1 
ATOM   7819  C CA    . LEU B 1 400 ? -6.689  48.062  43.800  1.00 33.28  ? 400  LEU B CA    1 
ATOM   7820  C C     . LEU B 1 400 ? -6.000  46.846  44.384  1.00 31.97  ? 400  LEU B C     1 
ATOM   7821  O O     . LEU B 1 400 ? -6.084  45.766  43.817  1.00 31.27  ? 400  LEU B O     1 
ATOM   7822  C CB    . LEU B 1 400 ? -5.783  48.796  42.799  1.00 36.14  ? 400  LEU B CB    1 
ATOM   7823  C CG    . LEU B 1 400 ? -6.581  49.896  42.082  1.00 38.22  ? 400  LEU B CG    1 
ATOM   7824  C CD1   . LEU B 1 400 ? -5.699  51.005  41.599  1.00 43.86  ? 400  LEU B CD1   1 
ATOM   7825  C CD2   . LEU B 1 400 ? -7.423  49.275  40.939  1.00 39.14  ? 400  LEU B CD2   1 
ATOM   7826  N N     . CYS B 1 401 ? -5.335  47.021  45.527  1.00 33.31  ? 401  CYS B N     1 
ATOM   7827  C CA    . CYS B 1 401 ? -4.879  45.881  46.358  1.00 33.93  ? 401  CYS B CA    1 
ATOM   7828  C C     . CYS B 1 401 ? -6.031  44.951  46.702  1.00 34.26  ? 401  CYS B C     1 
ATOM   7829  O O     . CYS B 1 401 ? -5.867  43.736  46.678  1.00 36.30  ? 401  CYS B O     1 
ATOM   7830  C CB    . CYS B 1 401 ? -4.219  46.388  47.662  1.00 32.19  ? 401  CYS B CB    1 
ATOM   7831  S SG    . CYS B 1 401 ? -2.674  47.343  47.466  1.00 31.84  ? 401  CYS B SG    1 
ATOM   7832  N N     . ILE B 1 402 ? -7.178  45.537  47.048  1.00 34.67  ? 402  ILE B N     1 
ATOM   7833  C CA    . ILE B 1 402 ? -8.414  44.796  47.368  1.00 35.18  ? 402  ILE B CA    1 
ATOM   7834  C C     . ILE B 1 402 ? -8.931  44.093  46.119  1.00 33.99  ? 402  ILE B C     1 
ATOM   7835  O O     . ILE B 1 402 ? -9.099  42.888  46.129  1.00 33.37  ? 402  ILE B O     1 
ATOM   7836  C CB    . ILE B 1 402 ? -9.501  45.755  47.979  1.00 35.42  ? 402  ILE B CB    1 
ATOM   7837  C CG1   . ILE B 1 402 ? -9.098  46.173  49.400  1.00 37.68  ? 402  ILE B CG1   1 
ATOM   7838  C CG2   . ILE B 1 402 ? -10.866 45.112  48.022  1.00 37.80  ? 402  ILE B CG2   1 
ATOM   7839  C CD1   . ILE B 1 402 ? -9.957  47.305  50.039  1.00 36.41  ? 402  ILE B CD1   1 
ATOM   7840  N N     . LEU B 1 403 ? -9.148  44.854  45.054  1.00 35.53  ? 403  LEU B N     1 
ATOM   7841  C CA    . LEU B 1 403 ? -9.615  44.337  43.751  1.00 34.54  ? 403  LEU B CA    1 
ATOM   7842  C C     . LEU B 1 403 ? -8.803  43.175  43.245  1.00 34.33  ? 403  LEU B C     1 
ATOM   7843  O O     . LEU B 1 403 ? -9.372  42.191  42.767  1.00 34.48  ? 403  LEU B O     1 
ATOM   7844  C CB    . LEU B 1 403 ? -9.556  45.442  42.696  1.00 35.22  ? 403  LEU B CB    1 
ATOM   7845  C CG    . LEU B 1 403 ? -10.124 45.166  41.283  1.00 36.76  ? 403  LEU B CG    1 
ATOM   7846  C CD1   . LEU B 1 403 ? -11.590 44.859  41.313  1.00 32.68  ? 403  LEU B CD1   1 
ATOM   7847  C CD2   . LEU B 1 403 ? -9.853  46.342  40.314  1.00 32.97  ? 403  LEU B CD2   1 
ATOM   7848  N N     . TRP B 1 404 ? -7.475  43.263  43.374  1.00 34.22  ? 404  TRP B N     1 
ATOM   7849  C CA    . TRP B 1 404 ? -6.584  42.200  42.880  1.00 34.35  ? 404  TRP B CA    1 
ATOM   7850  C C     . TRP B 1 404 ? -6.042  41.261  43.978  1.00 35.45  ? 404  TRP B C     1 
ATOM   7851  O O     . TRP B 1 404 ? -5.280  40.347  43.672  1.00 35.27  ? 404  TRP B O     1 
ATOM   7852  C CB    . TRP B 1 404 ? -5.422  42.783  42.046  1.00 33.09  ? 404  TRP B CB    1 
ATOM   7853  C CG    . TRP B 1 404 ? -5.857  43.598  40.852  1.00 34.19  ? 404  TRP B CG    1 
ATOM   7854  C CD1   . TRP B 1 404 ? -6.975  43.396  40.073  1.00 32.99  ? 404  TRP B CD1   1 
ATOM   7855  C CD2   . TRP B 1 404 ? -5.194  44.751  40.299  1.00 29.38  ? 404  TRP B CD2   1 
ATOM   7856  N NE1   . TRP B 1 404 ? -7.035  44.344  39.077  1.00 30.80  ? 404  TRP B NE1   1 
ATOM   7857  C CE2   . TRP B 1 404 ? -5.952  45.176  39.183  1.00 30.54  ? 404  TRP B CE2   1 
ATOM   7858  C CE3   . TRP B 1 404 ? -4.015  45.447  40.618  1.00 33.94  ? 404  TRP B CE3   1 
ATOM   7859  C CZ2   . TRP B 1 404 ? -5.590  46.288  38.405  1.00 32.25  ? 404  TRP B CZ2   1 
ATOM   7860  C CZ3   . TRP B 1 404 ? -3.636  46.535  39.823  1.00 32.45  ? 404  TRP B CZ3   1 
ATOM   7861  C CH2   . TRP B 1 404 ? -4.433  46.950  38.730  1.00 32.32  ? 404  TRP B CH2   1 
ATOM   7862  N N     . ASP B 1 405 ? -6.465  41.457  45.228  1.00 37.84  ? 405  ASP B N     1 
ATOM   7863  C CA    . ASP B 1 405 ? -6.003  40.668  46.389  1.00 38.69  ? 405  ASP B CA    1 
ATOM   7864  C C     . ASP B 1 405 ? -4.483  40.573  46.440  1.00 39.28  ? 405  ASP B C     1 
ATOM   7865  O O     . ASP B 1 405 ? -3.914  39.508  46.653  1.00 39.75  ? 405  ASP B O     1 
ATOM   7866  C CB    . ASP B 1 405 ? -6.658  39.280  46.420  1.00 42.69  ? 405  ASP B CB    1 
ATOM   7867  C CG    . ASP B 1 405 ? -6.607  38.616  47.826  1.00 43.80  ? 405  ASP B CG    1 
ATOM   7868  O OD1   . ASP B 1 405 ? -6.319  39.295  48.845  1.00 47.49  ? 405  ASP B OD1   1 
ATOM   7869  O OD2   . ASP B 1 405 ? -6.852  37.396  47.903  1.00 54.35  ? 405  ASP B OD2   1 
ATOM   7870  N N     . MET B 1 406 ? -3.832  41.705  46.217  1.00 39.35  ? 406  MET B N     1 
ATOM   7871  C CA    . MET B 1 406 ? -2.382  41.758  46.103  1.00 39.80  ? 406  MET B CA    1 
ATOM   7872  C C     . MET B 1 406 ? -1.806  42.751  47.088  1.00 37.91  ? 406  MET B C     1 
ATOM   7873  O O     . MET B 1 406 ? -2.451  43.708  47.469  1.00 37.40  ? 406  MET B O     1 
ATOM   7874  C CB    . MET B 1 406 ? -1.963  42.211  44.706  1.00 39.25  ? 406  MET B CB    1 
ATOM   7875  C CG    . MET B 1 406 ? -1.864  41.125  43.666  1.00 44.66  ? 406  MET B CG    1 
ATOM   7876  S SD    . MET B 1 406 ? -1.013  41.629  42.135  1.00 44.04  ? 406  MET B SD    1 
ATOM   7877  C CE    . MET B 1 406 ? -1.226  43.377  42.140  1.00 41.59  ? 406  MET B CE    1 
ATOM   7878  N N     . GLU B 1 407 ? -0.553  42.533  47.445  1.00 39.69  ? 407  GLU B N     1 
ATOM   7879  C CA    . GLU B 1 407 ? 0.191   43.493  48.245  1.00 40.71  ? 407  GLU B CA    1 
ATOM   7880  C C     . GLU B 1 407 ? 0.517   44.756  47.468  1.00 37.57  ? 407  GLU B C     1 
ATOM   7881  O O     . GLU B 1 407 ? 0.674   44.714  46.251  1.00 36.85  ? 407  GLU B O     1 
ATOM   7882  C CB    . GLU B 1 407 ? 1.514   42.907  48.700  1.00 42.05  ? 407  GLU B CB    1 
ATOM   7883  C CG    . GLU B 1 407 ? 1.381   41.740  49.599  1.00 49.44  ? 407  GLU B CG    1 
ATOM   7884  C CD    . GLU B 1 407 ? 2.671   40.997  49.677  1.00 53.52  ? 407  GLU B CD    1 
ATOM   7885  O OE1   . GLU B 1 407 ? 3.723   41.663  49.929  1.00 66.08  ? 407  GLU B OE1   1 
ATOM   7886  O OE2   . GLU B 1 407 ? 2.639   39.761  49.451  1.00 70.99  ? 407  GLU B OE2   1 
ATOM   7887  N N     . THR B 1 408 ? 0.670   45.848  48.204  1.00 36.57  ? 408  THR B N     1 
ATOM   7888  C CA    . THR B 1 408 ? 0.940   47.174  47.651  1.00 39.03  ? 408  THR B CA    1 
ATOM   7889  C C     . THR B 1 408 ? 2.090   47.255  46.645  1.00 37.54  ? 408  THR B C     1 
ATOM   7890  O O     . THR B 1 408 ? 1.976   47.904  45.616  1.00 36.32  ? 408  THR B O     1 
ATOM   7891  C CB    . THR B 1 408 ? 1.312   48.182  48.743  1.00 39.71  ? 408  THR B CB    1 
ATOM   7892  O OG1   . THR B 1 408 ? 0.321   48.186  49.760  1.00 44.93  ? 408  THR B OG1   1 
ATOM   7893  C CG2   . THR B 1 408 ? 1.410   49.577  48.163  1.00 40.60  ? 408  THR B CG2   1 
ATOM   7894  N N     . GLU B 1 409 ? 3.223   46.660  46.997  1.00 37.69  ? 409  GLU B N     1 
ATOM   7895  C CA    . GLU B 1 409 ? 4.422   46.752  46.176  1.00 39.06  ? 409  GLU B CA    1 
ATOM   7896  C C     . GLU B 1 409 ? 4.168   46.136  44.801  1.00 37.96  ? 409  GLU B C     1 
ATOM   7897  O O     . GLU B 1 409 ? 4.537   46.712  43.779  1.00 37.47  ? 409  GLU B O     1 
ATOM   7898  C CB    . GLU B 1 409 ? 5.608   46.060  46.877  1.00 41.99  ? 409  GLU B CB    1 
ATOM   7899  C CG    . GLU B 1 409 ? 6.222   46.859  48.059  1.00 45.22  ? 409  GLU B CG    1 
ATOM   7900  C CD    . GLU B 1 409 ? 5.553   46.612  49.426  1.00 51.42  ? 409  GLU B CD    1 
ATOM   7901  O OE1   . GLU B 1 409 ? 4.336   46.294  49.495  1.00 50.23  ? 409  GLU B OE1   1 
ATOM   7902  O OE2   . GLU B 1 409 ? 6.260   46.738  50.451  1.00 52.91  ? 409  GLU B OE2   1 
ATOM   7903  N N     . GLU B 1 410 ? 3.501   44.991  44.789  1.00 37.11  ? 410  GLU B N     1 
ATOM   7904  C CA    . GLU B 1 410 ? 3.143   44.300  43.554  1.00 38.45  ? 410  GLU B CA    1 
ATOM   7905  C C     . GLU B 1 410 ? 2.110   45.082  42.716  1.00 36.33  ? 410  GLU B C     1 
ATOM   7906  O O     . GLU B 1 410 ? 2.256   45.182  41.503  1.00 37.11  ? 410  GLU B O     1 
ATOM   7907  C CB    . GLU B 1 410 ? 2.637   42.892  43.899  1.00 38.60  ? 410  GLU B CB    1 
ATOM   7908  C CG    . GLU B 1 410 ? 3.003   41.823  42.882  1.00 46.12  ? 410  GLU B CG    1 
ATOM   7909  C CD    . GLU B 1 410 ? 2.752   40.379  43.385  1.00 49.27  ? 410  GLU B CD    1 
ATOM   7910  O OE1   . GLU B 1 410 ? 2.621   40.147  44.623  1.00 59.36  ? 410  GLU B OE1   1 
ATOM   7911  O OE2   . GLU B 1 410 ? 2.700   39.469  42.519  1.00 56.71  ? 410  GLU B OE2   1 
ATOM   7912  N N     . VAL B 1 411 ? 1.094   45.647  43.368  1.00 34.20  ? 411  VAL B N     1 
ATOM   7913  C CA    . VAL B 1 411 ? 0.090   46.466  42.704  1.00 34.91  ? 411  VAL B CA    1 
ATOM   7914  C C     . VAL B 1 411 ? 0.745   47.688  42.063  1.00 34.97  ? 411  VAL B C     1 
ATOM   7915  O O     . VAL B 1 411 ? 0.468   48.020  40.916  1.00 33.32  ? 411  VAL B O     1 
ATOM   7916  C CB    . VAL B 1 411 ? -0.988  46.926  43.706  1.00 34.50  ? 411  VAL B CB    1 
ATOM   7917  C CG1   . VAL B 1 411 ? -1.908  47.980  43.078  1.00 33.71  ? 411  VAL B CG1   1 
ATOM   7918  C CG2   . VAL B 1 411 ? -1.800  45.728  44.213  1.00 31.50  ? 411  VAL B CG2   1 
ATOM   7919  N N     . GLU B 1 412 ? 1.600   48.367  42.827  1.00 34.95  ? 412  GLU B N     1 
ATOM   7920  C CA    . GLU B 1 412 ? 2.207   49.618  42.376  1.00 35.74  ? 412  GLU B CA    1 
ATOM   7921  C C     . GLU B 1 412 ? 3.171   49.363  41.212  1.00 32.78  ? 412  GLU B C     1 
ATOM   7922  O O     . GLU B 1 412 ? 3.312   50.194  40.330  1.00 30.41  ? 412  GLU B O     1 
ATOM   7923  C CB    . GLU B 1 412 ? 2.877   50.385  43.554  1.00 37.10  ? 412  GLU B CB    1 
ATOM   7924  C CG    . GLU B 1 412 ? 1.831   51.180  44.427  1.00 39.91  ? 412  GLU B CG    1 
ATOM   7925  C CD    . GLU B 1 412 ? 2.376   51.788  45.754  1.00 43.36  ? 412  GLU B CD    1 
ATOM   7926  O OE1   . GLU B 1 412 ? 3.506   51.442  46.168  1.00 45.07  ? 412  GLU B OE1   1 
ATOM   7927  O OE2   . GLU B 1 412 ? 1.656   52.622  46.381  1.00 50.16  ? 412  GLU B OE2   1 
ATOM   7928  N N     . ASP B 1 413 ? 3.813   48.204  41.210  1.00 30.79  ? 413  ASP B N     1 
ATOM   7929  C CA    . ASP B 1 413 ? 4.647   47.804  40.080  1.00 32.23  ? 413  ASP B CA    1 
ATOM   7930  C C     . ASP B 1 413 ? 3.850   47.585  38.780  1.00 31.54  ? 413  ASP B C     1 
ATOM   7931  O O     . ASP B 1 413 ? 4.262   48.055  37.722  1.00 33.42  ? 413  ASP B O     1 
ATOM   7932  C CB    . ASP B 1 413 ? 5.452   46.543  40.410  1.00 31.21  ? 413  ASP B CB    1 
ATOM   7933  C CG    . ASP B 1 413 ? 6.662   46.834  41.271  1.00 37.52  ? 413  ASP B CG    1 
ATOM   7934  O OD1   . ASP B 1 413 ? 7.058   48.019  41.364  1.00 38.90  ? 413  ASP B OD1   1 
ATOM   7935  O OD2   . ASP B 1 413 ? 7.216   45.880  41.858  1.00 40.84  ? 413  ASP B OD2   1 
ATOM   7936  N N     . ILE B 1 414 ? 2.727   46.868  38.875  1.00 30.58  ? 414  ILE B N     1 
ATOM   7937  C CA    . ILE B 1 414 ? 1.836   46.669  37.735  1.00 30.24  ? 414  ILE B CA    1 
ATOM   7938  C C     . ILE B 1 414 ? 1.314   48.019  37.216  1.00 30.24  ? 414  ILE B C     1 
ATOM   7939  O O     . ILE B 1 414 ? 1.408   48.314  36.022  1.00 30.46  ? 414  ILE B O     1 
ATOM   7940  C CB    . ILE B 1 414 ? 0.695   45.679  38.076  1.00 30.13  ? 414  ILE B CB    1 
ATOM   7941  C CG1   . ILE B 1 414 ? 1.278   44.271  38.226  1.00 29.45  ? 414  ILE B CG1   1 
ATOM   7942  C CG2   . ILE B 1 414 ? -0.425  45.704  37.026  1.00 31.74  ? 414  ILE B CG2   1 
ATOM   7943  C CD1   . ILE B 1 414 ? 0.484   43.397  39.125  1.00 30.80  ? 414  ILE B CD1   1 
ATOM   7944  N N     . LEU B 1 415 ? 0.810   48.855  38.116  1.00 30.18  ? 415  LEU B N     1 
ATOM   7945  C CA    . LEU B 1 415 ? 0.274   50.155  37.730  1.00 30.03  ? 415  LEU B CA    1 
ATOM   7946  C C     . LEU B 1 415 ? 1.315   51.103  37.088  1.00 31.96  ? 415  LEU B C     1 
ATOM   7947  O O     . LEU B 1 415 ? 0.993   51.920  36.225  1.00 32.22  ? 415  LEU B O     1 
ATOM   7948  C CB    . LEU B 1 415 ? -0.363  50.800  38.963  1.00 28.61  ? 415  LEU B CB    1 
ATOM   7949  C CG    . LEU B 1 415 ? -1.614  50.115  39.554  1.00 27.65  ? 415  LEU B CG    1 
ATOM   7950  C CD1   . LEU B 1 415 ? -2.068  50.800  40.857  1.00 31.73  ? 415  LEU B CD1   1 
ATOM   7951  C CD2   . LEU B 1 415 ? -2.777  50.080  38.594  1.00 27.96  ? 415  LEU B CD2   1 
ATOM   7952  N N     . GLN B 1 416 ? 2.567   51.000  37.514  1.00 33.85  ? 416  GLN B N     1 
ATOM   7953  C CA    . GLN B 1 416 ? 3.650   51.810  36.939  1.00 33.23  ? 416  GLN B CA    1 
ATOM   7954  C C     . GLN B 1 416 ? 3.882   51.479  35.465  1.00 33.03  ? 416  GLN B C     1 
ATOM   7955  O O     . GLN B 1 416 ? 4.194   52.350  34.663  1.00 31.06  ? 416  GLN B O     1 
ATOM   7956  C CB    . GLN B 1 416 ? 4.920   51.580  37.718  1.00 33.91  ? 416  GLN B CB    1 
ATOM   7957  C CG    . GLN B 1 416 ? 6.096   52.425  37.292  1.00 37.78  ? 416  GLN B CG    1 
ATOM   7958  C CD    . GLN B 1 416 ? 5.789   53.872  37.441  1.00 49.60  ? 416  GLN B CD    1 
ATOM   7959  O OE1   . GLN B 1 416 ? 5.202   54.272  38.439  1.00 63.05  ? 416  GLN B OE1   1 
ATOM   7960  N NE2   . GLN B 1 416 ? 6.137   54.668  36.445  1.00 49.14  ? 416  GLN B NE2   1 
ATOM   7961  N N     . GLU B 1 417 ? 3.739   50.198  35.130  1.00 33.40  ? 417  GLU B N     1 
ATOM   7962  C CA    . GLU B 1 417 ? 3.767   49.762  33.747  1.00 33.55  ? 417  GLU B CA    1 
ATOM   7963  C C     . GLU B 1 417 ? 2.718   50.445  32.898  1.00 31.14  ? 417  GLU B C     1 
ATOM   7964  O O     . GLU B 1 417 ? 3.008   50.867  31.799  1.00 30.69  ? 417  GLU B O     1 
ATOM   7965  C CB    . GLU B 1 417 ? 3.588   48.269  33.656  1.00 33.90  ? 417  GLU B CB    1 
ATOM   7966  C CG    . GLU B 1 417 ? 4.796   47.550  34.148  1.00 42.27  ? 417  GLU B CG    1 
ATOM   7967  C CD    . GLU B 1 417 ? 4.896   46.192  33.529  1.00 47.41  ? 417  GLU B CD    1 
ATOM   7968  O OE1   . GLU B 1 417 ? 5.366   46.082  32.358  1.00 49.04  ? 417  GLU B OE1   1 
ATOM   7969  O OE2   . GLU B 1 417 ? 4.481   45.245  34.230  1.00 49.82  ? 417  GLU B OE2   1 
ATOM   7970  N N     . PHE B 1 418 ? 1.512   50.579  33.425  1.00 29.80  ? 418  PHE B N     1 
ATOM   7971  C CA    . PHE B 1 418 ? 0.473   51.347  32.735  1.00 29.65  ? 418  PHE B CA    1 
ATOM   7972  C C     . PHE B 1 418 ? 0.793   52.819  32.632  1.00 27.01  ? 418  PHE B C     1 
ATOM   7973  O O     . PHE B 1 418 ? 0.589   53.423  31.605  1.00 25.69  ? 418  PHE B O     1 
ATOM   7974  C CB    . PHE B 1 418 ? -0.865  51.187  33.461  1.00 27.45  ? 418  PHE B CB    1 
ATOM   7975  C CG    . PHE B 1 418 ? -1.305  49.765  33.570  1.00 30.43  ? 418  PHE B CG    1 
ATOM   7976  C CD1   . PHE B 1 418 ? -1.084  48.869  32.534  1.00 27.67  ? 418  PHE B CD1   1 
ATOM   7977  C CD2   . PHE B 1 418 ? -1.958  49.309  34.694  1.00 27.65  ? 418  PHE B CD2   1 
ATOM   7978  C CE1   . PHE B 1 418 ? -1.503  47.547  32.653  1.00 25.76  ? 418  PHE B CE1   1 
ATOM   7979  C CE2   . PHE B 1 418 ? -2.387  48.014  34.778  1.00 24.44  ? 418  PHE B CE2   1 
ATOM   7980  C CZ    . PHE B 1 418 ? -2.154  47.141  33.761  1.00 24.66  ? 418  PHE B CZ    1 
ATOM   7981  N N     . VAL B 1 419 ? 1.285   53.382  33.730  1.00 26.86  ? 419  VAL B N     1 
ATOM   7982  C CA    . VAL B 1 419 ? 1.599   54.788  33.804  1.00 27.92  ? 419  VAL B CA    1 
ATOM   7983  C C     . VAL B 1 419 ? 2.716   55.135  32.787  1.00 28.18  ? 419  VAL B C     1 
ATOM   7984  O O     . VAL B 1 419 ? 2.625   56.156  32.082  1.00 29.42  ? 419  VAL B O     1 
ATOM   7985  C CB    . VAL B 1 419 ? 1.967   55.230  35.253  1.00 27.87  ? 419  VAL B CB    1 
ATOM   7986  C CG1   . VAL B 1 419 ? 2.530   56.624  35.293  1.00 29.97  ? 419  VAL B CG1   1 
ATOM   7987  C CG2   . VAL B 1 419 ? 0.752   55.157  36.179  1.00 27.71  ? 419  VAL B CG2   1 
ATOM   7988  N N     . ASN B 1 420 ? 3.735   54.282  32.702  1.00 27.90  ? 420  ASN B N     1 
ATOM   7989  C CA    . ASN B 1 420 ? 4.846   54.485  31.766  1.00 30.77  ? 420  ASN B CA    1 
ATOM   7990  C C     . ASN B 1 420 ? 4.424   54.368  30.288  1.00 29.94  ? 420  ASN B C     1 
ATOM   7991  O O     . ASN B 1 420 ? 5.121   54.843  29.397  1.00 29.75  ? 420  ASN B O     1 
ATOM   7992  C CB    . ASN B 1 420 ? 5.988   53.483  32.054  1.00 32.68  ? 420  ASN B CB    1 
ATOM   7993  C CG    . ASN B 1 420 ? 6.783   53.835  33.312  1.00 39.00  ? 420  ASN B CG    1 
ATOM   7994  O OD1   . ASN B 1 420 ? 6.847   55.001  33.734  1.00 45.55  ? 420  ASN B OD1   1 
ATOM   7995  N ND2   . ASN B 1 420 ? 7.414   52.823  33.905  1.00 40.97  ? 420  ASN B ND2   1 
ATOM   7996  N N     . LYS B 1 421 ? 3.287   53.722  30.038  1.00 30.45  ? 421  LYS B N     1 
ATOM   7997  C CA    . LYS B 1 421 ? 2.729   53.599  28.683  1.00 29.93  ? 421  LYS B CA    1 
ATOM   7998  C C     . LYS B 1 421 ? 1.671   54.661  28.340  1.00 28.45  ? 421  LYS B C     1 
ATOM   7999  O O     . LYS B 1 421 ? 1.084   54.614  27.266  1.00 28.03  ? 421  LYS B O     1 
ATOM   8000  C CB    . LYS B 1 421 ? 2.182   52.185  28.500  1.00 30.18  ? 421  LYS B CB    1 
ATOM   8001  C CG    . LYS B 1 421 ? 3.314   51.144  28.420  1.00 29.71  ? 421  LYS B CG    1 
ATOM   8002  C CD    . LYS B 1 421 ? 2.803   49.706  28.492  1.00 35.10  ? 421  LYS B CD    1 
ATOM   8003  C CE    . LYS B 1 421 ? 3.832   48.699  27.853  1.00 40.31  ? 421  LYS B CE    1 
ATOM   8004  N NZ    . LYS B 1 421 ? 3.560   48.339  26.394  1.00 39.04  ? 421  LYS B NZ    1 
ATOM   8005  N N     . SER B 1 422 ? 1.484   55.640  29.239  1.00 29.19  ? 422  SER B N     1 
ATOM   8006  C CA    . SER B 1 422 ? 0.410   56.686  29.163  1.00 27.96  ? 422  SER B CA    1 
ATOM   8007  C C     . SER B 1 422 ? -1.001  56.117  29.166  1.00 25.61  ? 422  SER B C     1 
ATOM   8008  O O     . SER B 1 422 ? -1.920  56.774  28.675  1.00 26.25  ? 422  SER B O     1 
ATOM   8009  C CB    . SER B 1 422 ? 0.540   57.613  27.943  1.00 27.10  ? 422  SER B CB    1 
ATOM   8010  O OG    . SER B 1 422 ? 1.590   58.544  28.101  1.00 34.31  ? 422  SER B OG    1 
ATOM   8011  N N     . LEU B 1 423 ? -1.163  54.922  29.735  1.00 25.19  ? 423  LEU B N     1 
ATOM   8012  C CA    . LEU B 1 423 ? -2.459  54.250  29.828  1.00 25.76  ? 423  LEU B CA    1 
ATOM   8013  C C     . LEU B 1 423 ? -3.143  54.504  31.173  1.00 27.48  ? 423  LEU B C     1 
ATOM   8014  O O     . LEU B 1 423 ? -4.301  54.106  31.375  1.00 28.02  ? 423  LEU B O     1 
ATOM   8015  C CB    . LEU B 1 423 ? -2.269  52.756  29.647  1.00 26.96  ? 423  LEU B CB    1 
ATOM   8016  C CG    . LEU B 1 423 ? -1.954  52.254  28.238  1.00 22.32  ? 423  LEU B CG    1 
ATOM   8017  C CD1   . LEU B 1 423 ? -1.577  50.799  28.335  1.00 20.46  ? 423  LEU B CD1   1 
ATOM   8018  C CD2   . LEU B 1 423 ? -3.141  52.446  27.340  1.00 24.85  ? 423  LEU B CD2   1 
ATOM   8019  N N     . LEU B 1 424 ? -2.430  55.211  32.056  1.00 26.31  ? 424  LEU B N     1 
ATOM   8020  C CA    . LEU B 1 424 ? -2.851  55.459  33.421  1.00 26.96  ? 424  LEU B CA    1 
ATOM   8021  C C     . LEU B 1 424 ? -2.022  56.632  33.927  1.00 27.11  ? 424  LEU B C     1 
ATOM   8022  O O     . LEU B 1 424 ? -0.909  56.831  33.447  1.00 29.09  ? 424  LEU B O     1 
ATOM   8023  C CB    . LEU B 1 424 ? -2.615  54.228  34.314  1.00 27.08  ? 424  LEU B CB    1 
ATOM   8024  C CG    . LEU B 1 424 ? -3.244  54.214  35.721  1.00 24.83  ? 424  LEU B CG    1 
ATOM   8025  C CD1   . LEU B 1 424 ? -4.766  54.287  35.590  1.00 31.27  ? 424  LEU B CD1   1 
ATOM   8026  C CD2   . LEU B 1 424 ? -2.896  52.969  36.447  1.00 23.82  ? 424  LEU B CD2   1 
ATOM   8027  N N     . PHE B 1 425 ? -2.564  57.378  34.888  1.00 27.01  ? 425  PHE B N     1 
ATOM   8028  C CA    . PHE B 1 425 ? -1.876  58.496  35.533  1.00 28.16  ? 425  PHE B CA    1 
ATOM   8029  C C     . PHE B 1 425 ? -1.819  58.293  37.035  1.00 28.68  ? 425  PHE B C     1 
ATOM   8030  O O     . PHE B 1 425 ? -2.646  57.595  37.608  1.00 29.29  ? 425  PHE B O     1 
ATOM   8031  C CB    . PHE B 1 425 ? -2.534  59.819  35.123  1.00 30.17  ? 425  PHE B CB    1 
ATOM   8032  C CG    . PHE B 1 425 ? -2.573  59.973  33.631  1.00 30.34  ? 425  PHE B CG    1 
ATOM   8033  C CD1   . PHE B 1 425 ? -3.509  59.285  32.879  1.00 34.40  ? 425  PHE B CD1   1 
ATOM   8034  C CD2   . PHE B 1 425 ? -1.577  60.648  32.973  1.00 29.85  ? 425  PHE B CD2   1 
ATOM   8035  C CE1   . PHE B 1 425 ? -3.497  59.350  31.482  1.00 35.87  ? 425  PHE B CE1   1 
ATOM   8036  C CE2   . PHE B 1 425 ? -1.568  60.704  31.575  1.00 34.54  ? 425  PHE B CE2   1 
ATOM   8037  C CZ    . PHE B 1 425 ? -2.517  60.049  30.841  1.00 27.77  ? 425  PHE B CZ    1 
ATOM   8038  N N     . CYS B 1 426 ? -0.782  58.843  37.642  1.00 29.44  ? 426  CYS B N     1 
ATOM   8039  C CA    . CYS B 1 426 ? -0.548  58.681  39.066  1.00 30.61  ? 426  CYS B CA    1 
ATOM   8040  C C     . CYS B 1 426 ? -0.131  60.024  39.652  1.00 31.26  ? 426  CYS B C     1 
ATOM   8041  O O     . CYS B 1 426 ? 0.845   60.640  39.170  1.00 32.33  ? 426  CYS B O     1 
ATOM   8042  C CB    . CYS B 1 426 ? 0.536   57.641  39.294  1.00 28.81  ? 426  CYS B CB    1 
ATOM   8043  S SG    . CYS B 1 426 ? 0.955   57.360  41.018  1.00 29.50  ? 426  CYS B SG    1 
ATOM   8044  N N     . ASP B 1 427 ? -0.872  60.491  40.660  1.00 33.71  ? 427  ASP B N     1 
ATOM   8045  C CA    . ASP B 1 427 ? -0.461  61.678  41.439  1.00 35.88  ? 427  ASP B CA    1 
ATOM   8046  C C     . ASP B 1 427 ? 0.158   61.189  42.747  1.00 36.17  ? 427  ASP B C     1 
ATOM   8047  O O     . ASP B 1 427 ? -0.441  60.418  43.476  1.00 33.58  ? 427  ASP B O     1 
ATOM   8048  C CB    . ASP B 1 427 ? -1.612  62.653  41.734  1.00 36.99  ? 427  ASP B CB    1 
ATOM   8049  C CG    . ASP B 1 427 ? -2.088  63.415  40.476  1.00 41.95  ? 427  ASP B CG    1 
ATOM   8050  O OD1   . ASP B 1 427 ? -1.342  63.511  39.491  1.00 43.53  ? 427  ASP B OD1   1 
ATOM   8051  O OD2   . ASP B 1 427 ? -3.226  63.898  40.454  1.00 45.29  ? 427  ASP B OD2   1 
ATOM   8052  N N     . ARG B 1 428 ? 1.377   61.646  42.998  1.00 38.21  ? 428  ARG B N     1 
ATOM   8053  C CA    . ARG B 1 428 ? 2.158   61.244  44.145  1.00 40.30  ? 428  ARG B CA    1 
ATOM   8054  C C     . ARG B 1 428 ? 2.262   62.389  45.148  1.00 41.96  ? 428  ARG B C     1 
ATOM   8055  O O     . ARG B 1 428 ? 2.765   63.444  44.808  1.00 42.87  ? 428  ARG B O     1 
ATOM   8056  C CB    . ARG B 1 428 ? 3.557   60.875  43.657  1.00 38.84  ? 428  ARG B CB    1 
ATOM   8057  C CG    . ARG B 1 428 ? 3.626   59.704  42.676  1.00 33.85  ? 428  ARG B CG    1 
ATOM   8058  C CD    . ARG B 1 428 ? 3.530   60.065  41.170  1.00 37.72  ? 428  ARG B CD    1 
ATOM   8059  N NE    . ARG B 1 428 ? 4.735   60.705  40.634  1.00 28.03  ? 428  ARG B NE    1 
ATOM   8060  C CZ    . ARG B 1 428 ? 4.903   61.085  39.370  1.00 34.18  ? 428  ARG B CZ    1 
ATOM   8061  N NH1   . ARG B 1 428 ? 3.956   60.907  38.471  1.00 38.12  ? 428  ARG B NH1   1 
ATOM   8062  N NH2   . ARG B 1 428 ? 6.038   61.656  38.996  1.00 38.81  ? 428  ARG B NH2   1 
ATOM   8063  N N     . ASN B 1 429 ? 1.746   62.201  46.367  1.00 46.16  ? 429  ASN B N     1 
ATOM   8064  C CA    . ASN B 1 429 ? 2.059   63.107  47.480  1.00 47.29  ? 429  ASN B CA    1 
ATOM   8065  C C     . ASN B 1 429 ? 2.767   62.305  48.583  1.00 48.43  ? 429  ASN B C     1 
ATOM   8066  O O     . ASN B 1 429 ? 2.149   61.773  49.501  1.00 48.45  ? 429  ASN B O     1 
ATOM   8067  C CB    . ASN B 1 429 ? 0.840   63.870  48.000  1.00 46.25  ? 429  ASN B CB    1 
ATOM   8068  C CG    . ASN B 1 429 ? 1.232   65.071  48.899  1.00 51.60  ? 429  ASN B CG    1 
ATOM   8069  O OD1   . ASN B 1 429 ? 2.326   65.656  48.763  1.00 59.01  ? 429  ASN B OD1   1 
ATOM   8070  N ND2   . ASN B 1 429 ? 0.337   65.439  49.818  1.00 59.65  ? 429  ASN B ND2   1 
ATOM   8071  N N     . GLY B 1 430 ? 4.081   62.199  48.436  1.00 51.27  ? 430  GLY B N     1 
ATOM   8072  C CA    . GLY B 1 430 ? 4.899   61.359  49.286  1.00 52.00  ? 430  GLY B CA    1 
ATOM   8073  C C     . GLY B 1 430 ? 4.485   59.901  49.199  1.00 53.28  ? 430  GLY B C     1 
ATOM   8074  O O     . GLY B 1 430 ? 4.609   59.267  48.151  1.00 52.11  ? 430  GLY B O     1 
ATOM   8075  N N     . LYS B 1 431 ? 3.979   59.380  50.311  1.00 54.29  ? 431  LYS B N     1 
ATOM   8076  C CA    . LYS B 1 431 ? 3.624   57.965  50.423  1.00 55.54  ? 431  LYS B CA    1 
ATOM   8077  C C     . LYS B 1 431 ? 2.236   57.632  49.853  1.00 53.26  ? 431  LYS B C     1 
ATOM   8078  O O     . LYS B 1 431 ? 1.979   56.489  49.533  1.00 53.80  ? 431  LYS B O     1 
ATOM   8079  C CB    . LYS B 1 431 ? 3.711   57.520  51.890  1.00 55.84  ? 431  LYS B CB    1 
ATOM   8080  C CG    . LYS B 1 431 ? 2.749   58.266  52.824  1.00 60.20  ? 431  LYS B CG    1 
ATOM   8081  C CD    . LYS B 1 431 ? 2.644   57.619  54.208  1.00 60.44  ? 431  LYS B CD    1 
ATOM   8082  C CE    . LYS B 1 431 ? 1.412   58.120  54.950  1.00 61.90  ? 431  LYS B CE    1 
ATOM   8083  N NZ    . LYS B 1 431 ? 1.460   57.710  56.376  1.00 62.66  ? 431  LYS B NZ    1 
ATOM   8084  N N     . SER B 1 432 ? 1.350   58.622  49.758  1.00 51.57  ? 432  SER B N     1 
ATOM   8085  C CA    . SER B 1 432 ? 0.026   58.419  49.146  1.00 51.76  ? 432  SER B CA    1 
ATOM   8086  C C     . SER B 1 432 ? 0.060   58.455  47.592  1.00 48.23  ? 432  SER B C     1 
ATOM   8087  O O     . SER B 1 432 ? 0.453   59.465  46.980  1.00 46.53  ? 432  SER B O     1 
ATOM   8088  C CB    . SER B 1 432 ? -1.004  59.429  49.703  1.00 55.46  ? 432  SER B CB    1 
ATOM   8089  O OG    . SER B 1 432 ? -1.586  58.948  50.935  1.00 62.52  ? 432  SER B OG    1 
ATOM   8090  N N     . PHE B 1 433 ? -0.327  57.339  46.965  1.00 44.59  ? 433  PHE B N     1 
ATOM   8091  C CA    . PHE B 1 433 ? -0.408  57.245  45.481  1.00 42.88  ? 433  PHE B CA    1 
ATOM   8092  C C     . PHE B 1 433 ? -1.871  57.151  45.086  1.00 39.61  ? 433  PHE B C     1 
ATOM   8093  O O     . PHE B 1 433 ? -2.636  56.398  45.671  1.00 36.14  ? 433  PHE B O     1 
ATOM   8094  C CB    . PHE B 1 433 ? 0.327   56.024  44.918  1.00 41.90  ? 433  PHE B CB    1 
ATOM   8095  C CG    . PHE B 1 433 ? 1.846   56.174  44.815  1.00 43.49  ? 433  PHE B CG    1 
ATOM   8096  C CD1   . PHE B 1 433 ? 2.558   57.072  45.597  1.00 47.15  ? 433  PHE B CD1   1 
ATOM   8097  C CD2   . PHE B 1 433 ? 2.564   55.343  43.969  1.00 42.69  ? 433  PHE B CD2   1 
ATOM   8098  C CE1   . PHE B 1 433 ? 3.965   57.161  45.500  1.00 49.65  ? 433  PHE B CE1   1 
ATOM   8099  C CE2   . PHE B 1 433 ? 3.946   55.426  43.865  1.00 48.56  ? 433  PHE B CE2   1 
ATOM   8100  C CZ    . PHE B 1 433 ? 4.654   56.345  44.634  1.00 46.59  ? 433  PHE B CZ    1 
ATOM   8101  N N     . ARG B 1 434 ? -2.258  57.934  44.091  1.00 39.03  ? 434  ARG B N     1 
ATOM   8102  C CA    . ARG B 1 434 ? -3.639  57.910  43.572  1.00 40.06  ? 434  ARG B CA    1 
ATOM   8103  C C     . ARG B 1 434 ? -3.604  57.801  42.067  1.00 36.02  ? 434  ARG B C     1 
ATOM   8104  O O     . ARG B 1 434 ? -2.830  58.478  41.430  1.00 33.15  ? 434  ARG B O     1 
ATOM   8105  C CB    . ARG B 1 434 ? -4.407  59.174  43.991  1.00 39.84  ? 434  ARG B CB    1 
ATOM   8106  C CG    . ARG B 1 434 ? -4.674  59.245  45.512  1.00 46.90  ? 434  ARG B CG    1 
ATOM   8107  C CD    . ARG B 1 434 ? -5.215  60.584  45.946  1.00 48.52  ? 434  ARG B CD    1 
ATOM   8108  N NE    . ARG B 1 434 ? -4.282  61.641  45.571  1.00 66.16  ? 434  ARG B NE    1 
ATOM   8109  C CZ    . ARG B 1 434 ? -4.421  62.935  45.852  1.00 76.69  ? 434  ARG B CZ    1 
ATOM   8110  N NH1   . ARG B 1 434 ? -5.474  63.376  46.543  1.00 81.04  ? 434  ARG B NH1   1 
ATOM   8111  N NH2   . ARG B 1 434 ? -3.485  63.794  45.438  1.00 79.62  ? 434  ARG B NH2   1 
ATOM   8112  N N     . TYR B 1 435 ? -4.462  56.947  41.516  1.00 34.77  ? 435  TYR B N     1 
ATOM   8113  C CA    . TYR B 1 435 ? -4.404  56.616  40.100  1.00 32.43  ? 435  TYR B CA    1 
ATOM   8114  C C     . TYR B 1 435 ? -5.678  57.053  39.439  1.00 31.30  ? 435  TYR B C     1 
ATOM   8115  O O     . TYR B 1 435 ? -6.736  57.028  40.056  1.00 28.96  ? 435  TYR B O     1 
ATOM   8116  C CB    . TYR B 1 435 ? -4.151  55.120  39.927  1.00 31.15  ? 435  TYR B CB    1 
ATOM   8117  C CG    . TYR B 1 435 ? -2.849  54.663  40.567  1.00 30.37  ? 435  TYR B CG    1 
ATOM   8118  C CD1   . TYR B 1 435 ? -1.661  54.685  39.851  1.00 28.37  ? 435  TYR B CD1   1 
ATOM   8119  C CD2   . TYR B 1 435 ? -2.809  54.232  41.889  1.00 32.13  ? 435  TYR B CD2   1 
ATOM   8120  C CE1   . TYR B 1 435 ? -0.461  54.277  40.416  1.00 27.25  ? 435  TYR B CE1   1 
ATOM   8121  C CE2   . TYR B 1 435 ? -1.612  53.823  42.472  1.00 31.17  ? 435  TYR B CE2   1 
ATOM   8122  C CZ    . TYR B 1 435 ? -0.439  53.856  41.722  1.00 34.02  ? 435  TYR B CZ    1 
ATOM   8123  O OH    . TYR B 1 435 ? 0.751   53.426  42.253  1.00 32.04  ? 435  TYR B OH    1 
ATOM   8124  N N     . TYR B 1 436 ? -5.551  57.487  38.190  1.00 29.86  ? 436  TYR B N     1 
ATOM   8125  C CA    . TYR B 1 436 ? -6.688  57.934  37.396  1.00 29.61  ? 436  TYR B CA    1 
ATOM   8126  C C     . TYR B 1 436 ? -6.449  57.792  35.888  1.00 30.99  ? 436  TYR B C     1 
ATOM   8127  O O     . TYR B 1 436 ? -5.311  57.622  35.398  1.00 30.42  ? 436  TYR B O     1 
ATOM   8128  C CB    . TYR B 1 436 ? -7.057  59.394  37.736  1.00 26.61  ? 436  TYR B CB    1 
ATOM   8129  C CG    . TYR B 1 436 ? -5.957  60.417  37.483  1.00 28.32  ? 436  TYR B CG    1 
ATOM   8130  C CD1   . TYR B 1 436 ? -4.900  60.542  38.366  1.00 31.36  ? 436  TYR B CD1   1 
ATOM   8131  C CD2   . TYR B 1 436 ? -5.987  61.266  36.371  1.00 29.94  ? 436  TYR B CD2   1 
ATOM   8132  C CE1   . TYR B 1 436 ? -3.906  61.465  38.176  1.00 30.14  ? 436  TYR B CE1   1 
ATOM   8133  C CE2   . TYR B 1 436 ? -4.990  62.216  36.167  1.00 27.59  ? 436  TYR B CE2   1 
ATOM   8134  C CZ    . TYR B 1 436 ? -3.946  62.300  37.079  1.00 33.56  ? 436  TYR B CZ    1 
ATOM   8135  O OH    . TYR B 1 436 ? -2.913  63.201  36.923  1.00 35.25  ? 436  TYR B OH    1 
ATOM   8136  N N     . LEU B 1 437 ? -7.557  57.868  35.168  1.00 31.46  ? 437  LEU B N     1 
ATOM   8137  C CA    . LEU B 1 437 ? -7.586  57.773  33.725  1.00 30.72  ? 437  LEU B CA    1 
ATOM   8138  C C     . LEU B 1 437 ? -8.046  59.095  33.191  1.00 31.34  ? 437  LEU B C     1 
ATOM   8139  O O     . LEU B 1 437 ? -8.847  59.759  33.829  1.00 32.02  ? 437  LEU B O     1 
ATOM   8140  C CB    . LEU B 1 437 ? -8.584  56.677  33.290  1.00 29.14  ? 437  LEU B CB    1 
ATOM   8141  C CG    . LEU B 1 437 ? -8.194  55.211  33.580  1.00 33.41  ? 437  LEU B CG    1 
ATOM   8142  C CD1   . LEU B 1 437 ? -9.370  54.293  33.405  1.00 31.99  ? 437  LEU B CD1   1 
ATOM   8143  C CD2   . LEU B 1 437 ? -7.040  54.740  32.674  1.00 32.11  ? 437  LEU B CD2   1 
ATOM   8144  N N     . HIS B 1 438 ? -7.598  59.459  31.994  1.00 29.57  ? 438  HIS B N     1 
