data_1Z83
# 
_entry.id   1Z83 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Z83         
RCSB  RCSB032416   
WWPDB D_1000032416 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Z83 
_pdbx_database_status.recvd_initial_deposition_date   2005-03-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1 
'Bunkoczi, G.'                         2 
'Jansson, A.'                          3 
'Schreurs, A.'                         4 
'Knapp, S.'                            5 
'Edwards, A.'                          6 
'von Delft, F.'                        7 
'Sundstrom, M.'                        8 
'Structural Genomics Consortium (SGC)' 9 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human AK1A in complex with  AP5A' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Filippakopoulos, P.' 1 
primary 'Bunkoczi, G.'        2 
primary 'Jansson, A.'         3 
primary 'Schreurs, A.'        4 
primary 'Knapp, S.'           5 
primary 'Edwards, A.'         6 
primary 'von Delft, F.'       7 
primary 'Sundstrom, M.'       8 
# 
_cell.entry_id           1Z83 
_cell.length_a           126.194 
_cell.length_b           46.259 
_cell.length_c           119.576 
_cell.angle_alpha        90.00 
_cell.angle_beta         116.01 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1Z83 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Adenylate kinase 1'               21837.957 3   2.7.4.3 ? ? ? 
2 non-polymer syn 'ZINC ION'                         65.409    8   ?       ? ? ? 
3 non-polymer syn 'SULFATE ION'                      96.063    3   ?       ? ? ? 
4 non-polymer syn "BIS(ADENOSINE)-5'-PENTAPHOSPHATE" 916.367   3   ?       ? ? ? 
5 water       nat water                              18.015    458 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ATP-AMP transphosphorylase, AK1, Myokinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDA
MVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEP
VIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALLN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDA
MVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEP
VIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALLN
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLU n 
1 4   GLU n 
1 5   LYS n 
1 6   LEU n 
1 7   LYS n 
1 8   LYS n 
1 9   THR n 
1 10  ASN n 
1 11  ILE n 
1 12  ILE n 
1 13  PHE n 
1 14  VAL n 
1 15  VAL n 
1 16  GLY n 
1 17  GLY n 
1 18  PRO n 
1 19  GLY n 
1 20  SER n 
1 21  GLY n 
1 22  LYS n 
1 23  GLY n 
1 24  THR n 
1 25  GLN n 
1 26  CYS n 
1 27  GLU n 
1 28  LYS n 
1 29  ILE n 
1 30  VAL n 
1 31  GLN n 
1 32  LYS n 
1 33  TYR n 
1 34  GLY n 
1 35  TYR n 
1 36  THR n 
1 37  HIS n 
1 38  LEU n 
1 39  SER n 
1 40  THR n 
1 41  GLY n 
1 42  ASP n 
1 43  LEU n 
1 44  LEU n 
1 45  ARG n 
1 46  SER n 
1 47  GLU n 
1 48  VAL n 
1 49  SER n 
1 50  SER n 
1 51  GLY n 
1 52  SER n 
1 53  ALA n 
1 54  ARG n 
1 55  GLY n 
1 56  LYS n 
1 57  LYS n 
1 58  LEU n 
1 59  SER n 
1 60  GLU n 
1 61  ILE n 
1 62  MET n 
1 63  GLU n 
1 64  LYS n 
1 65  GLY n 
1 66  GLN n 
1 67  LEU n 
1 68  VAL n 
1 69  PRO n 
1 70  LEU n 
1 71  GLU n 
1 72  THR n 
1 73  VAL n 
1 74  LEU n 
1 75  ASP n 
1 76  MET n 
1 77  LEU n 
1 78  ARG n 
1 79  ASP n 
1 80  ALA n 
1 81  MET n 
1 82  VAL n 
1 83  ALA n 
1 84  LYS n 
1 85  VAL n 
1 86  ASN n 
1 87  THR n 
1 88  SER n 
1 89  LYS n 
1 90  GLY n 
1 91  PHE n 
1 92  LEU n 
1 93  ILE n 
1 94  ASP n 
1 95  GLY n 
1 96  TYR n 
1 97  PRO n 
1 98  ARG n 
1 99  GLU n 
1 100 VAL n 
1 101 GLN n 
1 102 GLN n 
1 103 GLY n 
1 104 GLU n 
1 105 GLU n 
1 106 PHE n 
1 107 GLU n 
1 108 ARG n 
1 109 ARG n 
1 110 ILE n 
1 111 GLY n 
1 112 GLN n 
1 113 PRO n 
1 114 THR n 
1 115 LEU n 
1 116 LEU n 
1 117 LEU n 
1 118 TYR n 
1 119 VAL n 
1 120 ASP n 
1 121 ALA n 
1 122 GLY n 
1 123 PRO n 
1 124 GLU n 
1 125 THR n 
1 126 MET n 
1 127 THR n 
1 128 GLN n 
1 129 ARG n 
1 130 LEU n 
1 131 LEU n 
1 132 LYS n 
1 133 ARG n 
1 134 GLY n 
1 135 GLU n 
1 136 THR n 
1 137 SER n 
1 138 GLY n 
1 139 ARG n 
1 140 VAL n 
1 141 ASP n 
1 142 ASP n 
1 143 ASN n 
1 144 GLU n 
1 145 GLU n 
1 146 THR n 
1 147 ILE n 
1 148 LYS n 
1 149 LYS n 
1 150 ARG n 
1 151 LEU n 
1 152 GLU n 
1 153 THR n 
1 154 TYR n 
1 155 TYR n 
1 156 LYS n 
1 157 ALA n 
1 158 THR n 
1 159 GLU n 
1 160 PRO n 
1 161 VAL n 
1 162 ILE n 
1 163 ALA n 
1 164 PHE n 
1 165 TYR n 
1 166 GLU n 
1 167 LYS n 
1 168 ARG n 
1 169 GLY n 
1 170 ILE n 
1 171 VAL n 
1 172 ARG n 
1 173 LYS n 
1 174 VAL n 
1 175 ASN n 
1 176 ALA n 
1 177 GLU n 
1 178 GLY n 
1 179 SER n 
1 180 VAL n 
1 181 ASP n 
1 182 SER n 
1 183 VAL n 
1 184 PHE n 
1 185 SER n 
1 186 GLN n 
1 187 VAL n 
1 188 CYS n 
1 189 THR n 
1 190 HIS n 
1 191 LEU n 
1 192 ASP n 
1 193 ALA n 
1 194 LEU n 
1 195 LEU n 
1 196 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 AK1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21-DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pLIC-SGC 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       hak1a-pLIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KAD1_HUMAN 
_struct_ref.pdbx_db_accession          P00568 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAM
VAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPV
IAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALLN
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1Z83 A 2 ? 196 ? P00568 1 ? 195 ? 1 195 
2 1 1Z83 B 2 ? 196 ? P00568 1 ? 195 ? 1 195 
3 1 1Z83 C 2 ? 196 ? P00568 1 ? 195 ? 1 195 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1Z83 SER A 1 ? UNP P00568 ? ? 'cloning artifact' 0 1 
2 1Z83 SER B 1 ? UNP P00568 ? ? 'cloning artifact' 0 2 
3 1Z83 SER C 1 ? UNP P00568 ? ? 'cloning artifact' 0 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                            ? 'C3 H7 N O2'         89.093  
AP5 non-polymer         . "BIS(ADENOSINE)-5'-PENTAPHOSPHATE" ? 'C20 H29 N10 O22 P5' 916.367 
ARG 'L-peptide linking' y ARGININE                           ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE                           ? 'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE                          ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                            ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE                          ? 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER                              ? 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE                         ? 'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE                            ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                             ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                         ? 'C5 H11 N O2 S'      149.211 
PHE 'L-peptide linking' y PHENYLALANINE                      ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE                            ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                             ? 'C3 H7 N O3'         105.093 
SO4 non-polymer         . 'SULFATE ION'                      ? 'O4 S -2'            96.063  
THR 'L-peptide linking' y THREONINE                          ? 'C4 H9 N O3'         119.119 
TYR 'L-peptide linking' y TYROSINE                           ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                             ? 'C5 H11 N O2'        117.146 
ZN  non-polymer         . 'ZINC ION'                         ? 'Zn 2'               65.409  
# 
_exptl.entry_id          1Z83 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   50.2 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'MES, PEG550, Zinksulphate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-02-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.90 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.90 
# 
_reflns.entry_id                     1Z83 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   49395 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.035 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              1.94 
_reflns_shell.percent_possible_all   95.7 
_reflns_shell.Rmerge_I_obs           0.1 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    9.9 
_reflns_shell.pdbx_redundancy        5.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1Z83 
_refine.ls_number_reflns_obs                     44688 
_refine.ls_number_reflns_all                     44688 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    95.31 
_refine.ls_R_factor_obs                          0.17166 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16916 
_refine.ls_R_factor_R_free                       0.21832 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2379 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.B_iso_mean                               19.457 
_refine.aniso_B[1][1]                            -2.10 
_refine.aniso_B[2][2]                            2.40 
_refine.aniso_B[3][3]                            -0.66 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.41 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.154 
_refine.pdbx_overall_ESU_R_Free                  0.146 
_refine.overall_SU_ML                            0.103 
_refine.overall_SU_B                             5.698 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4471 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         194 
_refine_hist.number_atoms_solvent             458 
_refine_hist.number_atoms_total               5123 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 4755  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 4340  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.622  2.036  ? 6453  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.851  3.000  ? 10092 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.164  5.000  ? 592   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.869 24.011 ? 187   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.679 15.000 ? 855   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.356 15.000 ? 35    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.080  0.200  ? 733   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 5117  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 898   'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.211  0.200  ? 950   'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.180  0.200  ? 4362  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.171  0.200  ? 2272  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.082  0.200  ? 2651  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.213  0.200  ? 346   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.084  0.200  ? 10    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.232  0.200  ? 34    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.244  0.200  ? 40    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.214  0.200  ? 34    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined 0.162  0.200  ? 1     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.000  3.000  ? 2990  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.657  3.000  ? 1220  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.719  5.000  ? 4678  'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.909  8.000  ? 2010  'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.538  11.000 ? 1770  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1129 0.22 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 1  ? ? ? 
2 B 1129 0.19 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 2  ? ? ? 
3 C 1129 0.20 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 3  ? ? ? 
1 A 1673 0.55 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 4  ? ? ? 
2 B 1673 0.47 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 5  ? ? ? 
3 C 1673 0.59 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 6  ? ? ? 
1 A 1129 0.93 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 7  ? ? ? 
2 B 1129 0.82 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 8  ? ? ? 
3 C 1129 0.90 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 9  ? ? ? 
1 A 1673 2.07 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 10 ? ? ? 
2 B 1673 1.70 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 11 ? ? ? 
3 C 1673 2.04 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 12 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             2989 
_refine_ls_shell.R_factor_R_work                  0.214 
_refine_ls_shell.percent_reflns_obs               87.22 
_refine_ls_shell.R_factor_R_free                  0.269 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             178 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 C 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 1 A 194 1 5 A MET 2 ? A LEU 195 ? 1 ? 
2 B 1 B 194 1 5 B MET 2 ? B LEU 195 ? 1 ? 
3 C 1 C 194 1 5 C MET 2 ? C LEU 195 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1Z83 
_struct.title                     'Crystal structure of human AK1A in complex with AP5A' 
_struct.pdbx_descriptor           'Adenylate kinase isoenzyme 1 (E.C.2.7.4.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Z83 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;adenylate kinase, humna, AP5A, diadenosine pentaphosphate, nucleotide kinase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 4 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'Three monomers in the asymmetric unit' ? 
2 ?                                       ? 
3 ?                                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 1   ? LYS A 8   ? SER A 0   LYS A 7   1 ? 8  
HELX_P HELX_P2  2  GLY A 21  ? GLY A 34  ? GLY A 20  GLY A 33  1 ? 14 
HELX_P HELX_P3  3  THR A 40  ? SER A 49  ? THR A 39  SER A 48  1 ? 10 
HELX_P HELX_P4  4  SER A 52  ? GLU A 63  ? SER A 51  GLU A 62  1 ? 12 
HELX_P HELX_P5  5  PRO A 69  ? VAL A 85  ? PRO A 68  VAL A 84  1 ? 17 
HELX_P HELX_P6  6  ASN A 86  ? SER A 88  ? ASN A 85  SER A 87  5 ? 3  
HELX_P HELX_P7  7  GLU A 99  ? ILE A 110 ? GLU A 98  ILE A 109 1 ? 12 
HELX_P HELX_P8  8  GLY A 122 ? SER A 137 ? GLY A 121 SER A 136 1 ? 16 
HELX_P HELX_P9  9  ASN A 143 ? THR A 158 ? ASN A 142 THR A 157 1 ? 16 
HELX_P HELX_P10 10 THR A 158 ? LYS A 167 ? THR A 157 LYS A 166 1 ? 10 
HELX_P HELX_P11 11 SER A 179 ? ALA A 193 ? SER A 178 ALA A 192 1 ? 15 
HELX_P HELX_P12 12 SER B 1   ? LYS B 7   ? SER B 0   LYS B 6   1 ? 7  
HELX_P HELX_P13 13 GLY B 21  ? GLY B 34  ? GLY B 20  GLY B 33  1 ? 14 
HELX_P HELX_P14 14 THR B 40  ? SER B 50  ? THR B 39  SER B 49  1 ? 11 
HELX_P HELX_P15 15 SER B 52  ? LYS B 64  ? SER B 51  LYS B 63  1 ? 13 
HELX_P HELX_P16 16 PRO B 69  ? VAL B 85  ? PRO B 68  VAL B 84  1 ? 17 
HELX_P HELX_P17 17 GLU B 99  ? ILE B 110 ? GLU B 98  ILE B 109 1 ? 12 
HELX_P HELX_P18 18 GLY B 122 ? SER B 137 ? GLY B 121 SER B 136 1 ? 16 
HELX_P HELX_P19 19 ASN B 143 ? THR B 158 ? ASN B 142 THR B 157 1 ? 16 
HELX_P HELX_P20 20 THR B 158 ? LYS B 167 ? THR B 157 LYS B 166 1 ? 10 
HELX_P HELX_P21 21 SER B 179 ? LEU B 195 ? SER B 178 LEU B 194 1 ? 17 
HELX_P HELX_P22 22 SER C 1   ? LYS C 7   ? SER C 0   LYS C 6   1 ? 7  
HELX_P HELX_P23 23 GLY C 21  ? GLY C 34  ? GLY C 20  GLY C 33  1 ? 14 
HELX_P HELX_P24 24 THR C 40  ? SER C 50  ? THR C 39  SER C 49  1 ? 11 
HELX_P HELX_P25 25 SER C 52  ? GLU C 63  ? SER C 51  GLU C 62  1 ? 12 
HELX_P HELX_P26 26 PRO C 69  ? VAL C 85  ? PRO C 68  VAL C 84  1 ? 17 
HELX_P HELX_P27 27 GLU C 99  ? ILE C 110 ? GLU C 98  ILE C 109 1 ? 12 
HELX_P HELX_P28 28 GLY C 122 ? THR C 136 ? GLY C 121 THR C 135 1 ? 15 
HELX_P HELX_P29 29 ASN C 143 ? THR C 158 ? ASN C 142 THR C 157 1 ? 16 
HELX_P HELX_P30 30 THR C 158 ? LYS C 167 ? THR C 157 LYS C 166 1 ? 10 
HELX_P HELX_P31 31 SER C 179 ? LEU C 195 ? SER C 178 LEU C 194 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ZN . ZN ? ? ? 1_555 G AP5 .   O1G ? ? A ZN 601 A AP5 631 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc2  metalc ? ? D ZN . ZN ? ? ? 1_555 G AP5 .   O2D ? ? A ZN 601 A AP5 631 1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc3  metalc ? ? D ZN . ZN ? ? ? 1_555 R HOH .   O   ? ? A ZN 601 A HOH 703 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc4  metalc ? ? D ZN . ZN ? ? ? 1_555 R HOH .   O   ? ? A ZN 601 A HOH 838 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc5  metalc ? ? D ZN . ZN ? ? ? 1_555 R HOH .   O   ? ? A ZN 601 A HOH 845 1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc6  metalc ? ? D ZN . ZN ? ? ? 1_555 R HOH .   O   ? ? A ZN 601 A HOH 704 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc7  metalc ? ? E ZN . ZN ? ? ? 1_555 A HIS 37  ND1 ? ? A ZN 641 A HIS 36  1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc8  metalc ? ? E ZN . ZN ? ? ? 1_555 A GLU 27  OE2 ? ? A ZN 641 A GLU 26  1_555 ? ? ? ? ? ? ? 1.966 ? 
metalc9  metalc ? ? E ZN . ZN ? ? ? 1_555 R HOH .   O   ? ? A ZN 641 A HOH 846 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc10 metalc ? ? E ZN . ZN ? ? ? 1_555 R HOH .   O   ? ? A ZN 641 A HOH 840 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc11 metalc ? ? H ZN . ZN ? ? ? 1_555 S HOH .   O   ? ? B ZN 611 B HOH 704 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc12 metalc ? ? H ZN . ZN ? ? ? 1_555 M AP5 .   O1G ? ? B ZN 611 B AP5 632 1_555 ? ? ? ? ? ? ? 1.977 ? 
metalc13 metalc ? ? H ZN . ZN ? ? ? 1_555 M AP5 .   O2D ? ? B ZN 611 B AP5 632 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc14 metalc ? ? H ZN . ZN ? ? ? 1_555 S HOH .   O   ? ? B ZN 611 B HOH 776 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc15 metalc ? ? H ZN . ZN ? ? ? 1_555 S HOH .   O   ? ? B ZN 611 B HOH 805 1_555 ? ? ? ? ? ? ? 1.927 ? 
metalc16 metalc ? ? H ZN . ZN ? ? ? 1_555 S HOH .   O   ? ? B ZN 611 B HOH 811 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc17 metalc ? ? I ZN . ZN ? ? ? 1_555 B GLU 105 OE1 ? ? B ZN 642 B GLU 104 1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc18 metalc ? ? I ZN . ZN ? ? ? 1_555 A GLU 71  OE2 ? ? B ZN 642 A GLU 70  1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc19 metalc ? ? I ZN . ZN ? ? ? 1_555 B GLU 71  OE1 ? ? B ZN 642 B GLU 70  1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc20 metalc ? ? I ZN . ZN ? ? ? 1_555 A ASP 75  OD2 ? ? B ZN 642 A ASP 74  1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc21 metalc ? ? J ZN . ZN ? ? ? 1_555 B HIS 37  ND1 ? ? B ZN 643 B HIS 36  1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc22 metalc ? ? J ZN . ZN ? ? ? 1_555 B GLU 27  OE2 ? ? B ZN 643 B GLU 26  1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc23 metalc ? ? J ZN . ZN ? ? ? 1_555 S HOH .   O   ? ? B ZN 643 B HOH 806 1_555 ? ? ? ? ? ? ? 1.828 ? 
metalc24 metalc ? ? J ZN . ZN ? ? ? 1_555 S HOH .   O   ? ? B ZN 643 B HOH 812 1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc25 metalc ? ? N ZN . ZN ? ? ? 1_555 T HOH .   O   ? ? C ZN 621 C HOH 732 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc26 metalc ? ? N ZN . ZN ? ? ? 1_555 T HOH .   O   ? ? C ZN 621 C HOH 646 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc27 metalc ? ? N ZN . ZN ? ? ? 1_555 T HOH .   O   ? ? C ZN 621 C HOH 741 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc28 metalc ? ? N ZN . ZN ? ? ? 1_555 T HOH .   O   ? ? C ZN 621 C HOH 647 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc29 metalc ? ? N ZN . ZN ? ? ? 1_555 Q AP5 .   O2D ? ? C ZN 621 C AP5 633 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc30 metalc ? ? N ZN . ZN ? ? ? 1_555 Q AP5 .   O1G ? ? C ZN 621 C AP5 633 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc31 metalc ? ? O ZN . ZN ? ? ? 1_555 T HOH .   O   ? ? C ZN 644 C HOH 733 1_555 ? ? ? ? ? ? ? 2.009 ? 
metalc32 metalc ? ? O ZN . ZN ? ? ? 1_555 T HOH .   O   ? ? C ZN 644 C HOH 742 1_555 ? ? ? ? ? ? ? 1.948 ? 
metalc33 metalc ? ? O ZN . ZN ? ? ? 1_555 C GLU 27  OE2 ? ? C ZN 644 C GLU 26  1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc34 metalc ? ? O ZN . ZN ? ? ? 1_555 C HIS 37  ND1 ? ? C ZN 644 C HIS 36  1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc35 metalc ? ? P ZN . ZN ? ? ? 1_555 C ASP 75  OD2 ? ? C ZN 645 C ASP 74  1_555 ? ? ? ? ? ? ? 1.915 ? 
metalc36 metalc ? ? P ZN . ZN ? ? ? 1_555 C GLU 71  OE2 ? ? C ZN 645 C GLU 70  1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc37 metalc ? ? E ZN . ZN ? ? ? 1_555 A GLU 145 OE1 ? ? A ZN 641 A GLU 144 4_555 ? ? ? ? ? ? ? 2.709 ? 
metalc38 metalc ? ? E ZN . ZN ? ? ? 1_555 A GLU 145 OE2 ? ? A ZN 641 A GLU 144 4_555 ? ? ? ? ? ? ? 2.057 ? 
metalc39 metalc ? ? J ZN . ZN ? ? ? 1_555 C GLU 145 OE1 ? ? B ZN 643 C GLU 144 3_455 ? ? ? ? ? ? ? 2.586 ? 
metalc40 metalc ? ? J ZN . ZN ? ? ? 1_555 C GLU 145 OE2 ? ? B ZN 643 C GLU 144 3_455 ? ? ? ? ? ? ? 2.162 ? 
metalc41 metalc ? ? O ZN . ZN ? ? ? 1_555 B GLU 145 OE1 ? ? C ZN 644 B GLU 144 3_555 ? ? ? ? ? ? ? 2.742 ? 
metalc42 metalc ? ? O ZN . ZN ? ? ? 1_555 B GLU 145 OE2 ? ? C ZN 644 B GLU 144 3_555 ? ? ? ? ? ? ? 2.087 ? 
metalc43 metalc ? ? P ZN . ZN ? ? ? 1_555 C ASP 75  OD2 ? ? C ZN 645 C ASP 74  2_656 ? ? ? ? ? ? ? 2.204 ? 
metalc44 metalc ? ? P ZN . ZN ? ? ? 1_555 C GLU 71  OE2 ? ? C ZN 645 C GLU 70  2_656 ? ? ? ? ? ? ? 1.857 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 96  A . ? TYR 95  A PRO 97  A ? PRO 96  A 1 2.03 
2 TYR 96  B . ? TYR 95  B PRO 97  B ? PRO 96  B 1 3.95 
3 TYR 96  C . ? TYR 95  C PRO 97  C ? PRO 96  C 1 3.60 
4 SER 137 C . ? SER 136 C GLY 138 C ? GLY 137 C 1 1.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
C 1 2 ? parallel 
C 2 3 ? parallel 
C 3 4 ? parallel 
C 4 5 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 36  ? SER A 39  ? THR A 35  SER A 38  
A 2 PHE A 91  ? ASP A 94  ? PHE A 90  ASP A 93  
A 3 ILE A 11  ? GLY A 16  ? ILE A 10  GLY A 15  
A 4 LEU A 115 ? ASP A 120 ? LEU A 114 ASP A 119 
A 5 VAL A 171 ? ASN A 175 ? VAL A 170 ASN A 174 
B 1 THR B 36  ? SER B 39  ? THR B 35  SER B 38  
B 2 PHE B 91  ? ASP B 94  ? PHE B 90  ASP B 93  
B 3 ILE B 11  ? GLY B 16  ? ILE B 10  GLY B 15  
B 4 LEU B 115 ? ASP B 120 ? LEU B 114 ASP B 119 
B 5 VAL B 171 ? ASN B 175 ? VAL B 170 ASN B 174 
C 1 THR C 36  ? SER C 39  ? THR C 35  SER C 38  
C 2 PHE C 91  ? ASP C 94  ? PHE C 90  ASP C 93  
C 3 ILE C 11  ? GLY C 16  ? ILE C 10  GLY C 15  
C 4 LEU C 115 ? ASP C 120 ? LEU C 114 ASP C 119 
C 5 VAL C 171 ? ASN C 175 ? VAL C 170 ASN C 174 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 36  ? N THR A 35  O LEU A 92  ? O LEU A 91  
A 2 3 O ILE A 93  ? O ILE A 92  N VAL A 14  ? N VAL A 13  
A 3 4 N PHE A 13  ? N PHE A 12  O LEU A 117 ? O LEU A 116 
A 4 5 N TYR A 118 ? N TYR A 117 O VAL A 174 ? O VAL A 173 
B 1 2 N THR B 36  ? N THR B 35  O LEU B 92  ? O LEU B 91  
B 2 3 O ILE B 93  ? O ILE B 92  N VAL B 14  ? N VAL B 13  
B 3 4 N PHE B 13  ? N PHE B 12  O LEU B 117 ? O LEU B 116 
B 4 5 N TYR B 118 ? N TYR B 117 O ARG B 172 ? O ARG B 171 
C 1 2 N LEU C 38  ? N LEU C 37  O ASP C 94  ? O ASP C 93  
C 2 3 O ILE C 93  ? O ILE C 92  N VAL C 14  ? N VAL C 13  
C 3 4 N VAL C 15  ? N VAL C 14  O VAL C 119 ? O VAL C 118 
C 4 5 N LEU C 116 ? N LEU C 115 O ARG C 172 ? O ARG C 171 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN A 601'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN B 611'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN C 621'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN A 641'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN B 642'  
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN B 643'  
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN C 644'  
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN C 645'  
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 701' 
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 702' 
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 B 703' 
BC3 Software ? ? ? ? 43 'BINDING SITE FOR RESIDUE AP5 A 631' 
BC4 Software ? ? ? ? 40 'BINDING SITE FOR RESIDUE AP5 B 632' 
BC5 Software ? ? ? ? 41 'BINDING SITE FOR RESIDUE AP5 C 633' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  AP5 G .   ? AP5 A 631 . ? 1_555 ? 
2   AC1 5  HOH R .   ? HOH A 703 . ? 1_555 ? 
3   AC1 5  HOH R .   ? HOH A 704 . ? 1_555 ? 
4   AC1 5  HOH R .   ? HOH A 838 . ? 1_555 ? 
5   AC1 5  HOH R .   ? HOH A 845 . ? 1_555 ? 
6   AC2 5  AP5 M .   ? AP5 B 632 . ? 1_555 ? 
7   AC2 5  HOH S .   ? HOH B 704 . ? 1_555 ? 
8   AC2 5  HOH S .   ? HOH B 776 . ? 1_555 ? 
9   AC2 5  HOH S .   ? HOH B 805 . ? 1_555 ? 
10  AC2 5  HOH S .   ? HOH B 811 . ? 1_555 ? 
11  AC3 5  AP5 Q .   ? AP5 C 633 . ? 1_555 ? 
12  AC3 5  HOH T .   ? HOH C 646 . ? 1_555 ? 
13  AC3 5  HOH T .   ? HOH C 647 . ? 1_555 ? 
14  AC3 5  HOH T .   ? HOH C 732 . ? 1_555 ? 
15  AC3 5  HOH T .   ? HOH C 741 . ? 1_555 ? 
16  AC4 5  GLU A 27  ? GLU A 26  . ? 1_555 ? 
17  AC4 5  HIS A 37  ? HIS A 36  . ? 1_555 ? 
18  AC4 5  GLU A 145 ? GLU A 144 . ? 4_555 ? 
19  AC4 5  HOH R .   ? HOH A 840 . ? 1_555 ? 
20  AC4 5  HOH R .   ? HOH A 846 . ? 1_555 ? 
21  AC5 5  GLU A 71  ? GLU A 70  . ? 1_555 ? 
22  AC5 5  ASP A 75  ? ASP A 74  . ? 1_555 ? 
23  AC5 5  GLU B 71  ? GLU B 70  . ? 1_555 ? 
24  AC5 5  GLU B 105 ? GLU B 104 . ? 1_555 ? 
25  AC5 5  ARG B 109 ? ARG B 108 . ? 1_555 ? 
26  AC6 5  GLU B 27  ? GLU B 26  . ? 1_555 ? 
27  AC6 5  HIS B 37  ? HIS B 36  . ? 1_555 ? 
28  AC6 5  HOH S .   ? HOH B 806 . ? 1_555 ? 
29  AC6 5  HOH S .   ? HOH B 812 . ? 1_555 ? 
30  AC6 5  GLU C 145 ? GLU C 144 . ? 3_455 ? 
31  AC7 5  GLU B 145 ? GLU B 144 . ? 3_555 ? 
32  AC7 5  GLU C 27  ? GLU C 26  . ? 1_555 ? 
33  AC7 5  HIS C 37  ? HIS C 36  . ? 1_555 ? 
34  AC7 5  HOH T .   ? HOH C 733 . ? 1_555 ? 
35  AC7 5  HOH T .   ? HOH C 742 . ? 1_555 ? 
36  AC8 5  GLU C 71  ? GLU C 70  . ? 1_555 ? 
37  AC8 5  GLU C 71  ? GLU C 70  . ? 2_656 ? 
38  AC8 5  ASP C 75  ? ASP C 74  . ? 2_656 ? 
39  AC8 5  ASP C 75  ? ASP C 74  . ? 1_555 ? 
40  AC8 5  ARG C 109 ? ARG C 108 . ? 2_656 ? 
41  AC9 4  THR B 36  ? THR B 35  . ? 1_555 ? 
42  AC9 4  LYS B 84  ? LYS B 83  . ? 1_555 ? 
43  AC9 4  THR B 87  ? THR B 86  . ? 1_555 ? 
44  AC9 4  SER B 88  ? SER B 87  . ? 1_555 ? 
45  BC1 3  ARG A 108 ? ARG A 107 . ? 1_555 ? 
46  BC1 3  HOH R .   ? HOH A 858 . ? 1_555 ? 
47  BC1 3  ARG B 54  ? ARG B 53  . ? 1_555 ? 
48  BC2 6  ALA A 83  ? ALA A 82  . ? 1_555 ? 
49  BC2 6  LYS A 84  ? LYS A 83  . ? 1_555 ? 
50  BC2 6  HOH R .   ? HOH A 872 . ? 1_555 ? 
51  BC2 6  SER B 1   ? SER B 0   . ? 1_555 ? 
52  BC2 6  MET B 2   ? MET B 1   . ? 1_555 ? 
53  BC2 6  HOH S .   ? HOH B 740 . ? 1_555 ? 
54  BC3 43 PRO A 18  ? PRO A 17  . ? 1_555 ? 
55  BC3 43 GLY A 19  ? GLY A 18  . ? 1_555 ? 
56  BC3 43 SER A 20  ? SER A 19  . ? 1_555 ? 
57  BC3 43 GLY A 21  ? GLY A 20  . ? 1_555 ? 
58  BC3 43 LYS A 22  ? LYS A 21  . ? 1_555 ? 
59  BC3 43 GLY A 23  ? GLY A 22  . ? 1_555 ? 
60  BC3 43 THR A 24  ? THR A 23  . ? 1_555 ? 
61  BC3 43 THR A 40  ? THR A 39  . ? 1_555 ? 
62  BC3 43 GLY A 41  ? GLY A 40  . ? 1_555 ? 
63  BC3 43 LEU A 44  ? LEU A 43  . ? 1_555 ? 
64  BC3 43 ARG A 45  ? ARG A 44  . ? 1_555 ? 
65  BC3 43 MET A 62  ? MET A 61  . ? 1_555 ? 
66  BC3 43 GLN A 66  ? GLN A 65  . ? 1_555 ? 
67  BC3 43 LEU A 67  ? LEU A 66  . ? 1_555 ? 
68  BC3 43 VAL A 68  ? VAL A 67  . ? 1_555 ? 
69  BC3 43 GLY A 95  ? GLY A 94  . ? 1_555 ? 
70  BC3 43 TYR A 96  ? TYR A 95  . ? 1_555 ? 
71  BC3 43 ARG A 98  ? ARG A 97  . ? 1_555 ? 
72  BC3 43 GLN A 102 ? GLN A 101 . ? 1_555 ? 
73  BC3 43 ARG A 129 ? ARG A 128 . ? 1_555 ? 
74  BC3 43 ARG A 133 ? ARG A 132 . ? 1_555 ? 
75  BC3 43 ARG A 139 ? ARG A 138 . ? 1_555 ? 
76  BC3 43 ARG A 150 ? ARG A 149 . ? 1_555 ? 
77  BC3 43 GLY A 178 ? GLY A 177 . ? 1_555 ? 
78  BC3 43 SER A 179 ? SER A 178 . ? 1_555 ? 
79  BC3 43 VAL A 180 ? VAL A 179 . ? 1_555 ? 
80  BC3 43 ZN  D .   ? ZN  A 601 . ? 1_555 ? 
81  BC3 43 HOH R .   ? HOH A 703 . ? 1_555 ? 
82  BC3 43 HOH R .   ? HOH A 704 . ? 1_555 ? 
83  BC3 43 HOH R .   ? HOH A 707 . ? 1_555 ? 
84  BC3 43 HOH R .   ? HOH A 709 . ? 1_555 ? 
85  BC3 43 HOH R .   ? HOH A 710 . ? 1_555 ? 
86  BC3 43 HOH R .   ? HOH A 720 . ? 1_555 ? 
87  BC3 43 HOH R .   ? HOH A 723 . ? 1_555 ? 
88  BC3 43 HOH R .   ? HOH A 725 . ? 1_555 ? 
89  BC3 43 HOH R .   ? HOH A 732 . ? 4_555 ? 
90  BC3 43 HOH R .   ? HOH A 738 . ? 1_555 ? 
91  BC3 43 HOH R .   ? HOH A 755 . ? 1_555 ? 
92  BC3 43 HOH R .   ? HOH A 783 . ? 1_555 ? 
93  BC3 43 HOH R .   ? HOH A 789 . ? 1_555 ? 
94  BC3 43 HOH R .   ? HOH A 820 . ? 1_555 ? 
95  BC3 43 HOH R .   ? HOH A 838 . ? 1_555 ? 
96  BC3 43 HOH R .   ? HOH A 845 . ? 1_555 ? 
97  BC4 40 GLY B 17  ? GLY B 16  . ? 1_555 ? 
98  BC4 40 PRO B 18  ? PRO B 17  . ? 1_555 ? 
99  BC4 40 GLY B 19  ? GLY B 18  . ? 1_555 ? 
100 BC4 40 SER B 20  ? SER B 19  . ? 1_555 ? 
101 BC4 40 GLY B 21  ? GLY B 20  . ? 1_555 ? 
102 BC4 40 LYS B 22  ? LYS B 21  . ? 1_555 ? 
103 BC4 40 GLY B 23  ? GLY B 22  . ? 1_555 ? 
104 BC4 40 THR B 24  ? THR B 23  . ? 1_555 ? 
105 BC4 40 THR B 40  ? THR B 39  . ? 1_555 ? 
106 BC4 40 GLY B 41  ? GLY B 40  . ? 1_555 ? 
107 BC4 40 LEU B 44  ? LEU B 43  . ? 1_555 ? 
108 BC4 40 ARG B 45  ? ARG B 44  . ? 1_555 ? 
109 BC4 40 MET B 62  ? MET B 61  . ? 1_555 ? 
110 BC4 40 GLN B 66  ? GLN B 65  . ? 1_555 ? 
111 BC4 40 LEU B 67  ? LEU B 66  . ? 1_555 ? 
112 BC4 40 VAL B 68  ? VAL B 67  . ? 1_555 ? 
113 BC4 40 GLY B 95  ? GLY B 94  . ? 1_555 ? 
114 BC4 40 TYR B 96  ? TYR B 95  . ? 1_555 ? 
115 BC4 40 ARG B 98  ? ARG B 97  . ? 1_555 ? 
116 BC4 40 GLN B 102 ? GLN B 101 . ? 1_555 ? 
117 BC4 40 ARG B 129 ? ARG B 128 . ? 1_555 ? 
118 BC4 40 LEU B 130 ? LEU B 129 . ? 1_555 ? 
119 BC4 40 ARG B 133 ? ARG B 132 . ? 1_555 ? 
120 BC4 40 ARG B 139 ? ARG B 138 . ? 1_555 ? 
121 BC4 40 ARG B 150 ? ARG B 149 . ? 1_555 ? 
122 BC4 40 GLY B 178 ? GLY B 177 . ? 1_555 ? 
123 BC4 40 VAL B 180 ? VAL B 179 . ? 1_555 ? 
124 BC4 40 ZN  H .   ? ZN  B 611 . ? 1_555 ? 
125 BC4 40 HOH S .   ? HOH B 704 . ? 1_555 ? 
126 BC4 40 HOH S .   ? HOH B 705 . ? 1_555 ? 
127 BC4 40 HOH S .   ? HOH B 711 . ? 1_555 ? 
128 BC4 40 HOH S .   ? HOH B 726 . ? 1_555 ? 
129 BC4 40 HOH S .   ? HOH B 728 . ? 1_555 ? 
130 BC4 40 HOH S .   ? HOH B 776 . ? 1_555 ? 
131 BC4 40 HOH S .   ? HOH B 778 . ? 1_555 ? 
132 BC4 40 HOH S .   ? HOH B 797 . ? 1_555 ? 
133 BC4 40 HOH S .   ? HOH B 803 . ? 1_555 ? 
134 BC4 40 HOH S .   ? HOH B 805 . ? 1_555 ? 
135 BC4 40 HOH S .   ? HOH B 811 . ? 1_555 ? 
136 BC4 40 HOH S .   ? HOH B 838 . ? 1_555 ? 
137 BC5 41 LYS B 64  ? LYS B 63  . ? 3_555 ? 
138 BC5 41 GLY C 17  ? GLY C 16  . ? 1_555 ? 
139 BC5 41 PRO C 18  ? PRO C 17  . ? 1_555 ? 
140 BC5 41 GLY C 19  ? GLY C 18  . ? 1_555 ? 
141 BC5 41 SER C 20  ? SER C 19  . ? 1_555 ? 
142 BC5 41 GLY C 21  ? GLY C 20  . ? 1_555 ? 
143 BC5 41 LYS C 22  ? LYS C 21  . ? 1_555 ? 
144 BC5 41 GLY C 23  ? GLY C 22  . ? 1_555 ? 
145 BC5 41 THR C 24  ? THR C 23  . ? 1_555 ? 
146 BC5 41 THR C 40  ? THR C 39  . ? 1_555 ? 
147 BC5 41 GLY C 41  ? GLY C 40  . ? 1_555 ? 
148 BC5 41 LEU C 44  ? LEU C 43  . ? 1_555 ? 
149 BC5 41 ARG C 45  ? ARG C 44  . ? 1_555 ? 
150 BC5 41 MET C 62  ? MET C 61  . ? 1_555 ? 
151 BC5 41 GLN C 66  ? GLN C 65  . ? 1_555 ? 
152 BC5 41 LEU C 67  ? LEU C 66  . ? 1_555 ? 
153 BC5 41 VAL C 68  ? VAL C 67  . ? 1_555 ? 
154 BC5 41 GLY C 95  ? GLY C 94  . ? 1_555 ? 
155 BC5 41 TYR C 96  ? TYR C 95  . ? 1_555 ? 
156 BC5 41 ARG C 98  ? ARG C 97  . ? 1_555 ? 
157 BC5 41 GLN C 102 ? GLN C 101 . ? 1_555 ? 
158 BC5 41 ARG C 129 ? ARG C 128 . ? 1_555 ? 
159 BC5 41 ARG C 133 ? ARG C 132 . ? 1_555 ? 
160 BC5 41 ARG C 139 ? ARG C 138 . ? 1_555 ? 
161 BC5 41 ARG C 150 ? ARG C 149 . ? 1_555 ? 
162 BC5 41 GLY C 178 ? GLY C 177 . ? 1_555 ? 
163 BC5 41 VAL C 180 ? VAL C 179 . ? 1_555 ? 
164 BC5 41 ZN  N .   ? ZN  C 621 . ? 1_555 ? 
165 BC5 41 HOH T .   ? HOH C 646 . ? 1_555 ? 
166 BC5 41 HOH T .   ? HOH C 647 . ? 1_555 ? 
167 BC5 41 HOH T .   ? HOH C 649 . ? 1_555 ? 
168 BC5 41 HOH T .   ? HOH C 659 . ? 1_555 ? 
169 BC5 41 HOH T .   ? HOH C 663 . ? 1_555 ? 
170 BC5 41 HOH T .   ? HOH C 672 . ? 1_555 ? 
171 BC5 41 HOH T .   ? HOH C 674 . ? 1_555 ? 
172 BC5 41 HOH T .   ? HOH C 684 . ? 1_555 ? 
173 BC5 41 HOH T .   ? HOH C 688 . ? 1_555 ? 
174 BC5 41 HOH T .   ? HOH C 701 . ? 1_555 ? 
175 BC5 41 HOH T .   ? HOH C 703 . ? 1_555 ? 
176 BC5 41 HOH T .   ? HOH C 710 . ? 1_555 ? 
177 BC5 41 HOH T .   ? HOH C 732 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Z83 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Z83 
_atom_sites.fract_transf_matrix[1][1]   0.007924 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003867 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021617 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009305 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 1.470   57.113 17.923  1.00 26.40 ? 0   SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 2.466   56.048 18.290  1.00 26.13 ? 0   SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 3.420   55.923 17.136  1.00 22.32 ? 0   SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 3.068   56.293 16.002  1.00 21.15 ? 0   SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 1.776   54.718 18.557  1.00 25.09 ? 0   SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 1.406   54.076 17.354  1.00 26.81 ? 0   SER A OG  1 
ATOM   7    N  N   . MET A 1 2   ? 4.626   55.429 17.411  1.00 22.92 ? 1   MET A N   1 
ATOM   8    C  CA  . MET A 1 2   ? 5.642   55.335 16.361  1.00 21.42 ? 1   MET A CA  1 
ATOM   9    C  C   . MET A 1 2   ? 5.163   54.375 15.315  1.00 22.95 ? 1   MET A C   1 
ATOM   10   O  O   . MET A 1 2   ? 5.437   54.576 14.130  1.00 22.90 ? 1   MET A O   1 
ATOM   11   C  CB  . MET A 1 2   ? 7.016   54.886 16.874  1.00 22.51 ? 1   MET A CB  1 
ATOM   12   C  CG  . MET A 1 2   ? 7.665   55.800 17.906  1.00 23.25 ? 1   MET A CG  1 
ATOM   13   S  SD  . MET A 1 2   ? 7.741   57.579 17.451  1.00 31.65 ? 1   MET A SD  1 
ATOM   14   C  CE  . MET A 1 2   ? 9.050   57.516 16.242  1.00 34.33 ? 1   MET A CE  1 
ATOM   15   N  N   . GLU A 1 3   ? 4.430   53.342 15.735  1.00 22.13 ? 2   GLU A N   1 
ATOM   16   C  CA  . GLU A 1 3   ? 3.923   52.345 14.771  1.00 24.40 ? 2   GLU A CA  1 
ATOM   17   C  C   . GLU A 1 3   ? 2.867   52.926 13.801  1.00 22.87 ? 2   GLU A C   1 
ATOM   18   O  O   . GLU A 1 3   ? 2.882   52.627 12.600  1.00 22.49 ? 2   GLU A O   1 
ATOM   19   C  CB  . GLU A 1 3   ? 3.380   51.133 15.508  1.00 25.19 ? 2   GLU A CB  1 
ATOM   20   C  CG  . GLU A 1 3   ? 2.729   50.117 14.610  1.00 27.68 ? 2   GLU A CG  1 
ATOM   21   C  CD  . GLU A 1 3   ? 3.667   49.566 13.516  1.00 39.55 ? 2   GLU A CD  1 
ATOM   22   O  OE1 . GLU A 1 3   ? 4.891   49.420 13.770  1.00 29.30 ? 2   GLU A OE1 1 
ATOM   23   O  OE2 . GLU A 1 3   ? 3.153   49.259 12.405  1.00 33.05 ? 2   GLU A OE2 1 
ATOM   24   N  N   . GLU A 1 4   ? 1.996   53.796 14.303  1.00 23.36 ? 3   GLU A N   1 
ATOM   25   C  CA  . GLU A 1 4   ? 1.091   54.565 13.437  1.00 24.69 ? 3   GLU A CA  1 
ATOM   26   C  C   . GLU A 1 4   ? 1.837   55.462 12.414  1.00 23.27 ? 3   GLU A C   1 
ATOM   27   O  O   . GLU A 1 4   ? 1.464   55.539 11.220  1.00 19.95 ? 3   GLU A O   1 
ATOM   28   C  CB  . GLU A 1 4   ? 0.142   55.419 14.293  1.00 26.67 ? 3   GLU A CB  1 
ATOM   29   C  CG  . GLU A 1 4   ? -0.924  54.607 15.040  1.00 28.35 ? 3   GLU A CG  1 
ATOM   30   C  CD  . GLU A 1 4   ? -1.923  55.453 15.809  1.00 30.99 ? 3   GLU A CD  1 
ATOM   31   O  OE1 . GLU A 1 4   ? -1.714  56.688 15.917  1.00 44.56 ? 3   GLU A OE1 1 
ATOM   32   O  OE2 . GLU A 1 4   ? -2.919  54.873 16.314  1.00 39.98 ? 3   GLU A OE2 1 
ATOM   33   N  N   . LYS A 1 5   ? 2.885   56.147 12.865  1.00 21.80 ? 4   LYS A N   1 
ATOM   34   C  CA  . LYS A 1 5   ? 3.722   56.942 11.930  1.00 21.92 ? 4   LYS A CA  1 
ATOM   35   C  C   . LYS A 1 5   ? 4.350   56.048 10.826  1.00 20.00 ? 4   LYS A C   1 
ATOM   36   O  O   . LYS A 1 5   ? 4.392   56.420 9.641   1.00 19.50 ? 4   LYS A O   1 
ATOM   37   C  CB  . LYS A 1 5   ? 4.826   57.649 12.691  1.00 19.96 ? 4   LYS A CB  1 
ATOM   38   C  CG  . LYS A 1 5   ? 4.371   58.597 13.707  1.00 26.44 ? 4   LYS A CG  1 
ATOM   39   C  CD  . LYS A 1 5   ? 5.540   59.156 14.461  1.00 28.79 ? 4   LYS A CD  1 
ATOM   40   C  CE  . LYS A 1 5   ? 5.095   60.028 15.617  1.00 30.68 ? 4   LYS A CE  1 
ATOM   41   N  NZ  . LYS A 1 5   ? 4.992   61.430 15.191  1.00 37.65 ? 4   LYS A NZ  1 
ATOM   42   N  N   . LEU A 1 6   ? 4.828   54.876 11.224  1.00 19.64 ? 5   LEU A N   1 
ATOM   43   C  CA  . LEU A 1 6   ? 5.411   53.905 10.304  1.00 19.20 ? 5   LEU A CA  1 
ATOM   44   C  C   . LEU A 1 6   ? 4.423   53.497 9.199   1.00 22.55 ? 5   LEU A C   1 
ATOM   45   O  O   . LEU A 1 6   ? 4.802   53.388 8.032   1.00 21.20 ? 5   LEU A O   1 
ATOM   46   C  CB  . LEU A 1 6   ? 5.913   52.646 11.055  1.00 21.86 ? 5   LEU A CB  1 
ATOM   47   C  CG  . LEU A 1 6   ? 7.221   52.811 11.856  1.00 22.80 ? 5   LEU A CG  1 
ATOM   48   C  CD1 . LEU A 1 6   ? 7.564   51.601 12.708  1.00 22.85 ? 5   LEU A CD1 1 
ATOM   49   C  CD2 . LEU A 1 6   ? 8.389   53.132 10.886  1.00 28.13 ? 5   LEU A CD2 1 
ATOM   50   N  N   . LYS A 1 7   ? 3.163   53.295 9.574   1.00 23.01 ? 6   LYS A N   1 
ATOM   51   C  CA  . LYS A 1 7   ? 2.152   52.885 8.620   1.00 25.32 ? 6   LYS A CA  1 
ATOM   52   C  C   . LYS A 1 7   ? 1.761   53.973 7.627   1.00 23.54 ? 6   LYS A C   1 
ATOM   53   O  O   . LYS A 1 7   ? 1.250   53.651 6.561   1.00 26.41 ? 6   LYS A O   1 
ATOM   54   C  CB  . LYS A 1 7   ? 0.922   52.299 9.343   1.00 26.06 ? 6   LYS A CB  1 
ATOM   55   C  CG  . LYS A 1 7   ? 1.266   50.928 9.949   1.00 27.58 ? 6   LYS A CG  1 
ATOM   56   C  CD  . LYS A 1 7   ? 0.068   50.154 10.382  1.00 33.09 ? 6   LYS A CD  1 
ATOM   57   C  CE  . LYS A 1 7   ? 0.406   48.711 10.818  1.00 32.23 ? 6   LYS A CE  1 
ATOM   58   N  NZ  . LYS A 1 7   ? 0.986   47.747 9.807   1.00 27.50 ? 6   LYS A NZ  1 
ATOM   59   N  N   . LYS A 1 8   ? 2.009   55.248 7.929   1.00 21.19 ? 7   LYS A N   1 
ATOM   60   C  CA  . LYS A 1 8   ? 1.674   56.287 6.965   1.00 20.87 ? 7   LYS A CA  1 
ATOM   61   C  C   . LYS A 1 8   ? 2.867   56.852 6.156   1.00 22.84 ? 7   LYS A C   1 
ATOM   62   O  O   . LYS A 1 8   ? 2.737   57.874 5.487   1.00 25.16 ? 7   LYS A O   1 
ATOM   63   C  CB  . LYS A 1 8   ? 0.858   57.398 7.643   1.00 23.05 ? 7   LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 8   ? 1.536   58.095 8.775   1.00 23.99 ? 7   LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 8   ? 0.496   58.846 9.636   1.00 23.60 ? 7   LYS A CD  1 
ATOM   66   N  N   . THR A 1 9   ? 4.013   56.188 6.207   1.00 22.29 ? 8   THR A N   1 
ATOM   67   C  CA  . THR A 1 9   ? 5.217   56.614 5.478   1.00 22.26 ? 8   THR A CA  1 
ATOM   68   C  C   . THR A 1 9   ? 5.445   55.648 4.318   1.00 20.91 ? 8   THR A C   1 
ATOM   69   O  O   . THR A 1 9   ? 5.199   54.459 4.489   1.00 18.63 ? 8   THR A O   1 
ATOM   70   C  CB  . THR A 1 9   ? 6.466   56.590 6.424   1.00 26.30 ? 8   THR A CB  1 
ATOM   71   O  OG1 . THR A 1 9   ? 6.162   57.288 7.650   1.00 26.00 ? 8   THR A OG1 1 
ATOM   72   C  CG2 . THR A 1 9   ? 7.684   57.278 5.772   1.00 22.77 ? 8   THR A CG2 1 
ATOM   73   N  N   . ASN A 1 10  ? 5.931   56.139 3.174   1.00 19.03 ? 9   ASN A N   1 
ATOM   74   C  CA  . ASN A 1 10  ? 6.182   55.284 2.026   1.00 19.67 ? 9   ASN A CA  1 
ATOM   75   C  C   . ASN A 1 10  ? 7.350   54.337 2.328   1.00 16.01 ? 9   ASN A C   1 
ATOM   76   O  O   . ASN A 1 10  ? 8.337   54.733 2.932   1.00 15.80 ? 9   ASN A O   1 
ATOM   77   C  CB  . ASN A 1 10  ? 6.512   56.113 0.766   1.00 20.13 ? 9   ASN A CB  1 
ATOM   78   C  CG  . ASN A 1 10  ? 5.275   56.818 0.150   1.00 32.28 ? 9   ASN A CG  1 
ATOM   79   O  OD1 . ASN A 1 10  ? 4.139   56.373 0.295   1.00 32.62 ? 9   ASN A OD1 1 
ATOM   80   N  ND2 . ASN A 1 10  ? 5.525   57.920 -0.565  1.00 29.42 ? 9   ASN A ND2 1 
ATOM   81   N  N   . ILE A 1 11  ? 7.205   53.071 1.954   1.00 16.78 ? 10  ILE A N   1 
ATOM   82   C  CA  . ILE A 1 11  ? 8.243   52.061 2.159   1.00 16.20 ? 10  ILE A CA  1 
ATOM   83   C  C   . ILE A 1 11  ? 8.535   51.435 0.821   1.00 18.86 ? 10  ILE A C   1 
ATOM   84   O  O   . ILE A 1 11  ? 7.642   50.856 0.218   1.00 19.47 ? 10  ILE A O   1 
ATOM   85   C  CB  . ILE A 1 11  ? 7.797   51.013 3.214   1.00 18.25 ? 10  ILE A CB  1 
ATOM   86   C  CG1 . ILE A 1 11  ? 7.657   51.712 4.567   1.00 20.25 ? 10  ILE A CG1 1 
ATOM   87   C  CG2 . ILE A 1 11  ? 8.785   49.797 3.291   1.00 18.88 ? 10  ILE A CG2 1 
ATOM   88   C  CD1 . ILE A 1 11  ? 6.925   50.872 5.649   1.00 21.94 ? 10  ILE A CD1 1 
ATOM   89   N  N   . ILE A 1 12  ? 9.788   51.581 0.361   1.00 18.82 ? 11  ILE A N   1 
ATOM   90   C  CA  . ILE A 1 12  ? 10.251  51.025 -0.909  1.00 19.21 ? 11  ILE A CA  1 
ATOM   91   C  C   . ILE A 1 12  ? 11.290  49.968 -0.650  1.00 19.10 ? 11  ILE A C   1 
ATOM   92   O  O   . ILE A 1 12  ? 12.375  50.275 -0.148  1.00 17.61 ? 11  ILE A O   1 
ATOM   93   C  CB  . ILE A 1 12  ? 10.866  52.115 -1.807  1.00 20.23 ? 11  ILE A CB  1 
ATOM   94   C  CG1 . ILE A 1 12  ? 9.849   53.231 -2.004  1.00 18.09 ? 11  ILE A CG1 1 
ATOM   95   C  CG2 . ILE A 1 12  ? 11.297  51.522 -3.139  1.00 20.53 ? 11  ILE A CG2 1 
ATOM   96   C  CD1 . ILE A 1 12  ? 10.378  54.498 -2.822  1.00 21.67 ? 11  ILE A CD1 1 
ATOM   97   N  N   . PHE A 1 13  ? 10.951  48.715 -0.952  1.00 16.79 ? 12  PHE A N   1 
ATOM   98   C  CA  . PHE A 1 13  ? 11.904  47.634 -0.921  1.00 16.12 ? 12  PHE A CA  1 
ATOM   99   C  C   . PHE A 1 13  ? 12.791  47.715 -2.177  1.00 16.90 ? 12  PHE A C   1 
ATOM   100  O  O   . PHE A 1 13  ? 12.292  47.666 -3.312  1.00 16.82 ? 12  PHE A O   1 
ATOM   101  C  CB  . PHE A 1 13  ? 11.194  46.247 -0.912  1.00 17.06 ? 12  PHE A CB  1 
ATOM   102  C  CG  . PHE A 1 13  ? 10.496  45.870 0.387   1.00 20.81 ? 12  PHE A CG  1 
ATOM   103  C  CD1 . PHE A 1 13  ? 10.701  46.547 1.572   1.00 19.09 ? 12  PHE A CD1 1 
ATOM   104  C  CD2 . PHE A 1 13  ? 9.642   44.770 0.410   1.00 17.15 ? 12  PHE A CD2 1 
ATOM   105  C  CE1 . PHE A 1 13  ? 10.016  46.167 2.734   1.00 16.27 ? 12  PHE A CE1 1 
ATOM   106  C  CE2 . PHE A 1 13  ? 9.005   44.343 1.590   1.00 20.53 ? 12  PHE A CE2 1 
ATOM   107  C  CZ  . PHE A 1 13  ? 9.181   45.037 2.739   1.00 22.08 ? 12  PHE A CZ  1 