ATOM   8145  C CA    . HIS B 1 438 ? -8.180  60.587  31.303  1.00 28.84  ? 438  HIS B CA    1 
ATOM   8146  C C     . HIS B 1 438 ? -9.585  60.167  30.933  1.00 28.98  ? 438  HIS B C     1 
ATOM   8147  O O     . HIS B 1 438 ? -9.828  58.972  30.678  1.00 28.46  ? 438  HIS B O     1 
ATOM   8148  C CB    . HIS B 1 438 ? -7.373  60.935  30.055  1.00 28.30  ? 438  HIS B CB    1 
ATOM   8149  C CG    . HIS B 1 438 ? -7.711  62.270  29.478  1.00 32.07  ? 438  HIS B CG    1 
ATOM   8150  N ND1   . HIS B 1 438 ? -8.803  62.467  28.665  1.00 28.86  ? 438  HIS B ND1   1 
ATOM   8151  C CD2   . HIS B 1 438 ? -7.119  63.487  29.619  1.00 36.80  ? 438  HIS B CD2   1 
ATOM   8152  C CE1   . HIS B 1 438 ? -8.864  63.742  28.307  1.00 38.59  ? 438  HIS B CE1   1 
ATOM   8153  N NE2   . HIS B 1 438 ? -7.868  64.390  28.891  1.00 34.11  ? 438  HIS B NE2   1 
ATOM   8154  N N     . ASP B 1 439 ? -10.518 61.126  30.918  1.00 29.44  ? 439  ASP B N     1 
ATOM   8155  C CA    . ASP B 1 439 ? -11.901 60.891  30.469  1.00 29.43  ? 439  ASP B CA    1 
ATOM   8156  C C     . ASP B 1 439 ? -12.028 60.096  29.205  1.00 28.97  ? 439  ASP B C     1 
ATOM   8157  O O     . ASP B 1 439 ? -12.898 59.230  29.096  1.00 29.67  ? 439  ASP B O     1 
ATOM   8158  C CB    . ASP B 1 439 ? -12.601 62.218  30.161  1.00 30.89  ? 439  ASP B CB    1 
ATOM   8159  C CG    . ASP B 1 439 ? -13.019 62.961  31.406  1.00 39.80  ? 439  ASP B CG    1 
ATOM   8160  O OD1   . ASP B 1 439 ? -12.418 62.680  32.479  1.00 44.00  ? 439  ASP B OD1   1 
ATOM   8161  O OD2   . ASP B 1 439 ? -13.948 63.814  31.297  1.00 47.21  ? 439  ASP B OD2   1 
ATOM   8162  N N     . LEU B 1 440 ? -11.228 60.461  28.206  1.00 28.50  ? 440  LEU B N     1 
ATOM   8163  C CA    . LEU B 1 440 ? -11.289 59.819  26.919  1.00 28.16  ? 440  LEU B CA    1 
ATOM   8164  C C     . LEU B 1 440 ? -10.898 58.336  27.016  1.00 27.39  ? 440  LEU B C     1 
ATOM   8165  O O     . LEU B 1 440 ? -11.346 57.537  26.213  1.00 26.69  ? 440  LEU B O     1 
ATOM   8166  C CB    . LEU B 1 440 ? -10.409 60.550  25.911  1.00 28.28  ? 440  LEU B CB    1 
ATOM   8167  C CG    . LEU B 1 440 ? -10.720 62.026  25.636  1.00 33.08  ? 440  LEU B CG    1 
ATOM   8168  C CD1   . LEU B 1 440 ? -9.684  62.611  24.745  1.00 37.05  ? 440  LEU B CD1   1 
ATOM   8169  C CD2   . LEU B 1 440 ? -12.061 62.198  25.011  1.00 32.27  ? 440  LEU B CD2   1 
ATOM   8170  N N     . GLN B 1 441 ? -10.065 57.984  28.008  1.00 27.55  ? 441  GLN B N     1 
ATOM   8171  C CA    . GLN B 1 441 ? -9.645  56.596  28.217  1.00 27.19  ? 441  GLN B CA    1 
ATOM   8172  C C     . GLN B 1 441 ? -10.727 55.810  28.933  1.00 28.15  ? 441  GLN B C     1 
ATOM   8173  O O     . GLN B 1 441 ? -10.923 54.635  28.648  1.00 26.59  ? 441  GLN B O     1 
ATOM   8174  C CB    . GLN B 1 441 ? -8.341  56.526  28.993  1.00 25.34  ? 441  GLN B CB    1 
ATOM   8175  C CG    . GLN B 1 441 ? -7.212  57.195  28.241  1.00 26.54  ? 441  GLN B CG    1 
ATOM   8176  C CD    . GLN B 1 441 ? -5.936  57.200  29.014  1.00 25.65  ? 441  GLN B CD    1 
ATOM   8177  O OE1   . GLN B 1 441 ? -5.932  57.451  30.219  1.00 29.00  ? 441  GLN B OE1   1 
ATOM   8178  N NE2   . GLN B 1 441 ? -4.844  56.888  28.341  1.00 25.71  ? 441  GLN B NE2   1 
ATOM   8179  N N     . VAL B 1 442 ? -11.454 56.470  29.833  1.00 28.38  ? 442  VAL B N     1 
ATOM   8180  C CA    . VAL B 1 442 ? -12.635 55.864  30.450  1.00 27.58  ? 442  VAL B CA    1 
ATOM   8181  C C     . VAL B 1 442 ? -13.639 55.494  29.352  1.00 28.95  ? 442  VAL B C     1 
ATOM   8182  O O     . VAL B 1 442 ? -14.155 54.376  29.350  1.00 26.39  ? 442  VAL B O     1 
ATOM   8183  C CB    . VAL B 1 442 ? -13.300 56.779  31.530  1.00 25.54  ? 442  VAL B CB    1 
ATOM   8184  C CG1   . VAL B 1 442 ? -14.656 56.198  32.011  1.00 28.09  ? 442  VAL B CG1   1 
ATOM   8185  C CG2   . VAL B 1 442 ? -12.370 56.975  32.736  1.00 24.81  ? 442  VAL B CG2   1 
ATOM   8186  N N     . ASP B 1 443 ? -13.878 56.423  28.421  1.00 31.01  ? 443  ASP B N     1 
ATOM   8187  C CA    . ASP B 1 443 ? -14.766 56.191  27.272  1.00 30.63  ? 443  ASP B CA    1 
ATOM   8188  C C     . ASP B 1 443 ? -14.319 55.009  26.420  1.00 31.01  ? 443  ASP B C     1 
ATOM   8189  O O     . ASP B 1 443 ? -15.149 54.186  26.025  1.00 32.21  ? 443  ASP B O     1 
ATOM   8190  C CB    . ASP B 1 443 ? -14.839 57.422  26.376  1.00 33.49  ? 443  ASP B CB    1 
ATOM   8191  C CG    . ASP B 1 443 ? -15.580 58.581  27.010  1.00 40.61  ? 443  ASP B CG    1 
ATOM   8192  O OD1   . ASP B 1 443 ? -16.340 58.377  27.993  1.00 40.74  ? 443  ASP B OD1   1 
ATOM   8193  O OD2   . ASP B 1 443 ? -15.383 59.715  26.507  1.00 41.41  ? 443  ASP B OD2   1 
ATOM   8194  N N     . PHE B 1 444 ? -13.025 54.936  26.101  1.00 29.62  ? 444  PHE B N     1 
ATOM   8195  C CA    . PHE B 1 444 ? -12.500 53.770  25.373  1.00 29.05  ? 444  PHE B CA    1 
ATOM   8196  C C     . PHE B 1 444 ? -12.770 52.435  26.080  1.00 28.70  ? 444  PHE B C     1 
ATOM   8197  O O     . PHE B 1 444 ? -13.243 51.489  25.475  1.00 26.62  ? 444  PHE B O     1 
ATOM   8198  C CB    . PHE B 1 444 ? -10.995 53.873  25.127  1.00 30.00  ? 444  PHE B CB    1 
ATOM   8199  C CG    . PHE B 1 444 ? -10.402 52.632  24.492  1.00 28.14  ? 444  PHE B CG    1 
ATOM   8200  C CD1   . PHE B 1 444 ? -10.493 52.430  23.121  1.00 30.15  ? 444  PHE B CD1   1 
ATOM   8201  C CD2   . PHE B 1 444 ? -9.776  51.669  25.270  1.00 30.34  ? 444  PHE B CD2   1 
ATOM   8202  C CE1   . PHE B 1 444 ? -9.985  51.282  22.542  1.00 31.57  ? 444  PHE B CE1   1 
ATOM   8203  C CE2   . PHE B 1 444 ? -9.227  50.526  24.697  1.00 26.98  ? 444  PHE B CE2   1 
ATOM   8204  C CZ    . PHE B 1 444 ? -9.351  50.316  23.351  1.00 26.60  ? 444  PHE B CZ    1 
ATOM   8205  N N     . LEU B 1 445 ? -12.457 52.363  27.367  1.00 29.85  ? 445  LEU B N     1 
ATOM   8206  C CA    . LEU B 1 445 ? -12.559 51.104  28.133  1.00 29.98  ? 445  LEU B CA    1 
ATOM   8207  C C     . LEU B 1 445 ? -14.002 50.671  28.325  1.00 30.77  ? 445  LEU B C     1 
ATOM   8208  O O     . LEU B 1 445 ? -14.321 49.485  28.303  1.00 32.30  ? 445  LEU B O     1 
ATOM   8209  C CB    . LEU B 1 445 ? -11.846 51.240  29.506  1.00 29.65  ? 445  LEU B CB    1 
ATOM   8210  C CG    . LEU B 1 445 ? -10.306 51.241  29.432  1.00 32.78  ? 445  LEU B CG    1 
ATOM   8211  C CD1   . LEU B 1 445 ? -9.665  51.548  30.777  1.00 35.75  ? 445  LEU B CD1   1 
ATOM   8212  C CD2   . LEU B 1 445 ? -9.758  49.913  28.906  1.00 27.00  ? 445  LEU B CD2   1 
ATOM   8213  N N     . THR B 1 446 ? -14.868 51.652  28.515  1.00 32.73  ? 446  THR B N     1 
ATOM   8214  C CA    . THR B 1 446 ? -16.302 51.424  28.707  1.00 34.11  ? 446  THR B CA    1 
ATOM   8215  C C     . THR B 1 446 ? -16.907 50.828  27.427  1.00 35.24  ? 446  THR B C     1 
ATOM   8216  O O     . THR B 1 446 ? -17.770 49.911  27.490  1.00 34.36  ? 446  THR B O     1 
ATOM   8217  C CB    . THR B 1 446 ? -16.993 52.767  29.124  1.00 31.75  ? 446  THR B CB    1 
ATOM   8218  O OG1   . THR B 1 446 ? -16.763 52.979  30.523  1.00 38.58  ? 446  THR B OG1   1 
ATOM   8219  C CG2   . THR B 1 446 ? -18.474 52.757  28.874  1.00 37.07  ? 446  THR B CG2   1 
ATOM   8220  N N     . GLU B 1 447 ? -16.463 51.374  26.291  1.00 35.31  ? 447  GLU B N     1 
ATOM   8221  C CA    . GLU B 1 447 ? -16.813 50.880  24.954  1.00 35.84  ? 447  GLU B CA    1 
ATOM   8222  C C     . GLU B 1 447 ? -16.198 49.496  24.650  1.00 35.27  ? 447  GLU B C     1 
ATOM   8223  O O     . GLU B 1 447 ? -16.913 48.544  24.324  1.00 35.53  ? 447  GLU B O     1 
ATOM   8224  C CB    . GLU B 1 447 ? -16.329 51.880  23.905  1.00 37.23  ? 447  GLU B CB    1 
ATOM   8225  C CG    . GLU B 1 447 ? -16.540 51.457  22.479  1.00 39.32  ? 447  GLU B CG    1 
ATOM   8226  C CD    . GLU B 1 447 ? -17.995 51.369  22.111  1.00 45.87  ? 447  GLU B CD    1 
ATOM   8227  O OE1   . GLU B 1 447 ? -18.801 52.166  22.650  1.00 43.10  ? 447  GLU B OE1   1 
ATOM   8228  O OE2   . GLU B 1 447 ? -18.318 50.510  21.257  1.00 50.39  ? 447  GLU B OE2   1 
ATOM   8229  N N     . LYS B 1 448 ? -14.868 49.400  24.735  1.00 32.88  ? 448  LYS B N     1 
ATOM   8230  C CA    . LYS B 1 448 ? -14.164 48.125  24.538  1.00 32.82  ? 448  LYS B CA    1 
ATOM   8231  C C     . LYS B 1 448 ? -14.683 46.959  25.417  1.00 32.57  ? 448  LYS B C     1 
ATOM   8232  O O     . LYS B 1 448 ? -14.794 45.823  24.958  1.00 32.05  ? 448  LYS B O     1 
ATOM   8233  C CB    . LYS B 1 448 ? -12.657 48.270  24.802  1.00 31.91  ? 448  LYS B CB    1 
ATOM   8234  C CG    . LYS B 1 448 ? -11.888 46.963  24.492  1.00 33.16  ? 448  LYS B CG    1 
ATOM   8235  C CD    . LYS B 1 448 ? -10.444 46.979  24.954  1.00 35.19  ? 448  LYS B CD    1 
ATOM   8236  C CE    . LYS B 1 448 ? -9.737  45.645  24.614  1.00 32.71  ? 448  LYS B CE    1 
ATOM   8237  N NZ    . LYS B 1 448 ? -9.952  44.602  25.647  1.00 33.41  ? 448  LYS B NZ    1 
ATOM   8238  N N     . ASN B 1 449 ? -14.963 47.240  26.681  1.00 32.90  ? 449  ASN B N     1 
ATOM   8239  C CA    . ASN B 1 449 ? -15.277 46.197  27.625  1.00 33.65  ? 449  ASN B CA    1 
ATOM   8240  C C     . ASN B 1 449 ? -16.720 46.269  28.135  1.00 33.00  ? 449  ASN B C     1 
ATOM   8241  O O     . ASN B 1 449 ? -16.998 45.723  29.211  1.00 31.41  ? 449  ASN B O     1 
ATOM   8242  C CB    . ASN B 1 449 ? -14.263 46.230  28.807  1.00 33.39  ? 449  ASN B CB    1 
ATOM   8243  C CG    . ASN B 1 449 ? -12.787 46.083  28.359  1.00 35.38  ? 449  ASN B CG    1 
ATOM   8244  O OD1   . ASN B 1 449 ? -12.423 45.088  27.729  1.00 32.43  ? 449  ASN B OD1   1 
ATOM   8245  N ND2   . ASN B 1 449 ? -11.930 47.071  28.714  1.00 19.37  ? 449  ASN B ND2   1 
ATOM   8246  N N     . CYS B 1 450 ? -17.625 46.912  27.376  1.00 36.24  ? 450  CYS B N     1 
ATOM   8247  C CA    . CYS B 1 450 ? -19.066 47.093  27.793  1.00 36.61  ? 450  CYS B CA    1 
ATOM   8248  C C     . CYS B 1 450 ? -19.692 45.828  28.379  1.00 35.89  ? 450  CYS B C     1 
ATOM   8249  O O     . CYS B 1 450 ? -20.339 45.874  29.419  1.00 36.44  ? 450  CYS B O     1 
ATOM   8250  C CB    . CYS B 1 450 ? -20.009 47.572  26.644  1.00 37.04  ? 450  CYS B CB    1 
ATOM   8251  S SG    . CYS B 1 450 ? -21.877 47.367  27.058  1.00 47.72  ? 450  CYS B SG    1 
ATOM   8252  N N     . SER B 1 451 ? -19.509 44.704  27.689  1.00 35.89  ? 451  SER B N     1 
ATOM   8253  C CA    . SER B 1 451 ? -20.186 43.445  28.046  1.00 38.06  ? 451  SER B CA    1 
ATOM   8254  C C     . SER B 1 451 ? -19.615 42.792  29.303  1.00 37.84  ? 451  SER B C     1 
ATOM   8255  O O     . SER B 1 451 ? -20.242 41.916  29.862  1.00 38.97  ? 451  SER B O     1 
ATOM   8256  C CB    . SER B 1 451 ? -20.128 42.423  26.899  1.00 38.47  ? 451  SER B CB    1 
ATOM   8257  O OG    . SER B 1 451 ? -18.899 41.717  26.943  1.00 46.93  ? 451  SER B OG    1 
ATOM   8258  N N     . GLN B 1 452 ? -18.431 43.220  29.736  1.00 36.18  ? 452  GLN B N     1 
ATOM   8259  C CA    . GLN B 1 452 ? -17.815 42.716  30.955  1.00 36.59  ? 452  GLN B CA    1 
ATOM   8260  C C     . GLN B 1 452 ? -18.060 43.619  32.158  1.00 34.55  ? 452  GLN B C     1 
ATOM   8261  O O     . GLN B 1 452 ? -17.728 43.248  33.267  1.00 33.84  ? 452  GLN B O     1 
ATOM   8262  C CB    . GLN B 1 452 ? -16.282 42.602  30.764  1.00 37.17  ? 452  GLN B CB    1 
ATOM   8263  C CG    . GLN B 1 452 ? -15.828 41.552  29.755  1.00 41.30  ? 452  GLN B CG    1 
ATOM   8264  C CD    . GLN B 1 452 ? -14.307 41.460  29.662  1.00 43.38  ? 452  GLN B CD    1 
ATOM   8265  O OE1   . GLN B 1 452 ? -13.640 40.990  30.598  1.00 47.43  ? 452  GLN B OE1   1 
ATOM   8266  N NE2   . GLN B 1 452 ? -13.746 41.925  28.526  1.00 49.13  ? 452  GLN B NE2   1 
ATOM   8267  N N     . LEU B 1 453 ? -18.618 44.808  31.941  1.00 33.84  ? 453  LEU B N     1 
ATOM   8268  C CA    . LEU B 1 453 ? -18.599 45.862  32.956  1.00 33.40  ? 453  LEU B CA    1 
ATOM   8269  C C     . LEU B 1 453 ? -19.291 45.416  34.211  1.00 32.40  ? 453  LEU B C     1 
ATOM   8270  O O     . LEU B 1 453 ? -18.749 45.595  35.292  1.00 32.93  ? 453  LEU B O     1 
ATOM   8271  C CB    . LEU B 1 453 ? -19.227 47.162  32.444  1.00 30.52  ? 453  LEU B CB    1 
ATOM   8272  C CG    . LEU B 1 453 ? -18.409 47.919  31.397  1.00 34.86  ? 453  LEU B CG    1 
ATOM   8273  C CD1   . LEU B 1 453 ? -19.057 49.266  31.071  1.00 37.05  ? 453  LEU B CD1   1 
ATOM   8274  C CD2   . LEU B 1 453 ? -16.944 48.121  31.822  1.00 35.85  ? 453  LEU B CD2   1 
ATOM   8275  N N     . GLN B 1 454 ? -20.475 44.825  34.078  1.00 32.97  ? 454  GLN B N     1 
ATOM   8276  C CA    . GLN B 1 454 ? -21.248 44.333  35.254  1.00 34.22  ? 454  GLN B CA    1 
ATOM   8277  C C     . GLN B 1 454 ? -20.482 43.345  36.134  1.00 32.51  ? 454  GLN B C     1 
ATOM   8278  O O     . GLN B 1 454 ? -20.500 43.450  37.372  1.00 32.51  ? 454  GLN B O     1 
ATOM   8279  C CB    . GLN B 1 454 ? -22.548 43.687  34.804  1.00 33.49  ? 454  GLN B CB    1 
ATOM   8280  C CG    . GLN B 1 454 ? -23.509 43.392  35.938  1.00 38.16  ? 454  GLN B CG    1 
ATOM   8281  C CD    . GLN B 1 454 ? -24.759 42.652  35.447  1.00 41.05  ? 454  GLN B CD    1 
ATOM   8282  O OE1   . GLN B 1 454 ? -25.433 43.089  34.519  1.00 48.48  ? 454  GLN B OE1   1 
ATOM   8283  N NE2   . GLN B 1 454 ? -25.049 41.532  36.061  1.00 38.23  ? 454  GLN B NE2   1 
ATOM   8284  N N     . ASP B 1 455 ? -19.794 42.410  35.491  1.00 31.26  ? 455  ASP B N     1 
ATOM   8285  C CA    . ASP B 1 455 ? -18.997 41.397  36.202  1.00 33.02  ? 455  ASP B CA    1 
ATOM   8286  C C     . ASP B 1 455 ? -17.735 41.968  36.842  1.00 31.95  ? 455  ASP B C     1 
ATOM   8287  O O     . ASP B 1 455 ? -17.244 41.414  37.849  1.00 29.41  ? 455  ASP B O     1 
ATOM   8288  C CB    . ASP B 1 455 ? -18.573 40.246  35.272  1.00 34.22  ? 455  ASP B CB    1 
ATOM   8289  C CG    . ASP B 1 455 ? -19.680 39.212  35.062  1.00 42.58  ? 455  ASP B CG    1 
ATOM   8290  O OD1   . ASP B 1 455 ? -20.453 38.923  36.010  1.00 47.73  ? 455  ASP B OD1   1 
ATOM   8291  O OD2   . ASP B 1 455 ? -19.745 38.672  33.940  1.00 52.77  ? 455  ASP B OD2   1 
ATOM   8292  N N     . LEU B 1 456 ? -17.217 43.059  36.265  1.00 31.40  ? 456  LEU B N     1 
ATOM   8293  C CA    . LEU B 1 456 ? -16.089 43.776  36.889  1.00 31.84  ? 456  LEU B CA    1 
ATOM   8294  C C     . LEU B 1 456 ? -16.582 44.488  38.145  1.00 30.18  ? 456  LEU B C     1 
ATOM   8295  O O     . LEU B 1 456 ? -15.955 44.387  39.200  1.00 28.98  ? 456  LEU B O     1 
ATOM   8296  C CB    . LEU B 1 456 ? -15.368 44.727  35.905  1.00 32.17  ? 456  LEU B CB    1 
ATOM   8297  C CG    . LEU B 1 456 ? -14.805 44.010  34.659  1.00 37.06  ? 456  LEU B CG    1 
ATOM   8298  C CD1   . LEU B 1 456 ? -14.287 44.985  33.624  1.00 37.96  ? 456  LEU B CD1   1 
ATOM   8299  C CD2   . LEU B 1 456 ? -13.713 43.009  35.040  1.00 39.16  ? 456  LEU B CD2   1 
ATOM   8300  N N     . HIS B 1 457 ? -17.714 45.175  38.049  1.00 31.20  ? 457  HIS B N     1 
ATOM   8301  C CA    . HIS B 1 457 ? -18.300 45.793  39.228  1.00 31.21  ? 457  HIS B CA    1 
ATOM   8302  C C     . HIS B 1 457 ? -18.600 44.776  40.336  1.00 31.81  ? 457  HIS B C     1 
ATOM   8303  O O     . HIS B 1 457 ? -18.290 45.020  41.507  1.00 32.07  ? 457  HIS B O     1 
ATOM   8304  C CB    . HIS B 1 457 ? -19.525 46.584  38.845  1.00 30.50  ? 457  HIS B CB    1 
ATOM   8305  C CG    . HIS B 1 457 ? -19.200 47.898  38.215  1.00 31.85  ? 457  HIS B CG    1 
ATOM   8306  N ND1   . HIS B 1 457 ? -18.636 48.936  38.931  1.00 25.24  ? 457  HIS B ND1   1 
ATOM   8307  C CD2   . HIS B 1 457 ? -19.385 48.361  36.955  1.00 28.81  ? 457  HIS B CD2   1 
ATOM   8308  C CE1   . HIS B 1 457 ? -18.492 49.981  38.136  1.00 34.65  ? 457  HIS B CE1   1 
ATOM   8309  N NE2   . HIS B 1 457 ? -18.929 49.659  36.932  1.00 32.00  ? 457  HIS B NE2   1 
ATOM   8310  N N     . LYS B 1 458 ? -19.175 43.635  39.969  1.00 33.21  ? 458  LYS B N     1 
ATOM   8311  C CA    . LYS B 1 458 ? -19.402 42.545  40.918  1.00 33.45  ? 458  LYS B CA    1 
ATOM   8312  C C     . LYS B 1 458 ? -18.106 42.046  41.552  1.00 33.76  ? 458  LYS B C     1 
ATOM   8313  O O     . LYS B 1 458 ? -18.061 41.666  42.736  1.00 33.43  ? 458  LYS B O     1 
ATOM   8314  C CB    . LYS B 1 458 ? -20.094 41.367  40.237  1.00 31.79  ? 458  LYS B CB    1 
ATOM   8315  C CG    . LYS B 1 458 ? -20.288 40.179  41.169  1.00 38.27  ? 458  LYS B CG    1 
ATOM   8316  C CD    . LYS B 1 458 ? -21.241 39.131  40.599  1.00 39.22  ? 458  LYS B CD    1 
ATOM   8317  C CE    . LYS B 1 458 ? -21.686 38.109  41.677  1.00 44.31  ? 458  LYS B CE    1 
ATOM   8318  N NZ    . LYS B 1 458 ? -22.319 36.886  41.037  1.00 49.80  ? 458  LYS B NZ    1 
ATOM   8319  N N     . LYS B 1 459 ? -17.043 42.030  40.759  1.00 34.89  ? 459  LYS B N     1 
ATOM   8320  C CA    . LYS B 1 459 ? -15.729 41.621  41.245  1.00 36.20  ? 459  LYS B CA    1 
ATOM   8321  C C     . LYS B 1 459 ? -15.231 42.509  42.408  1.00 34.98  ? 459  LYS B C     1 
ATOM   8322  O O     . LYS B 1 459 ? -14.743 42.000  43.431  1.00 33.11  ? 459  LYS B O     1 
ATOM   8323  C CB    . LYS B 1 459 ? -14.716 41.632  40.096  1.00 37.41  ? 459  LYS B CB    1 
ATOM   8324  C CG    . LYS B 1 459 ? -13.513 40.769  40.326  1.00 38.75  ? 459  LYS B CG    1 
ATOM   8325  C CD    . LYS B 1 459 ? -12.424 41.009  39.261  1.00 42.97  ? 459  LYS B CD    1 
ATOM   8326  C CE    . LYS B 1 459 ? -11.026 40.758  39.861  1.00 49.51  ? 459  LYS B CE    1 
ATOM   8327  N NZ    . LYS B 1 459 ? -9.949  41.218  38.959  1.00 54.15  ? 459  LYS B NZ    1 
ATOM   8328  N N     . ILE B 1 460 ? -15.355 43.828  42.266  1.00 34.07  ? 460  ILE B N     1 
ATOM   8329  C CA    . ILE B 1 460 ? -14.859 44.729  43.318  1.00 33.28  ? 460  ILE B CA    1 
ATOM   8330  C C     . ILE B 1 460 ? -15.677 44.574  44.606  1.00 32.38  ? 460  ILE B C     1 
ATOM   8331  O O     . ILE B 1 460 ? -15.111 44.627  45.722  1.00 32.52  ? 460  ILE B O     1 
ATOM   8332  C CB    . ILE B 1 460 ? -14.721 46.207  42.829  1.00 31.04  ? 460  ILE B CB    1 
ATOM   8333  C CG1   . ILE B 1 460 ? -13.762 46.964  43.740  1.00 34.48  ? 460  ILE B CG1   1 
ATOM   8334  C CG2   . ILE B 1 460 ? -16.064 46.914  42.729  1.00 30.65  ? 460  ILE B CG2   1 
ATOM   8335  C CD1   . ILE B 1 460 ? -13.391 48.354  43.289  1.00 33.07  ? 460  ILE B CD1   1 
ATOM   8336  N N     . ILE B 1 461 ? -16.980 44.324  44.475  1.00 31.74  ? 461  ILE B N     1 
ATOM   8337  C CA    . ILE B 1 461 ? -17.831 44.067  45.663  1.00 33.09  ? 461  ILE B CA    1 
ATOM   8338  C C     . ILE B 1 461 ? -17.452 42.772  46.354  1.00 33.66  ? 461  ILE B C     1 
ATOM   8339  O O     . ILE B 1 461 ? -17.243 42.728  47.592  1.00 33.47  ? 461  ILE B O     1 
ATOM   8340  C CB    . ILE B 1 461 ? -19.315 44.069  45.290  1.00 30.90  ? 461  ILE B CB    1 
ATOM   8341  C CG1   . ILE B 1 461 ? -19.692 45.472  44.798  1.00 26.12  ? 461  ILE B CG1   1 
ATOM   8342  C CG2   . ILE B 1 461 ? -20.151 43.652  46.439  1.00 27.83  ? 461  ILE B CG2   1 
ATOM   8343  C CD1   . ILE B 1 461 ? -19.307 46.602  45.724  1.00 30.56  ? 461  ILE B CD1   1 
ATOM   8344  N N     . THR B 1 462 ? -17.321 41.720  45.562  1.00 35.83  ? 462  THR B N     1 
ATOM   8345  C CA    . THR B 1 462 ? -16.843 40.430  46.078  1.00 36.57  ? 462  THR B CA    1 
ATOM   8346  C C     . THR B 1 462 ? -15.516 40.562  46.833  1.00 36.58  ? 462  THR B C     1 
ATOM   8347  O O     . THR B 1 462 ? -15.336 39.991  47.913  1.00 37.37  ? 462  THR B O     1 
ATOM   8348  C CB    . THR B 1 462 ? -16.646 39.400  44.966  1.00 36.89  ? 462  THR B CB    1 
ATOM   8349  O OG1   . THR B 1 462 ? -17.925 39.039  44.467  1.00 42.48  ? 462  THR B OG1   1 
ATOM   8350  C CG2   . THR B 1 462 ? -15.961 38.111  45.510  1.00 38.05  ? 462  THR B CG2   1 
ATOM   8351  N N     . GLN B 1 463 ? -14.589 41.303  46.240  1.00 35.59  ? 463  GLN B N     1 
ATOM   8352  C CA    . GLN B 1 463 ? -13.273 41.510  46.822  1.00 35.16  ? 463  GLN B CA    1 
ATOM   8353  C C     . GLN B 1 463 ? -13.305 42.388  48.067  1.00 34.50  ? 463  GLN B C     1 
ATOM   8354  O O     . GLN B 1 463 ? -12.584 42.130  49.041  1.00 31.97  ? 463  GLN B O     1 
ATOM   8355  C CB    . GLN B 1 463 ? -12.319 42.133  45.792  1.00 34.78  ? 463  GLN B CB    1 
ATOM   8356  C CG    . GLN B 1 463 ? -12.006 41.195  44.648  1.00 37.21  ? 463  GLN B CG    1 
ATOM   8357  C CD    . GLN B 1 463 ? -11.076 40.081  45.070  1.00 42.95  ? 463  GLN B CD    1 
ATOM   8358  O OE1   . GLN B 1 463 ? -11.511 38.997  45.514  1.00 37.30  ? 463  GLN B OE1   1 
ATOM   8359  N NE2   . GLN B 1 463 ? -9.783  40.354  44.972  1.00 40.66  ? 463  GLN B NE2   1 
ATOM   8360  N N     . PHE B 1 464 ? -14.138 43.426  48.021  1.00 34.69  ? 464  PHE B N     1 
ATOM   8361  C CA    . PHE B 1 464 ? -14.380 44.272  49.187  1.00 35.54  ? 464  PHE B CA    1 
ATOM   8362  C C     . PHE B 1 464 ? -14.868 43.492  50.400  1.00 36.63  ? 464  PHE B C     1 
ATOM   8363  O O     . PHE B 1 464 ? -14.416 43.740  51.513  1.00 37.76  ? 464  PHE B O     1 
ATOM   8364  C CB    . PHE B 1 464 ? -15.408 45.327  48.852  1.00 34.68  ? 464  PHE B CB    1 
ATOM   8365  C CG    . PHE B 1 464 ? -15.942 46.053  50.042  1.00 34.80  ? 464  PHE B CG    1 
ATOM   8366  C CD1   . PHE B 1 464 ? -15.334 47.232  50.485  1.00 30.42  ? 464  PHE B CD1   1 
ATOM   8367  C CD2   . PHE B 1 464 ? -17.070 45.588  50.706  1.00 33.32  ? 464  PHE B CD2   1 
ATOM   8368  C CE1   . PHE B 1 464 ? -15.837 47.922  51.557  1.00 31.39  ? 464  PHE B CE1   1 
ATOM   8369  C CE2   . PHE B 1 464 ? -17.557 46.267  51.805  1.00 31.07  ? 464  PHE B CE2   1 
ATOM   8370  C CZ    . PHE B 1 464 ? -16.944 47.430  52.230  1.00 32.65  ? 464  PHE B CZ    1 
ATOM   8371  N N     . GLN B 1 465 ? -15.785 42.555  50.185  1.00 39.57  ? 465  GLN B N     1 
ATOM   8372  C CA    . GLN B 1 465 ? -16.355 41.749  51.263  1.00 43.06  ? 465  GLN B CA    1 
ATOM   8373  C C     . GLN B 1 465 ? -15.361 40.807  51.936  1.00 46.09  ? 465  GLN B C     1 
ATOM   8374  O O     . GLN B 1 465 ? -15.684 40.187  52.939  1.00 48.28  ? 465  GLN B O     1 
ATOM   8375  C CB    . GLN B 1 465 ? -17.535 40.930  50.757  1.00 42.66  ? 465  GLN B CB    1 
ATOM   8376  C CG    . GLN B 1 465 ? -18.792 41.774  50.474  1.00 44.71  ? 465  GLN B CG    1 
ATOM   8377  C CD    . GLN B 1 465 ? -19.864 40.987  49.760  1.00 45.31  ? 465  GLN B CD    1 
ATOM   8378  O OE1   . GLN B 1 465 ? -19.611 39.907  49.231  1.00 50.61  ? 465  GLN B OE1   1 
ATOM   8379  N NE2   . GLN B 1 465 ? -21.060 41.536  49.718  1.00 48.74  ? 465  GLN B NE2   1 
ATOM   8380  N N     . ARG B 1 466 ? -14.164 40.677  51.381  1.00 48.60  ? 466  ARG B N     1 
ATOM   8381  C CA    . ARG B 1 466 ? -13.108 39.857  51.986  1.00 50.24  ? 466  ARG B CA    1 
ATOM   8382  C C     . ARG B 1 466 ? -12.096 40.696  52.778  1.00 50.06  ? 466  ARG B C     1 
ATOM   8383  O O     . ARG B 1 466 ? -11.257 40.167  53.486  1.00 49.46  ? 466  ARG B O     1 
ATOM   8384  C CB    . ARG B 1 466 ? -12.362 39.080  50.901  1.00 51.26  ? 466  ARG B CB    1 
ATOM   8385  C CG    . ARG B 1 466 ? -13.297 38.377  49.933  1.00 56.37  ? 466  ARG B CG    1 
ATOM   8386  C CD    . ARG B 1 466 ? -12.611 37.238  49.242  1.00 58.90  ? 466  ARG B CD    1 
ATOM   8387  N NE    . ARG B 1 466 ? -11.452 37.700  48.483  1.00 69.51  ? 466  ARG B NE    1 
ATOM   8388  C CZ    . ARG B 1 466 ? -10.744 36.921  47.666  1.00 76.75  ? 466  ARG B CZ    1 
ATOM   8389  N NH1   . ARG B 1 466 ? -11.075 35.639  47.486  1.00 78.99  ? 466  ARG B NH1   1 
ATOM   8390  N NH2   . ARG B 1 466 ? -9.711  37.425  47.006  1.00 76.67  ? 466  ARG B NH2   1 
ATOM   8391  N N     . TYR B 1 467 ? -12.173 42.007  52.628  1.00 50.24  ? 467  TYR B N     1 
ATOM   8392  C CA    . TYR B 1 467 ? -11.306 42.923  53.354  1.00 50.15  ? 467  TYR B CA    1 
ATOM   8393  C C     . TYR B 1 467 ? -12.058 43.769  54.368  1.00 49.94  ? 467  TYR B C     1 
ATOM   8394  O O     . TYR B 1 467 ? -11.483 44.164  55.379  1.00 49.21  ? 467  TYR B O     1 
ATOM   8395  C CB    . TYR B 1 467 ? -10.581 43.871  52.397  1.00 50.61  ? 467  TYR B CB    1 
ATOM   8396  C CG    . TYR B 1 467 ? -9.347  43.299  51.755  1.00 52.22  ? 467  TYR B CG    1 
ATOM   8397  C CD1   . TYR B 1 467 ? -9.437  42.396  50.692  1.00 53.74  ? 467  TYR B CD1   1 
ATOM   8398  C CD2   . TYR B 1 467 ? -8.078  43.670  52.197  1.00 56.12  ? 467  TYR B CD2   1 
ATOM   8399  C CE1   . TYR B 1 467 ? -8.296  41.870  50.104  1.00 54.17  ? 467  TYR B CE1   1 
ATOM   8400  C CE2   . TYR B 1 467 ? -6.937  43.157  51.612  1.00 56.14  ? 467  TYR B CE2   1 
ATOM   8401  C CZ    . TYR B 1 467 ? -7.051  42.264  50.564  1.00 55.90  ? 467  TYR B CZ    1 
ATOM   8402  O OH    . TYR B 1 467 ? -5.910  41.767  49.986  1.00 56.34  ? 467  TYR B OH    1 
ATOM   8403  N N     . HIS B 1 468 ? -13.324 44.077  54.088  1.00 48.72  ? 468  HIS B N     1 
ATOM   8404  C CA    . HIS B 1 468 ? -14.111 44.951  54.957  1.00 47.23  ? 468  HIS B CA    1 
ATOM   8405  C C     . HIS B 1 468 ? -15.531 44.459  55.121  1.00 45.47  ? 468  HIS B C     1 
ATOM   8406  O O     . HIS B 1 468 ? -16.019 43.602  54.390  1.00 43.05  ? 468  HIS B O     1 
ATOM   8407  C CB    . HIS B 1 468 ? -14.226 46.375  54.422  1.00 45.94  ? 468  HIS B CB    1 
ATOM   8408  C CG    . HIS B 1 468 ? -12.926 47.099  54.251  1.00 49.93  ? 468  HIS B CG    1 
ATOM   8409  N ND1   . HIS B 1 468 ? -12.051 47.321  55.286  1.00 50.13  ? 468  HIS B ND1   1 
ATOM   8410  C CD2   . HIS B 1 468 ? -12.395 47.726  53.173  1.00 50.87  ? 468  HIS B CD2   1 
ATOM   8411  C CE1   . HIS B 1 468 ? -11.018 48.015  54.850  1.00 50.90  ? 468  HIS B CE1   1 
ATOM   8412  N NE2   . HIS B 1 468 ? -11.211 48.293  53.576  1.00 43.57  ? 468  HIS B NE2   1 
ATOM   8413  N N     . GLN B 1 469 ? -16.177 45.039  56.117  1.00 45.78  ? 469  GLN B N     1 
ATOM   8414  C CA    . GLN B 1 469 ? -17.613 45.053  56.227  1.00 46.69  ? 469  GLN B CA    1 
ATOM   8415  C C     . GLN B 1 469 ? -17.954 46.529  56.272  1.00 44.11  ? 469  GLN B C     1 
ATOM   8416  O O     . GLN B 1 469 ? -17.121 47.315  56.703  1.00 41.42  ? 469  GLN B O     1 
ATOM   8417  C CB    . GLN B 1 469 ? -18.057 44.351  57.504  1.00 46.88  ? 469  GLN B CB    1 
ATOM   8418  C CG    . GLN B 1 469 ? -17.988 42.851  57.441  1.00 48.85  ? 469  GLN B CG    1 
ATOM   8419  C CD    . GLN B 1 469 ? -18.316 42.224  58.783  1.00 51.33  ? 469  GLN B CD    1 
ATOM   8420  O OE1   . GLN B 1 469 ? -19.421 41.743  58.993  1.00 67.05  ? 469  GLN B OE1   1 
ATOM   8421  N NE2   . GLN B 1 469 ? -17.363 42.251  59.707  1.00 56.06  ? 469  GLN B NE2   1 
ATOM   8422  N N     . PRO B 1 470 ? -19.155 46.919  55.801  1.00 44.67  ? 470  PRO B N     1 
ATOM   8423  C CA    . PRO B 1 470 ? -19.579 48.329  55.864  1.00 45.37  ? 470  PRO B CA    1 
ATOM   8424  C C     . PRO B 1 470 ? -19.433 48.982  57.242  1.00 44.85  ? 470  PRO B C     1 
ATOM   8425  O O     . PRO B 1 470 ? -18.965 50.122  57.338  1.00 44.46  ? 470  PRO B O     1 
ATOM   8426  C CB    . PRO B 1 470 ? -21.048 48.277  55.416  1.00 43.62  ? 470  PRO B CB    1 
ATOM   8427  C CG    . PRO B 1 470 ? -21.108 47.102  54.516  1.00 43.49  ? 470  PRO B CG    1 
ATOM   8428  C CD    . PRO B 1 470 ? -20.159 46.084  55.104  1.00 43.02  ? 470  PRO B CD    1 
ATOM   8429  N N     . HIS B 1 471 ? -19.804 48.257  58.295  1.00 45.66  ? 471  HIS B N     1 
ATOM   8430  C CA    . HIS B 1 471 ? -19.719 48.785  59.661  1.00 47.38  ? 471  HIS B CA    1 
ATOM   8431  C C     . HIS B 1 471 ? -18.300 48.804  60.226  1.00 47.39  ? 471  HIS B C     1 
ATOM   8432  O O     . HIS B 1 471 ? -18.061 49.367  61.285  1.00 47.35  ? 471  HIS B O     1 
ATOM   8433  C CB    . HIS B 1 471 ? -20.676 48.038  60.605  1.00 49.44  ? 471  HIS B CB    1 
ATOM   8434  C CG    . HIS B 1 471 ? -20.465 46.556  60.645  1.00 52.40  ? 471  HIS B CG    1 
ATOM   8435  N ND1   . HIS B 1 471 ? -21.006 45.708  59.699  1.00 56.85  ? 471  HIS B ND1   1 
ATOM   8436  C CD2   . HIS B 1 471 ? -19.790 45.770  61.521  1.00 47.60  ? 471  HIS B CD2   1 
ATOM   8437  C CE1   . HIS B 1 471 ? -20.661 44.463  59.987  1.00 53.98  ? 471  HIS B CE1   1 
ATOM   8438  N NE2   . HIS B 1 471 ? -19.926 44.474  61.087  1.00 48.35  ? 471  HIS B NE2   1 
ATOM   8439  N N     . THR B 1 472 ? -17.368 48.201  59.497  1.00 48.21  ? 472  THR B N     1 
ATOM   8440  C CA    . THR B 1 472 ? -15.979 48.082  59.899  1.00 47.77  ? 472  THR B CA    1 
ATOM   8441  C C     . THR B 1 472 ? -15.097 49.187  59.246  1.00 48.99  ? 472  THR B C     1 
ATOM   8442  O O     . THR B 1 472 ? -13.894 49.261  59.499  1.00 49.19  ? 472  THR B O     1 
ATOM   8443  C CB    . THR B 1 472 ? -15.582 46.613  59.617  1.00 47.65  ? 472  THR B CB    1 
ATOM   8444  O OG1   . THR B 1 472 ? -15.584 45.864  60.853  1.00 47.86  ? 472  THR B OG1   1 
ATOM   8445  C CG2   . THR B 1 472 ? -14.305 46.498  58.923  1.00 47.64  ? 472  THR B CG2   1 
ATOM   8446  N N     . LEU B 1 473 ? -15.713 50.076  58.461  1.00 47.59  ? 473  LEU B N     1 
ATOM   8447  C CA    . LEU B 1 473 ? -14.992 51.187  57.811  1.00 46.86  ? 473  LEU B CA    1 
ATOM   8448  C C     . LEU B 1 473 ? -14.650 52.317  58.796  1.00 46.12  ? 473  LEU B C     1 
ATOM   8449  O O     . LEU B 1 473 ? -15.508 52.732  59.551  1.00 46.69  ? 473  LEU B O     1 
ATOM   8450  C CB    . LEU B 1 473 ? -15.828 51.774  56.669  1.00 45.79  ? 473  LEU B CB    1 
ATOM   8451  C CG    . LEU B 1 473 ? -16.081 50.937  55.411  1.00 44.61  ? 473  LEU B CG    1 
ATOM   8452  C CD1   . LEU B 1 473 ? -17.023 51.680  54.483  1.00 41.23  ? 473  LEU B CD1   1 
ATOM   8453  C CD2   . LEU B 1 473 ? -14.778 50.641  54.686  1.00 41.83  ? 473  LEU B CD2   1 
ATOM   8454  N N     . SER B 1 474 ? -13.426 52.838  58.749  1.00 44.28  ? 474  SER B N     1 
ATOM   8455  C CA    . SER B 1 474 ? -13.024 53.948  59.627  1.00 46.24  ? 474  SER B CA    1 
ATOM   8456  C C     . SER B 1 474 ? -12.120 54.929  58.898  1.00 44.63  ? 474  SER B C     1 
ATOM   8457  O O     . SER B 1 474 ? -11.298 54.508  58.137  1.00 42.45  ? 474  SER B O     1 
ATOM   8458  C CB    . SER B 1 474 ? -12.333 53.429  60.915  1.00 49.03  ? 474  SER B CB    1 
ATOM   8459  O OG    . SER B 1 474 ? -11.249 52.551  60.657  1.00 48.01  ? 474  SER B OG    1 
ATOM   8460  N N     . PRO B 1 475 ? -12.232 56.240  59.188  1.00 46.67  ? 475  PRO B N     1 
ATOM   8461  C CA    . PRO B 1 475 ? -11.627 57.298  58.346  1.00 47.48  ? 475  PRO B CA    1 
ATOM   8462  C C     . PRO B 1 475 ? -10.095 57.369  58.381  1.00 48.58  ? 475  PRO B C     1 
ATOM   8463  O O     . PRO B 1 475 ? -9.496  58.083  57.563  1.00 49.38  ? 475  PRO B O     1 
ATOM   8464  C CB    . PRO B 1 475 ? -12.208 58.601  58.923  1.00 47.90  ? 475  PRO B CB    1 
ATOM   8465  C CG    . PRO B 1 475 ? -13.158 58.202  60.016  1.00 48.90  ? 475  PRO B CG    1 
ATOM   8466  C CD    . PRO B 1 475 ? -12.836 56.799  60.416  1.00 48.12  ? 475  PRO B CD    1 
ATOM   8467  N N     . ASP B 1 476 ? -9.482  56.663  59.326  1.00 47.56  ? 476  ASP B N     1 
ATOM   8468  C CA    . ASP B 1 476 ? -8.038  56.486  59.349  1.00 47.42  ? 476  ASP B CA    1 
ATOM   8469  C C     . ASP B 1 476 ? -7.514  55.704  58.139  1.00 47.45  ? 476  ASP B C     1 
ATOM   8470  O O     . ASP B 1 476 ? -6.405  55.934  57.688  1.00 49.72  ? 476  ASP B O     1 
ATOM   8471  C CB    . ASP B 1 476 ? -7.574  55.799  60.667  1.00 45.39  ? 476  ASP B CB    1 
ATOM   8472  C CG    . ASP B 1 476 ? -8.192  54.401  60.886  1.00 45.82  ? 476  ASP B CG    1 
ATOM   8473  O OD1   . ASP B 1 476 ? -9.365  54.312  61.323  1.00 46.53  ? 476  ASP B OD1   1 
ATOM   8474  O OD2   . ASP B 1 476 ? -7.499  53.386  60.645  1.00 40.91  ? 476  ASP B OD2   1 
ATOM   8475  N N     . GLN B 1 477 ? -8.322  54.808  57.592  1.00 46.99  ? 477  GLN B N     1 
ATOM   8476  C CA    . GLN B 1 477 ? -7.914  53.981  56.447  1.00 47.49  ? 477  GLN B CA    1 
ATOM   8477  C C     . GLN B 1 477 ? -8.021  54.726  55.099  1.00 46.00  ? 477  GLN B C     1 
ATOM   8478  O O     . GLN B 1 477 ? -8.970  55.472  54.828  1.00 42.62  ? 477  GLN B O     1 
ATOM   8479  C CB    . GLN B 1 477 ? -8.667  52.610  56.391  1.00 47.27  ? 477  GLN B CB    1 
ATOM   8480  C CG    . GLN B 1 477 ? -9.817  52.421  57.405  1.00 54.63  ? 477  GLN B CG    1 
ATOM   8481  C CD    . GLN B 1 477 ? -10.492 51.035  57.448  1.00 52.03  ? 477  GLN B CD    1 
ATOM   8482  O OE1   . GLN B 1 477 ? -10.756 50.428  56.414  1.00 64.37  ? 477  GLN B OE1   1 
ATOM   8483  N NE2   . GLN B 1 477 ? -10.828 50.581  58.651  1.00 55.81  ? 477  GLN B NE2   1 
ATOM   8484  N N     . GLU B 1 478 ? -7.018  54.504  54.256  1.00 45.70  ? 478  GLU B N     1 
ATOM   8485  C CA    . GLU B 1 478 ? -6.797  55.310  53.045  1.00 45.42  ? 478  GLU B CA    1 
ATOM   8486  C C     . GLU B 1 478 ? -7.954  55.188  51.996  1.00 42.46  ? 478  GLU B C     1 
ATOM   8487  O O     . GLU B 1 478 ? -8.225  56.128  51.256  1.00 40.71  ? 478  GLU B O     1 
ATOM   8488  C CB    . GLU B 1 478 ? -5.396  54.979  52.491  1.00 43.21  ? 478  GLU B CB    1 
ATOM   8489  C CG    . GLU B 1 478 ? -5.226  54.897  50.975  1.00 49.70  ? 478  GLU B CG    1 
ATOM   8490  C CD    . GLU B 1 478 ? -3.901  54.212  50.582  1.00 52.05  ? 478  GLU B CD    1 
ATOM   8491  O OE1   . GLU B 1 478 ? -2.958  54.271  51.412  1.00 66.79  ? 478  GLU B OE1   1 
ATOM   8492  O OE2   . GLU B 1 478 ? -3.801  53.616  49.473  1.00 43.20  ? 478  GLU B OE2   1 
ATOM   8493  N N     . ASP B 1 479 ? -8.641  54.051  52.009  1.00 38.91  ? 479  ASP B N     1 
ATOM   8494  C CA    . ASP B 1 479 ? -9.713  53.736  51.071  1.00 39.88  ? 479  ASP B CA    1 
ATOM   8495  C C     . ASP B 1 479 ? -11.128 54.004  51.642  1.00 39.35  ? 479  ASP B C     1 
ATOM   8496  O O     . ASP B 1 479 ? -12.116 53.732  50.979  1.00 36.82  ? 479  ASP B O     1 
ATOM   8497  C CB    . ASP B 1 479 ? -9.589  52.259  50.619  1.00 37.39  ? 479  ASP B CB    1 
ATOM   8498  C CG    . ASP B 1 479 ? -9.602  51.286  51.783  1.00 37.21  ? 479  ASP B CG    1 
ATOM   8499  O OD1   . ASP B 1 479 ? -9.309  51.716  52.911  1.00 36.82  ? 479  ASP B OD1   1 
ATOM   8500  O OD2   . ASP B 1 479 ? -9.917  50.100  51.590  1.00 29.94  ? 479  ASP B OD2   1 
ATOM   8501  N N     . CYS B 1 480 ? -11.204 54.556  52.849  1.00 38.88  ? 480  CYS B N     1 
ATOM   8502  C CA    . CYS B 1 480 ? -12.468 54.684  53.576  1.00 37.48  ? 480  CYS B CA    1 
ATOM   8503  C C     . CYS B 1 480 ? -13.495 55.523  52.845  1.00 33.80  ? 480  CYS B C     1 
ATOM   8504  O O     . CYS B 1 480 ? -14.625 55.063  52.663  1.00 34.07  ? 480  CYS B O     1 
ATOM   8505  C CB    . CYS B 1 480 ? -12.253 55.228  55.004  1.00 37.09  ? 480  CYS B CB    1 
ATOM   8506  S SG    . CYS B 1 480 ? -13.782 55.591  55.900  1.00 40.00  ? 480  CYS B SG    1 
ATOM   8507  N N     . MET B 1 481 ? -13.108 56.712  52.400  1.00 29.78  ? 481  MET B N     1 
ATOM   8508  C CA    . MET B 1 481 ? -14.014 57.591  51.678  1.00 31.91  ? 481  MET B CA    1 
ATOM   8509  C C     . MET B 1 481 ? -14.375 57.102  50.274  1.00 33.46  ? 481  MET B C     1 
ATOM   8510  O O     . MET B 1 481 ? -15.442 57.449  49.747  1.00 33.45  ? 481  MET B O     1 
ATOM   8511  C CB    . MET B 1 481 ? -13.429 58.997  51.604  1.00 32.87  ? 481  MET B CB    1 
ATOM   8512  C CG    . MET B 1 481 ? -13.271 59.674  52.971  1.00 40.77  ? 481  MET B CG    1 
ATOM   8513  S SD    . MET B 1 481 ? -14.878 59.834  53.793  1.00 51.79  ? 481  MET B SD    1 
ATOM   8514  C CE    . MET B 1 481 ? -14.950 58.298  54.693  1.00 54.93  ? 481  MET B CE    1 
ATOM   8515  N N     . TYR B 1 482 ? -13.477 56.338  49.653  1.00 31.94  ? 482  TYR B N     1 
ATOM   8516  C CA    . TYR B 1 482 ? -13.778 55.703  48.388  1.00 31.60  ? 482  TYR B CA    1 
ATOM   8517  C C     . TYR B 1 482 ? -14.996 54.789  48.594  1.00 31.35  ? 482  TYR B C     1 
ATOM   8518  O O     . TYR B 1 482 ? -15.940 54.830  47.830  1.00 31.51  ? 482  TYR B O     1 
ATOM   8519  C CB    . TYR B 1 482 ? -12.574 54.884  47.806  1.00 29.87  ? 482  TYR B CB    1 
ATOM   8520  C CG    . TYR B 1 482 ? -12.925 54.310  46.422  1.00 31.14  ? 482  TYR B CG    1 
ATOM   8521  C CD1   . TYR B 1 482 ? -13.573 53.095  46.302  1.00 29.23  ? 482  TYR B CD1   1 
ATOM   8522  C CD2   . TYR B 1 482 ? -12.675 55.028  45.257  1.00 29.26  ? 482  TYR B CD2   1 
ATOM   8523  C CE1   . TYR B 1 482 ? -13.966 52.585  45.045  1.00 30.39  ? 482  TYR B CE1   1 
ATOM   8524  C CE2   . TYR B 1 482 ? -13.056 54.528  43.984  1.00 30.60  ? 482  TYR B CE2   1 
ATOM   8525  C CZ    . TYR B 1 482 ? -13.699 53.304  43.906  1.00 31.26  ? 482  TYR B CZ    1 
ATOM   8526  O OH    . TYR B 1 482 ? -14.095 52.787  42.704  1.00 36.69  ? 482  TYR B OH    1 
ATOM   8527  N N     . TRP B 1 483 ? -14.980 53.977  49.650  1.00 31.08  ? 483  TRP B N     1 
ATOM   8528  C CA    . TRP B 1 483 ? -16.086 53.046  49.884  1.00 30.19  ? 483  TRP B CA    1 
ATOM   8529  C C     . TRP B 1 483 ? -17.379 53.715  50.323  1.00 29.12  ? 483  TRP B C     1 
ATOM   8530  O O     . TRP B 1 483 ? -18.426 53.339  49.827  1.00 31.60  ? 483  TRP B O     1 
ATOM   8531  C CB    . TRP B 1 483 ? -15.685 51.965  50.861  1.00 29.92  ? 483  TRP B CB    1 
ATOM   8532  C CG    . TRP B 1 483 ? -14.535 51.153  50.372  1.00 32.56  ? 483  TRP B CG    1 
ATOM   8533  C CD1   . TRP B 1 483 ? -13.355 50.961  51.003  1.00 32.68  ? 483  TRP B CD1   1 
ATOM   8534  C CD2   . TRP B 1 483 ? -14.463 50.399  49.145  1.00 34.77  ? 483  TRP B CD2   1 
ATOM   8535  N NE1   . TRP B 1 483 ? -12.545 50.144  50.256  1.00 33.76  ? 483  TRP B NE1   1 
ATOM   8536  C CE2   . TRP B 1 483 ? -13.196 49.792  49.107  1.00 30.78  ? 483  TRP B CE2   1 
ATOM   8537  C CE3   . TRP B 1 483 ? -15.327 50.218  48.062  1.00 34.96  ? 483  TRP B CE3   1 
ATOM   8538  C CZ2   . TRP B 1 483 ? -12.778 48.995  48.045  1.00 29.17  ? 483  TRP B CZ2   1 
ATOM   8539  C CZ3   . TRP B 1 483 ? -14.919 49.416  47.023  1.00 33.18  ? 483  TRP B CZ3   1 
ATOM   8540  C CH2   . TRP B 1 483 ? -13.653 48.816  47.019  1.00 32.65  ? 483  TRP B CH2   1 
ATOM   8541  N N     . TYR B 1 484 ? -17.332 54.714  51.209  1.00 31.22  ? 484  TYR B N     1 
ATOM   8542  C CA    . TYR B 1 484 ? -18.552 55.501  51.542  1.00 30.83  ? 484  TYR B CA    1 
ATOM   8543  C C     . TYR B 1 484 ? -19.151 56.153  50.293  1.00 31.24  ? 484  TYR B C     1 
ATOM   8544  O O     . TYR B 1 484 ? -20.378 56.177  50.098  1.00 31.55  ? 484  TYR B O     1 
ATOM   8545  C CB    . TYR B 1 484 ? -18.272 56.538  52.644  1.00 32.65  ? 484  TYR B CB    1 
ATOM   8546  C CG    . TYR B 1 484 ? -18.307 55.970  54.081  1.00 32.58  ? 484  TYR B CG    1 
ATOM   8547  C CD1   . TYR B 1 484 ? -19.516 55.654  54.689  1.00 29.93  ? 484  TYR B CD1   1 
ATOM   8548  C CD2   . TYR B 1 484 ? -17.145 55.766  54.828  1.00 36.15  ? 484  TYR B CD2   1 
ATOM   8549  C CE1   . TYR B 1 484 ? -19.578 55.145  55.969  1.00 31.49  ? 484  TYR B CE1   1 
ATOM   8550  C CE2   . TYR B 1 484 ? -17.202 55.259  56.147  1.00 31.35  ? 484  TYR B CE2   1 
ATOM   8551  C CZ    . TYR B 1 484 ? -18.429 54.952  56.707  1.00 29.03  ? 484  TYR B CZ    1 
ATOM   8552  O OH    . TYR B 1 484 ? -18.532 54.412  57.993  1.00 31.70  ? 484  TYR B OH    1 
ATOM   8553  N N     . ASN B 1 485 ? -18.283 56.664  49.421  1.00 31.78  ? 485  ASN B N     1 
ATOM   8554  C CA    . ASN B 1 485 ? -18.747 57.356  48.231  1.00 30.22  ? 485  ASN B CA    1 
ATOM   8555  C C     . ASN B 1 485 ? -19.239 56.408  47.134  1.00 29.22  ? 485  ASN B C     1 
ATOM   8556  O O     . ASN B 1 485 ? -20.126 56.760  46.380  1.00 29.50  ? 485  ASN B O     1 
ATOM   8557  C CB    . ASN B 1 485 ? -17.664 58.280  47.647  1.00 31.85  ? 485  ASN B CB    1 
ATOM   8558  C CG    . ASN B 1 485 ? -17.263 59.383  48.580  1.00 36.14  ? 485  ASN B CG    1 
ATOM   8559  O OD1   . ASN B 1 485 ? -18.028 59.790  49.467  1.00 37.23  ? 485  ASN B OD1   1 
ATOM   8560  N ND2   . ASN B 1 485 ? -16.041 59.890  48.386  1.00 29.47  ? 485  ASN B ND2   1 
ATOM   8561  N N     . PHE B 1 486 ? -18.659 55.222  47.021  1.00 28.20  ? 486  PHE B N     1 
ATOM   8562  C CA    . PHE B 1 486 ? -18.816 54.439  45.809  1.00 28.04  ? 486  PHE B CA    1 
ATOM   8563  C C     . PHE B 1 486 ? -19.159 52.972  46.014  1.00 27.04  ? 486  PHE B C     1 
ATOM   8564  O O     . PHE B 1 486 ? -19.327 52.272  45.057  1.00 29.59  ? 486  PHE B O     1 
ATOM   8565  C CB    . PHE B 1 486 ? -17.542 54.561  44.969  1.00 29.04  ? 486  PHE B CB    1 
ATOM   8566  C CG    . PHE B 1 486 ? -17.188 55.979  44.600  1.00 29.33  ? 486  PHE B CG    1 
ATOM   8567  C CD1   . PHE B 1 486 ? -18.074 56.754  43.858  1.00 34.81  ? 486  PHE B CD1   1 
ATOM   8568  C CD2   . PHE B 1 486 ? -15.954 56.516  44.928  1.00 30.13  ? 486  PHE B CD2   1 
ATOM   8569  C CE1   . PHE B 1 486 ? -17.761 58.070  43.486  1.00 33.57  ? 486  PHE B CE1   1 
ATOM   8570  C CE2   . PHE B 1 486 ? -15.634 57.837  44.560  1.00 31.52  ? 486  PHE B CE2   1 
ATOM   8571  C CZ    . PHE B 1 486 ? -16.537 58.601  43.842  1.00 33.04  ? 486  PHE B CZ    1 
ATOM   8572  N N     . LEU B 1 487 ? -19.346 52.518  47.239  1.00 27.13  ? 487  LEU B N     1 
ATOM   8573  C CA    . LEU B 1 487 ? -19.780 51.137  47.469  1.00 28.48  ? 487  LEU B CA    1 
ATOM   8574  C C     . LEU B 1 487 ? -21.120 50.867  46.806  1.00 27.18  ? 487  LEU B C     1 
ATOM   8575  O O     . LEU B 1 487 ? -21.318 49.843  46.156  1.00 30.52  ? 487  LEU B O     1 
ATOM   8576  C CB    . LEU B 1 487 ? -19.944 50.851  48.993  1.00 29.55  ? 487  LEU B CB    1 
ATOM   8577  C CG    . LEU B 1 487 ? -19.181 49.685  49.628  1.00 34.73  ? 487  LEU B CG    1 
ATOM   8578  C CD1   . LEU B 1 487 ? -19.717 49.398  51.013  1.00 39.68  ? 487  LEU B CD1   1 
ATOM   8579  C CD2   . LEU B 1 487 ? -19.225 48.451  48.800  1.00 38.96  ? 487  LEU B CD2   1 
ATOM   8580  N N     . ALA B 1 488 ? -22.075 51.752  47.054  1.00 27.84  ? 488  ALA B N     1 
ATOM   8581  C CA    . ALA B 1 488 ? -23.406 51.617  46.523  1.00 28.18  ? 488  ALA B CA    1 
ATOM   8582  C C     . ALA B 1 488 ? -23.373 51.758  45.010  1.00 28.34  ? 488  ALA B C     1 
ATOM   8583  O O     . ALA B 1 488 ? -24.071 51.025  44.296  1.00 30.12  ? 488  ALA B O     1 
ATOM   8584  C CB    . ALA B 1 488 ? -24.338 52.638  47.149  1.00 27.27  ? 488  ALA B CB    1 
ATOM   8585  N N     . TYR B 1 489 ? -22.553 52.685  44.516  1.00 28.48  ? 489  TYR B N     1 
ATOM   8586  C CA    . TYR B 1 489 ? -22.374 52.840  43.058  1.00 28.30  ? 489  TYR B CA    1 
ATOM   8587  C C     . TYR B 1 489 ? -21.931 51.514  42.416  1.00 28.69  ? 489  TYR B C     1 
ATOM   8588  O O     . TYR B 1 489 ? -22.442 51.109  41.386  1.00 27.35  ? 489  TYR B O     1 
ATOM   8589  C CB    . TYR B 1 489 ? -21.360 53.933  42.734  1.00 30.06  ? 489  TYR B CB    1 
ATOM   8590  C CG    . TYR B 1 489 ? -20.898 53.927  41.278  1.00 28.33  ? 489  TYR B CG    1 
ATOM   8591  C CD1   . TYR B 1 489 ? -21.655 54.509  40.264  1.00 32.32  ? 489  TYR B CD1   1 
ATOM   8592  C CD2   . TYR B 1 489 ? -19.702 53.342  40.937  1.00 26.29  ? 489  TYR B CD2   1 
ATOM   8593  C CE1   . TYR B 1 489 ? -21.235 54.429  38.900  1.00 31.47  ? 489  TYR B CE1   1 
ATOM   8594  C CE2   . TYR B 1 489 ? -19.262 53.281  39.633  1.00 29.99  ? 489  TYR B CE2   1 
ATOM   8595  C CZ    . TYR B 1 489 ? -20.017 53.817  38.626  1.00 30.93  ? 489  TYR B CZ    1 
ATOM   8596  O OH    . TYR B 1 489 ? -19.467 53.744  37.385  1.00 36.10  ? 489  TYR B OH    1 
ATOM   8597  N N     . HIS B 1 490 ? -20.948 50.838  43.005  1.00 29.18  ? 490  HIS B N     1 
ATOM   8598  C CA    . HIS B 1 490 ? -20.456 49.596  42.383  1.00 28.27  ? 490  HIS B CA    1 
ATOM   8599  C C     . HIS B 1 490 ? -21.456 48.453  42.507  1.00 29.50  ? 490  HIS B C     1 
ATOM   8600  O O     . HIS B 1 490 ? -21.579 47.622  41.599  1.00 30.81  ? 490  HIS B O     1 
ATOM   8601  C CB    . HIS B 1 490 ? -19.101 49.158  42.957  1.00 29.30  ? 490  HIS B CB    1 
ATOM   8602  C CG    . HIS B 1 490 ? -17.932 49.987  42.499  1.00 32.08  ? 490  HIS B CG    1 
ATOM   8603  N ND1   . HIS B 1 490 ? -17.451 49.958  41.204  1.00 31.09  ? 490  HIS B ND1   1 
ATOM   8604  C CD2   . HIS B 1 490 ? -17.106 50.818  43.185  1.00 33.54  ? 490  HIS B CD2   1 
ATOM   8605  C CE1   . HIS B 1 490 ? -16.406 50.762  41.101  1.00 31.76  ? 490  HIS B CE1   1 
ATOM   8606  N NE2   . HIS B 1 490 ? -16.174 51.296  42.289  1.00 32.47  ? 490  HIS B NE2   1 
ATOM   8607  N N     . MET B 1 491 ? -22.149 48.362  43.642  1.00 29.87  ? 491  MET B N     1 
ATOM   8608  C CA    . MET B 1 491 ? -23.217 47.362  43.781  1.00 29.98  ? 491  MET B CA    1 
ATOM   8609  C C     . MET B 1 491 ? -24.337 47.577  42.763  1.00 31.06  ? 491  MET B C     1 
ATOM   8610  O O     . MET B 1 491 ? -24.876 46.609  42.207  1.00 32.09  ? 491  MET B O     1 
ATOM   8611  C CB    . MET B 1 491 ? -23.814 47.384  45.186  1.00 30.53  ? 491  MET B CB    1 
ATOM   8612  C CG    . MET B 1 491 ? -22.915 46.833  46.255  1.00 30.11  ? 491  MET B CG    1 
ATOM   8613  S SD    . MET B 1 491 ? -23.640 47.022  47.874  1.00 29.04  ? 491  MET B SD    1 
ATOM   8614  C CE    . MET B 1 491 ? -22.472 46.173  48.906  1.00 29.15  ? 491  MET B CE    1 
ATOM   8615  N N     . ALA B 1 492 ? -24.706 48.839  42.540  1.00 31.21  ? 492  ALA B N     1 
ATOM   8616  C CA    . ALA B 1 492 ? -25.806 49.173  41.640  1.00 31.71  ? 492  ALA B CA    1 
ATOM   8617  C C     . ALA B 1 492 ? -25.401 48.906  40.201  1.00 32.65  ? 492  ALA B C     1 
ATOM   8618  O O     . ALA B 1 492 ? -26.173 48.331  39.431  1.00 34.52  ? 492  ALA B O     1 
ATOM   8619  C CB    . ALA B 1 492 ? -26.209 50.610  41.825  1.00 32.91  ? 492  ALA B CB    1 
ATOM   8620  N N     . SER B 1 493 ? -24.167 49.284  39.866  1.00 33.18  ? 493  SER B N     1 
ATOM   8621  C CA    . SER B 1 493 ? -23.575 49.011  38.552  1.00 32.53  ? 493  SER B CA    1 
ATOM   8622  C C     . SER B 1 493 ? -23.412 47.508  38.297  1.00 31.78  ? 493  SER B C     1 
ATOM   8623  O O     . SER B 1 493 ? -23.534 47.058  37.171  1.00 31.68  ? 493  SER B O     1 
ATOM   8624  C CB    . SER B 1 493 ? -22.216 49.721  38.407  1.00 32.49  ? 493  SER B CB    1 
ATOM   8625  O OG    . SER B 1 493 ? -22.350 51.090  38.691  1.00 31.18  ? 493  SER B OG    1 
ATOM   8626  N N     . ALA B 1 494 ? -23.141 46.741  39.348  1.00 32.35  ? 494  ALA B N     1 
ATOM   8627  C CA    . ALA B 1 494 ? -23.062 45.271  39.284  1.00 32.73  ? 494  ALA B CA    1 
ATOM   8628  C C     . ALA B 1 494 ? -24.428 44.602  39.282  1.00 33.97  ? 494  ALA B C     1 
ATOM   8629  O O     . ALA B 1 494 ? -24.503 43.390  39.212  1.00 34.31  ? 494  ALA B O     1 
ATOM   8630  C CB    . ALA B 1 494 ? -22.265 44.758  40.488  1.00 34.27  ? 494  ALA B CB    1 
ATOM   8631  N N     . LYS B 1 495 ? -25.500 45.403  39.365  1.00 36.91  ? 495  LYS B N     1 
ATOM   8632  C CA    . LYS B 1 495 ? -26.887 44.954  39.497  1.00 36.55  ? 495  LYS B CA    1 
ATOM   8633  C C     . LYS B 1 495 ? -27.126 44.046  40.708  1.00 37.23  ? 495  LYS B C     1 
ATOM   8634  O O     . LYS B 1 495 ? -28.007 43.190  40.704  1.00 37.05  ? 495  LYS B O     1 
ATOM   8635  C CB    . LYS B 1 495 ? -27.340 44.305  38.198  1.00 37.38  ? 495  LYS B CB    1 
ATOM   8636  C CG    . LYS B 1 495 ? -27.313 45.235  37.006  1.00 43.07  ? 495  LYS B CG    1 
ATOM   8637  C CD    . LYS B 1 495 ? -28.409 46.288  37.072  1.00 50.97  ? 495  LYS B CD    1 
ATOM   8638  C CE    . LYS B 1 495 ? -28.380 47.246  35.863  1.00 55.75  ? 495  LYS B CE    1 
ATOM   8639  N NZ    . LYS B 1 495 ? -29.715 47.963  35.689  1.00 56.50  ? 495  LYS B NZ    1 
ATOM   8640  N N     . MET B 1 496 ? -26.367 44.275  41.767  1.00 37.33  ? 496  MET B N     1 
ATOM   8641  C CA    . MET B 1 496 ? -26.459 43.456  42.965  1.00 38.68  ? 496  MET B CA    1 
ATOM   8642  C C     . MET B 1 496 ? -27.511 44.056  43.911  1.00 38.19  ? 496  MET B C     1 
ATOM   8643  O O     . MET B 1 496 ? -27.180 44.671  44.922  1.00 36.34  ? 496  MET B O     1 
ATOM   8644  C CB    . MET B 1 496 ? -25.087 43.359  43.646  1.00 36.41  ? 496  MET B CB    1 
ATOM   8645  C CG    . MET B 1 496 ? -24.055 42.639  42.838  1.00 37.47  ? 496  MET B CG    1 
ATOM   8646  S SD    . MET B 1 496 ? -22.420 42.714  43.578  1.00 43.22  ? 496  MET B SD    1 
ATOM   8647  C CE    . MET B 1 496 ? -22.327 41.157  44.466  1.00 41.58  ? 496  MET B CE    1 
ATOM   8648  N N     . HIS B 1 497 ? -28.780 43.877  43.548  1.00 38.88  ? 497  HIS B N     1 
ATOM   8649  C CA    . HIS B 1 497 ? -29.902 44.490  44.278  1.00 39.49  ? 497  HIS B CA    1 
ATOM   8650  C C     . HIS B 1 497 ? -30.015 43.977  45.707  1.00 38.09  ? 497  HIS B C     1 
ATOM   8651  O O     . HIS B 1 497 ? -30.354 44.729  46.614  1.00 37.84  ? 497  HIS B O     1 
ATOM   8652  C CB    . HIS B 1 497 ? -31.236 44.350  43.518  1.00 40.07  ? 497  HIS B CB    1 
ATOM   8653  C CG    . HIS B 1 497 ? -31.581 42.943  43.138  1.00 49.14  ? 497  HIS B CG    1 
ATOM   8654  N ND1   . HIS B 1 497 ? -31.238 42.397  41.915  1.00 54.74  ? 497  HIS B ND1   1 
ATOM   8655  C CD2   . HIS B 1 497 ? -32.237 41.969  43.816  1.00 56.03  ? 497  HIS B CD2   1 
ATOM   8656  C CE1   . HIS B 1 497 ? -31.659 41.143  41.863  1.00 56.00  ? 497  HIS B CE1   1 
ATOM   8657  N NE2   . HIS B 1 497 ? -32.276 40.861  42.998  1.00 59.63  ? 497  HIS B NE2   1 
ATOM   8658  N N     . LYS B 1 498 ? -29.689 42.713  45.923  1.00 36.72  ? 498  LYS B N     1 
ATOM   8659  C CA    . LYS B 1 498 ? -29.728 42.160  47.276  1.00 37.52  ? 498  LYS B CA    1 
ATOM   8660  C C     . LYS B 1 498 ? -28.689 42.790  48.205  1.00 35.81  ? 498  LYS B C     1 
ATOM   8661  O O     . LYS B 1 498 ? -29.014 43.154  49.338  1.00 35.76  ? 498  LYS B O     1 
ATOM   8662  C CB    . LYS B 1 498 ? -29.583 40.634  47.243  1.00 37.07  ? 498  LYS B CB    1 
ATOM   8663  C CG    . LYS B 1 498 ? -30.874 39.951  46.903  1.00 42.28  ? 498  LYS B CG    1 
ATOM   8664  C CD    . LYS B 1 498 ? -30.761 38.419  46.936  1.00 45.06  ? 498  LYS B CD    1 
ATOM   8665  C CE    . LYS B 1 498 ? -32.140 37.791  46.657  1.00 50.18  ? 498  LYS B CE    1 
ATOM   8666  N NZ    . LYS B 1 498 ? -32.211 36.316  46.868  1.00 51.09  ? 498  LYS B NZ    1 
ATOM   8667  N N     . GLU B 1 499 ? -27.449 42.911  47.729  1.00 34.19  ? 499  GLU B N     1 
ATOM   8668  C CA    . GLU B 1 499 ? -26.362 43.516  48.500  1.00 32.87  ? 499  GLU B CA    1 
ATOM   8669  C C     . GLU B 1 499 ? -26.618 45.004  48.724  1.00 30.78  ? 499  GLU B C     1 
ATOM   8670  O O     . GLU B 1 499 ? -26.354 45.531  49.814  1.00 31.53  ? 499  GLU B O     1 
ATOM   8671  C CB    . GLU B 1 499 ? -25.004 43.356  47.811  1.00 34.85  ? 499  GLU B CB    1 
ATOM   8672  C CG    . GLU B 1 499 ? -24.372 41.964  47.860  1.00 38.73  ? 499  GLU B CG    1 
ATOM   8673  C CD    . GLU B 1 499 ? -24.992 40.971  46.875  1.00 45.99  ? 499  GLU B CD    1 
ATOM   8674  O OE1   . GLU B 1 499 ? -26.010 41.306  46.198  1.00 43.82  ? 499  GLU B OE1   1 
ATOM   8675  O OE2   . GLU B 1 499 ? -24.458 39.835  46.792  1.00 52.64  ? 499  GLU B OE2   1 
ATOM   8676  N N     . LEU B 1 500 ? -27.141 45.674  47.698  1.00 28.98  ? 500  LEU B N     1 
ATOM   8677  C CA    . LEU B 1 500 ? -27.451 47.101  47.782  1.00 30.57  ? 500  LEU B CA    1 
ATOM   8678  C C     . LEU B 1 500 ? -28.470 47.393  48.872  1.00 29.93  ? 500  LEU B C     1 
ATOM   8679  O O     . LEU B 1 500 ? -28.325 48.330  49.664  1.00 28.25  ? 500  LEU B O     1 
ATOM   8680  C CB    . LEU B 1 500 ? -27.997 47.579  46.440  1.00 31.02  ? 500  LEU B CB    1 
ATOM   8681  C CG    . LEU B 1 500 ? -28.200 49.072  46.313  1.00 28.17  ? 500  LEU B CG    1 
ATOM   8682  C CD1   . LEU B 1 500 ? -26.863 49.757  46.282  1.00 32.09  ? 500  LEU B CD1   1 
ATOM   8683  C CD2   . LEU B 1 500 ? -28.990 49.327  45.055  1.00 33.53  ? 500  LEU B CD2   1 
ATOM   8684  N N     . CYS B 1 501 ? -29.510 46.567  48.896  1.00 31.66  ? 501  CYS B N     1 
ATOM   8685  C CA    . CYS B 1 501 ? -30.539 46.657  49.901  1.00 30.15  ? 501  CYS B CA    1 
ATOM   8686  C C     . CYS B 1 501 ? -29.999 46.367  51.283  1.00 29.48  ? 501  CYS B C     1 
ATOM   8687  O O     . CYS B 1 501 ? -30.297 47.084  52.216  1.00 28.13  ? 501  CYS B O     1 
ATOM   8688  C CB    . CYS B 1 501 ? -31.678 45.726  49.530  1.00 31.00  ? 501  CYS B CB    1 
ATOM   8689  S SG    . CYS B 1 501 ? -32.550 46.336  48.052  1.00 37.88  ? 501  CYS B SG    1 
ATOM   8690  N N     . ALA B 1 502 ? -29.181 45.332  51.431  1.00 30.02  ? 502  ALA B N     1 
ATOM   8691  C CA    . ALA B 1 502 ? -28.601 45.026  52.754  1.00 29.75  ? 502  ALA B CA    1 
ATOM   8692  C C     . ALA B 1 502 ? -27.703 46.163  53.233  1.00 29.04  ? 502  ALA B C     1 
ATOM   8693  O O     . ALA B 1 502 ? -27.671 46.474  54.412  1.00 29.04  ? 502  ALA B O     1 
ATOM   8694  C CB    . ALA B 1 502 ? -27.842 43.705  52.731  1.00 32.52  ? 502  ALA B CB    1 
ATOM   8695  N N     . LEU B 1 503 ? -27.002 46.824  52.314  1.00 29.80  ? 503  LEU B N     1 
ATOM   8696  C CA    . LEU B 1 503 ? -26.157 47.981  52.688  1.00 28.92  ? 503  LEU B CA    1 
ATOM   8697  C C     . LEU B 1 503 ? -26.974 49.213  53.119  1.00 27.17  ? 503  LEU B C     1 
ATOM   8698  O O     . LEU B 1 503 ? -26.762 49.781  54.185  1.00 25.59  ? 503  LEU B O     1 
ATOM   8699  C CB    . LEU B 1 503 ? -25.271 48.428  51.501  1.00 27.75  ? 503  LEU B CB    1 
ATOM   8700  C CG    . LEU B 1 503 ? -24.422 49.695  51.697  1.00 27.37  ? 503  LEU B CG    1 
ATOM   8701  C CD1   . LEU B 1 503 ? -23.411 49.511  52.819  1.00 23.37  ? 503  LEU B CD1   1 
ATOM   8702  C CD2   . LEU B 1 503 ? -23.729 50.107  50.377  1.00 30.45  ? 503  LEU B CD2   1 
ATOM   8703  N N     . MET B 1 504 ? -27.852 49.636  52.224  1.00 25.18  ? 504  MET B N     1 
ATOM   8704  C CA    . MET B 1 504 ? -28.556 50.897  52.353  1.00 28.42  ? 504  MET B CA    1 
ATOM   8705  C C     . MET B 1 504 ? -29.797 50.882  53.254  1.00 27.22  ? 504  MET B C     1 
ATOM   8706  O O     . MET B 1 504 ? -30.090 51.885  53.870  1.00 26.25  ? 504  MET B O     1 
ATOM   8707  C CB    . MET B 1 504 ? -28.951 51.393  50.948  1.00 29.08  ? 504  MET B CB    1 
ATOM   8708  C CG    . MET B 1 504 ? -27.723 51.735  50.095  1.00 32.14  ? 504  MET B CG    1 
ATOM   8709  S SD    . MET B 1 504 ? -28.116 52.623  48.611  1.00 33.16  ? 504  MET B SD    1 
ATOM   8710  C CE    . MET B 1 504 ? -28.471 54.251  49.274  1.00 33.52  ? 504  MET B CE    1 
ATOM   8711  N N     . PHE B 1 505 ? -30.516 49.770  53.318  1.00 27.85  ? 505  PHE B N     1 
ATOM   8712  C CA    . PHE B 1 505 ? -31.755 49.697  54.103  1.00 28.44  ? 505  PHE B CA    1 
ATOM   8713  C C     . PHE B 1 505 ? -31.380 49.371  55.522  1.00 28.52  ? 505  PHE B C     1 
ATOM   8714  O O     . PHE B 1 505 ? -31.747 48.314  56.057  1.00 29.62  ? 505  PHE B O     1 
ATOM   8715  C CB    . PHE B 1 505 ? -32.709 48.618  53.560  1.00 28.23  ? 505  PHE B CB    1 
ATOM   8716  C CG    . PHE B 1 505 ? -33.217 48.866  52.165  1.00 27.81  ? 505  PHE B CG    1 
ATOM   8717  C CD1   . PHE B 1 505 ? -32.999 50.068  51.501  1.00 26.76  ? 505  PHE B CD1   1 
ATOM   8718  C CD2   . PHE B 1 505 ? -33.991 47.901  51.542  1.00 31.48  ? 505  PHE B CD2   1 
ATOM   8719  C CE1   . PHE B 1 505 ? -33.505 50.281  50.247  1.00 29.24  ? 505  PHE B CE1   1 
ATOM   8720  C CE2   . PHE B 1 505 ? -34.504 48.118  50.273  1.00 30.06  ? 505  PHE B CE2   1 
ATOM   8721  C CZ    . PHE B 1 505 ? -34.262 49.307  49.630  1.00 28.01  ? 505  PHE B CZ    1 
ATOM   8722  N N     . SER B 1 506 ? -30.653 50.294  56.137  1.00 28.35  ? 506  SER B N     1 
ATOM   8723  C CA    . SER B 1 506 ? -29.933 50.024  57.372  1.00 29.28  ? 506  SER B CA    1 
ATOM   8724  C C     . SER B 1 506 ? -29.727 51.305  58.143  1.00 28.39  ? 506  SER B C     1 
ATOM   8725  O O     . SER B 1 506 ? -29.052 52.218  57.676  1.00 27.74  ? 506  SER B O     1 
ATOM   8726  C CB    . SER B 1 506 ? -28.569 49.374  57.069  1.00 29.16  ? 506  SER B CB    1 
ATOM   8727  O OG    . SER B 1 506 ? -27.717 49.416  58.201  1.00 32.42  ? 506  SER B OG    1 
ATOM   8728  N N     . LEU B 1 507 ? -30.277 51.341  59.354  1.00 28.32  ? 507  LEU B N     1 
ATOM   8729  C CA    . LEU B 1 507 ? -30.035 52.450  60.275  1.00 28.06  ? 507  LEU B CA    1 
ATOM   8730  C C     . LEU B 1 507 ? -28.541 52.612  60.651  1.00 27.99  ? 507  LEU B C     1 
ATOM   8731  O O     . LEU B 1 507 ? -28.068 53.734  60.881  1.00 26.18  ? 507  LEU B O     1 
ATOM   8732  C CB    . LEU B 1 507 ? -30.896 52.319  61.557  1.00 27.88  ? 507  LEU B CB    1 
ATOM   8733  C CG    . LEU B 1 507 ? -32.422 52.317  61.344  1.00 24.25  ? 507  LEU B CG    1 
ATOM   8734  C CD1   . LEU B 1 507 ? -33.168 52.227  62.598  1.00 24.56  ? 507  LEU B CD1   1 
ATOM   8735  C CD2   . LEU B 1 507 ? -32.867 53.510  60.583  1.00 27.61  ? 507  LEU B CD2   1 
ATOM   8736  N N     . ASP B 1 508 ? -27.809 51.507  60.728  1.00 27.97  ? 508  ASP B N     1 
ATOM   8737  C CA    . ASP B 1 508 ? -26.363 51.564  61.054  1.00 27.28  ? 508  ASP B CA    1 
ATOM   8738  C C     . ASP B 1 508 ? -25.596 52.326  60.000  1.00 25.57  ? 508  ASP B C     1 
ATOM   8739  O O     . ASP B 1 508 ? -24.795 53.186  60.311  1.00 26.17  ? 508  ASP B O     1 
ATOM   8740  C CB    . ASP B 1 508 ? -25.800 50.150  61.182  1.00 28.58  ? 508  ASP B CB    1 
ATOM   8741  C CG    . ASP B 1 508 ? -26.243 49.448  62.474  1.00 32.72  ? 508  ASP B CG    1 
ATOM   8742  O OD1   . ASP B 1 508 ? -26.689 50.113  63.444  1.00 31.81  ? 508  ASP B OD1   1 
ATOM   8743  O OD2   . ASP B 1 508 ? -26.112 48.211  62.513  1.00 38.85  ? 508  ASP B OD2   1 
ATOM   8744  N N     . TRP B 1 509 ? -25.869 52.002  58.747  1.00 25.22  ? 509  TRP B N     1 
ATOM   8745  C CA    . TRP B 1 509 ? -25.219 52.623  57.615  1.00 25.81  ? 509  TRP B CA    1 
ATOM   8746  C C     . TRP B 1 509 ? -25.614 54.066  57.494  1.00 26.31  ? 509  TRP B C     1 
ATOM   8747  O O     . TRP B 1 509 ? -24.767 54.940  57.218  1.00 26.10  ? 509  TRP B O     1 
ATOM   8748  C CB    . TRP B 1 509 ? -25.555 51.858  56.337  1.00 26.28  ? 509  TRP B CB    1 
ATOM   8749  C CG    . TRP B 1 509 ? -24.899 52.445  55.140  1.00 28.56  ? 509  TRP B CG    1 
ATOM   8750  C CD1   . TRP B 1 509 ? -25.505 53.110  54.131  1.00 30.01  ? 509  TRP B CD1   1 
ATOM   8751  C CD2   . TRP B 1 509 ? -23.498 52.446  54.838  1.00 30.39  ? 509  TRP B CD2   1 
ATOM   8752  N NE1   . TRP B 1 509 ? -24.582 53.528  53.207  1.00 26.88  ? 509  TRP B NE1   1 
ATOM   8753  C CE2   . TRP B 1 509 ? -23.340 53.128  53.607  1.00 26.19  ? 509  TRP B CE2   1 
ATOM   8754  C CE3   . TRP B 1 509 ? -22.366 51.912  55.468  1.00 30.94  ? 509  TRP B CE3   1 
ATOM   8755  C CZ2   . TRP B 1 509 ? -22.096 53.306  52.998  1.00 27.68  ? 509  TRP B CZ2   1 
ATOM   8756  C CZ3   . TRP B 1 509 ? -21.107 52.093  54.856  1.00 30.84  ? 509  TRP B CZ3   1 
ATOM   8757  C CH2   . TRP B 1 509 ? -20.995 52.790  53.635  1.00 27.61  ? 509  TRP B CH2   1 
ATOM   8758  N N     . ILE B 1 510 ? -26.893 54.352  57.729  1.00 26.37  ? 510  ILE B N     1 
ATOM   8759  C CA    . ILE B 1 510 ? -27.346 55.737  57.746  1.00 27.81  ? 510  ILE B CA    1 
ATOM   8760  C C     . ILE B 1 510 ? -26.656 56.521  58.840  1.00 26.23  ? 510  ILE B C     1 
ATOM   8761  O O     . ILE B 1 510 ? -26.174 57.601  58.600  1.00 24.10  ? 510  ILE B O     1 
ATOM   8762  C CB    . ILE B 1 510 ? -28.891 55.839  57.896  1.00 29.84  ? 510  ILE B CB    1 
ATOM   8763  C CG1   . ILE B 1 510 ? -29.561 55.445  56.578  1.00 33.24  ? 510  ILE B CG1   1 
ATOM   8764  C CG2   . ILE B 1 510 ? -29.320 57.252  58.317  1.00 27.79  ? 510  ILE B CG2   1 
ATOM   8765  C CD1   . ILE B 1 510 ? -31.056 55.202  56.700  1.00 35.43  ? 510  ILE B CD1   1 
ATOM   8766  N N     . LYS B 1 511 ? -26.587 55.972  60.037  1.00 25.56  ? 511  LYS B N     1 
ATOM   8767  C CA    . LYS B 1 511 ? -25.823 56.624  61.101  1.00 26.62  ? 511  LYS B CA    1 
ATOM   8768  C C     . LYS B 1 511 ? -24.353 56.845  60.726  1.00 26.67  ? 511  LYS B C     1 
ATOM   8769  O O     . LYS B 1 511 ? -23.858 57.940  60.846  1.00 28.58  ? 511  LYS B O     1 
ATOM   8770  C CB    . LYS B 1 511 ? -25.890 55.821  62.393  1.00 27.95  ? 511  LYS B CB    1 
ATOM   8771  C CG    . LYS B 1 511 ? -25.226 56.508  63.553  1.00 25.44  ? 511  LYS B CG    1 
ATOM   8772  C CD    . LYS B 1 511 ? -25.393 55.727  64.820  1.00 28.31  ? 511  LYS B CD    1 
ATOM   8773  C CE    . LYS B 1 511 ? -24.586 56.395  65.919  1.00 29.46  ? 511  LYS B CE    1 
ATOM   8774  N NZ    . LYS B 1 511 ? -24.852 55.715  67.169  1.00 45.80  ? 511  LYS B NZ    1 
ATOM   8775  N N     . ALA B 1 512 ? -23.667 55.806  60.269  1.00 27.06  ? 512  ALA B N     1 
ATOM   8776  C CA    . ALA B 1 512 ? -22.223 55.883  60.021  1.00 27.11  ? 512  ALA B CA    1 
ATOM   8777  C C     . ALA B 1 512 ? -21.891 56.867  58.886  1.00 27.55  ? 512  ALA B C     1 
ATOM   8778  O O     . ALA B 1 512 ? -20.998 57.699  59.024  1.00 29.11  ? 512  ALA B O     1 
ATOM   8779  C CB    . ALA B 1 512 ? -21.680 54.494  59.722  1.00 28.34  ? 512  ALA B CB    1 
ATOM   8780  N N     . LYS B 1 513 ? -22.624 56.786  57.770  1.00 28.34  ? 513  LYS B N     1 
ATOM   8781  C CA    . LYS B 1 513 ? -22.365 57.667  56.627  1.00 26.75  ? 513  LYS B CA    1 
ATOM   8782  C C     . LYS B 1 513 ? -22.792 59.116  56.870  1.00 27.47  ? 513  LYS B C     1 
ATOM   8783  O O     . LYS B 1 513 ? -22.066 60.048  56.502  1.00 27.00  ? 513  LYS B O     1 
ATOM   8784  C CB    . LYS B 1 513 ? -23.043 57.151  55.331  1.00 29.35  ? 513  LYS B CB    1 
ATOM   8785  C CG    . LYS B 1 513 ? -22.795 58.080  54.140  1.00 26.53  ? 513  LYS B CG    1 
ATOM   8786  C CD    . LYS B 1 513 ? -22.896 57.370  52.795  1.00 25.80  ? 513  LYS B CD    1 
ATOM   8787  C CE    . LYS B 1 513 ? -22.622 58.308  51.684  1.00 24.22  ? 513  LYS B CE    1 
ATOM   8788  N NZ    . LYS B 1 513 ? -22.461 57.569  50.426  1.00 29.43  ? 513  LYS B NZ    1 
ATOM   8789  N N     . THR B 1 514 ? -23.960 59.325  57.486  1.00 27.14  ? 514  THR B N     1 
ATOM   8790  C CA    . THR B 1 514 ? -24.410 60.691  57.745  1.00 28.98  ? 514  THR B CA    1 
ATOM   8791  C C     . THR B 1 514 ? -23.583 61.422  58.763  1.00 28.52  ? 514  THR B C     1 
ATOM   8792  O O     . THR B 1 514 ? -23.419 62.639  58.654  1.00 30.05  ? 514  THR B O     1 
ATOM   8793  C CB    . THR B 1 514 ? -25.885 60.796  58.188  1.00 30.09  ? 514  THR B CB    1 
ATOM   8794  O OG1   . THR B 1 514 ? -26.073 60.117  59.432  1.00 25.57  ? 514  THR B OG1   1 
ATOM   8795  C CG2   . THR B 1 514 ? -26.787 60.292  57.104  1.00 30.17  ? 514  THR B CG2   1 