ATOM   108  N  N   . VAL A 1 14  ? 14.108  47.837 -1.995  1.00 16.55 ? 13  VAL A N   1 
ATOM   109  C  CA  . VAL A 1 14  ? 15.041  47.757 -3.144  1.00 17.65 ? 13  VAL A CA  1 
ATOM   110  C  C   . VAL A 1 14  ? 15.659  46.350 -3.163  1.00 18.56 ? 13  VAL A C   1 
ATOM   111  O  O   . VAL A 1 14  ? 16.331  45.944 -2.212  1.00 20.40 ? 13  VAL A O   1 
ATOM   112  C  CB  . VAL A 1 14  ? 16.103  48.822 -3.044  1.00 20.99 ? 13  VAL A CB  1 
ATOM   113  C  CG1 . VAL A 1 14  ? 16.971  48.830 -4.277  1.00 22.85 ? 13  VAL A CG1 1 
ATOM   114  C  CG2 . VAL A 1 14  ? 15.450  50.158 -2.864  1.00 13.87 ? 13  VAL A CG2 1 
ATOM   115  N  N   . VAL A 1 15  ? 15.393  45.595 -4.222  1.00 17.60 ? 14  VAL A N   1 
ATOM   116  C  CA  . VAL A 1 15  ? 15.750  44.143 -4.254  1.00 18.48 ? 14  VAL A CA  1 
ATOM   117  C  C   . VAL A 1 15  ? 16.600  43.881 -5.508  1.00 21.30 ? 14  VAL A C   1 
ATOM   118  O  O   . VAL A 1 15  ? 16.340  44.457 -6.566  1.00 20.29 ? 14  VAL A O   1 
ATOM   119  C  CB  . VAL A 1 15  ? 14.505  43.257 -4.312  1.00 20.14 ? 14  VAL A CB  1 
ATOM   120  C  CG1 . VAL A 1 15  ? 14.892  41.756 -4.360  1.00 19.87 ? 14  VAL A CG1 1 
ATOM   121  C  CG2 . VAL A 1 15  ? 13.609  43.502 -3.098  1.00 19.74 ? 14  VAL A CG2 1 
ATOM   122  N  N   . GLY A 1 16  ? 17.599  43.014 -5.364  1.00 19.40 ? 15  GLY A N   1 
ATOM   123  C  CA  . GLY A 1 16  ? 18.530  42.697 -6.443  1.00 17.49 ? 15  GLY A CA  1 
ATOM   124  C  C   . GLY A 1 16  ? 19.762  41.967 -5.973  1.00 17.48 ? 15  GLY A C   1 
ATOM   125  O  O   . GLY A 1 16  ? 20.062  41.944 -4.801  1.00 15.15 ? 15  GLY A O   1 
ATOM   126  N  N   . GLY A 1 17  ? 20.507  41.393 -6.901  1.00 17.01 ? 16  GLY A N   1 
ATOM   127  C  CA  . GLY A 1 17  ? 21.588  40.489 -6.526  1.00 17.73 ? 16  GLY A CA  1 
ATOM   128  C  C   . GLY A 1 17  ? 22.803  41.178 -5.968  1.00 18.14 ? 16  GLY A C   1 
ATOM   129  O  O   . GLY A 1 17  ? 22.906  42.407 -5.997  1.00 15.38 ? 16  GLY A O   1 
ATOM   130  N  N   . PRO A 1 18  ? 23.781  40.386 -5.533  1.00 17.74 ? 17  PRO A N   1 
ATOM   131  C  CA  . PRO A 1 18  ? 25.001  40.969 -4.966  1.00 17.51 ? 17  PRO A CA  1 
ATOM   132  C  C   . PRO A 1 18  ? 25.796  41.751 -6.020  1.00 18.28 ? 17  PRO A C   1 
ATOM   133  O  O   . PRO A 1 18  ? 26.165  41.193 -7.051  1.00 20.18 ? 17  PRO A O   1 
ATOM   134  C  CB  . PRO A 1 18  ? 25.785  39.740 -4.474  1.00 17.05 ? 17  PRO A CB  1 
ATOM   135  C  CG  . PRO A 1 18  ? 25.221  38.570 -5.204  1.00 23.99 ? 17  PRO A CG  1 
ATOM   136  C  CD  . PRO A 1 18  ? 23.821  38.897 -5.583  1.00 22.35 ? 17  PRO A CD  1 
ATOM   137  N  N   . GLY A 1 19  ? 25.958  43.055 -5.816  1.00 16.96 ? 18  GLY A N   1 
ATOM   138  C  CA  . GLY A 1 19  ? 26.667  43.856 -6.750  1.00 17.49 ? 18  GLY A CA  1 
ATOM   139  C  C   . GLY A 1 19  ? 25.793  44.369 -7.898  1.00 18.64 ? 18  GLY A C   1 
ATOM   140  O  O   . GLY A 1 19  ? 26.324  44.893 -8.867  1.00 20.70 ? 18  GLY A O   1 
ATOM   141  N  N   . SER A 1 20  ? 24.465  44.266 -7.790  1.00 14.82 ? 19  SER A N   1 
ATOM   142  C  CA  . SER A 1 20  ? 23.593  44.734 -8.836  1.00 15.25 ? 19  SER A CA  1 
ATOM   143  C  C   . SER A 1 20  ? 23.598  46.274 -8.970  1.00 15.99 ? 19  SER A C   1 
ATOM   144  O  O   . SER A 1 20  ? 23.175  46.785 -9.993  1.00 19.18 ? 19  SER A O   1 
ATOM   145  C  CB  . SER A 1 20  ? 22.165  44.263 -8.652  1.00 18.88 ? 19  SER A CB  1 
ATOM   146  O  OG  . SER A 1 20  ? 21.649  44.501 -7.372  1.00 16.98 ? 19  SER A OG  1 
ATOM   147  N  N   . GLY A 1 21  ? 24.049  46.962 -7.932  1.00 15.00 ? 20  GLY A N   1 
ATOM   148  C  CA  . GLY A 1 21  ? 24.034  48.443 -7.871  1.00 13.59 ? 20  GLY A CA  1 
ATOM   149  C  C   . GLY A 1 21  ? 22.992  49.086 -6.963  1.00 14.60 ? 20  GLY A C   1 
ATOM   150  O  O   . GLY A 1 21  ? 22.745  50.321 -7.086  1.00 16.54 ? 20  GLY A O   1 
ATOM   151  N  N   . LYS A 1 22  ? 22.446  48.321 -6.002  1.00 16.63 ? 21  LYS A N   1 
ATOM   152  C  CA  . LYS A 1 22  ? 21.422  48.836 -5.056  1.00 17.70 ? 21  LYS A CA  1 
ATOM   153  C  C   . LYS A 1 22  ? 21.876  50.085 -4.282  1.00 19.16 ? 21  LYS A C   1 
ATOM   154  O  O   . LYS A 1 22  ? 21.145  51.097 -4.295  1.00 16.82 ? 21  LYS A O   1 
ATOM   155  C  CB  . LYS A 1 22  ? 20.917  47.784 -4.053  1.00 20.42 ? 21  LYS A CB  1 
ATOM   156  C  CG  . LYS A 1 22  ? 20.196  46.583 -4.709  1.00 21.02 ? 21  LYS A CG  1 
ATOM   157  C  CD  . LYS A 1 22  ? 19.656  45.608 -3.718  1.00 22.68 ? 21  LYS A CD  1 
ATOM   158  C  CE  . LYS A 1 22  ? 20.708  44.908 -2.867  1.00 21.99 ? 21  LYS A CE  1 
ATOM   159  N  NZ  . LYS A 1 22  ? 21.782  44.213 -3.597  1.00 22.33 ? 21  LYS A NZ  1 
ATOM   160  N  N   . GLY A 1 23  ? 23.030  50.028 -3.592  1.00 18.79 ? 22  GLY A N   1 
ATOM   161  C  CA  . GLY A 1 23  ? 23.525  51.224 -2.843  1.00 19.11 ? 22  GLY A CA  1 
ATOM   162  C  C   . GLY A 1 23  ? 23.756  52.453 -3.708  1.00 16.07 ? 22  GLY A C   1 
ATOM   163  O  O   . GLY A 1 23  ? 23.365  53.578 -3.371  1.00 17.31 ? 22  GLY A O   1 
ATOM   164  N  N   . THR A 1 24  ? 24.445  52.229 -4.826  1.00 17.20 ? 23  THR A N   1 
ATOM   165  C  CA  . THR A 1 24  ? 24.730  53.237 -5.822  1.00 17.57 ? 23  THR A CA  1 
ATOM   166  C  C   . THR A 1 24  ? 23.471  53.996 -6.225  1.00 17.45 ? 23  THR A C   1 
ATOM   167  O  O   . THR A 1 24  ? 23.450  55.229 -6.184  1.00 16.96 ? 23  THR A O   1 
ATOM   168  C  CB  . THR A 1 24  ? 25.441  52.597 -7.086  1.00 16.23 ? 23  THR A CB  1 
ATOM   169  O  OG1 . THR A 1 24  ? 26.720  52.083 -6.712  1.00 20.22 ? 23  THR A OG1 1 
ATOM   170  C  CG2 . THR A 1 24  ? 25.661  53.601 -8.178  1.00 18.75 ? 23  THR A CG2 1 
ATOM   171  N  N   . GLN A 1 25  ? 22.432  53.258 -6.606  1.00 16.32 ? 24  GLN A N   1 
ATOM   172  C  CA  . GLN A 1 25  ? 21.143  53.861 -6.986  1.00 16.91 ? 24  GLN A CA  1 
ATOM   173  C  C   . GLN A 1 25  ? 20.433  54.499 -5.792  1.00 15.63 ? 24  GLN A C   1 
ATOM   174  O  O   . GLN A 1 25  ? 19.925  55.591 -5.903  1.00 17.46 ? 24  GLN A O   1 
ATOM   175  C  CB  . GLN A 1 25  ? 20.247  52.800 -7.688  1.00 16.93 ? 24  GLN A CB  1 
ATOM   176  C  CG  . GLN A 1 25  ? 20.777  52.420 -9.126  1.00 14.23 ? 24  GLN A CG  1 
ATOM   177  C  CD  . GLN A 1 25  ? 20.997  53.611 -10.041 1.00 18.98 ? 24  GLN A CD  1 
ATOM   178  O  OE1 . GLN A 1 25  ? 20.126  54.474 -10.175 1.00 18.72 ? 24  GLN A OE1 1 
ATOM   179  N  NE2 . GLN A 1 25  ? 22.173  53.660 -10.689 1.00 18.19 ? 24  GLN A NE2 1 
ATOM   180  N  N   . CYS A 1 26  ? 20.423  53.834 -4.641  1.00 18.61 ? 25  CYS A N   1 
ATOM   181  C  CA  . CYS A 1 26  ? 19.809  54.451 -3.470  1.00 16.64 ? 25  CYS A CA  1 
ATOM   182  C  C   . CYS A 1 26  ? 20.386  55.828 -3.145  1.00 16.75 ? 25  CYS A C   1 
ATOM   183  O  O   . CYS A 1 26  ? 19.614  56.686 -2.739  1.00 16.50 ? 25  CYS A O   1 
ATOM   184  C  CB  . CYS A 1 26  ? 19.889  53.546 -2.246  1.00 16.47 ? 25  CYS A CB  1 
ATOM   185  S  SG  . CYS A 1 26  ? 18.721  52.092 -2.354  1.00 18.85 ? 25  CYS A SG  1 
ATOM   186  N  N   . GLU A 1 27  ? 21.705  56.048 -3.289  1.00 16.21 ? 26  GLU A N   1 
ATOM   187  C  CA  . GLU A 1 27  ? 22.292  57.334 -2.910  1.00 18.62 ? 26  GLU A CA  1 
ATOM   188  C  C   . GLU A 1 27  ? 21.836  58.393 -3.911  1.00 17.66 ? 26  GLU A C   1 
ATOM   189  O  O   . GLU A 1 27  ? 21.634  59.530 -3.550  1.00 19.71 ? 26  GLU A O   1 
ATOM   190  C  CB  . GLU A 1 27  ? 23.821  57.310 -2.780  1.00 18.08 ? 26  GLU A CB  1 
ATOM   191  C  CG  . GLU A 1 27  ? 24.358  56.349 -1.679  1.00 20.00 ? 26  GLU A CG  1 
ATOM   192  C  CD  . GLU A 1 27  ? 23.752  56.614 -0.289  1.00 23.69 ? 26  GLU A CD  1 
ATOM   193  O  OE1 . GLU A 1 27  ? 23.386  57.776 0.015   1.00 22.61 ? 26  GLU A OE1 1 
ATOM   194  O  OE2 . GLU A 1 27  ? 23.647  55.668 0.509   1.00 15.35 ? 26  GLU A OE2 1 
ATOM   195  N  N   . LYS A 1 28  ? 21.611  57.988 -5.159  1.00 16.34 ? 27  LYS A N   1 
ATOM   196  C  CA  . LYS A 1 28  ? 21.020  58.920 -6.150  1.00 16.77 ? 27  LYS A CA  1 
ATOM   197  C  C   . LYS A 1 28  ? 19.581  59.348 -5.818  1.00 15.46 ? 27  LYS A C   1 
ATOM   198  O  O   . LYS A 1 28  ? 19.185  60.526 -5.992  1.00 15.31 ? 27  LYS A O   1 
ATOM   199  C  CB  . LYS A 1 28  ? 21.052  58.293 -7.538  1.00 20.03 ? 27  LYS A CB  1 
ATOM   200  C  CG  . LYS A 1 28  ? 22.416  57.841 -7.958  1.00 25.77 ? 27  LYS A CG  1 
ATOM   201  C  CD  . LYS A 1 28  ? 23.236  58.916 -8.462  1.00 28.41 ? 27  LYS A CD  1 
ATOM   202  C  CE  . LYS A 1 28  ? 23.348  58.894 -9.995  1.00 29.34 ? 27  LYS A CE  1 
ATOM   203  N  NZ  . LYS A 1 28  ? 24.188  60.021 -10.402 1.00 28.44 ? 27  LYS A NZ  1 
ATOM   204  N  N   . ILE A 1 29  ? 18.796  58.379 -5.376  1.00 16.34 ? 28  ILE A N   1 
ATOM   205  C  CA  . ILE A 1 29  ? 17.401  58.584 -5.015  1.00 14.50 ? 28  ILE A CA  1 
ATOM   206  C  C   . ILE A 1 29  ? 17.329  59.491 -3.804  1.00 17.47 ? 28  ILE A C   1 
ATOM   207  O  O   . ILE A 1 29  ? 16.507  60.425 -3.747  1.00 15.57 ? 28  ILE A O   1 
ATOM   208  C  CB  . ILE A 1 29  ? 16.682  57.243 -4.724  1.00 15.34 ? 28  ILE A CB  1 
ATOM   209  C  CG1 . ILE A 1 29  ? 16.593  56.377 -5.973  1.00 15.00 ? 28  ILE A CG1 1 
ATOM   210  C  CG2 . ILE A 1 29  ? 15.278  57.488 -4.136  1.00 20.03 ? 28  ILE A CG2 1 
ATOM   211  C  CD1 . ILE A 1 29  ? 16.217  54.938 -5.656  1.00 14.56 ? 28  ILE A CD1 1 
ATOM   212  N  N   . VAL A 1 30  ? 18.212  59.233 -2.848  1.00 17.47 ? 29  VAL A N   1 
ATOM   213  C  CA  . VAL A 1 30  ? 18.259  60.013 -1.635  1.00 17.96 ? 29  VAL A CA  1 
ATOM   214  C  C   . VAL A 1 30  ? 18.555  61.445 -2.000  1.00 18.15 ? 29  VAL A C   1 
ATOM   215  O  O   . VAL A 1 30  ? 17.894  62.358 -1.499  1.00 20.07 ? 29  VAL A O   1 
ATOM   216  C  CB  . VAL A 1 30  ? 19.346  59.504 -0.677  1.00 17.86 ? 29  VAL A CB  1 
ATOM   217  C  CG1 . VAL A 1 30  ? 19.602  60.477 0.437   1.00 22.16 ? 29  VAL A CG1 1 
ATOM   218  C  CG2 . VAL A 1 30  ? 18.987  58.071 -0.145  1.00 18.94 ? 29  VAL A CG2 1 
ATOM   219  N  N   . GLN A 1 31  ? 19.514  61.661 -2.904  1.00 18.40 ? 30  GLN A N   1 
ATOM   220  C  CA  . GLN A 1 31  ? 19.865  63.060 -3.330  1.00 18.49 ? 30  GLN A CA  1 
ATOM   221  C  C   . GLN A 1 31  ? 18.728  63.795 -4.030  1.00 18.57 ? 30  GLN A C   1 
ATOM   222  O  O   . GLN A 1 31  ? 18.563  65.024 -3.859  1.00 17.86 ? 30  GLN A O   1 
ATOM   223  C  CB  . GLN A 1 31  ? 21.073  63.049 -4.277  1.00 16.10 ? 30  GLN A CB  1 
ATOM   224  C  CG  . GLN A 1 31  ? 22.401  62.563 -3.646  1.00 25.72 ? 30  GLN A CG  1 
ATOM   225  C  CD  . GLN A 1 31  ? 23.389  61.955 -4.672  1.00 25.31 ? 30  GLN A CD  1 
ATOM   226  O  OE1 . GLN A 1 31  ? 23.192  62.030 -5.896  1.00 31.56 ? 30  GLN A OE1 1 
ATOM   227  N  NE2 . GLN A 1 31  ? 24.477  61.415 -4.165  1.00 26.65 ? 30  GLN A NE2 1 
ATOM   228  N  N   . LYS A 1 32  ? 17.977  63.080 -4.870  1.00 14.79 ? 31  LYS A N   1 
ATOM   229  C  CA  . LYS A 1 32  ? 16.910  63.699 -5.679  1.00 18.05 ? 31  LYS A CA  1 
ATOM   230  C  C   . LYS A 1 32  ? 15.563  63.811 -4.958  1.00 19.74 ? 31  LYS A C   1 
ATOM   231  O  O   . LYS A 1 32  ? 14.911  64.869 -5.048  1.00 19.24 ? 31  LYS A O   1 
ATOM   232  C  CB  . LYS A 1 32  ? 16.726  62.928 -6.998  1.00 16.71 ? 31  LYS A CB  1 
ATOM   233  C  CG  . LYS A 1 32  ? 15.609  63.454 -7.917  1.00 21.15 ? 31  LYS A CG  1 
ATOM   234  C  CD  . LYS A 1 32  ? 15.832  63.012 -9.367  1.00 20.16 ? 31  LYS A CD  1 
ATOM   235  C  CE  . LYS A 1 32  ? 14.732  63.508 -10.303 1.00 30.00 ? 31  LYS A CE  1 
ATOM   236  N  NZ  . LYS A 1 32  ? 14.818  62.788 -11.614 1.00 37.00 ? 31  LYS A NZ  1 
ATOM   237  N  N   . TYR A 1 33  ? 15.150  62.727 -4.284  1.00 20.78 ? 32  TYR A N   1 
ATOM   238  C  CA  . TYR A 1 33  ? 13.840  62.605 -3.615  1.00 20.92 ? 32  TYR A CA  1 
ATOM   239  C  C   . TYR A 1 33  ? 13.831  62.789 -2.051  1.00 23.14 ? 32  TYR A C   1 
ATOM   240  O  O   . TYR A 1 33  ? 12.750  62.919 -1.468  1.00 20.70 ? 32  TYR A O   1 
ATOM   241  C  CB  . TYR A 1 33  ? 13.194  61.275 -3.970  1.00 23.09 ? 32  TYR A CB  1 
ATOM   242  C  CG  . TYR A 1 33  ? 12.945  61.077 -5.443  1.00 24.47 ? 32  TYR A CG  1 
ATOM   243  C  CD1 . TYR A 1 33  ? 13.971  60.642 -6.287  1.00 18.43 ? 32  TYR A CD1 1 
ATOM   244  C  CD2 . TYR A 1 33  ? 11.682  61.352 -6.011  1.00 24.89 ? 32  TYR A CD2 1 
ATOM   245  C  CE1 . TYR A 1 33  ? 13.763  60.473 -7.661  1.00 18.87 ? 32  TYR A CE1 1 
ATOM   246  C  CE2 . TYR A 1 33  ? 11.459  61.168 -7.382  1.00 20.24 ? 32  TYR A CE2 1 
ATOM   247  C  CZ  . TYR A 1 33  ? 12.501  60.728 -8.199  1.00 21.71 ? 32  TYR A CZ  1 
ATOM   248  O  OH  . TYR A 1 33  ? 12.299  60.547 -9.559  1.00 22.18 ? 32  TYR A OH  1 
ATOM   249  N  N   . GLY A 1 34  ? 15.000  62.788 -1.390  1.00 20.93 ? 33  GLY A N   1 
ATOM   250  C  CA  . GLY A 1 34  ? 15.103  63.072 0.055   1.00 20.38 ? 33  GLY A CA  1 
ATOM   251  C  C   . GLY A 1 34  ? 14.695  61.935 1.007   1.00 19.58 ? 33  GLY A C   1 
ATOM   252  O  O   . GLY A 1 34  ? 14.430  62.164 2.208   1.00 20.13 ? 33  GLY A O   1 
ATOM   253  N  N   . TYR A 1 35  ? 14.603  60.727 0.468   1.00 19.30 ? 34  TYR A N   1 
ATOM   254  C  CA  . TYR A 1 35  ? 14.221  59.540 1.213   1.00 19.43 ? 34  TYR A CA  1 
ATOM   255  C  C   . TYR A 1 35  ? 15.326  59.095 2.213   1.00 18.35 ? 34  TYR A C   1 
ATOM   256  O  O   . TYR A 1 35  ? 16.455  59.598 2.202   1.00 18.67 ? 34  TYR A O   1 
ATOM   257  C  CB  . TYR A 1 35  ? 13.859  58.443 0.222   1.00 22.35 ? 34  TYR A CB  1 
ATOM   258  C  CG  . TYR A 1 35  ? 12.396  58.445 -0.228  1.00 24.60 ? 34  TYR A CG  1 
ATOM   259  C  CD1 . TYR A 1 35  ? 11.759  59.600 -0.677  1.00 29.11 ? 34  TYR A CD1 1 
ATOM   260  C  CD2 . TYR A 1 35  ? 11.645  57.279 -0.160  1.00 26.16 ? 34  TYR A CD2 1 
ATOM   261  C  CE1 . TYR A 1 35  ? 10.403  59.596 -1.069  1.00 25.86 ? 34  TYR A CE1 1 
ATOM   262  C  CE2 . TYR A 1 35  ? 10.289  57.255 -0.568  1.00 34.30 ? 34  TYR A CE2 1 
ATOM   263  C  CZ  . TYR A 1 35  ? 9.677   58.411 -1.018  1.00 34.41 ? 34  TYR A CZ  1 
ATOM   264  O  OH  . TYR A 1 35  ? 8.335   58.378 -1.399  1.00 33.77 ? 34  TYR A OH  1 
ATOM   265  N  N   . THR A 1 36  ? 14.965  58.184 3.111   1.00 17.10 ? 35  THR A N   1 
ATOM   266  C  CA  . THR A 1 36  ? 15.860  57.692 4.149   1.00 15.81 ? 35  THR A CA  1 
ATOM   267  C  C   . THR A 1 36  ? 16.341  56.341 3.702   1.00 17.66 ? 35  THR A C   1 
ATOM   268  O  O   . THR A 1 36  ? 15.492  55.448 3.491   1.00 18.82 ? 35  THR A O   1 
ATOM   269  C  CB  . THR A 1 36  ? 15.094  57.550 5.505   1.00 19.37 ? 35  THR A CB  1 
ATOM   270  O  OG1 . THR A 1 36  ? 14.625  58.837 5.942   1.00 18.05 ? 35  THR A OG1 1 
ATOM   271  C  CG2 . THR A 1 36  ? 15.959  56.919 6.631   1.00 20.00 ? 35  THR A CG2 1 
ATOM   272  N  N   . HIS A 1 37  ? 17.668  56.160 3.580   1.00 15.14 ? 36  HIS A N   1 
ATOM   273  C  CA  . HIS A 1 37  ? 18.224  54.917 3.035   1.00 17.07 ? 36  HIS A CA  1 
ATOM   274  C  C   . HIS A 1 37  ? 18.767  54.079 4.196   1.00 16.75 ? 36  HIS A C   1 
ATOM   275  O  O   . HIS A 1 37  ? 19.601  54.570 4.960   1.00 15.44 ? 36  HIS A O   1 
ATOM   276  C  CB  . HIS A 1 37  ? 19.352  55.171 1.947   1.00 17.02 ? 36  HIS A CB  1 
ATOM   277  C  CG  . HIS A 1 37  ? 20.037  53.917 1.504   1.00 15.50 ? 36  HIS A CG  1 
ATOM   278  N  ND1 . HIS A 1 37  ? 21.412  53.762 1.483   1.00 17.57 ? 36  HIS A ND1 1 
ATOM   279  C  CD2 . HIS A 1 37  ? 19.531  52.748 1.051   1.00 18.76 ? 36  HIS A CD2 1 
ATOM   280  C  CE1 . HIS A 1 37  ? 21.717  52.549 1.074   1.00 29.62 ? 36  HIS A CE1 1 
ATOM   281  N  NE2 . HIS A 1 37  ? 20.594  51.895 0.842   1.00 20.25 ? 36  HIS A NE2 1 
ATOM   282  N  N   . LEU A 1 38  ? 18.289  52.838 4.292   1.00 19.13 ? 37  LEU A N   1 
ATOM   283  C  CA  . LEU A 1 38  ? 18.720  51.873 5.261   1.00 18.72 ? 37  LEU A CA  1 
ATOM   284  C  C   . LEU A 1 38  ? 19.111  50.596 4.556   1.00 18.63 ? 37  LEU A C   1 
ATOM   285  O  O   . LEU A 1 38  ? 18.301  50.029 3.835   1.00 19.17 ? 37  LEU A O   1 
ATOM   286  C  CB  . LEU A 1 38  ? 17.598  51.587 6.274   1.00 19.37 ? 37  LEU A CB  1 
ATOM   287  C  CG  . LEU A 1 38  ? 17.259  52.813 7.146   1.00 23.85 ? 37  LEU A CG  1 
ATOM   288  C  CD1 . LEU A 1 38  ? 16.054  52.514 8.018   1.00 27.25 ? 37  LEU A CD1 1 
ATOM   289  C  CD2 . LEU A 1 38  ? 18.441  53.181 8.020   1.00 19.35 ? 37  LEU A CD2 1 
ATOM   290  N  N   . SER A 1 39  ? 20.379  50.191 4.730   1.00 17.57 ? 38  SER A N   1 
ATOM   291  C  CA  . SER A 1 39  ? 20.904  48.934 4.189   1.00 18.25 ? 38  SER A CA  1 
ATOM   292  C  C   . SER A 1 39  ? 21.153  47.986 5.351   1.00 17.73 ? 38  SER A C   1 
ATOM   293  O  O   . SER A 1 39  ? 21.885  48.343 6.245   1.00 17.64 ? 38  SER A O   1 
ATOM   294  C  CB  . SER A 1 39  ? 22.224  49.260 3.448   1.00 20.26 ? 38  SER A CB  1 
ATOM   295  O  OG  . SER A 1 39  ? 23.014  48.107 3.203   1.00 20.49 ? 38  SER A OG  1 
ATOM   296  N  N   . THR A 1 40  ? 20.543  46.788 5.351   1.00 17.63 ? 39  THR A N   1 
ATOM   297  C  CA  . THR A 1 40  ? 20.780  45.841 6.411   1.00 19.43 ? 39  THR A CA  1 
ATOM   298  C  C   . THR A 1 40  ? 22.241  45.370 6.470   1.00 17.19 ? 39  THR A C   1 
ATOM   299  O  O   . THR A 1 40  ? 22.759  45.112 7.548   1.00 16.51 ? 39  THR A O   1 
ATOM   300  C  CB  . THR A 1 40  ? 19.810  44.639 6.362   1.00 18.85 ? 39  THR A CB  1 
ATOM   301  O  OG1 . THR A 1 40  ? 19.604  44.219 5.006   1.00 19.91 ? 39  THR A OG1 1 
ATOM   302  C  CG2 . THR A 1 40  ? 18.451  44.999 6.990   1.00 19.60 ? 39  THR A CG2 1 
ATOM   303  N  N   . GLY A 1 41  ? 22.890  45.241 5.325   1.00 17.61 ? 40  GLY A N   1 
ATOM   304  C  CA  . GLY A 1 41  ? 24.335  44.929 5.279   1.00 18.06 ? 40  GLY A CA  1 
ATOM   305  C  C   . GLY A 1 41  ? 25.182  46.006 5.927   1.00 15.70 ? 40  GLY A C   1 
ATOM   306  O  O   . GLY A 1 41  ? 26.059  45.702 6.750   1.00 16.93 ? 40  GLY A O   1 
ATOM   307  N  N   . ASP A 1 42  ? 24.874  47.286 5.660   1.00 17.26 ? 41  ASP A N   1 
ATOM   308  C  CA  . ASP A 1 42  ? 25.550  48.357 6.369   1.00 17.27 ? 41  ASP A CA  1 
ATOM   309  C  C   . ASP A 1 42  ? 25.353  48.261 7.886   1.00 18.55 ? 41  ASP A C   1 
ATOM   310  O  O   . ASP A 1 42  ? 26.280  48.448 8.663   1.00 19.46 ? 41  ASP A O   1 
ATOM   311  C  CB  . ASP A 1 42  ? 25.115  49.731 5.868   1.00 19.93 ? 41  ASP A CB  1 
ATOM   312  C  CG  . ASP A 1 42  ? 25.641  50.080 4.480   1.00 26.88 ? 41  ASP A CG  1 
ATOM   313  O  OD1 . ASP A 1 42  ? 26.678  49.551 4.043   1.00 29.03 ? 41  ASP A OD1 1 
ATOM   314  O  OD2 . ASP A 1 42  ? 25.037  50.974 3.818   1.00 40.21 ? 41  ASP A OD2 1 
ATOM   315  N  N   . LEU A 1 43  ? 24.127  48.024 8.322   1.00 16.47 ? 42  LEU A N   1 
ATOM   316  C  CA  . LEU A 1 43  ? 23.836  48.031 9.728   1.00 16.04 ? 42  LEU A CA  1 
ATOM   317  C  C   . LEU A 1 43  ? 24.564  46.875 10.390  1.00 17.50 ? 42  LEU A C   1 
ATOM   318  O  O   . LEU A 1 43  ? 25.127  46.991 11.500  1.00 16.59 ? 42  LEU A O   1 
ATOM   319  C  CB  . LEU A 1 43  ? 22.322  47.924 9.944   1.00 18.42 ? 42  LEU A CB  1 
ATOM   320  C  CG  . LEU A 1 43  ? 21.471  49.119 9.527   1.00 17.18 ? 42  LEU A CG  1 
ATOM   321  C  CD1 . LEU A 1 43  ? 19.971  48.708 9.576   1.00 26.76 ? 42  LEU A CD1 1 
ATOM   322  C  CD2 . LEU A 1 43  ? 21.767  50.319 10.379  1.00 20.90 ? 42  LEU A CD2 1 
ATOM   323  N  N   . LEU A 1 44  ? 24.589  45.754 9.697   1.00 15.24 ? 43  LEU A N   1 
ATOM   324  C  CA  . LEU A 1 44  ? 25.336  44.595 10.182  1.00 17.06 ? 43  LEU A CA  1 
ATOM   325  C  C   . LEU A 1 44  ? 26.831  44.869 10.281  1.00 16.73 ? 43  LEU A C   1 
ATOM   326  O  O   . LEU A 1 44  ? 27.427  44.643 11.328  1.00 19.55 ? 43  LEU A O   1 
ATOM   327  C  CB  . LEU A 1 44  ? 25.039  43.368 9.343   1.00 17.61 ? 43  LEU A CB  1 
ATOM   328  C  CG  . LEU A 1 44  ? 23.638  42.780 9.498   1.00 19.72 ? 43  LEU A CG  1 
ATOM   329  C  CD1 . LEU A 1 44  ? 23.386  41.787 8.361   1.00 18.91 ? 43  LEU A CD1 1 
ATOM   330  C  CD2 . LEU A 1 44  ? 23.449  42.080 10.834  1.00 20.12 ? 43  LEU A CD2 1 
ATOM   331  N  N   . ARG A 1 45  ? 27.436  45.406 9.234   1.00 16.55 ? 44  ARG A N   1 
ATOM   332  C  CA  . ARG A 1 45  ? 28.869  45.678 9.280   1.00 18.13 ? 44  ARG A CA  1 
ATOM   333  C  C   . ARG A 1 45  ? 29.216  46.721 10.378  1.00 19.10 ? 44  ARG A C   1 
ATOM   334  O  O   . ARG A 1 45  ? 30.318  46.700 10.916  1.00 21.15 ? 44  ARG A O   1 
ATOM   335  C  CB  . ARG A 1 45  ? 29.377  46.132 7.915   1.00 20.41 ? 44  ARG A CB  1 
ATOM   336  C  CG  . ARG A 1 45  ? 29.363  45.076 6.888   1.00 22.45 ? 44  ARG A CG  1 
ATOM   337  C  CD  . ARG A 1 45  ? 30.052  45.482 5.593   1.00 25.49 ? 44  ARG A CD  1 
ATOM   338  N  NE  . ARG A 1 45  ? 29.282  46.477 4.845   1.00 20.80 ? 44  ARG A NE  1 
ATOM   339  C  CZ  . ARG A 1 45  ? 28.272  46.189 4.024   1.00 21.55 ? 44  ARG A CZ  1 
ATOM   340  N  NH1 . ARG A 1 45  ? 27.875  44.926 3.789   1.00 20.35 ? 44  ARG A NH1 1 
ATOM   341  N  NH2 . ARG A 1 45  ? 27.623  47.176 3.447   1.00 20.10 ? 44  ARG A NH2 1 
ATOM   342  N  N   . SER A 1 46  ? 28.268  47.608 10.723  1.00 17.71 ? 45  SER A N   1 
ATOM   343  C  CA  A SER A 1 46  ? 28.472  48.559 11.816  0.50 19.86 ? 45  SER A CA  1 
ATOM   344  C  CA  B SER A 1 46  ? 28.459  48.567 11.823  0.50 19.75 ? 45  SER A CA  1 
ATOM   345  C  C   . SER A 1 46  ? 28.573  47.822 13.157  1.00 21.68 ? 45  SER A C   1 
ATOM   346  O  O   . SER A 1 46  ? 29.351  48.205 14.015  1.00 23.04 ? 45  SER A O   1 
ATOM   347  C  CB  A SER A 1 46  ? 27.356  49.607 11.859  0.50 20.91 ? 45  SER A CB  1 
ATOM   348  C  CB  B SER A 1 46  ? 27.320  49.603 11.885  0.50 20.74 ? 45  SER A CB  1 
ATOM   349  O  OG  A SER A 1 46  ? 27.517  50.456 12.979  0.50 19.39 ? 45  SER A OG  1 
ATOM   350  O  OG  B SER A 1 46  ? 27.487  50.632 10.923  0.50 18.47 ? 45  SER A OG  1 
ATOM   351  N  N   . GLU A 1 47  ? 27.799  46.757 13.332  1.00 19.56 ? 46  GLU A N   1 
ATOM   352  C  CA  . GLU A 1 47  ? 27.920  45.944 14.535  1.00 20.15 ? 46  GLU A CA  1 
ATOM   353  C  C   . GLU A 1 47  ? 29.233  45.174 14.523  1.00 19.62 ? 46  GLU A C   1 
ATOM   354  O  O   . GLU A 1 47  ? 29.888  45.097 15.558  1.00 18.51 ? 46  GLU A O   1 
ATOM   355  C  CB  . GLU A 1 47  ? 26.718  44.987 14.747  1.00 18.71 ? 46  GLU A CB  1 
ATOM   356  C  CG  . GLU A 1 47  ? 26.858  44.096 16.008  1.00 22.17 ? 46  GLU A CG  1 
ATOM   357  C  CD  . GLU A 1 47  ? 25.529  43.779 16.735  1.00 32.33 ? 46  GLU A CD  1 
ATOM   358  O  OE1 . GLU A 1 47  ? 24.437  43.995 16.155  1.00 43.47 ? 46  GLU A OE1 1 
ATOM   359  O  OE2 . GLU A 1 47  ? 25.571  43.280 17.896  1.00 37.37 ? 46  GLU A OE2 1 
ATOM   360  N  N   . VAL A 1 48  ? 29.619  44.614 13.373  1.00 17.64 ? 47  VAL A N   1 
ATOM   361  C  CA  . VAL A 1 48  ? 30.906  43.935 13.253  1.00 20.06 ? 47  VAL A CA  1 
ATOM   362  C  C   . VAL A 1 48  ? 32.044  44.881 13.657  1.00 21.31 ? 47  VAL A C   1 
ATOM   363  O  O   . VAL A 1 48  ? 32.950  44.485 14.385  1.00 21.66 ? 47  VAL A O   1 
ATOM   364  C  CB  . VAL A 1 48  ? 31.146  43.364 11.821  1.00 16.90 ? 47  VAL A CB  1 
ATOM   365  C  CG1 . VAL A 1 48  ? 32.531  42.732 11.695  1.00 20.15 ? 47  VAL A CG1 1 
ATOM   366  C  CG2 . VAL A 1 48  ? 30.047  42.374 11.441  1.00 19.66 ? 47  VAL A CG2 1 
ATOM   367  N  N   . SER A 1 49  ? 31.957  46.138 13.235  1.00 20.64 ? 48  SER A N   1 
ATOM   368  C  CA  . SER A 1 49  ? 32.982  47.162 13.548  1.00 21.37 ? 48  SER A CA  1 
ATOM   369  C  C   . SER A 1 49  ? 33.214  47.433 15.023  1.00 23.84 ? 48  SER A C   1 
ATOM   370  O  O   . SER A 1 49  ? 34.248  48.018 15.388  1.00 23.87 ? 48  SER A O   1 
ATOM   371  C  CB  . SER A 1 49  ? 32.592  48.485 12.918  1.00 22.65 ? 48  SER A CB  1 
ATOM   372  O  OG  . SER A 1 49  ? 32.744  48.402 11.523  1.00 36.79 ? 48  SER A OG  1 
ATOM   373  N  N   . SER A 1 50  ? 32.250  47.070 15.864  1.00 23.32 ? 49  SER A N   1 
ATOM   374  C  CA  . SER A 1 50  ? 32.403  47.195 17.314  1.00 24.63 ? 49  SER A CA  1 
ATOM   375  C  C   . SER A 1 50  ? 33.489  46.274 17.853  1.00 24.24 ? 49  SER A C   1 
ATOM   376  O  O   . SER A 1 50  ? 34.035  46.514 18.919  1.00 24.02 ? 49  SER A O   1 
ATOM   377  C  CB  . SER A 1 50  ? 31.076  46.896 18.019  1.00 25.56 ? 49  SER A CB  1 
ATOM   378  O  OG  . SER A 1 50  ? 30.843  45.498 18.154  1.00 24.95 ? 49  SER A OG  1 
ATOM   379  N  N   . GLY A 1 51  ? 33.781  45.203 17.129  1.00 25.33 ? 50  GLY A N   1 
ATOM   380  C  CA  . GLY A 1 51  ? 34.745  44.222 17.594  1.00 26.11 ? 50  GLY A CA  1 
ATOM   381  C  C   . GLY A 1 51  ? 34.148  43.248 18.600  1.00 26.02 ? 50  GLY A C   1 
ATOM   382  O  O   . GLY A 1 51  ? 34.881  42.447 19.182  1.00 27.34 ? 50  GLY A O   1 
ATOM   383  N  N   . SER A 1 52  ? 32.827  43.272 18.797  1.00 24.44 ? 51  SER A N   1 
ATOM   384  C  CA  . SER A 1 52  ? 32.186  42.440 19.833  1.00 22.30 ? 51  SER A CA  1 
ATOM   385  C  C   . SER A 1 52  ? 32.142  40.969 19.450  1.00 23.47 ? 51  SER A C   1 
ATOM   386  O  O   . SER A 1 52  ? 32.294  40.639 18.266  1.00 18.89 ? 51  SER A O   1 
ATOM   387  C  CB  . SER A 1 52  ? 30.758  42.917 20.043  1.00 23.38 ? 51  SER A CB  1 
ATOM   388  O  OG  . SER A 1 52  ? 30.026  42.683 18.875  1.00 18.66 ? 51  SER A OG  1 
ATOM   389  N  N   . ALA A 1 53  ? 31.905  40.096 20.439  1.00 22.14 ? 52  ALA A N   1 
ATOM   390  C  CA  . ALA A 1 53  ? 31.686  38.658 20.183  1.00 22.96 ? 52  ALA A CA  1 
ATOM   391  C  C   . ALA A 1 53  ? 30.511  38.419 19.234  1.00 24.16 ? 52  ALA A C   1 
ATOM   392  O  O   . ALA A 1 53  ? 30.588  37.598 18.298  1.00 23.17 ? 52  ALA A O   1 
ATOM   393  C  CB  . ALA A 1 53  ? 31.444  37.920 21.486  1.00 24.00 ? 52  ALA A CB  1 
ATOM   394  N  N   . ARG A 1 54  ? 29.433  39.165 19.455  1.00 24.48 ? 53  ARG A N   1 
ATOM   395  C  CA  . ARG A 1 54  ? 28.252  39.061 18.640  1.00 25.56 ? 53  ARG A CA  1 
ATOM   396  C  C   . ARG A 1 54  ? 28.600  39.421 17.204  1.00 22.79 ? 53  ARG A C   1 
ATOM   397  O  O   . ARG A 1 54  ? 28.241  38.699 16.259  1.00 19.11 ? 53  ARG A O   1 
ATOM   398  C  CB  . ARG A 1 54  ? 27.209  40.020 19.193  1.00 28.08 ? 53  ARG A CB  1 
ATOM   399  C  CG  . ARG A 1 54  ? 25.894  40.065 18.454  1.00 39.32 ? 53  ARG A CG  1 
ATOM   400  C  CD  . ARG A 1 54  ? 24.852  40.737 19.354  1.00 45.06 ? 53  ARG A CD  1 
ATOM   401  N  NE  . ARG A 1 54  ? 24.654  39.933 20.562  1.00 48.37 ? 53  ARG A NE  1 
ATOM   402  C  CZ  . ARG A 1 54  ? 23.629  39.110 20.778  1.00 49.03 ? 53  ARG A CZ  1 
ATOM   403  N  NH1 . ARG A 1 54  ? 22.641  38.981 19.895  1.00 49.44 ? 53  ARG A NH1 1 
ATOM   404  N  NH2 . ARG A 1 54  ? 23.584  38.422 21.908  1.00 47.54 ? 53  ARG A NH2 1 
ATOM   405  N  N   . GLY A 1 55  ? 29.326  40.523 17.065  1.00 20.17 ? 54  GLY A N   1 
ATOM   406  C  CA  . GLY A 1 55  ? 29.877  40.982 15.788  1.00 20.33 ? 54  GLY A CA  1 
ATOM   407  C  C   . GLY A 1 55  ? 30.717  39.933 15.073  1.00 19.75 ? 54  GLY A C   1 
ATOM   408  O  O   . GLY A 1 55  ? 30.560  39.730 13.876  1.00 17.91 ? 54  GLY A O   1 
ATOM   409  N  N   . LYS A 1 56  ? 31.567  39.221 15.800  1.00 18.98 ? 55  LYS A N   1 
ATOM   410  C  CA  . LYS A 1 56  ? 32.405  38.207 15.139  1.00 20.60 ? 55  LYS A CA  1 
ATOM   411  C  C   . LYS A 1 56  ? 31.562  37.053 14.577  1.00 20.50 ? 55  LYS A C   1 
ATOM   412  O  O   . LYS A 1 56  ? 31.821  36.588 13.475  1.00 17.50 ? 55  LYS A O   1 
ATOM   413  C  CB  . LYS A 1 56  ? 33.499  37.693 16.073  1.00 23.03 ? 55  LYS A CB  1 
ATOM   414  C  CG  . LYS A 1 56  ? 34.653  38.662 16.211  1.00 27.48 ? 55  LYS A CG  1 
ATOM   415  C  CD  . LYS A 1 56  ? 35.594  38.220 17.299  1.00 33.73 ? 55  LYS A CD  1 
ATOM   416  C  CE  . LYS A 1 56  ? 36.717  39.242 17.509  1.00 39.59 ? 55  LYS A CE  1 
ATOM   417  N  NZ  . LYS A 1 56  ? 37.986  38.612 17.995  1.00 45.87 ? 55  LYS A NZ  1 
ATOM   418  N  N   . LYS A 1 57  ? 30.533  36.632 15.314  1.00 19.93 ? 56  LYS A N   1 
ATOM   419  C  CA  . LYS A 1 57  ? 29.661  35.560 14.814  1.00 21.74 ? 56  LYS A CA  1 
ATOM   420  C  C   . LYS A 1 57  ? 28.899  36.000 13.578  1.00 21.15 ? 56  LYS A C   1 
ATOM   421  O  O   . LYS A 1 57  ? 28.735  35.217 12.680  1.00 18.84 ? 56  LYS A O   1 
ATOM   422  C  CB  . LYS A 1 57  ? 28.701  35.020 15.884  1.00 26.14 ? 56  LYS A CB  1 
ATOM   423  C  CG  . LYS A 1 57  ? 27.754  36.027 16.481  1.00 30.02 ? 56  LYS A CG  1 
ATOM   424  N  N   . LEU A 1 58  ? 28.442  37.253 13.543  1.00 19.27 ? 57  LEU A N   1 
ATOM   425  C  CA  . LEU A 1 58  ? 27.777  37.789 12.369  1.00 21.94 ? 57  LEU A CA  1 
ATOM   426  C  C   . LEU A 1 58  ? 28.730  37.877 11.167  1.00 19.15 ? 57  LEU A C   1 
ATOM   427  O  O   . LEU A 1 58  ? 28.372  37.471 10.062  1.00 18.83 ? 57  LEU A O   1 
ATOM   428  C  CB  . LEU A 1 58  ? 27.234  39.188 12.660  1.00 20.97 ? 57  LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 58  ? 26.112  39.262 13.689  1.00 24.77 ? 57  LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 58  ? 25.769  40.727 13.989  1.00 24.68 ? 57  LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 58  ? 24.874  38.510 13.226  1.00 29.84 ? 57  LEU A CD2 1 
ATOM   432  N  N   . SER A 1 59  ? 29.942  38.378 11.395  1.00 18.02 ? 58  SER A N   1 
ATOM   433  C  CA  . SER A 1 59  ? 30.932  38.465 10.325  1.00 19.82 ? 58  SER A CA  1 
ATOM   434  C  C   . SER A 1 59  ? 31.261  37.084 9.730   1.00 19.42 ? 58  SER A C   1 
ATOM   435  O  O   . SER A 1 59  ? 31.481  36.945 8.532   1.00 18.77 ? 58  SER A O   1 
ATOM   436  C  CB  . SER A 1 59  ? 32.209  39.120 10.858  1.00 21.68 ? 58  SER A CB  1 
ATOM   437  O  OG  . SER A 1 59  ? 33.064  39.438 9.794   1.00 23.28 ? 58  SER A OG  1 
ATOM   438  N  N   . GLU A 1 60  ? 31.343  36.059 10.569  1.00 20.51 ? 59  GLU A N   1 
ATOM   439  C  CA  . GLU A 1 60  ? 31.660  34.713 10.077  1.00 18.83 ? 59  GLU A CA  1 
ATOM   440  C  C   . GLU A 1 60  ? 30.540  34.158 9.157   1.00 19.48 ? 59  GLU A C   1 
ATOM   441  O  O   . GLU A 1 60  ? 30.785  33.282 8.270   1.00 20.74 ? 59  GLU A O   1 
ATOM   442  C  CB  . GLU A 1 60  ? 31.949  33.780 11.252  1.00 21.05 ? 59  GLU A CB  1 
ATOM   443  C  CG  . GLU A 1 60  ? 33.295  34.044 11.920  1.00 22.28 ? 59  GLU A CG  1 
ATOM   444  C  CD  . GLU A 1 60  ? 33.504  33.306 13.260  1.00 22.91 ? 59  GLU A CD  1 
ATOM   445  O  OE1 . GLU A 1 60  ? 32.979  32.167 13.451  1.00 25.53 ? 59  GLU A OE1 1 
ATOM   446  O  OE2 . GLU A 1 60  ? 34.263  33.862 14.107  1.00 27.74 ? 59  GLU A OE2 1 
ATOM   447  N  N   . ILE A 1 61  ? 29.325  34.656 9.359   1.00 18.97 ? 60  ILE A N   1 
ATOM   448  C  CA  . ILE A 1 61  ? 28.193  34.282 8.519   1.00 17.96 ? 60  ILE A CA  1 
ATOM   449  C  C   . ILE A 1 61  ? 28.201  35.058 7.206   1.00 17.97 ? 60  ILE A C   1 
ATOM   450  O  O   . ILE A 1 61  ? 27.856  34.521 6.154   1.00 16.77 ? 60  ILE A O   1 
ATOM   451  C  CB  . ILE A 1 61  ? 26.867  34.517 9.265   1.00 17.40 ? 60  ILE A CB  1 
ATOM   452  C  CG1 . ILE A 1 61  ? 26.748  33.564 10.456  1.00 19.89 ? 60  ILE A CG1 1 
ATOM   453  C  CG2 . ILE A 1 61  ? 25.687  34.345 8.320   1.00 19.29 ? 60  ILE A CG2 1 
ATOM   454  C  CD1 . ILE A 1 61  ? 25.571  33.858 11.359  1.00 21.36 ? 60  ILE A CD1 1 
ATOM   455  N  N   . MET A 1 62  ? 28.598  36.325 7.276   1.00 16.87 ? 61  MET A N   1 
ATOM   456  C  CA  . MET A 1 62  ? 28.594  37.194 6.105   1.00 16.50 ? 61  MET A CA  1 
ATOM   457  C  C   . MET A 1 62  ? 29.765  36.878 5.180   1.00 18.47 ? 61  MET A C   1 
ATOM   458  O  O   . MET A 1 62  ? 29.718  37.163 3.984   1.00 18.46 ? 61  MET A O   1 
ATOM   459  C  CB  . MET A 1 62  ? 28.641  38.663 6.528   1.00 16.80 ? 61  MET A CB  1 
ATOM   460  C  CG  . MET A 1 62  ? 27.600  39.043 7.570   1.00 13.97 ? 61  MET A CG  1 
ATOM   461  S  SD  . MET A 1 62  ? 27.873  40.686 8.260   1.00 27.41 ? 61  MET A SD  1 
ATOM   462  C  CE  . MET A 1 62  ? 27.676  41.703 6.799   1.00 18.91 ? 61  MET A CE  1 
ATOM   463  N  N   . GLU A 1 63  ? 30.814  36.287 5.743   1.00 18.05 ? 62  GLU A N   1 
ATOM   464  C  CA  . GLU A 1 63  ? 31.993  35.918 4.968   1.00 18.76 ? 62  GLU A CA  1 
ATOM   465  C  C   . GLU A 1 63  ? 31.799  34.573 4.275   1.00 19.74 ? 62  GLU A C   1 
ATOM   466  O  O   . GLU A 1 63  ? 32.625  34.158 3.463   1.00 22.41 ? 62  GLU A O   1 
ATOM   467  C  CB  . GLU A 1 63  ? 33.232  35.874 5.864   1.00 18.00 ? 62  GLU A CB  1 
ATOM   468  C  CG  . GLU A 1 63  ? 33.613  37.219 6.462   1.00 18.97 ? 62  GLU A CG  1 
ATOM   469  C  CD  . GLU A 1 63  ? 34.714  37.105 7.498   1.00 25.81 ? 62  GLU A CD  1 
ATOM   470  O  OE1 . GLU A 1 63  ? 35.868  36.822 7.112   1.00 30.21 ? 62  GLU A OE1 1 
ATOM   471  O  OE2 . GLU A 1 63  ? 34.427  37.298 8.698   1.00 25.24 ? 62  GLU A OE2 1 
ATOM   472  N  N   . LYS A 1 64  ? 30.703  33.897 4.603   1.00 18.52 ? 63  LYS A N   1 
ATOM   473  C  CA  . LYS A 1 64  ? 30.281  32.701 3.858   1.00 20.88 ? 63  LYS A CA  1 
ATOM   474  C  C   . LYS A 1 64  ? 29.138  32.997 2.878   1.00 20.73 ? 63  LYS A C   1 
ATOM   475  O  O   . LYS A 1 64  ? 28.617  32.087 2.206   1.00 22.62 ? 63  LYS A O   1 
ATOM   476  C  CB  . LYS A 1 64  ? 29.792  31.613 4.824   1.00 21.51 ? 63  LYS A CB  1 
ATOM   477  C  CG  . LYS A 1 64  ? 30.877  30.974 5.657   1.00 27.16 ? 63  LYS A CG  1 
ATOM   478  N  N   . GLY A 1 65  ? 28.754  34.252 2.802   1.00 21.53 ? 64  GLY A N   1 
ATOM   479  C  CA  . GLY A 1 65  ? 27.658  34.701 1.931   1.00 21.83 ? 64  GLY A CA  1 
ATOM   480  C  C   . GLY A 1 65  ? 26.312  34.110 2.308   1.00 22.92 ? 64  GLY A C   1 
ATOM   481  O  O   . GLY A 1 65  ? 25.435  33.965 1.453   1.00 26.81 ? 64  GLY A O   1 
ATOM   482  N  N   . GLN A 1 66  ? 26.129  33.805 3.589   1.00 18.78 ? 65  GLN A N   1 
ATOM   483  C  CA  . GLN A 1 66  ? 24.864  33.260 4.090   1.00 19.71 ? 65  GLN A CA  1 
ATOM   484  C  C   . GLN A 1 66  ? 24.041  34.315 4.782   1.00 17.13 ? 65  GLN A C   1 
ATOM   485  O  O   . GLN A 1 66  ? 24.553  35.383 5.124   1.00 20.84 ? 65  GLN A O   1 
ATOM   486  C  CB  . GLN A 1 66  ? 25.123  32.081 5.050   1.00 22.54 ? 65  GLN A CB  1 
ATOM   487  C  CG  . GLN A 1 66  ? 25.945  30.989 4.457   1.00 28.12 ? 65  GLN A CG  1 
ATOM   488  C  CD  . GLN A 1 66  ? 25.358  30.363 3.183   1.00 43.47 ? 65  GLN A CD  1 
ATOM   489  O  OE1 . GLN A 1 66  ? 24.353  29.619 3.224   1.00 45.04 ? 65  GLN A OE1 1 
ATOM   490  N  NE2 . GLN A 1 66  ? 26.026  30.616 2.045   1.00 42.10 ? 65  GLN A NE2 1 
ATOM   491  N  N   . LEU A 1 67  ? 22.746  34.034 4.933   1.00 15.67 ? 66  LEU A N   1 
ATOM   492  C  CA  . LEU A 1 67  ? 21.838  34.902 5.675   1.00 17.24 ? 66  LEU A CA  1 
ATOM   493  C  C   . LEU A 1 67  ? 22.003  34.790 7.184   1.00 15.72 ? 66  LEU A C   1 
ATOM   494  O  O   . LEU A 1 67  ? 22.078  33.684 7.750   1.00 13.15 ? 66  LEU A O   1 
ATOM   495  C  CB  . LEU A 1 67  ? 20.392  34.593 5.282   1.00 17.92 ? 66  LEU A CB  1 
ATOM   496  C  CG  . LEU A 1 67  ? 20.085  34.794 3.795   1.00 17.33 ? 66  LEU A CG  1 
ATOM   497  C  CD1 . LEU A 1 67  ? 18.621  34.438 3.583   1.00 25.18 ? 66  LEU A CD1 1 
ATOM   498  C  CD2 . LEU A 1 67  ? 20.412  36.242 3.314   1.00 20.77 ? 66  LEU A CD2 1 
ATOM   499  N  N   . VAL A 1 68  ? 22.115  35.933 7.833   1.00 16.04 ? 67  VAL A N   1 
ATOM   500  C  CA  A VAL A 1 68  ? 22.101  36.117 9.285   0.50 17.95 ? 67  VAL A CA  1 
ATOM   501  C  CA  B VAL A 1 68  ? 22.140  35.947 9.288   0.50 17.14 ? 67  VAL A CA  1 
ATOM   502  C  C   . VAL A 1 68  ? 20.707  35.737 9.780   1.00 20.11 ? 67  VAL A C   1 
ATOM   503  O  O   . VAL A 1 68  ? 19.756  35.826 8.998   1.00 19.31 ? 67  VAL A O   1 
ATOM   504  C  CB  A VAL A 1 68  ? 22.385  37.625 9.595   0.50 18.21 ? 67  VAL A CB  1 
ATOM   505  C  CB  B VAL A 1 68  ? 22.755  37.224 9.891   0.50 17.37 ? 67  VAL A CB  1 
ATOM   506  C  CG1 A VAL A 1 68  ? 22.106  38.020 11.027  0.50 18.19 ? 67  VAL A CG1 1 
ATOM   507  C  CG1 B VAL A 1 68  ? 24.177  37.428 9.340   0.50 15.83 ? 67  VAL A CG1 1 
ATOM   508  C  CG2 A VAL A 1 68  ? 23.838  37.960 9.216   0.50 20.66 ? 67  VAL A CG2 1 
ATOM   509  C  CG2 B VAL A 1 68  ? 21.876  38.422 9.651   0.50 16.53 ? 67  VAL A CG2 1 
ATOM   510  N  N   . PRO A 1 69  ? 20.565  35.352 11.067  1.00 20.59 ? 68  PRO A N   1 
ATOM   511  C  CA  . PRO A 1 69  ? 19.208  35.106 11.615  1.00 21.67 ? 68  PRO A CA  1 
ATOM   512  C  C   . PRO A 1 69  ? 18.217  36.245 11.455  1.00 19.92 ? 68  PRO A C   1 
ATOM   513  O  O   . PRO A 1 69  ? 18.579  37.436 11.613  1.00 17.26 ? 68  PRO A O   1 
ATOM   514  C  CB  . PRO A 1 69  ? 19.485  34.789 13.089  1.00 21.64 ? 68  PRO A CB  1 
ATOM   515  C  CG  . PRO A 1 69  ? 20.882  34.137 13.015  1.00 21.78 ? 68  PRO A CG  1 
ATOM   516  C  CD  . PRO A 1 69  ? 21.612  34.995 12.044  1.00 17.92 ? 68  PRO A CD  1 
ATOM   517  N  N   . LEU A 1 70  ? 16.993  35.876 11.043  1.00 17.65 ? 69  LEU A N   1 
ATOM   518  C  CA  . LEU A 1 70  ? 15.895  36.833 10.815  1.00 16.99 ? 69  LEU A CA  1 
ATOM   519  C  C   . LEU A 1 70  ? 15.703  37.793 11.980  1.00 19.68 ? 69  LEU A C   1 
ATOM   520  O  O   . LEU A 1 70  ? 15.594  39.012 11.785  1.00 17.75 ? 69  LEU A O   1 
ATOM   521  C  CB  . LEU A 1 70  ? 14.574  36.100 10.527  1.00 18.70 ? 69  LEU A CB  1 
ATOM   522  C  CG  . LEU A 1 70  ? 13.319  36.924 10.178  1.00 20.94 ? 69  LEU A CG  1 
ATOM   523  C  CD1 . LEU A 1 70  ? 12.384  36.017 9.380   1.00 20.64 ? 69  LEU A CD1 1 
ATOM   524  C  CD2 . LEU A 1 70  ? 12.618  37.494 11.428  1.00 21.73 ? 69  LEU A CD2 1 
ATOM   525  N  N   . GLU A 1 71  ? 15.597  37.273 13.195  1.00 20.26 ? 70  GLU A N   1 
ATOM   526  C  CA  . GLU A 1 71  ? 15.380  38.180 14.347  1.00 21.97 ? 70  GLU A CA  1 
ATOM   527  C  C   . GLU A 1 71  ? 16.434  39.299 14.467  1.00 17.64 ? 70  GLU A C   1 
ATOM   528  O  O   . GLU A 1 71  ? 16.110  40.461 14.757  1.00 18.09 ? 70  GLU A O   1 
ATOM   529  C  CB  . GLU A 1 71  ? 15.356  37.390 15.661  1.00 22.68 ? 70  GLU A CB  1 
ATOM   530  C  CG  . GLU A 1 71  ? 15.282  38.324 16.916  1.00 24.18 ? 70  GLU A CG  1 
ATOM   531  C  CD  . GLU A 1 71  ? 15.767  37.692 18.203  1.00 25.50 ? 70  GLU A CD  1 
ATOM   532  O  OE1 . GLU A 1 71  ? 16.094  36.481 18.219  1.00 33.82 ? 70  GLU A OE1 1 
ATOM   533  O  OE2 . GLU A 1 71  ? 15.828  38.424 19.218  1.00 13.95 ? 70  GLU A OE2 1 
ATOM   534  N  N   . THR A 1 72  ? 17.701  38.922 14.311  1.00 18.90 ? 71  THR A N   1 
ATOM   535  C  CA  . THR A 1 72  ? 18.840  39.815 14.496  1.00 20.37 ? 71  THR A CA  1 
ATOM   536  C  C   . THR A 1 72  ? 18.722  40.965 13.517  1.00 20.32 ? 71  THR A C   1 
ATOM   537  O  O   . THR A 1 72  ? 18.786  42.125 13.879  1.00 20.53 ? 71  THR A O   1 
ATOM   538  C  CB  . THR A 1 72  ? 20.199  39.067 14.249  1.00 22.35 ? 71  THR A CB  1 
ATOM   539  O  OG1 . THR A 1 72  ? 20.342  37.977 15.171  1.00 24.00 ? 71  THR A OG1 1 
ATOM   540  C  CG2 . THR A 1 72  ? 21.359  40.017 14.395  1.00 23.42 ? 71  THR A CG2 1 
ATOM   541  N  N   . VAL A 1 73  ? 18.511  40.633 12.243  1.00 21.98 ? 72  VAL A N   1 
ATOM   542  C  CA  . VAL A 1 73  ? 18.406  41.689 11.240  1.00 19.39 ? 72  VAL A CA  1 
ATOM   543  C  C   . VAL A 1 73  ? 17.101  42.496 11.309  1.00 16.61 ? 72  VAL A C   1 
ATOM   544  O  O   . VAL A 1 73  ? 17.137  43.717 11.165  1.00 17.89 ? 72  VAL A O   1 
ATOM   545  C  CB  . VAL A 1 73  ? 18.671  41.097 9.806   1.00 26.12 ? 72  VAL A CB  1 
ATOM   546  C  CG1 . VAL A 1 73  ? 17.684  40.071 9.451   1.00 17.36 ? 72  VAL A CG1 1 
ATOM   547  C  CG2 . VAL A 1 73  ? 18.639  42.150 8.814   1.00 23.83 ? 72  VAL A CG2 1 
ATOM   548  N  N   . LEU A 1 74  ? 15.955  41.848 11.569  1.00 18.50 ? 73  LEU A N   1 
ATOM   549  C  CA  . LEU A 1 74  ? 14.715  42.614 11.650  1.00 18.76 ? 73  LEU A CA  1 
ATOM   550  C  C   . LEU A 1 74  ? 14.679  43.528 12.896  1.00 17.51 ? 73  LEU A C   1 
ATOM   551  O  O   . LEU A 1 74  ? 14.235  44.700 12.826  1.00 17.58 ? 73  LEU A O   1 
ATOM   552  C  CB  . LEU A 1 74  ? 13.480  41.685 11.571  1.00 18.75 ? 73  LEU A CB  1 
ATOM   553  C  CG  . LEU A 1 74  ? 12.131  42.440 11.595  1.00 19.14 ? 73  LEU A CG  1 
ATOM   554  C  CD1 . LEU A 1 74  ? 12.048  43.684 10.712  1.00 16.70 ? 73  LEU A CD1 1 
ATOM   555  C  CD2 . LEU A 1 74  ? 11.017  41.515 11.258  1.00 20.60 ? 73  LEU A CD2 1 
ATOM   556  N  N   . ASP A 1 75  ? 15.180  43.025 14.031  1.00 14.27 ? 74  ASP A N   1 
ATOM   557  C  CA  . ASP A 1 75  ? 15.297  43.889 15.198  1.00 15.96 ? 74  ASP A CA  1 
ATOM   558  C  C   . ASP A 1 75  ? 16.108  45.179 14.899  1.00 16.64 ? 74  ASP A C   1 
ATOM   559  O  O   . ASP A 1 75  ? 15.715  46.270 15.280  1.00 16.65 ? 74  ASP A O   1 
ATOM   560  C  CB  . ASP A 1 75  ? 16.007  43.185 16.359  1.00 13.96 ? 74  ASP A CB  1 
ATOM   561  C  CG  . ASP A 1 75  ? 15.124  42.192 17.105  1.00 23.10 ? 74  ASP A CG  1 
ATOM   562  O  OD1 . ASP A 1 75  ? 13.876  42.127 16.871  1.00 18.67 ? 74  ASP A OD1 1 
ATOM   563  O  OD2 . ASP A 1 75  ? 15.729  41.482 17.965  1.00 22.00 ? 74  ASP A OD2 1 
ATOM   564  N  N   . MET A 1 76  ? 17.285  45.011 14.292  1.00 16.42 ? 75  MET A N   1 
ATOM   565  C  CA  . MET A 1 76  ? 18.174  46.138 13.943  1.00 21.04 ? 75  MET A CA  1 
ATOM   566  C  C   . MET A 1 76  ? 17.523  47.122 12.962  1.00 17.02 ? 75  MET A C   1 
ATOM   567  O  O   . MET A 1 76  ? 17.643  48.313 13.083  1.00 16.26 ? 75  MET A O   1 
ATOM   568  C  CB  . MET A 1 76  ? 19.410  45.580 13.234  1.00 22.42 ? 75  MET A CB  1 
ATOM   569  C  CG  . MET A 1 76  ? 20.539  45.160 14.023  1.00 28.10 ? 75  MET A CG  1 
ATOM   570  S  SD  . MET A 1 76  ? 21.845  44.775 12.804  1.00 35.85 ? 75  MET A SD  1 
ATOM   571  C  CE  . MET A 1 76  ? 23.098  44.198 13.876  1.00 37.28 ? 75  MET A CE  1 
ATOM   572  N  N   . LEU A 1 77  ? 16.910  46.569 11.929  1.00 18.27 ? 76  LEU A N   1 
ATOM   573  C  CA  . LEU A 1 77  ? 16.171  47.324 10.936  1.00 18.17 ? 76  LEU A CA  1 
ATOM   574  C  C   . LEU A 1 77  ? 15.008  48.102 11.511  1.00 16.75 ? 76  LEU A C   1 
ATOM   575  O  O   . LEU A 1 77  ? 14.869  49.298 11.236  1.00 17.24 ? 76  LEU A O   1 
ATOM   576  C  CB  . LEU A 1 77  ? 15.673  46.376 9.820   1.00 16.48 ? 76  LEU A CB  1 
ATOM   577  C  CG  . LEU A 1 77  ? 14.929  47.078 8.649   1.00 18.81 ? 76  LEU A CG  1 
ATOM   578  C  CD1 . LEU A 1 77  ? 15.714  48.281 8.024   1.00 17.99 ? 76  LEU A CD1 1 
ATOM   579  C  CD2 . LEU A 1 77  ? 14.513  46.073 7.576   1.00 17.73 ? 76  LEU A CD2 1 
ATOM   580  N  N   . ARG A 1 78  ? 14.176  47.453 12.337  1.00 15.19 ? 77  ARG A N   1 
ATOM   581  C  CA  . ARG A 1 78  ? 13.036  48.153 12.959  1.00 17.16 ? 77  ARG A CA  1 
ATOM   582  C  C   . ARG A 1 78  ? 13.482  49.273 13.893  1.00 17.39 ? 77  ARG A C   1 