ATOM   8796  N N     . GLU B 1 515 ? -23.066 60.702  59.747  1.00 29.74  ? 515  GLU B N     1 
ATOM   8797  C CA    . GLU B 1 515 ? -22.209 61.339  60.760  1.00 31.68  ? 515  GLU B CA    1 
ATOM   8798  C C     . GLU B 1 515 ? -20.854 61.795  60.190  1.00 32.70  ? 515  GLU B C     1 
ATOM   8799  O O     . GLU B 1 515 ? -20.249 62.689  60.743  1.00 35.62  ? 515  GLU B O     1 
ATOM   8800  C CB    . GLU B 1 515 ? -22.058 60.450  61.991  1.00 30.00  ? 515  GLU B CB    1 
ATOM   8801  C CG    . GLU B 1 515 ? -23.376 60.304  62.790  1.00 36.49  ? 515  GLU B CG    1 
ATOM   8802  C CD    . GLU B 1 515 ? -23.184 59.619  64.151  1.00 34.77  ? 515  GLU B CD    1 
ATOM   8803  O OE1   . GLU B 1 515 ? -22.122 58.993  64.354  1.00 37.26  ? 515  GLU B OE1   1 
ATOM   8804  O OE2   . GLU B 1 515 ? -24.091 59.723  65.013  1.00 37.53  ? 515  GLU B OE2   1 
ATOM   8805  N N     . LEU B 1 516 ? -20.406 61.199  59.079  1.00 33.70  ? 516  LEU B N     1 
ATOM   8806  C CA    . LEU B 1 516 ? -19.212 61.665  58.346  1.00 33.36  ? 516  LEU B CA    1 
ATOM   8807  C C     . LEU B 1 516 ? -19.460 62.722  57.263  1.00 32.91  ? 516  LEU B C     1 
ATOM   8808  O O     . LEU B 1 516 ? -18.665 63.657  57.126  1.00 33.64  ? 516  LEU B O     1 
ATOM   8809  C CB    . LEU B 1 516 ? -18.482 60.509  57.667  1.00 35.31  ? 516  LEU B CB    1 
ATOM   8810  C CG    . LEU B 1 516 ? -17.731 59.492  58.517  1.00 45.26  ? 516  LEU B CG    1 
ATOM   8811  C CD1   . LEU B 1 516 ? -17.175 58.437  57.583  1.00 50.26  ? 516  LEU B CD1   1 
ATOM   8812  C CD2   . LEU B 1 516 ? -16.601 60.148  59.343  1.00 45.84  ? 516  LEU B CD2   1 
ATOM   8813  N N     . VAL B 1 517 ? -20.504 62.544  56.452  1.00 31.82  ? 517  VAL B N     1 
ATOM   8814  C CA    . VAL B 1 517 ? -20.721 63.434  55.282  1.00 29.49  ? 517  VAL B CA    1 
ATOM   8815  C C     . VAL B 1 517 ? -22.118 64.058  55.154  1.00 28.22  ? 517  VAL B C     1 
ATOM   8816  O O     . VAL B 1 517 ? -22.396 64.824  54.206  1.00 29.32  ? 517  VAL B O     1 
ATOM   8817  C CB    . VAL B 1 517 ? -20.346 62.734  53.984  1.00 30.57  ? 517  VAL B CB    1 
ATOM   8818  C CG1   . VAL B 1 517 ? -18.846 62.378  53.986  1.00 27.95  ? 517  VAL B CG1   1 
ATOM   8819  C CG2   . VAL B 1 517 ? -21.227 61.497  53.757  1.00 30.82  ? 517  VAL B CG2   1 
ATOM   8820  N N     . GLY B 1 518 ? -22.990 63.774  56.121  1.00 27.97  ? 518  GLY B N     1 
ATOM   8821  C CA    . GLY B 1 518 ? -24.347 64.294  56.086  1.00 28.37  ? 518  GLY B CA    1 
ATOM   8822  C C     . GLY B 1 518 ? -25.199 63.452  55.176  1.00 27.76  ? 518  GLY B C     1 
ATOM   8823  O O     . GLY B 1 518 ? -24.735 62.409  54.698  1.00 26.96  ? 518  GLY B O     1 
ATOM   8824  N N     . PRO B 1 519 ? -26.457 63.876  54.959  1.00 28.92  ? 519  PRO B N     1 
ATOM   8825  C CA    . PRO B 1 519 ? -27.480 63.111  54.245  1.00 28.86  ? 519  PRO B CA    1 
ATOM   8826  C C     . PRO B 1 519 ? -27.526 63.239  52.738  1.00 27.94  ? 519  PRO B C     1 
ATOM   8827  O O     . PRO B 1 519 ? -28.177 62.434  52.095  1.00 28.44  ? 519  PRO B O     1 
ATOM   8828  C CB    . PRO B 1 519 ? -28.786 63.705  54.789  1.00 29.09  ? 519  PRO B CB    1 
ATOM   8829  C CG    . PRO B 1 519 ? -28.458 65.126  55.030  1.00 30.40  ? 519  PRO B CG    1 
ATOM   8830  C CD    . PRO B 1 519 ? -27.003 65.154  55.468  1.00 31.20  ? 519  PRO B CD    1 
ATOM   8831  N N     . ALA B 1 520 ? -26.878 64.245  52.169  1.00 27.09  ? 520  ALA B N     1 
ATOM   8832  C CA    . ALA B 1 520 ? -27.168 64.609  50.792  1.00 27.77  ? 520  ALA B CA    1 
ATOM   8833  C C     . ALA B 1 520 ? -26.874 63.521  49.747  1.00 27.87  ? 520  ALA B C     1 
ATOM   8834  O O     . ALA B 1 520 ? -27.694 63.209  48.893  1.00 25.83  ? 520  ALA B O     1 
ATOM   8835  C CB    . ALA B 1 520 ? -26.446 65.904  50.441  1.00 27.54  ? 520  ALA B CB    1 
ATOM   8836  N N     . HIS B 1 521 ? -25.675 62.987  49.783  1.00 29.65  ? 521  HIS B N     1 
ATOM   8837  C CA    . HIS B 1 521 ? -25.268 61.997  48.806  1.00 29.35  ? 521  HIS B CA    1 
ATOM   8838  C C     . HIS B 1 521 ? -26.069 60.695  49.006  1.00 30.91  ? 521  HIS B C     1 
ATOM   8839  O O     . HIS B 1 521 ? -26.515 60.076  48.027  1.00 30.99  ? 521  HIS B O     1 
ATOM   8840  C CB    . HIS B 1 521 ? -23.748 61.794  48.869  1.00 28.54  ? 521  HIS B CB    1 
ATOM   8841  C CG    . HIS B 1 521 ? -23.222 60.768  47.907  1.00 29.63  ? 521  HIS B CG    1 
ATOM   8842  N ND1   . HIS B 1 521 ? -23.492 60.790  46.552  1.00 36.91  ? 521  HIS B ND1   1 
ATOM   8843  C CD2   . HIS B 1 521 ? -22.467 59.673  48.117  1.00 30.57  ? 521  HIS B CD2   1 
ATOM   8844  C CE1   . HIS B 1 521 ? -22.909 59.756  45.975  1.00 29.73  ? 521  HIS B CE1   1 
ATOM   8845  N NE2   . HIS B 1 521 ? -22.271 59.071  46.904  1.00 33.95  ? 521  HIS B NE2   1 
ATOM   8846  N N     . LEU B 1 522 ? -26.285 60.318  50.260  1.00 31.33  ? 522  LEU B N     1 
ATOM   8847  C CA    . LEU B 1 522 ? -27.135 59.176  50.583  1.00 31.60  ? 522  LEU B CA    1 
ATOM   8848  C C     . LEU B 1 522 ? -28.525 59.281  49.963  1.00 29.62  ? 522  LEU B C     1 
ATOM   8849  O O     . LEU B 1 522 ? -28.965 58.343  49.330  1.00 29.81  ? 522  LEU B O     1 
ATOM   8850  C CB    . LEU B 1 522 ? -27.220 59.002  52.097  1.00 31.40  ? 522  LEU B CB    1 
ATOM   8851  C CG    . LEU B 1 522 ? -27.658 57.622  52.589  1.00 33.65  ? 522  LEU B CG    1 
ATOM   8852  C CD1   . LEU B 1 522 ? -26.936 56.473  51.934  1.00 33.79  ? 522  LEU B CD1   1 
ATOM   8853  C CD2   . LEU B 1 522 ? -27.432 57.563  54.060  1.00 34.83  ? 522  LEU B CD2   1 
ATOM   8854  N N     . ILE B 1 523 ? -29.184 60.426  50.125  1.00 31.27  ? 523  ILE B N     1 
ATOM   8855  C CA    . ILE B 1 523 ? -30.487 60.687  49.495  1.00 31.94  ? 523  ILE B CA    1 
ATOM   8856  C C     . ILE B 1 523 ? -30.400 60.520  47.972  1.00 33.95  ? 523  ILE B C     1 
ATOM   8857  O O     . ILE B 1 523 ? -31.208 59.854  47.344  1.00 36.36  ? 523  ILE B O     1 
ATOM   8858  C CB    . ILE B 1 523 ? -30.986 62.125  49.822  1.00 30.50  ? 523  ILE B CB    1 
ATOM   8859  C CG1   . ILE B 1 523 ? -31.395 62.195  51.304  1.00 27.81  ? 523  ILE B CG1   1 
ATOM   8860  C CG2   . ILE B 1 523 ? -32.145 62.504  48.898  1.00 28.75  ? 523  ILE B CG2   1 
ATOM   8861  C CD1   . ILE B 1 523 ? -31.633 63.616  51.858  1.00 27.21  ? 523  ILE B CD1   1 
ATOM   8862  N N     . HIS B 1 524 ? -29.401 61.132  47.378  1.00 34.27  ? 524  HIS B N     1 
ATOM   8863  C CA    . HIS B 1 524 ? -29.162 60.985  45.949  1.00 34.10  ? 524  HIS B CA    1 
ATOM   8864  C C     . HIS B 1 524 ? -28.965 59.509  45.525  1.00 33.24  ? 524  HIS B C     1 
ATOM   8865  O O     . HIS B 1 524 ? -29.406 59.112  44.475  1.00 34.96  ? 524  HIS B O     1 
ATOM   8866  C CB    . HIS B 1 524 ? -27.935 61.855  45.534  1.00 34.32  ? 524  HIS B CB    1 
ATOM   8867  C CG    . HIS B 1 524 ? -27.488 61.641  44.118  1.00 35.26  ? 524  HIS B CG    1 
ATOM   8868  N ND1   . HIS B 1 524 ? -28.238 62.041  43.035  1.00 42.67  ? 524  HIS B ND1   1 
ATOM   8869  C CD2   . HIS B 1 524 ? -26.399 61.022  43.608  1.00 37.62  ? 524  HIS B CD2   1 
ATOM   8870  C CE1   . HIS B 1 524 ? -27.626 61.695  41.920  1.00 39.59  ? 524  HIS B CE1   1 
ATOM   8871  N NE2   . HIS B 1 524 ? -26.504 61.082  42.240  1.00 44.21  ? 524  HIS B NE2   1 
ATOM   8872  N N     . GLU B 1 525 ? -28.279 58.711  46.332  1.00 33.20  ? 525  GLU B N     1 
ATOM   8873  C CA    . GLU B 1 525 ? -28.049 57.299  46.012  1.00 32.18  ? 525  GLU B CA    1 
ATOM   8874  C C     . GLU B 1 525 ? -29.366 56.539  45.996  1.00 32.08  ? 525  GLU B C     1 
ATOM   8875  O O     . GLU B 1 525 ? -29.566 55.693  45.132  1.00 32.35  ? 525  GLU B O     1 
ATOM   8876  C CB    . GLU B 1 525 ? -27.077 56.615  46.996  1.00 30.82  ? 525  GLU B CB    1 
ATOM   8877  C CG    . GLU B 1 525 ? -25.683 57.103  46.918  1.00 31.35  ? 525  GLU B CG    1 
ATOM   8878  C CD    . GLU B 1 525 ? -24.709 56.504  47.924  1.00 33.66  ? 525  GLU B CD    1 
ATOM   8879  O OE1   . GLU B 1 525 ? -24.905 56.565  49.166  1.00 34.84  ? 525  GLU B OE1   1 
ATOM   8880  O OE2   . GLU B 1 525 ? -23.658 56.013  47.455  1.00 37.58  ? 525  GLU B OE2   1 
ATOM   8881  N N     . PHE B 1 526 ? -30.247 56.831  46.950  1.00 31.65  ? 526  PHE B N     1 
ATOM   8882  C CA    . PHE B 1 526 ? -31.558 56.191  47.003  1.00 32.91  ? 526  PHE B CA    1 
ATOM   8883  C C     . PHE B 1 526 ? -32.351 56.490  45.705  1.00 34.68  ? 526  PHE B C     1 
ATOM   8884  O O     . PHE B 1 526 ? -32.967 55.596  45.119  1.00 33.16  ? 526  PHE B O     1 
ATOM   8885  C CB    . PHE B 1 526 ? -32.342 56.638  48.249  1.00 30.16  ? 526  PHE B CB    1 
ATOM   8886  C CG    . PHE B 1 526 ? -31.992 55.860  49.500  1.00 34.07  ? 526  PHE B CG    1 
ATOM   8887  C CD1   . PHE B 1 526 ? -32.466 54.565  49.681  1.00 32.87  ? 526  PHE B CD1   1 
ATOM   8888  C CD2   . PHE B 1 526 ? -31.189 56.409  50.481  1.00 29.92  ? 526  PHE B CD2   1 
ATOM   8889  C CE1   . PHE B 1 526 ? -32.136 53.835  50.813  1.00 32.91  ? 526  PHE B CE1   1 
ATOM   8890  C CE2   . PHE B 1 526 ? -30.852 55.672  51.639  1.00 29.20  ? 526  PHE B CE2   1 
ATOM   8891  C CZ    . PHE B 1 526 ? -31.343 54.390  51.803  1.00 27.56  ? 526  PHE B CZ    1 
ATOM   8892  N N     . VAL B 1 527 ? -32.308 57.738  45.255  1.00 35.02  ? 527  VAL B N     1 
ATOM   8893  C CA    . VAL B 1 527 ? -33.029 58.126  44.055  1.00 36.46  ? 527  VAL B CA    1 
ATOM   8894  C C     . VAL B 1 527 ? -32.427 57.506  42.777  1.00 38.25  ? 527  VAL B C     1 
ATOM   8895  O O     . VAL B 1 527 ? -33.135 56.899  41.979  1.00 38.66  ? 527  VAL B O     1 
ATOM   8896  C CB    . VAL B 1 527 ? -33.079 59.634  43.936  1.00 37.98  ? 527  VAL B CB    1 
ATOM   8897  C CG1   . VAL B 1 527 ? -33.635 60.051  42.546  1.00 36.16  ? 527  VAL B CG1   1 
ATOM   8898  C CG2   . VAL B 1 527 ? -33.955 60.183  45.057  1.00 37.74  ? 527  VAL B CG2   1 
ATOM   8899  N N     . GLU B 1 528 ? -31.122 57.679  42.620  1.00 37.69  ? 528  GLU B N     1 
ATOM   8900  C CA    . GLU B 1 528 ? -30.351 57.240  41.462  1.00 36.85  ? 528  GLU B CA    1 
ATOM   8901  C C     . GLU B 1 528 ? -30.369 55.727  41.202  1.00 38.33  ? 528  GLU B C     1 
ATOM   8902  O O     . GLU B 1 528 ? -30.383 55.279  40.026  1.00 36.82  ? 528  GLU B O     1 
ATOM   8903  C CB    . GLU B 1 528 ? -28.906 57.702  41.645  1.00 37.05  ? 528  GLU B CB    1 
ATOM   8904  C CG    . GLU B 1 528 ? -27.905 57.388  40.547  1.00 40.22  ? 528  GLU B CG    1 
ATOM   8905  C CD    . GLU B 1 528 ? -28.063 58.261  39.320  1.00 54.27  ? 528  GLU B CD    1 
ATOM   8906  O OE1   . GLU B 1 528 ? -28.888 59.216  39.344  1.00 57.45  ? 528  GLU B OE1   1 
ATOM   8907  O OE2   . GLU B 1 528 ? -27.361 57.973  38.316  1.00 58.36  ? 528  GLU B OE2   1 
ATOM   8908  N N     . TYR B 1 529 ? -30.360 54.927  42.267  1.00 37.03  ? 529  TYR B N     1 
ATOM   8909  C CA    . TYR B 1 529 ? -30.208 53.487  42.076  1.00 37.65  ? 529  TYR B CA    1 
ATOM   8910  C C     . TYR B 1 529 ? -31.514 52.727  42.225  1.00 36.75  ? 529  TYR B C     1 
ATOM   8911  O O     . TYR B 1 529 ? -31.536 51.529  42.015  1.00 35.65  ? 529  TYR B O     1 
ATOM   8912  C CB    . TYR B 1 529 ? -29.114 52.893  42.984  1.00 37.35  ? 529  TYR B CB    1 
ATOM   8913  C CG    . TYR B 1 529 ? -27.788 53.611  42.950  1.00 36.08  ? 529  TYR B CG    1 
ATOM   8914  C CD1   . TYR B 1 529 ? -27.254 54.135  41.767  1.00 35.56  ? 529  TYR B CD1   1 
ATOM   8915  C CD2   . TYR B 1 529 ? -27.052 53.749  44.104  1.00 35.99  ? 529  TYR B CD2   1 
ATOM   8916  C CE1   . TYR B 1 529 ? -26.029 54.814  41.769  1.00 37.03  ? 529  TYR B CE1   1 
ATOM   8917  C CE2   . TYR B 1 529 ? -25.844 54.405  44.105  1.00 37.62  ? 529  TYR B CE2   1 
ATOM   8918  C CZ    . TYR B 1 529 ? -25.337 54.941  42.949  1.00 34.85  ? 529  TYR B CZ    1 
ATOM   8919  O OH    . TYR B 1 529 ? -24.114 55.576  43.045  1.00 41.37  ? 529  TYR B OH    1 
ATOM   8920  N N     . ARG B 1 530 ? -32.590 53.435  42.524  1.00 37.62  ? 530  ARG B N     1 
ATOM   8921  C CA    . ARG B 1 530 ? -33.898 52.841  42.703  1.00 40.31  ? 530  ARG B CA    1 
ATOM   8922  C C     . ARG B 1 530 ? -34.337 51.986  41.505  1.00 40.27  ? 530  ARG B C     1 
ATOM   8923  O O     . ARG B 1 530 ? -34.988 50.980  41.689  1.00 38.40  ? 530  ARG B O     1 
ATOM   8924  C CB    . ARG B 1 530 ? -34.927 53.945  42.968  1.00 38.97  ? 530  ARG B CB    1 
ATOM   8925  C CG    . ARG B 1 530 ? -36.250 53.406  43.394  1.00 43.43  ? 530  ARG B CG    1 
ATOM   8926  C CD    . ARG B 1 530 ? -37.142 54.489  43.984  1.00 44.33  ? 530  ARG B CD    1 
ATOM   8927  N NE    . ARG B 1 530 ? -36.686 54.909  45.303  1.00 44.19  ? 530  ARG B NE    1 
ATOM   8928  C CZ    . ARG B 1 530 ? -36.478 56.168  45.692  1.00 46.47  ? 530  ARG B CZ    1 
ATOM   8929  N NH1   . ARG B 1 530 ? -36.720 57.196  44.883  1.00 43.10  ? 530  ARG B NH1   1 
ATOM   8930  N NH2   . ARG B 1 530 ? -36.044 56.396  46.931  1.00 38.93  ? 530  ARG B NH2   1 
ATOM   8931  N N     . HIS B 1 531 ? -33.951 52.388  40.296  1.00 41.08  ? 531  HIS B N     1 
ATOM   8932  C CA    . HIS B 1 531 ? -34.415 51.740  39.057  1.00 43.47  ? 531  HIS B CA    1 
ATOM   8933  C C     . HIS B 1 531 ? -33.958 50.277  38.897  1.00 44.23  ? 531  HIS B C     1 
ATOM   8934  O O     . HIS B 1 531 ? -34.510 49.565  38.088  1.00 42.89  ? 531  HIS B O     1 
ATOM   8935  C CB    . HIS B 1 531 ? -33.970 52.531  37.813  1.00 42.35  ? 531  HIS B CB    1 
ATOM   8936  C CG    . HIS B 1 531 ? -32.510 52.400  37.516  1.00 46.90  ? 531  HIS B CG    1 
ATOM   8937  N ND1   . HIS B 1 531 ? -31.570 53.293  37.989  1.00 51.51  ? 531  HIS B ND1   1 
ATOM   8938  C CD2   . HIS B 1 531 ? -31.818 51.449  36.843  1.00 50.38  ? 531  HIS B CD2   1 
ATOM   8939  C CE1   . HIS B 1 531 ? -30.364 52.900  37.614  1.00 48.83  ? 531  HIS B CE1   1 
ATOM   8940  N NE2   . HIS B 1 531 ? -30.485 51.784  36.918  1.00 47.63  ? 531  HIS B NE2   1 
ATOM   8941  N N     . ILE B 1 532 ? -32.950 49.837  39.653  1.00 44.99  ? 532  ILE B N     1 
ATOM   8942  C CA    . ILE B 1 532 ? -32.525 48.426  39.587  1.00 44.17  ? 532  ILE B CA    1 
ATOM   8943  C C     . ILE B 1 532 ? -33.324 47.504  40.518  1.00 44.49  ? 532  ILE B C     1 
ATOM   8944  O O     . ILE B 1 532 ? -33.095 46.300  40.553  1.00 45.39  ? 532  ILE B O     1 
ATOM   8945  C CB    . ILE B 1 532 ? -30.993 48.239  39.833  1.00 44.99  ? 532  ILE B CB    1 
ATOM   8946  C CG1   . ILE B 1 532 ? -30.617 48.336  41.320  1.00 44.69  ? 532  ILE B CG1   1 
ATOM   8947  C CG2   . ILE B 1 532 ? -30.178 49.223  38.980  1.00 44.68  ? 532  ILE B CG2   1 
ATOM   8948  C CD1   . ILE B 1 532 ? -29.499 47.391  41.727  1.00 42.78  ? 532  ILE B CD1   1 
ATOM   8949  N N     . LEU B 1 533 ? -34.260 48.063  41.270  1.00 44.38  ? 533  LEU B N     1 
ATOM   8950  C CA    . LEU B 1 533 ? -34.925 47.319  42.333  1.00 45.01  ? 533  LEU B CA    1 
ATOM   8951  C C     . LEU B 1 533 ? -36.260 46.760  41.886  1.00 44.27  ? 533  LEU B C     1 
ATOM   8952  O O     . LEU B 1 533 ? -36.926 47.352  41.058  1.00 43.54  ? 533  LEU B O     1 
ATOM   8953  C CB    . LEU B 1 533 ? -35.138 48.224  43.547  1.00 44.11  ? 533  LEU B CB    1 
ATOM   8954  C CG    . LEU B 1 533 ? -33.875 48.895  44.087  1.00 39.74  ? 533  LEU B CG    1 
ATOM   8955  C CD1   . LEU B 1 533 ? -34.242 49.767  45.275  1.00 37.56  ? 533  LEU B CD1   1 
ATOM   8956  C CD2   . LEU B 1 533 ? -32.848 47.857  44.462  1.00 38.29  ? 533  LEU B CD2   1 
ATOM   8957  N N     . ASP B 1 534 ? -36.651 45.620  42.445  1.00 44.83  ? 534  ASP B N     1 
ATOM   8958  C CA    . ASP B 1 534 ? -38.001 45.116  42.211  1.00 46.85  ? 534  ASP B CA    1 
ATOM   8959  C C     . ASP B 1 534 ? -39.017 46.022  42.933  1.00 48.07  ? 534  ASP B C     1 
ATOM   8960  O O     . ASP B 1 534 ? -38.635 47.007  43.582  1.00 46.93  ? 534  ASP B O     1 
ATOM   8961  C CB    . ASP B 1 534 ? -38.132 43.632  42.573  1.00 46.27  ? 534  ASP B CB    1 
ATOM   8962  C CG    . ASP B 1 534 ? -38.076 43.363  44.067  1.00 51.63  ? 534  ASP B CG    1 
ATOM   8963  O OD1   . ASP B 1 534 ? -38.076 44.324  44.875  1.00 54.88  ? 534  ASP B OD1   1 
ATOM   8964  O OD2   . ASP B 1 534 ? -38.051 42.159  44.433  1.00 52.21  ? 534  ASP B OD2   1 
ATOM   8965  N N     . GLU B 1 535 ? -40.297 45.698  42.792  1.00 48.60  ? 535  GLU B N     1 
ATOM   8966  C CA    . GLU B 1 535 ? -41.391 46.532  43.299  1.00 48.97  ? 535  GLU B CA    1 
ATOM   8967  C C     . GLU B 1 535 ? -41.351 46.694  44.807  1.00 47.45  ? 535  GLU B C     1 
ATOM   8968  O O     . GLU B 1 535 ? -41.587 47.783  45.336  1.00 44.73  ? 535  GLU B O     1 
ATOM   8969  C CB    . GLU B 1 535 ? -42.738 45.919  42.897  1.00 49.86  ? 535  GLU B CB    1 
ATOM   8970  C CG    . GLU B 1 535 ? -43.141 46.210  41.458  1.00 58.53  ? 535  GLU B CG    1 
ATOM   8971  C CD    . GLU B 1 535 ? -43.807 47.586  41.270  1.00 63.93  ? 535  GLU B CD    1 
ATOM   8972  O OE1   . GLU B 1 535 ? -43.742 48.437  42.192  1.00 65.54  ? 535  GLU B OE1   1 
ATOM   8973  O OE2   . GLU B 1 535 ? -44.399 47.809  40.186  1.00 68.75  ? 535  GLU B OE2   1 
ATOM   8974  N N     . LYS B 1 536 ? -41.062 45.586  45.478  1.00 47.98  ? 536  LYS B N     1 
ATOM   8975  C CA    . LYS B 1 536 ? -41.080 45.494  46.929  1.00 48.97  ? 536  LYS B CA    1 
ATOM   8976  C C     . LYS B 1 536 ? -39.968 46.362  47.535  1.00 46.67  ? 536  LYS B C     1 
ATOM   8977  O O     . LYS B 1 536 ? -40.204 47.148  48.445  1.00 46.12  ? 536  LYS B O     1 
ATOM   8978  C CB    . LYS B 1 536 ? -40.898 44.024  47.326  1.00 50.10  ? 536  LYS B CB    1 
ATOM   8979  C CG    . LYS B 1 536 ? -41.919 43.493  48.318  1.00 56.39  ? 536  LYS B CG    1 
ATOM   8980  C CD    . LYS B 1 536 ? -41.675 42.012  48.597  1.00 56.43  ? 536  LYS B CD    1 
ATOM   8981  C CE    . LYS B 1 536 ? -42.583 41.497  49.728  1.00 62.84  ? 536  LYS B CE    1 
ATOM   8982  N NZ    . LYS B 1 536 ? -42.168 40.145  50.229  1.00 64.18  ? 536  LYS B NZ    1 
ATOM   8983  N N     . ASP B 1 537 ? -38.755 46.180  47.021  1.00 45.39  ? 537  ASP B N     1 
ATOM   8984  C CA    . ASP B 1 537 ? -37.570 46.906  47.490  1.00 45.79  ? 537  ASP B CA    1 
ATOM   8985  C C     . ASP B 1 537 ? -37.652 48.374  47.118  1.00 43.66  ? 537  ASP B C     1 
ATOM   8986  O O     . ASP B 1 537 ? -37.213 49.221  47.854  1.00 41.81  ? 537  ASP B O     1 
ATOM   8987  C CB    . ASP B 1 537 ? -36.289 46.301  46.890  1.00 45.49  ? 537  ASP B CB    1 
ATOM   8988  C CG    . ASP B 1 537 ? -35.864 44.999  47.563  1.00 46.32  ? 537  ASP B CG    1 
ATOM   8989  O OD1   . ASP B 1 537 ? -36.131 44.816  48.775  1.00 42.38  ? 537  ASP B OD1   1 
ATOM   8990  O OD2   . ASP B 1 537 ? -35.218 44.170  46.871  1.00 50.49  ? 537  ASP B OD2   1 
ATOM   8991  N N     . CYS B 1 538 ? -38.216 48.659  45.960  1.00 44.74  ? 538  CYS B N     1 
ATOM   8992  C CA    . CYS B 1 538 ? -38.468 50.026  45.547  1.00 44.67  ? 538  CYS B CA    1 
ATOM   8993  C C     . CYS B 1 538 ? -39.310 50.843  46.560  1.00 43.86  ? 538  CYS B C     1 
ATOM   8994  O O     . CYS B 1 538 ? -39.007 52.010  46.828  1.00 42.43  ? 538  CYS B O     1 
ATOM   8995  C CB    . CYS B 1 538 ? -39.129 50.021  44.173  1.00 44.66  ? 538  CYS B CB    1 
ATOM   8996  S SG    . CYS B 1 538 ? -39.385 51.636  43.498  1.00 52.30  ? 538  CYS B SG    1 
ATOM   8997  N N     . ALA B 1 539 ? -40.353 50.223  47.119  1.00 42.88  ? 539  ALA B N     1 
ATOM   8998  C CA    . ALA B 1 539 ? -41.165 50.828  48.180  1.00 41.90  ? 539  ALA B CA    1 
ATOM   8999  C C     . ALA B 1 539 ? -40.357 51.090  49.470  1.00 41.60  ? 539  ALA B C     1 
ATOM   9000  O O     . ALA B 1 539 ? -40.473 52.156  50.066  1.00 40.77  ? 539  ALA B O     1 
ATOM   9001  C CB    . ALA B 1 539 ? -42.396 49.943  48.494  1.00 40.53  ? 539  ALA B CB    1 
ATOM   9002  N N     . VAL B 1 540 ? -39.566 50.104  49.894  1.00 39.61  ? 540  VAL B N     1 
ATOM   9003  C CA    . VAL B 1 540 ? -38.662 50.259  51.034  1.00 38.03  ? 540  VAL B CA    1 
ATOM   9004  C C     . VAL B 1 540 ? -37.643 51.380  50.792  1.00 37.35  ? 540  VAL B C     1 
ATOM   9005  O O     . VAL B 1 540 ? -37.399 52.213  51.649  1.00 36.04  ? 540  VAL B O     1 
ATOM   9006  C CB    . VAL B 1 540 ? -37.895 48.977  51.306  1.00 35.93  ? 540  VAL B CB    1 
ATOM   9007  C CG1   . VAL B 1 540 ? -36.907 49.182  52.411  1.00 37.93  ? 540  VAL B CG1   1 
ATOM   9008  C CG2   . VAL B 1 540 ? -38.854 47.839  51.652  1.00 39.45  ? 540  VAL B CG2   1 
ATOM   9009  N N     . SER B 1 541 ? -37.048 51.387  49.607  1.00 37.58  ? 541  SER B N     1 
ATOM   9010  C CA    . SER B 1 541 ? -36.179 52.489  49.190  1.00 36.92  ? 541  SER B CA    1 
ATOM   9011  C C     . SER B 1 541 ? -36.861 53.842  49.471  1.00 36.70  ? 541  SER B C     1 
ATOM   9012  O O     . SER B 1 541 ? -36.269 54.745  50.042  1.00 36.02  ? 541  SER B O     1 
ATOM   9013  C CB    . SER B 1 541 ? -35.839 52.326  47.700  1.00 34.70  ? 541  SER B CB    1 
ATOM   9014  O OG    . SER B 1 541 ? -34.987 53.337  47.197  1.00 33.74  ? 541  SER B OG    1 
ATOM   9015  N N     . GLU B 1 542 ? -38.127 53.956  49.099  1.00 38.36  ? 542  GLU B N     1 
ATOM   9016  C CA    . GLU B 1 542 ? -38.869 55.208  49.255  1.00 39.83  ? 542  GLU B CA    1 
ATOM   9017  C C     . GLU B 1 542 ? -39.135 55.557  50.728  1.00 37.82  ? 542  GLU B C     1 
ATOM   9018  O O     . GLU B 1 542 ? -39.070 56.735  51.091  1.00 38.66  ? 542  GLU B O     1 
ATOM   9019  C CB    . GLU B 1 542 ? -40.156 55.164  48.421  1.00 40.96  ? 542  GLU B CB    1 
ATOM   9020  C CG    . GLU B 1 542 ? -39.911 55.277  46.900  1.00 44.57  ? 542  GLU B CG    1 
ATOM   9021  C CD    . GLU B 1 542 ? -41.041 54.692  46.043  1.00 48.26  ? 542  GLU B CD    1 
ATOM   9022  O OE1   . GLU B 1 542 ? -41.992 54.095  46.597  1.00 56.60  ? 542  GLU B OE1   1 
ATOM   9023  O OE2   . GLU B 1 542 ? -40.967 54.831  44.796  1.00 61.55  ? 542  GLU B OE2   1 
ATOM   9024  N N     . ASN B 1 543 ? -39.392 54.551  51.562  1.00 35.17  ? 543  ASN B N     1 
ATOM   9025  C CA    . ASN B 1 543 ? -39.433 54.731  53.023  1.00 34.92  ? 543  ASN B CA    1 
ATOM   9026  C C     . ASN B 1 543 ? -38.160 55.359  53.572  1.00 33.05  ? 543  ASN B C     1 
ATOM   9027  O O     . ASN B 1 543 ? -38.223 56.330  54.306  1.00 32.10  ? 543  ASN B O     1 
ATOM   9028  C CB    . ASN B 1 543 ? -39.674 53.401  53.755  1.00 35.62  ? 543  ASN B CB    1 
ATOM   9029  C CG    . ASN B 1 543 ? -41.055 52.804  53.504  1.00 39.66  ? 543  ASN B CG    1 
ATOM   9030  O OD1   . ASN B 1 543 ? -41.268 51.628  53.835  1.00 42.75  ? 543  ASN B OD1   1 
ATOM   9031  N ND2   . ASN B 1 543 ? -41.986 53.583  52.912  1.00 26.15  ? 543  ASN B ND2   1 
ATOM   9032  N N     . PHE B 1 544 ? -37.014 54.778  53.237  1.00 33.09  ? 544  PHE B N     1 
ATOM   9033  C CA    . PHE B 1 544 ? -35.725 55.303  53.705  1.00 33.10  ? 544  PHE B CA    1 
ATOM   9034  C C     . PHE B 1 544 ? -35.462 56.697  53.196  1.00 32.63  ? 544  PHE B C     1 
ATOM   9035  O O     . PHE B 1 544 ? -34.980 57.537  53.950  1.00 31.44  ? 544  PHE B O     1 
ATOM   9036  C CB    . PHE B 1 544 ? -34.563 54.341  53.379  1.00 31.03  ? 544  PHE B CB    1 
ATOM   9037  C CG    . PHE B 1 544 ? -34.492 53.194  54.324  1.00 28.17  ? 544  PHE B CG    1 
ATOM   9038  C CD1   . PHE B 1 544 ? -35.303 52.067  54.140  1.00 26.08  ? 544  PHE B CD1   1 
ATOM   9039  C CD2   . PHE B 1 544 ? -33.689 53.268  55.457  1.00 32.38  ? 544  PHE B CD2   1 
ATOM   9040  C CE1   . PHE B 1 544 ? -35.268 51.007  55.053  1.00 31.73  ? 544  PHE B CE1   1 
ATOM   9041  C CE2   . PHE B 1 544 ? -33.651 52.227  56.386  1.00 31.53  ? 544  PHE B CE2   1 
ATOM   9042  C CZ    . PHE B 1 544 ? -34.450 51.084  56.181  1.00 29.62  ? 544  PHE B CZ    1 
ATOM   9043  N N     . GLN B 1 545 ? -35.791 56.948  51.933  1.00 33.88  ? 545  GLN B N     1 
ATOM   9044  C CA    . GLN B 1 545 ? -35.525 58.247  51.319  1.00 36.14  ? 545  GLN B CA    1 
ATOM   9045  C C     . GLN B 1 545 ? -36.305 59.377  51.983  1.00 34.55  ? 545  GLN B C     1 
ATOM   9046  O O     . GLN B 1 545 ? -35.793 60.470  52.138  1.00 34.55  ? 545  GLN B O     1 
ATOM   9047  C CB    . GLN B 1 545 ? -35.846 58.265  49.795  1.00 36.26  ? 545  GLN B CB    1 
ATOM   9048  C CG    . GLN B 1 545 ? -35.999 59.726  49.256  1.00 39.31  ? 545  GLN B CG    1 
ATOM   9049  C CD    . GLN B 1 545 ? -36.079 59.876  47.749  1.00 43.94  ? 545  GLN B CD    1 
ATOM   9050  O OE1   . GLN B 1 545 ? -36.677 59.067  47.067  1.00 45.84  ? 545  GLN B OE1   1 
ATOM   9051  N NE2   . GLN B 1 545 ? -35.505 60.965  47.236  1.00 52.40  ? 545  GLN B NE2   1 
ATOM   9052  N N     . GLU B 1 546 ? -37.551 59.100  52.340  1.00 34.89  ? 546  GLU B N     1 
ATOM   9053  C CA    . GLU B 1 546 ? -38.410 60.092  52.918  1.00 38.09  ? 546  GLU B CA    1 
ATOM   9054  C C     . GLU B 1 546 ? -38.027 60.335  54.381  1.00 36.74  ? 546  GLU B C     1 
ATOM   9055  O O     . GLU B 1 546 ? -38.138 61.466  54.864  1.00 37.22  ? 546  GLU B O     1 
ATOM   9056  C CB    . GLU B 1 546 ? -39.883 59.701  52.707  1.00 37.22  ? 546  GLU B CB    1 
ATOM   9057  C CG    . GLU B 1 546 ? -40.364 58.540  53.555  1.00 45.73  ? 546  GLU B CG    1 
ATOM   9058  C CD    . GLU B 1 546 ? -41.753 58.005  53.176  1.00 47.82  ? 546  GLU B CD    1 
ATOM   9059  O OE1   . GLU B 1 546 ? -42.137 58.084  51.965  1.00 53.17  ? 546  GLU B OE1   1 
ATOM   9060  O OE2   . GLU B 1 546 ? -42.434 57.473  54.106  1.00 55.33  ? 546  GLU B OE2   1 
ATOM   9061  N N     . PHE B 1 547 ? -37.539 59.292  55.046  1.00 34.85  ? 547  PHE B N     1 
ATOM   9062  C CA    . PHE B 1 547 ? -36.946 59.384  56.389  1.00 34.57  ? 547  PHE B CA    1 
ATOM   9063  C C     . PHE B 1 547 ? -35.776 60.332  56.423  1.00 33.61  ? 547  PHE B C     1 
ATOM   9064  O O     . PHE B 1 547 ? -35.700 61.167  57.296  1.00 32.99  ? 547  PHE B O     1 
ATOM   9065  C CB    . PHE B 1 547 ? -36.522 57.985  56.836  1.00 32.29  ? 547  PHE B CB    1 
ATOM   9066  C CG    . PHE B 1 547 ? -35.723 57.966  58.092  1.00 32.44  ? 547  PHE B CG    1 
ATOM   9067  C CD1   . PHE B 1 547 ? -36.232 58.510  59.260  1.00 25.14  ? 547  PHE B CD1   1 
ATOM   9068  C CD2   . PHE B 1 547 ? -34.459 57.392  58.111  1.00 32.92  ? 547  PHE B CD2   1 
ATOM   9069  C CE1   . PHE B 1 547 ? -35.486 58.489  60.443  1.00 29.51  ? 547  PHE B CE1   1 
ATOM   9070  C CE2   . PHE B 1 547 ? -33.701 57.365  59.298  1.00 34.58  ? 547  PHE B CE2   1 
ATOM   9071  C CZ    . PHE B 1 547 ? -34.220 57.919  60.460  1.00 29.14  ? 547  PHE B CZ    1 
ATOM   9072  N N     . LEU B 1 548 ? -34.884 60.207  55.449  1.00 34.59  ? 548  LEU B N     1 
ATOM   9073  C CA    . LEU B 1 548 ? -33.699 61.053  55.348  1.00 36.49  ? 548  LEU B CA    1 
ATOM   9074  C C     . LEU B 1 548 ? -34.020 62.485  54.969  1.00 37.91  ? 548  LEU B C     1 
ATOM   9075  O O     . LEU B 1 548 ? -33.402 63.416  55.475  1.00 36.00  ? 548  LEU B O     1 
ATOM   9076  C CB    . LEU B 1 548 ? -32.705 60.511  54.312  1.00 35.58  ? 548  LEU B CB    1 
ATOM   9077  C CG    . LEU B 1 548 ? -32.087 59.147  54.586  1.00 38.92  ? 548  LEU B CG    1 
ATOM   9078  C CD1   . LEU B 1 548 ? -31.339 58.690  53.359  1.00 38.01  ? 548  LEU B CD1   1 
ATOM   9079  C CD2   . LEU B 1 548 ? -31.166 59.163  55.814  1.00 42.47  ? 548  LEU B CD2   1 
ATOM   9080  N N     . SER B 1 549 ? -34.979 62.653  54.059  1.00 39.41  ? 549  SER B N     1 
ATOM   9081  C CA    . SER B 1 549 ? -35.380 63.987  53.615  1.00 39.87  ? 549  SER B CA    1 
ATOM   9082  C C     . SER B 1 549 ? -36.020 64.763  54.747  1.00 39.76  ? 549  SER B C     1 
ATOM   9083  O O     . SER B 1 549 ? -35.704 65.939  54.942  1.00 41.57  ? 549  SER B O     1 
ATOM   9084  C CB    . SER B 1 549 ? -36.378 63.926  52.448  1.00 38.96  ? 549  SER B CB    1 
ATOM   9085  O OG    . SER B 1 549 ? -35.850 63.165  51.398  1.00 46.72  ? 549  SER B OG    1 
ATOM   9086  N N     . LEU B 1 550 ? -36.919 64.096  55.471  1.00 37.88  ? 550  LEU B N     1 
ATOM   9087  C CA    . LEU B 1 550 ? -37.586 64.690  56.623  1.00 36.28  ? 550  LEU B CA    1 
ATOM   9088  C C     . LEU B 1 550 ? -36.557 65.184  57.674  1.00 35.16  ? 550  LEU B C     1 
ATOM   9089  O O     . LEU B 1 550 ? -36.677 66.291  58.220  1.00 34.42  ? 550  LEU B O     1 
ATOM   9090  C CB    . LEU B 1 550 ? -38.570 63.674  57.218  1.00 35.02  ? 550  LEU B CB    1 
ATOM   9091  C CG    . LEU B 1 550 ? -39.460 64.094  58.378  1.00 41.69  ? 550  LEU B CG    1 
ATOM   9092  C CD1   . LEU B 1 550 ? -40.586 63.072  58.543  1.00 50.05  ? 550  LEU B CD1   1 
ATOM   9093  C CD2   . LEU B 1 550 ? -38.705 64.198  59.693  1.00 50.34  ? 550  LEU B CD2   1 
ATOM   9094  N N     . ASN B 1 551 ? -35.539 64.366  57.927  1.00 32.61  ? 551  ASN B N     1 
ATOM   9095  C CA    . ASN B 1 551 ? -34.599 64.604  59.004  1.00 32.52  ? 551  ASN B CA    1 
ATOM   9096  C C     . ASN B 1 551 ? -33.304 65.174  58.512  1.00 33.15  ? 551  ASN B C     1 
ATOM   9097  O O     . ASN B 1 551 ? -32.332 65.226  59.244  1.00 33.37  ? 551  ASN B O     1 
ATOM   9098  C CB    . ASN B 1 551 ? -34.373 63.297  59.747  1.00 31.90  ? 551  ASN B CB    1 
ATOM   9099  C CG    . ASN B 1 551 ? -35.599 62.894  60.502  1.00 29.63  ? 551  ASN B CG    1 
ATOM   9100  O OD1   . ASN B 1 551 ? -36.047 63.645  61.364  1.00 31.99  ? 551  ASN B OD1   1 
ATOM   9101  N ND2   . ASN B 1 551 ? -36.201 61.763  60.143  1.00 24.28  ? 551  ASN B ND2   1 
ATOM   9102  N N     . GLY B 1 552 ? -33.306 65.632  57.266  1.00 34.96  ? 552  GLY B N     1 
ATOM   9103  C CA    . GLY B 1 552 ? -32.089 66.010  56.549  1.00 33.60  ? 552  GLY B CA    1 
ATOM   9104  C C     . GLY B 1 552 ? -31.302 67.137  57.184  1.00 34.35  ? 552  GLY B C     1 
ATOM   9105  O O     . GLY B 1 552 ? -30.072 67.170  57.129  1.00 33.07  ? 552  GLY B O     1 
ATOM   9106  N N     . HIS B 1 553 ? -32.025 68.054  57.806  1.00 35.07  ? 553  HIS B N     1 
ATOM   9107  C CA    . HIS B 1 553 ? -31.432 69.187  58.537  1.00 34.38  ? 553  HIS B CA    1 
ATOM   9108  C C     . HIS B 1 553 ? -30.770 68.801  59.861  1.00 34.32  ? 553  HIS B C     1 
ATOM   9109  O O     . HIS B 1 553 ? -30.046 69.601  60.432  1.00 35.57  ? 553  HIS B O     1 
ATOM   9110  C CB    . HIS B 1 553 ? -32.499 70.268  58.789  1.00 34.05  ? 553  HIS B CB    1 
ATOM   9111  C CG    . HIS B 1 553 ? -33.726 69.753  59.481  1.00 35.80  ? 553  HIS B CG    1 
ATOM   9112  N ND1   . HIS B 1 553 ? -34.105 70.173  60.739  1.00 33.64  ? 553  HIS B ND1   1 
ATOM   9113  C CD2   . HIS B 1 553 ? -34.651 68.840  59.093  1.00 33.54  ? 553  HIS B CD2   1 
ATOM   9114  C CE1   . HIS B 1 553 ? -35.215 69.544  61.088  1.00 39.42  ? 553  HIS B CE1   1 
ATOM   9115  N NE2   . HIS B 1 553 ? -35.560 68.726  60.110  1.00 36.59  ? 553  HIS B NE2   1 
ATOM   9116  N N     . LEU B 1 554 ? -31.024 67.589  60.348  1.00 33.35  ? 554  LEU B N     1 
ATOM   9117  C CA    . LEU B 1 554 ? -30.468 67.116  61.605  1.00 32.44  ? 554  LEU B CA    1 
ATOM   9118  C C     . LEU B 1 554 ? -29.233 66.246  61.415  1.00 30.46  ? 554  LEU B C     1 
ATOM   9119  O O     . LEU B 1 554 ? -28.357 66.203  62.281  1.00 28.02  ? 554  LEU B O     1 
ATOM   9120  C CB    . LEU B 1 554 ? -31.551 66.309  62.343  1.00 32.73  ? 554  LEU B CB    1 
ATOM   9121  C CG    . LEU B 1 554 ? -32.839 67.038  62.726  1.00 34.90  ? 554  LEU B CG    1 
ATOM   9122  C CD1   . LEU B 1 554 ? -33.747 66.095  63.454  1.00 31.89  ? 554  LEU B CD1   1 
ATOM   9123  C CD2   . LEU B 1 554 ? -32.577 68.269  63.585  1.00 39.91  ? 554  LEU B CD2   1 
ATOM   9124  N N     . LEU B 1 555 ? -29.192 65.518  60.298  1.00 31.18  ? 555  LEU B N     1 
ATOM   9125  C CA    . LEU B 1 555 ? -28.246 64.421  60.118  1.00 31.36  ? 555  LEU B CA    1 
ATOM   9126  C C     . LEU B 1 555 ? -26.851 64.945  59.834  1.00 30.97  ? 555  LEU B C     1 
ATOM   9127  O O     . LEU B 1 555 ? -26.670 65.841  59.005  1.00 29.34  ? 555  LEU B O     1 
ATOM   9128  C CB    . LEU B 1 555 ? -28.737 63.466  59.024  1.00 32.02  ? 555  LEU B CB    1 
ATOM   9129  C CG    . LEU B 1 555 ? -30.021 62.704  59.386  1.00 27.43  ? 555  LEU B CG    1 
ATOM   9130  C CD1   . LEU B 1 555 ? -30.618 62.132  58.124  1.00 31.32  ? 555  LEU B CD1   1 
ATOM   9131  C CD2   . LEU B 1 555 ? -29.757 61.611  60.424  1.00 28.59  ? 555  LEU B CD2   1 
ATOM   9132  N N     . GLY B 1 556 ? -25.886 64.418  60.589  1.00 32.09  ? 556  GLY B N     1 
ATOM   9133  C CA    . GLY B 1 556 ? -24.492 64.820  60.464  1.00 33.95  ? 556  GLY B CA    1 
ATOM   9134  C C     . GLY B 1 556 ? -24.147 66.102  61.202  1.00 34.94  ? 556  GLY B C     1 
ATOM   9135  O O     . GLY B 1 556 ? -23.047 66.624  61.066  1.00 31.93  ? 556  GLY B O     1 
ATOM   9136  N N     . ARG B 1 557 ? -25.097 66.609  61.981  1.00 38.60  ? 557  ARG B N     1 
ATOM   9137  C CA    . ARG B 1 557 ? -24.863 67.815  62.786  1.00 40.75  ? 557  ARG B CA    1 
ATOM   9138  C C     . ARG B 1 557 ? -24.668 67.475  64.244  1.00 41.21  ? 557  ARG B C     1 
ATOM   9139  O O     . ARG B 1 557 ? -25.512 66.862  64.854  1.00 41.13  ? 557  ARG B O     1 
ATOM   9140  C CB    . ARG B 1 557 ? -25.979 68.838  62.599  1.00 40.88  ? 557  ARG B CB    1 
ATOM   9141  C CG    . ARG B 1 557 ? -25.681 69.708  61.413  1.00 42.66  ? 557  ARG B CG    1 
ATOM   9142  C CD    . ARG B 1 557 ? -26.871 70.404  60.814  1.00 46.55  ? 557  ARG B CD    1 
ATOM   9143  N NE    . ARG B 1 557 ? -26.569 70.720  59.414  1.00 57.82  ? 557  ARG B NE    1 
ATOM   9144  C CZ    . ARG B 1 557 ? -27.340 71.432  58.597  1.00 65.05  ? 557  ARG B CZ    1 
ATOM   9145  N NH1   . ARG B 1 557 ? -28.489 71.961  59.018  1.00 72.12  ? 557  ARG B NH1   1 
ATOM   9146  N NH2   . ARG B 1 557 ? -26.949 71.622  57.345  1.00 65.13  ? 557  ARG B NH2   1 
ATOM   9147  N N     . GLN B 1 558 ? -23.508 67.853  64.760  1.00 41.88  ? 558  GLN B N     1 
ATOM   9148  C CA    . GLN B 1 558 ? -23.137 67.624  66.141  1.00 43.52  ? 558  GLN B CA    1 
ATOM   9149  C C     . GLN B 1 558 ? -23.945 68.597  66.993  1.00 43.30  ? 558  GLN B C     1 
ATOM   9150  O O     . GLN B 1 558 ? -24.088 69.755  66.613  1.00 43.73  ? 558  GLN B O     1 
ATOM   9151  C CB    . GLN B 1 558 ? -21.658 67.935  66.312  1.00 44.18  ? 558  GLN B CB    1 
ATOM   9152  C CG    . GLN B 1 558 ? -20.990 67.170  67.396  1.00 50.57  ? 558  GLN B CG    1 
ATOM   9153  C CD    . GLN B 1 558 ? -20.273 65.951  66.888  1.00 54.71  ? 558  GLN B CD    1 
ATOM   9154  O OE1   . GLN B 1 558 ? -20.426 64.861  67.436  1.00 62.03  ? 558  GLN B OE1   1 
ATOM   9155  N NE2   . GLN B 1 558 ? -19.473 66.125  65.848  1.00 53.87  ? 558  GLN B NE2   1 
ATOM   9156  N N     . PRO B 1 559 ? -24.499 68.143  68.133  1.00 41.73  ? 559  PRO B N     1 
ATOM   9157  C CA    . PRO B 1 559 ? -24.536 66.793  68.685  1.00 39.46  ? 559  PRO B CA    1 
ATOM   9158  C C     . PRO B 1 559 ? -25.451 65.911  67.850  1.00 37.44  ? 559  PRO B C     1 
ATOM   9159  O O     . PRO B 1 559 ? -26.543 66.310  67.476  1.00 36.66  ? 559  PRO B O     1 
ATOM   9160  C CB    . PRO B 1 559 ? -25.113 67.011  70.090  1.00 41.62  ? 559  PRO B CB    1 
ATOM   9161  C CG    . PRO B 1 559 ? -25.933 68.228  69.976  1.00 41.95  ? 559  PRO B CG    1 
ATOM   9162  C CD    . PRO B 1 559 ? -25.195 69.104  69.015  1.00 43.40  ? 559  PRO B CD    1 
ATOM   9163  N N     . PHE B 1 560 ? -24.983 64.719  67.540  1.00 36.65  ? 560  PHE B N     1 
ATOM   9164  C CA    . PHE B 1 560 ? -25.620 63.887  66.540  1.00 33.78  ? 560  PHE B CA    1 
ATOM   9165  C C     . PHE B 1 560 ? -26.985 63.376  67.008  1.00 32.98  ? 560  PHE B C     1 
ATOM   9166  O O     . PHE B 1 560 ? -27.102 62.923  68.139  1.00 32.06  ? 560  PHE B O     1 
ATOM   9167  C CB    . PHE B 1 560 ? -24.711 62.711  66.236  1.00 32.49  ? 560  PHE B CB    1 
ATOM   9168  C CG    . PHE B 1 560 ? -23.469 63.072  65.476  1.00 31.44  ? 560  PHE B CG    1 
ATOM   9169  C CD1   . PHE B 1 560 ? -23.520 63.905  64.366  1.00 32.04  ? 560  PHE B CD1   1 
ATOM   9170  C CD2   . PHE B 1 560 ? -22.252 62.510  65.829  1.00 34.14  ? 560  PHE B CD2   1 
ATOM   9171  C CE1   . PHE B 1 560 ? -22.373 64.193  63.649  1.00 30.56  ? 560  PHE B CE1   1 
ATOM   9172  C CE2   . PHE B 1 560 ? -21.112 62.797  65.119  1.00 36.30  ? 560  PHE B CE2   1 
ATOM   9173  C CZ    . PHE B 1 560 ? -21.171 63.645  64.027  1.00 31.60  ? 560  PHE B CZ    1 
ATOM   9174  N N     . PRO B 1 561 ? -28.016 63.410  66.118  1.00 31.58  ? 561  PRO B N     1 
ATOM   9175  C CA    . PRO B 1 561 ? -29.317 62.890  66.517  1.00 29.59  ? 561  PRO B CA    1 
ATOM   9176  C C     . PRO B 1 561 ? -29.300 61.373  66.780  1.00 28.73  ? 561  PRO B C     1 
ATOM   9177  O O     . PRO B 1 561 ? -28.436 60.654  66.264  1.00 28.21  ? 561  PRO B O     1 
ATOM   9178  C CB    . PRO B 1 561 ? -30.216 63.223  65.319  1.00 31.80  ? 561  PRO B CB    1 
ATOM   9179  C CG    . PRO B 1 561 ? -29.289 63.364  64.144  1.00 30.71  ? 561  PRO B CG    1 
ATOM   9180  C CD    . PRO B 1 561 ? -28.010 63.893  64.720  1.00 31.51  ? 561  PRO B CD    1 
ATOM   9181  N N     . ASN B 1 562 ? -30.219 60.931  67.628  1.00 27.38  ? 562  ASN B N     1 
ATOM   9182  C CA    . ASN B 1 562 ? -30.431 59.527  67.912  1.00 26.25  ? 562  ASN B CA    1 
ATOM   9183  C C     . ASN B 1 562 ? -31.258 59.009  66.787  1.00 25.51  ? 562  ASN B C     1 
ATOM   9184  O O     . ASN B 1 562 ? -32.427 59.367  66.656  1.00 23.74  ? 562  ASN B O     1 
ATOM   9185  C CB    . ASN B 1 562 ? -31.174 59.387  69.224  1.00 24.97  ? 562  ASN B CB    1 
ATOM   9186  C CG    . ASN B 1 562 ? -31.376 57.965  69.645  1.00 19.61  ? 562  ASN B CG    1 
ATOM   9187  O OD1   . ASN B 1 562 ? -31.346 57.045  68.863  1.00 19.74  ? 562  ASN B OD1   1 
ATOM   9188  N ND2   . ASN B 1 562 ? -31.618 57.786  70.917  1.00 29.36  ? 562  ASN B ND2   1 
ATOM   9189  N N     . ILE B 1 563 ? -30.635 58.192  65.954  1.00 26.08  ? 563  ILE B N     1 
ATOM   9190  C CA    . ILE B 1 563 ? -31.258 57.701  64.741  1.00 27.78  ? 563  ILE B CA    1 
ATOM   9191  C C     . ILE B 1 563 ? -32.372 56.699  64.986  1.00 25.74  ? 563  ILE B C     1 
ATOM   9192  O O     . ILE B 1 563 ? -33.294 56.662  64.201  1.00 21.66  ? 563  ILE B O     1 
ATOM   9193  C CB    . ILE B 1 563 ? -30.195 57.211  63.747  1.00 28.41  ? 563  ILE B CB    1 
ATOM   9194  C CG1   . ILE B 1 563 ? -29.601 58.474  63.095  1.00 37.57  ? 563  ILE B CG1   1 
ATOM   9195  C CG2   . ILE B 1 563 ? -30.775 56.341  62.680  1.00 30.70  ? 563  ILE B CG2   1 
ATOM   9196  C CD1   . ILE B 1 563 ? -28.342 58.282  62.409  1.00 39.39  ? 563  ILE B CD1   1 
ATOM   9197  N N     . VAL B 1 564 ? -32.288 55.940  66.084  1.00 25.70  ? 564  VAL B N     1 
ATOM   9198  C CA    . VAL B 1 564 ? -33.375 55.036  66.505  1.00 25.30  ? 564  VAL B CA    1 
ATOM   9199  C C     . VAL B 1 564 ? -34.611 55.837  66.952  1.00 23.20  ? 564  VAL B C     1 
ATOM   9200  O O     . VAL B 1 564 ? -35.706 55.515  66.545  1.00 26.60  ? 564  VAL B O     1 
ATOM   9201  C CB    . VAL B 1 564 ? -32.880 54.076  67.585  1.00 25.86  ? 564  VAL B CB    1 
ATOM   9202  C CG1   . VAL B 1 564 ? -34.041 53.321  68.260  1.00 26.25  ? 564  VAL B CG1   1 
ATOM   9203  C CG2   . VAL B 1 564 ? -31.852 53.146  66.981  1.00 21.83  ? 564  VAL B CG2   1 
ATOM   9204  N N     . GLN B 1 565 ? -34.423 56.877  67.761  1.00 19.82  ? 565  GLN B N     1 
ATOM   9205  C CA    . GLN B 1 565 ? -35.501 57.785  68.150  1.00 22.18  ? 565  GLN B CA    1 
ATOM   9206  C C     . GLN B 1 565 ? -36.216 58.403  66.943  1.00 21.98  ? 565  GLN B C     1 
ATOM   9207  O O     . GLN B 1 565 ? -37.451 58.414  66.882  1.00 23.09  ? 565  GLN B O     1 
ATOM   9208  C CB    . GLN B 1 565 ? -34.931 58.890  69.058  1.00 20.64  ? 565  GLN B CB    1 
ATOM   9209  C CG    . GLN B 1 565 ? -35.939 59.882  69.598  1.00 17.96  ? 565  GLN B CG    1 
ATOM   9210  C CD    . GLN B 1 565 ? -37.121 59.269  70.337  1.00 23.37  ? 565  GLN B CD    1 
ATOM   9211  O OE1   . GLN B 1 565 ? -37.031 58.185  70.926  1.00 20.31  ? 565  GLN B OE1   1 
ATOM   9212  N NE2   . GLN B 1 565 ? -38.240 60.002  70.351  1.00 22.29  ? 565  GLN B NE2   1 
ATOM   9213  N N     . LEU B 1 566 ? -35.424 58.897  65.996  1.00 22.29  ? 566  LEU B N     1 
ATOM   9214  C CA    . LEU B 1 566 ? -35.944 59.456  64.745  1.00 23.79  ? 566  LEU B CA    1 
ATOM   9215  C C     . LEU B 1 566 ? -36.724 58.443  63.905  1.00 23.54  ? 566  LEU B C     1 
ATOM   9216  O O     . LEU B 1 566 ? -37.772 58.747  63.347  1.00 24.04  ? 566  LEU B O     1 
ATOM   9217  C CB    . LEU B 1 566 ? -34.829 60.053  63.872  1.00 20.94  ? 566  LEU B CB    1 
ATOM   9218  C CG    . LEU B 1 566 ? -34.046 61.287  64.354  1.00 26.99  ? 566  LEU B CG    1 
ATOM   9219  C CD1   . LEU B 1 566 ? -32.967 61.597  63.337  1.00 22.76  ? 566  LEU B CD1   1 
ATOM   9220  C CD2   . LEU B 1 566 ? -34.899 62.518  64.599  1.00 29.58  ? 566  LEU B CD2   1 
ATOM   9221  N N     . GLY B 1 567 ? -36.224 57.227  63.832  1.00 24.54  ? 567  GLY B N     1 
ATOM   9222  C CA    . GLY B 1 567 ? -36.930 56.173  63.107  1.00 24.67  ? 567  GLY B CA    1 
ATOM   9223  C C     . GLY B 1 567 ? -38.221 55.736  63.776  1.00 23.78  ? 567  GLY B C     1 
ATOM   9224  O O     . GLY B 1 567 ? -39.144 55.241  63.089  1.00 23.74  ? 567  GLY B O     1 
ATOM   9225  N N     . LEU B 1 568 ? -38.292 55.864  65.099  1.00 23.87  ? 568  LEU B N     1 
ATOM   9226  C CA    . LEU B 1 568 ? -39.533 55.524  65.838  1.00 24.35  ? 568  LEU B CA    1 
ATOM   9227  C C     . LEU B 1 568 ? -40.648 56.535  65.593  1.00 24.65  ? 568  LEU B C     1 
ATOM   9228  O O     . LEU B 1 568 ? -41.786 56.309  65.979  1.00 23.62  ? 568  LEU B O     1 
ATOM   9229  C CB    . LEU B 1 568 ? -39.266 55.424  67.331  1.00 23.41  ? 568  LEU B CB    1 
ATOM   9230  C CG    . LEU B 1 568 ? -38.500 54.170  67.723  1.00 26.42  ? 568  LEU B CG    1 
ATOM   9231  C CD1   . LEU B 1 568 ? -38.068 54.283  69.168  1.00 23.13  ? 568  LEU B CD1   1 
ATOM   9232  C CD2   . LEU B 1 568 ? -39.317 52.921  67.449  1.00 27.78  ? 568  LEU B CD2   1 
ATOM   9233  N N     . CYS B 1 569 ? -40.299 57.649  64.950  1.00 27.26  ? 569  CYS B N     1 
ATOM   9234  C CA    . CYS B 1 569 ? -41.255 58.667  64.532  1.00 28.81  ? 569  CYS B CA    1 
ATOM   9235  C C     . CYS B 1 569 ? -41.799 58.427  63.135  1.00 31.96  ? 569  CYS B C     1 
ATOM   9236  O O     . CYS B 1 569 ? -42.681 59.158  62.698  1.00 34.37  ? 569  CYS B O     1 
ATOM   9237  C CB    . CYS B 1 569 ? -40.618 60.061  64.545  1.00 27.49  ? 569  CYS B CB    1 
ATOM   9238  S SG    . CYS B 1 569 ? -40.087 60.565  66.127  1.00 27.95  ? 569  CYS B SG    1 
ATOM   9239  N N     . GLU B 1 570 ? -41.274 57.425  62.435  1.00 31.87  ? 570  GLU B N     1 
ATOM   9240  C CA    . GLU B 1 570 ? -41.783 57.099  61.116  1.00 32.85  ? 570  GLU B CA    1 
ATOM   9241  C C     . GLU B 1 570 ? -43.098 56.303  61.260  1.00 32.36  ? 570  GLU B C     1 
ATOM   9242  O O     . GLU B 1 570 ? -43.361 55.744  62.314  1.00 29.81  ? 570  GLU B O     1 
ATOM   9243  C CB    . GLU B 1 570 ? -40.741 56.335  60.281  1.00 32.46  ? 570  GLU B CB    1 
ATOM   9244  C CG    . GLU B 1 570 ? -39.570 57.159  59.829  1.00 33.00  ? 570  GLU B CG    1 
ATOM   9245  C CD    . GLU B 1 570 ? -39.987 58.385  59.019  1.00 42.65  ? 570  GLU B CD    1 
ATOM   9246  O OE1   . GLU B 1 570 ? -40.283 58.249  57.798  1.00 41.63  ? 570  GLU B OE1   1 
ATOM   9247  O OE2   . GLU B 1 570 ? -40.008 59.492  59.623  1.00 41.18  ? 570  GLU B OE2   1 
ATOM   9248  N N     . PRO B 1 571 ? -43.942 56.288  60.206  1.00 34.86  ? 571  PRO B N     1 
ATOM   9249  C CA    . PRO B 1 571 ? -45.150 55.465  60.244  1.00 36.49  ? 571  PRO B CA    1 
ATOM   9250  C C     . PRO B 1 571 ? -44.853 53.980  60.496  1.00 37.64  ? 571  PRO B C     1 
ATOM   9251  O O     . PRO B 1 571 ? -43.863 53.447  60.009  1.00 39.03  ? 571  PRO B O     1 
ATOM   9252  C CB    . PRO B 1 571 ? -45.773 55.681  58.860  1.00 36.90  ? 571  PRO B CB    1 
ATOM   9253  C CG    . PRO B 1 571 ? -45.180 56.906  58.350  1.00 37.23  ? 571  PRO B CG    1 
ATOM   9254  C CD    . PRO B 1 571 ? -43.836 57.043  58.947  1.00 32.62  ? 571  PRO B CD    1 
ATOM   9255  N N     . GLU B 1 572 ? -45.720 53.328  61.253  1.00 38.52  ? 572  GLU B N     1 
ATOM   9256  C CA    . GLU B 1 572 ? -45.511 51.945  61.692  1.00 40.43  ? 572  GLU B CA    1 
ATOM   9257  C C     . GLU B 1 572 ? -45.439 50.934  60.520  1.00 40.91  ? 572  GLU B C     1 
ATOM   9258  O O     . GLU B 1 572 ? -44.965 49.797  60.663  1.00 41.59  ? 572  GLU B O     1 
ATOM   9259  C CB    . GLU B 1 572 ? -46.643 51.559  62.654  1.00 40.88  ? 572  GLU B CB    1 
ATOM   9260  C CG    . GLU B 1 572 ? -46.199 50.810  63.880  1.00 44.57  ? 572  GLU B CG    1 
ATOM   9261  C CD    . GLU B 1 572 ? -47.283 49.905  64.419  1.00 48.47  ? 572  GLU B CD    1 
ATOM   9262  O OE1   . GLU B 1 572 ? -48.308 50.421  64.937  1.00 56.59  ? 572  GLU B OE1   1 
ATOM   9263  O OE2   . GLU B 1 572 ? -47.110 48.665  64.292  1.00 62.33  ? 572  GLU B OE2   1 
ATOM   9264  N N     . THR B 1 573 ? -45.924 51.353  59.361  1.00 41.35  ? 573  THR B N     1 
ATOM   9265  C CA    . THR B 1 573 ? -45.840 50.559  58.141  1.00 41.04  ? 573  THR B CA    1 
ATOM   9266  C C     . THR B 1 573 ? -44.438 50.614  57.528  1.00 41.85  ? 573  THR B C     1 
ATOM   9267  O O     . THR B 1 573 ? -44.049 49.701  56.794  1.00 44.19  ? 573  THR B O     1 
ATOM   9268  C CB    . THR B 1 573 ? -46.878 51.058  57.078  1.00 42.63  ? 573  THR B CB    1 
ATOM   9269  O OG1   . THR B 1 573 ? -46.792 52.489  56.917  1.00 46.17  ? 573  THR B OG1   1 
ATOM   9270  C CG2   . THR B 1 573 ? -48.306 50.696  57.490  1.00 42.83  ? 573  THR B CG2   1 
ATOM   9271  N N     . SER B 1 574 ? -43.691 51.680  57.841  1.00 39.85  ? 574  SER B N     1 
ATOM   9272  C CA    . SER B 1 574 ? -42.338 51.924  57.324  1.00 36.09  ? 574  SER B CA    1 
ATOM   9273  C C     . SER B 1 574 ? -41.328 50.914  57.887  1.00 34.95  ? 574  SER B C     1 
ATOM   9274  O O     . SER B 1 574 ? -41.322 50.601  59.077  1.00 34.20  ? 574  SER B O     1 
ATOM   9275  C CB    . SER B 1 574 ? -41.936 53.374  57.661  1.00 32.98  ? 574  SER B CB    1 
ATOM   9276  O OG    . SER B 1 574 ? -40.802 53.849  56.960  1.00 34.79  ? 574  SER B OG    1 
ATOM   9277  N N     . GLU B 1 575 ? -40.459 50.422  57.011  1.00 35.18  ? 575  GLU B N     1 
ATOM   9278  C CA    . GLU B 1 575 ? -39.362 49.528  57.386  1.00 33.52  ? 575  GLU B CA    1 
ATOM   9279  C C     . GLU B 1 575 ? -38.344 50.242  58.279  1.00 30.06  ? 575  GLU B C     1 
ATOM   9280  O O     . GLU B 1 575 ? -37.618 49.600  59.014  1.00 30.37  ? 575  GLU B O     1 
ATOM   9281  C CB    . GLU B 1 575 ? -38.681 48.977  56.125  1.00 33.73  ? 575  GLU B CB    1 
ATOM   9282  C CG    . GLU B 1 575 ? -38.506 47.463  56.136  1.00 46.07  ? 575  GLU B CG    1 
ATOM   9283  C CD    . GLU B 1 575 ? -37.473 46.961  57.188  1.00 56.94  ? 575  GLU B CD    1 
ATOM   9284  O OE1   . GLU B 1 575 ? -36.240 47.053  56.929  1.00 53.39  ? 575  GLU B OE1   1 
ATOM   9285  O OE2   . GLU B 1 575 ? -37.907 46.445  58.254  1.00 60.11  ? 575  GLU B OE2   1 
ATOM   9286  N N     . VAL B 1 576 ? -38.294 51.568  58.198  1.00 28.51  ? 576  VAL B N     1 
ATOM   9287  C CA    . VAL B 1 576 ? -37.421 52.367  59.059  1.00 28.09  ? 576  VAL B CA    1 
ATOM   9288  C C     . VAL B 1 576 ? -37.915 52.232  60.494  1.00 27.12  ? 576  VAL B C     1 
ATOM   9289  O O     . VAL B 1 576 ? -37.146 51.926  61.402  1.00 27.29  ? 576  VAL B O     1 
ATOM   9290  C CB    . VAL B 1 576 ? -37.433 53.872  58.591  1.00 26.95  ? 576  VAL B CB    1 
ATOM   9291  C CG1   . VAL B 1 576 ? -36.603 54.749  59.495  1.00 26.57  ? 576  VAL B CG1   1 
ATOM   9292  C CG2   . VAL B 1 576 ? -36.945 54.009  57.140  1.00 23.42  ? 576  VAL B CG2   1 
ATOM   9293  N N     . TYR B 1 577 ? -39.214 52.433  60.673  1.00 27.01  ? 577  TYR B N     1 
ATOM   9294  C CA    . TYR B 1 577 ? -39.871 52.244  61.960  1.00 27.59  ? 577  TYR B CA    1 
ATOM   9295  C C     . TYR B 1 577 ? -39.662 50.858  62.541  1.00 27.37  ? 577  TYR B C     1 
ATOM   9296  O O     . TYR B 1 577 ? -39.264 50.742  63.702  1.00 26.56  ? 577  TYR B O     1 
ATOM   9297  C CB    . TYR B 1 577 ? -41.379 52.584  61.888  1.00 27.50  ? 577  TYR B CB    1 
ATOM   9298  C CG    . TYR B 1 577 ? -42.046 52.319  63.203  1.00 26.22  ? 577  TYR B CG    1 
ATOM   9299  C CD1   . TYR B 1 577 ? -42.522 51.040  63.527  1.00 25.37  ? 577  TYR B CD1   1 
ATOM   9300  C CD2   . TYR B 1 577 ? -42.132 53.316  64.161  1.00 28.80  ? 577  TYR B CD2   1 
ATOM   9301  C CE1   . TYR B 1 577 ? -43.081 50.799  64.763  1.00 25.52  ? 577  TYR B CE1   1 
ATOM   9302  C CE2   . TYR B 1 577 ? -42.691 53.085  65.385  1.00 26.78  ? 577  TYR B CE2   1 
ATOM   9303  C CZ    . TYR B 1 577 ? -43.157 51.833  65.690  1.00 24.50  ? 577  TYR B CZ    1 
ATOM   9304  O OH    . TYR B 1 577 ? -43.707 51.636  66.926  1.00 28.01  ? 577  TYR B OH    1 
ATOM   9305  N N     . GLN B 1 578 ? -39.877 49.830  61.725  1.00 29.26  ? 578  GLN B N     1 
ATOM   9306  C CA    . GLN B 1 578 ? -39.743 48.451  62.167  1.00 29.55  ? 578  GLN B CA    1 
ATOM   9307  C C     . GLN B 1 578 ? -38.314 48.135  62.573  1.00 29.13  ? 578  GLN B C     1 
ATOM   9308  O O     . GLN B 1 578 ? -38.102 47.502  63.587  1.00 30.67  ? 578  GLN B O     1 
ATOM   9309  C CB    . GLN B 1 578 ? -40.251 47.496  61.099  1.00 29.95  ? 578  GLN B CB    1 
ATOM   9310  C CG    . GLN B 1 578 ? -41.749 47.672  60.764  1.00 34.61  ? 578  GLN B CG    1 
ATOM   9311  C CD    . GLN B 1 578 ? -42.708 47.412  61.965  1.00 42.31  ? 578  GLN B CD    1 
ATOM   9312  O OE1   . GLN B 1 578 ? -42.368 46.697  62.926  1.00 43.23  ? 578  GLN B OE1   1 
ATOM   9313  N NE2   . GLN B 1 578 ? -43.909 48.009  61.902  1.00 39.23  ? 578  GLN B NE2   1 
ATOM   9314  N N     . GLN B 1 579 ? -37.336 48.617  61.803  1.00 30.51  ? 579  GLN B N     1 
ATOM   9315  C CA    . GLN B 1 579 ? -35.925 48.505  62.199  1.00 30.31  ? 579  GLN B CA    1 
ATOM   9316  C C     . GLN B 1 579 ? -35.630 49.247  63.501  1.00 30.95  ? 579  GLN B C     1 
ATOM   9317  O O     . GLN B 1 579 ? -34.967 48.711  64.398  1.00 32.05  ? 579  GLN B O     1 
ATOM   9318  C CB    . GLN B 1 579 ? -35.037 49.050  61.091  1.00 30.59  ? 579  GLN B CB    1 
ATOM   9319  C CG    . GLN B 1 579 ? -34.842 48.076  59.945  1.00 29.53  ? 579  GLN B CG    1 
ATOM   9320  C CD    . GLN B 1 579 ? -33.622 48.417  59.064  1.00 30.95  ? 579  GLN B CD    1 
ATOM   9321  O OE1   . GLN B 1 579 ? -32.669 49.055  59.512  1.00 28.40  ? 579  GLN B OE1   1 
ATOM   9322  N NE2   . GLN B 1 579 ? -33.637 47.932  57.824  1.00 26.52  ? 579  GLN B NE2   1 
ATOM   9323  N N     . ALA B 1 580 ? -36.145 50.469  63.609  1.00 30.84  ? 580  ALA B N     1 
ATOM   9324  C CA    . ALA B 1 580 ? -35.926 51.296  64.798  1.00 29.57  ? 580  ALA B CA    1 
ATOM   9325  C C     . ALA B 1 580 ? -36.521 50.641  66.036  1.00 29.29  ? 580  ALA B C     1 
ATOM   9326  O O     . ALA B 1 580 ? -35.905 50.683  67.109  1.00 28.26  ? 580  ALA B O     1 
ATOM   9327  C CB    . ALA B 1 580 ? -36.485 52.687  64.594  1.00 27.28  ? 580  ALA B CB    1 
ATOM   9328  N N     . LYS B 1 581 ? -37.685 50.012  65.876  1.00 31.23  ? 581  LYS B N     1 
ATOM   9329  C CA    . LYS B 1 581 ? -38.348 49.266  66.965  1.00 33.65  ? 581  LYS B CA    1 
ATOM   9330  C C     . LYS B 1 581 ? -37.510 48.067  67.469  1.00 35.20  ? 581  LYS B C     1 
ATOM   9331  O O     . LYS B 1 581 ? -37.454 47.816  68.669  1.00 34.29  ? 581  LYS B O     1 
ATOM   9332  C CB    . LYS B 1 581 ? -39.728 48.803  66.511  1.00 32.13  ? 581  LYS B CB    1 
ATOM   9333  C CG    . LYS B 1 581 ? -40.664 48.380  67.654  1.00 35.72  ? 581  LYS B CG    1 
ATOM   9334  C CD    . LYS B 1 581 ? -41.225 49.618  68.388  1.00 45.92  ? 581  LYS B CD    1 
ATOM   9335  C CE    . LYS B 1 581 ? -41.310 49.454  69.929  1.00 47.59  ? 581  LYS B CE    1 
ATOM   9336  N NZ    . LYS B 1 581 ? -40.829 50.672  70.706  1.00 45.80  ? 581  LYS B NZ    1 
ATOM   9337  N N     . LEU B 1 582 ? -36.870 47.341  66.552  1.00 36.69  ? 582  LEU B N     1 
ATOM   9338  C CA    . LEU B 1 582 ? -36.032 46.202  66.928  1.00 37.57  ? 582  LEU B CA    1 
ATOM   9339  C C     . LEU B 1 582 ? -34.834 46.647  67.733  1.00 37.25  ? 582  LEU B C     1 
ATOM   9340  O O     . LEU B 1 582 ? -34.515 46.053  68.763  1.00 37.54  ? 582  LEU B O     1 
ATOM   9341  C CB    . LEU B 1 582 ? -35.564 45.417  65.696  1.00 38.24  ? 582  LEU B CB    1 
ATOM   9342  C CG    . LEU B 1 582 ? -36.507 44.341  65.171  1.00 45.08  ? 582  LEU B CG    1 
ATOM   9343  C CD1   . LEU B 1 582 ? -36.047 43.807  63.819  1.00 47.52  ? 582  LEU B CD1   1 
ATOM   9344  C CD2   . LEU B 1 582 ? -36.642 43.190  66.178  1.00 49.10  ? 582  LEU B CD2   1 
ATOM   9345  N N     . GLN B 1 583 ? -34.161 47.683  67.252  1.00 38.95  ? 583  GLN B N     1 
ATOM   9346  C CA    . GLN B 1 583 ? -32.998 48.244  67.948  1.00 40.68  ? 583  GLN B CA    1 
ATOM   9347  C C     . GLN B 1 583 ? -33.318 48.752  69.333  1.00 40.47  ? 583  GLN B C     1 
ATOM   9348  O O     . GLN B 1 583 ? -32.513 48.582  70.245  1.00 41.86  ? 583  GLN B O     1 
ATOM   9349  C CB    . GLN B 1 583 ? -32.408 49.398  67.154  1.00 39.67  ? 583  GLN B CB    1 
ATOM   9350  C CG    . GLN B 1 583 ? -31.729 48.971  65.909  1.00 40.79  ? 583  GLN B CG    1 
ATOM   9351  C CD    . GLN B 1 583 ? -30.525 49.839  65.606  1.00 45.29  ? 583  GLN B CD    1 
ATOM   9352  O OE1   . GLN B 1 583 ? -29.929 50.420  66.520  1.00 50.89  ? 583  GLN B OE1   1 
ATOM   9353  N NE2   . GLN B 1 583 ? -30.153 49.928  64.328  1.00 42.03  ? 583  GLN B NE2   1 
ATOM   9354  N N     . ALA B 1 584 ? -34.473 49.392  69.484  1.00 41.05  ? 584  ALA B N     1 
ATOM   9355  C CA    . ALA B 1 584 ? -34.911 49.897  70.772  1.00 43.91  ? 584  ALA B CA    1 
ATOM   9356  C C     . ALA B 1 584 ? -34.968 48.759  71.791  1.00 47.36  ? 584  ALA B C     1 
ATOM   9357  O O     . ALA B 1 584 ? -34.355 48.840  72.860  1.00 49.19  ? 584  ALA B O     1 
ATOM   9358  C CB    . ALA B 1 584 ? -36.271 50.561  70.635  1.00 42.23  ? 584  ALA B CB    1 
ATOM   9359  N N     . LYS B 1 585 ? -35.701 47.702  71.447  1.00 50.66  ? 585  LYS B N     1 
ATOM   9360  C CA    . LYS B 1 585 ? -35.757 46.477  72.248  1.00 53.94  ? 585  LYS B CA    1 
ATOM   9361  C C     . LYS B 1 585 ? -34.374 45.862  72.509  1.00 56.23  ? 585  LYS B C     1 
ATOM   9362  O O     . LYS B 1 585 ? -34.032 45.568  73.655  1.00 55.01  ? 585  LYS B O     1 
ATOM   9363  C CB    . LYS B 1 585 ? -36.658 45.446  71.553  1.00 54.73  ? 585  LYS B CB    1 
ATOM   9364  C CG    . LYS B 1 585 ? -38.111 45.514  71.988  1.00 58.95  ? 585  LYS B CG    1 
ATOM   9365  C CD    . LYS B 1 585 ? -38.311 44.777  73.321  1.00 63.60  ? 585  LYS B CD    1 
ATOM   9366  C CE    . LYS B 1 585 ? -39.584 45.207  74.041  1.00 62.34  ? 585  LYS B CE    1 
ATOM   9367  N NZ    . LYS B 1 585 ? -40.077 44.132  74.936  1.00 60.07  ? 585  LYS B NZ    1 
ATOM   9368  N N     . GLN B 1 586 ? -33.582 45.678  71.452  1.00 60.01  ? 586  GLN B N     1 
ATOM   9369  C CA    . GLN B 1 586 ? -32.288 45.002  71.584  1.00 62.93  ? 586  GLN B CA    1 
ATOM   9370  C C     . GLN B 1 586 ? -31.275 45.855  72.372  1.00 66.50  ? 586  GLN B C     1 
ATOM   9371  O O     . GLN B 1 586 ? -30.355 45.324  72.995  1.00 68.95  ? 586  GLN B O     1 
ATOM   9372  C CB    . GLN B 1 586 ? -31.754 44.548  70.211  1.00 63.13  ? 586  GLN B CB    1 
ATOM   9373  C CG    . GLN B 1 586 ? -30.788 45.485  69.497  1.00 65.99  ? 586  GLN B CG    1 
ATOM   9374  C CD    . GLN B 1 586 ? -30.540 45.088  68.029  1.00 67.00  ? 586  GLN B CD    1 
ATOM   9375  O OE1   . GLN B 1 586 ? -29.457 45.331  67.485  1.00 73.32  ? 586  GLN B OE1   1 
ATOM   9376  N NE2   . GLN B 1 586 ? -31.547 44.486  67.388  1.00 71.42  ? 586  GLN B NE2   1 
ATOM   9377  N N     . MET C 1 1   ? 68.945  106.839 34.498  1.00 33.13  ? 1    MET C N     1 
ATOM   9378  C CA    . MET C 1 1   ? 68.332  105.544 34.110  1.00 31.11  ? 1    MET C CA    1 
ATOM   9379  C C     . MET C 1 1   ? 68.984  105.029 32.842  1.00 30.29  ? 1    MET C C     1 
ATOM   9380  O O     . MET C 1 1   ? 69.762  105.728 32.208  1.00 28.31  ? 1    MET C O     1 
ATOM   9381  C CB    . MET C 1 1   ? 66.814  105.702 33.901  1.00 31.48  ? 1    MET C CB    1 
ATOM   9382  C CG    . MET C 1 1   ? 66.423  106.642 32.762  1.00 31.63  ? 1    MET C CG    1 
ATOM   9383  S SD    . MET C 1 1   ? 64.644  106.686 32.538  1.00 28.82  ? 1    MET C SD    1 
ATOM   9384  C CE    . MET C 1 1   ? 64.137  107.492 34.059  1.00 29.98  ? 1    MET C CE    1 
ATOM   9385  N N     . ASP C 1 2   ? 68.641  103.804 32.457  1.00 31.45  ? 2    ASP C N     1 
ATOM   9386  C CA    . ASP C 1 2   ? 69.201  103.215 31.237  1.00 31.82  ? 2    ASP C CA    1 
ATOM   9387  C C     . ASP C 1 2   ? 68.786  104.044 30.023  1.00 28.09  ? 2    ASP C C     1 
ATOM   9388  O O     . ASP C 1 2   ? 67.736  104.644 30.032  1.00 25.05  ? 2    ASP C O     1 
ATOM   9389  C CB    . ASP C 1 2   ? 68.720  101.762 31.074  1.00 32.97  ? 2    ASP C CB    1 
ATOM   9390  C CG    . ASP C 1 2   ? 69.319  100.804 32.120  1.00 37.86  ? 2    ASP C CG    1 
ATOM   9391  O OD1   . ASP C 1 2   ? 70.357  101.129 32.761  1.00 36.35  ? 2    ASP C OD1   1 
ATOM   9392  O OD2   . ASP C 1 2   ? 68.732  99.706  32.290  1.00 48.04  ? 2    ASP C OD2   1 
ATOM   9393  N N     . ALA C 1 3   ? 69.620  104.078 28.994  1.00 29.32  ? 3    ALA C N     1 
ATOM   9394  C CA    . ALA C 1 3   ? 69.291  104.784 27.743  1.00 29.94  ? 3    ALA C CA    1 
ATOM   9395  C C     . ALA C 1 3   ? 67.970  104.313 27.135  1.00 30.70  ? 3    ALA C C     1 
ATOM   9396  O O     . ALA C 1 3   ? 67.124  105.141 26.757  1.00 31.24  ? 3    ALA C O     1 
ATOM   9397  C CB    . ALA C 1 3   ? 70.417  104.623 26.743  1.00 30.39  ? 3    ALA C CB    1 
ATOM   9398  N N     . LYS C 1 4   ? 67.783  102.990 27.065  1.00 30.50  ? 4    LYS C N     1 
ATOM   9399  C CA    . LYS C 1 4   ? 66.528  102.386 26.565  1.00 29.45  ? 4    LYS C CA    1 
ATOM   9400  C C     . LYS C 1 4   ? 65.318  103.092 27.122  1.00 26.64  ? 4    LYS C C     1 
ATOM   9401  O O     . LYS C 1 4   ? 64.457  103.561 26.369  1.00 30.09  ? 4    LYS C O     1 
ATOM   9402  C CB    . LYS C 1 4   ? 66.436  100.894 26.938  1.00 30.73  ? 4    LYS C CB    1 
ATOM   9403  C CG    . LYS C 1 4   ? 67.327  99.978  26.109  1.00 39.53  ? 4    LYS C CG    1 
ATOM   9404  C CD    . LYS C 1 4   ? 67.128  98.469  26.401  1.00 37.28  ? 4    LYS C CD    1 
ATOM   9405  C CE    . LYS C 1 4   ? 68.342  97.657  25.875  1.00 44.65  ? 4    LYS C CE    1 
ATOM   9406  N NZ    . LYS C 1 4   ? 68.062  96.190  25.732  1.00 47.90  ? 4    LYS C NZ    1 
ATOM   9407  N N     . ALA C 1 5   ? 65.251  103.138 28.451  1.00 23.75  ? 5    ALA C N     1 
ATOM   9408  C CA    . ALA C 1 5   ? 64.157  103.764 29.192  1.00 22.74  ? 5    ALA C CA    1 
ATOM   9409  C C     . ALA C 1 5   ? 64.061  105.269 28.915  1.00 20.43  ? 5    ALA C C     1 
ATOM   9410  O O     . ALA C 1 5   ? 62.975  105.800 28.674  1.00 18.80  ? 5    ALA C O     1 
ATOM   9411  C CB    . ALA C 1 5   ? 64.355  103.524 30.681  1.00 21.85  ? 5    ALA C CB    1 
ATOM   9412  N N     . ARG C 1 6   ? 65.201  105.947 28.977  1.00 21.00  ? 6    ARG C N     1 
ATOM   9413  C CA    . ARG C 1 6   ? 65.275  107.356 28.653  1.00 23.83  ? 6    ARG C CA    1 
ATOM   9414  C C     . ARG C 1 6   ? 64.650  107.632 27.269  1.00 23.36  ? 6    ARG C C     1 
ATOM   9415  O O     . ARG C 1 6   ? 63.748  108.445 27.148  1.00 22.65  ? 6    ARG C O     1 
ATOM   9416  C CB    . ARG C 1 6   ? 66.727  107.830 28.733  1.00 20.71  ? 6    ARG C CB    1 
ATOM   9417  C CG    . ARG C 1 6   ? 67.026  109.216 28.111  1.00 27.47  ? 6    ARG C CG    1 
ATOM   9418  C CD    . ARG C 1 6   ? 68.559  109.431 27.909  1.00 30.45  ? 6    ARG C CD    1 
ATOM   9419  N NE    . ARG C 1 6   ? 69.270  108.779 29.010  1.00 34.68  ? 6    ARG C NE    1 
ATOM   9420  C CZ    . ARG C 1 6   ? 70.418  108.114 28.918  1.00 34.33  ? 6    ARG C CZ    1 
ATOM   9421  N NH1   . ARG C 1 6   ? 71.070  107.998 27.761  1.00 40.23  ? 6    ARG C NH1   1 
ATOM   9422  N NH2   . ARG C 1 6   ? 70.916  107.552 30.018  1.00 29.71  ? 6    ARG C NH2   1 
ATOM   9423  N N     . ASN C 1 7   ? 65.115  106.911 26.255  1.00 24.24  ? 7    ASN C N     1 
ATOM   9424  C CA    . ASN C 1 7   ? 64.667  107.108 24.881  1.00 24.84  ? 7    ASN C CA    1 
ATOM   9425  C C     . ASN C 1 7   ? 63.217  106.788 24.664  1.00 23.68  ? 7    ASN C C     1 
ATOM   9426  O O     . ASN C 1 7   ? 62.554  107.435 23.851  1.00 24.41  ? 7    ASN C O     1 
ATOM   9427  C CB    . ASN C 1 7   ? 65.472  106.249 23.913  1.00 22.30  ? 7    ASN C CB    1 
ATOM   9428  C CG    . ASN C 1 7   ? 66.891  106.681 23.808  1.00 27.48  ? 7    ASN C CG    1 
ATOM   9429  O OD1   . ASN C 1 7   ? 67.219  107.842 24.053  1.00 31.02  ? 7    ASN C OD1   1 
ATOM   9430  N ND2   . ASN C 1 7   ? 67.765  105.742 23.449  1.00 28.73  ? 7    ASN C ND2   1 
ATOM   9431  N N     . CYS C 1 8   ? 62.754  105.746 25.340  1.00 24.70  ? 8    CYS C N     1 
ATOM   9432  C CA    . CYS C 1 8   ? 61.355  105.353 25.304  1.00 25.70  ? 8    CYS C CA    1 
ATOM   9433  C C     . CYS C 1 8   ? 60.481  106.451 25.871  1.00 27.20  ? 8    CYS C C     1 
ATOM   9434  O O     . CYS C 1 8   ? 59.422  106.772 25.327  1.00 29.57  ? 8    CYS C O     1 
ATOM   9435  C CB    . CYS C 1 8   ? 61.148  104.083 26.126  1.00 24.23  ? 8    CYS C CB    1 
ATOM   9436  S SG    . CYS C 1 8   ? 59.481  103.545 26.159  1.00 29.29  ? 8    CYS C SG    1 
ATOM   9437  N N     . LEU C 1 9   ? 60.928  107.004 26.992  1.00 29.24  ? 9    LEU C N     1 
ATOM   9438  C CA    . LEU C 1 9   ? 60.218  108.080 27.657  1.00 29.72  ? 9    LEU C CA    1 
ATOM   9439  C C     . LEU C 1 9   ? 60.258  109.311 26.770  1.00 30.39  ? 9    LEU C C     1 
ATOM   9440  O O     . LEU C 1 9   ? 59.246  109.993 26.630  1.00 28.85  ? 9    LEU C O     1 
ATOM   9441  C CB    . LEU C 1 9   ? 60.830  108.344 29.036  1.00 28.70  ? 9    LEU C CB    1 
ATOM   9442  C CG    . LEU C 1 9   ? 60.311  109.481 29.918  1.00 30.25  ? 9    LEU C CG    1 
ATOM   9443  C CD1   . LEU C 1 9   ? 58.804  109.441 30.073  1.00 26.21  ? 9    LEU C CD1   1 
ATOM   9444  C CD2   . LEU C 1 9   ? 60.995  109.405 31.302  1.00 33.96  ? 9    LEU C CD2   1 
ATOM   9445  N N     . LEU C 1 10  ? 61.410  109.565 26.141  1.00 31.63  ? 10   LEU C N     1 
ATOM   9446  C CA    . LEU C 1 10  ? 61.559  110.700 25.230  1.00 34.55  ? 10   LEU C CA    1 
ATOM   9447  C C     . LEU C 1 10  ? 60.650  110.603 24.010  1.00 36.42  ? 10   LEU C C     1 