ATOM   583  O  O   . ARG A 1 78  ? 12.942  50.389 13.831  1.00 15.42 ? 77  ARG A O   1 
ATOM   584  C  CB  . ARG A 1 78  ? 12.056  47.199 13.657  1.00 19.38 ? 77  ARG A CB  1 
ATOM   585  C  CG  . ARG A 1 78  ? 10.677  47.808 13.895  1.00 23.34 ? 77  ARG A CG  1 
ATOM   586  C  CD  . ARG A 1 78  ? 9.667   46.870 14.642  1.00 17.51 ? 77  ARG A CD  1 
ATOM   587  N  NE  . ARG A 1 78  ? 8.404   47.595 14.866  1.00 17.06 ? 77  ARG A NE  1 
ATOM   588  C  CZ  . ARG A 1 78  ? 8.191   48.545 15.770  1.00 22.09 ? 77  ARG A CZ  1 
ATOM   589  N  NH1 . ARG A 1 78  ? 9.130   48.901 16.627  1.00 20.71 ? 77  ARG A NH1 1 
ATOM   590  N  NH2 . ARG A 1 78  ? 7.006   49.130 15.832  1.00 16.60 ? 77  ARG A NH2 1 
ATOM   591  N  N   . ASP A 1 79  ? 14.471  49.007 14.749  1.00 19.92 ? 78  ASP A N   1 
ATOM   592  C  CA  . ASP A 1 79  ? 15.029  50.025 15.635  1.00 18.04 ? 78  ASP A CA  1 
ATOM   593  C  C   . ASP A 1 79  ? 15.513  51.266 14.855  1.00 17.61 ? 78  ASP A C   1 
ATOM   594  O  O   . ASP A 1 79  ? 15.285  52.399 15.257  1.00 19.24 ? 78  ASP A O   1 
ATOM   595  C  CB  . ASP A 1 79  ? 16.180  49.449 16.497  1.00 20.44 ? 78  ASP A CB  1 
ATOM   596  C  CG  . ASP A 1 79  ? 15.704  48.382 17.541  1.00 25.72 ? 78  ASP A CG  1 
ATOM   597  O  OD1 . ASP A 1 79  ? 14.481  48.201 17.755  1.00 23.93 ? 78  ASP A OD1 1 
ATOM   598  O  OD2 . ASP A 1 79  ? 16.575  47.698 18.136  1.00 16.82 ? 78  ASP A OD2 1 
ATOM   599  N  N   . ALA A 1 80  ? 16.166  51.031 13.724  1.00 18.91 ? 79  ALA A N   1 
ATOM   600  C  CA  . ALA A 1 80  ? 16.734  52.097 12.895  1.00 20.69 ? 79  ALA A CA  1 
ATOM   601  C  C   . ALA A 1 80  ? 15.619  52.862 12.200  1.00 19.88 ? 79  ALA A C   1 
ATOM   602  O  O   . ALA A 1 80  ? 15.742  54.031 12.001  1.00 20.02 ? 79  ALA A O   1 
ATOM   603  C  CB  . ALA A 1 80  ? 17.681  51.502 11.865  1.00 20.29 ? 79  ALA A CB  1 
ATOM   604  N  N   . MET A 1 81  ? 14.550  52.174 11.784  1.00 18.25 ? 80  MET A N   1 
ATOM   605  C  CA  . MET A 1 81  ? 13.417  52.875 11.179  1.00 19.97 ? 80  MET A CA  1 
ATOM   606  C  C   . MET A 1 81  ? 12.693  53.741 12.214  1.00 18.87 ? 80  MET A C   1 
ATOM   607  O  O   . MET A 1 81  ? 12.333  54.876 11.941  1.00 17.93 ? 80  MET A O   1 
ATOM   608  C  CB  . MET A 1 81  ? 12.436  51.887 10.562  1.00 17.59 ? 80  MET A CB  1 
ATOM   609  C  CG  . MET A 1 81  ? 12.907  51.249 9.251   1.00 21.87 ? 80  MET A CG  1 
ATOM   610  S  SD  . MET A 1 81  ? 11.718  50.066 8.552   1.00 20.88 ? 80  MET A SD  1 
ATOM   611  C  CE  . MET A 1 81  ? 10.613  51.140 7.668   1.00 18.49 ? 80  MET A CE  1 
ATOM   612  N  N   . VAL A 1 82  ? 12.461  53.187 13.407  1.00 18.05 ? 81  VAL A N   1 
ATOM   613  C  CA  . VAL A 1 82  ? 11.772  53.969 14.479  1.00 18.78 ? 81  VAL A CA  1 
ATOM   614  C  C   . VAL A 1 82  ? 12.526  55.260 14.898  1.00 15.13 ? 81  VAL A C   1 
ATOM   615  O  O   . VAL A 1 82  ? 11.904  56.293 15.240  1.00 17.25 ? 81  VAL A O   1 
ATOM   616  C  CB  . VAL A 1 82  ? 11.482  53.030 15.719  1.00 17.77 ? 81  VAL A CB  1 
ATOM   617  C  CG1 . VAL A 1 82  ? 11.098  53.821 16.942  1.00 20.85 ? 81  VAL A CG1 1 
ATOM   618  C  CG2 . VAL A 1 82  ? 10.364  52.000 15.336  1.00 18.64 ? 81  VAL A CG2 1 
ATOM   619  N  N   . ALA A 1 83  ? 13.863  55.191 14.883  1.00 15.51 ? 82  ALA A N   1 
ATOM   620  C  CA  . ALA A 1 83  ? 14.749  56.359 15.088  1.00 17.56 ? 82  ALA A CA  1 
ATOM   621  C  C   . ALA A 1 83  ? 14.563  57.543 14.117  1.00 18.67 ? 82  ALA A C   1 
ATOM   622  O  O   . ALA A 1 83  ? 14.775  58.713 14.507  1.00 18.53 ? 82  ALA A O   1 
ATOM   623  C  CB  . ALA A 1 83  ? 16.215  55.904 15.092  1.00 17.39 ? 82  ALA A CB  1 
ATOM   624  N  N   . LYS A 1 84  ? 14.162  57.246 12.878  1.00 19.16 ? 83  LYS A N   1 
ATOM   625  C  CA  . LYS A 1 84  ? 14.126  58.245 11.811  1.00 22.45 ? 83  LYS A CA  1 
ATOM   626  C  C   . LYS A 1 84  ? 12.741  58.596 11.279  1.00 21.70 ? 83  LYS A C   1 
ATOM   627  O  O   . LYS A 1 84  ? 12.584  59.579 10.543  1.00 22.11 ? 83  LYS A O   1 
ATOM   628  C  CB  . LYS A 1 84  ? 14.997  57.776 10.684  1.00 25.37 ? 83  LYS A CB  1 
ATOM   629  C  CG  . LYS A 1 84  ? 16.472  57.791 11.086  1.00 31.77 ? 83  LYS A CG  1 
ATOM   630  C  CD  . LYS A 1 84  ? 17.254  56.807 10.293  1.00 35.68 ? 83  LYS A CD  1 
ATOM   631  C  CE  . LYS A 1 84  ? 18.768  57.039 10.497  1.00 41.28 ? 83  LYS A CE  1 
ATOM   632  N  NZ  . LYS A 1 84  ? 19.595  55.935 9.952   1.00 41.07 ? 83  LYS A NZ  1 
ATOM   633  N  N   . VAL A 1 85  ? 11.726  57.842 11.687  1.00 21.12 ? 84  VAL A N   1 
ATOM   634  C  CA  . VAL A 1 85  ? 10.403  57.978 11.077  1.00 21.23 ? 84  VAL A CA  1 
ATOM   635  C  C   . VAL A 1 85  ? 9.810   59.361 11.272  1.00 22.19 ? 84  VAL A C   1 
ATOM   636  O  O   . VAL A 1 85  ? 9.166   59.879 10.367  1.00 22.63 ? 84  VAL A O   1 
ATOM   637  C  CB  . VAL A 1 85  ? 9.394   56.812 11.484  1.00 20.66 ? 84  VAL A CB  1 
ATOM   638  C  CG1 . VAL A 1 85  ? 9.055   56.802 12.986  1.00 19.08 ? 84  VAL A CG1 1 
ATOM   639  C  CG2 . VAL A 1 85  ? 8.138   56.871 10.648  1.00 26.76 ? 84  VAL A CG2 1 
ATOM   640  N  N   . ASN A 1 86  ? 10.043  59.970 12.427  1.00 22.80 ? 85  ASN A N   1 
ATOM   641  C  CA  A ASN A 1 86  ? 9.410   61.245 12.732  0.50 23.69 ? 85  ASN A CA  1 
ATOM   642  C  CA  B ASN A 1 86  ? 9.446   61.269 12.763  0.50 24.54 ? 85  ASN A CA  1 
ATOM   643  C  C   . ASN A 1 86  ? 9.774   62.373 11.755  1.00 25.24 ? 85  ASN A C   1 
ATOM   644  O  O   . ASN A 1 86  ? 9.006   63.338 11.594  1.00 27.80 ? 85  ASN A O   1 
ATOM   645  C  CB  A ASN A 1 86  ? 9.735   61.674 14.157  0.50 23.16 ? 85  ASN A CB  1 
ATOM   646  C  CB  B ASN A 1 86  ? 9.905   61.736 14.153  0.50 24.53 ? 85  ASN A CB  1 
ATOM   647  C  CG  A ASN A 1 86  ? 8.885   62.837 14.613  0.50 19.24 ? 85  ASN A CG  1 
ATOM   648  C  CG  B ASN A 1 86  ? 9.177   61.039 15.291  0.50 25.37 ? 85  ASN A CG  1 
ATOM   649  O  OD1 A ASN A 1 86  ? 7.661   62.766 14.585  0.50 16.48 ? 85  ASN A OD1 1 
ATOM   650  O  OD1 B ASN A 1 86  ? 8.005   60.704 15.182  0.50 27.24 ? 85  ASN A OD1 1 
ATOM   651  N  ND2 A ASN A 1 86  ? 9.527   63.917 15.017  0.50 22.19 ? 85  ASN A ND2 1 
ATOM   652  N  ND2 B ASN A 1 86  ? 9.871   60.845 16.404  0.50 19.40 ? 85  ASN A ND2 1 
ATOM   653  N  N   . THR A 1 87  ? 10.932  62.282 11.115  1.00 22.73 ? 86  THR A N   1 
ATOM   654  C  CA  . THR A 1 87  ? 11.315  63.295 10.130  1.00 24.61 ? 86  THR A CA  1 
ATOM   655  C  C   . THR A 1 87  ? 11.525  62.733 8.708   1.00 24.55 ? 86  THR A C   1 
ATOM   656  O  O   . THR A 1 87  ? 11.932  63.462 7.797   1.00 22.80 ? 86  THR A O   1 
ATOM   657  C  CB  . THR A 1 87  ? 12.564  64.048 10.590  1.00 26.24 ? 86  THR A CB  1 
ATOM   658  O  OG1 . THR A 1 87  ? 13.639  63.125 10.801  1.00 30.48 ? 86  THR A OG1 1 
ATOM   659  C  CG2 . THR A 1 87  ? 12.273  64.807 11.890  1.00 31.04 ? 86  THR A CG2 1 
ATOM   660  N  N   . SER A 1 88  ? 11.231  61.448 8.509   1.00 18.97 ? 87  SER A N   1 
ATOM   661  C  CA  . SER A 1 88  ? 11.476  60.821 7.229   1.00 20.06 ? 87  SER A CA  1 
ATOM   662  C  C   . SER A 1 88  ? 10.462  61.215 6.141   1.00 22.39 ? 87  SER A C   1 
ATOM   663  O  O   . SER A 1 88  ? 9.259   61.293 6.406   1.00 22.38 ? 87  SER A O   1 
ATOM   664  C  CB  . SER A 1 88  ? 11.502  59.284 7.405   1.00 19.66 ? 87  SER A CB  1 
ATOM   665  O  OG  . SER A 1 88  ? 11.668  58.621 6.184   1.00 25.91 ? 87  SER A OG  1 
ATOM   666  N  N   . LYS A 1 89  ? 10.948  61.414 4.906   1.00 22.32 ? 88  LYS A N   1 
ATOM   667  C  CA  . LYS A 1 89  ? 10.082  61.637 3.736   1.00 21.87 ? 88  LYS A CA  1 
ATOM   668  C  C   . LYS A 1 89  ? 9.653   60.334 3.101   1.00 20.40 ? 88  LYS A C   1 
ATOM   669  O  O   . LYS A 1 89  ? 8.859   60.328 2.154   1.00 20.69 ? 88  LYS A O   1 
ATOM   670  C  CB  . LYS A 1 89  ? 10.796  62.471 2.672   1.00 21.41 ? 88  LYS A CB  1 
ATOM   671  C  CG  . LYS A 1 89  ? 11.039  63.891 3.123   1.00 23.64 ? 88  LYS A CG  1 
ATOM   672  C  CD  . LYS A 1 89  ? 11.644  64.782 2.012   1.00 29.40 ? 88  LYS A CD  1 
ATOM   673  C  CE  . LYS A 1 89  ? 10.628  65.157 0.936   1.00 38.75 ? 88  LYS A CE  1 
ATOM   674  N  NZ  . LYS A 1 89  ? 10.892  66.515 0.329   1.00 49.60 ? 88  LYS A NZ  1 
ATOM   675  N  N   . GLY A 1 90  ? 10.120  59.228 3.654   1.00 20.68 ? 89  GLY A N   1 
ATOM   676  C  CA  . GLY A 1 90  ? 9.988   57.916 3.016   1.00 19.10 ? 89  GLY A CA  1 
ATOM   677  C  C   . GLY A 1 90  ? 11.263  57.107 3.199   1.00 19.55 ? 89  GLY A C   1 
ATOM   678  O  O   . GLY A 1 90  ? 12.383  57.667 3.307   1.00 16.47 ? 89  GLY A O   1 
ATOM   679  N  N   . PHE A 1 91  ? 11.087  55.785 3.165   1.00 15.98 ? 90  PHE A N   1 
ATOM   680  C  CA  . PHE A 1 91  ? 12.178  54.817 3.344   1.00 18.62 ? 90  PHE A CA  1 
ATOM   681  C  C   . PHE A 1 91  ? 12.546  53.970 2.108   1.00 18.04 ? 90  PHE A C   1 
ATOM   682  O  O   . PHE A 1 91  ? 11.653  53.402 1.430   1.00 15.79 ? 90  PHE A O   1 
ATOM   683  C  CB  . PHE A 1 91  ? 11.818  53.805 4.423   1.00 14.68 ? 90  PHE A CB  1 
ATOM   684  C  CG  . PHE A 1 91  ? 11.774  54.343 5.832   1.00 16.97 ? 90  PHE A CG  1 
ATOM   685  C  CD1 . PHE A 1 91  ? 10.565  54.670 6.422   1.00 21.84 ? 90  PHE A CD1 1 
ATOM   686  C  CD2 . PHE A 1 91  ? 12.938  54.474 6.584   1.00 18.82 ? 90  PHE A CD2 1 
ATOM   687  C  CE1 . PHE A 1 91  ? 10.515  55.136 7.759   1.00 19.29 ? 90  PHE A CE1 1 
ATOM   688  C  CE2 . PHE A 1 91  ? 12.897  54.907 7.906   1.00 22.53 ? 90  PHE A CE2 1 
ATOM   689  C  CZ  . PHE A 1 91  ? 11.684  55.232 8.488   1.00 18.61 ? 90  PHE A CZ  1 
ATOM   690  N  N   . LEU A 1 92  ? 13.856  53.866 1.855   1.00 18.04 ? 91  LEU A N   1 
ATOM   691  C  CA  . LEU A 1 92  ? 14.424  52.893 0.932   1.00 18.68 ? 91  LEU A CA  1 
ATOM   692  C  C   . LEU A 1 92  ? 15.106  51.785 1.748   1.00 18.78 ? 91  LEU A C   1 
ATOM   693  O  O   . LEU A 1 92  ? 16.134  52.019 2.406   1.00 19.96 ? 91  LEU A O   1 
ATOM   694  C  CB  . LEU A 1 92  ? 15.477  53.520 0.020   1.00 22.84 ? 91  LEU A CB  1 
ATOM   695  C  CG  . LEU A 1 92  ? 15.130  54.742 -0.790  1.00 20.81 ? 91  LEU A CG  1 
ATOM   696  C  CD1 . LEU A 1 92  ? 16.375  55.521 -1.178  1.00 18.84 ? 91  LEU A CD1 1 
ATOM   697  C  CD2 . LEU A 1 92  ? 14.342  54.266 -2.043  1.00 26.59 ? 91  LEU A CD2 1 
ATOM   698  N  N   . ILE A 1 93  ? 14.536  50.601 1.665   1.00 18.57 ? 92  ILE A N   1 
ATOM   699  C  CA  . ILE A 1 93  ? 14.967  49.437 2.416   1.00 19.37 ? 92  ILE A CA  1 
ATOM   700  C  C   . ILE A 1 93  ? 15.737  48.478 1.424   1.00 19.03 ? 92  ILE A C   1 
ATOM   701  O  O   . ILE A 1 93  ? 15.158  47.788 0.557   1.00 20.39 ? 92  ILE A O   1 
ATOM   702  C  CB  . ILE A 1 93  ? 13.788  48.714 3.107   1.00 20.79 ? 92  ILE A CB  1 
ATOM   703  C  CG1 . ILE A 1 93  ? 12.894  49.662 3.944   1.00 21.43 ? 92  ILE A CG1 1 
ATOM   704  C  CG2 . ILE A 1 93  ? 14.326  47.489 3.919   1.00 19.98 ? 92  ILE A CG2 1 
ATOM   705  C  CD1 . ILE A 1 93  ? 13.622  50.482 4.942   1.00 22.70 ? 92  ILE A CD1 1 
ATOM   706  N  N   . ASP A 1 94  ? 17.056  48.509 1.557   1.00 18.63 ? 93  ASP A N   1 
ATOM   707  C  CA  . ASP A 1 94  ? 18.034  47.965 0.590   1.00 15.03 ? 93  ASP A CA  1 
ATOM   708  C  C   . ASP A 1 94  ? 18.558  46.670 1.178   1.00 19.77 ? 93  ASP A C   1 
ATOM   709  O  O   . ASP A 1 94  ? 19.173  46.668 2.259   1.00 21.02 ? 93  ASP A O   1 
ATOM   710  C  CB  . ASP A 1 94  ? 19.106  49.048 0.413   1.00 22.34 ? 93  ASP A CB  1 
ATOM   711  C  CG  . ASP A 1 94  ? 20.396  48.561 -0.203  1.00 20.97 ? 93  ASP A CG  1 
ATOM   712  O  OD1 . ASP A 1 94  ? 20.605  47.344 -0.392  1.00 17.07 ? 93  ASP A OD1 1 
ATOM   713  O  OD2 . ASP A 1 94  ? 21.260  49.429 -0.446  1.00 16.70 ? 93  ASP A OD2 1 
ATOM   714  N  N   . GLY A 1 95  ? 18.291  45.543 0.505   1.00 18.35 ? 94  GLY A N   1 
ATOM   715  C  CA  . GLY A 1 95  ? 18.784  44.265 0.987   1.00 20.85 ? 94  GLY A CA  1 
ATOM   716  C  C   . GLY A 1 95  ? 17.980  43.558 2.070   1.00 20.84 ? 94  GLY A C   1 
ATOM   717  O  O   . GLY A 1 95  ? 18.415  42.536 2.614   1.00 20.68 ? 94  GLY A O   1 
ATOM   718  N  N   . TYR A 1 96  ? 16.777  44.044 2.306   1.00 16.86 ? 95  TYR A N   1 
ATOM   719  C  CA  . TYR A 1 96  ? 15.770  43.391 3.156   1.00 18.91 ? 95  TYR A CA  1 
ATOM   720  C  C   . TYR A 1 96  ? 14.430  43.628 2.473   1.00 16.51 ? 95  TYR A C   1 
ATOM   721  O  O   . TYR A 1 96  ? 14.134  44.778 2.188   1.00 17.16 ? 95  TYR A O   1 
ATOM   722  C  CB  . TYR A 1 96  ? 15.733  43.993 4.601   1.00 17.15 ? 95  TYR A CB  1 
ATOM   723  C  CG  . TYR A 1 96  ? 14.855  43.148 5.555   1.00 17.19 ? 95  TYR A CG  1 
ATOM   724  C  CD1 . TYR A 1 96  ? 15.416  42.374 6.559   1.00 23.01 ? 95  TYR A CD1 1 
ATOM   725  C  CD2 . TYR A 1 96  ? 13.471  43.094 5.397   1.00 18.42 ? 95  TYR A CD2 1 
ATOM   726  C  CE1 . TYR A 1 96  ? 14.610  41.577 7.376   1.00 23.52 ? 95  TYR A CE1 1 
ATOM   727  C  CE2 . TYR A 1 96  ? 12.686  42.333 6.204   1.00 18.18 ? 95  TYR A CE2 1 
ATOM   728  C  CZ  . TYR A 1 96  ? 13.250  41.568 7.193   1.00 22.88 ? 95  TYR A CZ  1 
ATOM   729  O  OH  . TYR A 1 96  ? 12.450  40.747 7.969   1.00 21.80 ? 95  TYR A OH  1 
ATOM   730  N  N   . PRO A 1 97  ? 13.608  42.588 2.269   1.00 15.13 ? 96  PRO A N   1 
ATOM   731  C  CA  . PRO A 1 97  ? 13.791  41.168 2.660   1.00 14.05 ? 96  PRO A CA  1 
ATOM   732  C  C   . PRO A 1 97  ? 14.577  40.316 1.718   1.00 16.80 ? 96  PRO A C   1 
ATOM   733  O  O   . PRO A 1 97  ? 14.539  40.547 0.495   1.00 19.59 ? 96  PRO A O   1 
ATOM   734  C  CB  . PRO A 1 97  ? 12.347  40.649 2.711   1.00 13.14 ? 96  PRO A CB  1 
ATOM   735  C  CG  . PRO A 1 97  ? 11.684  41.371 1.640   1.00 20.78 ? 96  PRO A CG  1 
ATOM   736  C  CD  . PRO A 1 97  ? 12.300  42.764 1.605   1.00 18.10 ? 96  PRO A CD  1 
ATOM   737  N  N   . ARG A 1 98  ? 15.211  39.258 2.267   1.00 17.27 ? 97  ARG A N   1 
ATOM   738  C  CA  . ARG A 1 98  ? 16.011  38.333 1.482   1.00 20.52 ? 97  ARG A CA  1 
ATOM   739  C  C   . ARG A 1 98  ? 15.371  36.959 1.332   1.00 18.04 ? 97  ARG A C   1 
ATOM   740  O  O   . ARG A 1 98  ? 15.903  36.114 0.627   1.00 22.13 ? 97  ARG A O   1 
ATOM   741  C  CB  . ARG A 1 98  ? 17.410  38.173 2.107   1.00 20.47 ? 97  ARG A CB  1 
ATOM   742  C  CG  . ARG A 1 98  ? 18.273  39.439 2.043   1.00 21.78 ? 97  ARG A CG  1 
ATOM   743  C  CD  . ARG A 1 98  ? 18.565  39.895 0.621   1.00 26.36 ? 97  ARG A CD  1 
ATOM   744  N  NE  . ARG A 1 98  ? 19.080  38.759 -0.134  1.00 38.35 ? 97  ARG A NE  1 
ATOM   745  C  CZ  . ARG A 1 98  ? 20.330  38.324 -0.054  1.00 38.74 ? 97  ARG A CZ  1 
ATOM   746  N  NH1 . ARG A 1 98  ? 20.657  37.252 -0.729  1.00 27.09 ? 97  ARG A NH1 1 
ATOM   747  N  NH2 . ARG A 1 98  ? 21.265  38.984 0.660   1.00 43.19 ? 97  ARG A NH2 1 
ATOM   748  N  N   . GLU A 1 99  ? 14.235  36.736 1.991   1.00 18.41 ? 98  GLU A N   1 
ATOM   749  C  CA  . GLU A 1 99  ? 13.484  35.499 1.871   1.00 22.66 ? 98  GLU A CA  1 
ATOM   750  C  C   . GLU A 1 99  ? 12.013  35.854 2.131   1.00 20.95 ? 98  GLU A C   1 
ATOM   751  O  O   . GLU A 1 99  ? 11.711  36.890 2.715   1.00 19.04 ? 98  GLU A O   1 
ATOM   752  C  CB  . GLU A 1 99  ? 14.036  34.439 2.853   1.00 23.49 ? 98  GLU A CB  1 
ATOM   753  C  CG  . GLU A 1 99  ? 13.996  34.895 4.298   1.00 30.88 ? 98  GLU A CG  1 
ATOM   754  C  CD  . GLU A 1 99  ? 14.492  33.862 5.312   1.00 32.23 ? 98  GLU A CD  1 
ATOM   755  O  OE1 . GLU A 1 99  ? 15.112  32.842 4.923   1.00 47.64 ? 98  GLU A OE1 1 
ATOM   756  O  OE2 . GLU A 1 99  ? 14.254  34.090 6.525   1.00 51.01 ? 98  GLU A OE2 1 
ATOM   757  N  N   . VAL A 1 100 ? 11.093  35.011 1.694   1.00 23.05 ? 99  VAL A N   1 
ATOM   758  C  CA  . VAL A 1 100 ? 9.656   35.335 1.850   1.00 21.03 ? 99  VAL A CA  1 
ATOM   759  C  C   . VAL A 1 100 ? 9.283   35.508 3.309   1.00 20.51 ? 99  VAL A C   1 
ATOM   760  O  O   . VAL A 1 100 ? 8.546   36.449 3.642   1.00 18.46 ? 99  VAL A O   1 
ATOM   761  C  CB  . VAL A 1 100 ? 8.746   34.341 1.145   1.00 23.12 ? 99  VAL A CB  1 
ATOM   762  C  CG1 . VAL A 1 100 ? 7.248   34.540 1.557   1.00 21.30 ? 99  VAL A CG1 1 
ATOM   763  C  CG2 . VAL A 1 100 ? 8.890   34.505 -0.351  1.00 24.58 ? 99  VAL A CG2 1 
ATOM   764  N  N   . GLN A 1 101 ? 9.829   34.669 4.185   1.00 17.86 ? 100 GLN A N   1 
ATOM   765  C  CA  . GLN A 1 101 ? 9.551   34.783 5.638   1.00 18.35 ? 100 GLN A CA  1 
ATOM   766  C  C   . GLN A 1 101 ? 9.985   36.144 6.200   1.00 18.32 ? 100 GLN A C   1 
ATOM   767  O  O   . GLN A 1 101 ? 9.287   36.720 7.069   1.00 18.97 ? 100 GLN A O   1 
ATOM   768  C  CB  . GLN A 1 101 ? 10.241  33.655 6.370   1.00 19.02 ? 100 GLN A CB  1 
ATOM   769  C  CG  . GLN A 1 101 ? 10.034  33.571 7.861   1.00 33.48 ? 100 GLN A CG  1 
ATOM   770  C  CD  . GLN A 1 101 ? 10.916  32.475 8.455   1.00 42.52 ? 100 GLN A CD  1 
ATOM   771  O  OE1 . GLN A 1 101 ? 12.140  32.634 8.574   1.00 52.64 ? 100 GLN A OE1 1 
ATOM   772  N  NE2 . GLN A 1 101 ? 10.310  31.340 8.760   1.00 44.95 ? 100 GLN A NE2 1 
ATOM   773  N  N   . GLN A 1 102 ? 11.095  36.690 5.673   1.00 16.65 ? 101 GLN A N   1 
ATOM   774  C  CA  . GLN A 1 102 ? 11.538  38.032 6.062   1.00 16.86 ? 101 GLN A CA  1 
ATOM   775  C  C   . GLN A 1 102 ? 10.524  39.125 5.696   1.00 17.74 ? 101 GLN A C   1 
ATOM   776  O  O   . GLN A 1 102 ? 10.319  40.057 6.471   1.00 17.97 ? 101 GLN A O   1 
ATOM   777  C  CB  . GLN A 1 102 ? 12.922  38.396 5.499   1.00 15.65 ? 101 GLN A CB  1 
ATOM   778  C  CG  . GLN A 1 102 ? 14.059  37.827 6.296   1.00 21.34 ? 101 GLN A CG  1 
ATOM   779  C  CD  . GLN A 1 102 ? 15.417  38.292 5.872   1.00 18.71 ? 101 GLN A CD  1 
ATOM   780  O  OE1 . GLN A 1 102 ? 15.572  39.356 5.220   1.00 19.91 ? 101 GLN A OE1 1 
ATOM   781  N  NE2 . GLN A 1 102 ? 16.420  37.554 6.309   1.00 16.29 ? 101 GLN A NE2 1 
ATOM   782  N  N   . GLY A 1 103 ? 9.879   38.990 4.544   1.00 16.91 ? 102 GLY A N   1 
ATOM   783  C  CA  . GLY A 1 103 ? 8.823   39.917 4.138   1.00 16.90 ? 102 GLY A CA  1 
ATOM   784  C  C   . GLY A 1 103 ? 7.578   39.789 4.991   1.00 17.63 ? 102 GLY A C   1 
ATOM   785  O  O   . GLY A 1 103 ? 6.977   40.794 5.364   1.00 17.30 ? 102 GLY A O   1 
ATOM   786  N  N   . GLU A 1 104 ? 7.173   38.558 5.297   1.00 16.09 ? 103 GLU A N   1 
ATOM   787  C  CA  . GLU A 1 104 ? 5.988   38.336 6.154   1.00 18.45 ? 103 GLU A CA  1 
ATOM   788  C  C   . GLU A 1 104 ? 6.202   38.937 7.570   1.00 18.09 ? 103 GLU A C   1 
ATOM   789  O  O   . GLU A 1 104 ? 5.313   39.563 8.147   1.00 16.50 ? 103 GLU A O   1 
ATOM   790  C  CB  . GLU A 1 104 ? 5.674   36.821 6.229   1.00 18.74 ? 103 GLU A CB  1 
ATOM   791  C  CG  . GLU A 1 104 ? 5.291   36.233 4.857   1.00 17.90 ? 103 GLU A CG  1 
ATOM   792  C  CD  . GLU A 1 104 ? 5.140   34.694 4.818   1.00 26.21 ? 103 GLU A CD  1 
ATOM   793  O  OE1 . GLU A 1 104 ? 5.803   33.975 5.593   1.00 29.22 ? 103 GLU A OE1 1 
ATOM   794  O  OE2 . GLU A 1 104 ? 4.360   34.208 3.964   1.00 31.54 ? 103 GLU A OE2 1 
ATOM   795  N  N   . GLU A 1 105 ? 7.381   38.741 8.141   1.00 18.88 ? 104 GLU A N   1 
ATOM   796  C  CA  . GLU A 1 105 ? 7.657   39.261 9.483   1.00 17.62 ? 104 GLU A CA  1 
ATOM   797  C  C   . GLU A 1 105 ? 7.724   40.778 9.533   1.00 17.40 ? 104 GLU A C   1 
ATOM   798  O  O   . GLU A 1 105 ? 7.351   41.392 10.550  1.00 15.19 ? 104 GLU A O   1 
ATOM   799  C  CB  . GLU A 1 105 ? 8.932   38.646 10.027  1.00 21.30 ? 104 GLU A CB  1 
ATOM   800  C  CG  . GLU A 1 105 ? 8.694   37.198 10.475  1.00 19.30 ? 104 GLU A CG  1 
ATOM   801  C  CD  . GLU A 1 105 ? 7.816   37.157 11.697  1.00 32.98 ? 104 GLU A CD  1 
ATOM   802  O  OE1 . GLU A 1 105 ? 8.250   37.641 12.761  1.00 38.65 ? 104 GLU A OE1 1 
ATOM   803  O  OE2 . GLU A 1 105 ? 6.667   36.700 11.589  1.00 33.92 ? 104 GLU A OE2 1 
ATOM   804  N  N   . PHE A 1 106 ? 8.237   41.366 8.455   1.00 13.81 ? 105 PHE A N   1 
ATOM   805  C  CA  . PHE A 1 106 ? 8.303   42.850 8.315   1.00 16.08 ? 105 PHE A CA  1 
ATOM   806  C  C   . PHE A 1 106 ? 6.900   43.438 8.346   1.00 16.17 ? 105 PHE A C   1 
ATOM   807  O  O   . PHE A 1 106 ? 6.653   44.448 8.995   1.00 19.63 ? 105 PHE A O   1 
ATOM   808  C  CB  . PHE A 1 106 ? 9.005   43.191 6.994   1.00 16.32 ? 105 PHE A CB  1 
ATOM   809  C  CG  . PHE A 1 106 ? 9.255   44.651 6.782   1.00 14.82 ? 105 PHE A CG  1 
ATOM   810  C  CD1 . PHE A 1 106 ? 10.491  45.209 7.071   1.00 18.06 ? 105 PHE A CD1 1 
ATOM   811  C  CD2 . PHE A 1 106 ? 8.238   45.480 6.297   1.00 17.67 ? 105 PHE A CD2 1 
ATOM   812  C  CE1 . PHE A 1 106 ? 10.699  46.637 6.840   1.00 13.14 ? 105 PHE A CE1 1 
ATOM   813  C  CE2 . PHE A 1 106 ? 8.432   46.835 6.102   1.00 18.52 ? 105 PHE A CE2 1 
ATOM   814  C  CZ  . PHE A 1 106 ? 9.656   47.399 6.363   1.00 17.37 ? 105 PHE A CZ  1 
ATOM   815  N  N   . GLU A 1 107 ? 5.993   42.847 7.577   1.00 18.63 ? 106 GLU A N   1 
ATOM   816  C  CA  . GLU A 1 107 ? 4.614   43.344 7.477   1.00 18.37 ? 106 GLU A CA  1 
ATOM   817  C  C   . GLU A 1 107 ? 3.872   43.180 8.812   1.00 19.70 ? 106 GLU A C   1 
ATOM   818  O  O   . GLU A 1 107 ? 3.088   44.048 9.193   1.00 20.75 ? 106 GLU A O   1 
ATOM   819  C  CB  . GLU A 1 107 ? 3.880   42.631 6.318   1.00 20.81 ? 106 GLU A CB  1 
ATOM   820  C  CG  . GLU A 1 107 ? 4.591   42.810 4.982   1.00 26.07 ? 106 GLU A CG  1 
ATOM   821  C  CD  . GLU A 1 107 ? 3.735   42.406 3.777   1.00 25.61 ? 106 GLU A CD  1 
ATOM   822  O  OE1 . GLU A 1 107 ? 2.772   43.139 3.513   1.00 34.14 ? 106 GLU A OE1 1 
ATOM   823  O  OE2 . GLU A 1 107 ? 4.037   41.373 3.122   1.00 34.85 ? 106 GLU A OE2 1 
ATOM   824  N  N   . ARG A 1 108 ? 4.164   42.088 9.529   1.00 21.09 ? 107 ARG A N   1 
ATOM   825  C  CA  . ARG A 1 108 ? 3.613   41.818 10.861  1.00 22.21 ? 107 ARG A CA  1 
ATOM   826  C  C   . ARG A 1 108 ? 4.080   42.803 11.954  1.00 22.19 ? 107 ARG A C   1 
ATOM   827  O  O   . ARG A 1 108 ? 3.278   43.216 12.776  1.00 22.61 ? 107 ARG A O   1 
ATOM   828  C  CB  . ARG A 1 108 ? 3.943   40.375 11.285  1.00 21.58 ? 107 ARG A CB  1 
ATOM   829  C  CG  . ARG A 1 108 ? 3.191   39.906 12.498  1.00 26.58 ? 107 ARG A CG  1 
ATOM   830  C  CD  . ARG A 1 108 ? 3.508   38.454 12.846  1.00 27.14 ? 107 ARG A CD  1 
ATOM   831  N  NE  . ARG A 1 108 ? 4.888   38.274 13.287  1.00 32.05 ? 107 ARG A NE  1 
ATOM   832  C  CZ  . ARG A 1 108 ? 5.357   38.632 14.491  1.00 36.22 ? 107 ARG A CZ  1 
ATOM   833  N  NH1 . ARG A 1 108 ? 6.636   38.407 14.807  1.00 34.89 ? 107 ARG A NH1 1 
ATOM   834  N  NH2 . ARG A 1 108 ? 4.573   39.228 15.376  1.00 33.90 ? 107 ARG A NH2 1 
ATOM   835  N  N   . ARG A 1 109 ? 5.354   43.205 11.942  1.00 19.77 ? 108 ARG A N   1 
ATOM   836  C  CA  . ARG A 1 109 ? 5.923   44.143 12.950  1.00 18.21 ? 108 ARG A CA  1 
ATOM   837  C  C   . ARG A 1 109 ? 5.990   45.625 12.534  1.00 17.65 ? 108 ARG A C   1 
ATOM   838  O  O   . ARG A 1 109 ? 6.145   46.497 13.400  1.00 15.72 ? 108 ARG A O   1 
ATOM   839  C  CB  . ARG A 1 109 ? 7.336   43.661 13.353  1.00 18.16 ? 108 ARG A CB  1 
ATOM   840  C  CG  . ARG A 1 109 ? 7.305   42.313 14.107  1.00 14.02 ? 108 ARG A CG  1 
ATOM   841  C  CD  . ARG A 1 109 ? 8.711   41.799 14.494  1.00 19.50 ? 108 ARG A CD  1 
ATOM   842  N  NE  . ARG A 1 109 ? 9.439   42.708 15.379  1.00 17.07 ? 108 ARG A NE  1 
ATOM   843  C  CZ  . ARG A 1 109 ? 10.719  42.573 15.729  1.00 14.75 ? 108 ARG A CZ  1 
ATOM   844  N  NH1 . ARG A 1 109 ? 11.438  41.566 15.249  1.00 20.53 ? 108 ARG A NH1 1 
ATOM   845  N  NH2 . ARG A 1 109 ? 11.288  43.468 16.539  1.00 24.31 ? 108 ARG A NH2 1 
ATOM   846  N  N   . ILE A 1 110 ? 5.929   45.902 11.225  1.00 16.91 ? 109 ILE A N   1 
ATOM   847  C  CA  . ILE A 1 110 ? 6.060   47.262 10.688  1.00 20.97 ? 109 ILE A CA  1 
ATOM   848  C  C   . ILE A 1 110 ? 4.878   47.604 9.752   1.00 22.46 ? 109 ILE A C   1 
ATOM   849  O  O   . ILE A 1 110 ? 3.995   48.322 10.151  1.00 23.21 ? 109 ILE A O   1 
ATOM   850  C  CB  . ILE A 1 110 ? 7.409   47.507 9.988   1.00 23.23 ? 109 ILE A CB  1 
ATOM   851  C  CG1 . ILE A 1 110 ? 8.571   47.338 10.989  1.00 24.35 ? 109 ILE A CG1 1 
ATOM   852  C  CG2 . ILE A 1 110 ? 7.461   48.912 9.442   1.00 27.74 ? 109 ILE A CG2 1 
ATOM   853  C  CD1 . ILE A 1 110 ? 9.925   47.027 10.353  1.00 29.82 ? 109 ILE A CD1 1 
ATOM   854  N  N   . GLY A 1 111 ? 4.880   47.100 8.523   1.00 21.22 ? 110 GLY A N   1 
ATOM   855  C  CA  . GLY A 1 111 ? 3.690   47.143 7.664   1.00 21.28 ? 110 GLY A CA  1 
ATOM   856  C  C   . GLY A 1 111 ? 4.032   46.794 6.225   1.00 19.77 ? 110 GLY A C   1 
ATOM   857  O  O   . GLY A 1 111 ? 5.185   46.548 5.892   1.00 20.79 ? 110 GLY A O   1 
ATOM   858  N  N   . GLN A 1 112 ? 3.029   46.781 5.363   1.00 21.65 ? 111 GLN A N   1 
ATOM   859  C  CA  . GLN A 1 112 ? 3.233   46.418 3.957   1.00 19.65 ? 111 GLN A CA  1 
ATOM   860  C  C   . GLN A 1 112 ? 4.041   47.462 3.149   1.00 17.53 ? 111 GLN A C   1 
ATOM   861  O  O   . GLN A 1 112 ? 3.916   48.701 3.362   1.00 18.72 ? 111 GLN A O   1 
ATOM   862  C  CB  . GLN A 1 112 ? 1.885   46.152 3.284   1.00 21.48 ? 111 GLN A CB  1 
ATOM   863  C  CG  . GLN A 1 112 ? 1.117   47.373 2.845   1.00 21.18 ? 111 GLN A CG  1 
ATOM   864  C  CD  . GLN A 1 112 ? -0.125  47.011 2.071   1.00 23.30 ? 111 GLN A CD  1 
ATOM   865  O  OE1 . GLN A 1 112 ? -0.442  45.841 1.925   1.00 20.07 ? 111 GLN A OE1 1 
ATOM   866  N  NE2 . GLN A 1 112 ? -0.849  48.028 1.567   1.00 17.53 ? 111 GLN A NE2 1 
ATOM   867  N  N   . PRO A 1 113 ? 4.846   46.980 2.181   1.00 18.00 ? 112 PRO A N   1 
ATOM   868  C  CA  . PRO A 1 113 ? 5.600   47.873 1.305   1.00 17.51 ? 112 PRO A CA  1 
ATOM   869  C  C   . PRO A 1 113 ? 4.685   48.615 0.324   1.00 18.76 ? 112 PRO A C   1 
ATOM   870  O  O   . PRO A 1 113 ? 3.643   48.090 -0.072  1.00 15.82 ? 112 PRO A O   1 
ATOM   871  C  CB  . PRO A 1 113 ? 6.562   46.923 0.599   1.00 18.52 ? 112 PRO A CB  1 
ATOM   872  C  CG  . PRO A 1 113 ? 5.833   45.593 0.577   1.00 17.83 ? 112 PRO A CG  1 
ATOM   873  C  CD  . PRO A 1 113 ? 5.135   45.551 1.894   1.00 16.79 ? 112 PRO A CD  1 
ATOM   874  N  N   . THR A 1 114 ? 5.045   49.854 -0.001  1.00 16.93 ? 113 THR A N   1 
ATOM   875  C  CA  . THR A 1 114 ? 4.348   50.644 -1.009  1.00 15.69 ? 113 THR A CA  1 
ATOM   876  C  C   . THR A 1 114 ? 4.807   50.285 -2.428  1.00 17.49 ? 113 THR A C   1 
ATOM   877  O  O   . THR A 1 114 ? 4.030   50.355 -3.386  1.00 16.58 ? 113 THR A O   1 
ATOM   878  C  CB  . THR A 1 114 ? 4.660   52.147 -0.802  1.00 19.79 ? 113 THR A CB  1 
ATOM   879  O  OG1 . THR A 1 114 ? 4.665   52.452 0.598   1.00 24.06 ? 113 THR A OG1 1 
ATOM   880  C  CG2 . THR A 1 114 ? 3.663   53.005 -1.507  1.00 23.40 ? 113 THR A CG2 1 
ATOM   881  N  N   . LEU A 1 115 ? 6.087   49.941 -2.562  1.00 17.56 ? 114 LEU A N   1 
ATOM   882  C  CA  . LEU A 1 115 ? 6.714   49.649 -3.853  1.00 18.30 ? 114 LEU A CA  1 
ATOM   883  C  C   . LEU A 1 115 ? 7.903   48.694 -3.704  1.00 16.30 ? 114 LEU A C   1 
ATOM   884  O  O   . LEU A 1 115 ? 8.519   48.644 -2.666  1.00 16.79 ? 114 LEU A O   1 
ATOM   885  C  CB  . LEU A 1 115 ? 7.217   50.935 -4.485  1.00 18.07 ? 114 LEU A CB  1 
ATOM   886  C  CG  . LEU A 1 115 ? 7.511   50.894 -5.993  1.00 25.13 ? 114 LEU A CG  1 
ATOM   887  C  CD1 . LEU A 1 115 ? 6.209   50.735 -6.765  1.00 33.77 ? 114 LEU A CD1 1 
ATOM   888  C  CD2 . LEU A 1 115 ? 8.204   52.191 -6.397  1.00 31.00 ? 114 LEU A CD2 1 
ATOM   889  N  N   . LEU A 1 116 ? 8.229   47.956 -4.766  1.00 15.97 ? 115 LEU A N   1 
ATOM   890  C  CA  . LEU A 1 116 ? 9.415   47.145 -4.795  1.00 17.41 ? 115 LEU A CA  1 
ATOM   891  C  C   . LEU A 1 116 ? 10.174  47.516 -6.060  1.00 20.08 ? 115 LEU A C   1 
ATOM   892  O  O   . LEU A 1 116 ? 9.656   47.335 -7.169  1.00 18.82 ? 115 LEU A O   1 
ATOM   893  C  CB  . LEU A 1 116 ? 9.031   45.678 -4.760  1.00 20.09 ? 115 LEU A CB  1 
ATOM   894  C  CG  . LEU A 1 116 ? 10.199  44.694 -4.560  1.00 19.90 ? 115 LEU A CG  1 
ATOM   895  C  CD1 . LEU A 1 116 ? 9.690   43.381 -3.998  1.00 20.66 ? 115 LEU A CD1 1 
ATOM   896  C  CD2 . LEU A 1 116 ? 10.989  44.401 -5.881  1.00 20.98 ? 115 LEU A CD2 1 
ATOM   897  N  N   . LEU A 1 117 ? 11.363  48.101 -5.887  1.00 18.17 ? 116 LEU A N   1 
ATOM   898  C  CA  . LEU A 1 117 ? 12.227  48.455 -7.007  1.00 19.63 ? 116 LEU A CA  1 
ATOM   899  C  C   . LEU A 1 117 ? 13.207  47.282 -7.225  1.00 19.27 ? 116 LEU A C   1 
ATOM   900  O  O   . LEU A 1 117 ? 14.045  47.000 -6.383  1.00 19.11 ? 116 LEU A O   1 
ATOM   901  C  CB  . LEU A 1 117 ? 12.960  49.763 -6.672  1.00 21.09 ? 116 LEU A CB  1 
ATOM   902  C  CG  . LEU A 1 117 ? 13.742  50.463 -7.775  1.00 28.88 ? 116 LEU A CG  1 
ATOM   903  C  CD1 . LEU A 1 117 ? 12.797  51.007 -8.850  1.00 32.34 ? 116 LEU A CD1 1 
ATOM   904  C  CD2 . LEU A 1 117 ? 14.550  51.600 -7.158  1.00 28.21 ? 116 LEU A CD2 1 
ATOM   905  N  N   . TYR A 1 118 ? 13.076  46.617 -8.364  1.00 16.21 ? 117 TYR A N   1 
ATOM   906  C  CA  . TYR A 1 118 ? 13.859  45.451 -8.751  1.00 18.63 ? 117 TYR A CA  1 
ATOM   907  C  C   . TYR A 1 118 ? 15.015  45.847 -9.708  1.00 16.82 ? 117 TYR A C   1 
ATOM   908  O  O   . TYR A 1 118 ? 14.820  46.136 -10.882 1.00 17.66 ? 117 TYR A O   1 
ATOM   909  C  CB  . TYR A 1 118 ? 12.904  44.433 -9.374  1.00 19.55 ? 117 TYR A CB  1 
ATOM   910  C  CG  . TYR A 1 118 ? 13.463  43.138 -9.933  1.00 18.44 ? 117 TYR A CG  1 
ATOM   911  C  CD1 . TYR A 1 118 ? 14.667  42.594 -9.493  1.00 21.59 ? 117 TYR A CD1 1 
ATOM   912  C  CD2 . TYR A 1 118 ? 12.755  42.455 -10.880 1.00 19.93 ? 117 TYR A CD2 1 
ATOM   913  C  CE1 . TYR A 1 118 ? 15.150  41.426 -10.028 1.00 23.61 ? 117 TYR A CE1 1 
ATOM   914  C  CE2 . TYR A 1 118 ? 13.218  41.251 -11.406 1.00 22.95 ? 117 TYR A CE2 1 
ATOM   915  C  CZ  . TYR A 1 118 ? 14.407  40.745 -10.982 1.00 24.75 ? 117 TYR A CZ  1 
ATOM   916  O  OH  . TYR A 1 118 ? 14.851  39.552 -11.512 1.00 27.54 ? 117 TYR A OH  1 
ATOM   917  N  N   . VAL A 1 119 ? 16.218  45.849 -9.149  1.00 18.68 ? 118 VAL A N   1 
ATOM   918  C  CA  . VAL A 1 119 ? 17.483  46.101 -9.836  1.00 16.40 ? 118 VAL A CA  1 
ATOM   919  C  C   . VAL A 1 119 ? 18.035  44.779 -10.411 1.00 19.63 ? 118 VAL A C   1 
ATOM   920  O  O   . VAL A 1 119 ? 18.613  43.959 -9.697  1.00 16.79 ? 118 VAL A O   1 
ATOM   921  C  CB  . VAL A 1 119 ? 18.432  46.781 -8.826  1.00 22.44 ? 118 VAL A CB  1 
ATOM   922  C  CG1 . VAL A 1 119 ? 19.747  47.191 -9.461  1.00 24.83 ? 118 VAL A CG1 1 
ATOM   923  C  CG2 . VAL A 1 119 ? 17.772  48.048 -8.285  1.00 24.62 ? 118 VAL A CG2 1 
ATOM   924  N  N   . ASP A 1 120 ? 17.792  44.560 -11.706 1.00 17.48 ? 119 ASP A N   1 
ATOM   925  C  CA  . ASP A 1 120 ? 18.021  43.248 -12.335 1.00 19.32 ? 119 ASP A CA  1 
ATOM   926  C  C   . ASP A 1 120 ? 19.301  43.272 -13.156 1.00 18.24 ? 119 ASP A C   1 
ATOM   927  O  O   . ASP A 1 120 ? 19.354  43.858 -14.238 1.00 17.14 ? 119 ASP A O   1 
ATOM   928  C  CB  . ASP A 1 120 ? 16.810  42.949 -13.212 1.00 20.81 ? 119 ASP A CB  1 
ATOM   929  C  CG  . ASP A 1 120 ? 16.857  41.601 -13.869 1.00 25.51 ? 119 ASP A CG  1 
ATOM   930  O  OD1 . ASP A 1 120 ? 17.683  40.748 -13.479 1.00 21.80 ? 119 ASP A OD1 1 
ATOM   931  O  OD2 . ASP A 1 120 ? 16.052  41.416 -14.799 1.00 28.27 ? 119 ASP A OD2 1 
ATOM   932  N  N   . ALA A 1 121 ? 20.348  42.664 -12.614 1.00 22.59 ? 120 ALA A N   1 
ATOM   933  C  CA  . ALA A 1 121 ? 21.623  42.503 -13.321 1.00 22.14 ? 120 ALA A CA  1 
ATOM   934  C  C   . ALA A 1 121 ? 21.951  41.022 -13.540 1.00 22.53 ? 120 ALA A C   1 
ATOM   935  O  O   . ALA A 1 121 ? 21.448  40.136 -12.831 1.00 19.93 ? 120 ALA A O   1 
ATOM   936  C  CB  . ALA A 1 121 ? 22.750  43.231 -12.541 1.00 26.50 ? 120 ALA A CB  1 
ATOM   937  N  N   . GLY A 1 122 ? 22.756  40.750 -14.571 1.00 20.67 ? 121 GLY A N   1 
ATOM   938  C  CA  . GLY A 1 122 ? 23.194  39.390 -14.867 1.00 19.27 ? 121 GLY A CA  1 
ATOM   939  C  C   . GLY A 1 122 ? 24.324  38.952 -13.943 1.00 20.06 ? 121 GLY A C   1 
ATOM   940  O  O   . GLY A 1 122 ? 25.057  39.767 -13.404 1.00 15.50 ? 121 GLY A O   1 
ATOM   941  N  N   . PRO A 1 123 ? 24.488  37.640 -13.754 1.00 14.93 ? 122 PRO A N   1 
ATOM   942  C  CA  . PRO A 1 123 ? 25.502  37.155 -12.797 1.00 16.14 ? 122 PRO A CA  1 
ATOM   943  C  C   . PRO A 1 123 ? 26.960  37.422 -13.138 1.00 17.07 ? 122 PRO A C   1 
ATOM   944  O  O   . PRO A 1 123 ? 27.788  37.587 -12.237 1.00 20.91 ? 122 PRO A O   1 
ATOM   945  C  CB  . PRO A 1 123 ? 25.241  35.637 -12.756 1.00 16.26 ? 122 PRO A CB  1 
ATOM   946  C  CG  . PRO A 1 123 ? 24.526  35.360 -14.047 1.00 14.11 ? 122 PRO A CG  1 
ATOM   947  C  CD  . PRO A 1 123 ? 23.694  36.544 -14.335 1.00 17.15 ? 122 PRO A CD  1 
ATOM   948  N  N   . GLU A 1 124 ? 27.298  37.502 -14.409 1.00 17.47 ? 123 GLU A N   1 
ATOM   949  C  CA  . GLU A 1 124 ? 28.671  37.895 -14.800 1.00 20.47 ? 123 GLU A CA  1 
ATOM   950  C  C   . GLU A 1 124 ? 28.937  39.393 -14.563 1.00 19.86 ? 123 GLU A C   1 
ATOM   951  O  O   . GLU A 1 124 ? 30.034  39.822 -14.142 1.00 17.88 ? 123 GLU A O   1 
ATOM   952  C  CB  . GLU A 1 124 ? 28.963  37.505 -16.252 1.00 21.46 ? 123 GLU A CB  1 
ATOM   953  C  CG  . GLU A 1 124 ? 28.121  38.236 -17.288 1.00 32.07 ? 123 GLU A CG  1 
ATOM   954  N  N   . THR A 1 125 ? 27.929  40.203 -14.810 1.00 20.16 ? 124 THR A N   1 
ATOM   955  C  CA  . THR A 1 125 ? 28.027  41.633 -14.485 1.00 20.62 ? 124 THR A CA  1 
ATOM   956  C  C   . THR A 1 125 ? 28.330  41.891 -12.990 1.00 20.21 ? 124 THR A C   1 
ATOM   957  O  O   . THR A 1 125 ? 29.227  42.675 -12.624 1.00 18.41 ? 124 THR A O   1 
ATOM   958  C  CB  . THR A 1 125 ? 26.740  42.330 -14.898 1.00 19.56 ? 124 THR A CB  1 
ATOM   959  O  OG1 . THR A 1 125 ? 26.634  42.235 -16.322 1.00 23.45 ? 124 THR A OG1 1 
ATOM   960  C  CG2 . THR A 1 125 ? 26.758  43.799 -14.510 1.00 21.62 ? 124 THR A CG2 1 
ATOM   961  N  N   . MET A 1 126 ? 27.549  41.221 -12.163 1.00 17.18 ? 125 MET A N   1 
ATOM   962  C  CA  . MET A 1 126 ? 27.664  41.252 -10.711 1.00 19.16 ? 125 MET A CA  1 
ATOM   963  C  C   . MET A 1 126 ? 29.030  40.785 -10.246 1.00 17.78 ? 125 MET A C   1 
ATOM   964  O  O   . MET A 1 126 ? 29.701  41.481 -9.469  1.00 17.24 ? 125 MET A O   1 
ATOM   965  C  CB  . MET A 1 126 ? 26.538  40.395 -10.103 1.00 16.23 ? 125 MET A CB  1 
ATOM   966  C  CG  . MET A 1 126 ? 25.200  41.027 -10.292 1.00 23.24 ? 125 MET A CG  1 
ATOM   967  S  SD  . MET A 1 126 ? 23.852  40.474 -9.279  1.00 23.28 ? 125 MET A SD  1 
ATOM   968  C  CE  . MET A 1 126 ? 23.404  38.910 -10.014 1.00 15.27 ? 125 MET A CE  1 
ATOM   969  N  N   . THR A 1 127 ? 29.472  39.640 -10.764 1.00 19.15 ? 126 THR A N   1 
ATOM   970  C  CA  . THR A 1 127 ? 30.766  39.081 -10.382 1.00 18.51 ? 126 THR A CA  1 
ATOM   971  C  C   . THR A 1 127 ? 31.917  40.033 -10.710 1.00 19.91 ? 126 THR A C   1 
ATOM   972  O  O   . THR A 1 127 ? 32.777  40.281 -9.866  1.00 19.67 ? 126 THR A O   1 
ATOM   973  C  CB  . THR A 1 127 ? 30.986  37.684 -11.036 1.00 20.44 ? 126 THR A CB  1 
ATOM   974  O  OG1 . THR A 1 127 ? 29.967  36.787 -10.580 1.00 18.35 ? 126 THR A OG1 1 
ATOM   975  C  CG2 . THR A 1 127 ? 32.349  37.123 -10.699 1.00 21.38 ? 126 THR A CG2 1 
ATOM   976  N  N   . GLN A 1 128 ? 31.938  40.566 -11.937 1.00 20.24 ? 127 GLN A N   1 
ATOM   977  C  CA  . GLN A 1 128 ? 33.003  41.482 -12.359 1.00 20.17 ? 127 GLN A CA  1 
ATOM   978  C  C   . GLN A 1 128 ? 33.057  42.744 -11.507 1.00 19.81 ? 127 GLN A C   1 
ATOM   979  O  O   . GLN A 1 128 ? 34.159  43.176 -11.142 1.00 17.85 ? 127 GLN A O   1 
ATOM   980  C  CB  . GLN A 1 128 ? 32.844  41.923 -13.821 1.00 21.54 ? 127 GLN A CB  1 
ATOM   981  C  CG  . GLN A 1 128 ? 32.593  40.812 -14.783 1.00 29.91 ? 127 GLN A CG  1 
ATOM   982  N  N   . ARG A 1 129 ? 31.892  43.335 -11.200 1.00 18.43 ? 128 ARG A N   1 
ATOM   983  C  CA  . ARG A 1 129 ? 31.827  44.543 -10.368 1.00 17.72 ? 128 ARG A CA  1 
ATOM   984  C  C   . ARG A 1 129 ? 32.360  44.318 -8.962  1.00 19.18 ? 128 ARG A C   1 
ATOM   985  O  O   . ARG A 1 129 ? 33.006  45.198 -8.396  1.00 17.44 ? 128 ARG A O   1 
ATOM   986  C  CB  . ARG A 1 129 ? 30.409  45.035 -10.241 1.00 17.43 ? 128 ARG A CB  1 
ATOM   987  C  CG  . ARG A 1 129 ? 29.836  45.656 -11.469 1.00 18.21 ? 128 ARG A CG  1 
ATOM   988  C  CD  . ARG A 1 129 ? 28.376  46.005 -11.228 1.00 16.47 ? 128 ARG A CD  1 
ATOM   989  N  NE  . ARG A 1 129 ? 27.791  46.594 -12.427 1.00 17.05 ? 128 ARG A NE  1 
ATOM   990  C  CZ  . ARG A 1 129 ? 26.504  46.842 -12.600 1.00 20.92 ? 128 ARG A CZ  1 
ATOM   991  N  NH1 . ARG A 1 129 ? 25.644  46.677 -11.623 1.00 20.69 ? 128 ARG A NH1 1 
ATOM   992  N  NH2 . ARG A 1 129 ? 26.088  47.348 -13.751 1.00 20.02 ? 128 ARG A NH2 1 
ATOM   993  N  N   . LEU A 1 130 ? 32.070  43.156 -8.390  1.00 17.91 ? 129 LEU A N   1 
ATOM   994  C  CA  . LEU A 1 130 ? 32.514  42.845 -7.023  1.00 16.96 ? 129 LEU A CA  1 
ATOM   995  C  C   . LEU A 1 130 ? 33.981  42.438 -6.978  1.00 18.68 ? 129 LEU A C   1 
ATOM   996  O  O   . LEU A 1 130 ? 34.697  42.797 -6.037  1.00 20.62 ? 129 LEU A O   1 
ATOM   997  C  CB  . LEU A 1 130 ? 31.643  41.769 -6.400  1.00 15.83 ? 129 LEU A CB  1 
ATOM   998  C  CG  . LEU A 1 130 ? 30.168  42.106 -6.210  1.00 17.65 ? 129 LEU A CG  1 
ATOM   999  C  CD1 . LEU A 1 130 ? 29.417  40.832 -5.755  1.00 20.55 ? 129 LEU A CD1 1 
ATOM   1000 C  CD2 . LEU A 1 130 ? 29.954  43.257 -5.253  1.00 24.46 ? 129 LEU A CD2 1 
ATOM   1001 N  N   . LEU A 1 131 ? 34.438  41.687 -7.991  1.00 20.22 ? 130 LEU A N   1 
ATOM   1002 C  CA  . LEU A 1 131 ? 35.875  41.415 -8.130  1.00 19.09 ? 130 LEU A CA  1 
ATOM   1003 C  C   . LEU A 1 131 ? 36.690  42.689 -8.255  1.00 19.53 ? 130 LEU A C   1 
ATOM   1004 O  O   . LEU A 1 131 ? 37.752  42.796 -7.660  1.00 22.04 ? 130 LEU A O   1 
ATOM   1005 C  CB  . LEU A 1 131 ? 36.161  40.485 -9.288  1.00 17.44 ? 130 LEU A CB  1 
ATOM   1006 C  CG  . LEU A 1 131 ? 35.778  39.022 -8.997  1.00 14.92 ? 130 LEU A CG  1 
ATOM   1007 C  CD1 . LEU A 1 131 ? 36.008  38.215 -10.241 1.00 22.28 ? 130 LEU A CD1 1 
ATOM   1008 C  CD2 . LEU A 1 131 ? 36.538  38.442 -7.820  1.00 25.77 ? 130 LEU A CD2 1 
ATOM   1009 N  N   . LYS A 1 132 ? 36.166  43.678 -8.979  1.00 19.70 ? 131 LYS A N   1 
ATOM   1010 C  CA  . LYS A 1 132 ? 36.855  44.959 -9.147  1.00 21.08 ? 131 LYS A CA  1 
ATOM   1011 C  C   . LYS A 1 132 ? 36.880  45.734 -7.848  1.00 21.36 ? 131 LYS A C   1 
ATOM   1012 O  O   . LYS A 1 132 ? 37.888  46.337 -7.502  1.00 22.00 ? 131 LYS A O   1 
ATOM   1013 C  CB  . LYS A 1 132 ? 36.189  45.764 -10.253 1.00 22.69 ? 131 LYS A CB  1 
ATOM   1014 C  CG  . LYS A 1 132 ? 36.582  47.236 -10.278 1.00 28.80 ? 131 LYS A CG  1 
ATOM   1015 C  CD  . LYS A 1 132 ? 36.345  47.860 -11.636 1.00 37.05 ? 131 LYS A CD  1 
ATOM   1016 C  CE  . LYS A 1 132 ? 36.761  49.344 -11.625 1.00 41.12 ? 131 LYS A CE  1 
ATOM   1017 N  NZ  . LYS A 1 132 ? 37.418  49.700 -12.891 1.00 41.70 ? 131 LYS A NZ  1 
ATOM   1018 N  N   . ARG A 1 133 ? 35.775  45.720 -7.118  1.00 21.10 ? 132 ARG A N   1 
ATOM   1019 C  CA  . ARG A 1 133 ? 35.747  46.333 -5.805  1.00 22.37 ? 132 ARG A CA  1 
ATOM   1020 C  C   . ARG A 1 133 ? 36.725  45.669 -4.836  1.00 22.14 ? 132 ARG A C   1 
ATOM   1021 O  O   . ARG A 1 133 ? 37.404  46.359 -4.066  1.00 25.77 ? 132 ARG A O   1 
ATOM   1022 C  CB  . ARG A 1 133 ? 34.326  46.336 -5.223  1.00 21.36 ? 132 ARG A CB  1 
ATOM   1023 C  CG  . ARG A 1 133 ? 34.239  46.986 -3.857  1.00 20.47 ? 132 ARG A CG  1 
ATOM   1024 C  CD  . ARG A 1 133 ? 32.791  47.191 -3.415  1.00 20.03 ? 132 ARG A CD  1 
ATOM   1025 N  NE  . ARG A 1 133 ? 32.249  45.940 -2.886  1.00 19.99 ? 132 ARG A NE  1 
ATOM   1026 C  CZ  . ARG A 1 133 ? 30.961  45.727 -2.690  1.00 16.23 ? 132 ARG A CZ  1 
ATOM   1027 N  NH1 . ARG A 1 133 ? 30.057  46.689 -2.979  1.00 19.65 ? 132 ARG A NH1 1 
ATOM   1028 N  NH2 . ARG A 1 133 ? 30.574  44.582 -2.181  1.00 23.02 ? 132 ARG A NH2 1 
ATOM   1029 N  N   . GLY A 1 134 ? 36.784  44.346 -4.856  1.00 26.40 ? 133 GLY A N   1 
ATOM   1030 C  CA  . GLY A 1 134 ? 37.694  43.587 -3.996  1.00 28.88 ? 133 GLY A CA  1 
ATOM   1031 C  C   . GLY A 1 134 ? 39.177  43.912 -4.162  1.00 32.44 ? 133 GLY A C   1 
ATOM   1032 O  O   . GLY A 1 134 ? 39.977  43.604 -3.270  1.00 33.25 ? 133 GLY A O   1 
ATOM   1033 N  N   . GLU A 1 135 ? 39.549  44.515 -5.291  1.00 35.53 ? 134 GLU A N   1 
ATOM   1034 C  CA  . GLU A 1 135 ? 40.934  44.954 -5.519  1.00 40.63 ? 134 GLU A CA  1 
ATOM   1035 C  C   . GLU A 1 135 ? 41.307  46.098 -4.591  1.00 43.03 ? 134 GLU A C   1 
ATOM   1036 O  O   . GLU A 1 135 ? 42.397  46.128 -4.020  1.00 44.93 ? 134 GLU A O   1 
ATOM   1037 C  CB  . GLU A 1 135 ? 41.124  45.468 -6.952  1.00 39.90 ? 134 GLU A CB  1 
ATOM   1038 C  CG  . GLU A 1 135 ? 40.917  44.457 -8.049  1.00 40.94 ? 134 GLU A CG  1 
ATOM   1039 C  CD  . GLU A 1 135 ? 40.849  45.097 -9.439  1.00 45.07 ? 134 GLU A CD  1 
ATOM   1040 O  OE1 . GLU A 1 135 ? 41.355  46.230 -9.634  1.00 56.39 ? 134 GLU A OE1 1 
ATOM   1041 O  OE2 . GLU A 1 135 ? 40.289  44.465 -10.354 1.00 47.58 ? 134 GLU A OE2 1 
ATOM   1042 N  N   . THR A 1 136 ? 40.397  47.057 -4.492  1.00 45.51 ? 135 THR A N   1 
ATOM   1043 C  CA  . THR A 1 136 ? 40.627  48.328 -3.824  1.00 47.93 ? 135 THR A CA  1 
ATOM   1044 C  C   . THR A 1 136 ? 40.095  48.336 -2.393  1.00 49.14 ? 135 THR A C   1 
ATOM   1045 O  O   . THR A 1 136 ? 40.782  48.791 -1.485  1.00 51.06 ? 135 THR A O   1 
ATOM   1046 C  CB  . THR A 1 136 ? 39.968  49.492 -4.640  1.00 49.02 ? 135 THR A CB  1 
ATOM   1047 O  OG1 . THR A 1 136 ? 40.471  50.756 -4.193  1.00 56.41 ? 135 THR A OG1 1 
ATOM   1048 C  CG2 . THR A 1 136 ? 38.417  49.500 -4.532  1.00 50.10 ? 135 THR A CG2 1 
ATOM   1049 N  N   . SER A 1 137 ? 38.893  47.786 -2.202  1.00 50.21 ? 136 SER A N   1 
ATOM   1050 C  CA  . SER A 1 137 ? 38.101  47.944 -0.973  1.00 50.11 ? 136 SER A CA  1 
ATOM   1051 C  C   . SER A 1 137 ? 38.566  47.092 0.201   1.00 49.13 ? 136 SER A C   1 
ATOM   1052 O  O   . SER A 1 137 ? 39.366  46.172 0.038   1.00 51.39 ? 136 SER A O   1 
ATOM   1053 C  CB  . SER A 1 137 ? 36.643  47.567 -1.243  1.00 51.24 ? 136 SER A CB  1 
ATOM   1054 O  OG  . SER A 1 137 ? 36.470  46.144 -1.199  1.00 54.56 ? 136 SER A OG  1 
ATOM   1055 N  N   . GLY A 1 138 ? 38.000  47.395 1.373   1.00 47.61 ? 137 GLY A N   1 
ATOM   1056 C  CA  . GLY A 1 138 ? 38.187  46.619 2.598   1.00 45.22 ? 137 GLY A CA  1 
ATOM   1057 C  C   . GLY A 1 138 ? 37.071  45.632 2.984   1.00 42.90 ? 137 GLY A C   1 