ATOM   9448  O O     . LEU C 1 10  ? 60.023  111.573 23.631  1.00 36.43  ? 10   LEU C O     1 
ATOM   9449  C CB    . LEU C 1 10  ? 63.011  110.842 24.771  1.00 36.16  ? 10   LEU C CB    1 
ATOM   9450  C CG    . LEU C 1 10  ? 64.025  111.308 25.817  1.00 35.74  ? 10   LEU C CG    1 
ATOM   9451  C CD1   . LEU C 1 10  ? 65.419  111.242 25.235  1.00 37.56  ? 10   LEU C CD1   1 
ATOM   9452  C CD2   . LEU C 1 10  ? 63.692  112.710 26.304  1.00 36.36  ? 10   LEU C CD2   1 
ATOM   9453  N N     . GLN C 1 11  ? 60.559  109.425 23.412  1.00 40.12  ? 11   GLN C N     1 
ATOM   9454  C CA    . GLN C 1 11  ? 59.746  109.242 22.208  1.00 41.99  ? 11   GLN C CA    1 
ATOM   9455  C C     . GLN C 1 11  ? 58.247  109.440 22.447  1.00 43.69  ? 11   GLN C C     1 
ATOM   9456  O O     . GLN C 1 11  ? 57.523  109.890 21.554  1.00 41.33  ? 11   GLN C O     1 
ATOM   9457  C CB    . GLN C 1 11  ? 59.992  107.850 21.615  1.00 42.54  ? 11   GLN C CB    1 
ATOM   9458  C CG    . GLN C 1 11  ? 58.824  107.288 20.790  1.00 43.27  ? 11   GLN C CG    1 
ATOM   9459  C CD    . GLN C 1 11  ? 59.075  105.881 20.270  1.00 44.85  ? 11   GLN C CD    1 
ATOM   9460  O OE1   . GLN C 1 11  ? 58.166  105.247 19.721  1.00 41.57  ? 11   GLN C OE1   1 
ATOM   9461  N NE2   . GLN C 1 11  ? 60.319  105.390 20.423  1.00 50.34  ? 11   GLN C NE2   1 
ATOM   9462  N N     . HIS C 1 12  ? 57.782  109.072 23.639  1.00 46.38  ? 12   HIS C N     1 
ATOM   9463  C CA    . HIS C 1 12  ? 56.352  109.024 23.927  1.00 47.58  ? 12   HIS C CA    1 
ATOM   9464  C C     . HIS C 1 12  ? 55.848  110.184 24.767  1.00 49.59  ? 12   HIS C C     1 
ATOM   9465  O O     . HIS C 1 12  ? 54.665  110.262 25.071  1.00 47.54  ? 12   HIS C O     1 
ATOM   9466  C CB    . HIS C 1 12  ? 56.029  107.709 24.602  1.00 46.79  ? 12   HIS C CB    1 
ATOM   9467  C CG    . HIS C 1 12  ? 56.109  106.551 23.673  1.00 45.24  ? 12   HIS C CG    1 
ATOM   9468  N ND1   . HIS C 1 12  ? 56.927  105.467 23.903  1.00 44.95  ? 12   HIS C ND1   1 
ATOM   9469  C CD2   . HIS C 1 12  ? 55.492  106.320 22.490  1.00 37.27  ? 12   HIS C CD2   1 
ATOM   9470  C CE1   . HIS C 1 12  ? 56.787  104.601 22.915  1.00 46.62  ? 12   HIS C CE1   1 
ATOM   9471  N NE2   . HIS C 1 12  ? 55.926  105.097 22.043  1.00 46.36  ? 12   HIS C NE2   1 
ATOM   9472  N N     . ARG C 1 13  ? 56.755  111.091 25.107  1.00 52.47  ? 13   ARG C N     1 
ATOM   9473  C CA    . ARG C 1 13  ? 56.438  112.284 25.858  1.00 54.64  ? 13   ARG C CA    1 
ATOM   9474  C C     . ARG C 1 13  ? 55.354  113.173 25.217  1.00 56.94  ? 13   ARG C C     1 
ATOM   9475  O O     . ARG C 1 13  ? 54.681  113.918 25.929  1.00 57.48  ? 13   ARG C O     1 
ATOM   9476  C CB    . ARG C 1 13  ? 57.713  113.088 26.025  1.00 55.04  ? 13   ARG C CB    1 
ATOM   9477  C CG    . ARG C 1 13  ? 57.600  114.286 26.907  1.00 56.02  ? 13   ARG C CG    1 
ATOM   9478  C CD    . ARG C 1 13  ? 58.885  115.072 26.845  1.00 59.02  ? 13   ARG C CD    1 
ATOM   9479  N NE    . ARG C 1 13  ? 58.965  116.061 27.912  1.00 62.27  ? 13   ARG C NE    1 
ATOM   9480  C CZ    . ARG C 1 13  ? 59.984  116.893 28.070  1.00 64.77  ? 13   ARG C CZ    1 
ATOM   9481  N NH1   . ARG C 1 13  ? 61.010  116.864 27.226  1.00 68.99  ? 13   ARG C NH1   1 
ATOM   9482  N NH2   . ARG C 1 13  ? 59.977  117.758 29.073  1.00 68.57  ? 13   ARG C NH2   1 
ATOM   9483  N N     . GLU C 1 14  ? 55.185  113.126 23.895  1.00 57.97  ? 14   GLU C N     1 
ATOM   9484  C CA    . GLU C 1 14  ? 54.106  113.902 23.271  1.00 58.72  ? 14   GLU C CA    1 
ATOM   9485  C C     . GLU C 1 14  ? 52.758  113.372 23.754  1.00 57.91  ? 14   GLU C C     1 
ATOM   9486  O O     . GLU C 1 14  ? 51.880  114.136 24.163  1.00 55.50  ? 14   GLU C O     1 
ATOM   9487  C CB    . GLU C 1 14  ? 54.171  113.852 21.735  1.00 59.59  ? 14   GLU C CB    1 
ATOM   9488  C CG    . GLU C 1 14  ? 55.400  114.520 21.115  1.00 67.74  ? 14   GLU C CG    1 
ATOM   9489  C CD    . GLU C 1 14  ? 55.450  116.054 21.295  1.00 75.71  ? 14   GLU C CD    1 
ATOM   9490  O OE1   . GLU C 1 14  ? 54.563  116.622 21.987  1.00 71.82  ? 14   GLU C OE1   1 
ATOM   9491  O OE2   . GLU C 1 14  ? 56.392  116.687 20.739  1.00 75.80  ? 14   GLU C OE2   1 
ATOM   9492  N N     . ALA C 1 15  ? 52.620  112.050 23.710  1.00 58.26  ? 15   ALA C N     1 
ATOM   9493  C CA    . ALA C 1 15  ? 51.393  111.383 24.110  1.00 58.94  ? 15   ALA C CA    1 
ATOM   9494  C C     . ALA C 1 15  ? 51.105  111.617 25.591  1.00 59.10  ? 15   ALA C C     1 
ATOM   9495  O O     . ALA C 1 15  ? 49.981  111.935 25.958  1.00 61.25  ? 15   ALA C O     1 
ATOM   9496  C CB    . ALA C 1 15  ? 51.479  109.893 23.795  1.00 59.00  ? 15   ALA C CB    1 
ATOM   9497  N N     . LEU C 1 16  ? 52.135  111.479 26.424  1.00 59.19  ? 16   LEU C N     1 
ATOM   9498  C CA    . LEU C 1 16  ? 52.041  111.708 27.866  1.00 59.32  ? 16   LEU C CA    1 
ATOM   9499  C C     . LEU C 1 16  ? 51.692  113.150 28.235  1.00 59.58  ? 16   LEU C C     1 
ATOM   9500  O O     . LEU C 1 16  ? 50.948  113.385 29.188  1.00 58.87  ? 16   LEU C O     1 
ATOM   9501  C CB    . LEU C 1 16  ? 53.359  111.336 28.569  1.00 57.53  ? 16   LEU C CB    1 
ATOM   9502  C CG    . LEU C 1 16  ? 53.737  109.863 28.692  1.00 53.83  ? 16   LEU C CG    1 
ATOM   9503  C CD1   . LEU C 1 16  ? 55.216  109.709 29.037  1.00 54.94  ? 16   LEU C CD1   1 
ATOM   9504  C CD2   . LEU C 1 16  ? 52.882  109.193 29.736  1.00 51.63  ? 16   LEU C CD2   1 
ATOM   9505  N N     . GLU C 1 17  ? 52.256  114.111 27.515  1.00 61.20  ? 17   GLU C N     1 
ATOM   9506  C CA    . GLU C 1 17  ? 52.011  115.533 27.803  1.00 63.07  ? 17   GLU C CA    1 
ATOM   9507  C C     . GLU C 1 17  ? 50.556  115.917 27.555  1.00 63.19  ? 17   GLU C C     1 
ATOM   9508  O O     . GLU C 1 17  ? 49.904  116.530 28.395  1.00 64.01  ? 17   GLU C O     1 
ATOM   9509  C CB    . GLU C 1 17  ? 52.915  116.416 26.952  1.00 63.27  ? 17   GLU C CB    1 
ATOM   9510  C CG    . GLU C 1 17  ? 54.322  116.532 27.485  1.00 65.10  ? 17   GLU C CG    1 
ATOM   9511  C CD    . GLU C 1 17  ? 55.256  117.246 26.523  1.00 65.33  ? 17   GLU C CD    1 
ATOM   9512  O OE1   . GLU C 1 17  ? 54.938  117.303 25.312  1.00 71.19  ? 17   GLU C OE1   1 
ATOM   9513  O OE2   . GLU C 1 17  ? 56.312  117.746 26.978  1.00 72.13  ? 17   GLU C OE2   1 
ATOM   9514  N N     . LYS C 1 18  ? 50.071  115.552 26.380  1.00 64.00  ? 18   LYS C N     1 
ATOM   9515  C CA    . LYS C 1 18  ? 48.686  115.757 26.000  1.00 65.28  ? 18   LYS C CA    1 
ATOM   9516  C C     . LYS C 1 18  ? 47.742  115.098 27.031  1.00 66.75  ? 18   LYS C C     1 
ATOM   9517  O O     . LYS C 1 18  ? 47.219  115.778 27.933  1.00 67.70  ? 18   LYS C O     1 
ATOM   9518  C CB    . LYS C 1 18  ? 48.496  115.207 24.571  1.00 65.98  ? 18   LYS C CB    1 
ATOM   9519  C CG    . LYS C 1 18  ? 47.074  115.006 24.049  1.00 64.30  ? 18   LYS C CG    1 
ATOM   9520  C CD    . LYS C 1 18  ? 47.156  114.339 22.676  1.00 65.25  ? 18   LYS C CD    1 
ATOM   9521  C CE    . LYS C 1 18  ? 45.867  113.644 22.269  1.00 68.69  ? 18   LYS C CE    1 
ATOM   9522  N NZ    . LYS C 1 18  ? 45.987  113.039 20.914  1.00 64.69  ? 18   LYS C NZ    1 
ATOM   9523  N N     . ASP C 1 19  ? 47.614  113.774 26.945  1.00 66.41  ? 19   ASP C N     1 
ATOM   9524  C CA    . ASP C 1 19  ? 46.522  113.037 27.592  1.00 65.57  ? 19   ASP C CA    1 
ATOM   9525  C C     . ASP C 1 19  ? 46.518  113.006 29.137  1.00 66.10  ? 19   ASP C C     1 
ATOM   9526  O O     . ASP C 1 19  ? 45.436  112.992 29.730  1.00 69.03  ? 19   ASP C O     1 
ATOM   9527  C CB    . ASP C 1 19  ? 46.457  111.602 27.037  1.00 65.00  ? 19   ASP C CB    1 
ATOM   9528  C CG    . ASP C 1 19  ? 46.235  111.562 25.515  1.00 70.45  ? 19   ASP C CG    1 
ATOM   9529  O OD1   . ASP C 1 19  ? 45.147  111.980 25.054  1.00 71.60  ? 19   ASP C OD1   1 
ATOM   9530  O OD2   . ASP C 1 19  ? 47.150  111.110 24.775  1.00 70.56  ? 19   ASP C OD2   1 
ATOM   9531  N N     . ILE C 1 20  ? 47.672  113.007 29.811  1.00 65.35  ? 20   ILE C N     1 
ATOM   9532  C CA    . ILE C 1 20  ? 47.643  112.751 31.269  1.00 64.30  ? 20   ILE C CA    1 
ATOM   9533  C C     . ILE C 1 20  ? 47.373  113.944 32.159  1.00 63.61  ? 20   ILE C C     1 
ATOM   9534  O O     . ILE C 1 20  ? 47.819  115.056 31.882  1.00 63.63  ? 20   ILE C O     1 
ATOM   9535  C CB    . ILE C 1 20  ? 48.897  111.989 31.851  1.00 64.44  ? 20   ILE C CB    1 
ATOM   9536  C CG1   . ILE C 1 20  ? 49.992  112.949 32.339  1.00 65.04  ? 20   ILE C CG1   1 
ATOM   9537  C CG2   . ILE C 1 20  ? 49.383  110.948 30.884  1.00 63.18  ? 20   ILE C CG2   1 
ATOM   9538  C CD1   . ILE C 1 20  ? 51.185  112.255 32.957  1.00 63.85  ? 20   ILE C CD1   1 
ATOM   9539  N N     . LYS C 1 21  ? 46.633  113.657 33.236  1.00 63.52  ? 21   LYS C N     1 
ATOM   9540  C CA    . LYS C 1 21  ? 46.475  114.526 34.407  1.00 61.75  ? 21   LYS C CA    1 
ATOM   9541  C C     . LYS C 1 21  ? 47.466  114.028 35.467  1.00 59.44  ? 21   LYS C C     1 
ATOM   9542  O O     . LYS C 1 21  ? 47.872  112.872 35.421  1.00 58.87  ? 21   LYS C O     1 
ATOM   9543  C CB    . LYS C 1 21  ? 45.036  114.460 34.941  1.00 61.27  ? 21   LYS C CB    1 
ATOM   9544  C CG    . LYS C 1 21  ? 43.955  114.316 33.870  1.00 60.85  ? 21   LYS C CG    1 
ATOM   9545  C CD    . LYS C 1 21  ? 42.548  114.551 34.448  1.00 62.46  ? 21   LYS C CD    1 
ATOM   9546  C CE    . LYS C 1 21  ? 41.617  115.236 33.453  1.00 61.93  ? 21   LYS C CE    1 
ATOM   9547  N NZ    . LYS C 1 21  ? 40.201  115.250 33.959  1.00 69.29  ? 21   LYS C NZ    1 
ATOM   9548  N N     . THR C 1 22  ? 47.801  114.878 36.441  1.00 58.15  ? 22   THR C N     1 
ATOM   9549  C CA    . THR C 1 22  ? 49.073  114.768 37.183  1.00 57.25  ? 22   THR C CA    1 
ATOM   9550  C C     . THR C 1 22  ? 49.048  114.540 38.690  1.00 56.17  ? 22   THR C C     1 
ATOM   9551  O O     . THR C 1 22  ? 50.069  114.129 39.255  1.00 57.61  ? 22   THR C O     1 
ATOM   9552  C CB    . THR C 1 22  ? 49.883  116.079 37.002  1.00 57.45  ? 22   THR C CB    1 
ATOM   9553  O OG1   . THR C 1 22  ? 49.945  116.421 35.607  1.00 62.62  ? 22   THR C OG1   1 
ATOM   9554  C CG2   . THR C 1 22  ? 51.317  115.947 37.584  1.00 59.84  ? 22   THR C CG2   1 
ATOM   9555  N N     . SER C 1 23  ? 47.941  114.839 39.371  1.00 55.52  ? 23   SER C N     1 
ATOM   9556  C CA    . SER C 1 23  ? 47.972  114.899 40.869  1.00 53.61  ? 23   SER C CA    1 
ATOM   9557  C C     . SER C 1 23  ? 48.228  113.564 41.598  1.00 49.07  ? 23   SER C C     1 
ATOM   9558  O O     . SER C 1 23  ? 49.029  113.498 42.527  1.00 44.59  ? 23   SER C O     1 
ATOM   9559  C CB    . SER C 1 23  ? 46.695  115.571 41.434  1.00 55.36  ? 23   SER C CB    1 
ATOM   9560  O OG    . SER C 1 23  ? 45.496  115.071 40.854  1.00 57.97  ? 23   SER C OG    1 
ATOM   9561  N N     . TYR C 1 24  ? 47.547  112.502 41.177  1.00 49.30  ? 24   TYR C N     1 
ATOM   9562  C CA    . TYR C 1 24  ? 47.559  111.234 41.942  1.00 47.56  ? 24   TYR C CA    1 
ATOM   9563  C C     . TYR C 1 24  ? 48.787  110.367 41.618  1.00 45.38  ? 24   TYR C C     1 
ATOM   9564  O O     . TYR C 1 24  ? 49.332  109.694 42.499  1.00 42.29  ? 24   TYR C O     1 
ATOM   9565  C CB    . TYR C 1 24  ? 46.261  110.481 41.718  1.00 46.31  ? 24   TYR C CB    1 
ATOM   9566  C CG    . TYR C 1 24  ? 45.018  111.197 42.240  1.00 46.64  ? 24   TYR C CG    1 
ATOM   9567  C CD1   . TYR C 1 24  ? 44.627  111.100 43.581  1.00 52.79  ? 24   TYR C CD1   1 
ATOM   9568  C CD2   . TYR C 1 24  ? 44.225  111.934 41.394  1.00 40.18  ? 24   TYR C CD2   1 
ATOM   9569  C CE1   . TYR C 1 24  ? 43.474  111.751 44.046  1.00 48.74  ? 24   TYR C CE1   1 
ATOM   9570  C CE2   . TYR C 1 24  ? 43.094  112.589 41.840  1.00 46.57  ? 24   TYR C CE2   1 
ATOM   9571  C CZ    . TYR C 1 24  ? 42.709  112.494 43.164  1.00 49.65  ? 24   TYR C CZ    1 
ATOM   9572  O OH    . TYR C 1 24  ? 41.560  113.173 43.581  1.00 51.03  ? 24   TYR C OH    1 
ATOM   9573  N N     . ILE C 1 25  ? 49.218  110.408 40.355  1.00 46.07  ? 25   ILE C N     1 
ATOM   9574  C CA    . ILE C 1 25  ? 50.536  109.905 39.950  1.00 46.71  ? 25   ILE C CA    1 
ATOM   9575  C C     . ILE C 1 25  ? 51.550  110.452 40.931  1.00 47.77  ? 25   ILE C C     1 
ATOM   9576  O O     . ILE C 1 25  ? 52.251  109.708 41.638  1.00 46.36  ? 25   ILE C O     1 
ATOM   9577  C CB    . ILE C 1 25  ? 50.918  110.382 38.521  1.00 45.72  ? 25   ILE C CB    1 
ATOM   9578  C CG1   . ILE C 1 25  ? 50.056  109.679 37.472  1.00 40.34  ? 25   ILE C CG1   1 
ATOM   9579  C CG2   . ILE C 1 25  ? 52.403  110.143 38.240  1.00 46.68  ? 25   ILE C CG2   1 
ATOM   9580  C CD1   . ILE C 1 25  ? 50.064  110.359 36.144  1.00 45.27  ? 25   ILE C CD1   1 
ATOM   9581  N N     . MET C 1 26  ? 51.590  111.776 40.995  1.00 51.49  ? 26   MET C N     1 
ATOM   9582  C CA    . MET C 1 26  ? 52.512  112.489 41.879  1.00 52.67  ? 26   MET C CA    1 
ATOM   9583  C C     . MET C 1 26  ? 52.473  111.967 43.330  1.00 51.13  ? 26   MET C C     1 
ATOM   9584  O O     . MET C 1 26  ? 53.513  111.801 43.946  1.00 51.04  ? 26   MET C O     1 
ATOM   9585  C CB    . MET C 1 26  ? 52.193  113.985 41.806  1.00 54.21  ? 26   MET C CB    1 
ATOM   9586  C CG    . MET C 1 26  ? 53.203  114.881 42.512  1.00 58.47  ? 26   MET C CG    1 
ATOM   9587  S SD    . MET C 1 26  ? 54.527  115.544 41.476  1.00 72.80  ? 26   MET C SD    1 
ATOM   9588  C CE    . MET C 1 26  ? 53.579  116.251 40.106  1.00 72.06  ? 26   MET C CE    1 
ATOM   9589  N N     . ASP C 1 27  ? 51.279  111.680 43.852  1.00 52.71  ? 27   ASP C N     1 
ATOM   9590  C CA    . ASP C 1 27  ? 51.128  111.028 45.183  1.00 53.72  ? 27   ASP C CA    1 
ATOM   9591  C C     . ASP C 1 27  ? 51.833  109.673 45.252  1.00 53.57  ? 27   ASP C C     1 
ATOM   9592  O O     . ASP C 1 27  ? 52.625  109.430 46.159  1.00 54.19  ? 27   ASP C O     1 
ATOM   9593  C CB    . ASP C 1 27  ? 49.655  110.798 45.564  1.00 53.50  ? 27   ASP C CB    1 
ATOM   9594  C CG    . ASP C 1 27  ? 48.803  112.062 45.508  1.00 56.80  ? 27   ASP C CG    1 
ATOM   9595  O OD1   . ASP C 1 27  ? 49.330  113.150 45.217  1.00 63.48  ? 27   ASP C OD1   1 
ATOM   9596  O OD2   . ASP C 1 27  ? 47.576  111.962 45.749  1.00 62.68  ? 27   ASP C OD2   1 
ATOM   9597  N N     . HIS C 1 28  ? 51.543  108.795 44.290  1.00 53.85  ? 28   HIS C N     1 
ATOM   9598  C CA    . HIS C 1 28  ? 52.119  107.436 44.286  1.00 54.09  ? 28   HIS C CA    1 
ATOM   9599  C C     . HIS C 1 28  ? 53.625  107.455 44.319  1.00 54.10  ? 28   HIS C C     1 
ATOM   9600  O O     . HIS C 1 28  ? 54.239  106.698 45.068  1.00 55.82  ? 28   HIS C O     1 
ATOM   9601  C CB    . HIS C 1 28  ? 51.669  106.627 43.069  1.00 53.49  ? 28   HIS C CB    1 
ATOM   9602  C CG    . HIS C 1 28  ? 50.186  106.574 42.904  1.00 52.05  ? 28   HIS C CG    1 
ATOM   9603  N ND1   . HIS C 1 28  ? 49.337  106.251 43.939  1.00 56.09  ? 28   HIS C ND1   1 
ATOM   9604  C CD2   . HIS C 1 28  ? 49.399  106.805 41.829  1.00 50.17  ? 28   HIS C CD2   1 
ATOM   9605  C CE1   . HIS C 1 28  ? 48.089  106.301 43.511  1.00 58.32  ? 28   HIS C CE1   1 
ATOM   9606  N NE2   . HIS C 1 28  ? 48.099  106.634 42.233  1.00 56.77  ? 28   HIS C NE2   1 
ATOM   9607  N N     . MET C 1 29  ? 54.228  108.317 43.511  1.00 56.07  ? 29   MET C N     1 
ATOM   9608  C CA    . MET C 1 29  ? 55.697  108.421 43.474  1.00 57.31  ? 29   MET C CA    1 
ATOM   9609  C C     . MET C 1 29  ? 56.220  109.070 44.746  1.00 59.40  ? 29   MET C C     1 
ATOM   9610  O O     . MET C 1 29  ? 57.256  108.650 45.271  1.00 58.39  ? 29   MET C O     1 
ATOM   9611  C CB    . MET C 1 29  ? 56.172  109.220 42.263  1.00 56.89  ? 29   MET C CB    1 
ATOM   9612  C CG    . MET C 1 29  ? 55.699  108.655 40.944  1.00 54.06  ? 29   MET C CG    1 
ATOM   9613  S SD    . MET C 1 29  ? 56.445  109.458 39.537  1.00 54.53  ? 29   MET C SD    1 
ATOM   9614  C CE    . MET C 1 29  ? 58.142  108.890 39.709  1.00 49.11  ? 29   MET C CE    1 
ATOM   9615  N N     . ILE C 1 30  ? 55.503  110.089 45.235  1.00 62.26  ? 30   ILE C N     1 
ATOM   9616  C CA    . ILE C 1 30  ? 55.821  110.709 46.534  1.00 63.58  ? 30   ILE C CA    1 
ATOM   9617  C C     . ILE C 1 30  ? 55.818  109.644 47.646  1.00 64.69  ? 30   ILE C C     1 
ATOM   9618  O O     . ILE C 1 30  ? 56.707  109.634 48.497  1.00 66.16  ? 30   ILE C O     1 
ATOM   9619  C CB    . ILE C 1 30  ? 54.872  111.917 46.870  1.00 64.54  ? 30   ILE C CB    1 
ATOM   9620  C CG1   . ILE C 1 30  ? 55.323  113.180 46.117  1.00 65.93  ? 30   ILE C CG1   1 
ATOM   9621  C CG2   . ILE C 1 30  ? 54.839  112.207 48.375  1.00 63.85  ? 30   ILE C CG2   1 
ATOM   9622  C CD1   . ILE C 1 30  ? 54.333  114.378 46.186  1.00 64.57  ? 30   ILE C CD1   1 
ATOM   9623  N N     . SER C 1 31  ? 54.835  108.746 47.623  1.00 64.97  ? 31   SER C N     1 
ATOM   9624  C CA    . SER C 1 31  ? 54.814  107.596 48.536  1.00 64.59  ? 31   SER C CA    1 
ATOM   9625  C C     . SER C 1 31  ? 55.987  106.658 48.270  1.00 65.35  ? 31   SER C C     1 
ATOM   9626  O O     . SER C 1 31  ? 56.705  106.274 49.195  1.00 66.02  ? 31   SER C O     1 
ATOM   9627  C CB    . SER C 1 31  ? 53.497  106.824 48.411  1.00 64.99  ? 31   SER C CB    1 
ATOM   9628  O OG    . SER C 1 31  ? 53.720  105.418 48.403  1.00 63.01  ? 31   SER C OG    1 
ATOM   9629  N N     . ASP C 1 32  ? 56.177  106.288 47.004  1.00 66.03  ? 32   ASP C N     1 
ATOM   9630  C CA    . ASP C 1 32  ? 57.312  105.425 46.599  1.00 65.93  ? 32   ASP C CA    1 
ATOM   9631  C C     . ASP C 1 32  ? 58.703  106.018 46.956  1.00 64.61  ? 32   ASP C C     1 
ATOM   9632  O O     . ASP C 1 32  ? 59.695  105.288 47.032  1.00 61.19  ? 32   ASP C O     1 
ATOM   9633  C CB    . ASP C 1 32  ? 57.248  105.117 45.085  1.00 66.28  ? 32   ASP C CB    1 
ATOM   9634  C CG    . ASP C 1 32  ? 56.073  104.199 44.694  1.00 66.37  ? 32   ASP C CG    1 
ATOM   9635  O OD1   . ASP C 1 32  ? 55.185  103.919 45.540  1.00 63.38  ? 32   ASP C OD1   1 
ATOM   9636  O OD2   . ASP C 1 32  ? 56.049  103.766 43.517  1.00 61.07  ? 32   ASP C OD2   1 
ATOM   9637  N N     . GLY C 1 33  ? 58.755  107.336 47.158  1.00 65.47  ? 33   GLY C N     1 
ATOM   9638  C CA    . GLY C 1 33  ? 59.974  108.037 47.570  1.00 66.26  ? 33   GLY C CA    1 
ATOM   9639  C C     . GLY C 1 33  ? 60.883  108.427 46.415  1.00 66.36  ? 33   GLY C C     1 
ATOM   9640  O O     . GLY C 1 33  ? 62.105  108.478 46.571  1.00 66.02  ? 33   GLY C O     1 
ATOM   9641  N N     . PHE C 1 34  ? 60.279  108.701 45.259  1.00 66.65  ? 34   PHE C N     1 
ATOM   9642  C CA    . PHE C 1 34  ? 61.004  109.086 44.052  1.00 66.75  ? 34   PHE C CA    1 
ATOM   9643  C C     . PHE C 1 34  ? 60.615  110.492 43.576  1.00 68.48  ? 34   PHE C C     1 
ATOM   9644  O O     . PHE C 1 34  ? 61.116  110.959 42.546  1.00 69.70  ? 34   PHE C O     1 
ATOM   9645  C CB    . PHE C 1 34  ? 60.750  108.069 42.927  1.00 65.68  ? 34   PHE C CB    1 
ATOM   9646  C CG    . PHE C 1 34  ? 61.218  106.661 43.243  1.00 63.19  ? 34   PHE C CG    1 
ATOM   9647  C CD1   . PHE C 1 34  ? 62.561  106.395 43.490  1.00 63.98  ? 34   PHE C CD1   1 
ATOM   9648  C CD2   . PHE C 1 34  ? 60.322  105.602 43.265  1.00 59.23  ? 34   PHE C CD2   1 
ATOM   9649  C CE1   . PHE C 1 34  ? 63.001  105.094 43.770  1.00 62.13  ? 34   PHE C CE1   1 
ATOM   9650  C CE2   . PHE C 1 34  ? 60.757  104.304 43.547  1.00 59.90  ? 34   PHE C CE2   1 
ATOM   9651  C CZ    . PHE C 1 34  ? 62.100  104.056 43.797  1.00 61.26  ? 34   PHE C CZ    1 
ATOM   9652  N N     . LEU C 1 35  ? 59.720  111.160 44.307  1.00 69.24  ? 35   LEU C N     1 
ATOM   9653  C CA    . LEU C 1 35  ? 59.391  112.557 44.032  1.00 69.36  ? 35   LEU C CA    1 
ATOM   9654  C C     . LEU C 1 35  ? 59.371  113.390 45.338  1.00 71.39  ? 35   LEU C C     1 
ATOM   9655  O O     . LEU C 1 35  ? 59.484  112.823 46.443  1.00 72.89  ? 35   LEU C O     1 
ATOM   9656  C CB    . LEU C 1 35  ? 58.058  112.623 43.310  1.00 68.99  ? 35   LEU C CB    1 
ATOM   9657  C CG    . LEU C 1 35  ? 57.648  113.971 42.719  1.00 69.77  ? 35   LEU C CG    1 
ATOM   9658  C CD1   . LEU C 1 35  ? 58.512  114.419 41.529  1.00 69.56  ? 35   LEU C CD1   1 
ATOM   9659  C CD2   . LEU C 1 35  ? 56.252  113.855 42.306  1.00 70.24  ? 35   LEU C CD2   1 
ATOM   9660  N N     . THR C 1 36  ? 59.292  114.724 45.203  1.00 71.09  ? 36   THR C N     1 
ATOM   9661  C CA    . THR C 1 36  ? 59.173  115.645 46.346  1.00 69.92  ? 36   THR C CA    1 
ATOM   9662  C C     . THR C 1 36  ? 58.025  116.663 46.205  1.00 70.61  ? 36   THR C C     1 
ATOM   9663  O O     . THR C 1 36  ? 57.412  116.810 45.139  1.00 70.16  ? 36   THR C O     1 
ATOM   9664  C CB    . THR C 1 36  ? 60.484  116.434 46.578  1.00 70.08  ? 36   THR C CB    1 
ATOM   9665  O OG1   . THR C 1 36  ? 60.666  117.372 45.515  1.00 64.74  ? 36   THR C OG1   1 
ATOM   9666  C CG2   . THR C 1 36  ? 61.692  115.486 46.657  1.00 68.81  ? 36   THR C CG2   1 
ATOM   9667  N N     . ILE C 1 37  ? 57.759  117.366 47.309  1.00 70.81  ? 37   ILE C N     1 
ATOM   9668  C CA    . ILE C 1 37  ? 56.678  118.362 47.405  1.00 69.67  ? 37   ILE C CA    1 
ATOM   9669  C C     . ILE C 1 37  ? 57.025  119.638 46.618  1.00 68.61  ? 37   ILE C C     1 
ATOM   9670  O O     . ILE C 1 37  ? 56.148  120.243 45.987  1.00 66.80  ? 37   ILE C O     1 
ATOM   9671  C CB    . ILE C 1 37  ? 56.370  118.736 48.906  1.00 70.29  ? 37   ILE C CB    1 
ATOM   9672  C CG1   . ILE C 1 37  ? 55.851  117.525 49.694  1.00 69.17  ? 37   ILE C CG1   1 
ATOM   9673  C CG2   . ILE C 1 37  ? 55.373  119.899 49.011  1.00 70.95  ? 37   ILE C CG2   1 
ATOM   9674  C CD1   . ILE C 1 37  ? 54.446  117.080 49.323  1.00 70.26  ? 37   ILE C CD1   1 
ATOM   9675  N N     . SER C 1 38  ? 58.293  120.050 46.665  1.00 66.94  ? 38   SER C N     1 
ATOM   9676  C CA    . SER C 1 38  ? 58.743  121.204 45.882  1.00 66.20  ? 38   SER C CA    1 
ATOM   9677  C C     . SER C 1 38  ? 58.450  120.985 44.392  1.00 64.38  ? 38   SER C C     1 
ATOM   9678  O O     . SER C 1 38  ? 58.029  121.903 43.679  1.00 62.01  ? 38   SER C O     1 
ATOM   9679  C CB    . SER C 1 38  ? 60.239  121.469 46.111  1.00 66.05  ? 38   SER C CB    1 
ATOM   9680  O OG    . SER C 1 38  ? 61.027  120.344 45.766  1.00 65.45  ? 38   SER C OG    1 
ATOM   9681  N N     . GLU C 1 39  ? 58.650  119.745 43.949  1.00 64.58  ? 39   GLU C N     1 
ATOM   9682  C CA    . GLU C 1 39  ? 58.418  119.361 42.564  1.00 64.36  ? 39   GLU C CA    1 
ATOM   9683  C C     . GLU C 1 39  ? 56.934  119.369 42.182  1.00 63.20  ? 39   GLU C C     1 
ATOM   9684  O O     . GLU C 1 39  ? 56.569  119.882 41.119  1.00 58.47  ? 39   GLU C O     1 
ATOM   9685  C CB    . GLU C 1 39  ? 59.052  117.997 42.288  1.00 64.22  ? 39   GLU C CB    1 
ATOM   9686  C CG    . GLU C 1 39  ? 60.575  118.052 42.263  1.00 64.87  ? 39   GLU C CG    1 
ATOM   9687  C CD    . GLU C 1 39  ? 61.204  116.874 41.548  1.00 65.69  ? 39   GLU C CD    1 
ATOM   9688  O OE1   . GLU C 1 39  ? 60.920  116.691 40.341  1.00 60.25  ? 39   GLU C OE1   1 
ATOM   9689  O OE2   . GLU C 1 39  ? 61.998  116.149 42.190  1.00 71.12  ? 39   GLU C OE2   1 
ATOM   9690  N N     . GLU C 1 40  ? 56.086  118.801 43.044  1.00 64.72  ? 40   GLU C N     1 
ATOM   9691  C CA    . GLU C 1 40  ? 54.629  118.844 42.832  1.00 64.78  ? 40   GLU C CA    1 
ATOM   9692  C C     . GLU C 1 40  ? 54.151  120.294 42.789  1.00 63.28  ? 40   GLU C C     1 
ATOM   9693  O O     . GLU C 1 40  ? 53.383  120.688 41.921  1.00 59.82  ? 40   GLU C O     1 
ATOM   9694  C CB    . GLU C 1 40  ? 53.863  118.082 43.927  1.00 65.31  ? 40   GLU C CB    1 
ATOM   9695  C CG    . GLU C 1 40  ? 52.332  118.039 43.684  1.00 64.88  ? 40   GLU C CG    1 
ATOM   9696  C CD    . GLU C 1 40  ? 51.537  117.511 44.873  1.00 66.23  ? 40   GLU C CD    1 
ATOM   9697  O OE1   . GLU C 1 40  ? 51.871  117.871 46.032  1.00 66.99  ? 40   GLU C OE1   1 
ATOM   9698  O OE2   . GLU C 1 40  ? 50.564  116.748 44.639  1.00 65.76  ? 40   GLU C OE2   1 
ATOM   9699  N N     . GLU C 1 41  ? 54.629  121.074 43.745  1.00 64.57  ? 41   GLU C N     1 
ATOM   9700  C CA    . GLU C 1 41  ? 54.358  122.502 43.790  1.00 65.45  ? 41   GLU C CA    1 
ATOM   9701  C C     . GLU C 1 41  ? 54.721  123.129 42.445  1.00 64.91  ? 41   GLU C C     1 
ATOM   9702  O O     . GLU C 1 41  ? 53.961  123.931 41.906  1.00 62.77  ? 41   GLU C O     1 
ATOM   9703  C CB    . GLU C 1 41  ? 55.179  123.143 44.917  1.00 66.18  ? 41   GLU C CB    1 
ATOM   9704  C CG    . GLU C 1 41  ? 54.518  124.323 45.617  1.00 67.35  ? 41   GLU C CG    1 
ATOM   9705  C CD    . GLU C 1 41  ? 55.048  124.496 47.029  1.00 67.04  ? 41   GLU C CD    1 
ATOM   9706  O OE1   . GLU C 1 41  ? 54.616  123.737 47.929  1.00 65.06  ? 41   GLU C OE1   1 
ATOM   9707  O OE2   . GLU C 1 41  ? 55.909  125.379 47.231  1.00 68.96  ? 41   GLU C OE2   1 
ATOM   9708  N N     . LYS C 1 42  ? 55.884  122.732 41.920  1.00 64.88  ? 42   LYS C N     1 
ATOM   9709  C CA    . LYS C 1 42  ? 56.396  123.216 40.632  1.00 64.75  ? 42   LYS C CA    1 
ATOM   9710  C C     . LYS C 1 42  ? 55.495  122.812 39.450  1.00 64.16  ? 42   LYS C C     1 
ATOM   9711  O O     . LYS C 1 42  ? 55.352  123.578 38.482  1.00 62.84  ? 42   LYS C O     1 
ATOM   9712  C CB    . LYS C 1 42  ? 57.847  122.726 40.422  1.00 64.12  ? 42   LYS C CB    1 
ATOM   9713  C CG    . LYS C 1 42  ? 58.476  123.115 39.090  1.00 64.31  ? 42   LYS C CG    1 
ATOM   9714  C CD    . LYS C 1 42  ? 60.012  123.226 39.176  1.00 64.35  ? 42   LYS C CD    1 
ATOM   9715  C CE    . LYS C 1 42  ? 60.610  123.729 37.853  1.00 62.21  ? 42   LYS C CE    1 
ATOM   9716  N NZ    . LYS C 1 42  ? 62.069  124.005 37.918  1.00 55.76  ? 42   LYS C NZ    1 
ATOM   9717  N N     . VAL C 1 43  ? 54.881  121.630 39.539  1.00 62.86  ? 43   VAL C N     1 
ATOM   9718  C CA    . VAL C 1 43  ? 54.017  121.124 38.461  1.00 64.56  ? 43   VAL C CA    1 
ATOM   9719  C C     . VAL C 1 43  ? 52.551  121.613 38.559  1.00 64.22  ? 43   VAL C C     1 
ATOM   9720  O O     . VAL C 1 43  ? 51.904  121.837 37.535  1.00 63.39  ? 43   VAL C O     1 
ATOM   9721  C CB    . VAL C 1 43  ? 54.057  119.559 38.379  1.00 65.04  ? 43   VAL C CB    1 
ATOM   9722  C CG1   . VAL C 1 43  ? 53.154  119.056 37.261  1.00 66.13  ? 43   VAL C CG1   1 
ATOM   9723  C CG2   . VAL C 1 43  ? 55.484  119.054 38.164  1.00 63.26  ? 43   VAL C CG2   1 
ATOM   9724  N N     . ARG C 1 44  ? 52.033  121.757 39.778  1.00 64.46  ? 44   ARG C N     1 
ATOM   9725  C CA    . ARG C 1 44  ? 50.692  122.308 40.001  1.00 65.21  ? 44   ARG C CA    1 
ATOM   9726  C C     . ARG C 1 44  ? 50.662  123.757 39.466  1.00 65.27  ? 44   ARG C C     1 
ATOM   9727  O O     . ARG C 1 44  ? 49.652  124.193 38.912  1.00 64.81  ? 44   ARG C O     1 
ATOM   9728  C CB    . ARG C 1 44  ? 50.343  122.236 41.505  1.00 66.22  ? 44   ARG C CB    1 
ATOM   9729  C CG    . ARG C 1 44  ? 48.847  122.352 41.902  1.00 66.83  ? 44   ARG C CG    1 
ATOM   9730  C CD    . ARG C 1 44  ? 48.615  121.863 43.383  1.00 67.51  ? 44   ARG C CD    1 
ATOM   9731  N NE    . ARG C 1 44  ? 47.194  121.843 43.780  1.00 73.48  ? 44   ARG C NE    1 
ATOM   9732  C CZ    . ARG C 1 44  ? 46.654  121.066 44.734  1.00 77.09  ? 44   ARG C CZ    1 
ATOM   9733  N NH1   . ARG C 1 44  ? 47.409  120.221 45.441  1.00 81.82  ? 44   ARG C NH1   1 
ATOM   9734  N NH2   . ARG C 1 44  ? 45.338  121.124 44.990  1.00 71.47  ? 44   ARG C NH2   1 
ATOM   9735  N N     . ASN C 1 45  ? 51.795  124.466 39.605  1.00 64.57  ? 45   ASN C N     1 
ATOM   9736  C CA    . ASN C 1 45  ? 51.992  125.843 39.109  1.00 64.67  ? 45   ASN C CA    1 
ATOM   9737  C C     . ASN C 1 45  ? 51.635  126.089 37.645  1.00 63.45  ? 45   ASN C C     1 
ATOM   9738  O O     . ASN C 1 45  ? 51.243  127.197 37.289  1.00 62.03  ? 45   ASN C O     1 
ATOM   9739  C CB    . ASN C 1 45  ? 53.455  126.286 39.312  1.00 65.18  ? 45   ASN C CB    1 
ATOM   9740  C CG    . ASN C 1 45  ? 53.829  126.457 40.781  1.00 70.47  ? 45   ASN C CG    1 
ATOM   9741  O OD1   . ASN C 1 45  ? 52.963  126.439 41.661  1.00 79.52  ? 45   ASN C OD1   1 
ATOM   9742  N ND2   . ASN C 1 45  ? 55.129  126.615 41.054  1.00 67.22  ? 45   ASN C ND2   1 
ATOM   9743  N N     . GLU C 1 46  ? 51.790  125.068 36.804  1.00 63.91  ? 46   GLU C N     1 
ATOM   9744  C CA    . GLU C 1 46  ? 51.560  125.193 35.355  1.00 63.15  ? 46   GLU C CA    1 
ATOM   9745  C C     . GLU C 1 46  ? 50.071  125.296 35.016  1.00 62.05  ? 46   GLU C C     1 
ATOM   9746  O O     . GLU C 1 46  ? 49.285  124.505 35.512  1.00 61.85  ? 46   GLU C O     1 
ATOM   9747  C CB    . GLU C 1 46  ? 52.165  124.003 34.590  1.00 63.43  ? 46   GLU C CB    1 
ATOM   9748  C CG    . GLU C 1 46  ? 53.688  123.894 34.637  1.00 61.83  ? 46   GLU C CG    1 
ATOM   9749  C CD    . GLU C 1 46  ? 54.388  125.144 34.136  1.00 64.85  ? 46   GLU C CD    1 
ATOM   9750  O OE1   . GLU C 1 46  ? 54.228  125.495 32.946  1.00 67.41  ? 46   GLU C OE1   1 
ATOM   9751  O OE2   . GLU C 1 46  ? 55.102  125.774 34.942  1.00 60.61  ? 46   GLU C OE2   1 
ATOM   9752  N N     . PRO C 1 47  ? 49.695  126.239 34.123  1.00 61.89  ? 47   PRO C N     1 
ATOM   9753  C CA    . PRO C 1 47  ? 48.291  126.607 33.903  1.00 60.66  ? 47   PRO C CA    1 
ATOM   9754  C C     . PRO C 1 47  ? 47.422  125.523 33.262  1.00 59.52  ? 47   PRO C C     1 
ATOM   9755  O O     . PRO C 1 47  ? 46.223  125.452 33.552  1.00 59.74  ? 47   PRO C O     1 
ATOM   9756  C CB    . PRO C 1 47  ? 48.376  127.824 32.961  1.00 61.30  ? 47   PRO C CB    1 
ATOM   9757  C CG    . PRO C 1 47  ? 49.795  128.210 32.899  1.00 62.46  ? 47   PRO C CG    1 
ATOM   9758  C CD    . PRO C 1 47  ? 50.591  126.996 33.229  1.00 62.52  ? 47   PRO C CD    1 
ATOM   9759  N N     . THR C 1 48  ? 48.009  124.692 32.404  1.00 57.95  ? 48   THR C N     1 
ATOM   9760  C CA    . THR C 1 48  ? 47.235  123.658 31.715  1.00 57.29  ? 48   THR C CA    1 
ATOM   9761  C C     . THR C 1 48  ? 47.723  122.244 32.014  1.00 56.99  ? 48   THR C C     1 
ATOM   9762  O O     . THR C 1 48  ? 48.753  122.045 32.668  1.00 58.39  ? 48   THR C O     1 
ATOM   9763  C CB    . THR C 1 48  ? 47.167  123.903 30.176  1.00 56.52  ? 48   THR C CB    1 
ATOM   9764  O OG1   . THR C 1 48  ? 48.446  123.688 29.568  1.00 58.01  ? 48   THR C OG1   1 
ATOM   9765  C CG2   . THR C 1 48  ? 46.696  125.318 29.891  1.00 55.16  ? 48   THR C CG2   1 
ATOM   9766  N N     . GLN C 1 49  ? 46.956  121.270 31.535  1.00 55.73  ? 49   GLN C N     1 
ATOM   9767  C CA    . GLN C 1 49  ? 47.191  119.855 31.816  1.00 56.21  ? 49   GLN C CA    1 
ATOM   9768  C C     . GLN C 1 49  ? 48.372  119.278 30.998  1.00 55.96  ? 49   GLN C C     1 
ATOM   9769  O O     . GLN C 1 49  ? 49.049  118.337 31.462  1.00 55.19  ? 49   GLN C O     1 
ATOM   9770  C CB    . GLN C 1 49  ? 45.876  119.103 31.567  1.00 55.85  ? 49   GLN C CB    1 
ATOM   9771  C CG    . GLN C 1 49  ? 45.904  117.595 31.586  1.00 55.52  ? 49   GLN C CG    1 
ATOM   9772  C CD    . GLN C 1 49  ? 44.521  117.036 31.291  1.00 59.05  ? 49   GLN C CD    1 
ATOM   9773  O OE1   . GLN C 1 49  ? 43.575  117.272 32.054  1.00 59.72  ? 49   GLN C OE1   1 