ATOM   1058 O  O   . GLY A 1 138 ? 37.184  44.974 4.020   1.00 42.71 ? 137 GLY A O   1 
ATOM   1059 N  N   . ARG A 1 139 ? 36.011  45.510 2.180   1.00 38.58 ? 138 ARG A N   1 
ATOM   1060 C  CA  . ARG A 1 139 ? 34.940  44.532 2.459   1.00 33.17 ? 138 ARG A CA  1 
ATOM   1061 C  C   . ARG A 1 139 ? 35.434  43.083 2.442   1.00 27.22 ? 138 ARG A C   1 
ATOM   1062 O  O   . ARG A 1 139 ? 36.124  42.677 1.537   1.00 29.29 ? 138 ARG A O   1 
ATOM   1063 C  CB  . ARG A 1 139 ? 33.748  44.702 1.497   1.00 35.71 ? 138 ARG A CB  1 
ATOM   1064 C  CG  . ARG A 1 139 ? 32.596  45.470 2.140   1.00 29.25 ? 138 ARG A CG  1 
ATOM   1065 C  CD  . ARG A 1 139 ? 31.365  45.592 1.307   1.00 29.77 ? 138 ARG A CD  1 
ATOM   1066 N  NE  . ARG A 1 139 ? 30.541  44.368 1.201   1.00 19.81 ? 138 ARG A NE  1 
ATOM   1067 C  CZ  . ARG A 1 139 ? 29.269  44.409 0.802   1.00 20.16 ? 138 ARG A CZ  1 
ATOM   1068 N  NH1 . ARG A 1 139 ? 28.699  45.589 0.531   1.00 17.76 ? 138 ARG A NH1 1 
ATOM   1069 N  NH2 . ARG A 1 139 ? 28.560  43.295 0.656   1.00 23.54 ? 138 ARG A NH2 1 
ATOM   1070 N  N   . VAL A 1 140 ? 35.060  42.322 3.466   1.00 21.29 ? 139 VAL A N   1 
ATOM   1071 C  CA  . VAL A 1 140 ? 35.573  40.969 3.642   1.00 25.08 ? 139 VAL A CA  1 
ATOM   1072 C  C   . VAL A 1 140 ? 34.583  39.932 3.123   1.00 23.95 ? 139 VAL A C   1 
ATOM   1073 O  O   . VAL A 1 140 ? 34.485  38.829 3.661   1.00 24.61 ? 139 VAL A O   1 
ATOM   1074 C  CB  . VAL A 1 140 ? 35.885  40.672 5.120   1.00 23.00 ? 139 VAL A CB  1 
ATOM   1075 C  CG1 . VAL A 1 140 ? 37.042  41.532 5.604   1.00 32.59 ? 139 VAL A CG1 1 
ATOM   1076 C  CG2 . VAL A 1 140 ? 34.651  40.893 5.981   1.00 27.83 ? 139 VAL A CG2 1 
ATOM   1077 N  N   . ASP A 1 141 ? 33.850  40.294 2.075   1.00 23.77 ? 140 ASP A N   1 
ATOM   1078 C  CA  . ASP A 1 141 ? 32.932  39.366 1.425   1.00 20.09 ? 140 ASP A CA  1 
ATOM   1079 C  C   . ASP A 1 141 ? 32.931  39.560 -0.088  1.00 20.15 ? 140 ASP A C   1 
ATOM   1080 O  O   . ASP A 1 141 ? 31.905  39.384 -0.745  1.00 20.75 ? 140 ASP A O   1 
ATOM   1081 C  CB  . ASP A 1 141 ? 31.516  39.537 1.978   1.00 21.13 ? 140 ASP A CB  1 
ATOM   1082 C  CG  . ASP A 1 141 ? 30.873  40.838 1.542   1.00 25.46 ? 140 ASP A CG  1 
ATOM   1083 O  OD1 . ASP A 1 141 ? 31.614  41.783 1.199   1.00 19.13 ? 140 ASP A OD1 1 
ATOM   1084 O  OD2 . ASP A 1 141 ? 29.636  41.008 1.509   1.00 28.14 ? 140 ASP A OD2 1 
ATOM   1085 N  N   . ASP A 1 142 ? 34.086  39.925 -0.634  1.00 18.02 ? 141 ASP A N   1 
ATOM   1086 C  CA  . ASP A 1 142 ? 34.226  40.129 -2.090  1.00 18.90 ? 141 ASP A CA  1 
ATOM   1087 C  C   . ASP A 1 142 ? 35.248  39.201 -2.747  1.00 18.81 ? 141 ASP A C   1 
ATOM   1088 O  O   . ASP A 1 142 ? 35.624  39.391 -3.929  1.00 20.20 ? 141 ASP A O   1 
ATOM   1089 C  CB  . ASP A 1 142 ? 34.607  41.611 -2.374  1.00 15.84 ? 141 ASP A CB  1 
ATOM   1090 C  CG  . ASP A 1 142 ? 33.454  42.583 -2.167  1.00 29.55 ? 141 ASP A CG  1 
ATOM   1091 O  OD1 . ASP A 1 142 ? 32.274  42.160 -2.198  1.00 23.53 ? 141 ASP A OD1 1 
ATOM   1092 O  OD2 . ASP A 1 142 ? 33.738  43.795 -1.995  1.00 18.98 ? 141 ASP A OD2 1 
ATOM   1093 N  N   . ASN A 1 143 ? 35.648  38.136 -2.057  1.00 19.85 ? 142 ASN A N   1 
ATOM   1094 C  CA  . ASN A 1 143 ? 36.519  37.129 -2.675  1.00 17.30 ? 142 ASN A CA  1 
ATOM   1095 C  C   . ASN A 1 143 ? 35.729  36.164 -3.589  1.00 17.94 ? 142 ASN A C   1 
ATOM   1096 O  O   . ASN A 1 143 ? 34.519  35.973 -3.418  1.00 17.03 ? 142 ASN A O   1 
ATOM   1097 C  CB  . ASN A 1 143 ? 37.292  36.322 -1.617  1.00 16.04 ? 142 ASN A CB  1 
ATOM   1098 C  CG  . ASN A 1 143 ? 36.393  35.675 -0.619  1.00 18.30 ? 142 ASN A CG  1 
ATOM   1099 O  OD1 . ASN A 1 143 ? 35.944  36.311 0.309   1.00 21.26 ? 142 ASN A OD1 1 
ATOM   1100 N  ND2 . ASN A 1 143 ? 36.114  34.415 -0.805  1.00 16.12 ? 142 ASN A ND2 1 
ATOM   1101 N  N   . GLU A 1 144 ? 36.415  35.550 -4.547  1.00 15.86 ? 143 GLU A N   1 
ATOM   1102 C  CA  . GLU A 1 144 ? 35.720  34.919 -5.656  0.50 14.05 ? 143 GLU A CA  1 
ATOM   1103 C  C   . GLU A 1 144 ? 34.788  33.844 -5.141  1.00 17.60 ? 143 GLU A C   1 
ATOM   1104 O  O   . GLU A 1 144 ? 33.655  33.744 -5.604  1.00 20.84 ? 143 GLU A O   1 
ATOM   1105 C  CB  . GLU A 1 144 ? 36.695  34.353 -6.696  0.50 13.38 ? 143 GLU A CB  1 
ATOM   1106 C  CG  . GLU A 1 144 ? 37.585  33.230 -6.192  0.50 12.49 ? 143 GLU A CG  1 
ATOM   1107 N  N   . GLU A 1 145 ? 35.256  33.033 -4.185  1.00 19.53 ? 144 GLU A N   1 
ATOM   1108 C  CA  . GLU A 1 145 ? 34.462  31.914 -3.635  1.00 20.18 ? 144 GLU A CA  1 
ATOM   1109 C  C   . GLU A 1 145 ? 33.200  32.424 -2.894  1.00 20.84 ? 144 GLU A C   1 
ATOM   1110 O  O   . GLU A 1 145 ? 32.155  31.800 -2.935  1.00 21.57 ? 144 GLU A O   1 
ATOM   1111 C  CB  . GLU A 1 145 ? 35.258  31.102 -2.619  1.00 19.30 ? 144 GLU A CB  1 
ATOM   1112 C  CG  . GLU A 1 145 ? 36.544  30.527 -3.144  1.00 18.31 ? 144 GLU A CG  1 
ATOM   1113 C  CD  . GLU A 1 145 ? 37.741  31.415 -2.889  1.00 19.75 ? 144 GLU A CD  1 
ATOM   1114 O  OE1 . GLU A 1 145 ? 37.596  32.661 -2.728  1.00 21.40 ? 144 GLU A OE1 1 
ATOM   1115 O  OE2 . GLU A 1 145 ? 38.851  30.861 -2.862  1.00 20.82 ? 144 GLU A OE2 1 
ATOM   1116 N  N   . THR A 1 146 ? 33.338  33.510 -2.164  1.00 17.59 ? 145 THR A N   1 
ATOM   1117 C  CA  . THR A 1 146 ? 32.212  34.077 -1.425  1.00 18.69 ? 145 THR A CA  1 
ATOM   1118 C  C   . THR A 1 146 ? 31.211  34.822 -2.352  1.00 17.32 ? 145 THR A C   1 
ATOM   1119 O  O   . THR A 1 146 ? 29.998  34.789 -2.115  1.00 16.88 ? 145 THR A O   1 
ATOM   1120 C  CB  . THR A 1 146 ? 32.674  35.010 -0.317  1.00 18.39 ? 145 THR A CB  1 
ATOM   1121 O  OG1 . THR A 1 146 ? 33.485  34.282 0.606   1.00 18.35 ? 145 THR A OG1 1 
ATOM   1122 C  CG2 . THR A 1 146 ? 31.474  35.578 0.453   1.00 17.18 ? 145 THR A CG2 1 
ATOM   1123 N  N   . ILE A 1 147 ? 31.701  35.391 -3.445  1.00 17.50 ? 146 ILE A N   1 
ATOM   1124 C  CA  . ILE A 1 147 ? 30.782  35.957 -4.486  1.00 17.19 ? 146 ILE A CA  1 
ATOM   1125 C  C   . ILE A 1 147 ? 29.897  34.820 -5.037  1.00 14.10 ? 146 ILE A C   1 
ATOM   1126 O  O   . ILE A 1 147 ? 28.675  34.950 -5.160  1.00 15.29 ? 146 ILE A O   1 
ATOM   1127 C  CB  . ILE A 1 147 ? 31.531  36.646 -5.622  1.00 18.35 ? 146 ILE A CB  1 
ATOM   1128 C  CG1 . ILE A 1 147 ? 32.231  37.895 -5.071  1.00 15.15 ? 146 ILE A CG1 1 
ATOM   1129 C  CG2 . ILE A 1 147 ? 30.540  37.066 -6.750  1.00 17.59 ? 146 ILE A CG2 1 
ATOM   1130 C  CD1 . ILE A 1 147 ? 33.215  38.593 -6.028  1.00 20.08 ? 146 ILE A CD1 1 
ATOM   1131 N  N   . LYS A 1 148 ? 30.492  33.673 -5.283  1.00 17.79 ? 147 LYS A N   1 
ATOM   1132 C  CA  . LYS A 1 148 ? 29.700  32.500 -5.720  1.00 14.32 ? 147 LYS A CA  1 
ATOM   1133 C  C   . LYS A 1 148 ? 28.596  32.122 -4.735  1.00 16.14 ? 147 LYS A C   1 
ATOM   1134 O  O   . LYS A 1 148 ? 27.451  31.864 -5.152  1.00 15.40 ? 147 LYS A O   1 
ATOM   1135 C  CB  . LYS A 1 148 ? 30.622  31.292 -5.938  1.00 19.69 ? 147 LYS A CB  1 
ATOM   1136 C  CG  . LYS A 1 148 ? 31.428  31.376 -7.186  1.00 27.34 ? 147 LYS A CG  1 
ATOM   1137 C  CD  . LYS A 1 148 ? 32.497  30.304 -7.214  1.00 28.52 ? 147 LYS A CD  1 
ATOM   1138 C  CE  . LYS A 1 148 ? 33.128  30.198 -8.590  1.00 29.14 ? 147 LYS A CE  1 
ATOM   1139 N  NZ  . LYS A 1 148 ? 33.940  31.383 -8.927  1.00 35.11 ? 147 LYS A NZ  1 
ATOM   1140 N  N   . LYS A 1 149 ? 28.946  32.022 -3.443  1.00 14.87 ? 148 LYS A N   1 
ATOM   1141 C  CA  . LYS A 1 149 ? 27.956  31.732 -2.366  1.00 17.21 ? 148 LYS A CA  1 
ATOM   1142 C  C   . LYS A 1 149 ? 26.877  32.785 -2.279  1.00 17.16 ? 148 LYS A C   1 
ATOM   1143 O  O   . LYS A 1 149 ? 25.701  32.470 -2.115  1.00 17.02 ? 148 LYS A O   1 
ATOM   1144 C  CB  . LYS A 1 149 ? 28.637  31.497 -0.983  1.00 14.99 ? 148 LYS A CB  1 
ATOM   1145 C  CG  . LYS A 1 149 ? 29.645  30.325 -1.026  1.00 26.08 ? 148 LYS A CG  1 
ATOM   1146 C  CD  . LYS A 1 149 ? 30.321  30.084 0.337   1.00 25.80 ? 148 LYS A CD  1 
ATOM   1147 C  CE  . LYS A 1 149 ? 31.511  29.169 0.260   1.00 31.01 ? 148 LYS A CE  1 
ATOM   1148 N  NZ  . LYS A 1 149 ? 32.245  29.248 1.561   1.00 43.20 ? 148 LYS A NZ  1 
ATOM   1149 N  N   . ARG A 1 150 ? 27.250  34.058 -2.426  1.00 14.32 ? 149 ARG A N   1 
ATOM   1150 C  CA  . ARG A 1 150 ? 26.279  35.117 -2.362  1.00 14.40 ? 149 ARG A CA  1 
ATOM   1151 C  C   . ARG A 1 150 ? 25.302  35.044 -3.522  1.00 15.71 ? 149 ARG A C   1 
ATOM   1152 O  O   . ARG A 1 150 ? 24.079  35.278 -3.351  1.00 16.84 ? 149 ARG A O   1 
ATOM   1153 C  CB  . ARG A 1 150 ? 26.975  36.476 -2.371  1.00 14.85 ? 149 ARG A CB  1 
ATOM   1154 C  CG  . ARG A 1 150 ? 27.731  36.736 -1.061  1.00 21.41 ? 149 ARG A CG  1 
ATOM   1155 C  CD  . ARG A 1 150 ? 28.748  37.878 -1.157  1.00 16.05 ? 149 ARG A CD  1 
ATOM   1156 N  NE  . ARG A 1 150 ? 28.141  39.166 -1.467  1.00 13.81 ? 149 ARG A NE  1 
ATOM   1157 C  CZ  . ARG A 1 150 ? 28.808  40.252 -1.822  1.00 23.32 ? 149 ARG A CZ  1 
ATOM   1158 N  NH1 . ARG A 1 150 ? 30.121  40.219 -1.953  1.00 21.64 ? 149 ARG A NH1 1 
ATOM   1159 N  NH2 . ARG A 1 150 ? 28.152  41.382 -2.075  1.00 18.43 ? 149 ARG A NH2 1 
ATOM   1160 N  N   . LEU A 1 151 ? 25.805  34.662 -4.698  1.00 16.90 ? 150 LEU A N   1 
ATOM   1161 C  CA  . LEU A 1 151 ? 24.917  34.509 -5.845  1.00 16.33 ? 150 LEU A CA  1 
ATOM   1162 C  C   . LEU A 1 151 ? 23.929  33.371 -5.591  1.00 16.41 ? 150 LEU A C   1 
ATOM   1163 O  O   . LEU A 1 151 ? 22.723  33.530 -5.863  1.00 15.88 ? 150 LEU A O   1 
ATOM   1164 C  CB  . LEU A 1 151 ? 25.693  34.371 -7.166  1.00 15.40 ? 150 LEU A CB  1 
ATOM   1165 C  CG  . LEU A 1 151 ? 26.359  35.635 -7.711  1.00 21.23 ? 150 LEU A CG  1 
ATOM   1166 C  CD1 . LEU A 1 151 ? 27.399  35.295 -8.771  1.00 25.90 ? 150 LEU A CD1 1 
ATOM   1167 C  CD2 . LEU A 1 151 ? 25.334  36.590 -8.293  1.00 24.22 ? 150 LEU A CD2 1 
ATOM   1168 N  N   . GLU A 1 152 ? 24.422  32.227 -5.108  1.00 17.37 ? 151 GLU A N   1 
ATOM   1169 C  CA  . GLU A 1 152 ? 23.575  31.068 -4.827  1.00 20.27 ? 151 GLU A CA  1 
ATOM   1170 C  C   . GLU A 1 152 ? 22.474  31.391 -3.849  1.00 19.21 ? 151 GLU A C   1 
ATOM   1171 O  O   . GLU A 1 152 ? 21.310  31.046 -4.131  1.00 18.77 ? 151 GLU A O   1 
ATOM   1172 C  CB  . GLU A 1 152 ? 24.377  29.887 -4.300  1.00 23.10 ? 151 GLU A CB  1 
ATOM   1173 C  CG  . GLU A 1 152 ? 25.415  29.422 -5.273  1.00 26.91 ? 151 GLU A CG  1 
ATOM   1174 C  CD  . GLU A 1 152 ? 26.304  28.327 -4.714  1.00 48.76 ? 151 GLU A CD  1 
ATOM   1175 O  OE1 . GLU A 1 152 ? 26.253  28.061 -3.483  1.00 57.29 ? 151 GLU A OE1 1 
ATOM   1176 O  OE2 . GLU A 1 152 ? 27.056  27.736 -5.528  1.00 49.56 ? 151 GLU A OE2 1 
ATOM   1177 N  N   . THR A 1 153 ? 22.828  32.118 -2.767  1.00 16.10 ? 152 THR A N   1 
ATOM   1178 C  CA  . THR A 1 153 ? 21.893  32.459 -1.721  1.00 17.03 ? 152 THR A CA  1 
ATOM   1179 C  C   . THR A 1 153 ? 20.818  33.366 -2.293  1.00 18.73 ? 152 THR A C   1 
ATOM   1180 O  O   . THR A 1 153 ? 19.640  33.137 -2.047  1.00 19.41 ? 152 THR A O   1 
ATOM   1181 C  CB  . THR A 1 153 ? 22.565  33.138 -0.509  1.00 19.88 ? 152 THR A CB  1 
ATOM   1182 O  OG1 . THR A 1 153 ? 23.548  32.250 0.028   1.00 24.03 ? 152 THR A OG1 1 
ATOM   1183 C  CG2 . THR A 1 153 ? 21.550  33.405 0.598   1.00 25.42 ? 152 THR A CG2 1 
ATOM   1184 N  N   . TYR A 1 154 ? 21.218  34.350 -3.101  1.00 17.04 ? 153 TYR A N   1 
ATOM   1185 C  CA  . TYR A 1 154 ? 20.256  35.258 -3.761  1.00 17.07 ? 153 TYR A CA  1 
ATOM   1186 C  C   . TYR A 1 154 ? 19.239  34.540 -4.664  1.00 18.52 ? 153 TYR A C   1 
ATOM   1187 O  O   . TYR A 1 154 ? 18.021  34.850 -4.611  1.00 17.38 ? 153 TYR A O   1 
ATOM   1188 C  CB  . TYR A 1 154 ? 20.986  36.364 -4.560  1.00 15.88 ? 153 TYR A CB  1 
ATOM   1189 C  CG  . TYR A 1 154 ? 20.051  37.213 -5.405  1.00 15.77 ? 153 TYR A CG  1 
ATOM   1190 C  CD1 . TYR A 1 154 ? 19.226  38.143 -4.820  1.00 20.05 ? 153 TYR A CD1 1 
ATOM   1191 C  CD2 . TYR A 1 154 ? 19.908  36.980 -6.775  1.00 24.10 ? 153 TYR A CD2 1 
ATOM   1192 C  CE1 . TYR A 1 154 ? 18.323  38.885 -5.577  1.00 20.84 ? 153 TYR A CE1 1 
ATOM   1193 C  CE2 . TYR A 1 154 ? 19.017  37.701 -7.538  1.00 20.06 ? 153 TYR A CE2 1 
ATOM   1194 C  CZ  . TYR A 1 154 ? 18.224  38.662 -6.926  1.00 17.83 ? 153 TYR A CZ  1 
ATOM   1195 O  OH  . TYR A 1 154 ? 17.324  39.384 -7.674  1.00 22.75 ? 153 TYR A OH  1 
ATOM   1196 N  N   . TYR A 1 155 ? 19.705  33.586 -5.493  1.00 18.69 ? 154 TYR A N   1 
ATOM   1197 C  CA  . TYR A 1 155 ? 18.816  32.935 -6.450  1.00 18.17 ? 154 TYR A CA  1 
ATOM   1198 C  C   . TYR A 1 155 ? 17.911  31.947 -5.730  1.00 22.20 ? 154 TYR A C   1 
ATOM   1199 O  O   . TYR A 1 155 ? 16.749  31.804 -6.087  1.00 22.20 ? 154 TYR A O   1 
ATOM   1200 C  CB  . TYR A 1 155 ? 19.578  32.242 -7.601  1.00 21.34 ? 154 TYR A CB  1 
ATOM   1201 C  CG  . TYR A 1 155 ? 20.231  33.221 -8.537  1.00 23.45 ? 154 TYR A CG  1 
ATOM   1202 C  CD1 . TYR A 1 155 ? 19.478  34.195 -9.187  1.00 27.16 ? 154 TYR A CD1 1 
ATOM   1203 C  CD2 . TYR A 1 155 ? 21.601  33.208 -8.755  1.00 26.77 ? 154 TYR A CD2 1 
ATOM   1204 C  CE1 . TYR A 1 155 ? 20.065  35.118 -10.029 1.00 27.59 ? 154 TYR A CE1 1 
ATOM   1205 C  CE2 . TYR A 1 155 ? 22.205  34.144 -9.613  1.00 20.92 ? 154 TYR A CE2 1 
ATOM   1206 C  CZ  . TYR A 1 155 ? 21.428  35.083 -10.253 1.00 27.96 ? 154 TYR A CZ  1 
ATOM   1207 O  OH  . TYR A 1 155 ? 21.996  36.016 -11.106 1.00 25.26 ? 154 TYR A OH  1 
ATOM   1208 N  N   . LYS A 1 156 ? 18.448  31.249 -4.728  1.00 21.67 ? 155 LYS A N   1 
ATOM   1209 C  CA  . LYS A 1 156 ? 17.648  30.329 -3.935  1.00 19.16 ? 155 LYS A CA  1 
ATOM   1210 C  C   . LYS A 1 156 ? 16.557  30.965 -3.068  1.00 19.62 ? 155 LYS A C   1 
ATOM   1211 O  O   . LYS A 1 156 ? 15.427  30.522 -3.098  1.00 18.41 ? 155 LYS A O   1 
ATOM   1212 C  CB  . LYS A 1 156 ? 18.565  29.448 -3.083  1.00 23.22 ? 155 LYS A CB  1 
ATOM   1213 C  CG  . LYS A 1 156 ? 17.886  28.241 -2.537  1.00 24.51 ? 155 LYS A CG  1 
ATOM   1214 C  CD  . LYS A 1 156 ? 18.412  27.936 -1.126  1.00 35.81 ? 155 LYS A CD  1 
ATOM   1215 N  N   . ALA A 1 157 ? 16.882  32.036 -2.335  1.00 19.33 ? 156 ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 157 ? 16.017  32.581 -1.290  1.00 20.53 ? 156 ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 157 ? 15.318  33.873 -1.674  1.00 20.31 ? 156 ALA A C   1 
ATOM   1218 O  O   . ALA A 1 157 ? 14.171  34.095 -1.303  1.00 20.35 ? 156 ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 157 ? 16.839  32.850 -0.074  1.00 21.54 ? 156 ALA A CB  1 
ATOM   1220 N  N   . THR A 1 158 ? 16.027  34.737 -2.398  1.00 19.45 ? 157 THR A N   1 
ATOM   1221 C  CA  . THR A 1 158 ? 15.574  36.092 -2.617  1.00 19.60 ? 157 THR A CA  1 
ATOM   1222 C  C   . THR A 1 158 ? 14.779  36.246 -3.916  1.00 19.07 ? 157 THR A C   1 
ATOM   1223 O  O   . THR A 1 158 ? 13.847  37.042 -3.981  1.00 21.00 ? 157 THR A O   1 
ATOM   1224 C  CB  . THR A 1 158 ? 16.765  37.105 -2.597  1.00 19.97 ? 157 THR A CB  1 
ATOM   1225 O  OG1 . THR A 1 158 ? 17.593  36.852 -1.449  1.00 21.74 ? 157 THR A OG1 1 
ATOM   1226 C  CG2 . THR A 1 158 ? 16.249  38.513 -2.587  1.00 21.81 ? 157 THR A CG2 1 
ATOM   1227 N  N   . GLU A 1 159 ? 15.127  35.531 -4.972  1.00 20.67 ? 158 GLU A N   1 
ATOM   1228 C  CA  . GLU A 1 159 ? 14.340  35.682 -6.193  1.00 23.43 ? 158 GLU A CA  1 
ATOM   1229 C  C   . GLU A 1 159 ? 12.806  35.417 -5.993  1.00 22.29 ? 158 GLU A C   1 
ATOM   1230 O  O   . GLU A 1 159 ? 11.979  36.180 -6.510  1.00 21.40 ? 158 GLU A O   1 
ATOM   1231 C  CB  . GLU A 1 159 ? 14.953  34.899 -7.369  1.00 25.69 ? 158 GLU A CB  1 
ATOM   1232 C  CG  . GLU A 1 159 ? 14.972  35.689 -8.665  1.00 32.36 ? 158 GLU A CG  1 
ATOM   1233 C  CD  . GLU A 1 159 ? 15.816  35.053 -9.750  1.00 27.05 ? 158 GLU A CD  1 
ATOM   1234 O  OE1 . GLU A 1 159 ? 15.721  33.831 -9.968  1.00 23.56 ? 158 GLU A OE1 1 
ATOM   1235 O  OE2 . GLU A 1 159 ? 16.575  35.778 -10.398 1.00 29.55 ? 158 GLU A OE2 1 
ATOM   1236 N  N   . PRO A 1 160 ? 12.412  34.380 -5.214  1.00 21.83 ? 159 PRO A N   1 
ATOM   1237 C  CA  . PRO A 1 160 ? 11.013  34.197 -4.764  1.00 23.38 ? 159 PRO A CA  1 
ATOM   1238 C  C   . PRO A 1 160 ? 10.265  35.363 -4.096  1.00 25.09 ? 159 PRO A C   1 
ATOM   1239 O  O   . PRO A 1 160 ? 9.033   35.367 -4.094  1.00 22.62 ? 159 PRO A O   1 
ATOM   1240 C  CB  . PRO A 1 160 ? 11.146  33.081 -3.739  1.00 25.70 ? 159 PRO A CB  1 
ATOM   1241 C  CG  . PRO A 1 160 ? 12.216  32.248 -4.259  1.00 20.51 ? 159 PRO A CG  1 
ATOM   1242 C  CD  . PRO A 1 160 ? 13.245  33.269 -4.729  1.00 23.70 ? 159 PRO A CD  1 
ATOM   1243 N  N   . VAL A 1 161 ? 10.999  36.304 -3.500  1.00 19.43 ? 160 VAL A N   1 
ATOM   1244 C  CA  . VAL A 1 161 ? 10.434  37.501 -2.915  1.00 22.89 ? 160 VAL A CA  1 
ATOM   1245 C  C   . VAL A 1 161 ? 9.815   38.365 -4.035  1.00 23.55 ? 160 VAL A C   1 
ATOM   1246 O  O   . VAL A 1 161 ? 8.722   38.897 -3.885  1.00 21.40 ? 160 VAL A O   1 
ATOM   1247 C  CB  . VAL A 1 161 ? 11.551  38.297 -2.164  1.00 21.36 ? 160 VAL A CB  1 
ATOM   1248 C  CG1 . VAL A 1 161 ? 11.134  39.711 -1.842  1.00 26.39 ? 160 VAL A CG1 1 
ATOM   1249 C  CG2 . VAL A 1 161 ? 11.951  37.573 -0.891  1.00 26.85 ? 160 VAL A CG2 1 
ATOM   1250 N  N   . ILE A 1 162 ? 10.523  38.494 -5.153  1.00 23.55 ? 161 ILE A N   1 
ATOM   1251 C  CA  . ILE A 1 162 ? 9.988   39.197 -6.342  1.00 23.01 ? 161 ILE A CA  1 
ATOM   1252 C  C   . ILE A 1 162 ? 8.624   38.614 -6.798  1.00 22.49 ? 161 ILE A C   1 
ATOM   1253 O  O   . ILE A 1 162 ? 7.636   39.346 -6.900  1.00 22.38 ? 161 ILE A O   1 
ATOM   1254 C  CB  . ILE A 1 162 ? 10.976  39.149 -7.527  1.00 25.59 ? 161 ILE A CB  1 
ATOM   1255 C  CG1 . ILE A 1 162 ? 12.373  39.649 -7.122  1.00 27.89 ? 161 ILE A CG1 1 
ATOM   1256 C  CG2 . ILE A 1 162 ? 10.420  39.941 -8.724  1.00 26.53 ? 161 ILE A CG2 1 
ATOM   1257 C  CD1 . ILE A 1 162 ? 12.373  41.039 -6.596  1.00 30.79 ? 161 ILE A CD1 1 
ATOM   1258 N  N   . ALA A 1 163 ? 8.553   37.307 -7.027  1.00 23.88 ? 162 ALA A N   1 
ATOM   1259 C  CA  . ALA A 1 163 ? 7.290   36.686 -7.461  1.00 24.22 ? 162 ALA A CA  1 
ATOM   1260 C  C   . ALA A 1 163 ? 6.170   36.841 -6.406  1.00 22.86 ? 162 ALA A C   1 
ATOM   1261 O  O   . ALA A 1 163 ? 4.988   36.944 -6.740  1.00 22.41 ? 162 ALA A O   1 
ATOM   1262 C  CB  . ALA A 1 163 ? 7.489   35.257 -7.811  1.00 27.74 ? 162 ALA A CB  1 
ATOM   1263 N  N   . PHE A 1 164 ? 6.564   36.913 -5.140  1.00 21.90 ? 163 PHE A N   1 
ATOM   1264 C  CA  . PHE A 1 164 ? 5.627   37.079 -4.024  1.00 21.00 ? 163 PHE A CA  1 
ATOM   1265 C  C   . PHE A 1 164 ? 4.957   38.427 -4.092  1.00 18.12 ? 163 PHE A C   1 
ATOM   1266 O  O   . PHE A 1 164 ? 3.739   38.516 -4.080  1.00 18.26 ? 163 PHE A O   1 
ATOM   1267 C  CB  . PHE A 1 164 ? 6.372   36.913 -2.721  1.00 19.14 ? 163 PHE A CB  1 
ATOM   1268 C  CG  . PHE A 1 164 ? 5.520   36.976 -1.506  1.00 19.13 ? 163 PHE A CG  1 
ATOM   1269 C  CD1 . PHE A 1 164 ? 4.743   35.889 -1.130  1.00 27.59 ? 163 PHE A CD1 1 
ATOM   1270 C  CD2 . PHE A 1 164 ? 5.551   38.085 -0.685  1.00 24.70 ? 163 PHE A CD2 1 
ATOM   1271 C  CE1 . PHE A 1 164 ? 3.991   35.943 0.039   1.00 29.08 ? 163 PHE A CE1 1 
ATOM   1272 C  CE2 . PHE A 1 164 ? 4.791   38.155 0.478   1.00 27.81 ? 163 PHE A CE2 1 
ATOM   1273 C  CZ  . PHE A 1 164 ? 4.026   37.068 0.844   1.00 27.00 ? 163 PHE A CZ  1 
ATOM   1274 N  N   . TYR A 1 165 ? 5.758   39.463 -4.202  1.00 16.86 ? 164 TYR A N   1 
ATOM   1275 C  CA  . TYR A 1 165 ? 5.239   40.840 -4.282  1.00 16.47 ? 164 TYR A CA  1 
ATOM   1276 C  C   . TYR A 1 165 ? 4.687   41.196 -5.659  1.00 15.73 ? 164 TYR A C   1 
ATOM   1277 O  O   . TYR A 1 165 ? 3.813   42.044 -5.761  1.00 16.19 ? 164 TYR A O   1 
ATOM   1278 C  CB  . TYR A 1 165 ? 6.270   41.852 -3.802  1.00 17.45 ? 164 TYR A CB  1 
ATOM   1279 C  CG  . TYR A 1 165 ? 6.460   41.753 -2.323  1.00 14.05 ? 164 TYR A CG  1 
ATOM   1280 C  CD1 . TYR A 1 165 ? 5.419   42.031 -1.468  1.00 14.97 ? 164 TYR A CD1 1 
ATOM   1281 C  CD2 . TYR A 1 165 ? 7.661   41.316 -1.766  1.00 23.46 ? 164 TYR A CD2 1 
ATOM   1282 C  CE1 . TYR A 1 165 ? 5.559   41.910 -0.097  1.00 18.84 ? 164 TYR A CE1 1 
ATOM   1283 C  CE2 . TYR A 1 165 ? 7.800   41.178 -0.370  1.00 24.56 ? 164 TYR A CE2 1 
ATOM   1284 C  CZ  . TYR A 1 165 ? 6.741   41.471 0.452   1.00 22.64 ? 164 TYR A CZ  1 
ATOM   1285 O  OH  . TYR A 1 165 ? 6.832   41.333 1.842   1.00 24.11 ? 164 TYR A OH  1 
ATOM   1286 N  N   . GLU A 1 166 ? 5.135   40.488 -6.695  1.00 19.84 ? 165 GLU A N   1 
ATOM   1287 C  CA  . GLU A 1 166 ? 4.611   40.659 -8.052  1.00 20.18 ? 165 GLU A CA  1 
ATOM   1288 C  C   . GLU A 1 166 ? 3.083   40.507 -8.084  1.00 20.74 ? 165 GLU A C   1 
ATOM   1289 O  O   . GLU A 1 166 ? 2.403   41.222 -8.807  1.00 17.88 ? 165 GLU A O   1 
ATOM   1290 C  CB  . GLU A 1 166 ? 5.289   39.642 -8.967  1.00 24.55 ? 165 GLU A CB  1 
ATOM   1291 C  CG  . GLU A 1 166 ? 4.780   39.556 -10.378 1.00 30.72 ? 165 GLU A CG  1 
ATOM   1292 C  CD  . GLU A 1 166 ? 4.792   40.868 -11.073 1.00 31.63 ? 165 GLU A CD  1 
ATOM   1293 O  OE1 . GLU A 1 166 ? 5.786   41.610 -10.899 1.00 36.30 ? 165 GLU A OE1 1 
ATOM   1294 O  OE2 . GLU A 1 166 ? 3.806   41.141 -11.803 1.00 43.64 ? 165 GLU A OE2 1 
ATOM   1295 N  N   . LYS A 1 167 ? 2.562   39.578 -7.284  1.00 19.52 ? 166 LYS A N   1 
ATOM   1296 C  CA  . LYS A 1 167 ? 1.120   39.337 -7.175  1.00 20.37 ? 166 LYS A CA  1 
ATOM   1297 C  C   . LYS A 1 167 ? 0.278   40.552 -6.777  1.00 20.35 ? 166 LYS A C   1 
ATOM   1298 O  O   . LYS A 1 167 ? -0.874  40.667 -7.190  1.00 23.66 ? 166 LYS A O   1 
ATOM   1299 C  CB  . LYS A 1 167 ? 0.865   38.180 -6.198  1.00 20.97 ? 166 LYS A CB  1 
ATOM   1300 C  CG  . LYS A 1 167 ? 1.367   36.865 -6.751  1.00 25.23 ? 166 LYS A CG  1 
ATOM   1301 C  CD  . LYS A 1 167 ? 1.188   35.705 -5.723  1.00 25.62 ? 166 LYS A CD  1 
ATOM   1302 C  CE  . LYS A 1 167 ? 1.758   34.406 -6.254  1.00 31.17 ? 166 LYS A CE  1 
ATOM   1303 N  NZ  . LYS A 1 167 ? 1.065   33.985 -7.485  1.00 41.64 ? 166 LYS A NZ  1 
ATOM   1304 N  N   . ARG A 1 168 ? 0.869   41.457 -6.000  1.00 17.09 ? 167 ARG A N   1 
ATOM   1305 C  CA  . ARG A 1 168 ? 0.220   42.670 -5.517  1.00 16.62 ? 167 ARG A CA  1 
ATOM   1306 C  C   . ARG A 1 168 ? 0.376   43.869 -6.464  1.00 17.14 ? 167 ARG A C   1 
ATOM   1307 O  O   . ARG A 1 168 ? -0.150  44.929 -6.177  1.00 15.78 ? 167 ARG A O   1 
ATOM   1308 C  CB  . ARG A 1 168 ? 0.822   43.053 -4.161  1.00 17.14 ? 167 ARG A CB  1 
ATOM   1309 C  CG  . ARG A 1 168 ? 0.822   41.957 -3.132  1.00 20.15 ? 167 ARG A CG  1 
ATOM   1310 C  CD  . ARG A 1 168 ? 1.301   42.571 -1.797  1.00 22.02 ? 167 ARG A CD  1 
ATOM   1311 N  NE  . ARG A 1 168 ? 1.551   41.517 -0.830  1.00 24.87 ? 167 ARG A NE  1 
ATOM   1312 C  CZ  . ARG A 1 168 ? 1.953   41.727 0.416   1.00 21.83 ? 167 ARG A CZ  1 
ATOM   1313 N  NH1 . ARG A 1 168 ? 2.118   42.960 0.867   1.00 23.00 ? 167 ARG A NH1 1 
ATOM   1314 N  NH2 . ARG A 1 168 ? 2.151   40.698 1.203   1.00 24.26 ? 167 ARG A NH2 1 
ATOM   1315 N  N   . GLY A 1 169 ? 1.122   43.711 -7.569  1.00 18.26 ? 168 GLY A N   1 
ATOM   1316 C  CA  . GLY A 1 169 ? 1.222   44.745 -8.615  1.00 16.50 ? 168 GLY A CA  1 
ATOM   1317 C  C   . GLY A 1 169 ? 2.227   45.856 -8.321  1.00 16.78 ? 168 GLY A C   1 
ATOM   1318 O  O   . GLY A 1 169 ? 2.218   46.856 -9.007  1.00 17.14 ? 168 GLY A O   1 
ATOM   1319 N  N   . ILE A 1 170 ? 3.075   45.681 -7.299  1.00 15.99 ? 169 ILE A N   1 
ATOM   1320 C  CA  . ILE A 1 170 ? 3.950   46.767 -6.766  1.00 17.04 ? 169 ILE A CA  1 
ATOM   1321 C  C   . ILE A 1 170 ? 5.394   46.677 -7.227  1.00 16.90 ? 169 ILE A C   1 
ATOM   1322 O  O   . ILE A 1 170 ? 6.229   47.527 -6.851  1.00 15.32 ? 169 ILE A O   1 
ATOM   1323 C  CB  . ILE A 1 170 ? 3.947   46.854 -5.214  1.00 15.39 ? 169 ILE A CB  1 
ATOM   1324 C  CG1 . ILE A 1 170 ? 4.672   45.647 -4.592  1.00 18.75 ? 169 ILE A CG1 1 
ATOM   1325 C  CG2 . ILE A 1 170 ? 2.548   46.981 -4.679  1.00 15.99 ? 169 ILE A CG2 1 
ATOM   1326 C  CD1 . ILE A 1 170 ? 4.981   45.859 -3.133  1.00 22.93 ? 169 ILE A CD1 1 
ATOM   1327 N  N   . VAL A 1 171 ? 5.720   45.677 -8.046  1.00 15.88 ? 170 VAL A N   1 
ATOM   1328 C  CA  . VAL A 1 171 ? 7.088   45.576 -8.568  1.00 16.13 ? 170 VAL A CA  1 
ATOM   1329 C  C   . VAL A 1 171 ? 7.325   46.499 -9.792  1.00 16.14 ? 170 VAL A C   1 
ATOM   1330 O  O   . VAL A 1 171 ? 6.515   46.551 -10.730 1.00 15.99 ? 170 VAL A O   1 
ATOM   1331 C  CB  . VAL A 1 171 ? 7.451   44.118 -8.946  1.00 15.84 ? 170 VAL A CB  1 
ATOM   1332 C  CG1 . VAL A 1 171 ? 8.848   44.067 -9.560  1.00 21.62 ? 170 VAL A CG1 1 
ATOM   1333 C  CG2 . VAL A 1 171 ? 7.327   43.186 -7.725  1.00 14.37 ? 170 VAL A CG2 1 
ATOM   1334 N  N   . ARG A 1 172 ? 8.485   47.160 -9.800  1.00 16.50 ? 171 ARG A N   1 
ATOM   1335 C  CA  . ARG A 1 172 ? 8.951   47.970 -10.922 1.00 15.96 ? 171 ARG A CA  1 
ATOM   1336 C  C   . ARG A 1 172 ? 10.388  47.572 -11.222 1.00 18.37 ? 171 ARG A C   1 
ATOM   1337 O  O   . ARG A 1 172 ? 11.247  47.711 -10.358 1.00 16.85 ? 171 ARG A O   1 
ATOM   1338 C  CB  . ARG A 1 172 ? 8.933   49.450 -10.538 1.00 16.72 ? 171 ARG A CB  1 
ATOM   1339 C  CG  . ARG A 1 172 ? 7.548   50.011 -10.165 1.00 21.01 ? 171 ARG A CG  1 
ATOM   1340 C  CD  . ARG A 1 172 ? 6.533   50.009 -11.289 1.00 20.68 ? 171 ARG A CD  1 
ATOM   1341 N  NE  . ARG A 1 172 ? 5.276   50.618 -10.822 1.00 14.93 ? 171 ARG A NE  1 
ATOM   1342 C  CZ  . ARG A 1 172 ? 4.316   49.961 -10.151 1.00 22.74 ? 171 ARG A CZ  1 
ATOM   1343 N  NH1 . ARG A 1 172 ? 4.379   48.649 -9.940  1.00 20.26 ? 171 ARG A NH1 1 
ATOM   1344 N  NH2 . ARG A 1 172 ? 3.252   50.603 -9.722  1.00 19.61 ? 171 ARG A NH2 1 
ATOM   1345 N  N   . LYS A 1 173 ? 10.630  47.045 -12.419 1.00 16.95 ? 172 LYS A N   1 
ATOM   1346 C  CA  . LYS A 1 173 ? 11.964  46.482 -12.752 1.00 21.75 ? 172 LYS A CA  1 
ATOM   1347 C  C   . LYS A 1 173 ? 12.821  47.509 -13.462 1.00 20.59 ? 172 LYS A C   1 
ATOM   1348 O  O   . LYS A 1 173 ? 12.327  48.295 -14.301 1.00 17.44 ? 172 LYS A O   1 
ATOM   1349 C  CB  . LYS A 1 173 ? 11.840  45.257 -13.633 1.00 22.74 ? 172 LYS A CB  1 
ATOM   1350 C  CG  . LYS A 1 173 ? 13.193  44.581 -13.970 1.00 27.07 ? 172 LYS A CG  1 
ATOM   1351 C  CD  . LYS A 1 173 ? 13.009  43.273 -14.726 1.00 32.10 ? 172 LYS A CD  1 
ATOM   1352 C  CE  . LYS A 1 173 ? 12.534  43.501 -16.169 1.00 38.70 ? 172 LYS A CE  1 
ATOM   1353 N  NZ  . LYS A 1 173 ? 13.657  43.979 -17.040 1.00 48.94 ? 172 LYS A NZ  1 
ATOM   1354 N  N   . VAL A 1 174 ? 14.100  47.495 -13.265 1.00 20.39 ? 173 VAL A N   1 
ATOM   1355 C  CA  . VAL A 1 174 ? 15.051  48.288 -14.035 1.00 19.43 ? 173 VAL A CA  1 
ATOM   1356 C  C   . VAL A 1 174 ? 16.231  47.439 -14.496 1.00 20.70 ? 173 VAL A C   1 
ATOM   1357 O  O   . VAL A 1 174 ? 16.804  46.680 -13.716 1.00 21.07 ? 173 VAL A O   1 
ATOM   1358 C  CB  . VAL A 1 174 ? 15.578  49.484 -13.221 1.00 19.80 ? 173 VAL A CB  1 
ATOM   1359 C  CG1 . VAL A 1 174 ? 14.423  50.337 -12.717 1.00 25.05 ? 173 VAL A CG1 1 
ATOM   1360 C  CG2 . VAL A 1 174 ? 16.439  49.003 -12.064 1.00 23.23 ? 173 VAL A CG2 1 
ATOM   1361 N  N   . ASN A 1 175 ? 16.588  47.574 -15.769 1.00 17.77 ? 174 ASN A N   1 
ATOM   1362 C  CA  . ASN A 1 175 ? 17.784  46.932 -16.301 1.00 19.36 ? 174 ASN A CA  1 
ATOM   1363 C  C   . ASN A 1 175 ? 19.063  47.520 -15.717 1.00 19.09 ? 174 ASN A C   1 
ATOM   1364 O  O   . ASN A 1 175 ? 19.430  48.656 -16.019 1.00 21.12 ? 174 ASN A O   1 
ATOM   1365 C  CB  . ASN A 1 175 ? 17.810  47.029 -17.828 1.00 21.90 ? 174 ASN A CB  1 
ATOM   1366 C  CG  . ASN A 1 175 ? 18.981  46.284 -18.439 1.00 23.20 ? 174 ASN A CG  1 
ATOM   1367 O  OD1 . ASN A 1 175 ? 19.851  45.782 -17.729 1.00 26.34 ? 174 ASN A OD1 1 
ATOM   1368 N  ND2 . ASN A 1 175 ? 19.007  46.209 -19.765 1.00 31.89 ? 174 ASN A ND2 1 
ATOM   1369 N  N   . ALA A 1 176 ? 19.738  46.741 -14.878 1.00 18.10 ? 175 ALA A N   1 
ATOM   1370 C  CA  . ALA A 1 176 ? 20.839  47.249 -14.086 1.00 20.56 ? 175 ALA A CA  1 
ATOM   1371 C  C   . ALA A 1 176 ? 22.174  47.221 -14.815 1.00 21.46 ? 175 ALA A C   1 
ATOM   1372 O  O   . ALA A 1 176 ? 23.174  47.592 -14.233 1.00 17.00 ? 175 ALA A O   1 
ATOM   1373 C  CB  . ALA A 1 176 ? 20.946  46.456 -12.818 1.00 25.09 ? 175 ALA A CB  1 
ATOM   1374 N  N   . GLU A 1 177 ? 22.199  46.768 -16.075 1.00 21.17 ? 176 GLU A N   1 
ATOM   1375 C  CA  . GLU A 1 177 ? 23.443  46.724 -16.838 1.00 25.43 ? 176 GLU A CA  1 
ATOM   1376 C  C   . GLU A 1 177 ? 23.561  48.094 -17.465 1.00 26.29 ? 176 GLU A C   1 
ATOM   1377 O  O   . GLU A 1 177 ? 22.565  48.812 -17.592 1.00 31.45 ? 176 GLU A O   1 
ATOM   1378 C  CB  . GLU A 1 177 ? 23.414  45.653 -17.944 1.00 25.82 ? 176 GLU A CB  1 
ATOM   1379 C  CG  . GLU A 1 177 ? 22.667  44.353 -17.636 1.00 31.68 ? 176 GLU A CG  1 
ATOM   1380 C  CD  . GLU A 1 177 ? 23.391  43.415 -16.691 1.00 41.15 ? 176 GLU A CD  1 
ATOM   1381 O  OE1 . GLU A 1 177 ? 23.786  42.309 -17.131 1.00 43.19 ? 176 GLU A OE1 1 
ATOM   1382 O  OE2 . GLU A 1 177 ? 23.531  43.758 -15.497 1.00 52.97 ? 176 GLU A OE2 1 
ATOM   1383 N  N   . GLY A 1 178 ? 24.764  48.481 -17.836 1.00 26.89 ? 177 GLY A N   1 
ATOM   1384 C  CA  . GLY A 1 178 ? 24.954  49.791 -18.489 1.00 27.86 ? 177 GLY A CA  1 
ATOM   1385 C  C   . GLY A 1 178 ? 25.329  50.827 -17.465 1.00 25.62 ? 177 GLY A C   1 
ATOM   1386 O  O   . GLY A 1 178 ? 25.601  50.471 -16.324 1.00 26.16 ? 177 GLY A O   1 
ATOM   1387 N  N   . SER A 1 179 ? 25.288  52.106 -17.849 1.00 22.69 ? 178 SER A N   1 
ATOM   1388 C  CA  . SER A 1 179 ? 25.887  53.149 -17.044 1.00 22.00 ? 178 SER A CA  1 
ATOM   1389 C  C   . SER A 1 179 ? 25.074  53.448 -15.797 1.00 23.14 ? 178 SER A C   1 
ATOM   1390 O  O   . SER A 1 179 ? 23.853  53.201 -15.761 1.00 23.93 ? 178 SER A O   1 
ATOM   1391 C  CB  . SER A 1 179 ? 26.036  54.445 -17.853 1.00 23.36 ? 178 SER A CB  1 
ATOM   1392 O  OG  . SER A 1 179 ? 24.765  54.985 -18.140 1.00 15.74 ? 178 SER A OG  1 
ATOM   1393 N  N   . VAL A 1 180 ? 25.729  54.025 -14.785 1.00 21.83 ? 179 VAL A N   1 
ATOM   1394 C  CA  . VAL A 1 180 ? 25.004  54.456 -13.560 1.00 21.48 ? 179 VAL A CA  1 
ATOM   1395 C  C   . VAL A 1 180 ? 23.856  55.413 -13.944 1.00 20.26 ? 179 VAL A C   1 
ATOM   1396 O  O   . VAL A 1 180 ? 22.758  55.353 -13.384 1.00 18.13 ? 179 VAL A O   1 
ATOM   1397 C  CB  . VAL A 1 180 ? 25.939  55.160 -12.524 1.00 20.08 ? 179 VAL A CB  1 
ATOM   1398 C  CG1 . VAL A 1 180 ? 25.104  55.798 -11.437 1.00 18.87 ? 179 VAL A CG1 1 
ATOM   1399 C  CG2 . VAL A 1 180 ? 26.932  54.158 -11.913 1.00 18.25 ? 179 VAL A CG2 1 
ATOM   1400 N  N   . ASP A 1 181 ? 24.099  56.261 -14.935 1.00 19.08 ? 180 ASP A N   1 
ATOM   1401 C  CA  . ASP A 1 181 ? 23.082  57.249 -15.321 1.00 21.75 ? 180 ASP A CA  1 
ATOM   1402 C  C   . ASP A 1 181 ? 21.914  56.593 -16.082 1.00 21.46 ? 180 ASP A C   1 
ATOM   1403 O  O   . ASP A 1 181 ? 20.755  56.934 -15.842 1.00 22.03 ? 180 ASP A O   1 
ATOM   1404 C  CB  . ASP A 1 181 ? 23.718  58.378 -16.131 1.00 21.96 ? 180 ASP A CB  1 
ATOM   1405 C  CG  . ASP A 1 181 ? 24.424  59.421 -15.246 1.00 30.97 ? 180 ASP A CG  1 
ATOM   1406 O  OD1 . ASP A 1 181 ? 24.395  59.327 -13.998 1.00 33.81 ? 180 ASP A OD1 1 
ATOM   1407 O  OD2 . ASP A 1 181 ? 24.964  60.387 -15.814 1.00 49.90 ? 180 ASP A OD2 1 
ATOM   1408 N  N   . SER A 1 182 ? 22.204  55.655 -16.973 1.00 20.55 ? 181 SER A N   1 
ATOM   1409 C  CA  . SER A 1 182 ? 21.141  54.929 -17.668 1.00 21.36 ? 181 SER A CA  1 
ATOM   1410 C  C   . SER A 1 182 ? 20.234  54.146 -16.719 1.00 19.33 ? 181 SER A C   1 
ATOM   1411 O  O   . SER A 1 182 ? 19.032  54.024 -16.951 1.00 18.28 ? 181 SER A O   1 
ATOM   1412 C  CB  . SER A 1 182 ? 21.687  54.017 -18.783 1.00 21.97 ? 181 SER A CB  1 
ATOM   1413 O  OG  . SER A 1 182 ? 22.229  52.789 -18.297 1.00 24.58 ? 181 SER A OG  1 
ATOM   1414 N  N   . VAL A 1 183 ? 20.793  53.619 -15.645 1.00 19.86 ? 182 VAL A N   1 
ATOM   1415 C  CA  . VAL A 1 183 ? 19.993  52.880 -14.690 1.00 18.27 ? 182 VAL A CA  1 
ATOM   1416 C  C   . VAL A 1 183 ? 19.100  53.834 -13.908 1.00 19.84 ? 182 VAL A C   1 
ATOM   1417 O  O   . VAL A 1 183 ? 17.921  53.524 -13.737 1.00 19.84 ? 182 VAL A O   1 
ATOM   1418 C  CB  . VAL A 1 183 ? 20.858  51.997 -13.762 1.00 18.55 ? 182 VAL A CB  1 
ATOM   1419 C  CG1 . VAL A 1 183 ? 19.982  51.202 -12.820 1.00 16.21 ? 182 VAL A CG1 1 
ATOM   1420 C  CG2 . VAL A 1 183 ? 21.656  51.022 -14.605 1.00 22.06 ? 182 VAL A CG2 1 
ATOM   1421 N  N   . PHE A 1 184 ? 19.648  54.977 -13.461 1.00 16.90 ? 183 PHE A N   1 
ATOM   1422 C  CA  . PHE A 1 184 ? 18.888  55.987 -12.697 1.00 17.28 ? 183 PHE A CA  1 
ATOM   1423 C  C   . PHE A 1 184 ? 17.762  56.647 -13.485 1.00 15.24 ? 183 PHE A C   1 
ATOM   1424 O  O   . PHE A 1 184 ? 16.722  56.989 -12.924 1.00 14.91 ? 183 PHE A O   1 
ATOM   1425 C  CB  . PHE A 1 184 ? 19.827  57.081 -12.146 1.00 16.69 ? 183 PHE A CB  1 
ATOM   1426 C  CG  . PHE A 1 184 ? 19.188  58.001 -11.113 1.00 14.59 ? 183 PHE A CG  1 
ATOM   1427 C  CD1 . PHE A 1 184 ? 19.192  59.411 -11.284 1.00 13.64 ? 183 PHE A CD1 1 
ATOM   1428 C  CD2 . PHE A 1 184 ? 18.586  57.479 -9.967  1.00 22.05 ? 183 PHE A CD2 1 
ATOM   1429 C  CE1 . PHE A 1 184 ? 18.608  60.209 -10.323 1.00 14.29 ? 183 PHE A CE1 1 
ATOM   1430 C  CE2 . PHE A 1 184 ? 17.994  58.289 -9.016  1.00 17.96 ? 183 PHE A CE2 1 
ATOM   1431 C  CZ  . PHE A 1 184 ? 17.999  59.640 -9.175  1.00 13.88 ? 183 PHE A CZ  1 
ATOM   1432 N  N   . SER A 1 185 ? 17.970  56.876 -14.769 1.00 15.94 ? 184 SER A N   1 
ATOM   1433 C  CA  . SER A 1 185 ? 16.876  57.344 -15.616 1.00 16.71 ? 184 SER A CA  1 
ATOM   1434 C  C   . SER A 1 185 ? 15.647  56.422 -15.560 1.00 18.10 ? 184 SER A C   1 
ATOM   1435 O  O   . SER A 1 185 ? 14.521  56.909 -15.441 1.00 17.17 ? 184 SER A O   1 
ATOM   1436 C  CB  . SER A 1 185 ? 17.359  57.538 -17.058 1.00 21.22 ? 184 SER A CB  1 
ATOM   1437 O  OG  . SER A 1 185 ? 17.714  56.294 -17.616 1.00 31.93 ? 184 SER A OG  1 
ATOM   1438 N  N   . GLN A 1 186 ? 15.866  55.102 -15.612 1.00 17.38 ? 185 GLN A N   1 
ATOM   1439 C  CA  . GLN A 1 186 ? 14.795  54.123 -15.478 1.00 17.99 ? 185 GLN A CA  1 
ATOM   1440 C  C   . GLN A 1 186 ? 14.172  54.167 -14.083 1.00 20.54 ? 185 GLN A C   1 
ATOM   1441 O  O   . GLN A 1 186 ? 12.952  54.082 -13.936 1.00 21.32 ? 185 GLN A O   1 
ATOM   1442 C  CB  . GLN A 1 186 ? 15.340  52.697 -15.711 1.00 13.74 ? 185 GLN A CB  1 
ATOM   1443 C  CG  . GLN A 1 186 ? 15.922  52.440 -17.069 1.00 19.86 ? 185 GLN A CG  1 
ATOM   1444 C  CD  . GLN A 1 186 ? 16.592  51.086 -17.139 1.00 23.41 ? 185 GLN A CD  1 
ATOM   1445 O  OE1 . GLN A 1 186 ? 15.943  50.040 -16.934 1.00 24.37 ? 185 GLN A OE1 1 
ATOM   1446 N  NE2 . GLN A 1 186 ? 17.905  51.089 -17.380 1.00 25.74 ? 185 GLN A NE2 1 
ATOM   1447 N  N   . VAL A 1 187 ? 15.022  54.308 -13.062 1.00 18.43 ? 186 VAL A N   1 
ATOM   1448 C  CA  . VAL A 1 187 ? 14.550  54.444 -11.689 1.00 19.67 ? 186 VAL A CA  1 
ATOM   1449 C  C   . VAL A 1 187 ? 13.635  55.678 -11.560 1.00 17.27 ? 186 VAL A C   1 
ATOM   1450 O  O   . VAL A 1 187 ? 12.527  55.566 -11.001 1.00 16.01 ? 186 VAL A O   1 
ATOM   1451 C  CB  . VAL A 1 187 ? 15.741  54.507 -10.651 1.00 17.17 ? 186 VAL A CB  1 
ATOM   1452 C  CG1 . VAL A 1 187 ? 15.237  54.863 -9.248  1.00 23.59 ? 186 VAL A CG1 1 
ATOM   1453 C  CG2 . VAL A 1 187 ? 16.580  53.238 -10.699 1.00 16.33 ? 186 VAL A CG2 1 
ATOM   1454 N  N   . CYS A 1 188 ? 14.054  56.833 -12.093 1.00 17.99 ? 187 CYS A N   1 
ATOM   1455 C  CA  . CYS A 1 188 ? 13.228  58.043 -11.979 1.00 18.00 ? 187 CYS A CA  1 
ATOM   1456 C  C   . CYS A 1 188 ? 11.862  57.943 -12.719 1.00 19.15 ? 187 CYS A C   1 
ATOM   1457 O  O   . CYS A 1 188 ? 10.844  58.454 -12.257 1.00 19.19 ? 187 CYS A O   1 
ATOM   1458 C  CB  . CYS A 1 188 ? 13.996  59.284 -12.480 1.00 22.35 ? 187 CYS A CB  1 
ATOM   1459 S  SG  . CYS A 1 188 ? 15.325  59.810 -11.332 1.00 27.46 ? 187 CYS A SG  1 
ATOM   1460 N  N   . THR A 1 189 ? 11.874  57.276 -13.869 1.00 19.62 ? 188 THR A N   1 
ATOM   1461 C  CA  . THR A 1 189 ? 10.654  57.045 -14.633 1.00 21.55 ? 188 THR A CA  1 
ATOM   1462 C  C   . THR A 1 189 ? 9.613   56.305 -13.800 1.00 20.20 ? 188 THR A C   1 
ATOM   1463 O  O   . THR A 1 189 ? 8.418   56.585 -13.891 1.00 19.59 ? 188 THR A O   1 
ATOM   1464 C  CB  . THR A 1 189 ? 10.936  56.243 -15.917 1.00 20.94 ? 188 THR A CB  1 
ATOM   1465 O  OG1 . THR A 1 189 ? 11.705  57.041 -16.824 1.00 23.23 ? 188 THR A OG1 1 
ATOM   1466 C  CG2 . THR A 1 189 ? 9.632   55.835 -16.587 1.00 26.26 ? 188 THR A CG2 1 
ATOM   1467 N  N   . HIS A 1 190 ? 10.075  55.359 -12.988 1.00 20.21 ? 189 HIS A N   1 
ATOM   1468 C  CA  . HIS A 1 190 ? 9.184   54.564 -12.152 1.00 21.78 ? 189 HIS A CA  1 
ATOM   1469 C  C   . HIS A 1 190 ? 8.671   55.374 -10.967 1.00 21.73 ? 189 HIS A C   1 
ATOM   1470 O  O   . HIS A 1 190 ? 7.483   55.338 -10.645 1.00 22.69 ? 189 HIS A O   1 
ATOM   1471 C  CB  . HIS A 1 190 ? 9.896   53.303 -11.659 1.00 18.44 ? 189 HIS A CB  1 
ATOM   1472 C  CG  . HIS A 1 190 ? 9.996   52.223 -12.691 1.00 20.44 ? 189 HIS A CG  1 
ATOM   1473 N  ND1 . HIS A 1 190 ? 8.980   51.946 -13.580 1.00 20.41 ? 189 HIS A ND1 1 
ATOM   1474 C  CD2 . HIS A 1 190 ? 10.992  51.352 -12.976 1.00 17.02 ? 189 HIS A CD2 1 
ATOM   1475 C  CE1 . HIS A 1 190 ? 9.345   50.950 -14.367 1.00 16.69 ? 189 HIS A CE1 1 
ATOM   1476 N  NE2 . HIS A 1 190 ? 10.563  50.572 -14.022 1.00 19.49 ? 189 HIS A NE2 1 
ATOM   1477 N  N   . LEU A 1 191 ? 9.574   56.104 -10.320 1.00 22.02 ? 190 LEU A N   1 
ATOM   1478 C  CA  . LEU A 1 191 ? 9.234   56.855 -9.118  1.00 22.82 ? 190 LEU A CA  1 
ATOM   1479 C  C   . LEU A 1 191 ? 8.344   58.049 -9.447  1.00 24.55 ? 190 LEU A C   1 
ATOM   1480 O  O   . LEU A 1 191 ? 7.389   58.341 -8.727  1.00 28.01 ? 190 LEU A O   1 
ATOM   1481 C  CB  . LEU A 1 191 ? 10.502  57.326 -8.403  1.00 21.28 ? 190 LEU A CB  1 
ATOM   1482 C  CG  . LEU A 1 191 ? 11.376  56.234 -7.784  1.00 20.13 ? 190 LEU A CG  1 
ATOM   1483 C  CD1 . LEU A 1 191 ? 12.593  56.841 -7.103  1.00 17.26 ? 190 LEU A CD1 1 
ATOM   1484 C  CD2 . LEU A 1 191 ? 10.572  55.394 -6.803  1.00 33.42 ? 190 LEU A CD2 1 
ATOM   1485 N  N   . ASP A 1 192 ? 8.664   58.736 -10.539 1.00 25.25 ? 191 ASP A N   1 
ATOM   1486 C  CA  . ASP A 1 192 ? 7.856   59.869 -11.001 1.00 23.20 ? 191 ASP A CA  1 
ATOM   1487 C  C   . ASP A 1 192 ? 6.413   59.468 -11.369 1.00 23.69 ? 191 ASP A C   1 
ATOM   1488 O  O   . ASP A 1 192 ? 5.489   60.257 -11.181 1.00 25.00 ? 191 ASP A O   1 
ATOM   1489 C  CB  . ASP A 1 192 ? 8.503   60.594 -12.187 1.00 23.33 ? 191 ASP A CB  1 
ATOM   1490 C  CG  . ASP A 1 192 ? 9.790   61.351 -11.805 1.00 29.81 ? 191 ASP A CG  1 
ATOM   1491 O  OD1 . ASP A 1 192 ? 10.140  61.395 -10.601 1.00 27.74 ? 191 ASP A OD1 1 
ATOM   1492 O  OD2 . ASP A 1 192 ? 10.454  61.906 -12.722 1.00 27.10 ? 191 ASP A OD2 1 
ATOM   1493 N  N   . ALA A 1 193 ? 6.207   58.254 -11.878 1.00 23.87 ? 192 ALA A N   1 
ATOM   1494 C  CA  . ALA A 1 193 ? 4.857   57.799 -12.238 1.00 26.38 ? 192 ALA A CA  1 
ATOM   1495 C  C   . ALA A 1 193 ? 3.958   57.563 -11.020 1.00 27.99 ? 192 ALA A C   1 
ATOM   1496 O  O   . ALA A 1 193 ? 2.728   57.501 -11.158 1.00 29.29 ? 192 ALA A O   1 
ATOM   1497 C  CB  . ALA A 1 193 ? 4.920   56.538 -13.104 1.00 27.12 ? 192 ALA A CB  1 
ATOM   1498 N  N   . LEU A 1 194 ? 4.570   57.445 -9.848  1.00 29.74 ? 193 LEU A N   1 
ATOM   1499 C  CA  . LEU A 1 194 ? 3.874   57.183 -8.584  1.00 33.60 ? 193 LEU A CA  1 
ATOM   1500 C  C   . LEU A 1 194 ? 3.797   58.409 -7.677  1.00 36.61 ? 193 LEU A C   1 
ATOM   1501 O  O   . LEU A 1 194 ? 2.803   58.593 -6.960  1.00 33.36 ? 193 LEU A O   1 
ATOM   1502 C  CB  . LEU A 1 194 ? 4.592   56.079 -7.833  1.00 34.34 ? 193 LEU A CB  1 
ATOM   1503 C  CG  . LEU A 1 194 ? 4.434   54.681 -8.449  1.00 41.46 ? 193 LEU A CG  1 
ATOM   1504 C  CD1 . LEU A 1 194 ? 5.607   53.795 -8.089  1.00 44.87 ? 193 LEU A CD1 1 
ATOM   1505 C  CD2 . LEU A 1 194 ? 3.093   54.026 -8.027  1.00 44.04 ? 193 LEU A CD2 1 
ATOM   1506 N  N   . LEU A 1 195 ? 4.880   59.192 -7.677  1.00 38.50 ? 194 LEU A N   1 
ATOM   1507 C  CA  . LEU A 1 195 ? 4.967   60.452 -6.959  1.00 41.75 ? 194 LEU A CA  1 
ATOM   1508 C  C   . LEU A 1 195 ? 4.697   61.559 -7.945  1.00 39.91 ? 194 LEU A C   1 
ATOM   1509 O  O   . LEU A 1 195 ? 4.102   62.546 -7.584  1.00 43.08 ? 194 LEU A O   1 
ATOM   1510 C  CB  . LEU A 1 195 ? 6.366   60.650 -6.354  1.00 42.09 ? 194 LEU A CB  1 
ATOM   1511 C  CG  . LEU A 1 195 ? 6.872   59.535 -5.431  1.00 49.18 ? 194 LEU A CG  1 
ATOM   1512 C  CD1 . LEU A 1 195 ? 8.294   59.846 -4.946  1.00 50.00 ? 194 LEU A CD1 1 
ATOM   1513 C  CD2 . LEU A 1 195 ? 5.910   59.310 -4.239  1.00 49.48 ? 194 LEU A CD2 1 
ATOM   1514 N  N   . SER B 1 1   ? 23.103  60.408 18.199  1.00 24.88 ? 0   SER B N   1 
ATOM   1515 C  CA  . SER B 1 1   ? 22.261  59.285 17.689  1.00 24.68 ? 0   SER B CA  1 
ATOM   1516 C  C   . SER B 1 1   ? 21.216  58.866 18.725  1.00 23.54 ? 0   SER B C   1 
ATOM   1517 O  O   . SER B 1 1   ? 21.364  59.132 19.919  1.00 20.87 ? 0   SER B O   1 
ATOM   1518 C  CB  . SER B 1 1   ? 23.149  58.080 17.332  1.00 27.01 ? 0   SER B CB  1 
ATOM   1519 O  OG  . SER B 1 1   ? 23.568  57.370 18.494  1.00 26.98 ? 0   SER B OG  1 
ATOM   1520 N  N   . MET B 1 2   ? 20.159  58.208 18.256  1.00 22.30 ? 1   MET B N   1 
ATOM   1521 C  CA  . MET B 1 2   ? 19.106  57.708 19.123  1.00 22.11 ? 1   MET B CA  1 
ATOM   1522 C  C   . MET B 1 2   ? 19.678  56.643 20.064  1.00 23.19 ? 1   MET B C   1 
ATOM   1523 O  O   . MET B 1 2   ? 19.337  56.607 21.242  1.00 22.37 ? 1   MET B O   1 
ATOM   1524 C  CB  . MET B 1 2   ? 17.968  57.132 18.277  1.00 21.32 ? 1   MET B CB  1 
ATOM   1525 C  CG  . MET B 1 2   ? 16.822  56.580 19.050  1.00 21.75 ? 1   MET B CG  1 
ATOM   1526 S  SD  . MET B 1 2   ? 16.234  57.715 20.323  1.00 31.48 ? 1   MET B SD  1 
ATOM   1527 C  CE  . MET B 1 2   ? 15.655  59.100 19.354  1.00 25.67 ? 1   MET B CE  1 
ATOM   1528 N  N   . GLU B 1 3   ? 20.549  55.788 19.530  1.00 24.01 ? 2   GLU B N   1 
ATOM   1529 C  CA  . GLU B 1 3   ? 21.241  54.769 20.327  1.00 26.73 ? 2   GLU B CA  1 
ATOM   1530 C  C   . GLU B 1 3   ? 22.016  55.364 21.509  1.00 24.44 ? 2   GLU B C   1 
ATOM   1531 O  O   . GLU B 1 3   ? 21.983  54.846 22.633  1.00 25.84 ? 2   GLU B O   1 
ATOM   1532 C  CB  . GLU B 1 3   ? 22.220  54.006 19.427  1.00 28.18 ? 2   GLU B CB  1 
ATOM   1533 C  CG  . GLU B 1 3   ? 23.135  53.011 20.151  1.00 28.02 ? 2   GLU B CG  1 
ATOM   1534 C  CD  . GLU B 1 3   ? 24.305  52.561 19.291  1.00 33.93 ? 2   GLU B CD  1 
ATOM   1535 O  OE1 . GLU B 1 3   ? 24.159  52.510 18.046  1.00 46.26 ? 2   GLU B OE1 1 
ATOM   1536 O  OE2 . GLU B 1 3   ? 25.377  52.270 19.863  1.00 47.31 ? 2   GLU B OE2 1 
ATOM   1537 N  N   . GLU B 1 4   ? 22.718  56.450 21.247  1.00 24.31 ? 3   GLU B N   1 
ATOM   1538 C  CA  . GLU B 1 4   ? 23.503  57.118 22.291  1.00 23.69 ? 3   GLU B CA  1 
ATOM   1539 C  C   . GLU B 1 4   ? 22.604  57.736 23.330  1.00 21.71 ? 3   GLU B C   1 
ATOM   1540 O  O   . GLU B 1 4   ? 22.868  57.624 24.506  1.00 20.52 ? 3   GLU B O   1 
ATOM   1541 C  CB  . GLU B 1 4   ? 24.388  58.203 21.697  1.00 22.70 ? 3   GLU B CB  1 
ATOM   1542 C  CG  . GLU B 1 4   ? 25.645  57.673 21.061  1.00 24.95 ? 3   GLU B CG  1 
ATOM   1543 C  CD  . GLU B 1 4   ? 26.473  58.753 20.371  1.00 25.42 ? 3   GLU B CD  1 
ATOM   1544 N  N   . LYS B 1 5   ? 21.563  58.420 22.867  1.00 21.18 ? 4   LYS B N   1 
ATOM   1545 C  CA  . LYS B 1 5   ? 20.569  59.034 23.726  1.00 21.65 ? 4   LYS B CA  1 
ATOM   1546 C  C   . LYS B 1 5   ? 19.946  58.042 24.710  1.00 21.64 ? 4   LYS B C   1 
ATOM   1547 O  O   . LYS B 1 5   ? 19.827  58.334 25.899  1.00 21.84 ? 4   LYS B O   1 
ATOM   1548 C  CB  . LYS B 1 5   ? 19.453  59.648 22.877  1.00 19.78 ? 4   LYS B CB  1 
ATOM   1549 C  CG  . LYS B 1 5   ? 19.806  60.966 22.162  1.00 20.92 ? 4   LYS B CG  1 
ATOM   1550 C  CD  . LYS B 1 5   ? 18.565  61.497 21.438  1.00 22.59 ? 4   LYS B CD  1 
ATOM   1551 C  CE  . LYS B 1 5   ? 18.851  62.732 20.598  1.00 28.11 ? 4   LYS B CE  1 
ATOM   1552 N  NZ  . LYS B 1 5   ? 17.809  62.914 19.548  1.00 30.03 ? 4   LYS B NZ  1 
ATOM   1553 N  N   . LEU B 1 6   ? 19.528  56.876 24.210  1.00 22.06 ? 5   LEU B N   1 
ATOM   1554 C  CA  . LEU B 1 6   ? 18.897  55.872 25.069  1.00 21.99 ? 5   LEU B CA  1 
ATOM   1555 C  C   . LEU B 1 6   ? 19.854  55.289 26.133  1.00 24.40 ? 5   LEU B C   1 
ATOM   1556 O  O   . LEU B 1 6   ? 19.419  54.837 27.188  1.00 24.45 ? 5   LEU B O   1 
ATOM   1557 C  CB  . LEU B 1 6   ? 18.319  54.748 24.212  1.00 21.29 ? 5   LEU B CB  1 
ATOM   1558 C  CG  . LEU B 1 6   ? 17.112  55.151 23.348  1.00 23.61 ? 5   LEU B CG  1 
ATOM   1559 C  CD1 . LEU B 1 6   ? 16.814  54.049 22.315  1.00 23.14 ? 5   LEU B CD1 1 
ATOM   1560 C  CD2 . LEU B 1 6   ? 15.872  55.447 24.161  1.00 23.49 ? 5   LEU B CD2 1 
ATOM   1561 N  N   . LYS B 1 7   ? 21.143  55.258 25.818  1.00 25.04 ? 6   LYS B N   1 
ATOM   1562 C  CA  . LYS B 1 7   ? 22.177  54.810 26.759  1.00 27.07 ? 6   LYS B CA  1 
ATOM   1563 C  C   . LYS B 1 7   ? 22.477  55.851 27.846  1.00 25.73 ? 6   LYS B C   1 
ATOM   1564 O  O   . LYS B 1 7   ? 23.166  55.556 28.813  1.00 30.77 ? 6   LYS B O   1 
ATOM   1565 C  CB  . LYS B 1 7   ? 23.493  54.533 26.016  1.00 27.92 ? 6   LYS B CB  1 
ATOM   1566 C  CG  . LYS B 1 7   ? 23.587  53.244 25.249  1.00 32.02 ? 6   LYS B CG  1 
ATOM   1567 C  CD  . LYS B 1 7   ? 24.861  53.275 24.391  1.00 30.56 ? 6   LYS B CD  1 
ATOM   1568 C  CE  . LYS B 1 7   ? 25.127  51.969 23.659  1.00 34.24 ? 6   LYS B CE  1 
ATOM   1569 N  NZ  . LYS B 1 7   ? 26.077  52.140 22.505  1.00 30.08 ? 6   LYS B NZ  1 
ATOM   1570 N  N   . LYS B 1 8   ? 21.995  57.070 27.691  1.00 25.29 ? 7   LYS B N   1 
ATOM   1571 C  CA  . LYS B 1 8   ? 22.359  58.140 28.616  1.00 25.24 ? 7   LYS B CA  1 
ATOM   1572 C  C   . LYS B 1 8   ? 21.243  58.475 29.594  1.00 27.67 ? 7   LYS B C   1 
ATOM   1573 O  O   . LYS B 1 8   ? 21.499  59.015 30.659  1.00 29.20 ? 7   LYS B O   1 
ATOM   1574 C  CB  . LYS B 1 8   ? 22.773  59.389 27.836  1.00 25.90 ? 7   LYS B CB  1 
ATOM   1575 C  CG  . LYS B 1 8   ? 24.203  59.337 27.308  1.00 23.76 ? 7   LYS B CG  1 
ATOM   1576 N  N   . THR B 1 9   ? 19.999  58.163 29.233  1.00 26.77 ? 8   THR B N   1 
ATOM   1577 C  CA  . THR B 1 9   ? 18.858  58.535 30.056  1.00 23.23 ? 8   THR B CA  1 
ATOM   1578 C  C   . THR B 1 9   ? 18.755  57.605 31.262  1.00 22.23 ? 8   THR B C   1 
ATOM   1579 O  O   . THR B 1 9   ? 19.089  56.405 31.169  1.00 20.55 ? 8   THR B O   1 
ATOM   1580 C  CB  . THR B 1 9   ? 17.540  58.519 29.219  1.00 24.53 ? 8   THR B CB  1 
ATOM   1581 O  OG1 . THR B 1 9   ? 16.490  59.177 29.941  1.00 29.78 ? 8   THR B OG1 1 
ATOM   1582 C  CG2 . THR B 1 9   ? 17.110  57.116 28.870  1.00 26.69 ? 8   THR B CG2 1 
ATOM   1583 N  N   . ASN B 1 10  ? 18.325  58.159 32.393  1.00 20.53 ? 9   ASN B N   1 
ATOM   1584 C  CA  . ASN B 1 10  ? 18.050  57.356 33.598  1.00 20.88 ? 9   ASN B CA  1 
ATOM   1585 C  C   . ASN B 1 10  ? 16.875  56.372 33.380  1.00 19.44 ? 9   ASN B C   1 
ATOM   1586 O  O   . ASN B 1 10  ? 15.777  56.779 33.015  1.00 18.84 ? 9   ASN B O   1 
ATOM   1587 C  CB  . ASN B 1 10  ? 17.719  58.255 34.798  1.00 24.27 ? 9   ASN B CB  1 
ATOM   1588 C  CG  . ASN B 1 10  ? 18.944  58.738 35.552  1.00 35.15 ? 9   ASN B CG  1 
ATOM   1589 O  OD1 . ASN B 1 10  ? 20.094  58.440 35.200  1.00 42.76 ? 9   ASN B OD1 1 
ATOM   1590 N  ND2 . ASN B 1 10  ? 18.697  59.499 36.612  1.00 41.67 ? 9   ASN B ND2 1 
ATOM   1591 N  N   . ILE B 1 11  ? 17.122  55.083 33.618  1.00 16.45 ? 10  ILE B N   1 
ATOM   1592 C  CA  . ILE B 1 11  ? 16.091  54.069 33.509  1.00 17.19 ? 10  ILE B CA  1 
ATOM   1593 C  C   . ILE B 1 11  ? 15.907  53.406 34.870  1.00 20.06 ? 10  ILE B C   1 
ATOM   1594 O  O   . ILE B 1 11  ? 16.851  52.842 35.419  1.00 18.54 ? 10  ILE B O   1 
ATOM   1595 C  CB  . ILE B 1 11  ? 16.493  53.030 32.445  1.00 15.32 ? 10  ILE B CB  1 
ATOM   1596 C  CG1 . ILE B 1 11  ? 16.636  53.728 31.084  1.00 18.20 ? 10  ILE B CG1 1 
ATOM   1597 C  CG2 . ILE B 1 11  ? 15.515  51.881 32.400  1.00 20.75 ? 10  ILE B CG2 1 
ATOM   1598 C  CD1 . ILE B 1 11  ? 17.394  52.948 30.034  1.00 18.01 ? 10  ILE B CD1 1 
ATOM   1599 N  N   . ILE B 1 12  ? 14.695  53.495 35.422  1.00 18.13 ? 11  ILE B N   1 
ATOM   1600 C  CA  . ILE B 1 12  ? 14.357  52.782 36.662  1.00 19.22 ? 11  ILE B CA  1 
ATOM   1601 C  C   . ILE B 1 12  ? 13.348  51.653 36.407  1.00 19.28 ? 11  ILE B C   1 
ATOM   1602 O  O   . ILE B 1 12  ? 12.227  51.912 35.946  1.00 19.37 ? 11  ILE B O   1 
ATOM   1603 C  CB  . ILE B 1 12  ? 13.794  53.741 37.710  1.00 18.19 ? 11  ILE B CB  1 
ATOM   1604 C  CG1 . ILE B 1 12  ? 14.817  54.834 38.043  1.00 23.01 ? 11  ILE B CG1 1 
ATOM   1605 C  CG2 . ILE B 1 12  ? 13.396  52.969 38.958  1.00 18.66 ? 11  ILE B CG2 1 
ATOM   1606 C  CD1 . ILE B 1 12  ? 14.314  55.921 38.878  1.00 23.11 ? 11  ILE B CD1 1 
ATOM   1607 N  N   . PHE B 1 13  ? 13.752  50.403 36.674  1.00 17.03 ? 12  PHE B N   1 
ATOM   1608 C  CA  . PHE B 1 13  ? 12.848  49.234 36.556  1.00 16.18 ? 12  PHE B CA  1 
ATOM   1609 C  C   . PHE B 1 13  ? 11.942  49.128 37.827  1.00 19.47 ? 12  PHE B C   1 
ATOM   1610 O  O   . PHE B 1 13  ? 12.455  49.114 38.961  1.00 16.96 ? 12  PHE B O   1 
ATOM   1611 C  CB  . PHE B 1 13  ? 13.622  47.913 36.416  1.00 17.99 ? 12  PHE B CB  1 
ATOM   1612 C  CG  . PHE B 1 13  ? 14.282  47.633 35.039  1.00 15.26 ? 12  PHE B CG  1 
ATOM   1613 C  CD1 . PHE B 1 13  ? 14.009  48.373 33.890  1.00 23.04 ? 12  PHE B CD1 1 
ATOM   1614 C  CD2 . PHE B 1 13  ? 15.162  46.527 34.920  1.00 20.54 ? 12  PHE B CD2 1 
ATOM   1615 C  CE1 . PHE B 1 13  ? 14.610  48.037 32.652  1.00 20.81 ? 12  PHE B CE1 1 
ATOM   1616 C  CE2 . PHE B 1 13  ? 15.768  46.199 33.699  1.00 18.41 ? 12  PHE B CE2 1 
ATOM   1617 C  CZ  . PHE B 1 13  ? 15.482  46.965 32.560  1.00 19.42 ? 12  PHE B CZ  1 
ATOM   1618 N  N   . VAL B 1 14  ? 10.617  49.064 37.660  1.00 18.38 ? 13  VAL B N   1 
ATOM   1619 C  CA  . VAL B 1 14  ? 9.714   48.939 38.821  1.00 16.78 ? 13  VAL B CA  1 
ATOM   1620 C  C   . VAL B 1 14  ? 9.083   47.563 38.794  1.00 18.43 ? 13  VAL B C   1 
ATOM   1621 O  O   . VAL B 1 14  ? 8.300   47.254 37.884  1.00 20.09 ? 13  VAL B O   1 
ATOM   1622 C  CB  . VAL B 1 14  ? 8.634   49.981 38.824  1.00 15.09 ? 13  VAL B CB  1 
ATOM   1623 C  CG1 . VAL B 1 14  ? 7.760   49.849 40.081  1.00 16.24 ? 13  VAL B CG1 1 
ATOM   1624 C  CG2 . VAL B 1 14  ? 9.260   51.347 38.724  1.00 17.80 ? 13  VAL B CG2 1 
ATOM   1625 N  N   . VAL B 1 15  ? 9.467   46.746 39.777  1.00 15.62 ? 14  VAL B N   1 
ATOM   1626 C  CA  . VAL B 1 15  ? 9.125   45.328 39.843  1.00 16.87 ? 14  VAL B CA  1 
ATOM   1627 C  C   . VAL B 1 15  ? 8.326   44.992 41.072  1.00 17.73 ? 14  VAL B C   1 
ATOM   1628 O  O   . VAL B 1 15  ? 8.645   45.438 42.157  1.00 18.70 ? 14  VAL B O   1 
ATOM   1629 C  CB  . VAL B 1 15  ? 10.404  44.463 39.872  1.00 17.79 ? 14  VAL B CB  1 
ATOM   1630 C  CG1 . VAL B 1 15  ? 10.066  42.960 39.798  1.00 17.62 ? 14  VAL B CG1 1 
ATOM   1631 C  CG2 . VAL B 1 15  ? 11.356  44.891 38.748  1.00 21.70 ? 14  VAL B CG2 1 
ATOM   1632 N  N   . GLY B 1 16  ? 7.304   44.162 40.906  1.00 17.21 ? 15  GLY B N   1 
ATOM   1633 C  CA  . GLY B 1 16  ? 6.453   43.761 42.015  1.00 16.51 ? 15  GLY B CA  1 
ATOM   1634 C  C   . GLY B 1 16  ? 5.284   42.925 41.534  1.00 16.79 ? 15  GLY B C   1 
ATOM   1635 O  O   . GLY B 1 16  ? 4.943   42.914 40.347  1.00 17.01 ? 15  GLY B O   1 
ATOM   1636 N  N   . GLY B 1 17  ? 4.651   42.211 42.445  1.00 18.20 ? 16  GLY B N   1 
ATOM   1637 C  CA  . GLY B 1 17  ? 3.562   41.323 42.059  1.00 18.52 ? 16  GLY B CA  1 
ATOM   1638 C  C   . GLY B 1 17  ? 2.306   42.022 41.590  1.00 14.99 ? 16  GLY B C   1 
ATOM   1639 O  O   . GLY B 1 17  ? 2.227   43.260 41.598  1.00 19.92 ? 16  GLY B O   1 
ATOM   1640 N  N   . PRO B 1 18  ? 1.318   41.249 41.144  1.00 18.06 ? 17  PRO B N   1 
ATOM   1641 C  CA  . PRO B 1 18  ? 0.046   41.831 40.688  1.00 17.95 ? 17  PRO B CA  1 
ATOM   1642 C  C   . PRO B 1 18  ? -0.721  42.454 41.826  1.00 16.98 ? 17  PRO B C   1 
ATOM   1643 O  O   . PRO B 1 18  ? -1.105  41.776 42.746  1.00 20.95 ? 17  PRO B O   1 
ATOM   1644 C  CB  . PRO B 1 18  ? -0.739  40.637 40.120  1.00 15.34 ? 17  PRO B CB  1 
ATOM   1645 C  CG  . PRO B 1 18  ? -0.106  39.441 40.663  1.00 17.15 ? 17  PRO B CG  1 
ATOM   1646 C  CD  . PRO B 1 18  ? 1.332   39.783 40.997  1.00 15.91 ? 17  PRO B CD  1 
ATOM   1647 N  N   . GLY B 1 19  ? -0.936  43.753 41.743  1.00 17.12 ? 18  GLY B N   1 
ATOM   1648 C  CA  . GLY B 1 19  ? -1.657  44.478 42.761  1.00 18.48 ? 18  GLY B CA  1 
ATOM   1649 C  C   . GLY B 1 19  ? -0.769  45.018 43.857  1.00 17.60 ? 18  GLY B C   1 
ATOM   1650 O  O   . GLY B 1 19  ? -1.292  45.547 44.825  1.00 20.79 ? 18  GLY B O   1 
ATOM   1651 N  N   . SER B 1 20  ? 0.556   44.909 43.711  1.00 18.20 ? 19  SER B N   1 
ATOM   1652 C  CA  . SER B 1 20  ? 1.502   45.416 44.720  1.00 18.09 ? 19  SER B CA  1 
ATOM   1653 C  C   . SER B 1 20  ? 1.511   46.952 44.870  1.00 17.03 ? 19  SER B C   1 
ATOM   1654 O  O   . SER B 1 20  ? 1.980   47.481 45.891  1.00 20.92 ? 19  SER B O   1 
ATOM   1655 C  CB  . SER B 1 20  ? 2.932   44.917 44.433  1.00 19.27 ? 19  SER B CB  1 
ATOM   1656 O  OG  . SER B 1 20  ? 3.412   45.367 43.168  1.00 17.22 ? 19  SER B OG  1 
ATOM   1657 N  N   . GLY B 1 21  ? 1.015   47.655 43.864  1.00 16.79 ? 20  GLY B N   1 
ATOM   1658 C  CA  . GLY B 1 21  ? 0.899   49.109 43.879  1.00 15.18 ? 20  GLY B CA  1 
ATOM   1659 C  C   . GLY B 1 21  ? 1.897   49.832 43.010  1.00 15.64 ? 20  GLY B C   1 
ATOM   1660 O  O   . GLY B 1 21  ? 2.161   51.017 43.251  1.00 16.95 ? 20  GLY B O   1 
ATOM   1661 N  N   . LYS B 1 22  ? 2.432   49.163 41.977  1.00 18.90 ? 21  LYS B N   1 
ATOM   1662 C  CA  . LYS B 1 22  ? 3.406   49.794 41.064  1.00 17.98 ? 21  LYS B CA  1 
ATOM   1663 C  C   . LYS B 1 22  ? 2.844   51.064 40.403  1.00 19.99 ? 21  LYS B C   1 
ATOM   1664 O  O   . LYS B 1 22  ? 3.443   52.157 40.516  1.00 16.86 ? 21  LYS B O   1 
ATOM   1665 C  CB  . LYS B 1 22  ? 3.915   48.802 39.999  1.00 21.00 ? 21  LYS B CB  1 
ATOM   1666 C  CG  . LYS B 1 22  ? 4.674   47.619 40.600  1.00 20.68 ? 21  LYS B CG  1 
ATOM   1667 C  CD  . LYS B 1 22  ? 5.287   46.694 39.566  1.00 19.21 ? 21  LYS B CD  1 
ATOM   1668 C  CE  . LYS B 1 22  ? 4.270   46.032 38.611  1.00 21.18 ? 21  LYS B CE  1 
ATOM   1669 N  NZ  . LYS B 1 22  ? 3.259   45.147 39.314  1.00 16.66 ? 21  LYS B NZ  1 
ATOM   1670 N  N   . GLY B 1 23  ? 1.684   50.957 39.749  1.00 19.50 ? 22  GLY B N   1 
ATOM   1671 C  CA  . GLY B 1 23  ? 1.122   52.115 39.071  1.00 18.26 ? 22  GLY B CA  1 
ATOM   1672 C  C   . GLY B 1 23  ? 0.885   53.301 39.995  1.00 18.53 ? 22  GLY B C   1 
ATOM   1673 O  O   . GLY B 1 23  ? 1.172   54.458 39.653  1.00 17.14 ? 22  GLY B O   1 
ATOM   1674 N  N   . THR B 1 24  ? 0.350   52.997 41.167  1.00 19.91 ? 23  THR B N   1 
ATOM   1675 C  CA  . THR B 1 24  ? -0.036  54.000 42.161  1.00 18.85 ? 23  THR B CA  1 
ATOM   1676 C  C   . THR B 1 24  ? 1.173   54.780 42.638  1.00 17.45 ? 23  THR B C   1 
ATOM   1677 O  O   . THR B 1 24  ? 1.152   56.000 42.664  1.00 18.97 ? 23  THR B O   1 
ATOM   1678 C  CB  . THR B 1 24  ? -0.767  53.341 43.328  1.00 18.91 ? 23  THR B CB  1 
ATOM   1679 O  OG1 . THR B 1 24  ? -1.968  52.747 42.834  1.00 19.00 ? 23  THR B OG1 1 
ATOM   1680 C  CG2 . THR B 1 24  ? -1.122  54.352 44.412  1.00 20.48 ? 23  THR B CG2 1 
ATOM   1681 N  N   . GLN B 1 25  ? 2.244   54.064 42.930  1.00 18.51 ? 24  GLN B N   1 
ATOM   1682 C  CA  . GLN B 1 25  ? 3.496   54.688 43.332  1.00 17.70 ? 24  GLN B CA  1 
ATOM   1683 C  C   . GLN B 1 25  ? 4.123   55.432 42.159  1.00 18.61 ? 24  GLN B C   1 
ATOM   1684 O  O   . GLN B 1 25  ? 4.609   56.537 42.346  1.00 16.02 ? 24  GLN B O   1 
ATOM   1685 C  CB  . GLN B 1 25  ? 4.444   53.642 43.901  1.00 17.87 ? 24  GLN B CB  1 
ATOM   1686 C  CG  . GLN B 1 25  ? 3.983   53.058 45.228  1.00 19.17 ? 24  GLN B CG  1 
ATOM   1687 C  CD  . GLN B 1 25  ? 3.821   54.141 46.257  1.00 18.81 ? 24  GLN B CD  1 
ATOM   1688 O  OE1 . GLN B 1 25  ? 4.740   54.931 46.459  1.00 20.93 ? 24  GLN B OE1 1 
ATOM   1689 N  NE2 . GLN B 1 25  ? 2.641   54.228 46.873  1.00 13.41 ? 24  GLN B NE2 1 
ATOM   1690 N  N   . CYS B 1 26  ? 4.081   54.850 40.952  1.00 16.07 ? 25  CYS B N   1 
ATOM   1691 C  CA  . CYS B 1 26  ? 4.656   55.500 39.786  1.00 15.56 ? 25  CYS B CA  1 
ATOM   1692 C  C   . CYS B 1 26  ? 4.065   56.884 39.518  1.00 16.79 ? 25  CYS B C   1 
ATOM   1693 O  O   . CYS B 1 26  ? 4.806   57.805 39.211  1.00 16.50 ? 25  CYS B O   1 
ATOM   1694 C  CB  . CYS B 1 26  ? 4.530   54.628 38.548  1.00 17.54 ? 25  CYS B CB  1 
ATOM   1695 S  SG  . CYS B 1 26  ? 5.848   53.386 38.496  1.00 19.27 ? 25  CYS B SG  1 
ATOM   1696 N  N   . GLU B 1 27  ? 2.755   57.046 39.660  1.00 18.45 ? 26  GLU B N   1 
ATOM   1697 C  CA  . GLU B 1 27  ? 2.141   58.368 39.442  1.00 19.50 ? 26  GLU B CA  1 
ATOM   1698 C  C   . GLU B 1 27  ? 2.578   59.399 40.468  1.00 19.56 ? 26  GLU B C   1 
ATOM   1699 O  O   . GLU B 1 27  ? 2.724   60.572 40.148  1.00 18.33 ? 26  GLU B O   1 
ATOM   1700 C  CB  . GLU B 1 27  ? 0.623   58.281 39.433  1.00 22.45 ? 26  GLU B CB  1 
ATOM   1701 C  CG  . GLU B 1 27  ? 0.035   57.335 38.407  1.00 26.43 ? 26  GLU B CG  1 
ATOM   1702 C  CD  . GLU B 1 27  ? 0.528   57.569 36.998  1.00 24.54 ? 26  GLU B CD  1 
ATOM   1703 O  OE1 . GLU B 1 27  ? 0.963   58.700 36.668  1.00 28.15 ? 26  GLU B OE1 1 
ATOM   1704 O  OE2 . GLU B 1 27  ? 0.479   56.602 36.204  1.00 23.71 ? 26  GLU B OE2 1 
ATOM   1705 N  N   . LYS B 1 28  ? 2.799   58.960 41.691  1.00 18.95 ? 27  LYS B N   1 
ATOM   1706 C  CA  . LYS B 1 28  ? 3.286   59.862 42.727  1.00 19.58 ? 27  LYS B CA  1 
ATOM   1707 C  C   . LYS B 1 28  ? 4.726   60.284 42.429  1.00 17.84 ? 27  LYS B C   1 
ATOM   1708 O  O   . LYS B 1 28  ? 5.091   61.441 42.689  1.00 14.36 ? 27  LYS B O   1 
ATOM   1709 C  CB  . LYS B 1 28  ? 3.153   59.215 44.101  1.00 19.79 ? 27  LYS B CB  1 
ATOM   1710 C  CG  . LYS B 1 28  ? 1.680   59.036 44.519  1.00 26.60 ? 27  LYS B CG  1 
ATOM   1711 C  CD  . LYS B 1 28  ? 1.494   58.751 46.008  1.00 21.33 ? 27  LYS B CD  1 
ATOM   1712 C  CE  . LYS B 1 28  ? 1.571   60.002 46.889  1.00 27.74 ? 27  LYS B CE  1 
ATOM   1713 N  NZ  . LYS B 1 28  ? 0.470   60.988 46.683  1.00 24.03 ? 27  LYS B NZ  1 
ATOM   1714 N  N   . ILE B 1 29  ? 5.527   59.368 41.865  1.00 14.86 ? 28  ILE B N   1 
ATOM   1715 C  CA  . ILE B 1 29  ? 6.876   59.694 41.436  1.00 13.75 ? 28  ILE B CA  1 
ATOM   1716 C  C   . ILE B 1 29  ? 6.834   60.720 40.293  1.00 18.07 ? 28  ILE B C   1 
ATOM   1717 O  O   . ILE B 1 29  ? 7.579   61.699 40.303  1.00 17.56 ? 28  ILE B O   1 
ATOM   1718 C  CB  . ILE B 1 29  ? 7.686   58.449 40.999  1.00 16.90 ? 28  ILE B CB  1 
ATOM   1719 C  CG1 . ILE B 1 29  ? 7.911   57.471 42.164  1.00 16.21 ? 28  ILE B CG1 1 
ATOM   1720 C  CG2 . ILE B 1 29  ? 9.058   58.837 40.423  1.00 18.57 ? 28  ILE B CG2 1 
ATOM   1721 C  CD1 . ILE B 1 29  ? 8.328   56.094 41.689  1.00 18.93 ? 28  ILE B CD1 1 
ATOM   1722 N  N   . VAL B 1 30  ? 5.928   60.533 39.343  1.00 18.57 ? 29  VAL B N   1 
ATOM   1723 C  CA  . VAL B 1 30  ? 5.803   61.456 38.213  1.00 17.65 ? 29  VAL B CA  1 
ATOM   1724 C  C   . VAL B 1 30  ? 5.468   62.865 38.704  1.00 18.82 ? 29  VAL B C   1 
ATOM   1725 O  O   . VAL B 1 30  ? 6.086   63.854 38.301  1.00 18.35 ? 29  VAL B O   1 
ATOM   1726 C  CB  . VAL B 1 30  ? 4.725   60.977 37.231  1.00 18.97 ? 29  VAL B CB  1 
ATOM   1727 C  CG1 . VAL B 1 30  ? 4.461   62.016 36.147  1.00 18.35 ? 29  VAL B CG1 1 
ATOM   1728 C  CG2 . VAL B 1 30  ? 5.163   59.627 36.571  1.00 16.59 ? 29  VAL B CG2 1 
ATOM   1729 N  N   . GLN B 1 31  ? 4.492   62.931 39.595  1.00 18.75 ? 30  GLN B N   1 
ATOM   1730 C  CA  . GLN B 1 31  ? 4.052   64.180 40.188  1.00 20.65 ? 30  GLN B CA  1 
ATOM   1731 C  C   . GLN B 1 31  ? 5.174   64.899 40.951  1.00 20.88 ? 30  GLN B C   1 
ATOM   1732 O  O   . GLN B 1 31  ? 5.338   66.114 40.813  1.00 19.09 ? 30  GLN B O   1 
ATOM   1733 C  CB  . GLN B 1 31  ? 2.862   63.891 41.104  1.00 22.16 ? 30  GLN B CB  1 
ATOM   1734 C  CG  . GLN B 1 31  ? 1.593   63.479 40.328  1.00 23.39 ? 30  GLN B CG  1 
ATOM   1735 C  CD  . GLN B 1 31  ? 0.582   62.722 41.175  1.00 29.74 ? 30  GLN B CD  1 
ATOM   1736 O  OE1 . GLN B 1 31  ? 0.719   62.617 42.407  1.00 23.32 ? 30  GLN B OE1 1 
ATOM   1737 N  NE2 . GLN B 1 31  ? -0.456  62.205 40.523  1.00 23.60 ? 30  GLN B NE2 1 
ATOM   1738 N  N   . LYS B 1 32  ? 5.962   64.161 41.728  1.00 19.95 ? 31  LYS B N   1 
ATOM   1739 C  CA  . LYS B 1 32  ? 7.037   64.790 42.528  1.00 20.02 ? 31  LYS B CA  1 
ATOM   1740 C  C   . LYS B 1 32  ? 8.316   65.070 41.728  1.00 20.50 ? 31  LYS B C   1 
ATOM   1741 O  O   . LYS B 1 32  ? 8.911   66.140 41.891  1.00 19.16 ? 31  LYS B O   1 
ATOM   1742 C  CB  . LYS B 1 32  ? 7.387   63.912 43.737  1.00 20.42 ? 31  LYS B CB  1 
ATOM   1743 C  CG  . LYS B 1 32  ? 8.488   64.460 44.630  1.00 22.06 ? 31  LYS B CG  1 
ATOM   1744 C  CD  . LYS B 1 32  ? 8.421   63.843 46.035  1.00 21.77 ? 31  LYS B CD  1 
ATOM   1745 C  CE  . LYS B 1 32  ? 9.628   64.205 46.902  1.00 28.18 ? 31  LYS B CE  1 
ATOM   1746 N  NZ  . LYS B 1 32  ? 9.629   63.421 48.185  1.00 21.66 ? 31  LYS B NZ  1 
ATOM   1747 N  N   . TYR B 1 33  ? 8.739   64.111 40.892  1.00 18.94 ? 32  TYR B N   1 
ATOM   1748 C  CA  . TYR B 1 33  ? 10.061  64.141 40.236  1.00 20.14 ? 32  TYR B CA  1 
ATOM   1749 C  C   . TYR B 1 33  ? 10.059  64.428 38.737  1.00 20.42 ? 32  TYR B C   1 
ATOM   1750 O  O   . TYR B 1 33  ? 11.121  64.660 38.158  1.00 18.93 ? 32  TYR B O   1 
ATOM   1751 C  CB  . TYR B 1 33  ? 10.797  62.812 40.450  1.00 20.36 ? 32  TYR B CB  1 
ATOM   1752 C  CG  . TYR B 1 33  ? 11.127  62.526 41.896  1.00 24.22 ? 32  TYR B CG  1 
ATOM   1753 C  CD1 . TYR B 1 33  ? 10.272  61.760 42.684  1.00 17.92 ? 32  TYR B CD1 1 
ATOM   1754 C  CD2 . TYR B 1 33  ? 12.298  63.019 42.475  1.00 25.69 ? 32  TYR B CD2 1 
ATOM   1755 C  CE1 . TYR B 1 33  ? 10.568  61.493 44.010  1.00 21.14 ? 32  TYR B CE1 1 
ATOM   1756 C  CE2 . TYR B 1 33  ? 12.603  62.754 43.809  1.00 25.01 ? 32  TYR B CE2 1 
ATOM   1757 C  CZ  . TYR B 1 33  ? 11.741  61.987 44.565  1.00 23.30 ? 32  TYR B CZ  1 
ATOM   1758 O  OH  . TYR B 1 33  ? 12.034  61.723 45.881  1.00 23.78 ? 32  TYR B OH  1 
ATOM   1759 N  N   . GLY B 1 34  ? 8.890   64.372 38.102  1.00 20.29 ? 33  GLY B N   1 
ATOM   1760 C  CA  . GLY B 1 34  ? 8.753   64.660 36.675  1.00 19.55 ? 33  GLY B CA  1 
ATOM   1761 C  C   . GLY B 1 34  ? 9.269   63.589 35.723  1.00 19.89 ? 33  GLY B C   1 
ATOM   1762 O  O   . GLY B 1 34  ? 9.597   63.888 34.568  1.00 20.05 ? 33  GLY B O   1 
ATOM   1763 N  N   . TYR B 1 35  ? 9.352   62.344 36.186  1.00 19.72 ? 34  TYR B N   1 
ATOM   1764 C  CA  . TYR B 1 35  ? 9.778   61.233 35.327  1.00 21.14 ? 34  TYR B CA  1 
ATOM   1765 C  C   . TYR B 1 35  ? 8.633   60.822 34.385  1.00 20.93 ? 34  TYR B C   1 
ATOM   1766 O  O   . TYR B 1 35  ? 7.508   61.323 34.515  1.00 20.14 ? 34  TYR B O   1 
ATOM   1767 C  CB  . TYR B 1 35  ? 10.276  60.029 36.153  1.00 22.35 ? 34  TYR B CB  1 
ATOM   1768 C  CG  . TYR B 1 35  ? 11.753  60.105 36.521  1.00 28.64 ? 34  TYR B CG  1 
ATOM   1769 C  CD1 . TYR B 1 35  ? 12.334  61.306 36.959  1.00 33.74 ? 34  TYR B CD1 1 
ATOM   1770 C  CD2 . TYR B 1 35  ? 12.583  58.974 36.431  1.00 33.68 ? 34  TYR B CD2 1 
ATOM   1771 C  CE1 . TYR B 1 35  ? 13.706  61.387 37.277  1.00 31.76 ? 34  TYR B CE1 1 
ATOM   1772 C  CE2 . TYR B 1 35  ? 13.950  59.045 36.763  1.00 30.95 ? 34  TYR B CE2 1 
ATOM   1773 C  CZ  . TYR B 1 35  ? 14.504  60.253 37.182  1.00 34.74 ? 34  TYR B CZ  1 
ATOM   1774 O  OH  . TYR B 1 35  ? 15.861  60.333 37.493  1.00 36.16 ? 34  TYR B OH  1 
ATOM   1775 N  N   . THR B 1 36  ? 8.961   59.943 33.435  1.00 16.12 ? 35  THR B N   1 
ATOM   1776 C  CA  . THR B 1 36  ? 8.053   59.423 32.414  1.00 16.75 ? 35  THR B CA  1 
ATOM   1777 C  C   . THR B 1 36  ? 7.692   58.019 32.822  1.00 16.69 ? 35  THR B C   1 
ATOM   1778 O  O   . THR B 1 36  ? 8.582   57.204 32.998  1.00 19.69 ? 35  THR B O   1 
ATOM   1779 C  CB  . THR B 1 36  ? 8.754   59.340 31.030  1.00 16.65 ? 35  THR B CB  1 
ATOM   1780 O  OG1 . THR B 1 36  ? 9.208   60.643 30.668  1.00 18.39 ? 35  THR B OG1 1 
ATOM   1781 C  CG2 . THR B 1 36  ? 7.815   58.808 29.932  1.00 16.26 ? 35  THR B CG2 1 
ATOM   1782 N  N   . HIS B 1 37  ? 6.401   57.730 32.971  1.00 14.85 ? 36  HIS B N   1 
ATOM   1783 C  CA  . HIS B 1 37  ? 5.962   56.411 33.404  1.00 14.83 ? 36  HIS B CA  1 
ATOM   1784 C  C   . HIS B 1 37  ? 5.490   55.639 32.206  1.00 17.01 ? 36  HIS B C   1 
ATOM   1785 O  O   . HIS B 1 37  ? 4.591   56.117 31.506  1.00 15.71 ? 36  HIS B O   1 
ATOM   1786 C  CB  . HIS B 1 37  ? 4.820   56.560 34.420  1.00 15.82 ? 36  HIS B CB  1 
ATOM   1787 C  CG  . HIS B 1 37  ? 4.186   55.272 34.831  1.00 19.25 ? 36  HIS B CG  1 
ATOM   1788 N  ND1 . HIS B 1 37  ? 2.821   55.122 34.947  1.00 19.61 ? 36  HIS B ND1 1 
ATOM   1789 C  CD2 . HIS B 1 37  ? 4.720   54.075 35.151  1.00 21.05 ? 36  HIS B CD2 1 
ATOM   1790 C  CE1 . HIS B 1 37  ? 2.543   53.883 35.300  1.00 14.67 ? 36  HIS B CE1 1 
ATOM   1791 N  NE2 . HIS B 1 37  ? 3.678   53.236 35.461  1.00 20.14 ? 36  HIS B NE2 1 
ATOM   1792 N  N   . LEU B 1 38  ? 6.059   54.433 32.006  1.00 18.64 ? 37  LEU B N   1 
ATOM   1793 C  CA  . LEU B 1 38  ? 5.641   53.516 30.956  1.00 17.44 ? 37  LEU B CA  1 
ATOM   1794 C  C   . LEU B 1 38  ? 5.251   52.189 31.569  1.00 18.17 ? 37  LEU B C   1 
ATOM   1795 O  O   . LEU B 1 38  ? 6.067   51.537 32.164  1.00 17.65 ? 37  LEU B O   1 
ATOM   1796 C  CB  . LEU B 1 38  ? 6.766   53.311 29.940  1.00 17.58 ? 37  LEU B CB  1 
ATOM   1797 C  CG  . LEU B 1 38  ? 7.166   54.551 29.134  1.00 21.99 ? 37  LEU B CG  1 
ATOM   1798 C  CD1 . LEU B 1 38  ? 8.349   54.215 28.219  1.00 19.50 ? 37  LEU B CD1 1 
ATOM   1799 C  CD2 . LEU B 1 38  ? 5.985   55.079 28.347  1.00 19.72 ? 37  LEU B CD2 1 
ATOM   1800 N  N   . SER B 1 39  ? 3.983   51.823 31.434  1.00 17.73 ? 38  SER B N   1 
ATOM   1801 C  CA  . SER B 1 39  ? 3.463   50.523 31.867  1.00 16.95 ? 38  SER B CA  1 
ATOM   1802 C  C   . SER B 1 39  ? 3.229   49.607 30.676  1.00 17.63 ? 38  SER B C   1 
ATOM   1803 O  O   . SER B 1 39  ? 2.408   49.903 29.804  1.00 17.54 ? 38  SER B O   1 
ATOM   1804 C  CB  . SER B 1 39  ? 2.160   50.724 32.636  1.00 17.91 ? 38  SER B CB  1 
ATOM   1805 O  OG  . SER B 1 39  ? 1.475   49.507 32.839  1.00 20.79 ? 38  SER B OG  1 
ATOM   1806 N  N   . THR B 1 40  ? 3.946   48.488 30.611  1.00 15.97 ? 39  THR B N   1 
ATOM   1807 C  CA  . THR B 1 40  ? 3.724   47.553 29.512  1.00 17.25 ? 39  THR B CA  1 
ATOM   1808 C  C   . THR B 1 40  ? 2.298   47.016 29.478  1.00 17.54 ? 39  THR B C   1 
ATOM   1809 O  O   . THR B 1 40  ? 1.758   46.826 28.413  1.00 15.42 ? 39  THR B O   1 
ATOM   1810 C  CB  . THR B 1 40  ? 4.751   46.380 29.472  1.00 15.78 ? 39  THR B CB  1 
ATOM   1811 O  OG1 . THR B 1 40  ? 4.999   45.871 30.778  1.00 16.96 ? 39  THR B OG1 1 
ATOM   1812 C  CG2 . THR B 1 40  ? 6.041   46.847 28.867  1.00 20.53 ? 39  THR B CG2 1 
ATOM   1813 N  N   . GLY B 1 41  ? 1.682   46.812 30.646  1.00 17.33 ? 40  GLY B N   1 
ATOM   1814 C  CA  . GLY B 1 41  ? 0.260   46.434 30.727  1.00 16.81 ? 40  GLY B CA  1 
ATOM   1815 C  C   . GLY B 1 41  ? -0.660  47.449 30.080  1.00 14.65 ? 40  GLY B C   1 
ATOM   1816 O  O   . GLY B 1 41  ? -1.528  47.093 29.296  1.00 15.93 ? 40  GLY B O   1 
ATOM   1817 N  N   . ASP B 1 42  ? -0.476  48.733 30.400  1.00 15.37 ? 41  ASP B N   1 
ATOM   1818 C  CA  . ASP B 1 42  ? -1.234  49.799 29.715  1.00 17.14 ? 41  ASP B CA  1 
ATOM   1819 C  C   . ASP B 1 42  ? -1.073  49.826 28.193  1.00 17.95 ? 41  ASP B C   1 
ATOM   1820 O  O   . ASP B 1 42  ? -2.064  49.946 27.436  1.00 18.20 ? 41  ASP B O   1 
ATOM   1821 C  CB  . ASP B 1 42  ? -0.841  51.161 30.279  1.00 18.52 ? 41  ASP B CB  1 
ATOM   1822 C  CG  . ASP B 1 42  ? -1.260  51.332 31.711  1.00 26.34 ? 41  ASP B CG  1 
ATOM   1823 O  OD1 . ASP B 1 42  ? -2.300  50.741 32.110  1.00 31.58 ? 41  ASP B OD1 1 
ATOM   1824 O  OD2 . ASP B 1 42  ? -0.554  52.053 32.459  1.00 39.20 ? 41  ASP B OD2 1 
ATOM   1825 N  N   . LEU B 1 43  ? 0.178   49.740 27.743  1.00 15.53 ? 42  LEU B N   1 
ATOM   1826 C  CA  . LEU B 1 43  ? 0.501   49.604 26.339  1.00 15.12 ? 42  LEU B CA  1 
ATOM   1827 C  C   . LEU B 1 43  ? -0.226  48.479 25.674  1.00 16.85 ? 42  LEU B C   1 
ATOM   1828 O  O   . LEU B 1 43  ? -0.823  48.654 24.613  1.00 19.39 ? 42  LEU B O   1 
ATOM   1829 C  CB  . LEU B 1 43  ? 2.014   49.447 26.125  1.00 17.10 ? 42  LEU B CB  1 
ATOM   1830 C  CG  . LEU B 1 43  ? 2.824   50.700 26.472  1.00 20.67 ? 42  LEU B CG  1 
ATOM   1831 C  CD1 . LEU B 1 43  ? 4.332   50.392 26.466  1.00 26.95 ? 42  LEU B CD1 1 
ATOM   1832 C  CD2 . LEU B 1 43  ? 2.513   51.855 25.534  1.00 28.85 ? 42  LEU B CD2 1 
ATOM   1833 N  N   . LEU B 1 44  ? -0.177  47.302 26.279  1.00 15.95 ? 43  LEU B N   1 
ATOM   1834 C  CA  . LEU B 1 44  ? -0.843  46.128 25.715  1.00 17.08 ? 43  LEU B CA  1 
ATOM   1835 C  C   . LEU B 1 44  ? -2.373  46.250 25.679  1.00 17.67 ? 43  LEU B C   1 
ATOM   1836 O  O   . LEU B 1 44  ? -3.005  45.894 24.690  1.00 16.96 ? 43  LEU B O   1 
ATOM   1837 C  CB  . LEU B 1 44  ? -0.436  44.886 26.491  1.00 16.61 ? 43  LEU B CB  1 
ATOM   1838 C  CG  . LEU B 1 44  ? 1.016   44.412 26.407  1.00 18.31 ? 43  LEU B CG  1 
ATOM   1839 C  CD1 . LEU B 1 44  ? 1.316   43.347 27.470  1.00 20.66 ? 43  LEU B CD1 1 
ATOM   1840 C  CD2 . LEU B 1 44  ? 1.294   43.884 25.030  1.00 20.16 ? 43  LEU B CD2 1 
ATOM   1841 N  N   . ARG B 1 45  ? -2.959  46.757 26.760  1.00 17.55 ? 44  ARG B N   1 
ATOM   1842 C  CA  . ARG B 1 45  ? -4.390  47.030 26.811  1.00 19.09 ? 44  ARG B CA  1 
ATOM   1843 C  C   . ARG B 1 45  ? -4.830  48.107 25.787  1.00 18.93 ? 44  ARG B C   1 
ATOM   1844 O  O   . ARG B 1 45  ? -5.934  48.032 25.244  1.00 20.04 ? 44  ARG B O   1 
ATOM   1845 C  CB  . ARG B 1 45  ? -4.799  47.413 28.246  1.00 18.45 ? 44  ARG B CB  1 
ATOM   1846 C  CG  . ARG B 1 45  ? -4.749  46.208 29.198  1.00 21.59 ? 44  ARG B CG  1 
ATOM   1847 C  CD  . ARG B 1 45  ? -5.340  46.518 30.558  1.00 20.62 ? 44  ARG B CD  1 
ATOM   1848 N  NE  . ARG B 1 45  ? -4.590  47.526 31.286  1.00 17.55 ? 44  ARG B NE  1 
ATOM   1849 C  CZ  . ARG B 1 45  ? -3.565  47.284 32.088  1.00 22.11 ? 44  ARG B CZ  1 
ATOM   1850 N  NH1 . ARG B 1 45  ? -3.125  46.047 32.306  1.00 20.67 ? 44  ARG B NH1 1 
ATOM   1851 N  NH2 . ARG B 1 45  ? -2.972  48.301 32.675  1.00 18.63 ? 44  ARG B NH2 1 
ATOM   1852 N  N   . SER B 1 46  ? -3.990  49.106 25.517  1.00 18.97 ? 45  SER B N   1 
ATOM   1853 C  CA  . SER B 1 46  ? -4.268  50.035 24.404  1.00 21.80 ? 45  SER B CA  1 
ATOM   1854 C  C   . SER B 1 46  ? -4.402  49.287 23.069  1.00 21.73 ? 45  SER B C   1 
ATOM   1855 O  O   . SER B 1 46  ? -5.310  49.572 22.251  1.00 21.24 ? 45  SER B O   1 
ATOM   1856 C  CB  . SER B 1 46  ? -3.180  51.087 24.276  1.00 25.03 ? 45  SER B CB  1 
ATOM   1857 O  OG  . SER B 1 46  ? -3.237  51.976 25.357  1.00 27.76 ? 45  SER B OG  1 
ATOM   1858 N  N   . GLU B 1 47  ? -3.516  48.322 22.840  1.00 19.83 ? 46  GLU B N   1 
ATOM   1859 C  CA  . GLU B 1 47  ? -3.563  47.544 21.614  1.00 20.13 ? 46  GLU B CA  1 
ATOM   1860 C  C   . GLU B 1 47  ? -4.848  46.749 21.585  1.00 19.15 ? 46  GLU B C   1 
ATOM   1861 O  O   . GLU B 1 47  ? -5.507  46.634 20.548  1.00 22.60 ? 46  GLU B O   1 
ATOM   1862 C  CB  . GLU B 1 47  ? -2.364  46.594 21.496  1.00 22.19 ? 46  GLU B CB  1 
ATOM   1863 C  CG  . GLU B 1 47  ? -2.373  45.714 20.204  1.00 24.09 ? 46  GLU B CG  1 
ATOM   1864 C  CD  . GLU B 1 47  ? -2.198  46.552 18.925  1.00 34.45 ? 46  GLU B CD  1 
ATOM   1865 O  OE1 . GLU B 1 47  ? -1.515  47.604 18.995  1.00 28.38 ? 46  GLU B OE1 1 
ATOM   1866 O  OE2 . GLU B 1 47  ? -2.741  46.156 17.862  1.00 34.23 ? 46  GLU B OE2 1 
ATOM   1867 N  N   . VAL B 1 48  ? -5.202  46.154 22.709  1.00 20.40 ? 47  VAL B N   1 
ATOM   1868 C  CA  . VAL B 1 48  ? -6.436  45.375 22.747  1.00 20.82 ? 47  VAL B CA  1 
ATOM   1869 C  C   . VAL B 1 48  ? -7.633  46.262 22.373  1.00 23.50 ? 47  VAL B C   1 
ATOM   1870 O  O   . VAL B 1 48  ? -8.490  45.833 21.596  1.00 23.65 ? 47  VAL B O   1 
ATOM   1871 C  CB  . VAL B 1 48  ? -6.666  44.687 24.097  1.00 21.36 ? 47  VAL B CB  1 
ATOM   1872 C  CG1 . VAL B 1 48  ? -8.025  43.967 24.120  1.00 24.48 ? 47  VAL B CG1 1 
ATOM   1873 C  CG2 . VAL B 1 48  ? -5.566  43.732 24.360  1.00 17.33 ? 47  VAL B CG2 1 
ATOM   1874 N  N   . SER B 1 49  ? -7.663  47.501 22.883  1.00 20.49 ? 48  SER B N   1 
ATOM   1875 C  CA  . SER B 1 49  ? -8.812  48.373 22.666  1.00 23.27 ? 48  SER B CA  1 
ATOM   1876 C  C   . SER B 1 49  ? -8.932  48.835 21.195  1.00 23.55 ? 48  SER B C   1 
ATOM   1877 O  O   . SER B 1 49  ? -9.998  49.257 20.762  1.00 23.51 ? 48  SER B O   1 
ATOM   1878 C  CB  . SER B 1 49  ? -8.719  49.596 23.586  1.00 25.37 ? 48  SER B CB  1 
ATOM   1879 O  OG  . SER B 1 49  ? -7.742  50.482 23.071  1.00 27.71 ? 48  SER B OG  1 
ATOM   1880 N  N   . SER B 1 50  ? -7.844  48.761 20.431  1.00 22.75 ? 49  SER B N   1 
ATOM   1881 C  CA  . SER B 1 50  ? -7.886  49.056 18.981  1.00 23.84 ? 49  SER B CA  1 
ATOM   1882 C  C   . SER B 1 50  ? -8.790  48.111 18.184  1.00 24.38 ? 49  SER B C   1 
ATOM   1883 O  O   . SER B 1 50  ? -9.141  48.405 17.038  1.00 25.88 ? 49  SER B O   1 
ATOM   1884 C  CB  . SER B 1 50  ? -6.485  48.916 18.385  1.00 26.44 ? 49  SER B CB  1 
ATOM   1885 O  OG  . SER B 1 50  ? -6.178  47.527 18.184  1.00 23.93 ? 49  SER B OG  1 
ATOM   1886 N  N   . GLY B 1 51  ? -9.114  46.954 18.755  1.00 24.10 ? 50  GLY B N   1 
ATOM   1887 C  CA  . GLY B 1 51  ? -9.895  45.941 18.046  1.00 24.34 ? 50  GLY B CA  1 
ATOM   1888 C  C   . GLY B 1 51  ? -9.127  45.066 17.064  1.00 24.18 ? 50  GLY B C   1 
ATOM   1889 O  O   . GLY B 1 51  ? -9.727  44.313 16.328  1.00 25.04 ? 50  GLY B O   1 
ATOM   1890 N  N   . SER B 1 52  ? -7.799  45.131 17.084  1.00 24.32 ? 51  SER B N   1 
ATOM   1891 C  CA  . SER B 1 52  ? -6.960  44.392 16.141  1.00 21.11 ? 51  SER B CA  1 
ATOM   1892 C  C   . SER B 1 52  ? -6.949  42.886 16.436  1.00 20.85 ? 51  SER B C   1 
ATOM   1893 O  O   . SER B 1 52  ? -7.231  42.471 17.570  1.00 17.35 ? 51  SER B O   1 
ATOM   1894 C  CB  . SER B 1 52  ? -5.540  44.938 16.208  1.00 22.34 ? 51  SER B CB  1 
ATOM   1895 O  OG  . SER B 1 52  ? -4.964  44.742 17.512  1.00 17.26 ? 51  SER B OG  1 
ATOM   1896 N  N   . ALA B 1 53  ? -6.644  42.075 15.416  1.00 18.92 ? 52  ALA B N   1 
ATOM   1897 C  CA  . ALA B 1 53  ? -6.468  40.633 15.602  1.00 20.76 ? 52  ALA B CA  1 
ATOM   1898 C  C   . ALA B 1 53  ? -5.307  40.352 16.534  1.00 21.62 ? 52  ALA B C   1 
ATOM   1899 O  O   . ALA B 1 53  ? -5.367  39.414 17.326  1.00 21.11 ? 52  ALA B O   1 
ATOM   1900 C  CB  . ALA B 1 53  ? -6.244  39.933 14.291  1.00 22.40 ? 52  ALA B CB  1 
ATOM   1901 N  N   . ARG B 1 54  ? -4.239  41.147 16.428  1.00 22.75 ? 53  ARG B N   1 
ATOM   1902 C  CA  . ARG B 1 54  ? -3.159  41.090 17.402  1.00 23.93 ? 53  ARG B CA  1 
ATOM   1903 C  C   . ARG B 1 54  ? -3.705  41.273 18.819  1.00 21.82 ? 53  ARG B C   1 
ATOM   1904 O  O   . ARG B 1 54  ? -3.362  40.512 19.719  1.00 22.49 ? 53  ARG B O   1 
ATOM   1905 C  CB  . ARG B 1 54  ? -2.103  42.164 17.148  1.00 23.33 ? 53  ARG B CB  1 
ATOM   1906 C  CG  . ARG B 1 54  ? -1.148  42.339 18.329  1.00 31.40 ? 53  ARG B CG  1 
ATOM   1907 C  CD  . ARG B 1 54  ? -0.131  43.438 18.105  1.00 42.09 ? 53  ARG B CD  1 
ATOM   1908 N  NE  . ARG B 1 54  ? 1.035   42.934 17.391  1.00 42.55 ? 53  ARG B NE  1 
ATOM   1909 C  CZ  . ARG B 1 54  ? 1.495   43.403 16.234  1.00 51.25 ? 53  ARG B CZ  1 
ATOM   1910 N  NH1 . ARG B 1 54  ? 0.913   44.429 15.623  1.00 55.04 ? 53  ARG B NH1 1 
ATOM   1911 N  NH2 . ARG B 1 54  ? 2.567   42.841 15.687  1.00 58.09 ? 53  ARG B NH2 1 
ATOM   1912 N  N   . GLY B 1 55  ? -4.535  42.294 18.999  1.00 19.18 ? 54  GLY B N   1 
ATOM   1913 C  CA  . GLY B 1 55  ? -5.145  42.597 20.291  1.00 20.23 ? 54  GLY B CA  1 
ATOM   1914 C  C   . GLY B 1 55  ? -5.987  41.457 20.839  1.00 19.28 ? 54  GLY B C   1 
ATOM   1915 O  O   . GLY B 1 55  ? -5.919  41.135 22.028  1.00 19.21 ? 54  GLY B O   1 
ATOM   1916 N  N   . LYS B 1 56  ? -6.789  40.831 19.991  1.00 18.71 ? 55  LYS B N   1 
ATOM   1917 C  CA  . LYS B 1 56  ? -7.548  39.621 20.420  1.00 20.28 ? 55  LYS B CA  1 
ATOM   1918 C  C   . LYS B 1 56  ? -6.638  38.532 20.989  1.00 19.19 ? 55  LYS B C   1 
ATOM   1919 O  O   . LYS B 1 56  ? -6.927  37.971 22.042  1.00 21.21 ? 55  LYS B O   1 
ATOM   1920 C  CB  . LYS B 1 56  ? -8.392  39.035 19.272  1.00 21.77 ? 55  LYS B CB  1 
ATOM   1921 C  CG  . LYS B 1 56  ? -9.709  39.713 19.033  1.00 25.77 ? 55  LYS B CG  1 
ATOM   1922 N  N   . LYS B 1 57  ? -5.547  38.224 20.296  1.00 18.96 ? 56  LYS B N   1 
ATOM   1923 C  CA  . LYS B 1 57  ? -4.584  37.223 20.778  1.00 19.16 ? 56  LYS B CA  1 
ATOM   1924 C  C   . LYS B 1 57  ? -3.894  37.649 22.076  1.00 19.32 ? 56  LYS B C   1 
ATOM   1925 O  O   . LYS B 1 57  ? -3.767  36.852 22.990  1.00 18.28 ? 56  LYS B O   1 
ATOM   1926 C  CB  . LYS B 1 57  ? -3.534  36.909 19.720  1.00 19.91 ? 56  LYS B CB  1 
ATOM   1927 C  CG  . LYS B 1 57  ? -4.104  36.517 18.391  1.00 23.42 ? 56  LYS B CG  1 
ATOM   1928 N  N   . LEU B 1 58  ? -3.467  38.912 22.159  1.00 18.09 ? 57  LEU B N   1 
ATOM   1929 C  CA  . LEU B 1 58  ? -2.887  39.424 23.383  1.00 17.67 ? 57  LEU B CA  1 
ATOM   1930 C  C   . LEU B 1 58  ? -3.884  39.301 24.544  1.00 17.37 ? 57  LEU B C   1 
ATOM   1931 O  O   . LEU B 1 58  ? -3.493  38.901 25.634  1.00 19.56 ? 57  LEU B O   1 
ATOM   1932 C  CB  . LEU B 1 58  ? -2.431  40.877 23.203  1.00 19.89 ? 57  LEU B CB  1 
ATOM   1933 C  CG  . LEU B 1 58  ? -1.256  41.105 22.243  1.00 19.11 ? 57  LEU B CG  1 
ATOM   1934 C  CD1 . LEU B 1 58  ? -1.014  42.625 22.107  1.00 27.66 ? 57  LEU B CD1 1 
ATOM   1935 C  CD2 . LEU B 1 58  ? 0.016   40.378 22.693  1.00 23.43 ? 57  LEU B CD2 1 
ATOM   1936 N  N   . SER B 1 59  ? -5.164  39.597 24.310  1.00 17.66 ? 58  SER B N   1 
ATOM   1937 C  CA  . SER B 1 59  ? -6.162  39.528 25.378  1.00 17.64 ? 58  SER B CA  1 
ATOM   1938 C  C   . SER B 1 59  ? -6.291  38.116 25.926  1.00 19.23 ? 58  SER B C   1 
ATOM   1939 O  O   . SER B 1 59  ? -6.377  37.939 27.147  1.00 18.07 ? 58  SER B O   1 
ATOM   1940 C  CB  . SER B 1 59  ? -7.538  40.038 24.942  1.00 21.36 ? 58  SER B CB  1 
ATOM   1941 O  OG  . SER B 1 59  ? -8.319  40.403 26.078  1.00 24.92 ? 58  SER B OG  1 
ATOM   1942 N  N   . GLU B 1 60  ? -6.294  37.119 25.039  1.00 17.16 ? 59  GLU B N   1 
ATOM   1943 C  CA  . GLU B 1 60  ? -6.420  35.711 25.468  1.00 21.20 ? 59  GLU B CA  1 
ATOM   1944 C  C   . GLU B 1 60  ? -5.285  35.276 26.360  1.00 20.51 ? 59  GLU B C   1 
ATOM   1945 O  O   . GLU B 1 60  ? -5.475  34.429 27.244  1.00 18.08 ? 59  GLU B O   1 
ATOM   1946 C  CB  . GLU B 1 60  ? -6.454  34.761 24.264  1.00 21.01 ? 59  GLU B CB  1 
ATOM   1947 C  CG  . GLU B 1 60  ? -7.758  34.816 23.500  1.00 25.46 ? 59  GLU B CG  1 
ATOM   1948 C  CD  . GLU B 1 60  ? -7.822  33.839 22.327  1.00 30.53 ? 59  GLU B CD  1 
ATOM   1949 O  OE1 . GLU B 1 60  ? -7.120  32.785 22.356  1.00 42.97 ? 59  GLU B OE1 1 
ATOM   1950 O  OE2 . GLU B 1 60  ? -8.593  34.130 21.375  1.00 36.37 ? 59  GLU B OE2 1 
ATOM   1951 N  N   . ILE B 1 61  ? -4.105  35.845 26.139  1.00 19.42 ? 60  ILE B N   1 
ATOM   1952 C  CA  . ILE B 1 61  ? -2.935  35.521 26.946  1.00 19.70 ? 60  ILE B CA  1 
ATOM   1953 C  C   . ILE B 1 61  ? -2.963  36.263 28.278  1.00 17.41 ? 60  ILE B C   1 
ATOM   1954 O  O   . ILE B 1 61  ? -2.546  35.729 29.306  1.00 19.86 ? 60  ILE B O   1 
ATOM   1955 C  CB  . ILE B 1 61  ? -1.641  35.857 26.181  1.00 20.39 ? 60  ILE B CB  1 
ATOM   1956 C  CG1 . ILE B 1 61  ? -1.577  35.070 24.870  1.00 21.23 ? 60  ILE B CG1 1 
ATOM   1957 C  CG2 . ILE B 1 61  ? -0.422  35.567 27.042  1.00 21.65 ? 60  ILE B CG2 1 
ATOM   1958 C  CD1 . ILE B 1 61  ? -0.499  35.549 23.923  1.00 25.54 ? 60  ILE B CD1 1 
ATOM   1959 N  N   . MET B 1 62  ? -3.457  37.496 28.253  1.00 18.71 ? 61  MET B N   1 
ATOM   1960 C  CA  . MET B 1 62  ? -3.609  38.286 29.469  1.00 20.02 ? 61  MET B CA  1 
ATOM   1961 C  C   . MET B 1 62  ? -4.728  37.737 30.347  1.00 18.75 ? 61  MET B C   1 
ATOM   1962 O  O   . MET B 1 62  ? -4.694  37.872 31.570  1.00 18.18 ? 61  MET B O   1 
ATOM   1963 C  CB  . MET B 1 62  ? -3.882  39.752 29.125  1.00 19.03 ? 61  MET B CB  1 
ATOM   1964 C  CG  . MET B 1 62  ? -2.643  40.536 28.724  1.00 21.10 ? 61  MET B CG  1 
ATOM   1965 S  SD  . MET B 1 62  ? -2.996  42.272 28.390  1.00 34.60 ? 61  MET B SD  1 
ATOM   1966 C  CE  . MET B 1 62  ? -3.395  42.207 26.645  1.00 20.63 ? 61  MET B CE  1 
ATOM   1967 N  N   . GLU B 1 63  ? -5.719  37.116 29.715  1.00 19.10 ? 62  GLU B N   1 
ATOM   1968 C  CA  . GLU B 1 63  ? -6.806  36.444 30.451  1.00 18.16 ? 62  GLU B CA  1 
ATOM   1969 C  C   . GLU B 1 63  ? -6.399  35.116 31.109  1.00 19.03 ? 62  GLU B C   1 
ATOM   1970 O  O   . GLU B 1 63  ? -7.051  34.706 32.047  1.00 20.80 ? 62  GLU B O   1 
ATOM   1971 C  CB  . GLU B 1 63  ? -8.032  36.290 29.563  1.00 19.35 ? 62  GLU B CB  1 
ATOM   1972 C  CG  . GLU B 1 63  ? -8.691  37.666 29.357  1.00 20.54 ? 62  GLU B CG  1 
ATOM   1973 C  CD  . GLU B 1 63  ? -9.960  37.648 28.506  1.00 33.16 ? 62  GLU B CD  1 
ATOM   1974 O  OE1 . GLU B 1 63  ? -11.039 37.181 28.984  1.00 31.66 ? 62  GLU B OE1 1 
ATOM   1975 O  OE2 . GLU B 1 63  ? -9.888  38.183 27.377  1.00 34.18 ? 62  GLU B OE2 1 
ATOM   1976 N  N   . LYS B 1 64  ? -5.310  34.497 30.651  1.00 19.10 ? 63  LYS B N   1 
ATOM   1977 C  CA  . LYS B 1 64  ? -4.703  33.311 31.300  1.00 18.89 ? 63  LYS B CA  1 
ATOM   1978 C  C   . LYS B 1 64  ? -3.606  33.650 32.310  1.00 21.22 ? 63  LYS B C   1 
ATOM   1979 O  O   . LYS B 1 64  ? -2.952  32.751 32.834  1.00 21.77 ? 63  LYS B O   1 
ATOM   1980 C  CB  . LYS B 1 64  ? -4.084  32.378 30.255  1.00 19.36 ? 63  LYS B CB  1 
ATOM   1981 C  CG  . LYS B 1 64  ? -5.062  31.865 29.235  1.00 25.04 ? 63  LYS B CG  1 
ATOM   1982 C  CD  . LYS B 1 64  ? -4.416  31.541 27.859  1.00 27.81 ? 63  LYS B CD  1 
ATOM   1983 C  CE  . LYS B 1 64  ? -4.159  30.055 27.685  1.00 27.25 ? 63  LYS B CE  1 
ATOM   1984 N  NZ  . LYS B 1 64  ? -4.474  29.636 26.288  1.00 35.29 ? 63  LYS B NZ  1 
ATOM   1985 N  N   . GLY B 1 65  ? -3.365  34.934 32.537  1.00 19.02 ? 64  GLY B N   1 
ATOM   1986 C  CA  . GLY B 1 65  ? -2.340  35.393 33.501  1.00 20.78 ? 64  GLY B CA  1 
ATOM   1987 C  C   . GLY B 1 65  ? -0.920  35.107 33.055  1.00 19.64 ? 64  GLY B C   1 
ATOM   1988 O  O   . GLY B 1 65  ? -0.028  35.018 33.883  1.00 21.05 ? 64  GLY B O   1 
ATOM   1989 N  N   . GLN B 1 66  ? -0.720  34.968 31.736  1.00 18.63 ? 65  GLN B N   1 
ATOM   1990 C  CA  . GLN B 1 66  ? 0.560   34.550 31.149  1.00 16.92 ? 65  GLN B CA  1 
ATOM   1991 C  C   . GLN B 1 66  ? 1.286   35.702 30.472  1.00 14.81 ? 65  GLN B C   1 
ATOM   1992 O  O   . GLN B 1 66  ? 0.696   36.763 30.207  1.00 17.76 ? 65  GLN B O   1 
ATOM   1993 C  CB  . GLN B 1 66  ? 0.337   33.447 30.131  1.00 18.41 ? 65  GLN B CB  1 
ATOM   1994 C  CG  . GLN B 1 66  ? 0.057   32.100 30.756  1.00 24.48 ? 65  GLN B CG  1 
ATOM   1995 C  CD  . GLN B 1 66  ? -0.260  31.038 29.726  1.00 34.36 ? 65  GLN B CD  1 
ATOM   1996 O  OE1 . GLN B 1 66  ? -0.336  31.295 28.515  1.00 36.10 ? 65  GLN B OE1 1 
ATOM   1997 N  NE2 . GLN B 1 66  ? -0.474  29.834 30.209  1.00 32.99 ? 65  GLN B NE2 1 
ATOM   1998 N  N   . LEU B 1 67  ? 2.556   35.483 30.153  1.00 15.79 ? 66  LEU B N   1 
ATOM   1999 C  CA  . LEU B 1 67  ? 3.364   36.529 29.518  1.00 17.76 ? 66  LEU B CA  1 
ATOM   2000 C  C   . LEU B 1 67  ? 3.161   36.549 27.997  1.00 17.26 ? 66  LEU B C   1 
ATOM   2001 O  O   . LEU B 1 67  ? 3.183   35.525 27.340  1.00 17.04 ? 66  LEU B O   1 
ATOM   2002 C  CB  . LEU B 1 67  ? 4.848   36.370 29.843  1.00 20.02 ? 66  LEU B CB  1 
ATOM   2003 C  CG  . LEU B 1 67  ? 5.241   36.314 31.323  1.00 17.71 ? 66  LEU B CG  1 
ATOM   2004 C  CD1 . LEU B 1 67  ? 6.771   36.234 31.447  1.00 23.43 ? 66  LEU B CD1 1 
ATOM   2005 C  CD2 . LEU B 1 67  ? 4.692   37.494 32.137  1.00 20.52 ? 66  LEU B CD2 1 
ATOM   2006 N  N   . VAL B 1 68  ? 2.962   37.734 27.430  1.00 17.12 ? 67  VAL B N   1 
ATOM   2007 C  CA  . VAL B 1 68  ? 2.847   37.859 25.984  1.00 18.76 ? 67  VAL B CA  1 
ATOM   2008 C  C   . VAL B 1 68  ? 4.274   37.765 25.406  1.00 19.53 ? 67  VAL B C   1 