ATOM   9774  N NE2   . GLN C 1 49  ? 44.385  116.325 30.167  1.00 53.77  ? 49   GLN C NE2   1 
ATOM   9775  N N     . GLN C 1 50  ? 48.610  119.838 29.802  1.00 54.41  ? 50   GLN C N     1 
ATOM   9776  C CA    . GLN C 1 50  ? 49.806  119.517 28.999  1.00 55.09  ? 50   GLN C CA    1 
ATOM   9777  C C     . GLN C 1 50  ? 51.096  120.079 29.578  1.00 52.56  ? 50   GLN C C     1 
ATOM   9778  O O     . GLN C 1 50  ? 52.161  119.481 29.433  1.00 53.40  ? 50   GLN C O     1 
ATOM   9779  C CB    . GLN C 1 50  ? 49.721  120.084 27.581  1.00 55.26  ? 50   GLN C CB    1 
ATOM   9780  C CG    . GLN C 1 50  ? 48.535  119.645 26.770  1.00 59.19  ? 50   GLN C CG    1 
ATOM   9781  C CD    . GLN C 1 50  ? 48.724  119.943 25.278  1.00 61.20  ? 50   GLN C CD    1 
ATOM   9782  O OE1   . GLN C 1 50  ? 49.388  120.920 24.898  1.00 72.90  ? 50   GLN C OE1   1 
ATOM   9783  N NE2   . GLN C 1 50  ? 48.139  119.097 24.426  1.00 70.92  ? 50   GLN C NE2   1 
ATOM   9784  N N     . GLN C 1 51  ? 50.996  121.263 30.165  1.00 49.70  ? 51   GLN C N     1 
ATOM   9785  C CA    . GLN C 1 51  ? 52.133  121.934 30.754  1.00 49.09  ? 51   GLN C CA    1 
ATOM   9786  C C     . GLN C 1 51  ? 52.545  121.245 32.045  1.00 45.96  ? 51   GLN C C     1 
ATOM   9787  O O     . GLN C 1 51  ? 53.719  121.238 32.413  1.00 43.50  ? 51   GLN C O     1 
ATOM   9788  C CB    . GLN C 1 51  ? 51.795  123.408 30.978  1.00 49.61  ? 51   GLN C CB    1 
ATOM   9789  C CG    . GLN C 1 51  ? 51.782  124.208 29.670  1.00 52.78  ? 51   GLN C CG    1 
ATOM   9790  C CD    . GLN C 1 51  ? 51.292  125.623 29.845  1.00 49.62  ? 51   GLN C CD    1 
ATOM   9791  O OE1   . GLN C 1 51  ? 50.095  125.881 29.782  1.00 60.81  ? 51   GLN C OE1   1 
ATOM   9792  N NE2   . GLN C 1 51  ? 52.212  126.549 30.065  1.00 47.91  ? 51   GLN C NE2   1 
ATOM   9793  N N     . ARG C 1 52  ? 51.570  120.641 32.719  1.00 46.65  ? 52   ARG C N     1 
ATOM   9794  C CA    . ARG C 1 52  ? 51.827  119.899 33.975  1.00 45.91  ? 52   ARG C CA    1 
ATOM   9795  C C     . ARG C 1 52  ? 52.609  118.588 33.747  1.00 41.85  ? 52   ARG C C     1 
ATOM   9796  O O     . ARG C 1 52  ? 53.600  118.293 34.430  1.00 32.19  ? 52   ARG C O     1 
ATOM   9797  C CB    . ARG C 1 52  ? 50.512  119.637 34.691  1.00 43.38  ? 52   ARG C CB    1 
ATOM   9798  C CG    . ARG C 1 52  ? 49.880  120.917 35.205  1.00 48.53  ? 52   ARG C CG    1 
ATOM   9799  C CD    . ARG C 1 52  ? 48.543  120.686 35.848  1.00 48.94  ? 52   ARG C CD    1 
ATOM   9800  N NE    . ARG C 1 52  ? 48.126  121.808 36.693  1.00 58.26  ? 52   ARG C NE    1 
ATOM   9801  C CZ    . ARG C 1 52  ? 47.076  121.777 37.520  1.00 62.35  ? 52   ARG C CZ    1 
ATOM   9802  N NH1   . ARG C 1 52  ? 46.328  120.682 37.628  1.00 63.88  ? 52   ARG C NH1   1 
ATOM   9803  N NH2   . ARG C 1 52  ? 46.769  122.846 38.246  1.00 58.89  ? 52   ARG C NH2   1 
ATOM   9804  N N     . ALA C 1 53  ? 52.165  117.834 32.749  1.00 42.60  ? 53   ALA C N     1 
ATOM   9805  C CA    . ALA C 1 53  ? 52.829  116.608 32.359  1.00 44.99  ? 53   ALA C CA    1 
ATOM   9806  C C     . ALA C 1 53  ? 54.226  116.875 31.797  1.00 46.27  ? 53   ALA C C     1 
ATOM   9807  O O     . ALA C 1 53  ? 55.216  116.316 32.307  1.00 48.43  ? 53   ALA C O     1 
ATOM   9808  C CB    . ALA C 1 53  ? 51.964  115.847 31.367  1.00 47.82  ? 53   ALA C CB    1 
ATOM   9809  N N     . ALA C 1 54  ? 54.308  117.750 30.782  1.00 46.58  ? 54   ALA C N     1 
ATOM   9810  C CA    . ALA C 1 54  ? 55.597  118.213 30.225  1.00 45.30  ? 54   ALA C CA    1 
ATOM   9811  C C     . ALA C 1 54  ? 56.592  118.511 31.335  1.00 43.81  ? 54   ALA C C     1 
ATOM   9812  O O     . ALA C 1 54  ? 57.715  118.033 31.305  1.00 40.89  ? 54   ALA C O     1 
ATOM   9813  C CB    . ALA C 1 54  ? 55.407  119.466 29.357  1.00 45.85  ? 54   ALA C CB    1 
ATOM   9814  N N     . MET C 1 55  ? 56.148  119.273 32.330  1.00 44.16  ? 55   MET C N     1 
ATOM   9815  C CA    . MET C 1 55  ? 57.013  119.686 33.419  1.00 44.19  ? 55   MET C CA    1 
ATOM   9816  C C     . MET C 1 55  ? 57.521  118.473 34.160  1.00 41.94  ? 55   MET C C     1 
ATOM   9817  O O     . MET C 1 55  ? 58.718  118.343 34.342  1.00 36.12  ? 55   MET C O     1 
ATOM   9818  C CB    . MET C 1 55  ? 56.265  120.614 34.379  1.00 45.93  ? 55   MET C CB    1 
ATOM   9819  C CG    . MET C 1 55  ? 57.085  121.061 35.610  1.00 48.19  ? 55   MET C CG    1 
ATOM   9820  S SD    . MET C 1 55  ? 58.363  122.304 35.323  1.00 63.33  ? 55   MET C SD    1 
ATOM   9821  C CE    . MET C 1 55  ? 57.482  123.536 34.352  1.00 54.59  ? 55   MET C CE    1 
ATOM   9822  N N     . LEU C 1 56  ? 56.594  117.588 34.557  1.00 43.30  ? 56   LEU C N     1 
ATOM   9823  C CA    . LEU C 1 56  ? 56.900  116.401 35.392  1.00 44.49  ? 56   LEU C CA    1 
ATOM   9824  C C     . LEU C 1 56  ? 57.782  115.335 34.714  1.00 43.30  ? 56   LEU C C     1 
ATOM   9825  O O     . LEU C 1 56  ? 58.673  114.738 35.352  1.00 38.47  ? 56   LEU C O     1 
ATOM   9826  C CB    . LEU C 1 56  ? 55.596  115.757 35.873  1.00 45.73  ? 56   LEU C CB    1 
ATOM   9827  C CG    . LEU C 1 56  ? 55.659  114.354 36.488  1.00 44.21  ? 56   LEU C CG    1 
ATOM   9828  C CD1   . LEU C 1 56  ? 56.346  114.375 37.818  1.00 41.53  ? 56   LEU C CD1   1 
ATOM   9829  C CD2   . LEU C 1 56  ? 54.259  113.778 36.602  1.00 46.44  ? 56   LEU C CD2   1 
ATOM   9830  N N     . ILE C 1 57  ? 57.503  115.082 33.437  1.00 44.40  ? 57   ILE C N     1 
ATOM   9831  C CA    . ILE C 1 57  ? 58.330  114.188 32.621  1.00 46.47  ? 57   ILE C CA    1 
ATOM   9832  C C     . ILE C 1 57  ? 59.765  114.681 32.529  1.00 47.04  ? 57   ILE C C     1 
ATOM   9833  O O     . ILE C 1 57  ? 60.705  113.930 32.795  1.00 45.16  ? 57   ILE C O     1 
ATOM   9834  C CB    . ILE C 1 57  ? 57.748  114.040 31.223  1.00 47.11  ? 57   ILE C CB    1 
ATOM   9835  C CG1   . ILE C 1 57  ? 56.445  113.242 31.313  1.00 44.78  ? 57   ILE C CG1   1 
ATOM   9836  C CG2   . ILE C 1 57  ? 58.763  113.373 30.266  1.00 43.92  ? 57   ILE C CG2   1 
ATOM   9837  C CD1   . ILE C 1 57  ? 55.556  113.451 30.142  1.00 48.14  ? 57   ILE C CD1   1 
ATOM   9838  N N     . LYS C 1 58  ? 59.920  115.958 32.184  1.00 51.14  ? 58   LYS C N     1 
ATOM   9839  C CA    . LYS C 1 58  ? 61.228  116.646 32.215  1.00 51.05  ? 58   LYS C CA    1 
ATOM   9840  C C     . LYS C 1 58  ? 62.012  116.265 33.486  1.00 51.96  ? 58   LYS C C     1 
ATOM   9841  O O     . LYS C 1 58  ? 63.228  116.115 33.459  1.00 54.77  ? 58   LYS C O     1 
ATOM   9842  C CB    . LYS C 1 58  ? 61.025  118.179 32.123  1.00 51.00  ? 58   LYS C CB    1 
ATOM   9843  C CG    . LYS C 1 58  ? 62.231  118.986 31.622  1.00 52.78  ? 58   LYS C CG    1 
ATOM   9844  C CD    . LYS C 1 58  ? 61.853  120.385 31.047  1.00 50.13  ? 58   LYS C CD    1 
ATOM   9845  C CE    . LYS C 1 58  ? 63.126  121.177 30.676  1.00 53.88  ? 58   LYS C CE    1 
ATOM   9846  N NZ    . LYS C 1 58  ? 62.936  122.333 29.712  1.00 54.47  ? 58   LYS C NZ    1 
ATOM   9847  N N     . MET C 1 59  ? 61.305  116.059 34.589  1.00 52.31  ? 59   MET C N     1 
ATOM   9848  C CA    . MET C 1 59  ? 61.953  115.839 35.882  1.00 53.25  ? 59   MET C CA    1 
ATOM   9849  C C     . MET C 1 59  ? 62.333  114.377 36.096  1.00 53.36  ? 59   MET C C     1 
ATOM   9850  O O     . MET C 1 59  ? 63.391  114.104 36.669  1.00 55.20  ? 59   MET C O     1 
ATOM   9851  C CB    . MET C 1 59  ? 61.051  116.327 37.027  1.00 54.46  ? 59   MET C CB    1 
ATOM   9852  C CG    . MET C 1 59  ? 60.135  117.496 36.632  1.00 56.79  ? 59   MET C CG    1 
ATOM   9853  S SD    . MET C 1 59  ? 59.176  118.276 37.942  1.00 59.02  ? 59   MET C SD    1 
ATOM   9854  C CE    . MET C 1 59  ? 60.169  119.754 38.236  1.00 62.44  ? 59   MET C CE    1 
ATOM   9855  N N     . ILE C 1 60  ? 61.479  113.447 35.647  1.00 51.85  ? 60   ILE C N     1 
ATOM   9856  C CA    . ILE C 1 60  ? 61.712  111.995 35.842  1.00 51.15  ? 60   ILE C CA    1 
ATOM   9857  C C     . ILE C 1 60  ? 62.865  111.465 34.979  1.00 50.16  ? 60   ILE C C     1 
ATOM   9858  O O     . ILE C 1 60  ? 63.607  110.556 35.409  1.00 47.68  ? 60   ILE C O     1 
ATOM   9859  C CB    . ILE C 1 60  ? 60.409  111.144 35.593  1.00 52.04  ? 60   ILE C CB    1 
ATOM   9860  C CG1   . ILE C 1 60  ? 59.446  111.261 36.780  1.00 51.43  ? 60   ILE C CG1   1 
ATOM   9861  C CG2   . ILE C 1 60  ? 60.718  109.657 35.365  1.00 50.58  ? 60   ILE C CG2   1 
ATOM   9862  C CD1   . ILE C 1 60  ? 58.007  110.997 36.395  1.00 50.92  ? 60   ILE C CD1   1 
ATOM   9863  N N     . LEU C 1 61  ? 63.022  112.035 33.776  1.00 50.30  ? 61   LEU C N     1 
ATOM   9864  C CA    . LEU C 1 61  ? 64.129  111.680 32.869  1.00 49.98  ? 61   LEU C CA    1 
ATOM   9865  C C     . LEU C 1 61  ? 65.474  111.794 33.564  1.00 50.50  ? 61   LEU C C     1 
ATOM   9866  O O     . LEU C 1 61  ? 66.431  111.084 33.225  1.00 49.15  ? 61   LEU C O     1 
ATOM   9867  C CB    . LEU C 1 61  ? 64.139  112.580 31.627  1.00 48.04  ? 61   LEU C CB    1 
ATOM   9868  C CG    . LEU C 1 61  ? 63.019  112.417 30.593  1.00 45.60  ? 61   LEU C CG    1 
ATOM   9869  C CD1   . LEU C 1 61  ? 62.605  113.750 30.004  1.00 45.28  ? 61   LEU C CD1   1 
ATOM   9870  C CD2   . LEU C 1 61  ? 63.417  111.459 29.487  1.00 47.49  ? 61   LEU C CD2   1 
ATOM   9871  N N     . LYS C 1 62  ? 65.545  112.688 34.545  1.00 52.16  ? 62   LYS C N     1 
ATOM   9872  C CA    . LYS C 1 62  ? 66.787  112.928 35.267  1.00 53.44  ? 62   LYS C CA    1 
ATOM   9873  C C     . LYS C 1 62  ? 67.016  111.906 36.396  1.00 53.91  ? 62   LYS C C     1 
ATOM   9874  O O     . LYS C 1 62  ? 68.088  111.903 37.007  1.00 55.31  ? 62   LYS C O     1 
ATOM   9875  C CB    . LYS C 1 62  ? 66.823  114.383 35.776  1.00 54.71  ? 62   LYS C CB    1 
ATOM   9876  C CG    . LYS C 1 62  ? 66.583  115.433 34.655  1.00 54.76  ? 62   LYS C CG    1 
ATOM   9877  C CD    . LYS C 1 62  ? 66.847  116.881 35.102  1.00 55.76  ? 62   LYS C CD    1 
ATOM   9878  C CE    . LYS C 1 62  ? 66.591  117.884 33.959  1.00 60.69  ? 62   LYS C CE    1 
ATOM   9879  N NZ    . LYS C 1 62  ? 67.343  119.184 34.103  1.00 56.54  ? 62   LYS C NZ    1 
ATOM   9880  N N     . LYS C 1 63  ? 66.045  111.006 36.618  1.00 53.56  ? 63   LYS C N     1 
ATOM   9881  C CA    . LYS C 1 63  ? 66.064  110.037 37.741  1.00 52.12  ? 63   LYS C CA    1 
ATOM   9882  C C     . LYS C 1 63  ? 66.440  108.597 37.348  1.00 50.76  ? 63   LYS C C     1 
ATOM   9883  O O     . LYS C 1 63  ? 66.613  108.280 36.170  1.00 50.52  ? 63   LYS C O     1 
ATOM   9884  C CB    . LYS C 1 63  ? 64.689  109.993 38.419  1.00 53.00  ? 63   LYS C CB    1 
ATOM   9885  C CG    . LYS C 1 63  ? 64.041  111.350 38.689  1.00 55.47  ? 63   LYS C CG    1 
ATOM   9886  C CD    . LYS C 1 63  ? 62.673  111.156 39.334  1.00 54.36  ? 63   LYS C CD    1 
ATOM   9887  C CE    . LYS C 1 63  ? 62.042  112.467 39.754  1.00 55.53  ? 63   LYS C CE    1 
ATOM   9888  N NZ    . LYS C 1 63  ? 62.490  112.875 41.109  1.00 59.39  ? 63   LYS C NZ    1 
ATOM   9889  N N     . ASP C 1 64  ? 66.519  107.726 38.356  1.00 48.46  ? 64   ASP C N     1 
ATOM   9890  C CA    . ASP C 1 64  ? 67.003  106.344 38.201  1.00 47.69  ? 64   ASP C CA    1 
ATOM   9891  C C     . ASP C 1 64  ? 66.009  105.345 37.560  1.00 44.85  ? 64   ASP C C     1 
ATOM   9892  O O     . ASP C 1 64  ? 64.871  105.676 37.245  1.00 42.73  ? 64   ASP C O     1 
ATOM   9893  C CB    . ASP C 1 64  ? 67.458  105.796 39.568  1.00 48.32  ? 64   ASP C CB    1 
ATOM   9894  C CG    . ASP C 1 64  ? 66.289  105.497 40.500  1.00 54.39  ? 64   ASP C CG    1 
ATOM   9895  O OD1   . ASP C 1 64  ? 65.414  106.376 40.652  1.00 56.52  ? 64   ASP C OD1   1 
ATOM   9896  O OD2   . ASP C 1 64  ? 66.247  104.384 41.077  1.00 64.78  ? 64   ASP C OD2   1 
ATOM   9897  N N     . ASN C 1 65  ? 66.491  104.116 37.380  1.00 44.34  ? 65   ASN C N     1 
ATOM   9898  C CA    . ASN C 1 65  ? 65.733  103.040 36.752  1.00 43.14  ? 65   ASN C CA    1 
ATOM   9899  C C     . ASN C 1 65  ? 64.451  102.701 37.490  1.00 42.63  ? 65   ASN C C     1 
ATOM   9900  O O     . ASN C 1 65  ? 63.413  102.477 36.854  1.00 43.39  ? 65   ASN C O     1 
ATOM   9901  C CB    . ASN C 1 65  ? 66.612  101.797 36.568  1.00 40.29  ? 65   ASN C CB    1 
ATOM   9902  C CG    . ASN C 1 65  ? 67.433  101.859 35.291  1.00 42.89  ? 65   ASN C CG    1 
ATOM   9903  O OD1   . ASN C 1 65  ? 67.038  102.512 34.328  1.00 39.70  ? 65   ASN C OD1   1 
ATOM   9904  N ND2   . ASN C 1 65  ? 68.576  101.175 35.272  1.00 38.64  ? 65   ASN C ND2   1 
ATOM   9905  N N     . ASP C 1 66  ? 64.509  102.724 38.823  1.00 41.48  ? 66   ASP C N     1 
ATOM   9906  C CA    . ASP C 1 66  ? 63.358  102.343 39.655  1.00 38.91  ? 66   ASP C CA    1 
ATOM   9907  C C     . ASP C 1 66  ? 62.252  103.379 39.608  1.00 35.52  ? 66   ASP C C     1 
ATOM   9908  O O     . ASP C 1 66  ? 61.070  102.996 39.638  1.00 30.05  ? 66   ASP C O     1 
ATOM   9909  C CB    . ASP C 1 66  ? 63.786  102.043 41.100  1.00 40.27  ? 66   ASP C CB    1 
ATOM   9910  C CG    . ASP C 1 66  ? 64.905  101.000 41.167  1.00 45.89  ? 66   ASP C CG    1 
ATOM   9911  O OD1   . ASP C 1 66  ? 66.099  101.409 41.097  1.00 58.40  ? 66   ASP C OD1   1 
ATOM   9912  O OD2   . ASP C 1 66  ? 64.599  99.788  41.259  1.00 35.53  ? 66   ASP C OD2   1 
ATOM   9913  N N     . SER C 1 67  ? 62.631  104.665 39.483  1.00 33.66  ? 67   SER C N     1 
ATOM   9914  C CA    . SER C 1 67  ? 61.666  105.770 39.260  1.00 34.64  ? 67   SER C CA    1 
ATOM   9915  C C     . SER C 1 67  ? 60.881  105.671 37.961  1.00 33.73  ? 67   SER C C     1 
ATOM   9916  O O     . SER C 1 67  ? 59.685  105.984 37.938  1.00 35.80  ? 67   SER C O     1 
ATOM   9917  C CB    . SER C 1 67  ? 62.339  107.131 39.264  1.00 34.00  ? 67   SER C CB    1 
ATOM   9918  O OG    . SER C 1 67  ? 63.046  107.311 40.451  1.00 43.20  ? 67   SER C OG    1 
ATOM   9919  N N     . TYR C 1 68  ? 61.549  105.270 36.880  1.00 32.91  ? 68   TYR C N     1 
ATOM   9920  C CA    . TYR C 1 68  ? 60.839  104.953 35.633  1.00 32.34  ? 68   TYR C CA    1 
ATOM   9921  C C     . TYR C 1 68  ? 59.676  103.978 35.904  1.00 30.20  ? 68   TYR C C     1 
ATOM   9922  O O     . TYR C 1 68  ? 58.535  104.270 35.570  1.00 27.64  ? 68   TYR C O     1 
ATOM   9923  C CB    . TYR C 1 68  ? 61.807  104.371 34.612  1.00 30.18  ? 68   TYR C CB    1 
ATOM   9924  C CG    . TYR C 1 68  ? 61.224  104.100 33.239  1.00 30.33  ? 68   TYR C CG    1 
ATOM   9925  C CD1   . TYR C 1 68  ? 60.518  102.914 32.964  1.00 26.27  ? 68   TYR C CD1   1 
ATOM   9926  C CD2   . TYR C 1 68  ? 61.409  105.018 32.198  1.00 28.57  ? 68   TYR C CD2   1 
ATOM   9927  C CE1   . TYR C 1 68  ? 59.993  102.657 31.685  1.00 26.32  ? 68   TYR C CE1   1 
ATOM   9928  C CE2   . TYR C 1 68  ? 60.906  104.774 30.915  1.00 28.47  ? 68   TYR C CE2   1 
ATOM   9929  C CZ    . TYR C 1 68  ? 60.198  103.600 30.663  1.00 30.71  ? 68   TYR C CZ    1 
ATOM   9930  O OH    . TYR C 1 68  ? 59.719  103.396 29.391  1.00 27.80  ? 68   TYR C OH    1 
ATOM   9931  N N     . VAL C 1 69  ? 59.971  102.855 36.563  1.00 29.75  ? 69   VAL C N     1 
ATOM   9932  C CA    . VAL C 1 69  ? 58.965  101.818 36.824  1.00 31.40  ? 69   VAL C CA    1 
ATOM   9933  C C     . VAL C 1 69  ? 57.847  102.300 37.783  1.00 31.18  ? 69   VAL C C     1 
ATOM   9934  O O     . VAL C 1 69  ? 56.659  102.011 37.590  1.00 29.46  ? 69   VAL C O     1 
ATOM   9935  C CB    . VAL C 1 69  ? 59.646  100.474 37.339  1.00 32.57  ? 69   VAL C CB    1 
ATOM   9936  C CG1   . VAL C 1 69  ? 58.588  99.405  37.692  1.00 30.42  ? 69   VAL C CG1   1 
ATOM   9937  C CG2   . VAL C 1 69  ? 60.633  99.937  36.286  1.00 32.20  ? 69   VAL C CG2   1 
ATOM   9938  N N     . SER C 1 70  ? 58.258  103.031 38.812  1.00 32.10  ? 70   SER C N     1 
ATOM   9939  C CA    . SER C 1 70  ? 57.349  103.706 39.731  1.00 32.25  ? 70   SER C CA    1 
ATOM   9940  C C     . SER C 1 70  ? 56.371  104.628 38.998  1.00 30.36  ? 70   SER C C     1 
ATOM   9941  O O     . SER C 1 70  ? 55.196  104.628 39.276  1.00 30.38  ? 70   SER C O     1 
ATOM   9942  C CB    . SER C 1 70  ? 58.167  104.535 40.747  1.00 32.41  ? 70   SER C CB    1 
ATOM   9943  O OG    . SER C 1 70  ? 57.326  105.447 41.422  1.00 35.81  ? 70   SER C OG    1 
ATOM   9944  N N     . PHE C 1 71  ? 56.888  105.438 38.082  1.00 29.48  ? 71   PHE C N     1 
ATOM   9945  C CA    . PHE C 1 71  ? 56.055  106.263 37.235  1.00 28.73  ? 71   PHE C CA    1 
ATOM   9946  C C     . PHE C 1 71  ? 55.162  105.408 36.291  1.00 29.88  ? 71   PHE C C     1 
ATOM   9947  O O     . PHE C 1 71  ? 53.984  105.725 36.111  1.00 28.72  ? 71   PHE C O     1 
ATOM   9948  C CB    . PHE C 1 71  ? 56.960  107.186 36.465  1.00 29.76  ? 71   PHE C CB    1 
ATOM   9949  C CG    . PHE C 1 71  ? 56.267  108.049 35.486  1.00 27.32  ? 71   PHE C CG    1 
ATOM   9950  C CD1   . PHE C 1 71  ? 55.227  108.868 35.880  1.00 29.15  ? 71   PHE C CD1   1 
ATOM   9951  C CD2   . PHE C 1 71  ? 56.705  108.102 34.161  1.00 28.31  ? 71   PHE C CD2   1 
ATOM   9952  C CE1   . PHE C 1 71  ? 54.582  109.708 34.949  1.00 31.75  ? 71   PHE C CE1   1 
ATOM   9953  C CE2   . PHE C 1 71  ? 56.069  108.936 33.231  1.00 34.59  ? 71   PHE C CE2   1 
ATOM   9954  C CZ    . PHE C 1 71  ? 54.998  109.737 33.630  1.00 28.93  ? 71   PHE C CZ    1 
ATOM   9955  N N     . TYR C 1 72  ? 55.713  104.329 35.714  1.00 29.27  ? 72   TYR C N     1 
ATOM   9956  C CA    . TYR C 1 72  ? 54.923  103.362 34.908  1.00 28.66  ? 72   TYR C CA    1 
ATOM   9957  C C     . TYR C 1 72  ? 53.730  102.821 35.731  1.00 28.00  ? 72   TYR C C     1 
ATOM   9958  O O     . TYR C 1 72  ? 52.605  102.753 35.245  1.00 25.30  ? 72   TYR C O     1 
ATOM   9959  C CB    . TYR C 1 72  ? 55.834  102.215 34.352  1.00 29.67  ? 72   TYR C CB    1 
ATOM   9960  C CG    . TYR C 1 72  ? 55.096  100.998 33.792  1.00 28.98  ? 72   TYR C CG    1 
ATOM   9961  C CD1   . TYR C 1 72  ? 54.539  101.015 32.502  1.00 36.42  ? 72   TYR C CD1   1 
ATOM   9962  C CD2   . TYR C 1 72  ? 54.926  99.845  34.561  1.00 33.05  ? 72   TYR C CD2   1 
ATOM   9963  C CE1   . TYR C 1 72  ? 53.841  99.917  31.999  1.00 33.39  ? 72   TYR C CE1   1 
ATOM   9964  C CE2   . TYR C 1 72  ? 54.222  98.735  34.065  1.00 33.69  ? 72   TYR C CE2   1 
ATOM   9965  C CZ    . TYR C 1 72  ? 53.685  98.776  32.776  1.00 37.04  ? 72   TYR C CZ    1 
ATOM   9966  O OH    . TYR C 1 72  ? 52.978  97.677  32.261  1.00 38.35  ? 72   TYR C OH    1 
ATOM   9967  N N     . ASN C 1 73  ? 53.983  102.507 36.998  1.00 29.39  ? 73   ASN C N     1 
ATOM   9968  C CA    . ASN C 1 73  ? 52.981  101.935 37.891  1.00 30.49  ? 73   ASN C CA    1 
ATOM   9969  C C     . ASN C 1 73  ? 51.988  102.926 38.491  1.00 32.73  ? 73   ASN C C     1 
ATOM   9970  O O     . ASN C 1 73  ? 50.785  102.623 38.680  1.00 30.99  ? 73   ASN C O     1 
ATOM   9971  C CB    . ASN C 1 73  ? 53.679  101.115 38.984  1.00 30.60  ? 73   ASN C CB    1 
ATOM   9972  C CG    . ASN C 1 73  ? 53.984  99.680  38.520  1.00 31.27  ? 73   ASN C CG    1 
ATOM   9973  O OD1   . ASN C 1 73  ? 53.105  98.968  37.993  1.00 33.02  ? 73   ASN C OD1   1 
ATOM   9974  N ND2   . ASN C 1 73  ? 55.210  99.258  38.713  1.00 26.17  ? 73   ASN C ND2   1 
ATOM   9975  N N     . ALA C 1 74  ? 52.486  104.115 38.780  1.00 33.92  ? 74   ALA C N     1 
ATOM   9976  C CA    . ALA C 1 74  ? 51.612  105.241 39.077  1.00 32.76  ? 74   ALA C CA    1 
ATOM   9977  C C     . ALA C 1 74  ? 50.601  105.441 37.937  1.00 31.08  ? 74   ALA C C     1 
ATOM   9978  O O     . ALA C 1 74  ? 49.393  105.568 38.181  1.00 31.83  ? 74   ALA C O     1 
ATOM   9979  C CB    . ALA C 1 74  ? 52.448  106.482 39.301  1.00 33.71  ? 74   ALA C CB    1 
ATOM   9980  N N     . LEU C 1 75  ? 51.082  105.435 36.695  1.00 30.93  ? 75   LEU C N     1 
ATOM   9981  C CA    . LEU C 1 75  ? 50.202  105.548 35.520  1.00 32.57  ? 75   LEU C CA    1 
ATOM   9982  C C     . LEU C 1 75  ? 49.150  104.424 35.410  1.00 31.70  ? 75   LEU C C     1 
ATOM   9983  O O     . LEU C 1 75  ? 48.027  104.659 34.974  1.00 34.25  ? 75   LEU C O     1 
ATOM   9984  C CB    . LEU C 1 75  ? 51.008  105.589 34.219  1.00 30.86  ? 75   LEU C CB    1 
ATOM   9985  C CG    . LEU C 1 75  ? 51.878  106.795 33.841  1.00 34.45  ? 75   LEU C CG    1 
ATOM   9986  C CD1   . LEU C 1 75  ? 52.743  106.396 32.690  1.00 29.65  ? 75   LEU C CD1   1 
ATOM   9987  C CD2   . LEU C 1 75  ? 51.055  108.013 33.457  1.00 39.73  ? 75   LEU C CD2   1 
ATOM   9988  N N     . LEU C 1 76  ? 49.518  103.207 35.773  1.00 31.84  ? 76   LEU C N     1 
ATOM   9989  C CA    . LEU C 1 76  ? 48.572  102.092 35.731  1.00 36.46  ? 76   LEU C CA    1 
ATOM   9990  C C     . LEU C 1 76  ? 47.555  102.189 36.869  1.00 39.22  ? 76   LEU C C     1 
ATOM   9991  O O     . LEU C 1 76  ? 46.336  102.064 36.653  1.00 38.62  ? 76   LEU C O     1 
ATOM   9992  C CB    . LEU C 1 76  ? 49.310  100.745 35.806  1.00 35.95  ? 76   LEU C CB    1 
ATOM   9993  C CG    . LEU C 1 76  ? 50.100  100.312 34.578  1.00 37.52  ? 76   LEU C CG    1 
ATOM   9994  C CD1   . LEU C 1 76  ? 50.686  98.951  34.840  1.00 37.14  ? 76   LEU C CD1   1 
ATOM   9995  C CD2   . LEU C 1 76  ? 49.205  100.289 33.326  1.00 41.17  ? 76   LEU C CD2   1 
ATOM   9996  N N     . HIS C 1 77  ? 48.074  102.392 38.082  1.00 41.74  ? 77   HIS C N     1 
ATOM   9997  C CA    . HIS C 1 77  ? 47.257  102.689 39.253  1.00 41.71  ? 77   HIS C CA    1 
ATOM   9998  C C     . HIS C 1 77  ? 46.170  103.718 38.873  1.00 42.75  ? 77   HIS C C     1 
ATOM   9999  O O     . HIS C 1 77  ? 45.012  103.577 39.244  1.00 45.11  ? 77   HIS C O     1 
ATOM   10000 C CB    . HIS C 1 77  ? 48.183  103.175 40.382  1.00 43.13  ? 77   HIS C CB    1 
ATOM   10001 C CG    . HIS C 1 77  ? 47.536  103.311 41.728  1.00 47.37  ? 77   HIS C CG    1 
ATOM   10002 N ND1   . HIS C 1 77  ? 46.338  103.968 41.928  1.00 62.60  ? 77   HIS C ND1   1 
ATOM   10003 C CD2   . HIS C 1 77  ? 47.968  102.944 42.959  1.00 59.43  ? 77   HIS C CD2   1 
ATOM   10004 C CE1   . HIS C 1 77  ? 46.034  103.950 43.215  1.00 62.87  ? 77   HIS C CE1   1 
ATOM   10005 N NE2   . HIS C 1 77  ? 47.012  103.344 43.864  1.00 60.68  ? 77   HIS C NE2   1 
ATOM   10006 N N     . GLU C 1 78  ? 46.534  104.714 38.076  1.00 42.82  ? 78   GLU C N     1 
ATOM   10007 C CA    . GLU C 1 78  ? 45.632  105.805 37.746  1.00 41.67  ? 78   GLU C CA    1 
ATOM   10008 C C     . GLU C 1 78  ? 44.813  105.612 36.486  1.00 42.00  ? 78   GLU C C     1 
ATOM   10009 O O     . GLU C 1 78  ? 44.122  106.535 36.058  1.00 44.10  ? 78   GLU C O     1 
ATOM   10010 C CB    . GLU C 1 78  ? 46.444  107.113 37.657  1.00 41.23  ? 78   GLU C CB    1 
ATOM   10011 C CG    . GLU C 1 78  ? 46.867  107.627 38.995  1.00 32.78  ? 78   GLU C CG    1 
ATOM   10012 C CD    . GLU C 1 78  ? 45.697  107.652 39.994  1.00 38.03  ? 78   GLU C CD    1 
ATOM   10013 O OE1   . GLU C 1 78  ? 44.590  108.101 39.618  1.00 35.58  ? 78   GLU C OE1   1 
ATOM   10014 O OE2   . GLU C 1 78  ? 45.877  107.220 41.145  1.00 31.57  ? 78   GLU C OE2   1 
ATOM   10015 N N     . GLY C 1 79  ? 44.905  104.437 35.876  1.00 42.29  ? 79   GLY C N     1 
ATOM   10016 C CA    . GLY C 1 79  ? 44.101  104.099 34.698  1.00 43.60  ? 79   GLY C CA    1 
ATOM   10017 C C     . GLY C 1 79  ? 44.548  104.576 33.323  1.00 45.43  ? 79   GLY C C     1 
ATOM   10018 O O     . GLY C 1 79  ? 43.739  104.679 32.409  1.00 44.66  ? 79   GLY C O     1 
ATOM   10019 N N     . TYR C 1 80  ? 45.840  104.824 33.148  1.00 46.93  ? 80   TYR C N     1 
ATOM   10020 C CA    . TYR C 1 80  ? 46.359  105.259 31.857  1.00 47.65  ? 80   TYR C CA    1 
ATOM   10021 C C     . TYR C 1 80  ? 46.929  104.068 31.111  1.00 50.11  ? 80   TYR C C     1 
ATOM   10022 O O     . TYR C 1 80  ? 48.141  104.003 30.806  1.00 47.07  ? 80   TYR C O     1 
ATOM   10023 C CB    . TYR C 1 80  ? 47.433  106.333 32.024  1.00 46.40  ? 80   TYR C CB    1 
ATOM   10024 C CG    . TYR C 1 80  ? 46.914  107.650 32.530  1.00 42.27  ? 80   TYR C CG    1 
ATOM   10025 C CD1   . TYR C 1 80  ? 46.217  108.497 31.697  1.00 43.38  ? 80   TYR C CD1   1 
ATOM   10026 C CD2   . TYR C 1 80  ? 47.152  108.054 33.835  1.00 44.30  ? 80   TYR C CD2   1 
ATOM   10027 C CE1   . TYR C 1 80  ? 45.779  109.716 32.141  1.00 42.82  ? 80   TYR C CE1   1 
ATOM   10028 C CE2   . TYR C 1 80  ? 46.709  109.251 34.291  1.00 46.06  ? 80   TYR C CE2   1 
ATOM   10029 C CZ    . TYR C 1 80  ? 46.021  110.083 33.437  1.00 45.33  ? 80   TYR C CZ    1 
ATOM   10030 O OH    . TYR C 1 80  ? 45.568  111.298 33.897  1.00 54.96  ? 80   TYR C OH    1 
ATOM   10031 N N     . LYS C 1 81  ? 46.012  103.164 30.780  1.00 52.13  ? 81   LYS C N     1 
ATOM   10032 C CA    . LYS C 1 81  ? 46.311  101.885 30.169  1.00 53.19  ? 81   LYS C CA    1 
ATOM   10033 C C     . LYS C 1 81  ? 47.224  102.026 28.943  1.00 55.06  ? 81   LYS C C     1 
ATOM   10034 O O     . LYS C 1 81  ? 48.262  101.351 28.828  1.00 55.92  ? 81   LYS C O     1 
ATOM   10035 C CB    . LYS C 1 81  ? 44.985  101.239 29.782  1.00 54.81  ? 81   LYS C CB    1 
ATOM   10036 C CG    . LYS C 1 81  ? 45.015  99.727  29.653  1.00 57.81  ? 81   LYS C CG    1 
ATOM   10037 C CD    . LYS C 1 81  ? 43.863  99.246  28.763  1.00 57.23  ? 81   LYS C CD    1 
ATOM   10038 C CE    . LYS C 1 81  ? 44.167  97.893  28.133  1.00 61.70  ? 81   LYS C CE    1 
ATOM   10039 N NZ    . LYS C 1 81  ? 43.030  97.420  27.273  1.00 68.58  ? 81   LYS C NZ    1 
ATOM   10040 N N     . ASP C 1 82  ? 46.860  102.933 28.045  1.00 54.88  ? 82   ASP C N     1 
ATOM   10041 C CA    . ASP C 1 82  ? 47.505  102.997 26.734  1.00 54.05  ? 82   ASP C CA    1 
ATOM   10042 C C     . ASP C 1 82  ? 48.864  103.697 26.779  1.00 52.45  ? 82   ASP C C     1 
ATOM   10043 O O     . ASP C 1 82  ? 49.822  103.246 26.153  1.00 54.33  ? 82   ASP C O     1 
ATOM   10044 C CB    . ASP C 1 82  ? 46.567  103.670 25.719  1.00 55.65  ? 82   ASP C CB    1 
ATOM   10045 C CG    . ASP C 1 82  ? 45.256  102.902 25.528  1.00 62.35  ? 82   ASP C CG    1 
ATOM   10046 O OD1   . ASP C 1 82  ? 45.247  101.659 25.736  1.00 67.29  ? 82   ASP C OD1   1 
ATOM   10047 O OD2   . ASP C 1 82  ? 44.238  103.545 25.167  1.00 66.71  ? 82   ASP C OD2   1 
ATOM   10048 N N     . LEU C 1 83  ? 48.939  104.790 27.526  1.00 49.63  ? 83   LEU C N     1 
ATOM   10049 C CA    . LEU C 1 83  ? 50.198  105.505 27.747  1.00 48.29  ? 83   LEU C CA    1 
ATOM   10050 C C     . LEU C 1 83  ? 51.252  104.681 28.481  1.00 46.45  ? 83   LEU C C     1 
ATOM   10051 O O     . LEU C 1 83  ? 52.434  104.782 28.176  1.00 45.59  ? 83   LEU C O     1 
ATOM   10052 C CB    . LEU C 1 83  ? 49.935  106.774 28.549  1.00 48.23  ? 83   LEU C CB    1 
ATOM   10053 C CG    . LEU C 1 83  ? 49.127  107.835 27.809  1.00 45.72  ? 83   LEU C CG    1 
ATOM   10054 C CD1   . LEU C 1 83  ? 48.864  108.950 28.758  1.00 40.24  ? 83   LEU C CD1   1 
ATOM   10055 C CD2   . LEU C 1 83  ? 49.879  108.336 26.596  1.00 49.11  ? 83   LEU C CD2   1 
ATOM   10056 N N     . ALA C 1 84  ? 50.816  103.900 29.465  1.00 45.20  ? 84   ALA C N     1 
ATOM   10057 C CA    . ALA C 1 84  ? 51.695  102.971 30.173  1.00 44.70  ? 84   ALA C CA    1 
ATOM   10058 C C     . ALA C 1 84  ? 52.150  101.864 29.243  1.00 43.24  ? 84   ALA C C     1 
ATOM   10059 O O     . ALA C 1 84  ? 53.260  101.358 29.380  1.00 45.20  ? 84   ALA C O     1 
ATOM   10060 C CB    . ALA C 1 84  ? 50.987  102.390 31.399  1.00 43.67  ? 84   ALA C CB    1 
ATOM   10061 N N     . ALA C 1 85  ? 51.302  101.510 28.275  1.00 43.84  ? 85   ALA C N     1 
ATOM   10062 C CA    . ALA C 1 85  ? 51.630  100.476 27.270  1.00 43.23  ? 85   ALA C CA    1 
ATOM   10063 C C     . ALA C 1 85  ? 52.759  100.919 26.389  1.00 41.47  ? 85   ALA C C     1 
ATOM   10064 O O     . ALA C 1 85  ? 53.573  100.111 25.973  1.00 41.22  ? 85   ALA C O     1 
ATOM   10065 C CB    . ALA C 1 85  ? 50.406  100.127 26.413  1.00 44.46  ? 85   ALA C CB    1 
ATOM   10066 N N     . LEU C 1 86  ? 52.799  102.219 26.111  1.00 42.34  ? 86   LEU C N     1 
ATOM   10067 C CA    . LEU C 1 86  ? 53.898  102.821 25.378  1.00 41.42  ? 86   LEU C CA    1 
ATOM   10068 C C     . LEU C 1 86  ? 55.198  102.847 26.176  1.00 41.36  ? 86   LEU C C     1 
ATOM   10069 O O     . LEU C 1 86  ? 56.286  102.712 25.597  1.00 40.48  ? 86   LEU C O     1 
ATOM   10070 C CB    . LEU C 1 86  ? 53.532  104.236 24.946  1.00 41.27  ? 86   LEU C CB    1 
ATOM   10071 C CG    . LEU C 1 86  ? 52.267  104.337 24.090  1.00 46.42  ? 86   LEU C CG    1 
ATOM   10072 C CD1   . LEU C 1 86  ? 52.074  105.765 23.555  1.00 43.05  ? 86   LEU C CD1   1 
ATOM   10073 C CD2   . LEU C 1 86  ? 52.308  103.295 22.947  1.00 47.79  ? 86   LEU C CD2   1 
ATOM   10074 N N     . LEU C 1 87  ? 55.108  103.029 27.495  1.00 40.39  ? 87   LEU C N     1 
ATOM   10075 C CA    . LEU C 1 87  ? 56.323  103.019 28.310  1.00 39.71  ? 87   LEU C CA    1 
ATOM   10076 C C     . LEU C 1 87  ? 56.791  101.610 28.591  1.00 37.59  ? 87   LEU C C     1 
ATOM   10077 O O     . LEU C 1 87  ? 57.928  101.432 28.953  1.00 35.59  ? 87   LEU C O     1 
ATOM   10078 C CB    . LEU C 1 87  ? 56.133  103.775 29.620  1.00 40.37  ? 87   LEU C CB    1 
ATOM   10079 C CG    . LEU C 1 87  ? 56.091  105.304 29.565  1.00 41.32  ? 87   LEU C CG    1 
ATOM   10080 C CD1   . LEU C 1 87  ? 55.932  105.834 30.973  1.00 41.16  ? 87   LEU C CD1   1 
ATOM   10081 C CD2   . LEU C 1 87  ? 57.327  105.915 28.909  1.00 39.63  ? 87   LEU C CD2   1 
ATOM   10082 N N     . HIS C 1 88  ? 55.916  100.622 28.380  1.00 39.62  ? 88   HIS C N     1 
ATOM   10083 C CA    . HIS C 1 88  ? 56.152  99.235  28.779  1.00 40.65  ? 88   HIS C CA    1 
ATOM   10084 C C     . HIS C 1 88  ? 57.477  98.625  28.319  1.00 41.26  ? 88   HIS C C     1 
ATOM   10085 O O     . HIS C 1 88  ? 58.161  97.962  29.109  1.00 40.75  ? 88   HIS C O     1 
ATOM   10086 C CB    . HIS C 1 88  ? 55.013  98.320  28.299  1.00 41.00  ? 88   HIS C CB    1 
ATOM   10087 C CG    . HIS C 1 88  ? 55.191  96.886  28.708  1.00 39.97  ? 88   HIS C CG    1 
ATOM   10088 N ND1   . HIS C 1 88  ? 54.750  96.398  29.918  1.00 46.06  ? 88   HIS C ND1   1 
ATOM   10089 C CD2   . HIS C 1 88  ? 55.806  95.851  28.088  1.00 39.46  ? 88   HIS C CD2   1 
ATOM   10090 C CE1   . HIS C 1 88  ? 55.062  95.118  30.017  1.00 48.47  ? 88   HIS C CE1   1 
ATOM   10091 N NE2   . HIS C 1 88  ? 55.705  94.762  28.920  1.00 44.33  ? 88   HIS C NE2   1 
ATOM   10092 N N     . ASP C 1 89  ? 57.820  98.815  27.049  1.00 41.02  ? 89   ASP C N     1 
ATOM   10093 C CA    . ASP C 1 89  ? 58.968  98.120  26.467  1.00 42.49  ? 89   ASP C CA    1 
ATOM   10094 C C     . ASP C 1 89  ? 60.258  98.760  26.969  1.00 41.23  ? 89   ASP C C     1 
ATOM   10095 O O     . ASP C 1 89  ? 61.281  98.093  27.069  1.00 40.74  ? 89   ASP C O     1 
ATOM   10096 C CB    . ASP C 1 89  ? 58.886  98.075  24.919  1.00 44.84  ? 89   ASP C CB    1 
ATOM   10097 C CG    . ASP C 1 89  ? 57.634  97.288  24.414  1.00 55.41  ? 89   ASP C CG    1 
ATOM   10098 O OD1   . ASP C 1 89  ? 57.633  96.033  24.503  1.00 60.94  ? 89   ASP C OD1   1 
ATOM   10099 O OD2   . ASP C 1 89  ? 56.643  97.921  23.951  1.00 56.15  ? 89   ASP C OD2   1 