ATOM   2009 O  O   . VAL B 1 68  ? 5.238   37.947 26.153  1.00 20.14 ? 67  VAL B O   1 
ATOM   2010 C  CB  . VAL B 1 68  ? 2.108   39.147 25.584  1.00 16.70 ? 67  VAL B CB  1 
ATOM   2011 C  CG1 . VAL B 1 68  ? 0.809   39.298 26.410  1.00 17.96 ? 67  VAL B CG1 1 
ATOM   2012 C  CG2 . VAL B 1 68  ? 2.965   40.346 25.732  1.00 23.11 ? 67  VAL B CG2 1 
ATOM   2013 N  N   . PRO B 1 69  ? 4.412   37.423 24.117  1.00 21.23 ? 68  PRO B N   1 
ATOM   2014 C  CA  . PRO B 1 69  ? 5.764   37.291 23.493  1.00 20.88 ? 68  PRO B CA  1 
ATOM   2015 C  C   . PRO B 1 69  ? 6.643   38.552 23.615  1.00 19.21 ? 68  PRO B C   1 
ATOM   2016 O  O   . PRO B 1 69  ? 6.161   39.644 23.528  1.00 18.29 ? 68  PRO B O   1 
ATOM   2017 C  CB  . PRO B 1 69  ? 5.456   37.041 22.024  1.00 22.92 ? 68  PRO B CB  1 
ATOM   2018 C  CG  . PRO B 1 69  ? 3.999   36.660 21.972  1.00 23.34 ? 68  PRO B CG  1 
ATOM   2019 C  CD  . PRO B 1 69  ? 3.320   37.131 23.170  1.00 19.66 ? 68  PRO B CD  1 
ATOM   2020 N  N   . LEU B 1 70  ? 7.929   38.349 23.809  1.00 16.80 ? 69  LEU B N   1 
ATOM   2021 C  CA  . LEU B 1 70  ? 8.892   39.391 24.101  1.00 17.38 ? 69  LEU B CA  1 
ATOM   2022 C  C   . LEU B 1 70  ? 8.926   40.492 23.048  1.00 16.51 ? 69  LEU B C   1 
ATOM   2023 O  O   . LEU B 1 70  ? 8.911   41.631 23.395  1.00 19.55 ? 69  LEU B O   1 
ATOM   2024 C  CB  . LEU B 1 70  ? 10.269  38.756 24.225  1.00 19.31 ? 69  LEU B CB  1 
ATOM   2025 C  CG  . LEU B 1 70  ? 11.427  39.690 24.650  1.00 16.92 ? 69  LEU B CG  1 
ATOM   2026 C  CD1 . LEU B 1 70  ? 12.546  38.815 25.237  1.00 22.59 ? 69  LEU B CD1 1 
ATOM   2027 C  CD2 . LEU B 1 70  ? 11.933  40.571 23.468  1.00 29.50 ? 69  LEU B CD2 1 
ATOM   2028 N  N   . GLU B 1 71  ? 8.947   40.119 21.765  1.00 16.57 ? 70  GLU B N   1 
ATOM   2029 C  CA  . GLU B 1 71  ? 9.218   41.061 20.676  1.00 19.97 ? 70  GLU B CA  1 
ATOM   2030 C  C   . GLU B 1 71  ? 8.021   42.001 20.541  1.00 18.67 ? 70  GLU B C   1 
ATOM   2031 O  O   . GLU B 1 71  ? 8.176   43.208 20.242  1.00 21.22 ? 70  GLU B O   1 
ATOM   2032 C  CB  . GLU B 1 71  ? 9.468   40.269 19.370  1.00 20.55 ? 70  GLU B CB  1 
ATOM   2033 C  CG  . GLU B 1 71  ? 10.576  40.721 18.475  1.00 28.08 ? 70  GLU B CG  1 
ATOM   2034 C  CD  . GLU B 1 71  ? 11.941  40.816 19.139  1.00 22.74 ? 70  GLU B CD  1 
ATOM   2035 O  OE1 . GLU B 1 71  ? 12.711  39.842 19.184  1.00 21.04 ? 70  GLU B OE1 1 
ATOM   2036 O  OE2 . GLU B 1 71  ? 12.264  41.920 19.576  1.00 21.81 ? 70  GLU B OE2 1 
ATOM   2037 N  N   . THR B 1 72  ? 6.829   41.476 20.818  1.00 17.19 ? 71  THR B N   1 
ATOM   2038 C  CA  . THR B 1 72  ? 5.632   42.301 20.760  1.00 18.41 ? 71  THR B CA  1 
ATOM   2039 C  C   . THR B 1 72  ? 5.663   43.394 21.844  1.00 18.22 ? 71  THR B C   1 
ATOM   2040 O  O   . THR B 1 72  ? 5.512   44.602 21.558  1.00 19.25 ? 71  THR B O   1 
ATOM   2041 C  CB  . THR B 1 72  ? 4.349   41.438 20.869  1.00 19.82 ? 71  THR B CB  1 
ATOM   2042 O  OG1 . THR B 1 72  ? 4.351   40.480 19.833  1.00 18.96 ? 71  THR B OG1 1 
ATOM   2043 C  CG2 . THR B 1 72  ? 3.073   42.285 20.701  1.00 23.34 ? 71  THR B CG2 1 
ATOM   2044 N  N   . VAL B 1 73  ? 5.913   42.983 23.086  1.00 18.55 ? 72  VAL B N   1 
ATOM   2045 C  CA  . VAL B 1 73  ? 5.956   43.946 24.180  1.00 20.47 ? 72  VAL B CA  1 
ATOM   2046 C  C   . VAL B 1 73  ? 7.167   44.904 24.114  1.00 18.86 ? 72  VAL B C   1 
ATOM   2047 O  O   . VAL B 1 73  ? 7.044   46.118 24.390  1.00 20.34 ? 72  VAL B O   1 
ATOM   2048 C  CB  . VAL B 1 73  ? 5.834   43.240 25.578  1.00 21.75 ? 72  VAL B CB  1 
ATOM   2049 C  CG1 . VAL B 1 73  ? 7.051   42.394 25.888  1.00 25.27 ? 72  VAL B CG1 1 
ATOM   2050 C  CG2 . VAL B 1 73  ? 5.559   44.289 26.665  1.00 21.85 ? 72  VAL B CG2 1 
ATOM   2051 N  N   . LEU B 1 74  ? 8.330   44.379 23.748  1.00 18.88 ? 73  LEU B N   1 
ATOM   2052 C  CA  . LEU B 1 74  ? 9.530   45.222 23.616  1.00 17.22 ? 73  LEU B CA  1 
ATOM   2053 C  C   . LEU B 1 74  ? 9.475   46.220 22.447  1.00 15.58 ? 73  LEU B C   1 
ATOM   2054 O  O   . LEU B 1 74  ? 9.989   47.322 22.580  1.00 18.98 ? 73  LEU B O   1 
ATOM   2055 C  CB  . LEU B 1 74  ? 10.780  44.378 23.558  1.00 19.20 ? 73  LEU B CB  1 
ATOM   2056 C  CG  . LEU B 1 74  ? 12.120  45.132 23.652  1.00 21.44 ? 73  LEU B CG  1 
ATOM   2057 C  CD1 . LEU B 1 74  ? 12.211  45.964 24.891  1.00 18.30 ? 73  LEU B CD1 1 
ATOM   2058 C  CD2 . LEU B 1 74  ? 13.250  44.115 23.610  1.00 18.22 ? 73  LEU B CD2 1 
ATOM   2059 N  N   . ASP B 1 75  ? 8.853   45.855 21.344  1.00 17.14 ? 74  ASP B N   1 
ATOM   2060 C  CA  . ASP B 1 75  ? 8.589   46.803 20.245  1.00 18.43 ? 74  ASP B CA  1 
ATOM   2061 C  C   . ASP B 1 75  ? 7.784   48.002 20.787  1.00 18.88 ? 74  ASP B C   1 
ATOM   2062 O  O   . ASP B 1 75  ? 8.132   49.170 20.556  1.00 22.05 ? 74  ASP B O   1 
ATOM   2063 C  CB  . ASP B 1 75  ? 7.796   46.149 19.079  1.00 17.64 ? 74  ASP B CB  1 
ATOM   2064 C  CG  . ASP B 1 75  ? 8.695   45.382 18.047  1.00 27.36 ? 74  ASP B CG  1 
ATOM   2065 O  OD1 . ASP B 1 75  ? 9.952   45.466 18.116  1.00 23.51 ? 74  ASP B OD1 1 
ATOM   2066 O  OD2 . ASP B 1 75  ? 8.116   44.680 17.158  1.00 24.13 ? 74  ASP B OD2 1 
ATOM   2067 N  N   . MET B 1 76  ? 6.687   47.710 21.500  1.00 19.22 ? 75  MET B N   1 
ATOM   2068 C  CA  . MET B 1 76  ? 5.813   48.767 22.046  1.00 20.93 ? 75  MET B CA  1 
ATOM   2069 C  C   . MET B 1 76  ? 6.572   49.635 23.037  1.00 15.58 ? 75  MET B C   1 
ATOM   2070 O  O   . MET B 1 76  ? 6.491   50.873 23.009  1.00 17.13 ? 75  MET B O   1 
ATOM   2071 C  CB  . MET B 1 76  ? 4.591   48.148 22.747  1.00 20.73 ? 75  MET B CB  1 
ATOM   2072 C  CG  . MET B 1 76  ? 3.545   47.633 21.821  1.00 26.67 ? 75  MET B CG  1 
ATOM   2073 S  SD  . MET B 1 76  ? 2.196   46.918 22.787  1.00 30.17 ? 75  MET B SD  1 
ATOM   2074 C  CE  . MET B 1 76  ? 1.463   45.820 21.582  1.00 30.37 ? 75  MET B CE  1 
ATOM   2075 N  N   . LEU B 1 77  ? 7.288   48.994 23.939  1.00 16.45 ? 76  LEU B N   1 
ATOM   2076 C  CA  . LEU B 1 77  ? 8.053   49.670 24.984  1.00 17.20 ? 76  LEU B CA  1 
ATOM   2077 C  C   . LEU B 1 77  ? 9.176   50.559 24.442  1.00 16.91 ? 76  LEU B C   1 
ATOM   2078 O  O   . LEU B 1 77  ? 9.277   51.713 24.842  1.00 15.31 ? 76  LEU B O   1 
ATOM   2079 C  CB  . LEU B 1 77  ? 8.646   48.654 25.973  1.00 18.11 ? 76  LEU B CB  1 
ATOM   2080 C  CG  . LEU B 1 77  ? 9.395   49.228 27.197  1.00 19.86 ? 76  LEU B CG  1 
ATOM   2081 C  CD1 . LEU B 1 77  ? 8.507   50.115 28.049  1.00 26.46 ? 76  LEU B CD1 1 
ATOM   2082 C  CD2 . LEU B 1 77  ? 9.997   48.114 28.045  1.00 18.05 ? 76  LEU B CD2 1 
ATOM   2083 N  N   . ARG B 1 78  ? 10.022  50.022 23.560  1.00 16.66 ? 77  ARG B N   1 
ATOM   2084 C  CA  . ARG B 1 78  ? 11.111  50.816 22.980  1.00 16.63 ? 77  ARG B CA  1 
ATOM   2085 C  C   . ARG B 1 78  ? 10.573  51.976 22.151  1.00 16.68 ? 77  ARG B C   1 
ATOM   2086 O  O   . ARG B 1 78  ? 11.141  53.060 22.186  1.00 13.71 ? 77  ARG B O   1 
ATOM   2087 C  CB  . ARG B 1 78  ? 12.029  49.937 22.106  1.00 18.39 ? 77  ARG B CB  1 
ATOM   2088 C  CG  . ARG B 1 78  ? 13.348  50.635 21.751  1.00 23.80 ? 77  ARG B CG  1 
ATOM   2089 C  CD  . ARG B 1 78  ? 14.290  49.698 20.978  1.00 19.70 ? 77  ARG B CD  1 
ATOM   2090 N  NE  . ARG B 1 78  ? 15.502  50.391 20.584  1.00 16.82 ? 77  ARG B NE  1 
ATOM   2091 C  CZ  . ARG B 1 78  ? 15.579  51.293 19.602  1.00 20.34 ? 77  ARG B CZ  1 
ATOM   2092 N  NH1 . ARG B 1 78  ? 14.514  51.633 18.881  1.00 20.10 ? 77  ARG B NH1 1 
ATOM   2093 N  NH2 . ARG B 1 78  ? 16.746  51.851 19.318  1.00 18.27 ? 77  ARG B NH2 1 
ATOM   2094 N  N   . ASP B 1 79  ? 9.503   51.731 21.382  1.00 15.99 ? 78  ASP B N   1 
ATOM   2095 C  CA  . ASP B 1 79  ? 8.848   52.798 20.611  1.00 16.32 ? 78  ASP B CA  1 
ATOM   2096 C  C   . ASP B 1 79  ? 8.430   53.964 21.514  1.00 17.43 ? 78  ASP B C   1 
ATOM   2097 O  O   . ASP B 1 79  ? 8.625   55.150 21.157  1.00 16.81 ? 78  ASP B O   1 
ATOM   2098 C  CB  . ASP B 1 79  ? 7.579   52.319 19.897  1.00 15.71 ? 78  ASP B CB  1 
ATOM   2099 C  CG  . ASP B 1 79  ? 7.843   51.476 18.658  1.00 21.63 ? 78  ASP B CG  1 
ATOM   2100 O  OD1 . ASP B 1 79  ? 9.017   51.245 18.266  1.00 21.25 ? 78  ASP B OD1 1 
ATOM   2101 O  OD2 . ASP B 1 79  ? 6.830   51.033 18.054  1.00 18.16 ? 78  ASP B OD2 1 
ATOM   2102 N  N   . ALA B 1 80  ? 7.793   53.638 22.640  1.00 15.80 ? 79  ALA B N   1 
ATOM   2103 C  CA  . ALA B 1 80  ? 7.346   54.707 23.573  1.00 17.94 ? 79  ALA B CA  1 
ATOM   2104 C  C   . ALA B 1 80  ? 8.504   55.506 24.191  1.00 17.00 ? 79  ALA B C   1 
ATOM   2105 O  O   . ALA B 1 80  ? 8.350   56.693 24.524  1.00 18.76 ? 79  ALA B O   1 
ATOM   2106 C  CB  . ALA B 1 80  ? 6.525   54.097 24.676  1.00 17.33 ? 79  ALA B CB  1 
ATOM   2107 N  N   . MET B 1 81  ? 9.631   54.834 24.426  1.00 17.10 ? 80  MET B N   1 
ATOM   2108 C  CA  . MET B 1 81  ? 10.858  55.463 24.900  1.00 17.16 ? 80  MET B CA  1 
ATOM   2109 C  C   . MET B 1 81  ? 11.464  56.378 23.849  1.00 18.50 ? 80  MET B C   1 
ATOM   2110 O  O   . MET B 1 81  ? 11.857  57.519 24.150  1.00 18.12 ? 80  MET B O   1 
ATOM   2111 C  CB  . MET B 1 81  ? 11.892  54.422 25.326  1.00 17.29 ? 80  MET B CB  1 
ATOM   2112 C  CG  . MET B 1 81  ? 11.506  53.695 26.579  1.00 19.47 ? 80  MET B CG  1 
ATOM   2113 S  SD  . MET B 1 81  ? 12.724  52.551 27.228  1.00 20.45 ? 80  MET B SD  1 
ATOM   2114 C  CE  . MET B 1 81  ? 13.935  53.604 27.990  1.00 22.28 ? 80  MET B CE  1 
ATOM   2115 N  N   . VAL B 1 82  ? 11.550  55.892 22.617  1.00 17.92 ? 81  VAL B N   1 
ATOM   2116 C  CA  . VAL B 1 82  ? 12.096  56.704 21.551  1.00 17.83 ? 81  VAL B CA  1 
ATOM   2117 C  C   . VAL B 1 82  ? 11.244  57.961 21.382  1.00 16.02 ? 81  VAL B C   1 
ATOM   2118 O  O   . VAL B 1 82  ? 11.776  59.065 21.166  1.00 18.46 ? 81  VAL B O   1 
ATOM   2119 C  CB  . VAL B 1 82  ? 12.170  55.917 20.209  1.00 16.40 ? 81  VAL B CB  1 
ATOM   2120 C  CG1 . VAL B 1 82  ? 12.493  56.857 19.052  1.00 18.88 ? 81  VAL B CG1 1 
ATOM   2121 C  CG2 . VAL B 1 82  ? 13.222  54.831 20.309  1.00 19.64 ? 81  VAL B CG2 1 
ATOM   2122 N  N   . ALA B 1 83  ? 9.927   57.826 21.473  1.00 15.61 ? 82  ALA B N   1 
ATOM   2123 C  CA  . ALA B 1 83  ? 9.048   59.008 21.276  1.00 17.70 ? 82  ALA B CA  1 
ATOM   2124 C  C   . ALA B 1 83  ? 9.259   60.115 22.310  1.00 20.03 ? 82  ALA B C   1 
ATOM   2125 O  O   . ALA B 1 83  ? 8.943   61.273 22.054  1.00 18.65 ? 82  ALA B O   1 
ATOM   2126 C  CB  . ALA B 1 83  ? 7.567   58.591 21.248  1.00 17.23 ? 82  ALA B CB  1 
ATOM   2127 N  N   . LYS B 1 84  ? 9.779   59.748 23.474  1.00 22.06 ? 83  LYS B N   1 
ATOM   2128 C  CA  . LYS B 1 84  ? 9.902   60.675 24.607  1.00 23.94 ? 83  LYS B CA  1 
ATOM   2129 C  C   . LYS B 1 84  ? 11.331  61.036 25.036  1.00 22.90 ? 83  LYS B C   1 
ATOM   2130 O  O   . LYS B 1 84  ? 11.497  61.904 25.902  1.00 19.98 ? 83  LYS B O   1 
ATOM   2131 C  CB  . LYS B 1 84  ? 9.211   60.051 25.829  1.00 21.55 ? 83  LYS B CB  1 
ATOM   2132 C  CG  . LYS B 1 84  ? 7.720   59.745 25.661  1.00 30.69 ? 83  LYS B CG  1 
ATOM   2133 C  CD  . LYS B 1 84  ? 6.868   61.017 25.682  1.00 37.77 ? 83  LYS B CD  1 
ATOM   2134 C  CE  . LYS B 1 84  ? 5.379   60.711 25.957  1.00 45.60 ? 83  LYS B CE  1 
ATOM   2135 N  NZ  . LYS B 1 84  ? 5.160   59.782 27.130  1.00 45.41 ? 83  LYS B NZ  1 
ATOM   2136 N  N   . VAL B 1 85  ? 12.346  60.345 24.512  1.00 20.27 ? 84  VAL B N   1 
ATOM   2137 C  CA  . VAL B 1 85  ? 13.705  60.484 25.048  1.00 22.78 ? 84  VAL B CA  1 
ATOM   2138 C  C   . VAL B 1 85  ? 14.306  61.890 24.899  1.00 22.02 ? 84  VAL B C   1 
ATOM   2139 O  O   . VAL B 1 85  ? 15.128  62.275 25.707  1.00 21.60 ? 84  VAL B O   1 
ATOM   2140 C  CB  . VAL B 1 85  ? 14.686  59.434 24.456  1.00 24.57 ? 84  VAL B CB  1 
ATOM   2141 C  CG1 . VAL B 1 85  ? 14.942  59.682 22.963  1.00 26.31 ? 84  VAL B CG1 1 
ATOM   2142 C  CG2 . VAL B 1 85  ? 15.989  59.422 25.246  1.00 29.75 ? 84  VAL B CG2 1 
ATOM   2143 N  N   . ASN B 1 86  ? 13.901  62.636 23.869  1.00 22.16 ? 85  ASN B N   1 
ATOM   2144 C  CA  . ASN B 1 86  ? 14.409  63.991 23.662  1.00 25.05 ? 85  ASN B CA  1 
ATOM   2145 C  C   . ASN B 1 86  ? 13.968  64.937 24.768  1.00 24.59 ? 85  ASN B C   1 
ATOM   2146 O  O   . ASN B 1 86  ? 14.666  65.904 25.040  1.00 24.61 ? 85  ASN B O   1 
ATOM   2147 C  CB  . ASN B 1 86  ? 13.953  64.572 22.317  1.00 26.89 ? 85  ASN B CB  1 
ATOM   2148 C  CG  . ASN B 1 86  ? 14.671  63.946 21.128  1.00 32.95 ? 85  ASN B CG  1 
ATOM   2149 O  OD1 . ASN B 1 86  ? 15.724  63.323 21.275  1.00 27.02 ? 85  ASN B OD1 1 
ATOM   2150 N  ND2 . ASN B 1 86  ? 14.098  64.117 19.936  1.00 32.34 ? 85  ASN B ND2 1 
ATOM   2151 N  N   . THR B 1 87  ? 12.825  64.646 25.393  1.00 23.22 ? 86  THR B N   1 
ATOM   2152 C  CA  . THR B 1 87  ? 12.206  65.537 26.386  1.00 23.72 ? 86  THR B CA  1 
ATOM   2153 C  C   . THR B 1 87  ? 12.129  64.974 27.800  1.00 23.14 ? 86  THR B C   1 
ATOM   2154 O  O   . THR B 1 87  ? 11.858  65.707 28.748  1.00 23.28 ? 86  THR B O   1 
ATOM   2155 C  CB  . THR B 1 87  ? 10.771  65.906 25.962  1.00 21.68 ? 86  THR B CB  1 
ATOM   2156 O  OG1 . THR B 1 87  ? 10.108  64.741 25.440  1.00 27.29 ? 86  THR B OG1 1 
ATOM   2157 C  CG2 . THR B 1 87  ? 10.807  66.990 24.891  1.00 23.43 ? 86  THR B CG2 1 
ATOM   2158 N  N   . SER B 1 88  ? 12.378  63.685 27.956  1.00 19.19 ? 87  SER B N   1 
ATOM   2159 C  CA  . SER B 1 88  ? 12.188  63.022 29.245  1.00 19.36 ? 87  SER B CA  1 
ATOM   2160 C  C   . SER B 1 88  ? 13.295  63.334 30.257  1.00 19.59 ? 87  SER B C   1 
ATOM   2161 O  O   . SER B 1 88  ? 14.458  63.441 29.882  1.00 22.01 ? 87  SER B O   1 
ATOM   2162 C  CB  . SER B 1 88  ? 12.114  61.494 29.017  1.00 15.40 ? 87  SER B CB  1 
ATOM   2163 O  OG  . SER B 1 88  ? 12.037  60.850 30.261  1.00 17.17 ? 87  SER B OG  1 
ATOM   2164 N  N   . LYS B 1 89  ? 12.942  63.468 31.538  1.00 20.07 ? 88  LYS B N   1 
ATOM   2165 C  CA  . LYS B 1 89  ? 13.935  63.599 32.622  1.00 20.33 ? 88  LYS B CA  1 
ATOM   2166 C  C   . LYS B 1 89  ? 14.423  62.237 33.121  1.00 19.00 ? 88  LYS B C   1 
ATOM   2167 O  O   . LYS B 1 89  ? 15.343  62.175 33.921  1.00 18.04 ? 88  LYS B O   1 
ATOM   2168 C  CB  . LYS B 1 89  ? 13.356  64.353 33.822  1.00 21.20 ? 88  LYS B CB  1 
ATOM   2169 C  CG  . LYS B 1 89  ? 13.016  65.804 33.537  1.00 29.10 ? 88  LYS B CG  1 
ATOM   2170 C  CD  . LYS B 1 89  ? 12.141  66.430 34.648  1.00 26.78 ? 88  LYS B CD  1 
ATOM   2171 C  CE  . LYS B 1 89  ? 12.907  66.694 35.937  1.00 38.19 ? 88  LYS B CE  1 
ATOM   2172 N  NZ  . LYS B 1 89  ? 12.011  67.257 37.012  1.00 36.52 ? 88  LYS B NZ  1 
ATOM   2173 N  N   . GLY B 1 90  ? 13.828  61.155 32.623  1.00 18.78 ? 89  GLY B N   1 
ATOM   2174 C  CA  . GLY B 1 90  ? 14.079  59.827 33.136  1.00 18.18 ? 89  GLY B CA  1 
ATOM   2175 C  C   . GLY B 1 90  ? 12.850  58.941 33.003  1.00 18.33 ? 89  GLY B C   1 
ATOM   2176 O  O   . GLY B 1 90  ? 11.735  59.427 32.939  1.00 16.84 ? 89  GLY B O   1 
ATOM   2177 N  N   . PHE B 1 91  ? 13.063  57.632 32.960  1.00 16.88 ? 90  PHE B N   1 
ATOM   2178 C  CA  . PHE B 1 91  ? 11.997  56.670 32.689  1.00 16.65 ? 90  PHE B CA  1 
ATOM   2179 C  C   . PHE B 1 91  ? 11.734  55.754 33.877  1.00 17.82 ? 90  PHE B C   1 
ATOM   2180 O  O   . PHE B 1 91  ? 12.678  55.314 34.507  1.00 19.29 ? 90  PHE B O   1 
ATOM   2181 C  CB  . PHE B 1 91  ? 12.352  55.827 31.491  1.00 16.37 ? 90  PHE B CB  1 
ATOM   2182 C  CG  . PHE B 1 91  ? 12.267  56.552 30.178  1.00 13.82 ? 90  PHE B CG  1 
ATOM   2183 C  CD1 . PHE B 1 91  ? 13.402  57.045 29.573  1.00 19.93 ? 90  PHE B CD1 1 
ATOM   2184 C  CD2 . PHE B 1 91  ? 11.061  56.679 29.529  1.00 13.40 ? 90  PHE B CD2 1 
ATOM   2185 C  CE1 . PHE B 1 91  ? 13.332  57.672 28.335  1.00 21.31 ? 90  PHE B CE1 1 
ATOM   2186 C  CE2 . PHE B 1 91  ? 10.981  57.296 28.296  1.00 19.30 ? 90  PHE B CE2 1 
ATOM   2187 C  CZ  . PHE B 1 91  ? 12.110  57.807 27.714  1.00 21.66 ? 90  PHE B CZ  1 
ATOM   2188 N  N   . LEU B 1 92  ? 10.445  55.530 34.193  1.00 17.24 ? 91  LEU B N   1 
ATOM   2189 C  CA  . LEU B 1 92  ? 9.978   54.470 35.086  1.00 17.68 ? 91  LEU B CA  1 
ATOM   2190 C  C   . LEU B 1 92  ? 9.330   53.383 34.250  1.00 17.58 ? 91  LEU B C   1 
ATOM   2191 O  O   . LEU B 1 92  ? 8.261   53.608 33.676  1.00 20.13 ? 91  LEU B O   1 
ATOM   2192 C  CB  . LEU B 1 92  ? 8.942   54.977 36.088  1.00 18.16 ? 91  LEU B CB  1 
ATOM   2193 C  CG  . LEU B 1 92  ? 9.319   56.190 36.928  1.00 20.96 ? 91  LEU B CG  1 
ATOM   2194 C  CD1 . LEU B 1 92  ? 8.033   56.871 37.470  1.00 21.55 ? 91  LEU B CD1 1 
ATOM   2195 C  CD2 . LEU B 1 92  ? 10.272  55.747 38.048  1.00 22.90 ? 91  LEU B CD2 1 
ATOM   2196 N  N   . ILE B 1 93  ? 9.989   52.239 34.193  1.00 17.95 ? 92  ILE B N   1 
ATOM   2197 C  CA  . ILE B 1 93  ? 9.548   51.078 33.447  1.00 19.96 ? 92  ILE B CA  1 
ATOM   2198 C  C   . ILE B 1 93  ? 8.843   50.127 34.400  1.00 19.06 ? 92  ILE B C   1 
ATOM   2199 O  O   . ILE B 1 93  ? 9.463   49.373 35.125  1.00 20.70 ? 92  ILE B O   1 
ATOM   2200 C  CB  . ILE B 1 93  ? 10.720  50.372 32.750  1.00 20.76 ? 92  ILE B CB  1 
ATOM   2201 C  CG1 . ILE B 1 93  ? 11.612  51.376 31.991  1.00 20.73 ? 92  ILE B CG1 1 
ATOM   2202 C  CG2 . ILE B 1 93  ? 10.226  49.266 31.793  1.00 18.98 ? 92  ILE B CG2 1 
ATOM   2203 C  CD1 . ILE B 1 93  ? 10.955  52.145 30.923  1.00 23.33 ? 92  ILE B CD1 1 
ATOM   2204 N  N   . ASP B 1 94  ? 7.520   50.171 34.347  1.00 17.71 ? 93  ASP B N   1 
ATOM   2205 C  CA  . ASP B 1 94  ? 6.621   49.427 35.248  1.00 18.86 ? 93  ASP B CA  1 
ATOM   2206 C  C   . ASP B 1 94  ? 6.147   48.112 34.594  1.00 16.25 ? 93  ASP B C   1 
ATOM   2207 O  O   . ASP B 1 94  ? 5.433   48.127 33.575  1.00 17.40 ? 93  ASP B O   1 
ATOM   2208 C  CB  . ASP B 1 94  ? 5.482   50.412 35.538  1.00 16.74 ? 93  ASP B CB  1 
ATOM   2209 C  CG  . ASP B 1 94  ? 4.259   49.814 36.190  1.00 18.67 ? 93  ASP B CG  1 
ATOM   2210 O  OD1 . ASP B 1 94  ? 4.084   48.571 36.322  1.00 22.46 ? 93  ASP B OD1 1 
ATOM   2211 O  OD2 . ASP B 1 94  ? 3.417   50.683 36.539  1.00 22.42 ? 93  ASP B OD2 1 
ATOM   2212 N  N   . GLY B 1 95  ? 6.544   46.974 35.150  1.00 20.32 ? 94  GLY B N   1 
ATOM   2213 C  CA  . GLY B 1 95  ? 6.070   45.671 34.641  1.00 21.05 ? 94  GLY B CA  1 
ATOM   2214 C  C   . GLY B 1 95  ? 6.850   45.044 33.480  1.00 21.13 ? 94  GLY B C   1 
ATOM   2215 O  O   . GLY B 1 95  ? 6.412   44.046 32.897  1.00 19.54 ? 94  GLY B O   1 
ATOM   2216 N  N   . TYR B 1 96  ? 7.996   45.638 33.146  1.00 18.35 ? 95  TYR B N   1 
ATOM   2217 C  CA  . TYR B 1 96  ? 8.999   45.036 32.269  1.00 18.00 ? 95  TYR B CA  1 
ATOM   2218 C  C   . TYR B 1 96  ? 10.337  45.326 32.969  1.00 19.61 ? 95  TYR B C   1 
ATOM   2219 O  O   . TYR B 1 96  ? 10.563  46.487 33.367  1.00 17.97 ? 95  TYR B O   1 
ATOM   2220 C  CB  . TYR B 1 96  ? 8.972   45.694 30.874  1.00 19.45 ? 95  TYR B CB  1 
ATOM   2221 C  CG  . TYR B 1 96  ? 9.898   45.002 29.854  1.00 19.66 ? 95  TYR B CG  1 
ATOM   2222 C  CD1 . TYR B 1 96  ? 9.381   44.291 28.775  1.00 23.85 ? 95  TYR B CD1 1 
ATOM   2223 C  CD2 . TYR B 1 96  ? 11.273  45.035 29.997  1.00 18.03 ? 95  TYR B CD2 1 
ATOM   2224 C  CE1 . TYR B 1 96  ? 10.209  43.675 27.863  1.00 15.51 ? 95  TYR B CE1 1 
ATOM   2225 C  CE2 . TYR B 1 96  ? 12.105  44.395 29.106  1.00 14.80 ? 95  TYR B CE2 1 
ATOM   2226 C  CZ  . TYR B 1 96  ? 11.570  43.730 28.038  1.00 17.72 ? 95  TYR B CZ  1 
ATOM   2227 O  OH  . TYR B 1 96  ? 12.414  43.092 27.153  1.00 19.46 ? 95  TYR B OH  1 
ATOM   2228 N  N   . PRO B 1 97  ? 11.230  44.318 33.108  1.00 18.10 ? 96  PRO B N   1 
ATOM   2229 C  CA  . PRO B 1 97  ? 11.157  42.947 32.611  1.00 17.09 ? 96  PRO B CA  1 
ATOM   2230 C  C   . PRO B 1 97  ? 10.401  41.982 33.517  1.00 18.34 ? 96  PRO B C   1 
ATOM   2231 O  O   . PRO B 1 97  ? 10.460  42.106 34.753  1.00 21.28 ? 96  PRO B O   1 
ATOM   2232 C  CB  . PRO B 1 97  ? 12.635  42.539 32.532  1.00 19.93 ? 96  PRO B CB  1 
ATOM   2233 C  CG  . PRO B 1 97  ? 13.249  43.204 33.703  1.00 20.93 ? 96  PRO B CG  1 
ATOM   2234 C  CD  . PRO B 1 97  ? 12.505  44.553 33.818  1.00 17.25 ? 96  PRO B CD  1 
ATOM   2235 N  N   . ARG B 1 98  ? 9.732   40.997 32.904  1.00 19.13 ? 97  ARG B N   1 
ATOM   2236 C  CA  . ARG B 1 98  ? 9.022   39.928 33.634  1.00 16.96 ? 97  ARG B CA  1 
ATOM   2237 C  C   . ARG B 1 98  ? 9.759   38.597 33.668  1.00 19.60 ? 97  ARG B C   1 
ATOM   2238 O  O   . ARG B 1 98  ? 9.308   37.674 34.320  1.00 18.80 ? 97  ARG B O   1 
ATOM   2239 C  CB  . ARG B 1 98  ? 7.613   39.729 33.048  1.00 17.22 ? 97  ARG B CB  1 
ATOM   2240 C  CG  . ARG B 1 98  ? 6.719   40.953 33.161  1.00 25.35 ? 97  ARG B CG  1 
ATOM   2241 C  CD  . ARG B 1 98  ? 6.398   41.308 34.589  1.00 29.23 ? 97  ARG B CD  1 
ATOM   2242 N  NE  . ARG B 1 98  ? 6.005   40.091 35.292  1.00 41.67 ? 97  ARG B NE  1 
ATOM   2243 C  CZ  . ARG B 1 98  ? 4.751   39.674 35.496  1.00 39.59 ? 97  ARG B CZ  1 
ATOM   2244 N  NH1 . ARG B 1 98  ? 4.558   38.517 36.105  1.00 25.81 ? 97  ARG B NH1 1 
ATOM   2245 N  NH2 . ARG B 1 98  ? 3.695   40.401 35.111  1.00 34.37 ? 97  ARG B NH2 1 
ATOM   2246 N  N   . GLU B 1 99  ? 10.920  38.512 33.024  1.00 18.60 ? 98  GLU B N   1 
ATOM   2247 C  CA  . GLU B 1 99  ? 11.763  37.299 33.027  1.00 21.84 ? 98  GLU B CA  1 
ATOM   2248 C  C   . GLU B 1 99  ? 13.182  37.763 32.754  1.00 19.99 ? 98  GLU B C   1 
ATOM   2249 O  O   . GLU B 1 99  ? 13.375  38.865 32.247  1.00 17.60 ? 98  GLU B O   1 
ATOM   2250 C  CB  . GLU B 1 99  ? 11.275  36.266 31.992  1.00 22.27 ? 98  GLU B CB  1 
ATOM   2251 C  CG  . GLU B 1 99  ? 11.244  36.790 30.558  1.00 27.30 ? 98  GLU B CG  1 
ATOM   2252 C  CD  . GLU B 1 99  ? 10.730  35.793 29.534  1.00 33.16 ? 98  GLU B CD  1 
ATOM   2253 O  OE1 . GLU B 1 99  ? 10.094  34.790 29.930  1.00 45.48 ? 98  GLU B OE1 1 
ATOM   2254 O  OE2 . GLU B 1 99  ? 10.968  36.035 28.319  1.00 47.03 ? 98  GLU B OE2 1 
ATOM   2255 N  N   . VAL B 1 100 ? 14.184  36.957 33.078  1.00 20.50 ? 99  VAL B N   1 
ATOM   2256 C  CA  . VAL B 1 100 ? 15.575  37.387 32.863  1.00 20.10 ? 99  VAL B CA  1 
ATOM   2257 C  C   . VAL B 1 100 ? 15.890  37.700 31.383  1.00 20.08 ? 99  VAL B C   1 
ATOM   2258 O  O   . VAL B 1 100 ? 16.593  38.662 31.079  1.00 21.50 ? 99  VAL B O   1 
ATOM   2259 C  CB  . VAL B 1 100 ? 16.574  36.362 33.444  1.00 20.21 ? 99  VAL B CB  1 
ATOM   2260 C  CG1 . VAL B 1 100 ? 17.980  36.682 33.024  1.00 19.61 ? 99  VAL B CG1 1 
ATOM   2261 C  CG2 . VAL B 1 100 ? 16.506  36.382 34.976  1.00 24.99 ? 99  VAL B CG2 1 
ATOM   2262 N  N   . GLN B 1 101 ? 15.378  36.878 30.473  1.00 18.96 ? 100 GLN B N   1 
ATOM   2263 C  CA  . GLN B 1 101 ? 15.588  37.073 29.027  1.00 19.27 ? 100 GLN B CA  1 
ATOM   2264 C  C   . GLN B 1 101 ? 15.107  38.451 28.551  1.00 19.11 ? 100 GLN B C   1 
ATOM   2265 O  O   . GLN B 1 101 ? 15.728  39.094 27.662  1.00 18.12 ? 100 GLN B O   1 
ATOM   2266 C  CB  . GLN B 1 101 ? 14.838  35.979 28.261  1.00 21.91 ? 100 GLN B CB  1 
ATOM   2267 N  N   . GLN B 1 102 ? 13.978  38.900 29.107  1.00 17.52 ? 101 GLN B N   1 
ATOM   2268 C  CA  . GLN B 1 102 ? 13.458  40.236 28.762  1.00 18.16 ? 101 GLN B CA  1 
ATOM   2269 C  C   . GLN B 1 102 ? 14.465  41.320 29.174  1.00 17.31 ? 101 GLN B C   1 
ATOM   2270 O  O   . GLN B 1 102 ? 14.667  42.290 28.453  1.00 17.40 ? 101 GLN B O   1 
ATOM   2271 C  CB  . GLN B 1 102 ? 12.081  40.502 29.398  1.00 14.89 ? 101 GLN B CB  1 
ATOM   2272 C  CG  . GLN B 1 102 ? 10.936  39.833 28.646  1.00 21.24 ? 101 GLN B CG  1 
ATOM   2273 C  CD  . GLN B 1 102 ? 9.553   40.223 29.174  1.00 23.12 ? 101 GLN B CD  1 
ATOM   2274 O  OE1 . GLN B 1 102 ? 9.421   41.139 30.000  1.00 18.18 ? 101 GLN B OE1 1 
ATOM   2275 N  NE2 . GLN B 1 102 ? 8.523   39.498 28.730  1.00 17.93 ? 101 GLN B NE2 1 
ATOM   2276 N  N   . GLY B 1 103 ? 15.081  41.159 30.332  1.00 13.30 ? 102 GLY B N   1 
ATOM   2277 C  CA  . GLY B 1 103 ? 16.044  42.153 30.817  1.00 17.87 ? 102 GLY B CA  1 
ATOM   2278 C  C   . GLY B 1 103 ? 17.305  42.238 29.941  1.00 18.81 ? 102 GLY B C   1 
ATOM   2279 O  O   . GLY B 1 103 ? 17.802  43.338 29.613  1.00 19.47 ? 102 GLY B O   1 
ATOM   2280 N  N   . GLU B 1 104 ? 17.795  41.077 29.529  1.00 18.25 ? 103 GLU B N   1 
ATOM   2281 C  CA  . GLU B 1 104 ? 18.992  40.989 28.725  1.00 19.84 ? 103 GLU B CA  1 
ATOM   2282 C  C   . GLU B 1 104 ? 18.775  41.602 27.349  1.00 18.82 ? 103 GLU B C   1 
ATOM   2283 O  O   . GLU B 1 104 ? 19.645  42.301 26.848  1.00 18.35 ? 103 GLU B O   1 
ATOM   2284 C  CB  . GLU B 1 104 ? 19.442  39.532 28.615  1.00 21.29 ? 103 GLU B CB  1 
ATOM   2285 C  CG  . GLU B 1 104 ? 19.875  38.973 29.984  1.00 25.78 ? 103 GLU B CG  1 
ATOM   2286 C  CD  . GLU B 1 104 ? 20.549  37.603 29.909  1.00 29.13 ? 103 GLU B CD  1 
ATOM   2287 O  OE1 . GLU B 1 104 ? 19.860  36.582 29.623  1.00 47.11 ? 103 GLU B OE1 1 
ATOM   2288 O  OE2 . GLU B 1 104 ? 21.769  37.555 30.174  1.00 43.55 ? 103 GLU B OE2 1 
ATOM   2289 N  N   . GLU B 1 105 ? 17.618  41.379 26.742  1.00 17.90 ? 104 GLU B N   1 
ATOM   2290 C  CA  . GLU B 1 105 ? 17.406  41.972 25.403  1.00 17.84 ? 104 GLU B CA  1 
ATOM   2291 C  C   . GLU B 1 105 ? 17.190  43.481 25.493  1.00 18.81 ? 104 GLU B C   1 
ATOM   2292 O  O   . GLU B 1 105 ? 17.635  44.203 24.610  1.00 17.69 ? 104 GLU B O   1 
ATOM   2293 C  CB  . GLU B 1 105 ? 16.261  41.285 24.622  1.00 19.59 ? 104 GLU B CB  1 
ATOM   2294 C  CG  . GLU B 1 105 ? 16.235  41.790 23.168  1.00 19.13 ? 104 GLU B CG  1 
ATOM   2295 C  CD  . GLU B 1 105 ? 15.620  40.853 22.145  1.00 26.76 ? 104 GLU B CD  1 
ATOM   2296 O  OE1 . GLU B 1 105 ? 15.446  41.303 20.996  1.00 18.74 ? 104 GLU B OE1 1 
ATOM   2297 O  OE2 . GLU B 1 105 ? 15.289  39.704 22.466  1.00 22.29 ? 104 GLU B OE2 1 
ATOM   2298 N  N   . PHE B 1 106 ? 16.536  43.960 26.559  1.00 16.93 ? 105 PHE B N   1 
ATOM   2299 C  CA  . PHE B 1 106 ? 16.358  45.414 26.774  1.00 16.54 ? 105 PHE B CA  1 
ATOM   2300 C  C   . PHE B 1 106 ? 17.714  46.100 26.860  1.00 17.42 ? 105 PHE B C   1 
ATOM   2301 O  O   . PHE B 1 106 ? 17.961  47.103 26.188  1.00 17.28 ? 105 PHE B O   1 
ATOM   2302 C  CB  . PHE B 1 106 ? 15.550  45.645 28.053  1.00 16.86 ? 105 PHE B CB  1 
ATOM   2303 C  CG  . PHE B 1 106 ? 15.276  47.103 28.381  1.00 16.28 ? 105 PHE B CG  1 
ATOM   2304 C  CD1 . PHE B 1 106 ? 14.033  47.649 28.128  1.00 19.62 ? 105 PHE B CD1 1 
ATOM   2305 C  CD2 . PHE B 1 106 ? 16.250  47.909 29.002  1.00 16.76 ? 105 PHE B CD2 1 
ATOM   2306 C  CE1 . PHE B 1 106 ? 13.749  48.994 28.453  1.00 13.03 ? 105 PHE B CE1 1 
ATOM   2307 C  CE2 . PHE B 1 106 ? 15.972  49.242 29.308  1.00 17.04 ? 105 PHE B CE2 1 
ATOM   2308 C  CZ  . PHE B 1 106 ? 14.731  49.776 29.028  1.00 14.22 ? 105 PHE B CZ  1 
ATOM   2309 N  N   . GLU B 1 107 ? 18.623  45.539 27.660  1.00 18.22 ? 106 GLU B N   1 
ATOM   2310 C  CA  . GLU B 1 107 ? 19.949  46.136 27.848  1.00 19.50 ? 106 GLU B CA  1 
ATOM   2311 C  C   . GLU B 1 107 ? 20.787  46.249 26.566  1.00 20.95 ? 106 GLU B C   1 
ATOM   2312 O  O   . GLU B 1 107 ? 21.464  47.257 26.326  1.00 22.63 ? 106 GLU B O   1 
ATOM   2313 C  CB  . GLU B 1 107 ? 20.692  45.350 28.926  1.00 20.02 ? 106 GLU B CB  1 
ATOM   2314 C  CG  . GLU B 1 107 ? 20.074  45.552 30.285  1.00 27.40 ? 106 GLU B CG  1 
ATOM   2315 C  CD  . GLU B 1 107 ? 20.876  44.931 31.409  1.00 28.06 ? 106 GLU B CD  1 
ATOM   2316 O  OE1 . GLU B 1 107 ? 21.690  45.672 31.954  1.00 30.06 ? 106 GLU B OE1 1 
ATOM   2317 O  OE2 . GLU B 1 107 ? 20.699  43.729 31.742  1.00 32.88 ? 106 GLU B OE2 1 
ATOM   2318 N  N   . ARG B 1 108 ? 20.695  45.224 25.732  1.00 20.77 ? 107 ARG B N   1 
ATOM   2319 C  CA  . ARG B 1 108 ? 21.430  45.156 24.491  1.00 22.94 ? 107 ARG B CA  1 
ATOM   2320 C  C   . ARG B 1 108 ? 20.866  46.157 23.456  1.00 21.97 ? 107 ARG B C   1 
ATOM   2321 O  O   . ARG B 1 108 ? 21.649  46.755 22.724  1.00 22.50 ? 107 ARG B O   1 
ATOM   2322 C  CB  . ARG B 1 108 ? 21.387  43.715 23.957  1.00 22.70 ? 107 ARG B CB  1 
ATOM   2323 C  CG  . ARG B 1 108 ? 22.050  43.517 22.609  1.00 33.15 ? 107 ARG B CG  1 
ATOM   2324 C  CD  . ARG B 1 108 ? 21.961  42.052 22.167  1.00 31.92 ? 107 ARG B CD  1 
ATOM   2325 N  NE  . ARG B 1 108 ? 20.775  41.823 21.343  1.00 43.08 ? 107 ARG B NE  1 
ATOM   2326 C  CZ  . ARG B 1 108 ? 19.795  40.970 21.619  1.00 46.82 ? 107 ARG B CZ  1 
ATOM   2327 N  NH1 . ARG B 1 108 ? 18.787  40.881 20.768  1.00 46.13 ? 107 ARG B NH1 1 
ATOM   2328 N  NH2 . ARG B 1 108 ? 19.820  40.199 22.714  1.00 46.76 ? 107 ARG B NH2 1 
ATOM   2329 N  N   . ARG B 1 109 ? 19.540  46.339 23.388  1.00 19.33 ? 108 ARG B N   1 
ATOM   2330 C  CA  . ARG B 1 109 ? 18.953  47.247 22.386  1.00 19.61 ? 108 ARG B CA  1 
ATOM   2331 C  C   . ARG B 1 109 ? 18.593  48.644 22.919  1.00 21.24 ? 108 ARG B C   1 
ATOM   2332 O  O   . ARG B 1 109 ? 18.143  49.492 22.148  1.00 19.58 ? 108 ARG B O   1 
ATOM   2333 C  CB  . ARG B 1 109 ? 17.693  46.651 21.768  1.00 20.70 ? 108 ARG B CB  1 
ATOM   2334 C  CG  . ARG B 1 109 ? 17.622  45.114 21.671  1.00 23.96 ? 108 ARG B CG  1 
ATOM   2335 C  CD  . ARG B 1 109 ? 17.237  44.634 20.316  1.00 19.78 ? 108 ARG B CD  1 
ATOM   2336 N  NE  . ARG B 1 109 ? 16.055  45.271 19.719  1.00 17.27 ? 108 ARG B NE  1 
ATOM   2337 C  CZ  . ARG B 1 109 ? 14.812  44.785 19.724  1.00 15.13 ? 108 ARG B CZ  1 
ATOM   2338 N  NH1 . ARG B 1 109 ? 13.856  45.483 19.124  1.00 28.35 ? 108 ARG B NH1 1 
ATOM   2339 N  NH2 . ARG B 1 109 ? 14.501  43.632 20.321  1.00 18.28 ? 108 ARG B NH2 1 
ATOM   2340 N  N   . ILE B 1 110 ? 18.713  48.885 24.217  1.00 17.37 ? 109 ILE B N   1 
ATOM   2341 C  CA  . ILE B 1 110 ? 18.368  50.210 24.763  1.00 18.77 ? 109 ILE B CA  1 
ATOM   2342 C  C   . ILE B 1 110 ? 19.477  50.737 25.680  1.00 20.36 ? 109 ILE B C   1 
ATOM   2343 O  O   . ILE B 1 110 ? 20.265  51.577 25.273  1.00 20.35 ? 109 ILE B O   1 
ATOM   2344 C  CB  . ILE B 1 110 ? 17.000  50.186 25.463  1.00 19.54 ? 109 ILE B CB  1 
ATOM   2345 C  CG1 . ILE B 1 110 ? 15.901  49.787 24.465  1.00 21.91 ? 109 ILE B CG1 1 
ATOM   2346 C  CG2 . ILE B 1 110 ? 16.697  51.522 26.115  1.00 22.94 ? 109 ILE B CG2 1 
ATOM   2347 C  CD1 . ILE B 1 110 ? 14.552  49.599 25.074  1.00 23.07 ? 109 ILE B CD1 1 
ATOM   2348 N  N   . GLY B 1 111 ? 19.547  50.218 26.899  1.00 21.23 ? 110 GLY B N   1 
ATOM   2349 C  CA  . GLY B 1 111 ? 20.625  50.520 27.828  1.00 20.63 ? 110 GLY B CA  1 
ATOM   2350 C  C   . GLY B 1 111 ? 20.380  49.820 29.166  1.00 19.49 ? 110 GLY B C   1 
ATOM   2351 O  O   . GLY B 1 111 ? 19.304  49.305 29.406  1.00 20.38 ? 110 GLY B O   1 
ATOM   2352 N  N   . GLN B 1 112 ? 21.367  49.833 30.043  1.00 20.27 ? 111 GLN B N   1 
ATOM   2353 C  CA  . GLN B 1 112 ? 21.229  49.147 31.333  1.00 20.87 ? 111 GLN B CA  1 
ATOM   2354 C  C   . GLN B 1 112 ? 20.485  50.014 32.340  1.00 20.71 ? 111 GLN B C   1 
ATOM   2355 O  O   . GLN B 1 112 ? 20.639  51.240 32.331  1.00 20.35 ? 111 GLN B O   1 
ATOM   2356 C  CB  . GLN B 1 112 ? 22.606  48.717 31.873  1.00 24.54 ? 111 GLN B CB  1 
ATOM   2357 C  CG  . GLN B 1 112 ? 23.460  49.802 32.448  1.00 24.76 ? 111 GLN B CG  1 
ATOM   2358 C  CD  . GLN B 1 112 ? 24.844  49.303 32.904  1.00 23.38 ? 111 GLN B CD  1 
ATOM   2359 O  OE1 . GLN B 1 112 ? 25.078  48.106 33.073  1.00 28.12 ? 111 GLN B OE1 1 
ATOM   2360 N  NE2 . GLN B 1 112 ? 25.750  50.236 33.105  1.00 18.43 ? 111 GLN B NE2 1 
ATOM   2361 N  N   . PRO B 1 113 ? 19.714  49.384 33.253  1.00 17.48 ? 112 PRO B N   1 
ATOM   2362 C  CA  . PRO B 1 113 ? 19.003  50.161 34.266  1.00 19.26 ? 112 PRO B CA  1 
ATOM   2363 C  C   . PRO B 1 113 ? 19.932  50.808 35.314  1.00 19.35 ? 112 PRO B C   1 
ATOM   2364 O  O   . PRO B 1 113 ? 20.965  50.255 35.668  1.00 18.67 ? 112 PRO B O   1 
ATOM   2365 C  CB  . PRO B 1 113 ? 18.108  49.103 34.949  1.00 19.66 ? 112 PRO B CB  1 
ATOM   2366 C  CG  . PRO B 1 113 ? 18.902  47.813 34.820  1.00 16.92 ? 112 PRO B CG  1 
ATOM   2367 C  CD  . PRO B 1 113 ? 19.487  47.931 33.420  1.00 18.52 ? 112 PRO B CD  1 
ATOM   2368 N  N   . THR B 1 114 ? 19.519  51.963 35.806  1.00 18.43 ? 113 THR B N   1 
ATOM   2369 C  CA  . THR B 1 114 ? 20.186  52.655 36.888  1.00 19.48 ? 113 THR B CA  1 
ATOM   2370 C  C   . THR B 1 114 ? 19.763  52.176 38.258  1.00 16.67 ? 113 THR B C   1 
ATOM   2371 O  O   . THR B 1 114 ? 20.580  52.143 39.161  1.00 15.95 ? 113 THR B O   1 
ATOM   2372 C  CB  . THR B 1 114 ? 19.860  54.160 36.833  1.00 21.54 ? 113 THR B CB  1 
ATOM   2373 O  OG1 . THR B 1 114 ? 20.152  54.675 35.521  1.00 35.50 ? 113 THR B OG1 1 
ATOM   2374 C  CG2 . THR B 1 114 ? 20.638  54.903 37.884  1.00 26.97 ? 113 THR B CG2 1 
ATOM   2375 N  N   . LEU B 1 115 ? 18.480  51.842 38.413  1.00 16.80 ? 114 LEU B N   1 
ATOM   2376 C  CA  . LEU B 1 115 ? 17.901  51.397 39.690  1.00 17.37 ? 114 LEU B CA  1 
ATOM   2377 C  C   . LEU B 1 115 ? 16.808  50.352 39.400  1.00 17.78 ? 114 LEU B C   1 
ATOM   2378 O  O   . LEU B 1 115 ? 16.181  50.367 38.313  1.00 16.90 ? 114 LEU B O   1 
ATOM   2379 C  CB  . LEU B 1 115 ? 17.313  52.597 40.451  1.00 19.00 ? 114 LEU B CB  1 
ATOM   2380 C  CG  . LEU B 1 115 ? 17.280  52.552 41.991  1.00 24.31 ? 114 LEU B CG  1 
ATOM   2381 C  CD1 . LEU B 1 115 ? 18.685  52.580 42.565  1.00 26.19 ? 114 LEU B CD1 1 
ATOM   2382 C  CD2 . LEU B 1 115 ? 16.460  53.709 42.583  1.00 25.82 ? 114 LEU B CD2 1 
ATOM   2383 N  N   . LEU B 1 116 ? 16.600  49.433 40.341  1.00 18.50 ? 115 LEU B N   1 
ATOM   2384 C  CA  . LEU B 1 116 ? 15.421  48.536 40.344  1.00 16.82 ? 115 LEU B CA  1 
ATOM   2385 C  C   . LEU B 1 116 ? 14.685  48.778 41.654  1.00 17.66 ? 115 LEU B C   1 
ATOM   2386 O  O   . LEU B 1 116 ? 15.210  48.525 42.741  1.00 16.19 ? 115 LEU B O   1 
ATOM   2387 C  CB  . LEU B 1 116 ? 15.794  47.079 40.208  1.00 18.49 ? 115 LEU B CB  1 
ATOM   2388 C  CG  . LEU B 1 116 ? 14.629  46.102 39.973  1.00 17.68 ? 115 LEU B CG  1 
ATOM   2389 C  CD1 . LEU B 1 116 ? 15.061  44.814 39.224  1.00 19.73 ? 115 LEU B CD1 1 
ATOM   2390 C  CD2 . LEU B 1 116 ? 13.947  45.697 41.287  1.00 15.96 ? 115 LEU B CD2 1 
ATOM   2391 N  N   . LEU B 1 117 ? 13.489  49.340 41.543  1.00 16.64 ? 116 LEU B N   1 
ATOM   2392 C  CA  . LEU B 1 117 ? 12.642  49.586 42.686  1.00 18.26 ? 116 LEU B CA  1 
ATOM   2393 C  C   . LEU B 1 117 ? 11.710  48.392 42.839  1.00 16.52 ? 116 LEU B C   1 
ATOM   2394 O  O   . LEU B 1 117 ? 10.904  48.100 41.952  1.00 16.79 ? 116 LEU B O   1 
ATOM   2395 C  CB  . LEU B 1 117 ? 11.871  50.898 42.491  1.00 16.24 ? 116 LEU B CB  1 
ATOM   2396 C  CG  . LEU B 1 117 ? 11.148  51.459 43.683  1.00 28.65 ? 116 LEU B CG  1 
ATOM   2397 C  CD1 . LEU B 1 117 ? 12.132  51.929 44.764  1.00 29.33 ? 116 LEU B CD1 1 
ATOM   2398 C  CD2 . LEU B 1 117 ? 10.273  52.603 43.201  1.00 30.34 ? 116 LEU B CD2 1 
ATOM   2399 N  N   . TYR B 1 118 ? 11.855  47.705 43.963  1.00 15.06 ? 117 TYR B N   1 
ATOM   2400 C  CA  . TYR B 1 118 ? 11.158  46.452 44.252  1.00 15.94 ? 117 TYR B CA  1 
ATOM   2401 C  C   . TYR B 1 118 ? 10.013  46.704 45.234  1.00 17.67 ? 117 TYR B C   1 
ATOM   2402 O  O   . TYR B 1 118 ? 10.236  46.908 46.436  1.00 18.08 ? 117 TYR B O   1 
ATOM   2403 C  CB  . TYR B 1 118 ? 12.165  45.480 44.847  1.00 18.55 ? 117 TYR B CB  1 
ATOM   2404 C  CG  . TYR B 1 118 ? 11.688  44.121 45.331  1.00 16.89 ? 117 TYR B CG  1 
ATOM   2405 C  CD1 . TYR B 1 118 ? 10.547  43.512 44.830  1.00 24.72 ? 117 TYR B CD1 1 
ATOM   2406 C  CD2 . TYR B 1 118 ? 12.450  43.415 46.255  1.00 17.73 ? 117 TYR B CD2 1 
ATOM   2407 C  CE1 . TYR B 1 118 ? 10.151  42.244 45.286  1.00 23.22 ? 117 TYR B CE1 1 
ATOM   2408 C  CE2 . TYR B 1 118 ? 12.068  42.173 46.700  1.00 18.35 ? 117 TYR B CE2 1 
ATOM   2409 C  CZ  . TYR B 1 118 ? 10.933  41.588 46.211  1.00 24.77 ? 117 TYR B CZ  1 
ATOM   2410 O  OH  . TYR B 1 118 ? 10.596  40.321 46.648  1.00 19.26 ? 117 TYR B OH  1 
ATOM   2411 N  N   . VAL B 1 119 ? 8.790   46.648 44.702  1.00 18.74 ? 118 VAL B N   1 
ATOM   2412 C  CA  . VAL B 1 119 ? 7.569   46.919 45.443  1.00 17.77 ? 118 VAL B CA  1 
ATOM   2413 C  C   . VAL B 1 119 ? 7.042   45.616 45.993  1.00 17.63 ? 118 VAL B C   1 
ATOM   2414 O  O   . VAL B 1 119 ? 6.387   44.845 45.310  1.00 17.83 ? 118 VAL B O   1 
ATOM   2415 C  CB  . VAL B 1 119 ? 6.512   47.598 44.551  1.00 18.29 ? 118 VAL B CB  1 
ATOM   2416 C  CG1 . VAL B 1 119 ? 5.321   48.032 45.379  1.00 18.96 ? 118 VAL B CG1 1 
ATOM   2417 C  CG2 . VAL B 1 119 ? 7.136   48.790 43.824  1.00 19.83 ? 118 VAL B CG2 1 
ATOM   2418 N  N   . ASP B 1 120 ? 7.304   45.407 47.275  1.00 18.34 ? 119 ASP B N   1 
ATOM   2419 C  CA  . ASP B 1 120 ? 7.239   44.081 47.864  1.00 19.01 ? 119 ASP B CA  1 
ATOM   2420 C  C   . ASP B 1 120 ? 6.010   43.925 48.742  1.00 19.62 ? 119 ASP B C   1 
ATOM   2421 O  O   . ASP B 1 120 ? 5.977   44.423 49.873  1.00 18.63 ? 119 ASP B O   1 
ATOM   2422 C  CB  . ASP B 1 120 ? 8.499   43.859 48.688  1.00 20.73 ? 119 ASP B CB  1 
ATOM   2423 C  CG  . ASP B 1 120 ? 8.507   42.533 49.400  1.00 24.30 ? 119 ASP B CG  1 
ATOM   2424 O  OD1 . ASP B 1 120 ? 7.767   41.626 48.984  1.00 18.86 ? 119 ASP B OD1 1 
ATOM   2425 O  OD2 . ASP B 1 120 ? 9.260   42.416 50.383  1.00 28.79 ? 119 ASP B OD2 1 
ATOM   2426 N  N   . ALA B 1 121 ? 5.011   43.222 48.218  1.00 20.84 ? 120 ALA B N   1 
ATOM   2427 C  CA  . ALA B 1 121 ? 3.776   42.910 48.966  1.00 21.94 ? 120 ALA B CA  1 
ATOM   2428 C  C   . ALA B 1 121 ? 3.543   41.406 49.082  1.00 21.17 ? 120 ALA B C   1 
ATOM   2429 O  O   . ALA B 1 121 ? 4.053   40.608 48.287  1.00 21.89 ? 120 ALA B O   1 
ATOM   2430 C  CB  . ALA B 1 121 ? 2.576   43.571 48.314  1.00 23.29 ? 120 ALA B CB  1 
ATOM   2431 N  N   . GLY B 1 122 ? 2.773   41.029 50.095  1.00 21.50 ? 121 GLY B N   1 
ATOM   2432 C  CA  . GLY B 1 122 ? 2.328   39.637 50.266  1.00 20.95 ? 121 GLY B CA  1 
ATOM   2433 C  C   . GLY B 1 122 ? 1.151   39.256 49.371  1.00 20.13 ? 121 GLY B C   1 
ATOM   2434 O  O   . GLY B 1 122 ? 0.347   40.105 48.996  1.00 18.41 ? 121 GLY B O   1 
ATOM   2435 N  N   . PRO B 1 123 ? 1.012   37.957 49.070  1.00 18.18 ? 122 PRO B N   1 
ATOM   2436 C  CA  . PRO B 1 123 ? -0.051  37.511 48.187  1.00 19.67 ? 122 PRO B CA  1 
ATOM   2437 C  C   . PRO B 1 123 ? -1.482  37.836 48.674  1.00 19.32 ? 122 PRO B C   1 
ATOM   2438 O  O   . PRO B 1 123 ? -2.322  38.157 47.849  1.00 19.77 ? 122 PRO B O   1 
ATOM   2439 C  CB  . PRO B 1 123 ? 0.177   35.993 48.098  1.00 21.08 ? 122 PRO B CB  1 
ATOM   2440 C  CG  . PRO B 1 123 ? 0.941   35.643 49.310  1.00 21.10 ? 122 PRO B CG  1 
ATOM   2441 C  CD  . PRO B 1 123 ? 1.819   36.828 49.564  1.00 19.26 ? 122 PRO B CD  1 
ATOM   2442 N  N   . GLU B 1 124 ? -1.767  37.740 49.976  1.00 17.22 ? 123 GLU B N   1 
ATOM   2443 C  CA  . GLU B 1 124 ? -3.102  38.081 50.478  1.00 17.67 ? 123 GLU B CA  1 
ATOM   2444 C  C   . GLU B 1 124 ? -3.437  39.569 50.279  1.00 17.60 ? 123 GLU B C   1 
ATOM   2445 O  O   . GLU B 1 124 ? -4.568  39.911 49.981  1.00 18.27 ? 123 GLU B O   1 
ATOM   2446 C  CB  . GLU B 1 124 ? -3.272  37.690 51.972  1.00 19.82 ? 123 GLU B CB  1 
ATOM   2447 N  N   . THR B 1 125 ? -2.462  40.448 50.450  1.00 18.34 ? 124 THR B N   1 
ATOM   2448 C  CA  . THR B 1 125 ? -2.658  41.873 50.195  1.00 19.74 ? 124 THR B CA  1 
ATOM   2449 C  C   . THR B 1 125 ? -2.954  42.128 48.693  1.00 19.85 ? 124 THR B C   1 
ATOM   2450 O  O   . THR B 1 125 ? -3.833  42.928 48.342  1.00 16.95 ? 124 THR B O   1 
ATOM   2451 C  CB  . THR B 1 125 ? -1.411  42.668 50.643  1.00 20.37 ? 124 THR B CB  1 
ATOM   2452 O  OG1 . THR B 1 125 ? -1.273  42.578 52.070  1.00 25.37 ? 124 THR B OG1 1 
ATOM   2453 C  CG2 . THR B 1 125 ? -1.512  44.146 50.268  1.00 21.44 ? 124 THR B CG2 1 
ATOM   2454 N  N   . MET B 1 126 ? -2.213  41.443 47.821  1.00 18.61 ? 125 MET B N   1 
ATOM   2455 C  CA  . MET B 1 126 ? -2.365  41.610 46.379  1.00 19.02 ? 125 MET B CA  1 
ATOM   2456 C  C   . MET B 1 126 ? -3.736  41.156 45.939  1.00 19.14 ? 125 MET B C   1 
ATOM   2457 O  O   . MET B 1 126 ? -4.436  41.886 45.218  1.00 18.72 ? 125 MET B O   1 
ATOM   2458 C  CB  . MET B 1 126 ? -1.277  40.859 45.617  1.00 17.26 ? 125 MET B CB  1 
ATOM   2459 C  CG  . MET B 1 126 ? 0.095   41.432 45.907  1.00 21.19 ? 125 MET B CG  1 
ATOM   2460 S  SD  . MET B 1 126 ? 1.434   40.976 44.829  1.00 26.02 ? 125 MET B SD  1 
ATOM   2461 C  CE  . MET B 1 126 ? 1.844   39.341 45.401  1.00 25.97 ? 125 MET B CE  1 
ATOM   2462 N  N   . THR B 1 127 ? -4.126  39.963 46.391  1.00 19.43 ? 126 THR B N   1 
ATOM   2463 C  CA  . THR B 1 127 ? -5.418  39.395 46.030  1.00 17.82 ? 126 THR B CA  1 
ATOM   2464 C  C   . THR B 1 127 ? -6.586  40.266 46.501  1.00 18.38 ? 126 THR B C   1 
ATOM   2465 O  O   . THR B 1 127 ? -7.519  40.511 45.749  1.00 16.85 ? 126 THR B O   1 
ATOM   2466 C  CB  . THR B 1 127 ? -5.530  37.957 46.576  1.00 19.36 ? 126 THR B CB  1 
ATOM   2467 O  OG1 . THR B 1 127 ? -4.492  37.167 45.978  1.00 18.32 ? 126 THR B OG1 1 
ATOM   2468 C  CG2 . THR B 1 127 ? -6.860  37.364 46.265  1.00 17.67 ? 126 THR B CG2 1 
ATOM   2469 N  N   . GLN B 1 128 ? -6.515  40.764 47.730  1.00 19.79 ? 127 GLN B N   1 
ATOM   2470 C  CA  . GLN B 1 128 ? -7.581  41.613 48.276  1.00 20.09 ? 127 GLN B CA  1 
ATOM   2471 C  C   . GLN B 1 128 ? -7.732  42.934 47.498  1.00 19.88 ? 127 GLN B C   1 
ATOM   2472 O  O   . GLN B 1 128 ? -8.848  43.381 47.248  1.00 20.69 ? 127 GLN B O   1 
ATOM   2473 C  CB  . GLN B 1 128 ? -7.338  41.893 49.767  1.00 20.88 ? 127 GLN B CB  1 
ATOM   2474 C  CG  . GLN B 1 128 ? -8.325  42.864 50.390  1.00 23.42 ? 127 GLN B CG  1 
ATOM   2475 N  N   . ARG B 1 129 ? -6.617  43.541 47.107  1.00 18.40 ? 128 ARG B N   1 
ATOM   2476 C  CA  . ARG B 1 129 ? -6.635  44.807 46.371  1.00 18.21 ? 128 ARG B CA  1 
ATOM   2477 C  C   . ARG B 1 129 ? -7.247  44.650 44.993  1.00 18.31 ? 128 ARG B C   1 
ATOM   2478 O  O   . ARG B 1 129 ? -8.033  45.507 44.549  1.00 16.13 ? 128 ARG B O   1 
ATOM   2479 C  CB  . ARG B 1 129 ? -5.214  45.361 46.228  1.00 18.68 ? 128 ARG B CB  1 
ATOM   2480 C  CG  . ARG B 1 129 ? -4.676  46.027 47.483  1.00 18.38 ? 128 ARG B CG  1 
ATOM   2481 C  CD  . ARG B 1 129 ? -3.259  46.474 47.262  1.00 20.44 ? 128 ARG B CD  1 
ATOM   2482 N  NE  . ARG B 1 129 ? -2.623  46.892 48.495  1.00 19.41 ? 128 ARG B NE  1 
ATOM   2483 C  CZ  . ARG B 1 129 ? -1.322  47.108 48.624  1.00 21.71 ? 128 ARG B CZ  1 
ATOM   2484 N  NH1 . ARG B 1 129 ? -0.498  47.000 47.585  1.00 18.43 ? 128 ARG B NH1 1 
ATOM   2485 N  NH2 . ARG B 1 129 ? -0.846  47.445 49.802  1.00 20.22 ? 128 ARG B NH2 1 
ATOM   2486 N  N   . LEU B 1 130 ? -6.915  43.539 44.333  1.00 17.11 ? 129 LEU B N   1 
ATOM   2487 C  CA  . LEU B 1 130 ? -7.380  43.297 42.959  1.00 18.69 ? 129 LEU B CA  1 
ATOM   2488 C  C   . LEU B 1 130 ? -8.858  42.880 42.919  1.00 18.71 ? 129 LEU B C   1 
ATOM   2489 O  O   . LEU B 1 130 ? -9.584  43.250 42.009  1.00 18.01 ? 129 LEU B O   1 
ATOM   2490 C  CB  . LEU B 1 130 ? -6.508  42.240 42.260  1.00 17.35 ? 129 LEU B CB  1 
ATOM   2491 C  CG  . LEU B 1 130 ? -5.053  42.603 42.003  1.00 17.02 ? 129 LEU B CG  1 
ATOM   2492 C  CD1 . LEU B 1 130 ? -4.272  41.380 41.536  1.00 18.53 ? 129 LEU B CD1 1 
ATOM   2493 C  CD2 . LEU B 1 130 ? -4.960  43.706 40.975  1.00 19.36 ? 129 LEU B CD2 1 
ATOM   2494 N  N   . LEU B 1 131 ? -9.302  42.122 43.911  1.00 19.19 ? 130 LEU B N   1 
ATOM   2495 C  CA  . LEU B 1 131 ? -10.731 41.822 44.025  1.00 19.20 ? 130 LEU B CA  1 
ATOM   2496 C  C   . LEU B 1 131 ? -11.548 43.079 44.252  1.00 19.53 ? 130 LEU B C   1 
ATOM   2497 O  O   . LEU B 1 131 ? -12.614 43.233 43.664  1.00 20.47 ? 130 LEU B O   1 
ATOM   2498 C  CB  . LEU B 1 131 ? -10.991 40.838 45.157  1.00 19.30 ? 130 LEU B CB  1 
ATOM   2499 C  CG  . LEU B 1 131 ? -10.484 39.428 44.842  1.00 22.57 ? 130 LEU B CG  1 
ATOM   2500 C  CD1 . LEU B 1 131 ? -10.654 38.550 46.045  1.00 25.84 ? 130 LEU B CD1 1 
ATOM   2501 C  CD2 . LEU B 1 131 ? -11.199 38.842 43.639  1.00 25.06 ? 130 LEU B CD2 1 
ATOM   2502 N  N   . LYS B 1 132 ? -11.051 43.972 45.103  1.00 19.93 ? 131 LYS B N   1 
ATOM   2503 C  CA  . LYS B 1 132 ? -11.732 45.248 45.350  1.00 22.00 ? 131 LYS B CA  1 
ATOM   2504 C  C   . LYS B 1 132 ? -11.818 46.107 44.088  1.00 21.43 ? 131 LYS B C   1 
ATOM   2505 O  O   . LYS B 1 132 ? -12.847 46.716 43.825  1.00 22.13 ? 131 LYS B O   1 
ATOM   2506 C  CB  . LYS B 1 132 ? -11.052 46.032 46.479  1.00 23.32 ? 131 LYS B CB  1 
ATOM   2507 C  CG  . LYS B 1 132 ? -11.850 47.250 46.951  1.00 27.96 ? 131 LYS B CG  1 
ATOM   2508 N  N   . ARG B 1 133 ? -10.741 46.159 43.313  1.00 22.44 ? 132 ARG B N   1 
ATOM   2509 C  CA  . ARG B 1 133 ? -10.764 46.855 42.031  1.00 23.19 ? 132 ARG B CA  1 
ATOM   2510 C  C   . ARG B 1 133 ? -11.722 46.168 41.084  1.00 24.18 ? 132 ARG B C   1 
ATOM   2511 O  O   . ARG B 1 133 ? -12.446 46.835 40.350  1.00 25.32 ? 132 ARG B O   1 
ATOM   2512 C  CB  . ARG B 1 133 ? -9.363  46.923 41.395  1.00 23.78 ? 132 ARG B CB  1 
ATOM   2513 C  CG  . ARG B 1 133 ? -9.341  47.659 40.042  1.00 23.63 ? 132 ARG B CG  1 
ATOM   2514 C  CD  . ARG B 1 133 ? -7.948  47.930 39.546  1.00 23.08 ? 132 ARG B CD  1 
ATOM   2515 N  NE  . ARG B 1 133 ? -7.323  46.723 39.016  1.00 21.22 ? 132 ARG B NE  1 
ATOM   2516 C  CZ  . ARG B 1 133 ? -6.019  46.569 38.844  1.00 19.50 ? 132 ARG B CZ  1 
ATOM   2517 N  NH1 . ARG B 1 133 ? -5.163  47.539 39.166  1.00 18.16 ? 132 ARG B NH1 1 
ATOM   2518 N  NH2 . ARG B 1 133 ? -5.560  45.431 38.356  1.00 17.80 ? 132 ARG B NH2 1 
ATOM   2519 N  N   . GLY B 1 134 ? -11.730 44.831 41.116  1.00 26.78 ? 133 GLY B N   1 
ATOM   2520 C  CA  . GLY B 1 134 ? -12.580 44.019 40.248  1.00 27.96 ? 133 GLY B CA  1 
ATOM   2521 C  C   . GLY B 1 134 ? -14.063 44.319 40.364  1.00 31.84 ? 133 GLY B C   1 
ATOM   2522 O  O   . GLY B 1 134 ? -14.793 44.199 39.388  1.00 32.40 ? 133 GLY B O   1 
ATOM   2523 N  N   . GLU B 1 135 ? -14.502 44.713 41.558  1.00 35.90 ? 134 GLU B N   1 
ATOM   2524 C  CA  . GLU B 1 135 ? -15.898 45.102 41.806  1.00 39.36 ? 134 GLU B CA  1 
ATOM   2525 C  C   . GLU B 1 135 ? -16.365 46.154 40.800  1.00 42.41 ? 134 GLU B C   1 
ATOM   2526 O  O   . GLU B 1 135 ? -17.455 46.054 40.235  1.00 43.27 ? 134 GLU B O   1 
ATOM   2527 C  CB  . GLU B 1 135 ? -16.051 45.664 43.231  1.00 39.04 ? 134 GLU B CB  1 
ATOM   2528 C  CG  . GLU B 1 135 ? -15.839 44.643 44.349  1.00 38.73 ? 134 GLU B CG  1 
ATOM   2529 C  CD  . GLU B 1 135 ? -15.714 45.265 45.747  1.00 41.54 ? 134 GLU B CD  1 
ATOM   2530 O  OE1 . GLU B 1 135 ? -15.163 44.591 46.647  1.00 49.46 ? 134 GLU B OE1 1 
ATOM   2531 O  OE2 . GLU B 1 135 ? -16.164 46.413 45.962  1.00 44.39 ? 134 GLU B OE2 1 
ATOM   2532 N  N   . THR B 1 136 ? -15.507 47.143 40.565  1.00 44.93 ? 135 THR B N   1 
ATOM   2533 C  CA  . THR B 1 136 ? -15.877 48.352 39.846  1.00 47.48 ? 135 THR B CA  1 
ATOM   2534 C  C   . THR B 1 136 ? -15.255 48.453 38.448  1.00 48.40 ? 135 THR B C   1 
ATOM   2535 O  O   . THR B 1 136 ? -15.900 48.929 37.513  1.00 49.42 ? 135 THR B O   1 
ATOM   2536 C  CB  . THR B 1 136 ? -15.493 49.604 40.694  1.00 47.18 ? 135 THR B CB  1 
ATOM   2537 O  OG1 . THR B 1 136 ? -16.221 50.749 40.236  1.00 51.41 ? 135 THR B OG1 1 
ATOM   2538 C  CG2 . THR B 1 136 ? -13.982 49.895 40.648  1.00 48.96 ? 135 THR B CG2 1 
ATOM   2539 N  N   . SER B 1 137 ? -14.017 47.986 38.306  1.00 49.47 ? 136 SER B N   1 
ATOM   2540 C  CA  . SER B 1 137 ? -13.215 48.247 37.108  1.00 49.79 ? 136 SER B CA  1 
ATOM   2541 C  C   . SER B 1 137 ? -13.720 47.541 35.852  1.00 49.22 ? 136 SER B C   1 
ATOM   2542 O  O   . SER B 1 137 ? -14.700 46.785 35.892  1.00 50.51 ? 136 SER B O   1 
ATOM   2543 C  CB  . SER B 1 137 ? -11.738 47.881 37.352  1.00 50.55 ? 136 SER B CB  1 
ATOM   2544 O  OG  . SER B 1 137 ? -11.512 46.475 37.310  1.00 53.41 ? 136 SER B OG  1 
ATOM   2545 N  N   . GLY B 1 138 ? -13.038 47.812 34.738  1.00 47.27 ? 137 GLY B N   1 
ATOM   2546 C  CA  . GLY B 1 138 ? -13.303 47.155 33.459  1.00 45.62 ? 137 GLY B CA  1 
ATOM   2547 C  C   . GLY B 1 138 ? -12.185 46.231 32.994  1.00 42.92 ? 137 GLY B C   1 
ATOM   2548 O  O   . GLY B 1 138 ? -12.241 45.698 31.874  1.00 43.04 ? 137 GLY B O   1 
ATOM   2549 N  N   . ARG B 1 139 ? -11.173 46.025 33.841  1.00 38.66 ? 138 ARG B N   1 
ATOM   2550 C  CA  . ARG B 1 139 ? -10.066 45.150 33.483  1.00 34.00 ? 138 ARG B CA  1 
ATOM   2551 C  C   . ARG B 1 139 ? -10.503 43.690 33.394  1.00 31.05 ? 138 ARG B C   1 
ATOM   2552 O  O   . ARG B 1 139 ? -11.229 43.176 34.237  1.00 32.71 ? 138 ARG B O   1 
ATOM   2553 C  CB  . ARG B 1 139 ? -8.858  45.309 34.411  1.00 34.35 ? 138 ARG B CB  1 
ATOM   2554 C  CG  . ARG B 1 139 ? -7.768  46.151 33.790  1.00 30.59 ? 138 ARG B CG  1 
ATOM   2555 C  CD  . ARG B 1 139 ? -6.612  46.382 34.711  1.00 25.29 ? 138 ARG B CD  1 
ATOM   2556 N  NE  . ARG B 1 139 ? -5.711  45.235 34.783  1.00 25.45 ? 138 ARG B NE  1 
ATOM   2557 C  CZ  . ARG B 1 139 ? -4.431  45.314 35.146  1.00 20.41 ? 138 ARG B CZ  1 
ATOM   2558 N  NH1 . ARG B 1 139 ? -3.878  46.482 35.457  1.00 20.39 ? 138 ARG B NH1 1 
ATOM   2559 N  NH2 . ARG B 1 139 ? -3.706  44.223 35.202  1.00 20.85 ? 138 ARG B NH2 1 
ATOM   2560 N  N   . VAL B 1 140 ? -10.020 43.046 32.346  1.00 27.94 ? 139 VAL B N   1 
ATOM   2561 C  CA  . VAL B 1 140 ? -10.452 41.723 31.933  1.00 28.73 ? 139 VAL B CA  1 
ATOM   2562 C  C   . VAL B 1 140 ? -9.693  40.649 32.714  1.00 26.54 ? 139 VAL B C   1 
ATOM   2563 O  O   . VAL B 1 140 ? -10.019 39.467 32.629  1.00 27.14 ? 139 VAL B O   1 
ATOM   2564 C  CB  . VAL B 1 140 ? -10.252 41.601 30.387  1.00 30.41 ? 139 VAL B CB  1 
ATOM   2565 C  CG1 . VAL B 1 140 ? -10.509 40.243 29.889  1.00 39.24 ? 139 VAL B CG1 1 
ATOM   2566 C  CG2 . VAL B 1 140 ? -11.197 42.566 29.664  1.00 39.01 ? 139 VAL B CG2 1 
ATOM   2567 N  N   . ASP B 1 141 ? -8.694  41.043 33.498  1.00 23.46 ? 140 ASP B N   1 
ATOM   2568 C  CA  . ASP B 1 141 ? -7.892  40.065 34.225  1.00 21.44 ? 140 ASP B CA  1 
ATOM   2569 C  C   . ASP B 1 141 ? -7.996  40.118 35.770  1.00 20.42 ? 140 ASP B C   1 
ATOM   2570 O  O   . ASP B 1 141 ? -7.223  39.438 36.444  1.00 20.47 ? 140 ASP B O   1 
ATOM   2571 C  CB  . ASP B 1 141 ? -6.428  40.161 33.754  1.00 22.45 ? 140 ASP B CB  1 
ATOM   2572 C  CG  . ASP B 1 141 ? -5.807  41.524 34.009  1.00 18.27 ? 140 ASP B CG  1 
ATOM   2573 O  OD1 . ASP B 1 141 ? -4.565  41.655 33.802  1.00 23.75 ? 140 ASP B OD1 1 
ATOM   2574 O  OD2 . ASP B 1 141 ? -6.551  42.446 34.409  1.00 22.40 ? 140 ASP B OD2 1 
ATOM   2575 N  N   . ASP B 1 142 ? -8.958  40.872 36.316  1.00 17.73 ? 141 ASP B N   1 
ATOM   2576 C  CA  . ASP B 1 142 ? -9.125  41.016 37.790  1.00 20.03 ? 141 ASP B CA  1 
ATOM   2577 C  C   . ASP B 1 142 ? -10.119 40.029 38.420  1.00 18.44 ? 141 ASP B C   1 
ATOM   2578 O  O   . ASP B 1 142 ? -10.478 40.165 39.582  1.00 20.56 ? 141 ASP B O   1 
ATOM   2579 C  CB  . ASP B 1 142 ? -9.571  42.449 38.162  1.00 20.56 ? 141 ASP B CB  1 
ATOM   2580 C  CG  . ASP B 1 142 ? -8.457  43.494 38.029  1.00 23.78 ? 141 ASP B CG  1 
ATOM   2581 O  OD1 . ASP B 1 142 ? -8.828  44.677 37.902  1.00 24.16 ? 141 ASP B OD1 1 
ATOM   2582 O  OD2 . ASP B 1 142 ? -7.237  43.177 38.061  1.00 19.17 ? 141 ASP B OD2 1 
ATOM   2583 N  N   . ASN B 1 143 ? -10.599 39.057 37.656  1.00 17.95 ? 142 ASN B N   1 
ATOM   2584 C  CA  . ASN B 1 143 ? -11.408 37.981 38.207  1.00 16.78 ? 142 ASN B CA  1 
ATOM   2585 C  C   . ASN B 1 143 ? -10.552 37.056 39.064  1.00 16.07 ? 142 ASN B C   1 
ATOM   2586 O  O   . ASN B 1 143 ? -9.370  36.884 38.806  1.00 15.90 ? 142 ASN B O   1 
ATOM   2587 C  CB  . ASN B 1 143 ? -12.120 37.192 37.087  1.00 17.03 ? 142 ASN B CB  1 
ATOM   2588 C  CG  . ASN B 1 143 ? -11.160 36.626 36.060  1.00 19.32 ? 142 ASN B CG  1 
ATOM   2589 O  OD1 . ASN B 1 143 ? -10.546 37.367 35.290  1.00 27.80 ? 142 ASN B OD1 1 
ATOM   2590 N  ND2 . ASN B 1 143 ? -11.019 35.310 36.041  1.00 10.65 ? 142 ASN B ND2 1 
ATOM   2591 N  N   . GLU B 1 144 ? -11.162 36.474 40.092  1.00 15.83 ? 143 GLU B N   1 
ATOM   2592 C  CA  . GLU B 1 144 ? -10.446 35.658 41.097  1.00 17.54 ? 143 GLU B CA  1 
ATOM   2593 C  C   . GLU B 1 144 ? -9.587  34.513 40.519  1.00 17.71 ? 143 GLU B C   1 
ATOM   2594 O  O   . GLU B 1 144 ? -8.478  34.287 40.990  1.00 18.70 ? 143 GLU B O   1 
ATOM   2595 C  CB  . GLU B 1 144 ? -11.410 35.148 42.186  1.00 18.76 ? 143 GLU B CB  1 
ATOM   2596 C  CG  . GLU B 1 144 ? -12.623 34.366 41.695  1.00 23.21 ? 143 GLU B CG  1 
ATOM   2597 C  CD  . GLU B 1 144 ? -13.835 35.238 41.246  1.00 33.13 ? 143 GLU B CD  1 
ATOM   2598 O  OE1 . GLU B 1 144 ? -14.989 34.844 41.547  1.00 33.38 ? 143 GLU B OE1 1 
ATOM   2599 O  OE2 . GLU B 1 144 ? -13.651 36.295 40.580  1.00 32.42 ? 143 GLU B OE2 1 
ATOM   2600 N  N   . GLU B 1 145 ? -10.048 33.848 39.467  1.00 17.93 ? 144 GLU B N   1 
ATOM   2601 C  CA  . GLU B 1 145 ? -9.276  32.734 38.881  1.00 18.58 ? 144 GLU B CA  1 
ATOM   2602 C  C   . GLU B 1 145 ? -8.027  33.225 38.140  1.00 18.76 ? 144 GLU B C   1 
ATOM   2603 O  O   . GLU B 1 145 ? -6.964  32.579 38.161  1.00 18.03 ? 144 GLU B O   1 
ATOM   2604 C  CB  . GLU B 1 145 ? -10.140 31.889 37.942  1.00 17.24 ? 144 GLU B CB  1 
ATOM   2605 C  CG  . GLU B 1 145 ? -11.473 31.490 38.511  1.00 15.95 ? 144 GLU B CG  1 
ATOM   2606 C  CD  . GLU B 1 145 ? -12.603 32.435 38.125  1.00 14.40 ? 144 GLU B CD  1 
ATOM   2607 O  OE1 . GLU B 1 145 ? -12.374 33.656 38.057  1.00 13.85 ? 144 GLU B OE1 1 
ATOM   2608 O  OE2 . GLU B 1 145 ? -13.727 31.959 37.898  1.00 14.06 ? 144 GLU B OE2 1 
ATOM   2609 N  N   . THR B 1 146 ? -8.142  34.390 37.511  1.00 17.87 ? 145 THR B N   1 
ATOM   2610 C  CA  . THR B 1 146 ? -7.043  34.957 36.793  1.00 15.82 ? 145 THR B CA  1 
ATOM   2611 C  C   . THR B 1 146 ? -6.033  35.641 37.727  1.00 16.28 ? 145 THR B C   1 
ATOM   2612 O  O   . THR B 1 146 ? -4.844  35.630 37.438  1.00 17.02 ? 145 THR B O   1 
ATOM   2613 C  CB  . THR B 1 146 ? -7.539  35.899 35.685  1.00 16.05 ? 145 THR B CB  1 
ATOM   2614 O  OG1 . THR B 1 146 ? -8.289  35.121 34.739  1.00 16.23 ? 145 THR B OG1 1 
ATOM   2615 C  CG2 . THR B 1 146 ? -6.410  36.560 34.971  1.00 19.29 ? 145 THR B CG2 1 
ATOM   2616 N  N   . ILE B 1 147 ? -6.509  36.235 38.820  1.00 15.89 ? 146 ILE B N   1 
ATOM   2617 C  CA  . ILE B 1 147 ? -5.620  36.746 39.868  1.00 15.95 ? 146 ILE B CA  1 
ATOM   2618 C  C   . ILE B 1 147 ? -4.667  35.626 40.314  1.00 17.30 ? 146 ILE B C   1 
ATOM   2619 O  O   . ILE B 1 147 ? -3.452  35.831 40.424  1.00 17.52 ? 146 ILE B O   1 
ATOM   2620 C  CB  . ILE B 1 147 ? -6.406  37.311 41.066  1.00 14.90 ? 146 ILE B CB  1 
ATOM   2621 C  CG1 . ILE B 1 147 ? -7.161  38.584 40.679  1.00 17.34 ? 146 ILE B CG1 1 
ATOM   2622 C  CG2 . ILE B 1 147 ? -5.460  37.668 42.230  1.00 18.59 ? 146 ILE B CG2 1 
ATOM   2623 C  CD1 . ILE B 1 147 ? -8.122  39.078 41.775  1.00 19.32 ? 146 ILE B CD1 1 
ATOM   2624 N  N   . LYS B 1 148 ? -5.219  34.449 40.567  1.00 15.31 ? 147 LYS B N   1 
ATOM   2625 C  CA  . LYS B 1 148 ? -4.430  33.296 40.998  1.00 16.42 ? 147 LYS B CA  1 
ATOM   2626 C  C   . LYS B 1 148 ? -3.335  32.911 40.018  1.00 16.49 ? 147 LYS B C   1 
ATOM   2627 O  O   . LYS B 1 148 ? -2.187  32.692 40.408  1.00 13.93 ? 147 LYS B O   1 
ATOM   2628 C  CB  . LYS B 1 148 ? -5.327  32.099 41.200  1.00 18.91 ? 147 LYS B CB  1 
ATOM   2629 C  CG  . LYS B 1 148 ? -6.133  32.147 42.479  1.00 26.16 ? 147 LYS B CG  1 
ATOM   2630 C  CD  . LYS B 1 148 ? -6.715  30.788 42.802  1.00 27.65 ? 147 LYS B CD  1 
ATOM   2631 C  CE  . LYS B 1 148 ? -7.319  30.786 44.200  1.00 35.80 ? 147 LYS B CE  1 
ATOM   2632 N  NZ  . LYS B 1 148 ? -8.754  31.153 44.169  1.00 35.94 ? 147 LYS B NZ  1 
ATOM   2633 N  N   . LYS B 1 149 ? -3.668  32.904 38.732  1.00 16.23 ? 148 LYS B N   1 
ATOM   2634 C  CA  . LYS B 1 149 ? -2.692  32.625 37.697  1.00 14.85 ? 148 LYS B CA  1 
ATOM   2635 C  C   . LYS B 1 149 ? -1.617  33.692 37.562  1.00 16.07 ? 148 LYS B C   1 
ATOM   2636 O  O   . LYS B 1 149 ? -0.450  33.361 37.327  1.00 15.55 ? 148 LYS B O   1 
ATOM   2637 C  CB  . LYS B 1 149 ? -3.413  32.409 36.373  1.00 16.37 ? 148 LYS B CB  1 
ATOM   2638 C  CG  . LYS B 1 149 ? -4.289  31.157 36.412  1.00 21.20 ? 148 LYS B CG  1 
ATOM   2639 C  CD  . LYS B 1 149 ? -5.113  30.981 35.137  1.00 21.84 ? 148 LYS B CD  1 
ATOM   2640 C  CE  . LYS B 1 149 ? -5.913  29.678 35.157  1.00 35.12 ? 148 LYS B CE  1 
ATOM   2641 N  NZ  . LYS B 1 149 ? -6.212  29.202 33.774  1.00 39.57 ? 148 LYS B NZ  1 
ATOM   2642 N  N   . ARG B 1 150 ? -1.998  34.970 37.710  1.00 13.83 ? 149 ARG B N   1 
ATOM   2643 C  CA  . ARG B 1 150 ? -1.047  36.074 37.637  1.00 14.18 ? 149 ARG B CA  1 
ATOM   2644 C  C   . ARG B 1 150 ? -0.020  36.007 38.726  1.00 16.39 ? 149 ARG B C   1 
ATOM   2645 O  O   . ARG B 1 150 ? 1.152   36.331 38.493  1.00 15.99 ? 149 ARG B O   1 
ATOM   2646 C  CB  . ARG B 1 150 ? -1.766  37.423 37.688  1.00 13.43 ? 149 ARG B CB  1 
ATOM   2647 C  CG  . ARG B 1 150 ? -2.588  37.714 36.408  1.00 13.05 ? 149 ARG B CG  1 
ATOM   2648 C  CD  . ARG B 1 150 ? -3.646  38.726 36.682  1.00 18.10 ? 149 ARG B CD  1 
ATOM   2649 N  NE  . ARG B 1 150 ? -3.055  40.010 37.050  1.00 14.01 ? 149 ARG B NE  1 
ATOM   2650 C  CZ  . ARG B 1 150 ? -3.743  41.081 37.447  1.00 17.97 ? 149 ARG B CZ  1 
ATOM   2651 N  NH1 . ARG B 1 150 ? -5.063  41.053 37.563  1.00 21.04 ? 149 ARG B NH1 1 
ATOM   2652 N  NH2 . ARG B 1 150 ? -3.106  42.189 37.737  1.00 21.37 ? 149 ARG B NH2 1 
ATOM   2653 N  N   . LEU B 1 151 ? -0.450  35.551 39.897  1.00 16.91 ? 150 LEU B N   1 
ATOM   2654 C  CA  . LEU B 1 151 ? 0.441   35.341 41.021  1.00 16.91 ? 150 LEU B CA  1 
ATOM   2655 C  C   . LEU B 1 151 ? 1.457   34.223 40.744  1.00 17.06 ? 150 LEU B C   1 
ATOM   2656 O  O   . LEU B 1 151 ? 2.646   34.399 41.008  1.00 17.65 ? 150 LEU B O   1 
ATOM   2657 C  CB  . LEU B 1 151 ? -0.356  35.047 42.311  1.00 16.63 ? 150 LEU B CB  1 
ATOM   2658 C  CG  . LEU B 1 151 ? -1.003  36.218 43.062  1.00 21.93 ? 150 LEU B CG  1 
ATOM   2659 C  CD1 . LEU B 1 151 ? -1.945  35.704 44.112  1.00 21.71 ? 150 LEU B CD1 1 
ATOM   2660 C  CD2 . LEU B 1 151 ? 0.047   37.079 43.699  1.00 24.94 ? 150 LEU B CD2 1 
ATOM   2661 N  N   . GLU B 1 152 ? 0.982   33.084 40.243  1.00 17.26 ? 151 GLU B N   1 
ATOM   2662 C  CA  . GLU B 1 152 ? 1.840   31.948 39.919  1.00 18.18 ? 151 GLU B CA  1 
ATOM   2663 C  C   . GLU B 1 152 ? 2.923   32.351 38.923  1.00 18.03 ? 151 GLU B C   1 
ATOM   2664 O  O   . GLU B 1 152 ? 4.105   32.031 39.108  1.00 16.46 ? 151 GLU B O   1 
ATOM   2665 C  CB  . GLU B 1 152 ? 1.009   30.814 39.337  1.00 20.04 ? 151 GLU B CB  1 
ATOM   2666 C  CG  . GLU B 1 152 ? 1.813   29.553 38.942  1.00 26.63 ? 151 GLU B CG  1 
ATOM   2667 N  N   . THR B 1 153 ? 2.509   33.035 37.863  1.00 13.80 ? 152 THR B N   1 
ATOM   2668 C  CA  . THR B 1 153 ? 3.438   33.514 36.840  1.00 16.28 ? 152 THR B CA  1 
ATOM   2669 C  C   . THR B 1 153 ? 4.473   34.489 37.456  1.00 16.71 ? 152 THR B C   1 
ATOM   2670 O  O   . THR B 1 153 ? 5.671   34.450 37.132  1.00 21.08 ? 152 THR B O   1 
ATOM   2671 C  CB  . THR B 1 153 ? 2.679   34.217 35.702  1.00 16.36 ? 152 THR B CB  1 
ATOM   2672 O  OG1 . THR B 1 153 ? 1.724   33.330 35.136  1.00 18.88 ? 152 THR B OG1 1 
ATOM   2673 C  CG2 . THR B 1 153 ? 3.636   34.711 34.617  1.00 16.12 ? 152 THR B CG2 1 
ATOM   2674 N  N   . TYR B 1 154 ? 4.034   35.357 38.347  1.00 17.40 ? 153 TYR B N   1 
ATOM   2675 C  CA  . TYR B 1 154 ? 4.971   36.318 38.957  1.00 17.65 ? 153 TYR B CA  1 
ATOM   2676 C  C   . TYR B 1 154 ? 6.034   35.579 39.764  1.00 18.19 ? 153 TYR B C   1 
ATOM   2677 O  O   . TYR B 1 154 ? 7.243   35.835 39.597  1.00 18.91 ? 153 TYR B O   1 
ATOM   2678 C  CB  . TYR B 1 154 ? 4.261   37.387 39.824  1.00 19.52 ? 153 TYR B CB  1 
ATOM   2679 C  CG  . TYR B 1 154 ? 5.231   38.209 40.674  1.00 16.53 ? 153 TYR B CG  1 
ATOM   2680 C  CD1 . TYR B 1 154 ? 5.950   39.248 40.123  1.00 20.70 ? 153 TYR B CD1 1 
ATOM   2681 C  CD2 . TYR B 1 154 ? 5.470   37.891 42.001  1.00 20.36 ? 153 TYR B CD2 1 
ATOM   2682 C  CE1 . TYR B 1 154 ? 6.867   39.960 40.879  1.00 19.87 ? 153 TYR B CE1 1 
ATOM   2683 C  CE2 . TYR B 1 154 ? 6.366   38.606 42.763  1.00 20.91 ? 153 TYR B CE2 1 
ATOM   2684 C  CZ  . TYR B 1 154 ? 7.067   39.637 42.197  1.00 17.19 ? 153 TYR B CZ  1 
ATOM   2685 O  OH  . TYR B 1 154 ? 7.977   40.340 42.953  1.00 19.73 ? 153 TYR B OH  1 
ATOM   2686 N  N   . TYR B 1 155 ? 5.610   34.644 40.618  1.00 17.57 ? 154 TYR B N   1 
ATOM   2687 C  CA  . TYR B 1 155 ? 6.580   33.943 41.471  1.00 19.83 ? 154 TYR B CA  1 
ATOM   2688 C  C   . TYR B 1 155 ? 7.516   33.042 40.670  1.00 19.30 ? 154 TYR B C   1 
ATOM   2689 O  O   . TYR B 1 155 ? 8.698   32.937 40.993  1.00 19.36 ? 154 TYR B O   1 
ATOM   2690 C  CB  . TYR B 1 155 ? 5.901   33.173 42.609  1.00 18.29 ? 154 TYR B CB  1 
ATOM   2691 C  CG  . TYR B 1 155 ? 5.250   34.085 43.629  1.00 20.11 ? 154 TYR B CG  1 
ATOM   2692 C  CD1 . TYR B 1 155 ? 5.999   35.007 44.356  1.00 23.52 ? 154 TYR B CD1 1 
ATOM   2693 C  CD2 . TYR B 1 155 ? 3.894   34.030 43.867  1.00 25.10 ? 154 TYR B CD2 1 
ATOM   2694 C  CE1 . TYR B 1 155 ? 5.404   35.843 45.295  1.00 23.58 ? 154 TYR B CE1 1 
ATOM   2695 C  CE2 . TYR B 1 155 ? 3.293   34.861 44.790  1.00 21.21 ? 154 TYR B CE2 1 
ATOM   2696 C  CZ  . TYR B 1 155 ? 4.047   35.762 45.513  1.00 26.70 ? 154 TYR B CZ  1 
ATOM   2697 O  OH  . TYR B 1 155 ? 3.419   36.581 46.449  1.00 24.08 ? 154 TYR B OH  1 
ATOM   2698 N  N   . LYS B 1 156 ? 7.017   32.452 39.599  1.00 17.88 ? 155 LYS B N   1 
ATOM   2699 C  CA  . LYS B 1 156 ? 7.843   31.563 38.767  1.00 18.68 ? 155 LYS B CA  1 
ATOM   2700 C  C   . LYS B 1 156 ? 8.857   32.296 37.861  1.00 19.21 ? 155 LYS B C   1 
ATOM   2701 O  O   . LYS B 1 156 ? 10.033  31.949 37.818  1.00 15.88 ? 155 LYS B O   1 
ATOM   2702 C  CB  . LYS B 1 156 ? 6.947   30.691 37.902  1.00 20.48 ? 155 LYS B CB  1 
ATOM   2703 C  CG  . LYS B 1 156 ? 7.656   29.455 37.369  1.00 25.92 ? 155 LYS B CG  1 
ATOM   2704 C  CD  . LYS B 1 156 ? 6.944   28.901 36.148  1.00 33.09 ? 155 LYS B CD  1 
ATOM   2705 N  N   . ALA B 1 157 ? 8.396   33.327 37.163  1.00 19.00 ? 156 ALA B N   1 
ATOM   2706 C  CA  . ALA B 1 157 ? 9.174   33.963 36.103  1.00 19.61 ? 156 ALA B CA  1 
ATOM   2707 C  C   . ALA B 1 157 ? 9.852   35.264 36.569  1.00 19.74 ? 156 ALA B C   1 
ATOM   2708 O  O   . ALA B 1 157 ? 11.035  35.525 36.247  1.00 19.06 ? 156 ALA B O   1 
ATOM   2709 C  CB  . ALA B 1 157 ? 8.257   34.229 34.886  1.00 20.35 ? 156 ALA B CB  1 
ATOM   2710 N  N   . THR B 1 158 ? 9.105   36.057 37.342  1.00 20.37 ? 157 THR B N   1 
ATOM   2711 C  CA  . THR B 1 158 ? 9.501   37.418 37.648  1.00 19.31 ? 157 THR B CA  1 
ATOM   2712 C  C   . THR B 1 158 ? 10.355  37.522 38.900  1.00 21.04 ? 157 THR B C   1 
ATOM   2713 O  O   . THR B 1 158 ? 11.332  38.256 38.898  1.00 18.94 ? 157 THR B O   1 
ATOM   2714 C  CB  . THR B 1 158 ? 8.272   38.373 37.715  1.00 19.53 ? 157 THR B CB  1 
ATOM   2715 O  OG1 . THR B 1 158 ? 7.510   38.254 36.505  1.00 18.01 ? 157 THR B OG1 1 
ATOM   2716 C  CG2 . THR B 1 158 ? 8.694   39.784 37.848  1.00 21.13 ? 157 THR B CG2 1 
ATOM   2717 N  N   . GLU B 1 159 ? 10.058  36.779 39.964  1.00 19.69 ? 158 GLU B N   1 
ATOM   2718 C  CA  . GLU B 1 159 ? 10.816  37.033 41.187  1.00 22.75 ? 158 GLU B CA  1 
ATOM   2719 C  C   . GLU B 1 159 ? 12.337  36.722 41.051  1.00 22.47 ? 158 GLU B C   1 
ATOM   2720 O  O   . GLU B 1 159 ? 13.158  37.403 41.659  1.00 23.07 ? 158 GLU B O   1 
ATOM   2721 C  CB  . GLU B 1 159 ? 10.164  36.392 42.439  1.00 24.26 ? 158 GLU B CB  1 
ATOM   2722 C  CG  . GLU B 1 159 ? 10.460  37.217 43.696  1.00 29.34 ? 158 GLU B CG  1 
ATOM   2723 C  CD  . GLU B 1 159 ? 9.491   36.992 44.846  1.00 37.12 ? 158 GLU B CD  1 
ATOM   2724 O  OE1 . GLU B 1 159 ? 9.318   35.820 45.217  1.00 16.58 ? 158 GLU B OE1 1 
ATOM   2725 O  OE2 . GLU B 1 159 ? 8.940   37.993 45.387  1.00 39.14 ? 158 GLU B OE2 1 
ATOM   2726 N  N   . PRO B 1 160 ? 12.725  35.755 40.199  1.00 21.33 ? 159 PRO B N   1 
ATOM   2727 C  CA  . PRO B 1 160 ? 14.133  35.618 39.791  1.00 22.72 ? 159 PRO B CA  1 
ATOM   2728 C  C   . PRO B 1 160 ? 14.837  36.832 39.163  1.00 22.73 ? 159 PRO B C   1 
ATOM   2729 O  O   . PRO B 1 160 ? 16.061  36.895 39.249  1.00 24.44 ? 159 PRO B O   1 
ATOM   2730 C  CB  . PRO B 1 160 ? 14.089  34.466 38.777  1.00 21.20 ? 159 PRO B CB  1 
ATOM   2731 C  CG  . PRO B 1 160 ? 12.908  33.647 39.223  1.00 18.60 ? 159 PRO B CG  1 
ATOM   2732 C  CD  . PRO B 1 160 ? 11.903  34.668 39.628  1.00 24.12 ? 159 PRO B CD  1 
ATOM   2733 N  N   . VAL B 1 161 ? 14.106  37.751 38.528  1.00 22.17 ? 160 VAL B N   1 
ATOM   2734 C  CA  . VAL B 1 161 ? 14.673  39.007 38.006  1.00 23.20 ? 160 VAL B CA  1 
ATOM   2735 C  C   . VAL B 1 161 ? 15.361  39.781 39.138  1.00 23.59 ? 160 VAL B C   1 
ATOM   2736 O  O   . VAL B 1 161 ? 16.430  40.397 38.928  1.00 19.76 ? 160 VAL B O   1 
ATOM   2737 C  CB  . VAL B 1 161 ? 13.572  39.873 37.347  1.00 23.80 ? 160 VAL B CB  1 
ATOM   2738 C  CG1 . VAL B 1 161 ? 14.006  41.319 37.163  1.00 29.55 ? 160 VAL B CG1 1 
ATOM   2739 C  CG2 . VAL B 1 161 ? 13.167  39.277 36.007  1.00 24.61 ? 160 VAL B CG2 1 
ATOM   2740 N  N   . ILE B 1 162 ? 14.753  39.730 40.331  1.00 21.82 ? 161 ILE B N   1 
ATOM   2741 C  CA  . ILE B 1 162 ? 15.276  40.423 41.525  1.00 22.77 ? 161 ILE B CA  1 
ATOM   2742 C  C   . ILE B 1 162 ? 16.671  39.948 41.902  1.00 23.23 ? 161 ILE B C   1 
ATOM   2743 O  O   . ILE B 1 162 ? 17.582  40.760 42.078  1.00 21.92 ? 161 ILE B O   1 
ATOM   2744 C  CB  . ILE B 1 162 ? 14.364  40.247 42.803  1.00 23.09 ? 161 ILE B CB  1 
ATOM   2745 C  CG1 . ILE B 1 162 ? 12.908  40.687 42.565  1.00 29.06 ? 161 ILE B CG1 1 
ATOM   2746 C  CG2 . ILE B 1 162 ? 14.957  41.009 43.987  1.00 27.18 ? 161 ILE B CG2 1 
ATOM   2747 C  CD1 . ILE B 1 162 ? 12.715  42.133 42.264  1.00 30.78 ? 161 ILE B CD1 1 
ATOM   2748 N  N   . ALA B 1 163 ? 16.831  38.640 42.069  1.00 21.90 ? 162 ALA B N   1 
ATOM   2749 C  CA  . ALA B 1 163 ? 18.125  38.066 42.409  1.00 22.22 ? 162 ALA B CA  1 
ATOM   2750 C  C   . ALA B 1 163 ? 19.184  38.384 41.323  1.00 22.75 ? 162 ALA B C   1 
ATOM   2751 O  O   . ALA B 1 163 ? 20.337  38.691 41.635  1.00 20.62 ? 162 ALA B O   1 
ATOM   2752 C  CB  . ALA B 1 163 ? 17.988  36.583 42.600  1.00 21.93 ? 162 ALA B CB  1 
ATOM   2753 N  N   . PHE B 1 164 ? 18.771  38.302 40.058  1.00 21.02 ? 163 PHE B N   1 
ATOM   2754 C  CA  . PHE B 1 164 ? 19.614  38.667 38.924  1.00 21.01 ? 163 PHE B CA  1 
ATOM   2755 C  C   . PHE B 1 164 ? 20.192  40.118 39.008  1.00 19.20 ? 163 PHE B C   1 
ATOM   2756 O  O   . PHE B 1 164 ? 21.405  40.315 38.833  1.00 18.58 ? 163 PHE B O   1 
ATOM   2757 C  CB  . PHE B 1 164 ? 18.809  38.454 37.636  1.00 21.38 ? 163 PHE B CB  1 
ATOM   2758 C  CG  . PHE B 1 164 ? 19.545  38.810 36.383  1.00 22.06 ? 163 PHE B CG  1 
ATOM   2759 C  CD1 . PHE B 1 164 ? 20.372  37.896 35.779  1.00 25.60 ? 163 PHE B CD1 1 
ATOM   2760 C  CD2 . PHE B 1 164 ? 19.380  40.052 35.791  1.00 24.37 ? 163 PHE B CD2 1 
ATOM   2761 C  CE1 . PHE B 1 164 ? 21.041  38.212 34.628  1.00 29.31 ? 163 PHE B CE1 1 
ATOM   2762 C  CE2 . PHE B 1 164 ? 20.049  40.372 34.630  1.00 26.86 ? 163 PHE B CE2 1 
ATOM   2763 C  CZ  . PHE B 1 164 ? 20.882  39.435 34.051  1.00 24.78 ? 163 PHE B CZ  1 
ATOM   2764 N  N   . TYR B 1 165 ? 19.342  41.109 39.283  1.00 17.22 ? 164 TYR B N   1 
ATOM   2765 C  CA  . TYR B 1 165 ? 19.802  42.505 39.398  1.00 15.99 ? 164 TYR B CA  1 
ATOM   2766 C  C   . TYR B 1 165 ? 20.450  42.835 40.766  1.00 16.39 ? 164 TYR B C   1 
ATOM   2767 O  O   . TYR B 1 165 ? 21.251  43.768 40.856  1.00 16.24 ? 164 TYR B O   1 
ATOM   2768 C  CB  . TYR B 1 165 ? 18.686  43.501 39.013  1.00 16.30 ? 164 TYR B CB  1 
ATOM   2769 C  CG  . TYR B 1 165 ? 18.452  43.486 37.536  1.00 14.09 ? 164 TYR B CG  1 
ATOM   2770 C  CD1 . TYR B 1 165 ? 19.399  44.016 36.663  1.00 16.44 ? 164 TYR B CD1 1 
ATOM   2771 C  CD2 . TYR B 1 165 ? 17.316  42.882 36.994  1.00 17.11 ? 164 TYR B CD2 1 
ATOM   2772 C  CE1 . TYR B 1 165 ? 19.219  43.964 35.278  1.00 21.08 ? 164 TYR B CE1 1 
ATOM   2773 C  CE2 . TYR B 1 165 ? 17.109  42.839 35.598  1.00 23.49 ? 164 TYR B CE2 1 
ATOM   2774 C  CZ  . TYR B 1 165 ? 18.060  43.383 34.752  1.00 27.71 ? 164 TYR B CZ  1 
ATOM   2775 O  OH  . TYR B 1 165 ? 17.870  43.335 33.385  1.00 23.38 ? 164 TYR B OH  1 
ATOM   2776 N  N   . GLU B 1 166 ? 20.154  42.062 41.809  1.00 16.90 ? 165 GLU B N   1 
ATOM   2777 C  CA  A GLU B 1 166 ? 20.814  42.276 43.103  0.50 19.21 ? 165 GLU B CA  1 
ATOM   2778 C  CA  B GLU B 1 166 ? 20.803  42.257 43.109  0.50 18.85 ? 165 GLU B CA  1 
ATOM   2779 C  C   . GLU B 1 166 ? 22.337  42.148 42.997  1.00 19.09 ? 165 GLU B C   1 
ATOM   2780 O  O   . GLU B 1 166 ? 23.073  42.844 43.683  1.00 17.55 ? 165 GLU B O   1 
ATOM   2781 C  CB  A GLU B 1 166 ? 20.261  41.332 44.173  0.50 17.61 ? 165 GLU B CB  1 
ATOM   2782 C  CB  B GLU B 1 166 ? 20.239  41.251 44.121  0.50 17.88 ? 165 GLU B CB  1 
ATOM   2783 C  CG  A GLU B 1 166 ? 18.870  41.718 44.623  0.50 22.67 ? 165 GLU B CG  1 
ATOM   2784 C  CG  B GLU B 1 166 ? 20.924  41.220 45.480  0.50 22.63 ? 165 GLU B CG  1 
ATOM   2785 C  CD  A GLU B 1 166 ? 18.358  40.931 45.817  0.50 21.62 ? 165 GLU B CD  1 
ATOM   2786 C  CD  B GLU B 1 166 ? 20.795  42.511 46.262  0.50 26.20 ? 165 GLU B CD  1 
ATOM   2787 O  OE1 A GLU B 1 166 ? 18.832  39.799 46.065  0.50 22.63 ? 165 GLU B OE1 1 
ATOM   2788 O  OE1 B GLU B 1 166 ? 19.863  43.286 46.000  0.50 23.41 ? 165 GLU B OE1 1 
ATOM   2789 O  OE2 A GLU B 1 166 ? 17.465  41.467 46.505  0.50 24.10 ? 165 GLU B OE2 1 
ATOM   2790 O  OE2 B GLU B 1 166 ? 21.630  42.743 47.158  0.50 30.40 ? 165 GLU B OE2 1 
ATOM   2791 N  N   . LYS B 1 167 ? 22.815  41.271 42.109  1.00 21.00 ? 166 LYS B N   1 
ATOM   2792 C  CA  . LYS B 1 167 ? 24.249  41.101 41.872  1.00 21.97 ? 166 LYS B CA  1 
ATOM   2793 C  C   . LYS B 1 167 ? 24.961  42.392 41.380  1.00 20.99 ? 166 LYS B C   1 
ATOM   2794 O  O   . LYS B 1 167 ? 26.208  42.491 41.465  1.00 23.27 ? 166 LYS B O   1 
ATOM   2795 C  CB  . LYS B 1 167 ? 24.476  39.950 40.889  1.00 22.70 ? 166 LYS B CB  1 
ATOM   2796 C  CG  . LYS B 1 167 ? 23.831  38.620 41.323  1.00 26.40 ? 166 LYS B CG  1 
ATOM   2797 C  CD  . LYS B 1 167 ? 24.275  37.441 40.461  1.00 26.10 ? 166 LYS B CD  1 
ATOM   2798 N  N   . ARG B 1 168 ? 24.197  43.363 40.871  1.00 18.42 ? 167 ARG B N   1 
ATOM   2799 C  CA  . ARG B 1 168 ? 24.760  44.675 40.450  1.00 17.29 ? 167 ARG B CA  1 
ATOM   2800 C  C   . ARG B 1 168 ? 24.637  45.798 41.490  1.00 17.43 ? 167 ARG B C   1 
ATOM   2801 O  O   . ARG B 1 168 ? 25.069  46.930 41.228  1.00 17.21 ? 167 ARG B O   1 
ATOM   2802 C  CB  . ARG B 1 168 ? 24.083  45.143 39.168  1.00 19.86 ? 167 ARG B CB  1 
ATOM   2803 C  CG  . ARG B 1 168 ? 24.109  44.085 38.101  1.00 19.73 ? 167 ARG B CG  1 
ATOM   2804 C  CD  . ARG B 1 168 ? 23.511  44.642 36.876  1.00 24.90 ? 167 ARG B CD  1 
ATOM   2805 N  NE  . ARG B 1 168 ? 23.291  43.614 35.894  1.00 24.90 ? 167 ARG B NE  1 
ATOM   2806 C  CZ  . ARG B 1 168 ? 22.840  43.875 34.686  1.00 23.51 ? 167 ARG B CZ  1 
ATOM   2807 N  NH1 . ARG B 1 168 ? 22.585  45.136 34.344  1.00 22.86 ? 167 ARG B NH1 1 
ATOM   2808 N  NH2 . ARG B 1 168 ? 22.672  42.890 33.830  1.00 29.57 ? 167 ARG B NH2 1 
ATOM   2809 N  N   . GLY B 1 169 ? 24.045  45.499 42.651  1.00 15.53 ? 168 GLY B N   1 
ATOM   2810 C  CA  . GLY B 1 169 ? 23.883  46.504 43.716  1.00 16.73 ? 168 GLY B CA  1 
ATOM   2811 C  C   . GLY B 1 169 ? 22.773  47.536 43.507  1.00 16.27 ? 168 GLY B C   1 
ATOM   2812 O  O   . GLY B 1 169 ? 22.644  48.455 44.327  1.00 16.04 ? 168 GLY B O   1 
ATOM   2813 N  N   . ILE B 1 170 ? 21.947  47.373 42.464  1.00 15.58 ? 169 ILE B N   1 
ATOM   2814 C  CA  . ILE B 1 170 ? 20.943  48.413 42.085  1.00 15.27 ? 169 ILE B CA  1 
ATOM   2815 C  C   . ILE B 1 170 ? 19.543  48.217 42.660  1.00 16.20 ? 169 ILE B C   1 
ATOM   2816 O  O   . ILE B 1 170 ? 18.669  49.038 42.408  1.00 14.48 ? 169 ILE B O   1 
ATOM   2817 C  CB  . ILE B 1 170 ? 20.793  48.574 40.539  1.00 17.87 ? 169 ILE B CB  1 
ATOM   2818 C  CG1 . ILE B 1 170 ? 20.142  47.341 39.908  1.00 14.15 ? 169 ILE B CG1 1 
ATOM   2819 C  CG2 . ILE B 1 170 ? 22.118  48.895 39.898  1.00 16.90 ? 169 ILE B CG2 1 
ATOM   2820 C  CD1 . ILE B 1 170 ? 19.808  47.520 38.430  1.00 16.56 ? 169 ILE B CD1 1 
ATOM   2821 N  N   . VAL B 1 171 ? 19.304  47.118 43.378  1.00 16.15 ? 170 VAL B N   1 
ATOM   2822 C  CA  . VAL B 1 171 ? 17.967  46.867 43.943  1.00 16.28 ? 170 VAL B CA  1 
ATOM   2823 C  C   . VAL B 1 171 ? 17.685  47.664 45.230  1.00 14.08 ? 170 VAL B C   1 
ATOM   2824 O  O   . VAL B 1 171 ? 18.518  47.735 46.140  1.00 14.87 ? 170 VAL B O   1 
ATOM   2825 C  CB  . VAL B 1 171 ? 17.719  45.350 44.179  1.00 16.89 ? 170 VAL B CB  1 
ATOM   2826 C  CG1 . VAL B 1 171 ? 16.386  45.098 44.890  1.00 14.33 ? 170 VAL B CG1 1 
ATOM   2827 C  CG2 . VAL B 1 171 ? 17.760  44.606 42.822  1.00 21.47 ? 170 VAL B CG2 1 
ATOM   2828 N  N   . ARG B 1 172 ? 16.490  48.241 45.289  1.00 14.18 ? 171 ARG B N   1 
ATOM   2829 C  CA  . ARG B 1 172 ? 16.003  48.969 46.454  1.00 16.58 ? 171 ARG B CA  1 
ATOM   2830 C  C   . ARG B 1 172 ? 14.586  48.510 46.741  1.00 17.24 ? 171 ARG B C   1 
ATOM   2831 O  O   . ARG B 1 172 ? 13.686  48.709 45.926  1.00 14.67 ? 171 ARG B O   1 
ATOM   2832 C  CB  . ARG B 1 172 ? 15.997  50.476 46.213  1.00 15.72 ? 171 ARG B CB  1 
ATOM   2833 C  CG  . ARG B 1 172 ? 17.332  51.087 45.780  1.00 17.94 ? 171 ARG B CG  1 
ATOM   2834 C  CD  . ARG B 1 172 ? 18.408  51.119 46.852  1.00 20.17 ? 171 ARG B CD  1 
ATOM   2835 N  NE  . ARG B 1 172 ? 19.551  51.909 46.363  1.00 18.84 ? 171 ARG B NE  1 
ATOM   2836 C  CZ  . ARG B 1 172 ? 20.545  51.415 45.616  1.00 23.40 ? 171 ARG B CZ  1 
ATOM   2837 N  NH1 . ARG B 1 172 ? 20.593  50.133 45.304  1.00 15.18 ? 171 ARG B NH1 1 
ATOM   2838 N  NH2 . ARG B 1 172 ? 21.516  52.199 45.191  1.00 20.36 ? 171 ARG B NH2 1 
ATOM   2839 N  N   . LYS B 1 173 ? 14.396  47.931 47.921  1.00 17.96 ? 172 LYS B N   1 
ATOM   2840 C  CA  . LYS B 1 173 ? 13.123  47.345 48.325  1.00 20.22 ? 172 LYS B CA  1 
ATOM   2841 C  C   . LYS B 1 173 ? 12.289  48.327 49.125  1.00 19.12 ? 172 LYS B C   1 
ATOM   2842 O  O   . LYS B 1 173 ? 12.812  49.030 50.000  1.00 17.67 ? 172 LYS B O   1 
ATOM   2843 C  CB  . LYS B 1 173 ? 13.374  46.095 49.184  1.00 22.47 ? 172 LYS B CB  1 
ATOM   2844 C  CG  . LYS B 1 173 ? 12.101  45.394 49.688  1.00 24.65 ? 172 LYS B CG  1 
ATOM   2845 C  CD  . LYS B 1 173 ? 12.402  44.009 50.242  1.00 23.54 ? 172 LYS B CD  1 
ATOM   2846 C  CE  . LYS B 1 173 ? 12.895  44.058 51.661  1.00 30.74 ? 172 LYS B CE  1 
ATOM   2847 N  NZ  . LYS B 1 173 ? 13.875  42.950 51.952  1.00 36.85 ? 172 LYS B NZ  1 
ATOM   2848 N  N   . VAL B 1 174 ? 10.991  48.356 48.843  1.00 19.57 ? 173 VAL B N   1 
ATOM   2849 C  CA  . VAL B 1 174 ? 10.027  49.014 49.717  1.00 19.16 ? 173 VAL B CA  1 
ATOM   2850 C  C   . VAL B 1 174 ? 8.943   48.045 50.188  1.00 18.61 ? 173 VAL B C   1 
ATOM   2851 O  O   . VAL B 1 174 ? 8.462   47.210 49.414  1.00 17.34 ? 173 VAL B O   1 
ATOM   2852 C  CB  . VAL B 1 174 ? 9.369   50.292 49.097  1.00 20.96 ? 173 VAL B CB  1 
ATOM   2853 C  CG1 . VAL B 1 174 ? 10.447  51.281 48.638  1.00 23.99 ? 173 VAL B CG1 1 
ATOM   2854 C  CG2 . VAL B 1 174 ? 8.415   49.959 47.985  1.00 26.48 ? 173 VAL B CG2 1 
ATOM   2855 N  N   . ASN B 1 175 ? 8.561   48.176 51.466  1.00 17.04 ? 174 ASN B N   1 
ATOM   2856 C  CA  . ASN B 1 175 ? 7.460   47.407 52.042  1.00 17.98 ? 174 ASN B CA  1 
ATOM   2857 C  C   . ASN B 1 175 ? 6.143   47.991 51.512  1.00 18.74 ? 174 ASN B C   1 
ATOM   2858 O  O   . ASN B 1 175 ? 5.768   49.101 51.881  1.00 18.36 ? 174 ASN B O   1 
ATOM   2859 C  CB  . ASN B 1 175 ? 7.524   47.468 53.580  1.00 19.11 ? 174 ASN B CB  1 
ATOM   2860 C  CG  . ASN B 1 175 ? 6.427   46.665 54.251  1.00 19.44 ? 174 ASN B CG  1 
ATOM   2861 O  OD1 . ASN B 1 175 ? 5.443   46.287 53.626  1.00 20.80 ? 174 ASN B OD1 1 
ATOM   2862 N  ND2 . ASN B 1 175 ? 6.592   46.409 55.550  1.00 23.55 ? 174 ASN B ND2 1 
ATOM   2863 N  N   . ALA B 1 176 ? 5.464   47.252 50.630  1.00 18.64 ? 175 ALA B N   1 
ATOM   2864 C  CA  . ALA B 1 176 ? 4.344   47.797 49.851  1.00 20.17 ? 175 ALA B CA  1 
ATOM   2865 C  C   . ALA B 1 176 ? 2.981   47.698 50.552  1.00 21.31 ? 175 ALA B C   1 
ATOM   2866 O  O   . ALA B 1 176 ? 1.966   48.126 50.019  1.00 18.77 ? 175 ALA B O   1 
ATOM   2867 C  CB  . ALA B 1 176 ? 4.276   47.129 48.467  1.00 22.38 ? 175 ALA B CB  1 
ATOM   2868 N  N   . GLU B 1 177 ? 2.973   47.145 51.750  1.00 22.67 ? 176 GLU B N   1 
ATOM   2869 C  CA  . GLU B 1 177 ? 1.769   47.075 52.553  1.00 26.07 ? 176 GLU B CA  1 
ATOM   2870 C  C   . GLU B 1 177 ? 1.700   48.305 53.439  1.00 25.95 ? 176 GLU B C   1 
ATOM   2871 O  O   . GLU B 1 177 ? 2.728   48.852 53.852  1.00 29.13 ? 176 GLU B O   1 
ATOM   2872 C  CB  . GLU B 1 177 ? 1.783   45.782 53.361  1.00 27.96 ? 176 GLU B CB  1 
ATOM   2873 C  CG  . GLU B 1 177 ? 2.097   44.578 52.474  1.00 32.24 ? 176 GLU B CG  1 
ATOM   2874 C  CD  . GLU B 1 177 ? 1.710   43.263 53.105  1.00 39.87 ? 176 GLU B CD  1 
ATOM   2875 O  OE1 . GLU B 1 177 ? 1.325   42.345 52.358  1.00 44.95 ? 176 GLU B OE1 1 
ATOM   2876 O  OE2 . GLU B 1 177 ? 1.794   43.148 54.347  1.00 46.00 ? 176 GLU B OE2 1 
ATOM   2877 N  N   . GLY B 1 178 ? 0.489   48.760 53.697  1.00 26.55 ? 177 GLY B N   1 
ATOM   2878 C  CA  . GLY B 1 178 ? 0.282   50.003 54.441  1.00 27.14 ? 177 GLY B CA  1 
ATOM   2879 C  C   . GLY B 1 178 ? -0.253  51.094 53.534  1.00 26.52 ? 177 GLY B C   1 
ATOM   2880 O  O   . GLY B 1 178 ? -0.610  50.838 52.383  1.00 25.64 ? 177 GLY B O   1 
ATOM   2881 N  N   . SER B 1 179 ? -0.312  52.317 54.052  1.00 24.35 ? 178 SER B N   1 
ATOM   2882 C  CA  . SER B 1 179 ? -0.898  53.406 53.286  1.00 22.68 ? 178 SER B CA  1 
ATOM   2883 C  C   . SER B 1 179 ? -0.037  53.781 52.080  1.00 20.32 ? 178 SER B C   1 
ATOM   2884 O  O   . SER B 1 179 ? 1.181   53.591 52.073  1.00 22.27 ? 178 SER B O   1 
ATOM   2885 C  CB  . SER B 1 179 ? -1.079  54.629 54.163  1.00 20.68 ? 178 SER B CB  1 
ATOM   2886 O  OG  . SER B 1 179 ? 0.194   55.200 54.448  1.00 21.08 ? 178 SER B OG  1 
ATOM   2887 N  N   . VAL B 1 180 ? -0.686  54.350 51.079  1.00 19.04 ? 179 VAL B N   1 
ATOM   2888 C  CA  . VAL B 1 180 ? -0.016  54.867 49.888  1.00 19.21 ? 179 VAL B CA  1 
ATOM   2889 C  C   . VAL B 1 180 ? 1.080   55.856 50.275  1.00 18.30 ? 179 VAL B C   1 
ATOM   2890 O  O   . VAL B 1 180 ? 2.154   55.883 49.682  1.00 15.48 ? 179 VAL B O   1 
ATOM   2891 C  CB  . VAL B 1 180 ? -1.052  55.542 48.942  1.00 19.79 ? 179 VAL B CB  1 
ATOM   2892 C  CG1 . VAL B 1 180 ? -0.361  56.340 47.839  1.00 22.37 ? 179 VAL B CG1 1 
ATOM   2893 C  CG2 . VAL B 1 180 ? -1.971  54.487 48.337  1.00 21.00 ? 179 VAL B CG2 1 
ATOM   2894 N  N   . ASP B 1 181 ? 0.810   56.657 51.302  1.00 19.82 ? 180 ASP B N   1 
ATOM   2895 C  CA  . ASP B 1 181 ? 1.777   57.634 51.800  1.00 20.26 ? 180 ASP B CA  1 
ATOM   2896 C  C   . ASP B 1 181 ? 2.973   57.002 52.523  1.00 18.98 ? 180 ASP B C   1 
ATOM   2897 O  O   . ASP B 1 181 ? 4.091   57.499 52.396  1.00 19.12 ? 180 ASP B O   1 
ATOM   2898 C  CB  . ASP B 1 181 ? 1.065   58.627 52.732  1.00 19.48 ? 180 ASP B CB  1 
ATOM   2899 C  CG  . ASP B 1 181 ? 0.153   59.597 51.983  1.00 26.97 ? 180 ASP B CG  1 
ATOM   2900 O  OD1 . ASP B 1 181 ? 0.068   59.532 50.734  1.00 36.31 ? 180 ASP B OD1 1 
ATOM   2901 O  OD2 . ASP B 1 181 ? -0.486  60.436 52.660  1.00 40.93 ? 180 ASP B OD2 1 
ATOM   2902 N  N   . SER B 1 182 ? 2.748   55.927 53.271  1.00 17.45 ? 181 SER B N   1 
ATOM   2903 C  CA  . SER B 1 182 ? 3.846   55.244 53.972  1.00 19.93 ? 181 SER B CA  1 
ATOM   2904 C  C   . SER B 1 182 ? 4.822   54.599 52.977  1.00 18.57 ? 181 SER B C   1 
ATOM   2905 O  O   . SER B 1 182 ? 6.056   54.668 53.143  1.00 15.86 ? 181 SER B O   1 
ATOM   2906 C  CB  . SER B 1 182 ? 3.313   54.191 54.965  1.00 20.70 ? 181 SER B CB  1 
ATOM   2907 O  OG  . SER B 1 182 ? 2.619   53.140 54.298  1.00 22.68 ? 181 SER B OG  1 
ATOM   2908 N  N   . VAL B 1 183 ? 4.260   53.979 51.940  1.00 18.76 ? 182 VAL B N   1 
ATOM   2909 C  CA  . VAL B 1 183 ? 5.043   53.354 50.879  1.00 17.17 ? 182 VAL B CA  1 
ATOM   2910 C  C   . VAL B 1 183 ? 5.836   54.426 50.135  1.00 18.73 ? 182 VAL B C   1 
ATOM   2911 O  O   . VAL B 1 183 ? 7.046   54.274 49.934  1.00 18.56 ? 182 VAL B O   1 
ATOM   2912 C  CB  . VAL B 1 183 ? 4.153   52.568 49.891  1.00 19.22 ? 182 VAL B CB  1 
ATOM   2913 C  CG1 . VAL B 1 183 ? 4.994   51.905 48.805  1.00 21.30 ? 182 VAL B CG1 1 
ATOM   2914 C  CG2 . VAL B 1 183 ? 3.367   51.502 50.603  1.00 21.24 ? 182 VAL B CG2 1 
ATOM   2915 N  N   . PHE B 1 184 ? 5.173   55.521 49.747  1.00 16.47 ? 183 PHE B N   1 
ATOM   2916 C  CA  . PHE B 1 184 ? 5.841   56.585 48.986  1.00 17.05 ? 183 PHE B CA  1 
ATOM   2917 C  C   . PHE B 1 184 ? 6.981   57.259 49.739  1.00 15.64 ? 183 PHE B C   1 
ATOM   2918 O  O   . PHE B 1 184 ? 7.973   57.667 49.135  1.00 14.83 ? 183 PHE B O   1 
ATOM   2919 C  CB  . PHE B 1 184 ? 4.839   57.631 48.503  1.00 17.18 ? 183 PHE B CB  1 
ATOM   2920 C  CG  . PHE B 1 184 ? 5.402   58.593 47.495  1.00 18.59 ? 183 PHE B CG  1 
ATOM   2921 C  CD1 . PHE B 1 184 ? 5.296   59.978 47.698  1.00 20.18 ? 183 PHE B CD1 1 
ATOM   2922 C  CD2 . PHE B 1 184 ? 6.032   58.129 46.343  1.00 15.59 ? 183 PHE B CD2 1 
ATOM   2923 C  CE1 . PHE B 1 184 ? 5.824   60.874 46.769  1.00 22.58 ? 183 PHE B CE1 1 
ATOM   2924 C  CE2 . PHE B 1 184 ? 6.583   59.022 45.422  1.00 19.16 ? 183 PHE B CE2 1 
ATOM   2925 C  CZ  . PHE B 1 184 ? 6.464   60.399 45.628  1.00 19.08 ? 183 PHE B CZ  1 
ATOM   2926 N  N   . SER B 1 185 ? 6.850   57.370 51.057  1.00 18.01 ? 184 SER B N   1 
ATOM   2927 C  CA  . SER B 1 185 ? 7.933   57.921 51.875  1.00 19.74 ? 184 SER B CA  1 
ATOM   2928 C  C   . SER B 1 185 ? 9.219   57.059 51.777  1.00 18.60 ? 184 SER B C   1 
ATOM   2929 O  O   . SER B 1 185 ? 10.322  57.597 51.748  1.00 17.83 ? 184 SER B O   1 
ATOM   2930 C  CB  . SER B 1 185 ? 7.480   58.108 53.334  1.00 22.44 ? 184 SER B CB  1 
ATOM   2931 O  OG  . SER B 1 185 ? 7.456   56.886 54.063  1.00 32.33 ? 184 SER B OG  1 
ATOM   2932 N  N   . GLN B 1 186 ? 9.052   55.736 51.726  1.00 16.92 ? 185 GLN B N   1 
ATOM   2933 C  CA  . GLN B 1 186 ? 10.161  54.815 51.478  1.00 19.12 ? 185 GLN B CA  1 
ATOM   2934 C  C   . GLN B 1 186 ? 10.749  55.032 50.086  1.00 19.68 ? 185 GLN B C   1 
ATOM   2935 O  O   . GLN B 1 186 ? 11.971  55.104 49.916  1.00 20.38 ? 185 GLN B O   1 
ATOM   2936 C  CB  . GLN B 1 186 ? 9.699   53.357 51.618  1.00 18.37 ? 185 GLN B CB  1 
ATOM   2937 C  CG  . GLN B 1 186 ? 9.171   52.973 52.994  1.00 22.01 ? 185 GLN B CG  1 
ATOM   2938 C  CD  . GLN B 1 186 ? 8.517   51.610 52.984  1.00 21.04 ? 185 GLN B CD  1 
ATOM   2939 O  OE1 . GLN B 1 186 ? 9.183   50.598 52.771  1.00 20.47 ? 185 GLN B OE1 1 
ATOM   2940 N  NE2 . GLN B 1 186 ? 7.210   51.574 53.203  1.00 24.30 ? 185 GLN B NE2 1 
ATOM   2941 N  N   . VAL B 1 187 ? 9.863   55.156 49.099  1.00 19.58 ? 186 VAL B N   1 
ATOM   2942 C  CA  . VAL B 1 187 ? 10.252  55.393 47.700  1.00 18.49 ? 186 VAL B CA  1 
ATOM   2943 C  C   . VAL B 1 187 ? 11.072  56.671 47.575  1.00 18.09 ? 186 VAL B C   1 
ATOM   2944 O  O   . VAL B 1 187 ? 12.097  56.699 46.903  1.00 18.01 ? 186 VAL B O   1 
ATOM   2945 C  CB  . VAL B 1 187 ? 8.994   55.458 46.778  1.00 18.51 ? 186 VAL B CB  1 
ATOM   2946 C  CG1 . VAL B 1 187 ? 9.343   55.930 45.320  1.00 19.75 ? 186 VAL B CG1 1 
ATOM   2947 C  CG2 . VAL B 1 187 ? 8.249   54.098 46.760  1.00 17.25 ? 186 VAL B CG2 1 
ATOM   2948 N  N   . CYS B 1 188 ? 10.664  57.722 48.274  1.00 17.95 ? 187 CYS B N   1 
ATOM   2949 C  CA  . CYS B 1 188 ? 11.374  58.984 48.177  1.00 18.82 ? 187 CYS B CA  1 
ATOM   2950 C  C   . CYS B 1 188 ? 12.777  58.942 48.767  1.00 19.51 ? 187 CYS B C   1 
ATOM   2951 O  O   . CYS B 1 188 ? 13.701  59.582 48.249  1.00 20.88 ? 187 CYS B O   1 
ATOM   2952 C  CB  . CYS B 1 188 ? 10.544  60.092 48.822  1.00 20.64 ? 187 CYS B CB  1 
ATOM   2953 S  SG  . CYS B 1 188 ? 9.127   60.454 47.798  1.00 25.04 ? 187 CYS B SG  1 
ATOM   2954 N  N   . THR B 1 189 ? 12.938  58.185 49.838  1.00 19.08 ? 188 THR B N   1 
ATOM   2955 C  CA  . THR B 1 189 ? 14.245  57.987 50.447  1.00 20.38 ? 188 THR B CA  1 
ATOM   2956 C  C   . THR B 1 189 ? 15.233  57.362 49.465  1.00 20.14 ? 188 THR B C   1 
ATOM   2957 O  O   . THR B 1 189 ? 16.394  57.779 49.399  1.00 19.72 ? 188 THR B O   1 
ATOM   2958 C  CB  . THR B 1 189 ? 14.123  57.118 51.680  1.00 19.88 ? 188 THR B CB  1 