ATOM   10100 N N     . GLY C 1 90  ? 60.188  100.040 27.329  1.00 39.20  ? 90   GLY C N     1 
ATOM   10101 C CA    . GLY C 1 90  ? 61.328  100.736 27.927  1.00 37.68  ? 90   GLY C CA    1 
ATOM   10102 C C     . GLY C 1 90  ? 61.632  100.352 29.372  1.00 35.31  ? 90   GLY C C     1 
ATOM   10103 O O     . GLY C 1 90  ? 62.640  100.800 29.905  1.00 30.97  ? 90   GLY C O     1 
ATOM   10104 N N     . ILE C 1 91  ? 60.762  99.555  30.017  1.00 34.85  ? 91   ILE C N     1 
ATOM   10105 C CA    . ILE C 1 91  ? 60.969  99.153  31.414  1.00 35.88  ? 91   ILE C CA    1 
ATOM   10106 C C     . ILE C 1 91  ? 62.334  98.488  31.558  1.00 36.13  ? 91   ILE C C     1 
ATOM   10107 O O     . ILE C 1 91  ? 62.597  97.473  30.903  1.00 37.05  ? 91   ILE C O     1 
ATOM   10108 C CB    . ILE C 1 91  ? 59.898  98.144  31.924  1.00 34.67  ? 91   ILE C CB    1 
ATOM   10109 C CG1   . ILE C 1 91  ? 58.576  98.846  32.208  1.00 34.76  ? 91   ILE C CG1   1 
ATOM   10110 C CG2   . ILE C 1 91  ? 60.368  97.445  33.217  1.00 32.79  ? 91   ILE C CG2   1 
ATOM   10111 C CD1   . ILE C 1 91  ? 57.384  97.897  32.209  1.00 37.94  ? 91   ILE C CD1   1 
ATOM   10112 N N     . PRO C 1 92  ? 63.217  99.050  32.405  1.00 35.86  ? 92   PRO C N     1 
ATOM   10113 C CA    . PRO C 1 92  ? 64.460  98.314  32.606  1.00 37.10  ? 92   PRO C CA    1 
ATOM   10114 C C     . PRO C 1 92  ? 64.215  96.963  33.316  1.00 38.21  ? 92   PRO C C     1 
ATOM   10115 O O     . PRO C 1 92  ? 63.466  96.896  34.309  1.00 35.30  ? 92   PRO C O     1 
ATOM   10116 C CB    . PRO C 1 92  ? 65.299  99.268  33.461  1.00 37.42  ? 92   PRO C CB    1 
ATOM   10117 C CG    . PRO C 1 92  ? 64.641  100.594 33.326  1.00 34.66  ? 92   PRO C CG    1 
ATOM   10118 C CD    . PRO C 1 92  ? 63.203  100.305 33.171  1.00 32.85  ? 92   PRO C CD    1 
ATOM   10119 N N     . VAL C 1 93  ? 64.834  95.906  32.777  1.00 40.61  ? 93   VAL C N     1 
ATOM   10120 C CA    . VAL C 1 93  ? 64.632  94.530  33.245  1.00 40.90  ? 93   VAL C CA    1 
ATOM   10121 C C     . VAL C 1 93  ? 65.082  94.380  34.708  1.00 41.96  ? 93   VAL C C     1 
ATOM   10122 O O     . VAL C 1 93  ? 64.405  93.723  35.505  1.00 40.50  ? 93   VAL C O     1 
ATOM   10123 C CB    . VAL C 1 93  ? 65.375  93.504  32.346  1.00 39.95  ? 93   VAL C CB    1 
ATOM   10124 C CG1   . VAL C 1 93  ? 65.271  92.102  32.919  1.00 43.56  ? 93   VAL C CG1   1 
ATOM   10125 C CG2   . VAL C 1 93  ? 64.807  93.519  30.951  1.00 38.35  ? 93   VAL C CG2   1 
ATOM   10126 N N     . VAL C 1 94  ? 66.197  95.021  35.065  1.00 43.12  ? 94   VAL C N     1 
ATOM   10127 C CA    . VAL C 1 94  ? 66.716  94.955  36.443  1.00 44.47  ? 94   VAL C CA    1 
ATOM   10128 C C     . VAL C 1 94  ? 65.751  95.581  37.488  1.00 46.18  ? 94   VAL C C     1 
ATOM   10129 O O     . VAL C 1 94  ? 65.888  95.326  38.683  1.00 46.70  ? 94   VAL C O     1 
ATOM   10130 C CB    . VAL C 1 94  ? 68.152  95.565  36.528  1.00 43.26  ? 94   VAL C CB    1 
ATOM   10131 C CG1   . VAL C 1 94  ? 68.629  95.693  37.965  1.00 38.46  ? 94   VAL C CG1   1 
ATOM   10132 C CG2   . VAL C 1 94  ? 69.130  94.702  35.730  1.00 44.18  ? 94   VAL C CG2   1 
ATOM   10133 N N     . SER C 1 95  ? 64.764  96.354  37.027  1.00 47.69  ? 95   SER C N     1 
ATOM   10134 C CA    . SER C 1 95  ? 63.797  97.022  37.899  1.00 48.82  ? 95   SER C CA    1 
ATOM   10135 C C     . SER C 1 95  ? 62.367  96.502  37.711  1.00 51.43  ? 95   SER C C     1 
ATOM   10136 O O     . SER C 1 95  ? 61.418  97.118  38.202  1.00 51.16  ? 95   SER C O     1 
ATOM   10137 C CB    . SER C 1 95  ? 63.828  98.523  37.609  1.00 47.84  ? 95   SER C CB    1 
ATOM   10138 O OG    . SER C 1 95  ? 65.127  98.934  37.227  1.00 38.20  ? 95   SER C OG    1 
ATOM   10139 N N     . SER C 1 96  ? 62.230  95.353  37.047  1.00 54.83  ? 96   SER C N     1 
ATOM   10140 C CA    . SER C 1 96  ? 60.954  94.896  36.459  1.00 57.19  ? 96   SER C CA    1 
ATOM   10141 C C     . SER C 1 96  ? 59.802  94.709  37.450  1.00 61.05  ? 96   SER C C     1 
ATOM   10142 O O     . SER C 1 96  ? 58.650  95.054  37.145  1.00 62.30  ? 96   SER C O     1 
ATOM   10143 C CB    . SER C 1 96  ? 61.158  93.594  35.662  1.00 57.03  ? 96   SER C CB    1 
ATOM   10144 O OG    . SER C 1 96  ? 61.579  93.852  34.334  1.00 54.65  ? 96   SER C OG    1 
ATOM   10145 N N     . SER C 1 97  ? 60.097  94.134  38.612  1.00 63.26  ? 97   SER C N     1 
ATOM   10146 C CA    . SER C 1 97  ? 59.102  94.044  39.679  1.00 65.34  ? 97   SER C CA    1 
ATOM   10147 C C     . SER C 1 97  ? 59.786  94.366  40.999  1.00 67.01  ? 97   SER C C     1 
ATOM   10148 O O     . SER C 1 97  ? 60.596  93.588  41.498  1.00 66.46  ? 97   SER C O     1 
ATOM   10149 C CB    . SER C 1 97  ? 58.439  92.660  39.711  1.00 66.37  ? 97   SER C CB    1 
ATOM   10150 O OG    . SER C 1 97  ? 57.323  92.644  40.583  1.00 67.76  ? 97   SER C OG    1 
ATOM   10151 N N     . SER C 1 98  ? 59.454  95.532  41.546  1.00 69.12  ? 98   SER C N     1 
ATOM   10152 C CA    . SER C 1 98  ? 60.153  96.087  42.705  1.00 70.49  ? 98   SER C CA    1 
ATOM   10153 C C     . SER C 1 98  ? 59.802  95.357  44.016  1.00 72.62  ? 98   SER C C     1 
ATOM   10154 O O     . SER C 1 98  ? 58.855  94.545  44.068  1.00 72.81  ? 98   SER C O     1 
ATOM   10155 C CB    . SER C 1 98  ? 59.842  97.589  42.820  1.00 70.09  ? 98   SER C CB    1 
ATOM   10156 O OG    . SER C 1 98  ? 58.439  97.821  42.815  1.00 65.69  ? 98   SER C OG    1 
ATOM   10157 N N     . GLY C 1 99  ? 60.569  95.670  45.065  1.00 73.34  ? 99   GLY C N     1 
ATOM   10158 C CA    . GLY C 1 99  ? 60.377  95.102  46.404  1.00 74.55  ? 99   GLY C CA    1 
ATOM   10159 C C     . GLY C 1 99  ? 58.976  95.270  46.985  1.00 76.24  ? 99   GLY C C     1 
ATOM   10160 O O     . GLY C 1 99  ? 58.593  94.555  47.925  1.00 76.58  ? 99   GLY C O     1 
ATOM   10161 N N     . LYS C 1 100 ? 58.210  96.209  46.430  1.00 76.45  ? 100  LYS C N     1 
ATOM   10162 C CA    . LYS C 1 100 ? 56.818  96.394  46.829  1.00 76.12  ? 100  LYS C CA    1 
ATOM   10163 C C     . LYS C 1 100 ? 55.927  95.286  46.205  1.00 76.32  ? 100  LYS C C     1 
ATOM   10164 O O     . LYS C 1 100 ? 55.230  94.562  46.935  1.00 75.46  ? 100  LYS C O     1 
ATOM   10165 C CB    . LYS C 1 100 ? 56.348  97.817  46.473  1.00 76.12  ? 100  LYS C CB    1 
ATOM   10166 C CG    . LYS C 1 100 ? 55.403  98.457  47.512  1.00 76.75  ? 100  LYS C CG    1 
ATOM   10167 C CD    . LYS C 1 100 ? 55.855  99.872  47.908  1.00 76.54  ? 100  LYS C CD    1 
ATOM   10168 C CE    . LYS C 1 100 ? 54.977  100.473 49.013  1.00 76.24  ? 100  LYS C CE    1 
ATOM   10169 N NZ    . LYS C 1 100 ? 55.751  101.343 49.953  1.00 72.76  ? 100  LYS C NZ    1 
ATOM   10170 N N     . ASP C 1 101 ? 55.988  95.135  44.876  1.00 75.74  ? 101  ASP C N     1 
ATOM   10171 C CA    . ASP C 1 101 ? 55.189  94.121  44.140  1.00 74.90  ? 101  ASP C CA    1 
ATOM   10172 C C     . ASP C 1 101 ? 55.310  92.692  44.693  1.00 74.82  ? 101  ASP C C     1 
ATOM   10173 O O     . ASP C 1 101 ? 54.311  91.956  44.768  1.00 73.42  ? 101  ASP C O     1 
ATOM   10174 C CB    . ASP C 1 101 ? 55.581  94.083  42.654  1.00 73.67  ? 101  ASP C CB    1 
ATOM   10175 C CG    . ASP C 1 101 ? 54.927  95.181  41.838  1.00 72.22  ? 101  ASP C CG    1 
ATOM   10176 O OD1   . ASP C 1 101 ? 54.843  96.330  42.331  1.00 57.69  ? 101  ASP C OD1   1 
ATOM   10177 O OD2   . ASP C 1 101 ? 54.513  94.887  40.689  1.00 70.38  ? 101  ASP C OD2   1 
ATOM   10178 N N     . SER C 1 102 ? 56.542  92.318  45.054  1.00 74.87  ? 102  SER C N     1 
ATOM   10179 C CA    . SER C 1 102 ? 56.893  90.965  45.534  1.00 73.63  ? 102  SER C CA    1 
ATOM   10180 C C     . SER C 1 102 ? 55.941  90.367  46.586  1.00 73.04  ? 102  SER C C     1 
ATOM   10181 O O     . SER C 1 102 ? 55.277  89.355  46.332  1.00 72.03  ? 102  SER C O     1 
ATOM   10182 C CB    . SER C 1 102 ? 58.316  90.976  46.107  1.00 73.14  ? 102  SER C CB    1 
ATOM   10183 O OG    . SER C 1 102 ? 58.398  91.837  47.228  1.00 71.30  ? 102  SER C OG    1 
ATOM   10184 N N     . VAL C 1 103 ? 55.882  90.998  47.757  1.00 72.48  ? 103  VAL C N     1 
ATOM   10185 C CA    . VAL C 1 103 ? 55.094  90.474  48.878  1.00 71.19  ? 103  VAL C CA    1 
ATOM   10186 C C     . VAL C 1 103 ? 53.705  91.127  48.974  1.00 69.73  ? 103  VAL C C     1 
ATOM   10187 O O     . VAL C 1 103 ? 52.831  90.608  49.684  1.00 70.65  ? 103  VAL C O     1 
ATOM   10188 C CB    . VAL C 1 103 ? 55.847  90.612  50.245  1.00 72.67  ? 103  VAL C CB    1 
ATOM   10189 C CG1   . VAL C 1 103 ? 55.232  89.684  51.306  1.00 72.91  ? 103  VAL C CG1   1 
ATOM   10190 C CG2   . VAL C 1 103 ? 57.350  90.313  50.087  1.00 75.41  ? 103  VAL C CG2   1 
ATOM   10191 N N     . SER C 1 104 ? 53.486  92.245  48.274  1.00 66.20  ? 104  SER C N     1 
ATOM   10192 C CA    . SER C 1 104 ? 52.141  92.854  48.249  1.00 63.02  ? 104  SER C CA    1 
ATOM   10193 C C     . SER C 1 104 ? 51.138  91.965  47.490  1.00 61.26  ? 104  SER C C     1 
ATOM   10194 O O     . SER C 1 104 ? 50.005  91.790  47.932  1.00 64.17  ? 104  SER C O     1 
ATOM   10195 C CB    . SER C 1 104 ? 52.154  94.284  47.661  1.00 62.86  ? 104  SER C CB    1 
ATOM   10196 O OG    . SER C 1 104 ? 52.349  94.297  46.250  1.00 52.49  ? 104  SER C OG    1 
ATOM   10197 N N     . GLY C 1 105 ? 51.562  91.390  46.367  1.00 57.88  ? 105  GLY C N     1 
ATOM   10198 C CA    . GLY C 1 105 ? 50.642  90.696  45.447  1.00 54.31  ? 105  GLY C CA    1 
ATOM   10199 C C     . GLY C 1 105 ? 49.981  91.641  44.446  1.00 50.26  ? 105  GLY C C     1 
ATOM   10200 O O     . GLY C 1 105 ? 49.080  91.236  43.702  1.00 44.74  ? 105  GLY C O     1 
ATOM   10201 N N     . ILE C 1 106 ? 50.424  92.904  44.427  1.00 48.29  ? 106  ILE C N     1 
ATOM   10202 C CA    . ILE C 1 106 ? 49.867  93.898  43.501  1.00 45.94  ? 106  ILE C CA    1 
ATOM   10203 C C     . ILE C 1 106 ? 50.823  94.142  42.330  1.00 43.20  ? 106  ILE C C     1 
ATOM   10204 O O     . ILE C 1 106 ? 51.861  94.792  42.458  1.00 42.60  ? 106  ILE C O     1 
ATOM   10205 C CB    . ILE C 1 106 ? 49.496  95.204  44.195  1.00 46.59  ? 106  ILE C CB    1 
ATOM   10206 C CG1   . ILE C 1 106 ? 48.642  94.947  45.436  1.00 49.05  ? 106  ILE C CG1   1 
ATOM   10207 C CG2   . ILE C 1 106 ? 48.664  96.103  43.265  1.00 47.00  ? 106  ILE C CG2   1 
ATOM   10208 C CD1   . ILE C 1 106 ? 48.351  96.244  46.216  1.00 47.56  ? 106  ILE C CD1   1 
ATOM   10209 N N     . THR C 1 107 ? 50.441  93.590  41.189  1.00 39.51  ? 107  THR C N     1 
ATOM   10210 C CA    . THR C 1 107 ? 51.214  93.667  39.982  1.00 37.02  ? 107  THR C CA    1 
ATOM   10211 C C     . THR C 1 107 ? 50.615  94.703  39.028  1.00 34.62  ? 107  THR C C     1 
ATOM   10212 O O     . THR C 1 107 ? 49.598  95.323  39.323  1.00 33.03  ? 107  THR C O     1 
ATOM   10213 C CB    . THR C 1 107 ? 51.230  92.294  39.344  1.00 35.71  ? 107  THR C CB    1 
ATOM   10214 O OG1   . THR C 1 107 ? 49.885  91.888  39.116  1.00 30.65  ? 107  THR C OG1   1 
ATOM   10215 C CG2   . THR C 1 107 ? 51.896  91.300  40.294  1.00 36.40  ? 107  THR C CG2   1 
ATOM   10216 N N     . SER C 1 108 ? 51.276  94.878  37.887  1.00 33.19  ? 108  SER C N     1 
ATOM   10217 C CA    . SER C 1 108 ? 50.768  95.669  36.764  1.00 32.16  ? 108  SER C CA    1 
ATOM   10218 C C     . SER C 1 108 ? 49.481  95.099  36.255  1.00 30.54  ? 108  SER C C     1 
ATOM   10219 O O     . SER C 1 108 ? 48.534  95.845  35.996  1.00 30.08  ? 108  SER C O     1 
ATOM   10220 C CB    . SER C 1 108 ? 51.795  95.672  35.631  1.00 30.24  ? 108  SER C CB    1 
ATOM   10221 O OG    . SER C 1 108 ? 52.995  96.206  36.098  1.00 34.77  ? 108  SER C OG    1 
ATOM   10222 N N     . TYR C 1 109 ? 49.462  93.774  36.120  1.00 30.53  ? 109  TYR C N     1 
ATOM   10223 C CA    . TYR C 1 109 ? 48.245  93.019  35.795  1.00 30.18  ? 109  TYR C CA    1 
ATOM   10224 C C     . TYR C 1 109 ? 47.089  93.416  36.710  1.00 28.48  ? 109  TYR C C     1 
ATOM   10225 O O     . TYR C 1 109 ? 46.016  93.810  36.264  1.00 29.79  ? 109  TYR C O     1 
ATOM   10226 C CB    . TYR C 1 109 ? 48.562  91.520  35.883  1.00 31.18  ? 109  TYR C CB    1 
ATOM   10227 C CG    . TYR C 1 109 ? 47.389  90.617  35.600  1.00 32.76  ? 109  TYR C CG    1 
ATOM   10228 C CD1   . TYR C 1 109 ? 46.920  90.409  34.293  1.00 34.75  ? 109  TYR C CD1   1 
ATOM   10229 C CD2   . TYR C 1 109 ? 46.733  89.979  36.643  1.00 35.41  ? 109  TYR C CD2   1 
ATOM   10230 C CE1   . TYR C 1 109 ? 45.815  89.581  34.052  1.00 37.53  ? 109  TYR C CE1   1 
ATOM   10231 C CE2   . TYR C 1 109 ? 45.662  89.147  36.416  1.00 30.84  ? 109  TYR C CE2   1 
ATOM   10232 C CZ    . TYR C 1 109 ? 45.202  88.943  35.128  1.00 38.80  ? 109  TYR C CZ    1 
ATOM   10233 O OH    . TYR C 1 109 ? 44.122  88.097  34.957  1.00 40.78  ? 109  TYR C OH    1 
ATOM   10234 N N     . VAL C 1 110 ? 47.307  93.345  38.013  1.00 29.95  ? 110  VAL C N     1 
ATOM   10235 C CA    . VAL C 1 110 ? 46.242  93.706  38.969  1.00 29.01  ? 110  VAL C CA    1 
ATOM   10236 C C     . VAL C 1 110 ? 45.770  95.153  38.788  1.00 28.43  ? 110  VAL C C     1 
ATOM   10237 O O     . VAL C 1 110 ? 44.565  95.438  38.787  1.00 24.75  ? 110  VAL C O     1 
ATOM   10238 C CB    . VAL C 1 110 ? 46.714  93.525  40.426  1.00 29.61  ? 110  VAL C CB    1 
ATOM   10239 C CG1   . VAL C 1 110 ? 45.753  94.212  41.412  1.00 30.52  ? 110  VAL C CG1   1 
ATOM   10240 C CG2   . VAL C 1 110 ? 46.847  92.052  40.739  1.00 29.86  ? 110  VAL C CG2   1 
ATOM   10241 N N     . ARG C 1 111 ? 46.725  96.077  38.673  1.00 27.27  ? 111  ARG C N     1 
ATOM   10242 C CA    . ARG C 1 111 ? 46.381  97.479  38.530  1.00 29.72  ? 111  ARG C CA    1 
ATOM   10243 C C     . ARG C 1 111 ? 45.518  97.727  37.273  1.00 30.49  ? 111  ARG C C     1 
ATOM   10244 O O     . ARG C 1 111 ? 44.515  98.424  37.345  1.00 30.15  ? 111  ARG C O     1 
ATOM   10245 C CB    . ARG C 1 111 ? 47.631  98.376  38.553  1.00 30.67  ? 111  ARG C CB    1 
ATOM   10246 C CG    . ARG C 1 111 ? 48.250  98.488  39.944  1.00 31.93  ? 111  ARG C CG    1 
ATOM   10247 C CD    . ARG C 1 111 ? 49.484  99.397  39.999  1.00 36.78  ? 111  ARG C CD    1 
ATOM   10248 N NE    . ARG C 1 111 ? 50.722  98.644  39.873  1.00 49.75  ? 111  ARG C NE    1 
ATOM   10249 C CZ    . ARG C 1 111 ? 51.568  98.368  40.865  1.00 48.23  ? 111  ARG C CZ    1 
ATOM   10250 N NH1   . ARG C 1 111 ? 51.361  98.798  42.105  1.00 49.94  ? 111  ARG C NH1   1 
ATOM   10251 N NH2   . ARG C 1 111 ? 52.646  97.649  40.601  1.00 46.60  ? 111  ARG C NH2   1 
ATOM   10252 N N     . THR C 1 112 ? 45.880  97.112  36.147  1.00 31.40  ? 112  THR C N     1 
ATOM   10253 C CA    . THR C 1 112 ? 45.123  97.257  34.894  1.00 32.49  ? 112  THR C CA    1 
ATOM   10254 C C     . THR C 1 112 ? 43.744  96.643  34.969  1.00 31.93  ? 112  THR C C     1 
ATOM   10255 O O     . THR C 1 112 ? 42.761  97.306  34.682  1.00 31.87  ? 112  THR C O     1 
ATOM   10256 C CB    . THR C 1 112 ? 45.851  96.570  33.750  1.00 34.56  ? 112  THR C CB    1 
ATOM   10257 O OG1   . THR C 1 112 ? 47.185  97.062  33.694  1.00 42.74  ? 112  THR C OG1   1 
ATOM   10258 C CG2   . THR C 1 112 ? 45.134  96.832  32.417  1.00 35.19  ? 112  THR C CG2   1 
ATOM   10259 N N     . VAL C 1 113 ? 43.675  95.378  35.374  1.00 31.97  ? 113  VAL C N     1 
ATOM   10260 C CA    . VAL C 1 113 ? 42.398  94.692  35.549  1.00 31.04  ? 113  VAL C CA    1 
ATOM   10261 C C     . VAL C 1 113 ? 41.408  95.514  36.378  1.00 31.05  ? 113  VAL C C     1 
ATOM   10262 O O     . VAL C 1 113 ? 40.248  95.721  35.953  1.00 32.87  ? 113  VAL C O     1 
ATOM   10263 C CB    . VAL C 1 113 ? 42.633  93.280  36.128  1.00 31.69  ? 113  VAL C CB    1 
ATOM   10264 C CG1   . VAL C 1 113 ? 41.323  92.635  36.698  1.00 28.80  ? 113  VAL C CG1   1 
ATOM   10265 C CG2   . VAL C 1 113 ? 43.240  92.416  35.044  1.00 30.40  ? 113  VAL C CG2   1 
ATOM   10266 N N     . LEU C 1 114 ? 41.850  96.012  37.528  1.00 30.87  ? 114  LEU C N     1 
ATOM   10267 C CA    . LEU C 1 114 ? 40.937  96.714  38.459  1.00 32.48  ? 114  LEU C CA    1 
ATOM   10268 C C     . LEU C 1 114 ? 40.465  98.068  37.917  1.00 33.69  ? 114  LEU C C     1 
ATOM   10269 O O     . LEU C 1 114 ? 39.288  98.427  38.037  1.00 30.64  ? 114  LEU C O     1 
ATOM   10270 C CB    . LEU C 1 114 ? 41.584  96.944  39.829  1.00 31.02  ? 114  LEU C CB    1 
ATOM   10271 C CG    . LEU C 1 114 ? 41.987  95.702  40.616  1.00 39.09  ? 114  LEU C CG    1 
ATOM   10272 C CD1   . LEU C 1 114 ? 42.122  96.030  42.117  1.00 40.49  ? 114  LEU C CD1   1 
ATOM   10273 C CD2   . LEU C 1 114 ? 41.035  94.543  40.374  1.00 37.89  ? 114  LEU C CD2   1 
ATOM   10274 N N     . CYS C 1 115 ? 41.392  98.820  37.330  1.00 37.63  ? 115  CYS C N     1 
ATOM   10275 C CA    . CYS C 1 115 ? 41.020  100.071 36.682  1.00 36.99  ? 115  CYS C CA    1 
ATOM   10276 C C     . CYS C 1 115 ? 40.071  99.865  35.454  1.00 34.10  ? 115  CYS C C     1 
ATOM   10277 O O     . CYS C 1 115 ? 39.056  100.565 35.320  1.00 31.89  ? 115  CYS C O     1 
ATOM   10278 C CB    . CYS C 1 115 ? 42.272  100.919 36.352  1.00 40.72  ? 115  CYS C CB    1 
ATOM   10279 S SG    . CYS C 1 115 ? 42.400  101.366 34.608  1.00 54.56  ? 115  CYS C SG    1 
ATOM   10280 N N     . GLU C 1 116 ? 40.373  98.893  34.583  1.00 34.45  ? 116  GLU C N     1 
ATOM   10281 C CA    . GLU C 1 116 ? 39.418  98.464  33.562  1.00 37.46  ? 116  GLU C CA    1 
ATOM   10282 C C     . GLU C 1 116 ? 38.004  98.229  34.122  1.00 36.23  ? 116  GLU C C     1 
ATOM   10283 O O     . GLU C 1 116 ? 37.037  98.681  33.545  1.00 36.39  ? 116  GLU C O     1 
ATOM   10284 C CB    . GLU C 1 116 ? 39.929  97.227  32.813  1.00 37.56  ? 116  GLU C CB    1 
ATOM   10285 C CG    . GLU C 1 116 ? 40.903  97.625  31.679  1.00 51.12  ? 116  GLU C CG    1 
ATOM   10286 C CD    . GLU C 1 116 ? 41.512  96.455  30.915  1.00 48.15  ? 116  GLU C CD    1 
ATOM   10287 O OE1   . GLU C 1 116 ? 41.476  95.310  31.422  1.00 61.23  ? 116  GLU C OE1   1 
ATOM   10288 O OE2   . GLU C 1 116 ? 42.034  96.693  29.793  1.00 62.33  ? 116  GLU C OE2   1 
ATOM   10289 N N     . GLY C 1 117 ? 37.897  97.542  35.250  1.00 33.57  ? 117  GLY C N     1 
ATOM   10290 C CA    . GLY C 1 117 ? 36.605  97.240  35.857  1.00 31.08  ? 117  GLY C CA    1 
ATOM   10291 C C     . GLY C 1 117 ? 35.961  98.354  36.669  1.00 29.29  ? 117  GLY C C     1 
ATOM   10292 O O     . GLY C 1 117 ? 34.849  98.187  37.141  1.00 28.16  ? 117  GLY C O     1 
ATOM   10293 N N     . GLY C 1 118 ? 36.649  99.485  36.833  1.00 27.08  ? 118  GLY C N     1 
ATOM   10294 C CA    . GLY C 1 118 ? 36.127  100.589 37.609  1.00 26.88  ? 118  GLY C CA    1 
ATOM   10295 C C     . GLY C 1 118 ? 36.149  100.361 39.108  1.00 28.37  ? 118  GLY C C     1 
ATOM   10296 O O     . GLY C 1 118 ? 35.325  100.891 39.824  1.00 27.68  ? 118  GLY C O     1 
ATOM   10297 N N     . VAL C 1 119 ? 37.102  99.563  39.588  1.00 29.51  ? 119  VAL C N     1 
ATOM   10298 C CA    . VAL C 1 119 ? 37.195  99.273  41.015  1.00 27.41  ? 119  VAL C CA    1 
ATOM   10299 C C     . VAL C 1 119 ? 37.849  100.499 41.664  1.00 26.96  ? 119  VAL C C     1 
ATOM   10300 O O     . VAL C 1 119 ? 38.883  100.994 41.169  1.00 26.43  ? 119  VAL C O     1 
ATOM   10301 C CB    . VAL C 1 119 ? 37.963  97.967  41.266  1.00 28.95  ? 119  VAL C CB    1 
ATOM   10302 C CG1   . VAL C 1 119 ? 38.119  97.670  42.783  1.00 29.31  ? 119  VAL C CG1   1 
ATOM   10303 C CG2   . VAL C 1 119 ? 37.261  96.815  40.607  1.00 25.33  ? 119  VAL C CG2   1 
ATOM   10304 N N     . PRO C 1 120 ? 37.213  101.063 42.720  1.00 26.81  ? 120  PRO C N     1 
ATOM   10305 C CA    . PRO C 1 120 ? 37.805  102.233 43.402  1.00 29.11  ? 120  PRO C CA    1 
ATOM   10306 C C     . PRO C 1 120 ? 39.247  102.050 43.814  1.00 28.05  ? 120  PRO C C     1 
ATOM   10307 O O     . PRO C 1 120 ? 39.609  100.985 44.258  1.00 26.37  ? 120  PRO C O     1 
ATOM   10308 C CB    . PRO C 1 120 ? 36.943  102.370 44.680  1.00 29.86  ? 120  PRO C CB    1 
ATOM   10309 C CG    . PRO C 1 120 ? 35.600  101.863 44.218  1.00 29.55  ? 120  PRO C CG    1 
ATOM   10310 C CD    . PRO C 1 120 ? 35.910  100.722 43.305  1.00 25.36  ? 120  PRO C CD    1 
ATOM   10311 N N     . GLN C 1 121 ? 40.060  103.085 43.662  1.00 29.54  ? 121  GLN C N     1 
ATOM   10312 C CA    . GLN C 1 121 ? 41.411  103.051 44.218  1.00 31.56  ? 121  GLN C CA    1 
ATOM   10313 C C     . GLN C 1 121 ? 41.370  102.926 45.770  1.00 32.11  ? 121  GLN C C     1 
ATOM   10314 O O     . GLN C 1 121 ? 40.352  103.166 46.417  1.00 29.82  ? 121  GLN C O     1 
ATOM   10315 C CB    . GLN C 1 121 ? 42.202  104.296 43.766  1.00 29.57  ? 121  GLN C CB    1 
ATOM   10316 C CG    . GLN C 1 121 ? 42.691  104.254 42.281  1.00 37.66  ? 121  GLN C CG    1 
ATOM   10317 C CD    . GLN C 1 121 ? 41.749  104.899 41.223  1.00 42.90  ? 121  GLN C CD    1 
ATOM   10318 O OE1   . GLN C 1 121 ? 40.677  105.426 41.527  1.00 33.85  ? 121  GLN C OE1   1 
ATOM   10319 N NE2   . GLN C 1 121 ? 42.192  104.876 39.968  1.00 37.07  ? 121  GLN C NE2   1 
ATOM   10320 N N     . ARG C 1 122 ? 42.475  102.524 46.368  1.00 33.63  ? 122  ARG C N     1 
ATOM   10321 C CA    . ARG C 1 122 ? 42.596  102.579 47.809  1.00 34.04  ? 122  ARG C CA    1 
ATOM   10322 C C     . ARG C 1 122 ? 42.345  103.952 48.403  1.00 37.15  ? 122  ARG C C     1 
ATOM   10323 O O     . ARG C 1 122 ? 42.670  104.982 47.774  1.00 39.04  ? 122  ARG C O     1 
ATOM   10324 C CB    . ARG C 1 122 ? 43.984  102.169 48.251  1.00 34.41  ? 122  ARG C CB    1 
ATOM   10325 C CG    . ARG C 1 122 ? 44.148  100.691 48.349  1.00 29.56  ? 122  ARG C CG    1 
ATOM   10326 C CD    . ARG C 1 122 ? 45.537  100.349 48.823  1.00 32.44  ? 122  ARG C CD    1 
ATOM   10327 N NE    . ARG C 1 122 ? 45.711  98.902  48.814  1.00 32.70  ? 122  ARG C NE    1 
ATOM   10328 C CZ    . ARG C 1 122 ? 46.758  98.259  49.319  1.00 35.77  ? 122  ARG C CZ    1 
ATOM   10329 N NH1   . ARG C 1 122 ? 47.770  98.932  49.836  1.00 38.04  ? 122  ARG C NH1   1 
ATOM   10330 N NH2   . ARG C 1 122 ? 46.792  96.922  49.290  1.00 29.80  ? 122  ARG C NH2   1 
ATOM   10331 N N     . PRO C 1 123 ? 41.802  103.983 49.645  1.00 38.33  ? 123  PRO C N     1 
ATOM   10332 C CA    . PRO C 1 123 ? 41.649  105.268 50.335  1.00 37.31  ? 123  PRO C CA    1 
ATOM   10333 C C     . PRO C 1 123 ? 42.971  106.026 50.475  1.00 38.04  ? 123  PRO C C     1 
ATOM   10334 O O     . PRO C 1 123 ? 44.041  105.424 50.463  1.00 32.67  ? 123  PRO C O     1 
ATOM   10335 C CB    . PRO C 1 123 ? 41.095  104.876 51.724  1.00 38.72  ? 123  PRO C CB    1 
ATOM   10336 C CG    . PRO C 1 123 ? 41.252  103.411 51.852  1.00 38.29  ? 123  PRO C CG    1 
ATOM   10337 C CD    . PRO C 1 123 ? 41.311  102.850 50.459  1.00 37.41  ? 123  PRO C CD    1 
ATOM   10338 N N     . VAL C 1 124 ? 42.879  107.346 50.589  1.00 40.17  ? 124  VAL C N     1 
ATOM   10339 C CA    . VAL C 1 124 ? 44.063  108.205 50.735  1.00 39.88  ? 124  VAL C CA    1 
ATOM   10340 C C     . VAL C 1 124 ? 45.061  107.645 51.775  1.00 40.63  ? 124  VAL C C     1 
ATOM   10341 O O     . VAL C 1 124 ? 46.270  107.633 51.527  1.00 44.07  ? 124  VAL C O     1 
ATOM   10342 C CB    . VAL C 1 124 ? 43.652  109.684 51.076  1.00 42.95  ? 124  VAL C CB    1 
ATOM   10343 C CG1   . VAL C 1 124 ? 42.729  110.268 49.978  1.00 44.25  ? 124  VAL C CG1   1 
ATOM   10344 C CG2   . VAL C 1 124 ? 42.964  109.809 52.452  1.00 44.44  ? 124  VAL C CG2   1 
ATOM   10345 N N     . VAL C 1 125 ? 44.544  107.164 52.920  1.00 37.34  ? 125  VAL C N     1 
ATOM   10346 C CA    . VAL C 1 125 ? 45.330  106.389 53.893  1.00 33.11  ? 125  VAL C CA    1 
ATOM   10347 C C     . VAL C 1 125 ? 44.604  105.046 54.062  1.00 31.89  ? 125  VAL C C     1 
ATOM   10348 O O     . VAL C 1 125 ? 43.390  105.003 54.212  1.00 31.46  ? 125  VAL C O     1 
ATOM   10349 C CB    . VAL C 1 125 ? 45.508  107.144 55.244  1.00 31.36  ? 125  VAL C CB    1 
ATOM   10350 C CG1   . VAL C 1 125 ? 45.974  106.238 56.380  1.00 33.89  ? 125  VAL C CG1   1 
ATOM   10351 C CG2   . VAL C 1 125 ? 46.486  108.301 55.082  1.00 29.09  ? 125  VAL C CG2   1 
ATOM   10352 N N     . PHE C 1 126 ? 45.373  103.962 54.035  1.00 31.72  ? 126  PHE C N     1 
ATOM   10353 C CA    . PHE C 1 126 ? 44.853  102.593 54.004  1.00 29.57  ? 126  PHE C CA    1 
ATOM   10354 C C     . PHE C 1 126 ? 45.560  101.719 55.026  1.00 28.32  ? 126  PHE C C     1 
ATOM   10355 O O     . PHE C 1 126 ? 46.783  101.685 55.075  1.00 28.81  ? 126  PHE C O     1 
ATOM   10356 C CB    . PHE C 1 126 ? 45.061  101.994 52.617  1.00 29.82  ? 126  PHE C CB    1 
ATOM   10357 C CG    . PHE C 1 126 ? 44.810  100.520 52.556  1.00 29.31  ? 126  PHE C CG    1 
ATOM   10358 C CD1   . PHE C 1 126 ? 43.517  100.031 52.498  1.00 26.25  ? 126  PHE C CD1   1 
ATOM   10359 C CD2   . PHE C 1 126 ? 45.869  99.616  52.573  1.00 29.01  ? 126  PHE C CD2   1 
ATOM   10360 C CE1   . PHE C 1 126 ? 43.264  98.643  52.453  1.00 30.12  ? 126  PHE C CE1   1 
ATOM   10361 C CE2   . PHE C 1 126 ? 45.625  98.239  52.534  1.00 27.70  ? 126  PHE C CE2   1 
ATOM   10362 C CZ    . PHE C 1 126 ? 44.316  97.760  52.477  1.00 27.78  ? 126  PHE C CZ    1 
ATOM   10363 N N     . VAL C 1 127 ? 44.802  101.011 55.850  1.00 28.10  ? 127  VAL C N     1 
ATOM   10364 C CA    . VAL C 1 127 ? 45.391  99.990  56.707  1.00 27.10  ? 127  VAL C CA    1 
ATOM   10365 C C     . VAL C 1 127 ? 44.871  98.593  56.314  1.00 26.83  ? 127  VAL C C     1 
ATOM   10366 O O     . VAL C 1 127 ? 43.721  98.419  55.954  1.00 27.86  ? 127  VAL C O     1 
ATOM   10367 C CB    . VAL C 1 127 ? 45.141  100.260 58.255  1.00 28.07  ? 127  VAL C CB    1 
ATOM   10368 C CG1   . VAL C 1 127 ? 45.767  101.580 58.689  1.00 27.78  ? 127  VAL C CG1   1 
ATOM   10369 C CG2   . VAL C 1 127 ? 43.654  100.230 58.602  1.00 27.73  ? 127  VAL C CG2   1 
ATOM   10370 N N     . THR C 1 128 ? 45.733  97.596  56.422  1.00 29.02  ? 128  THR C N     1 
ATOM   10371 C CA    . THR C 1 128 ? 45.377  96.235  56.101  1.00 28.27  ? 128  THR C CA    1 
ATOM   10372 C C     . THR C 1 128 ? 44.342  95.682  57.089  1.00 29.28  ? 128  THR C C     1 
ATOM   10373 O O     . THR C 1 128 ? 44.289  96.079  58.242  1.00 31.46  ? 128  THR C O     1 
ATOM   10374 C CB    . THR C 1 128 ? 46.608  95.309  56.150  1.00 28.64  ? 128  THR C CB    1 
ATOM   10375 O OG1   . THR C 1 128 ? 47.139  95.295  57.486  1.00 28.16  ? 128  THR C OG1   1 
ATOM   10376 C CG2   . THR C 1 128 ? 47.656  95.765  55.154  1.00 26.74  ? 128  THR C CG2   1 
ATOM   10377 N N     . ARG C 1 129 ? 43.531  94.764  56.606  1.00 28.38  ? 129  ARG C N     1 
ATOM   10378 C CA    . ARG C 1 129 ? 42.548  94.099  57.402  1.00 29.70  ? 129  ARG C CA    1 
ATOM   10379 C C     . ARG C 1 129 ? 42.594  92.691  56.898  1.00 30.90  ? 129  ARG C C     1 
ATOM   10380 O O     . ARG C 1 129 ? 41.659  92.245  56.247  1.00 28.70  ? 129  ARG C O     1 
ATOM   10381 C CB    . ARG C 1 129 ? 41.152  94.722  57.202  1.00 28.59  ? 129  ARG C CB    1 
ATOM   10382 C CG    . ARG C 1 129 ? 41.057  96.164  57.684  1.00 27.75  ? 129  ARG C CG    1 
ATOM   10383 C CD    . ARG C 1 129 ? 39.657  96.736  57.544  1.00 28.52  ? 129  ARG C CD    1 
ATOM   10384 N NE    . ARG C 1 129 ? 38.794  96.286  58.634  1.00 30.46  ? 129  ARG C NE    1 
ATOM   10385 C CZ    . ARG C 1 129 ? 37.499  96.576  58.751  1.00 30.01  ? 129  ARG C CZ    1 
ATOM   10386 N NH1   . ARG C 1 129 ? 36.883  97.318  57.855  1.00 30.30  ? 129  ARG C NH1   1 
ATOM   10387 N NH2   . ARG C 1 129 ? 36.823  96.140  59.791  1.00 30.68  ? 129  ARG C NH2   1 
ATOM   10388 N N     . LYS C 1 130 ? 43.696  92.012  57.218  1.00 35.62  ? 130  LYS C N     1 
ATOM   10389 C CA    . LYS C 1 130 ? 44.096  90.756  56.568  1.00 36.52  ? 130  LYS C CA    1 
ATOM   10390 C C     . LYS C 1 130 ? 43.127  89.636  56.787  1.00 35.25  ? 130  LYS C C     1 
ATOM   10391 O O     . LYS C 1 130 ? 42.838  88.894  55.865  1.00 37.35  ? 130  LYS C O     1 
ATOM   10392 C CB    . LYS C 1 130 ? 45.466  90.300  57.060  1.00 37.71  ? 130  LYS C CB    1 
ATOM   10393 C CG    . LYS C 1 130 ? 46.569  91.129  56.472  1.00 45.38  ? 130  LYS C CG    1 
ATOM   10394 C CD    . LYS C 1 130 ? 47.934  90.831  57.135  1.00 47.13  ? 130  LYS C CD    1 
ATOM   10395 C CE    . LYS C 1 130 ? 48.973  91.892  56.722  1.00 53.01  ? 130  LYS C CE    1 
ATOM   10396 N NZ    . LYS C 1 130 ? 50.312  91.625  57.300  1.00 57.66  ? 130  LYS C NZ    1 
ATOM   10397 N N     . LYS C 1 131 ? 42.657  89.481  58.016  1.00 35.11  ? 131  LYS C N     1 
ATOM   10398 C CA    . LYS C 1 131 ? 41.738  88.393  58.346  1.00 34.24  ? 131  LYS C CA    1 
ATOM   10399 C C     . LYS C 1 131 ? 40.420  88.519  57.551  1.00 33.00  ? 131  LYS C C     1 
ATOM   10400 O O     . LYS C 1 131 ? 39.902  87.546  56.995  1.00 32.14  ? 131  LYS C O     1 
ATOM   10401 C CB    . LYS C 1 131 ? 41.471  88.406  59.843  1.00 33.57  ? 131  LYS C CB    1 
ATOM   10402 C CG    . LYS C 1 131 ? 40.507  87.337  60.320  1.00 38.31  ? 131  LYS C CG    1 
ATOM   10403 C CD    . LYS C 1 131 ? 40.604  87.148  61.826  1.00 37.70  ? 131  LYS C CD    1 
ATOM   10404 C CE    . LYS C 1 131 ? 39.631  86.063  62.321  1.00 46.69  ? 131  LYS C CE    1 
ATOM   10405 N NZ    . LYS C 1 131 ? 39.551  85.941  63.825  1.00 48.07  ? 131  LYS C NZ    1 
ATOM   10406 N N     . LEU C 1 132 ? 39.871  89.722  57.485  1.00 31.99  ? 132  LEU C N     1 
ATOM   10407 C CA    . LEU C 1 132 ? 38.657  89.928  56.682  1.00 31.10  ? 132  LEU C CA    1 
ATOM   10408 C C     . LEU C 1 132 ? 38.922  89.768  55.190  1.00 29.96  ? 132  LEU C C     1 
ATOM   10409 O O     . LEU C 1 132 ? 38.154  89.107  54.510  1.00 28.19  ? 132  LEU C O     1 
ATOM   10410 C CB    . LEU C 1 132 ? 37.980  91.272  56.971  1.00 29.67  ? 132  LEU C CB    1 
ATOM   10411 C CG    . LEU C 1 132 ? 37.215  91.399  58.298  1.00 28.70  ? 132  LEU C CG    1 
ATOM   10412 C CD1   . LEU C 1 132 ? 37.051  92.865  58.710  1.00 23.91  ? 132  LEU C CD1   1 
ATOM   10413 C CD2   . LEU C 1 132 ? 35.864  90.681  58.229  1.00 26.61  ? 132  LEU C CD2   1 
ATOM   10414 N N     . VAL C 1 133 ? 40.014  90.347  54.690  1.00 29.87  ? 133  VAL C N     1 
ATOM   10415 C CA    . VAL C 1 133 ? 40.340  90.252  53.253  1.00 29.77  ? 133  VAL C CA    1 
ATOM   10416 C C     . VAL C 1 133 ? 40.593  88.788  52.845  1.00 29.10  ? 133  VAL C C     1 
ATOM   10417 O O     . VAL C 1 133 ? 40.101  88.333  51.809  1.00 28.23  ? 133  VAL C O     1 
ATOM   10418 C CB    . VAL C 1 133 ? 41.518  91.196  52.886  1.00 31.12  ? 133  VAL C CB    1 
ATOM   10419 C CG1   . VAL C 1 133 ? 41.970  90.986  51.463  1.00 30.35  ? 133  VAL C CG1   1 
ATOM   10420 C CG2   . VAL C 1 133 ? 41.111  92.646  53.080  1.00 32.37  ? 133  VAL C CG2   1 
ATOM   10421 N N     . ASN C 1 134 ? 41.344  88.046  53.655  1.00 28.65  ? 134  ASN C N     1 
ATOM   10422 C CA    . ASN C 1 134 ? 41.558  86.604  53.411  1.00 29.46  ? 134  ASN C CA    1 
ATOM   10423 C C     . ASN C 1 134 ? 40.272  85.774  53.418  1.00 28.43  ? 134  ASN C C     1 
ATOM   10424 O O     . ASN C 1 134 ? 40.106  84.881  52.579  1.00 28.03  ? 134  ASN C O     1 
ATOM   10425 C CB    . ASN C 1 134 ? 42.524  86.01