ATOM   2959 O  OG1 . THR B 1 189 ? 13.296  57.789 52.639  1.00 21.05 ? 188 THR B OG1 1 
ATOM   2960 C  CG2 . THR B 1 189 ? 15.485  56.870 52.306  1.00 24.96 ? 188 THR B CG2 1 
ATOM   2961 N  N   . HIS B 1 190 ? 14.769  56.386 48.704  1.00 18.65 ? 189 HIS B N   1 
ATOM   2962 C  CA  . HIS B 1 190 ? 15.611  55.730 47.698  1.00 18.73 ? 189 HIS B CA  1 
ATOM   2963 C  C   . HIS B 1 190 ? 15.928  56.639 46.523  1.00 20.54 ? 189 HIS B C   1 
ATOM   2964 O  O   . HIS B 1 190 ? 17.065  56.630 46.030  1.00 18.91 ? 189 HIS B O   1 
ATOM   2965 C  CB  . HIS B 1 190 ? 14.964  54.467 47.174  1.00 14.67 ? 189 HIS B CB  1 
ATOM   2966 C  CG  . HIS B 1 190 ? 14.922  53.347 48.164  1.00 17.81 ? 189 HIS B CG  1 
ATOM   2967 N  ND1 . HIS B 1 190 ? 16.003  52.994 48.945  1.00 18.02 ? 189 HIS B ND1 1 
ATOM   2968 C  CD2 . HIS B 1 190 ? 13.931  52.484 48.486  1.00 14.72 ? 189 HIS B CD2 1 
ATOM   2969 C  CE1 . HIS B 1 190 ? 15.677  51.961 49.706  1.00 16.95 ? 189 HIS B CE1 1 
ATOM   2970 N  NE2 . HIS B 1 190 ? 14.421  51.646 49.459  1.00 19.50 ? 189 HIS B NE2 1 
ATOM   2971 N  N   . LEU B 1 191 ? 14.924  57.392 46.064  1.00 21.12 ? 190 LEU B N   1 
ATOM   2972 C  CA  . LEU B 1 191 ? 15.078  58.254 44.913  1.00 21.28 ? 190 LEU B CA  1 
ATOM   2973 C  C   . LEU B 1 191 ? 15.906  59.471 45.276  1.00 22.56 ? 190 LEU B C   1 
ATOM   2974 O  O   . LEU B 1 191 ? 16.750  59.886 44.492  1.00 22.50 ? 190 LEU B O   1 
ATOM   2975 C  CB  . LEU B 1 191 ? 13.720  58.677 44.355  1.00 22.16 ? 190 LEU B CB  1 
ATOM   2976 C  CG  . LEU B 1 191 ? 12.856  57.530 43.795  1.00 24.18 ? 190 LEU B CG  1 
ATOM   2977 C  CD1 . LEU B 1 191 ? 11.604  58.092 43.166  1.00 26.12 ? 190 LEU B CD1 1 
ATOM   2978 C  CD2 . LEU B 1 191 ? 13.615  56.693 42.791  1.00 28.40 ? 190 LEU B CD2 1 
ATOM   2979 N  N   . ASP B 1 192 ? 15.691  60.023 46.473  1.00 21.68 ? 191 ASP B N   1 
ATOM   2980 C  CA  . ASP B 1 192 ? 16.515  61.143 46.948  1.00 21.69 ? 191 ASP B CA  1 
ATOM   2981 C  C   . ASP B 1 192 ? 18.013  60.781 47.046  1.00 23.36 ? 191 ASP B C   1 
ATOM   2982 O  O   . ASP B 1 192 ? 18.869  61.578 46.657  1.00 23.55 ? 191 ASP B O   1 
ATOM   2983 C  CB  . ASP B 1 192 ? 16.006  61.676 48.295  1.00 20.95 ? 191 ASP B CB  1 
ATOM   2984 C  CG  . ASP B 1 192 ? 14.665  62.396 48.184  1.00 24.60 ? 191 ASP B CG  1 
ATOM   2985 O  OD1 . ASP B 1 192 ? 14.174  62.572 47.048  1.00 26.09 ? 191 ASP B OD1 1 
ATOM   2986 O  OD2 . ASP B 1 192 ? 14.089  62.796 49.235  1.00 24.51 ? 191 ASP B OD2 1 
ATOM   2987 N  N   . ALA B 1 193 ? 18.331  59.587 47.542  1.00 24.40 ? 192 ALA B N   1 
ATOM   2988 C  CA  . ALA B 1 193 ? 19.731  59.148 47.624  1.00 26.80 ? 192 ALA B CA  1 
ATOM   2989 C  C   . ALA B 1 193 ? 20.391  59.096 46.251  1.00 27.42 ? 192 ALA B C   1 
ATOM   2990 O  O   . ALA B 1 193 ? 21.590  59.331 46.130  1.00 27.87 ? 192 ALA B O   1 
ATOM   2991 C  CB  . ALA B 1 193 ? 19.838  57.787 48.292  1.00 26.74 ? 192 ALA B CB  1 
ATOM   2992 N  N   . LEU B 1 194 ? 19.605  58.764 45.229  1.00 30.31 ? 193 LEU B N   1 
ATOM   2993 C  CA  . LEU B 1 194 ? 20.103  58.697 43.867  1.00 32.71 ? 193 LEU B CA  1 
ATOM   2994 C  C   . LEU B 1 194 ? 20.191  60.069 43.228  1.00 34.37 ? 193 LEU B C   1 
ATOM   2995 O  O   . LEU B 1 194 ? 21.203  60.402 42.635  1.00 33.69 ? 193 LEU B O   1 
ATOM   2996 C  CB  . LEU B 1 194 ? 19.239  57.770 43.016  1.00 32.81 ? 193 LEU B CB  1 
ATOM   2997 C  CG  . LEU B 1 194 ? 19.843  56.366 42.942  1.00 36.84 ? 193 LEU B CG  1 
ATOM   2998 N  N   . LEU B 1 195 ? 19.129  60.859 43.365  1.00 37.72 ? 194 LEU B N   1 
ATOM   2999 C  CA  . LEU B 1 195 ? 19.039  62.183 42.735  1.00 39.48 ? 194 LEU B CA  1 
ATOM   3000 C  C   . LEU B 1 195 ? 19.560  63.262 43.658  1.00 39.58 ? 194 LEU B C   1 
ATOM   3001 O  O   . LEU B 1 195 ? 20.704  63.684 43.542  1.00 42.93 ? 194 LEU B O   1 
ATOM   3002 C  CB  . LEU B 1 195 ? 17.586  62.499 42.382  1.00 39.02 ? 194 LEU B CB  1 
ATOM   3003 C  CG  . LEU B 1 195 ? 16.836  61.389 41.637  1.00 43.25 ? 194 LEU B CG  1 
ATOM   3004 C  CD1 . LEU B 1 195 ? 15.460  61.899 41.211  1.00 46.55 ? 194 LEU B CD1 1 
ATOM   3005 C  CD2 . LEU B 1 195 ? 17.634  60.868 40.440  1.00 43.52 ? 194 LEU B CD2 1 
ATOM   3006 N  N   . SER C 1 1   ? 25.881  60.265 52.399  1.00 26.74 ? 0   SER C N   1 
ATOM   3007 C  CA  . SER C 1 1   ? 26.882  59.276 52.868  1.00 26.15 ? 0   SER C CA  1 
ATOM   3008 C  C   . SER C 1 1   ? 27.895  58.996 51.780  1.00 25.27 ? 0   SER C C   1 
ATOM   3009 O  O   . SER C 1 1   ? 27.726  59.426 50.631  1.00 24.26 ? 0   SER C O   1 
ATOM   3010 C  CB  . SER C 1 1   ? 26.207  57.967 53.286  1.00 26.75 ? 0   SER C CB  1 
ATOM   3011 O  OG  . SER C 1 1   ? 25.583  57.344 52.179  1.00 24.97 ? 0   SER C OG  1 
ATOM   3012 N  N   . MET C 1 2   ? 28.950  58.279 52.156  1.00 24.09 ? 1   MET C N   1 
ATOM   3013 C  CA  . MET C 1 2   ? 30.003  57.884 51.226  1.00 24.09 ? 1   MET C CA  1 
ATOM   3014 C  C   . MET C 1 2   ? 29.514  56.762 50.276  1.00 24.47 ? 1   MET C C   1 
ATOM   3015 O  O   . MET C 1 2   ? 29.844  56.730 49.080  1.00 21.73 ? 1   MET C O   1 
ATOM   3016 C  CB  . MET C 1 2   ? 31.222  57.442 52.051  1.00 23.68 ? 1   MET C CB  1 
ATOM   3017 C  CG  . MET C 1 2   ? 32.425  57.039 51.272  1.00 28.00 ? 1   MET C CG  1 
ATOM   3018 S  SD  . MET C 1 2   ? 32.927  58.251 50.039  1.00 28.23 ? 1   MET C SD  1 
ATOM   3019 C  CE  . MET C 1 2   ? 33.378  59.606 51.117  1.00 26.87 ? 1   MET C CE  1 
ATOM   3020 N  N   . GLU C 1 3   ? 28.736  55.834 50.833  1.00 25.80 ? 2   GLU C N   1 
ATOM   3021 C  CA  . GLU C 1 3   ? 28.078  54.775 50.060  1.00 25.97 ? 2   GLU C CA  1 
ATOM   3022 C  C   . GLU C 1 3   ? 27.301  55.367 48.880  1.00 23.93 ? 2   GLU C C   1 
ATOM   3023 O  O   . GLU C 1 3   ? 27.448  54.932 47.739  1.00 24.15 ? 2   GLU C O   1 
ATOM   3024 C  CB  . GLU C 1 3   ? 27.133  53.967 50.970  1.00 27.77 ? 2   GLU C CB  1 
ATOM   3025 C  CG  . GLU C 1 3   ? 26.559  52.691 50.347  1.00 32.79 ? 2   GLU C CG  1 
ATOM   3026 N  N   . GLU C 1 4   ? 26.499  56.382 49.162  1.00 24.55 ? 3   GLU C N   1 
ATOM   3027 C  CA  . GLU C 1 4   ? 25.693  57.047 48.136  1.00 25.07 ? 3   GLU C CA  1 
ATOM   3028 C  C   . GLU C 1 4   ? 26.556  57.775 47.120  1.00 23.94 ? 3   GLU C C   1 
ATOM   3029 O  O   . GLU C 1 4   ? 26.268  57.734 45.921  1.00 24.73 ? 3   GLU C O   1 
ATOM   3030 C  CB  . GLU C 1 4   ? 24.687  58.009 48.786  1.00 24.57 ? 3   GLU C CB  1 
ATOM   3031 C  CG  . GLU C 1 4   ? 23.645  57.293 49.630  1.00 26.88 ? 3   GLU C CG  1 
ATOM   3032 C  CD  . GLU C 1 4   ? 22.764  58.233 50.450  1.00 30.35 ? 3   GLU C CD  1 
ATOM   3033 O  OE1 . GLU C 1 4   ? 22.944  59.475 50.382  1.00 38.40 ? 3   GLU C OE1 1 
ATOM   3034 O  OE2 . GLU C 1 4   ? 21.869  57.714 51.158  1.00 40.14 ? 3   GLU C OE2 1 
ATOM   3035 N  N   . LYS C 1 5   ? 27.619  58.415 47.594  1.00 23.23 ? 4   LYS C N   1 
ATOM   3036 C  CA  . LYS C 1 5   ? 28.553  59.139 46.727  1.00 24.95 ? 4   LYS C CA  1 
ATOM   3037 C  C   . LYS C 1 5   ? 29.218  58.226 45.699  1.00 23.36 ? 4   LYS C C   1 
ATOM   3038 O  O   . LYS C 1 5   ? 29.376  58.604 44.525  1.00 22.03 ? 4   LYS C O   1 
ATOM   3039 C  CB  . LYS C 1 5   ? 29.642  59.846 47.551  1.00 24.69 ? 4   LYS C CB  1 
ATOM   3040 C  CG  . LYS C 1 5   ? 29.354  61.297 47.886  1.00 30.75 ? 4   LYS C CG  1 
ATOM   3041 C  CD  . LYS C 1 5   ? 30.472  61.940 48.726  1.00 29.35 ? 4   LYS C CD  1 
ATOM   3042 C  CE  . LYS C 1 5   ? 30.013  62.282 50.152  1.00 36.89 ? 4   LYS C CE  1 
ATOM   3043 N  NZ  . LYS C 1 5   ? 30.987  63.113 50.943  1.00 29.52 ? 4   LYS C NZ  1 
ATOM   3044 N  N   . LEU C 1 6   ? 29.610  57.033 46.145  1.00 23.02 ? 5   LEU C N   1 
ATOM   3045 C  CA  . LEU C 1 6   ? 30.244  56.049 45.276  1.00 22.88 ? 5   LEU C CA  1 
ATOM   3046 C  C   . LEU C 1 6   ? 29.338  55.531 44.144  1.00 25.32 ? 5   LEU C C   1 
ATOM   3047 O  O   . LEU C 1 6   ? 29.825  54.982 43.149  1.00 26.08 ? 5   LEU C O   1 
ATOM   3048 C  CB  . LEU C 1 6   ? 30.789  54.874 46.110  1.00 22.72 ? 5   LEU C CB  1 
ATOM   3049 C  CG  . LEU C 1 6   ? 32.016  55.195 46.993  1.00 22.78 ? 5   LEU C CG  1 
ATOM   3050 C  CD1 . LEU C 1 6   ? 32.287  54.073 47.988  1.00 22.32 ? 5   LEU C CD1 1 
ATOM   3051 C  CD2 . LEU C 1 6   ? 33.260  55.466 46.152  1.00 23.54 ? 5   LEU C CD2 1 
ATOM   3052 N  N   . LYS C 1 7   ? 28.031  55.721 44.265  1.00 26.54 ? 6   LYS C N   1 
ATOM   3053 C  CA  . LYS C 1 7   ? 27.112  55.262 43.222  1.00 26.22 ? 6   LYS C CA  1 
ATOM   3054 C  C   . LYS C 1 7   ? 26.750  56.358 42.232  1.00 25.68 ? 6   LYS C C   1 
ATOM   3055 O  O   . LYS C 1 7   ? 26.031  56.121 41.271  1.00 27.36 ? 6   LYS C O   1 
ATOM   3056 C  CB  . LYS C 1 7   ? 25.865  54.683 43.866  1.00 27.65 ? 6   LYS C CB  1 
ATOM   3057 C  CG  . LYS C 1 7   ? 26.157  53.616 44.889  1.00 28.72 ? 6   LYS C CG  1 
ATOM   3058 C  CD  . LYS C 1 7   ? 24.997  52.674 45.057  1.00 30.87 ? 6   LYS C CD  1 
ATOM   3059 C  CE  . LYS C 1 7   ? 24.942  52.081 46.437  1.00 35.07 ? 6   LYS C CE  1 
ATOM   3060 N  NZ  . LYS C 1 7   ? 24.200  52.965 47.396  1.00 42.90 ? 6   LYS C NZ  1 
ATOM   3061 N  N   . LYS C 1 8   ? 27.256  57.556 42.469  1.00 25.34 ? 7   LYS C N   1 
ATOM   3062 C  CA  . LYS C 1 8   ? 26.938  58.711 41.658  1.00 25.10 ? 7   LYS C CA  1 
ATOM   3063 C  C   . LYS C 1 8   ? 28.113  59.141 40.787  1.00 27.22 ? 7   LYS C C   1 
ATOM   3064 O  O   . LYS C 1 8   ? 28.012  60.121 40.034  1.00 29.81 ? 7   LYS C O   1 
ATOM   3065 C  CB  . LYS C 1 8   ? 26.536  59.854 42.576  1.00 24.72 ? 7   LYS C CB  1 
ATOM   3066 C  CG  . LYS C 1 8   ? 25.241  59.585 43.311  1.00 27.16 ? 7   LYS C CG  1 
ATOM   3067 C  CD  . LYS C 1 8   ? 24.761  60.803 44.106  1.00 27.35 ? 7   LYS C CD  1 
ATOM   3068 N  N   . THR C 1 9   ? 29.228  58.422 40.896  1.00 27.27 ? 8   THR C N   1 
ATOM   3069 C  CA  . THR C 1 9   ? 30.436  58.770 40.159  1.00 26.74 ? 8   THR C CA  1 
ATOM   3070 C  C   . THR C 1 9   ? 30.593  57.816 38.965  1.00 23.39 ? 8   THR C C   1 
ATOM   3071 O  O   . THR C 1 9   ? 30.234  56.644 39.048  1.00 23.58 ? 8   THR C O   1 
ATOM   3072 C  CB  . THR C 1 9   ? 31.676  58.783 41.107  1.00 26.82 ? 8   THR C CB  1 
ATOM   3073 O  OG1 . THR C 1 9   ? 32.769  59.453 40.465  1.00 30.76 ? 8   THR C OG1 1 
ATOM   3074 C  CG2 . THR C 1 9   ? 32.099  57.371 41.502  1.00 26.94 ? 8   THR C CG2 1 
ATOM   3075 N  N   . ASN C 1 10  ? 31.058  58.349 37.837  1.00 22.69 ? 9   ASN C N   1 
ATOM   3076 C  CA  . ASN C 1 10  ? 31.366  57.548 36.658  1.00 23.28 ? 9   ASN C CA  1 
ATOM   3077 C  C   . ASN C 1 10  ? 32.510  56.575 36.938  1.00 19.71 ? 9   ASN C C   1 
ATOM   3078 O  O   . ASN C 1 10  ? 33.564  56.979 37.365  1.00 20.63 ? 9   ASN C O   1 
ATOM   3079 C  CB  . ASN C 1 10  ? 31.762  58.427 35.467  1.00 25.52 ? 9   ASN C CB  1 
ATOM   3080 C  CG  . ASN C 1 10  ? 30.595  58.756 34.557  1.00 33.23 ? 9   ASN C CG  1 
ATOM   3081 O  OD1 . ASN C 1 10  ? 29.435  58.406 34.828  1.00 45.40 ? 9   ASN C OD1 1 
ATOM   3082 N  ND2 . ASN C 1 10  ? 30.895  59.433 33.459  1.00 34.29 ? 9   ASN C ND2 1 
ATOM   3083 N  N   . ILE C 1 11  ? 32.290  55.301 36.667  1.00 18.90 ? 10  ILE C N   1 
ATOM   3084 C  CA  . ILE C 1 11  ? 33.297  54.271 36.893  1.00 18.88 ? 10  ILE C CA  1 
ATOM   3085 C  C   . ILE C 1 11  ? 33.545  53.537 35.570  1.00 21.06 ? 10  ILE C C   1 
ATOM   3086 O  O   . ILE C 1 11  ? 32.606  53.029 34.956  1.00 18.56 ? 10  ILE C O   1 
ATOM   3087 C  CB  . ILE C 1 11  ? 32.826  53.259 37.971  1.00 20.60 ? 10  ILE C CB  1 
ATOM   3088 C  CG1 . ILE C 1 11  ? 32.703  53.924 39.326  1.00 17.28 ? 10  ILE C CG1 1 
ATOM   3089 C  CG2 . ILE C 1 11  ? 33.765  52.080 38.066  1.00 19.50 ? 10  ILE C CG2 1 
ATOM   3090 C  CD1 . ILE C 1 11  ? 32.032  53.053 40.363  1.00 15.99 ? 10  ILE C CD1 1 
ATOM   3091 N  N   . ILE C 1 12  ? 34.808  53.510 35.145  1.00 17.98 ? 11  ILE C N   1 
ATOM   3092 C  CA  . ILE C 1 12  ? 35.190  52.819 33.929  1.00 20.73 ? 11  ILE C CA  1 
ATOM   3093 C  C   . ILE C 1 12  ? 36.185  51.743 34.281  1.00 17.91 ? 11  ILE C C   1 
ATOM   3094 O  O   . ILE C 1 12  ? 37.251  52.057 34.831  1.00 15.63 ? 11  ILE C O   1 
ATOM   3095 C  CB  . ILE C 1 12  ? 35.831  53.820 32.897  1.00 19.71 ? 11  ILE C CB  1 
ATOM   3096 C  CG1 . ILE C 1 12  ? 34.894  55.013 32.678  1.00 25.93 ? 11  ILE C CG1 1 
ATOM   3097 C  CG2 . ILE C 1 12  ? 36.172  53.094 31.576  1.00 22.22 ? 11  ILE C CG2 1 
ATOM   3098 C  CD1 . ILE C 1 12  ? 35.432  56.049 31.691  1.00 23.34 ? 11  ILE C CD1 1 
ATOM   3099 N  N   . PHE C 1 13  ? 35.850  50.476 33.974  1.00 17.43 ? 12  PHE C N   1 
ATOM   3100 C  CA  . PHE C 1 13  ? 36.795  49.388 34.137  1.00 17.76 ? 12  PHE C CA  1 
ATOM   3101 C  C   . PHE C 1 13  ? 37.704  49.400 32.913  1.00 19.15 ? 12  PHE C C   1 
ATOM   3102 O  O   . PHE C 1 13  ? 37.210  49.375 31.782  1.00 17.69 ? 12  PHE C O   1 
ATOM   3103 C  CB  . PHE C 1 13  ? 36.102  48.022 34.200  1.00 18.42 ? 12  PHE C CB  1 
ATOM   3104 C  CG  . PHE C 1 13  ? 35.283  47.765 35.444  1.00 19.39 ? 12  PHE C CG  1 
ATOM   3105 C  CD1 . PHE C 1 13  ? 35.451  48.523 36.606  1.00 21.73 ? 12  PHE C CD1 1 
ATOM   3106 C  CD2 . PHE C 1 13  ? 34.402  46.672 35.474  1.00 19.82 ? 12  PHE C CD2 1 
ATOM   3107 C  CE1 . PHE C 1 13  ? 34.718  48.232 37.735  1.00 15.60 ? 12  PHE C CE1 1 
ATOM   3108 C  CE2 . PHE C 1 13  ? 33.677  46.364 36.606  1.00 20.47 ? 12  PHE C CE2 1 
ATOM   3109 C  CZ  . PHE C 1 13  ? 33.839  47.149 37.750  1.00 16.77 ? 12  PHE C CZ  1 
ATOM   3110 N  N   . VAL C 1 14  ? 39.018  49.423 33.126  1.00 18.43 ? 13  VAL C N   1 
ATOM   3111 C  CA  . VAL C 1 14  ? 39.938  49.310 32.031  1.00 17.89 ? 13  VAL C CA  1 
ATOM   3112 C  C   . VAL C 1 14  ? 40.531  47.878 32.123  1.00 19.03 ? 13  VAL C C   1 
ATOM   3113 O  O   . VAL C 1 14  ? 41.234  47.572 33.064  1.00 19.18 ? 13  VAL C O   1 
ATOM   3114 C  CB  . VAL C 1 14  ? 41.015  50.344 32.109  1.00 17.51 ? 13  VAL C CB  1 
ATOM   3115 C  CG1 . VAL C 1 14  ? 42.034  50.096 30.978  1.00 19.15 ? 13  VAL C CG1 1 
ATOM   3116 C  CG2 . VAL C 1 14  ? 40.435  51.766 32.055  1.00 20.46 ? 13  VAL C CG2 1 
ATOM   3117 N  N   . VAL C 1 15  ? 40.225  47.029 31.134  1.00 19.93 ? 14  VAL C N   1 
ATOM   3118 C  CA  . VAL C 1 15  ? 40.550  45.594 31.131  1.00 18.21 ? 14  VAL C CA  1 
ATOM   3119 C  C   . VAL C 1 15  ? 41.455  45.216 29.930  1.00 19.78 ? 14  VAL C C   1 
ATOM   3120 O  O   . VAL C 1 15  ? 41.269  45.717 28.817  1.00 19.04 ? 14  VAL C O   1 
ATOM   3121 C  CB  . VAL C 1 15  ? 39.261  44.765 31.051  1.00 20.78 ? 14  VAL C CB  1 
ATOM   3122 C  CG1 . VAL C 1 15  ? 39.558  43.271 31.190  1.00 20.10 ? 14  VAL C CG1 1 
ATOM   3123 C  CG2 . VAL C 1 15  ? 38.295  45.221 32.133  1.00 22.47 ? 14  VAL C CG2 1 
ATOM   3124 N  N   . GLY C 1 16  ? 42.442  44.348 30.160  1.00 18.05 ? 15  GLY C N   1 
ATOM   3125 C  CA  . GLY C 1 16  ? 43.395  43.976 29.120  1.00 17.59 ? 15  GLY C CA  1 
ATOM   3126 C  C   . GLY C 1 16  ? 44.563  43.150 29.635  1.00 18.57 ? 15  GLY C C   1 
ATOM   3127 O  O   . GLY C 1 16  ? 44.851  43.128 30.821  1.00 15.08 ? 15  GLY C O   1 
ATOM   3128 N  N   . GLY C 1 17  ? 45.267  42.490 28.734  1.00 18.64 ? 16  GLY C N   1 
ATOM   3129 C  CA  . GLY C 1 17  ? 46.309  41.571 29.157  1.00 18.79 ? 16  GLY C CA  1 
ATOM   3130 C  C   . GLY C 1 17  ? 47.528  42.213 29.782  1.00 18.01 ? 16  GLY C C   1 
ATOM   3131 O  O   . GLY C 1 17  ? 47.667  43.450 29.801  1.00 18.71 ? 16  GLY C O   1 
ATOM   3132 N  N   . PRO C 1 18  ? 48.426  41.374 30.312  1.00 17.91 ? 17  PRO C N   1 
ATOM   3133 C  CA  . PRO C 1 18  ? 49.656  41.927 30.867  1.00 18.20 ? 17  PRO C CA  1 
ATOM   3134 C  C   . PRO C 1 18  ? 50.538  42.605 29.788  1.00 18.82 ? 17  PRO C C   1 
ATOM   3135 O  O   . PRO C 1 18  ? 50.949  41.963 28.812  1.00 19.50 ? 17  PRO C O   1 
ATOM   3136 C  CB  . PRO C 1 18  ? 50.328  40.733 31.511  1.00 18.39 ? 17  PRO C CB  1 
ATOM   3137 C  CG  . PRO C 1 18  ? 49.765  39.554 30.862  1.00 18.64 ? 17  PRO C CG  1 
ATOM   3138 C  CD  . PRO C 1 18  ? 48.364  39.911 30.453  1.00 19.90 ? 17  PRO C CD  1 
ATOM   3139 N  N   . GLY C 1 19  ? 50.803  43.883 29.980  1.00 15.99 ? 18  GLY C N   1 
ATOM   3140 C  CA  . GLY C 1 19  ? 51.562  44.696 29.018  1.00 17.70 ? 18  GLY C CA  1 
ATOM   3141 C  C   . GLY C 1 19  ? 50.764  45.187 27.823  1.00 17.39 ? 18  GLY C C   1 
ATOM   3142 O  O   . GLY C 1 19  ? 51.357  45.684 26.863  1.00 21.12 ? 18  GLY C O   1 
ATOM   3143 N  N   . SER C 1 20  ? 49.433  45.063 27.875  1.00 16.86 ? 19  SER C N   1 
ATOM   3144 C  CA  . SER C 1 20  ? 48.554  45.545 26.809  1.00 17.34 ? 19  SER C CA  1 
ATOM   3145 C  C   . SER C 1 20  ? 48.598  47.079 26.659  1.00 18.90 ? 19  SER C C   1 
ATOM   3146 O  O   . SER C 1 20  ? 48.260  47.607 25.597  1.00 22.19 ? 19  SER C O   1 
ATOM   3147 C  CB  . SER C 1 20  ? 47.098  45.078 27.064  1.00 19.45 ? 19  SER C CB  1 
ATOM   3148 O  OG  . SER C 1 20  ? 46.552  45.680 28.234  1.00 17.95 ? 19  SER C OG  1 
ATOM   3149 N  N   . GLY C 1 21  ? 49.067  47.778 27.690  1.00 14.76 ? 20  GLY C N   1 
ATOM   3150 C  CA  . GLY C 1 21  ? 49.171  49.264 27.698  1.00 14.47 ? 20  GLY C CA  1 
ATOM   3151 C  C   . GLY C 1 21  ? 48.153  50.061 28.510  1.00 15.97 ? 20  GLY C C   1 
ATOM   3152 O  O   . GLY C 1 21  ? 47.989  51.280 28.309  1.00 16.72 ? 20  GLY C O   1 
ATOM   3153 N  N   . LYS C 1 22  ? 47.498  49.417 29.464  1.00 17.22 ? 21  LYS C N   1 
ATOM   3154 C  CA  . LYS C 1 22  ? 46.461  50.079 30.261  1.00 17.26 ? 21  LYS C CA  1 
ATOM   3155 C  C   . LYS C 1 22  ? 46.968  51.289 31.041  1.00 17.75 ? 21  LYS C C   1 
ATOM   3156 O  O   . LYS C 1 22  ? 46.347  52.346 30.998  1.00 16.97 ? 21  LYS C O   1 
ATOM   3157 C  CB  . LYS C 1 22  ? 45.805  49.099 31.236  1.00 18.93 ? 21  LYS C CB  1 
ATOM   3158 C  CG  . LYS C 1 22  ? 45.309  47.810 30.585  1.00 18.33 ? 21  LYS C CG  1 
ATOM   3159 C  CD  . LYS C 1 22  ? 44.530  46.928 31.546  1.00 18.19 ? 21  LYS C CD  1 
ATOM   3160 C  CE  . LYS C 1 22  ? 45.426  46.215 32.569  1.00 23.35 ? 21  LYS C CE  1 
ATOM   3161 N  NZ  . LYS C 1 22  ? 46.465  45.366 31.951  1.00 21.19 ? 21  LYS C NZ  1 
ATOM   3162 N  N   . GLY C 1 23  ? 48.068  51.142 31.783  1.00 18.59 ? 22  GLY C N   1 
ATOM   3163 C  CA  . GLY C 1 23  ? 48.599  52.292 32.545  1.00 17.12 ? 22  GLY C CA  1 
ATOM   3164 C  C   . GLY C 1 23  ? 48.929  53.468 31.657  1.00 17.83 ? 22  GLY C C   1 
ATOM   3165 O  O   . GLY C 1 23  ? 48.561  54.593 31.963  1.00 15.25 ? 22  GLY C O   1 
ATOM   3166 N  N   . THR C 1 24  ? 49.641  53.182 30.564  1.00 17.45 ? 23  THR C N   1 
ATOM   3167 C  CA  . THR C 1 24  ? 50.043  54.159 29.555  1.00 18.54 ? 23  THR C CA  1 
ATOM   3168 C  C   . THR C 1 24  ? 48.836  54.923 28.987  1.00 18.51 ? 23  THR C C   1 
ATOM   3169 O  O   . THR C 1 24  ? 48.888  56.131 28.890  1.00 19.65 ? 23  THR C O   1 
ATOM   3170 C  CB  . THR C 1 24  ? 50.850  53.467 28.425  1.00 17.24 ? 23  THR C CB  1 
ATOM   3171 O  OG1 . THR C 1 24  ? 52.156  53.136 28.914  1.00 17.31 ? 23  THR C OG1 1 
ATOM   3172 C  CG2 . THR C 1 24  ? 50.995  54.320 27.219  1.00 18.29 ? 23  THR C CG2 1 
ATOM   3173 N  N   . GLN C 1 25  ? 47.762  54.220 28.636  1.00 16.65 ? 24  GLN C N   1 
ATOM   3174 C  CA  . GLN C 1 25  ? 46.543  54.896 28.122  1.00 17.05 ? 24  GLN C CA  1 
ATOM   3175 C  C   . GLN C 1 25  ? 45.772  55.640 29.221  1.00 16.18 ? 24  GLN C C   1 
ATOM   3176 O  O   . GLN C 1 25  ? 45.264  56.719 28.992  1.00 16.52 ? 24  GLN C O   1 
ATOM   3177 C  CB  . GLN C 1 25  ? 45.626  53.896 27.398  1.00 19.78 ? 24  GLN C CB  1 
ATOM   3178 C  CG  . GLN C 1 25  ? 46.254  53.328 26.091  1.00 15.66 ? 24  GLN C CG  1 
ATOM   3179 C  CD  . GLN C 1 25  ? 46.556  54.450 25.126  1.00 15.79 ? 24  GLN C CD  1 
ATOM   3180 O  OE1 . GLN C 1 25  ? 45.723  55.334 24.957  1.00 19.88 ? 24  GLN C OE1 1 
ATOM   3181 N  NE2 . GLN C 1 25  ? 47.776  54.468 24.541  1.00 15.83 ? 24  GLN C NE2 1 
ATOM   3182 N  N   . CYS C 1 26  ? 45.677  55.061 30.408  1.00 16.48 ? 25  CYS C N   1 
ATOM   3183 C  CA  . CYS C 1 26  ? 45.063  55.765 31.534  1.00 16.28 ? 25  CYS C CA  1 
ATOM   3184 C  C   . CYS C 1 26  ? 45.717  57.101 31.872  1.00 16.51 ? 25  CYS C C   1 
ATOM   3185 O  O   . CYS C 1 26  ? 45.034  58.020 32.254  1.00 18.13 ? 25  CYS C O   1 
ATOM   3186 C  CB  . CYS C 1 26  ? 45.052  54.885 32.765  1.00 18.60 ? 25  CYS C CB  1 
ATOM   3187 S  SG  . CYS C 1 26  ? 43.897  53.525 32.644  1.00 21.59 ? 25  CYS C SG  1 
ATOM   3188 N  N   . GLU C 1 27  ? 47.034  57.234 31.753  1.00 17.49 ? 26  GLU C N   1 
ATOM   3189 C  CA  . GLU C 1 27  ? 47.639  58.545 32.044  1.00 17.61 ? 26  GLU C CA  1 
ATOM   3190 C  C   . GLU C 1 27  ? 47.234  59.602 31.010  1.00 17.69 ? 26  GLU C C   1 
ATOM   3191 O  O   . GLU C 1 27  ? 47.000  60.744 31.378  1.00 15.72 ? 26  GLU C O   1 
ATOM   3192 C  CB  . GLU C 1 27  ? 49.158  58.459 32.159  1.00 19.30 ? 26  GLU C CB  1 
ATOM   3193 C  CG  . GLU C 1 27  ? 49.678  57.494 33.225  1.00 24.07 ? 26  GLU C CG  1 
ATOM   3194 C  CD  . GLU C 1 27  ? 49.109  57.708 34.633  1.00 26.03 ? 26  GLU C CD  1 
ATOM   3195 O  OE1 . GLU C 1 27  ? 48.797  58.861 35.014  1.00 27.53 ? 26  GLU C OE1 1 
ATOM   3196 O  OE2 . GLU C 1 27  ? 49.036  56.703 35.382  1.00 19.99 ? 26  GLU C OE2 1 
ATOM   3197 N  N   . LYS C 1 28  ? 47.111  59.197 29.745  1.00 16.91 ? 27  LYS C N   1 
ATOM   3198 C  CA  . LYS C 1 28  ? 46.678  60.101 28.677  1.00 17.85 ? 27  LYS C CA  1 
ATOM   3199 C  C   . LYS C 1 28  ? 45.228  60.569 28.898  1.00 16.86 ? 27  LYS C C   1 
ATOM   3200 O  O   . LYS C 1 28  ? 44.890  61.736 28.630  1.00 14.55 ? 27  LYS C O   1 
ATOM   3201 C  CB  . LYS C 1 28  ? 46.886  59.438 27.318  1.00 15.52 ? 27  LYS C CB  1 
ATOM   3202 C  CG  . LYS C 1 28  ? 48.384  59.207 27.032  1.00 18.04 ? 27  LYS C CG  1 
ATOM   3203 C  CD  . LYS C 1 28  ? 48.667  58.839 25.588  1.00 23.62 ? 27  LYS C CD  1 
ATOM   3204 C  CE  . LYS C 1 28  ? 48.730  60.053 24.695  1.00 29.27 ? 27  LYS C CE  1 
ATOM   3205 N  NZ  . LYS C 1 28  ? 50.088  60.665 24.714  1.00 26.17 ? 27  LYS C NZ  1 
ATOM   3206 N  N   . ILE C 1 29  ? 44.401  59.661 29.420  1.00 14.74 ? 28  ILE C N   1 
ATOM   3207 C  CA  . ILE C 1 29  ? 43.004  59.935 29.802  1.00 14.59 ? 28  ILE C CA  1 
ATOM   3208 C  C   . ILE C 1 29  ? 42.983  60.909 30.974  1.00 17.00 ? 28  ILE C C   1 
ATOM   3209 O  O   . ILE C 1 29  ? 42.274  61.909 30.943  1.00 18.69 ? 28  ILE C O   1 
ATOM   3210 C  CB  . ILE C 1 29  ? 42.232  58.623 30.207  1.00 15.13 ? 28  ILE C CB  1 
ATOM   3211 C  CG1 . ILE C 1 29  ? 42.070  57.698 29.008  1.00 15.97 ? 28  ILE C CG1 1 
ATOM   3212 C  CG2 . ILE C 1 29  ? 40.834  58.948 30.746  1.00 18.54 ? 28  ILE C CG2 1 
ATOM   3213 C  CD1 . ILE C 1 29  ? 41.649  56.237 29.362  1.00 13.76 ? 28  ILE C CD1 1 
ATOM   3214 N  N   . VAL C 1 30  ? 43.798  60.634 31.991  1.00 16.11 ? 29  VAL C N   1 
ATOM   3215 C  CA  . VAL C 1 30  ? 43.878  61.518 33.156  1.00 17.04 ? 29  VAL C CA  1 
ATOM   3216 C  C   . VAL C 1 30  ? 44.216  62.933 32.671  1.00 15.77 ? 29  VAL C C   1 
ATOM   3217 O  O   . VAL C 1 30  ? 43.564  63.883 33.036  1.00 15.78 ? 29  VAL C O   1 
ATOM   3218 C  CB  . VAL C 1 30  ? 44.919  61.049 34.227  1.00 13.86 ? 29  VAL C CB  1 
ATOM   3219 C  CG1 . VAL C 1 30  ? 45.150  62.166 35.281  1.00 21.82 ? 29  VAL C CG1 1 
ATOM   3220 C  CG2 . VAL C 1 30  ? 44.461  59.737 34.923  1.00 19.43 ? 29  VAL C CG2 1 
ATOM   3221 N  N   . GLN C 1 31  ? 45.235  63.048 31.819  1.00 18.10 ? 30  GLN C N   1 
ATOM   3222 C  CA  . GLN C 1 31  ? 45.671  64.338 31.283  1.00 19.06 ? 30  GLN C CA  1 
ATOM   3223 C  C   . GLN C 1 31  ? 44.588  65.078 30.475  1.00 19.60 ? 30  GLN C C   1 
ATOM   3224 O  O   . GLN C 1 31  ? 44.444  66.315 30.578  1.00 17.81 ? 30  GLN C O   1 
ATOM   3225 C  CB  . GLN C 1 31  ? 46.892  64.125 30.382  1.00 19.00 ? 30  GLN C CB  1 
ATOM   3226 C  CG  . GLN C 1 31  ? 48.140  63.715 31.128  1.00 22.28 ? 30  GLN C CG  1 
ATOM   3227 C  CD  . GLN C 1 31  ? 49.088  62.890 30.268  1.00 33.55 ? 30  GLN C CD  1 
ATOM   3228 O  OE1 . GLN C 1 31  ? 49.136  63.046 29.038  1.00 34.98 ? 30  GLN C OE1 1 
ATOM   3229 N  NE2 . GLN C 1 31  ? 49.858  62.009 30.913  1.00 26.72 ? 30  GLN C NE2 1 
ATOM   3230 N  N   . LYS C 1 32  ? 43.858  64.352 29.639  1.00 16.01 ? 31  LYS C N   1 
ATOM   3231 C  CA  . LYS C 1 32  ? 42.901  65.011 28.750  1.00 18.26 ? 31  LYS C CA  1 
ATOM   3232 C  C   . LYS C 1 32  ? 41.549  65.290 29.416  1.00 19.63 ? 31  LYS C C   1 
ATOM   3233 O  O   . LYS C 1 32  ? 40.980  66.358 29.205  1.00 17.81 ? 31  LYS C O   1 
ATOM   3234 C  CB  . LYS C 1 32  ? 42.701  64.192 27.475  1.00 16.05 ? 31  LYS C CB  1 
ATOM   3235 C  CG  . LYS C 1 32  ? 41.786  64.845 26.450  1.00 19.07 ? 31  LYS C CG  1 
ATOM   3236 C  CD  . LYS C 1 32  ? 41.819  64.105 25.123  1.00 17.55 ? 31  LYS C CD  1 
ATOM   3237 C  CE  . LYS C 1 32  ? 40.706  64.561 24.193  1.00 29.42 ? 31  LYS C CE  1 
ATOM   3238 N  NZ  . LYS C 1 32  ? 40.255  63.465 23.283  1.00 29.25 ? 31  LYS C NZ  1 
ATOM   3239 N  N   . TYR C 1 33  ? 41.069  64.330 30.213  1.00 20.29 ? 32  TYR C N   1 
ATOM   3240 C  CA  . TYR C 1 33  ? 39.708  64.312 30.766  1.00 20.75 ? 32  TYR C CA  1 
ATOM   3241 C  C   . TYR C 1 33  ? 39.654  64.543 32.291  1.00 21.33 ? 32  TYR C C   1 
ATOM   3242 O  O   . TYR C 1 33  ? 38.581  64.705 32.839  1.00 18.83 ? 32  TYR C O   1 
ATOM   3243 C  CB  . TYR C 1 33  ? 39.028  62.958 30.453  1.00 21.29 ? 32  TYR C CB  1 
ATOM   3244 C  CG  . TYR C 1 33  ? 38.863  62.671 28.963  1.00 20.41 ? 32  TYR C CG  1 
ATOM   3245 C  CD1 . TYR C 1 33  ? 39.763  61.850 28.282  1.00 19.85 ? 32  TYR C CD1 1 
ATOM   3246 C  CD2 . TYR C 1 33  ? 37.788  63.205 28.242  1.00 21.89 ? 32  TYR C CD2 1 
ATOM   3247 C  CE1 . TYR C 1 33  ? 39.613  61.592 26.914  1.00 22.18 ? 32  TYR C CE1 1 
ATOM   3248 C  CE2 . TYR C 1 33  ? 37.628  62.959 26.871  1.00 17.16 ? 32  TYR C CE2 1 
ATOM   3249 C  CZ  . TYR C 1 33  ? 38.538  62.154 26.211  1.00 29.99 ? 32  TYR C CZ  1 
ATOM   3250 O  OH  . TYR C 1 33  ? 38.380  61.918 24.847  1.00 25.54 ? 32  TYR C OH  1 
ATOM   3251 N  N   . GLY C 1 34  ? 40.795  64.502 32.972  1.00 19.35 ? 33  GLY C N   1 
ATOM   3252 C  CA  . GLY C 1 34  ? 40.837  64.785 34.413  1.00 20.29 ? 33  GLY C CA  1 
ATOM   3253 C  C   . GLY C 1 34  ? 40.251  63.750 35.351  1.00 18.59 ? 33  GLY C C   1 
ATOM   3254 O  O   . GLY C 1 34  ? 39.879  64.070 36.481  1.00 19.39 ? 33  GLY C O   1 
ATOM   3255 N  N   . TYR C 1 35  ? 40.156  62.504 34.895  1.00 17.07 ? 34  TYR C N   1 
ATOM   3256 C  CA  . TYR C 1 35  ? 39.729  61.409 35.732  1.00 21.03 ? 34  TYR C CA  1 
ATOM   3257 C  C   . TYR C 1 35  ? 40.827  60.982 36.729  1.00 19.69 ? 34  TYR C C   1 
ATOM   3258 O  O   . TYR C 1 35  ? 42.003  61.347 36.618  1.00 17.72 ? 34  TYR C O   1 
ATOM   3259 C  CB  . TYR C 1 35  ? 39.297  60.192 34.864  1.00 22.14 ? 34  TYR C CB  1 
ATOM   3260 C  CG  . TYR C 1 35  ? 37.844  60.240 34.420  1.00 28.57 ? 34  TYR C CG  1 
ATOM   3261 C  CD1 . TYR C 1 35  ? 37.229  61.452 34.109  1.00 34.68 ? 34  TYR C CD1 1 
ATOM   3262 C  CD2 . TYR C 1 35  ? 37.078  59.067 34.300  1.00 32.92 ? 34  TYR C CD2 1 
ATOM   3263 C  CE1 . TYR C 1 35  ? 35.897  61.508 33.707  1.00 36.78 ? 34  TYR C CE1 1 
ATOM   3264 C  CE2 . TYR C 1 35  ? 35.739  59.113 33.888  1.00 29.52 ? 34  TYR C CE2 1 
ATOM   3265 C  CZ  . TYR C 1 35  ? 35.159  60.339 33.595  1.00 38.12 ? 34  TYR C CZ  1 
ATOM   3266 O  OH  . TYR C 1 35  ? 33.834  60.444 33.201  1.00 40.85 ? 34  TYR C OH  1 
ATOM   3267 N  N   . THR C 1 36  ? 40.402  60.189 37.701  1.00 18.27 ? 35  THR C N   1 
ATOM   3268 C  CA  . THR C 1 36  ? 41.268  59.610 38.710  1.00 15.78 ? 35  THR C CA  1 
ATOM   3269 C  C   . THR C 1 36  ? 41.667  58.195 38.309  1.00 16.84 ? 35  THR C C   1 
ATOM   3270 O  O   . THR C 1 36  ? 40.795  57.371 38.162  1.00 17.85 ? 35  THR C O   1 
ATOM   3271 C  CB  . THR C 1 36  ? 40.487  59.502 40.040  1.00 16.07 ? 35  THR C CB  1 
ATOM   3272 O  OG1 . THR C 1 36  ? 39.941  60.784 40.375  1.00 19.53 ? 35  THR C OG1 1 
ATOM   3273 C  CG2 . THR C 1 36  ? 41.389  59.001 41.150  1.00 18.33 ? 35  THR C CG2 1 
ATOM   3274 N  N   . HIS C 1 37  ? 42.966  57.910 38.171  1.00 16.09 ? 36  HIS C N   1 
ATOM   3275 C  CA  . HIS C 1 37  ? 43.438  56.578 37.743  1.00 17.18 ? 36  HIS C CA  1 
ATOM   3276 C  C   . HIS C 1 37  ? 43.796  55.775 38.973  1.00 17.13 ? 36  HIS C C   1 
ATOM   3277 O  O   . HIS C 1 37  ? 44.612  56.237 39.772  1.00 16.94 ? 36  HIS C O   1 
ATOM   3278 C  CB  . HIS C 1 37  ? 44.677  56.710 36.856  1.00 17.41 ? 36  HIS C CB  1 
ATOM   3279 C  CG  . HIS C 1 37  ? 45.314  55.402 36.517  1.00 20.95 ? 36  HIS C CG  1 
ATOM   3280 N  ND1 . HIS C 1 37  ? 46.669  55.191 36.596  1.00 19.84 ? 36  HIS C ND1 1 
ATOM   3281 C  CD2 . HIS C 1 37  ? 44.781  54.238 36.089  1.00 15.26 ? 36  HIS C CD2 1 
ATOM   3282 C  CE1 . HIS C 1 37  ? 46.942  53.950 36.250  1.00 24.95 ? 36  HIS C CE1 1 
ATOM   3283 N  NE2 . HIS C 1 37  ? 45.815  53.349 35.940  1.00 17.90 ? 36  HIS C NE2 1 
ATOM   3284 N  N   . LEU C 1 38  ? 43.229  54.580 39.126  1.00 17.39 ? 37  LEU C N   1 
ATOM   3285 C  CA  . LEU C 1 38  ? 43.677  53.654 40.167  1.00 17.17 ? 37  LEU C CA  1 
ATOM   3286 C  C   . LEU C 1 38  ? 44.077  52.308 39.558  1.00 16.72 ? 37  LEU C C   1 
ATOM   3287 O  O   . LEU C 1 38  ? 43.270  51.696 38.907  1.00 17.58 ? 37  LEU C O   1 
ATOM   3288 C  CB  . LEU C 1 38  ? 42.545  53.481 41.202  1.00 18.35 ? 37  LEU C CB  1 
ATOM   3289 C  CG  . LEU C 1 38  ? 42.141  54.748 41.969  1.00 20.10 ? 37  LEU C CG  1 
ATOM   3290 C  CD1 . LEU C 1 38  ? 40.905  54.462 42.852  1.00 21.09 ? 37  LEU C CD1 1 
ATOM   3291 C  CD2 . LEU C 1 38  ? 43.295  55.262 42.791  1.00 19.25 ? 37  LEU C CD2 1 
ATOM   3292 N  N   . SER C 1 39  ? 45.297  51.855 39.802  1.00 16.21 ? 38  SER C N   1 
ATOM   3293 C  CA  . SER C 1 39  ? 45.769  50.509 39.429  1.00 18.19 ? 38  SER C CA  1 
ATOM   3294 C  C   . SER C 1 39  ? 45.928  49.609 40.654  1.00 16.29 ? 38  SER C C   1 
ATOM   3295 O  O   . SER C 1 39  ? 46.699  49.904 41.560  1.00 17.92 ? 38  SER C O   1 
ATOM   3296 C  CB  . SER C 1 39  ? 47.102  50.602 38.637  1.00 16.60 ? 38  SER C CB  1 
ATOM   3297 O  OG  . SER C 1 39  ? 47.864  49.411 38.722  1.00 23.44 ? 38  SER C OG  1 
ATOM   3298 N  N   . THR C 1 40  ? 45.215  48.487 40.693  1.00 17.94 ? 39  THR C N   1 
ATOM   3299 C  CA  . THR C 1 40  ? 45.381  47.574 41.820  1.00 17.16 ? 39  THR C CA  1 
ATOM   3300 C  C   . THR C 1 40  ? 46.814  47.012 41.932  1.00 16.36 ? 39  THR C C   1 
ATOM   3301 O  O   . THR C 1 40  ? 47.307  46.794 43.040  1.00 16.15 ? 39  THR C O   1 
ATOM   3302 C  CB  . THR C 1 40  ? 44.316  46.443 41.801  1.00 15.36 ? 39  THR C CB  1 
ATOM   3303 O  OG1 . THR C 1 40  ? 44.119  45.966 40.474  1.00 18.06 ? 39  THR C OG1 1 
ATOM   3304 C  CG2 . THR C 1 40  ? 42.990  46.961 42.299  1.00 15.34 ? 39  THR C CG2 1 
ATOM   3305 N  N   . GLY C 1 41  ? 47.493  46.783 40.800  1.00 15.78 ? 40  GLY C N   1 
ATOM   3306 C  CA  . GLY C 1 41  ? 48.943  46.484 40.832  1.00 16.16 ? 40  GLY C CA  1 
ATOM   3307 C  C   . GLY C 1 41  ? 49.760  47.532 41.563  1.00 15.42 ? 40  GLY C C   1 
ATOM   3308 O  O   . GLY C 1 41  ? 50.592  47.207 42.396  1.00 14.81 ? 40  GLY C O   1 
ATOM   3309 N  N   . ASP C 1 42  ? 49.538  48.820 41.252  1.00 16.96 ? 41  ASP C N   1 
ATOM   3310 C  CA  . ASP C 1 42  ? 50.261  49.894 41.929  1.00 16.68 ? 41  ASP C CA  1 
ATOM   3311 C  C   . ASP C 1 42  ? 49.976  49.896 43.435  1.00 16.81 ? 41  ASP C C   1 
ATOM   3312 O  O   . ASP C 1 42  ? 50.880  50.053 44.257  1.00 17.58 ? 41  ASP C O   1 
ATOM   3313 C  CB  . ASP C 1 42  ? 49.890  51.258 41.354  1.00 16.92 ? 41  ASP C CB  1 
ATOM   3314 C  CG  . ASP C 1 42  ? 50.418  51.474 39.950  1.00 29.21 ? 41  ASP C CG  1 
ATOM   3315 O  OD1 . ASP C 1 42  ? 51.445  50.846 39.598  1.00 30.76 ? 41  ASP C OD1 1 
ATOM   3316 O  OD2 . ASP C 1 42  ? 49.813  52.305 39.206  1.00 29.19 ? 41  ASP C OD2 1 
ATOM   3317 N  N   . LEU C 1 43  ? 48.713  49.743 43.790  1.00 17.54 ? 42  LEU C N   1 
ATOM   3318 C  CA  . LEU C 1 43  ? 48.302  49.673 45.179  1.00 17.44 ? 42  LEU C CA  1 
ATOM   3319 C  C   . LEU C 1 43  ? 48.969  48.542 45.911  1.00 16.36 ? 42  LEU C C   1 
ATOM   3320 O  O   . LEU C 1 43  ? 49.472  48.714 47.035  1.00 16.36 ? 42  LEU C O   1 
ATOM   3321 C  CB  . LEU C 1 43  ? 46.782  49.548 45.267  1.00 18.80 ? 42  LEU C CB  1 
ATOM   3322 C  CG  . LEU C 1 43  ? 45.978  50.783 44.816  1.00 21.35 ? 42  LEU C CG  1 
ATOM   3323 C  CD1 . LEU C 1 43  ? 44.443  50.496 44.926  1.00 19.41 ? 42  LEU C CD1 1 
ATOM   3324 C  CD2 . LEU C 1 43  ? 46.335  52.016 45.590  1.00 25.61 ? 42  LEU C CD2 1 
ATOM   3325 N  N   . LEU C 1 44  ? 48.987  47.370 45.292  1.00 16.37 ? 43  LEU C N   1 
ATOM   3326 C  CA  . LEU C 1 44  ? 49.619  46.221 45.916  1.00 15.90 ? 43  LEU C CA  1 
ATOM   3327 C  C   . LEU C 1 44  ? 51.143  46.409 46.055  1.00 16.25 ? 43  LEU C C   1 
ATOM   3328 O  O   . LEU C 1 44  ? 51.743  46.131 47.118  1.00 17.02 ? 43  LEU C O   1 
ATOM   3329 C  CB  . LEU C 1 44  ? 49.301  44.957 45.114  1.00 14.79 ? 43  LEU C CB  1 
ATOM   3330 C  CG  . LEU C 1 44  ? 47.891  44.383 45.211  1.00 19.99 ? 43  LEU C CG  1 
ATOM   3331 C  CD1 . LEU C 1 44  ? 47.568  43.469 44.018  1.00 24.15 ? 43  LEU C CD1 1 
ATOM   3332 C  CD2 . LEU C 1 44  ? 47.730  43.620 46.527  1.00 22.92 ? 43  LEU C CD2 1 
ATOM   3333 N  N   . ARG C 1 45  ? 51.767  46.944 45.005  1.00 16.98 ? 44  ARG C N   1 
ATOM   3334 C  CA  . ARG C 1 45  ? 53.212  47.170 45.028  1.00 17.73 ? 44  ARG C CA  1 
ATOM   3335 C  C   . ARG C 1 45  ? 53.567  48.241 46.067  1.00 17.32 ? 44  ARG C C   1 
ATOM   3336 O  O   . ARG C 1 45  ? 54.606  48.135 46.710  1.00 18.99 ? 44  ARG C O   1 
ATOM   3337 C  CB  . ARG C 1 45  ? 53.769  47.513 43.631  1.00 15.35 ? 44  ARG C CB  1 
ATOM   3338 C  CG  . ARG C 1 45  ? 53.850  46.320 42.704  1.00 22.27 ? 44  ARG C CG  1 
ATOM   3339 C  CD  . ARG C 1 45  ? 54.560  46.625 41.438  1.00 17.72 ? 44  ARG C CD  1 
ATOM   3340 N  NE  . ARG C 1 45  ? 53.828  47.590 40.614  1.00 20.17 ? 44  ARG C NE  1 
ATOM   3341 C  CZ  . ARG C 1 45  ? 52.888  47.277 39.730  1.00 20.18 ? 44  ARG C CZ  1 
ATOM   3342 N  NH1 . ARG C 1 45  ? 52.545  46.020 39.510  1.00 19.07 ? 44  ARG C NH1 1 
ATOM   3343 N  NH2 . ARG C 1 45  ? 52.290  48.234 39.046  1.00 21.48 ? 44  ARG C NH2 1 
ATOM   3344 N  N   . SER C 1 46  ? 52.694  49.229 46.292  1.00 17.85 ? 45  SER C N   1 
ATOM   3345 C  CA  . SER C 1 46  ? 52.918  50.195 47.379  1.00 21.16 ? 45  SER C CA  1 
ATOM   3346 C  C   . SER C 1 46  ? 52.938  49.491 48.741  1.00 22.14 ? 45  SER C C   1 
ATOM   3347 O  O   . SER C 1 46  ? 53.794  49.787 49.596  1.00 23.27 ? 45  SER C O   1 
ATOM   3348 C  CB  . SER C 1 46  ? 51.859  51.301 47.383  1.00 21.85 ? 45  SER C CB  1 
ATOM   3349 O  OG  . SER C 1 46  ? 52.083  52.201 46.302  1.00 29.90 ? 45  SER C OG  1 
ATOM   3350 N  N   . GLU C 1 47  ? 52.002  48.573 48.960  1.00 19.71 ? 46  GLU C N   1 
ATOM   3351 C  CA  . GLU C 1 47  ? 51.996  47.798 50.212  1.00 21.89 ? 46  GLU C CA  1 
ATOM   3352 C  C   . GLU C 1 47  ? 53.292  46.976 50.382  1.00 20.26 ? 46  GLU C C   1 
ATOM   3353 O  O   . GLU C 1 47  ? 53.870  46.919 51.486  1.00 19.78 ? 46  GLU C O   1 
ATOM   3354 C  CB  . GLU C 1 47  ? 50.770  46.884 50.278  1.00 23.31 ? 46  GLU C CB  1 
ATOM   3355 C  CG  . GLU C 1 47  ? 50.647  46.110 51.563  1.00 24.20 ? 46  GLU C CG  1 
ATOM   3356 C  CD  . GLU C 1 47  ? 50.502  47.019 52.770  1.00 30.38 ? 46  GLU C CD  1 
ATOM   3357 O  OE1 . GLU C 1 47  ? 50.985  46.646 53.856  1.00 32.64 ? 46  GLU C OE1 1 
ATOM   3358 O  OE2 . GLU C 1 47  ? 49.907  48.110 52.625  1.00 24.87 ? 46  GLU C OE2 1 
ATOM   3359 N  N   . VAL C 1 48  ? 53.759  46.336 49.314  1.00 21.16 ? 47  VAL C N   1 
ATOM   3360 C  CA  . VAL C 1 48  ? 55.046  45.626 49.378  1.00 19.92 ? 47  VAL C CA  1 
ATOM   3361 C  C   . VAL C 1 48  ? 56.159  46.600 49.799  1.00 23.07 ? 47  VAL C C   1 
ATOM   3362 O  O   . VAL C 1 48  ? 56.933  46.317 50.726  1.00 24.82 ? 47  VAL C O   1 
ATOM   3363 C  CB  . VAL C 1 48  ? 55.423  44.954 48.029  1.00 22.34 ? 47  VAL C CB  1 
ATOM   3364 C  CG1 . VAL C 1 48  ? 56.709  44.148 48.173  1.00 25.31 ? 47  VAL C CG1 1 
ATOM   3365 C  CG2 . VAL C 1 48  ? 54.302  44.061 47.532  1.00 20.47 ? 47  VAL C CG2 1 
ATOM   3366 N  N   . SER C 1 49  ? 56.210  47.766 49.155  1.00 21.19 ? 48  SER C N   1 
ATOM   3367 C  CA  . SER C 1 49  ? 57.197  48.804 49.481  1.00 24.02 ? 48  SER C CA  1 
ATOM   3368 C  C   . SER C 1 49  ? 57.264  49.194 50.949  1.00 25.18 ? 48  SER C C   1 
ATOM   3369 O  O   . SER C 1 49  ? 58.346  49.537 51.422  1.00 26.83 ? 48  SER C O   1 
ATOM   3370 C  CB  . SER C 1 49  ? 56.932  50.079 48.674  1.00 24.55 ? 48  SER C CB  1 
ATOM   3371 O  OG  . SER C 1 49  ? 57.421  49.916 47.362  1.00 32.44 ? 48  SER C OG  1 
ATOM   3372 N  N   . SER C 1 50  ? 56.135  49.168 51.664  1.00 23.64 ? 49  SER C N   1 
ATOM   3373 C  CA  . SER C 1 50  ? 56.124  49.513 53.105  1.00 24.20 ? 49  SER C CA  1 
ATOM   3374 C  C   . SER C 1 50  ? 57.000  48.611 53.968  1.00 24.96 ? 49  SER C C   1 
ATOM   3375 O  O   . SER C 1 50  ? 57.327  48.976 55.106  1.00 26.52 ? 49  SER C O   1 
ATOM   3376 C  CB  . SER C 1 50  ? 54.700  49.468 53.675  1.00 26.26 ? 49  SER C CB  1 
ATOM   3377 O  OG  . SER C 1 50  ? 54.241  48.123 53.794  1.00 26.34 ? 49  SER C OG  1 
ATOM   3378 N  N   . GLY C 1 51  ? 57.357  47.431 53.452  1.00 25.49 ? 50  GLY C N   1 
ATOM   3379 C  CA  . GLY C 1 51  ? 58.129  46.457 54.220  1.00 25.82 ? 50  GLY C CA  1 
ATOM   3380 C  C   . GLY C 1 51  ? 57.302  45.583 55.152  1.00 25.51 ? 50  GLY C C   1 
ATOM   3381 O  O   . GLY C 1 51  ? 57.870  44.785 55.893  1.00 26.64 ? 50  GLY C O   1 
ATOM   3382 N  N   . SER C 1 52  ? 55.967  45.687 55.116  1.00 24.38 ? 51  SER C N   1 
ATOM   3383 C  CA  . SER C 1 52  ? 55.114  44.890 56.033  1.00 21.70 ? 51  SER C CA  1 
ATOM   3384 C  C   . SER C 1 52  ? 55.201  43.384 55.735  1.00 21.73 ? 51  SER C C   1 
ATOM   3385 O  O   . SER C 1 52  ? 55.590  42.993 54.632  1.00 20.29 ? 51  SER C O   1 
ATOM   3386 C  CB  . SER C 1 52  ? 53.652  45.378 56.008  1.00 23.48 ? 51  SER C CB  1 
ATOM   3387 O  OG  . SER C 1 52  ? 53.057  45.298 54.717  1.00 18.42 ? 51  SER C OG  1 
ATOM   3388 N  N   . ALA C 1 53  ? 54.876  42.546 56.725  1.00 20.31 ? 52  ALA C N   1 
ATOM   3389 C  CA  . ALA C 1 53  ? 54.855  41.086 56.530  1.00 20.73 ? 52  ALA C CA  1 
ATOM   3390 C  C   . ALA C 1 53  ? 53.795  40.693 55.510  1.00 20.94 ? 52  ALA C C   1 
ATOM   3391 O  O   . ALA C 1 53  ? 54.030  39.844 54.658  1.00 21.29 ? 52  ALA C O   1 
ATOM   3392 C  CB  . ALA C 1 53  ? 54.591  40.369 57.849  1.00 21.79 ? 52  ALA C CB  1 
ATOM   3393 N  N   . ARG C 1 54  ? 52.628  41.327 55.602  1.00 23.24 ? 53  ARG C N   1 
ATOM   3394 C  CA  . ARG C 1 54  ? 51.540  41.069 54.649  1.00 24.23 ? 53  ARG C CA  1 
ATOM   3395 C  C   . ARG C 1 54  ? 51.946  41.469 53.247  1.00 21.21 ? 53  ARG C C   1 
ATOM   3396 O  O   . ARG C 1 54  ? 51.606  40.775 52.304  1.00 22.13 ? 53  ARG C O   1 
ATOM   3397 C  CB  . ARG C 1 54  ? 50.225  41.746 55.067  1.00 24.65 ? 53  ARG C CB  1 
ATOM   3398 C  CG  . ARG C 1 54  ? 49.428  40.893 56.079  1.00 28.95 ? 53  ARG C CG  1 
ATOM   3399 N  N   . GLY C 1 55  ? 52.706  42.558 53.124  1.00 21.21 ? 54  GLY C N   1 
ATOM   3400 C  CA  . GLY C 1 55  ? 53.349  42.937 51.857  1.00 21.11 ? 54  GLY C CA  1 
ATOM   3401 C  C   . GLY C 1 55  ? 54.270  41.852 51.305  1.00 22.51 ? 54  GLY C C   1 
ATOM   3402 O  O   . GLY C 1 55  ? 54.279  41.561 50.100  1.00 21.67 ? 54  GLY C O   1 
ATOM   3403 N  N   . LYS C 1 56  ? 55.065  41.261 52.184  1.00 21.43 ? 55  LYS C N   1 
ATOM   3404 C  CA  . LYS C 1 56  ? 55.971  40.178 51.792  1.00 22.77 ? 55  LYS C CA  1 
ATOM   3405 C  C   . LYS C 1 56  ? 55.199  39.000 51.164  1.00 21.80 ? 55  LYS C C   1 
ATOM   3406 O  O   . LYS C 1 56  ? 55.576  38.511 50.091  1.00 20.27 ? 55  LYS C O   1 
ATOM   3407 C  CB  . LYS C 1 56  ? 56.821  39.707 52.996  1.00 23.96 ? 55  LYS C CB  1 
ATOM   3408 C  CG  . LYS C 1 56  ? 58.122  39.029 52.585  1.00 23.62 ? 55  LYS C CG  1 
ATOM   3409 C  CD  . LYS C 1 56  ? 58.889  38.401 53.773  1.00 25.98 ? 55  LYS C CD  1 
ATOM   3410 N  N   . LYS C 1 57  ? 54.103  38.583 51.808  1.00 21.55 ? 56  LYS C N   1 
ATOM   3411 C  CA  . LYS C 1 57  ? 53.253  37.492 51.292  1.00 22.13 ? 56  LYS C CA  1 
ATOM   3412 C  C   . LYS C 1 57  ? 52.553  37.854 49.970  1.00 20.94 ? 56  LYS C C   1 
ATOM   3413 O  O   . LYS C 1 57  ? 52.398  36.999 49.109  1.00 20.30 ? 56  LYS C O   1 
ATOM   3414 C  CB  . LYS C 1 57  ? 52.206  37.064 52.312  1.00 22.32 ? 56  LYS C CB  1 
ATOM   3415 C  CG  . LYS C 1 57  ? 52.778  36.263 53.470  1.00 29.01 ? 56  LYS C CG  1 
ATOM   3416 C  CD  . LYS C 1 57  ? 51.796  36.196 54.637  1.00 39.28 ? 56  LYS C CD  1 
ATOM   3417 N  N   . LEU C 1 58  ? 52.134  39.108 49.811  1.00 19.91 ? 57  LEU C N   1 
ATOM   3418 C  CA  . LEU C 1 58  ? 51.553  39.556 48.555  1.00 20.33 ? 57  LEU C CA  1 
ATOM   3419 C  C   . LEU C 1 58  ? 52.574  39.462 47.440  1.00 19.50 ? 57  LEU C C   1 
ATOM   3420 O  O   . LEU C 1 58  ? 52.219  39.063 46.336  1.00 20.30 ? 57  LEU C O   1 
ATOM   3421 C  CB  . LEU C 1 58  ? 51.024  41.002 48.644  1.00 19.51 ? 57  LEU C CB  1 
ATOM   3422 C  CG  . LEU C 1 58  ? 49.796  41.225 49.527  1.00 21.24 ? 57  LEU C CG  1 
ATOM   3423 C  CD1 . LEU C 1 58  ? 49.470  42.717 49.639  1.00 22.81 ? 57  LEU C CD1 1 
ATOM   3424 C  CD2 . LEU C 1 58  ? 48.576  40.433 49.030  1.00 20.06 ? 57  LEU C CD2 1 
ATOM   3425 N  N   . SER C 1 59  ? 53.825  39.823 47.736  1.00 18.89 ? 58  SER C N   1 
ATOM   3426 C  CA  . SER C 1 59  ? 54.884  39.883 46.730  1.00 19.58 ? 58  SER C CA  1 
ATOM   3427 C  C   . SER C 1 59  ? 55.134  38.493 46.176  1.00 19.63 ? 58  SER C C   1 
ATOM   3428 O  O   . SER C 1 59  ? 55.259  38.318 44.968  1.00 19.37 ? 58  SER C O   1 
ATOM   3429 C  CB  . SER C 1 59  ? 56.190  40.440 47.304  1.00 22.25 ? 58  SER C CB  1 
ATOM   3430 O  OG  . SER C 1 59  ? 57.063  40.787 46.231  1.00 25.54 ? 58  SER C OG  1 
ATOM   3431 N  N   . GLU C 1 60  ? 55.169  37.509 47.068  1.00 19.56 ? 59  GLU C N   1 
ATOM   3432 C  CA  . GLU C 1 60  ? 55.379  36.111 46.677  1.00 20.81 ? 59  GLU C CA  1 
ATOM   3433 C  C   . GLU C 1 60  ? 54.357  35.585 45.662  1.00 19.55 ? 59  GLU C C   1 
ATOM   3434 O  O   . GLU C 1 60  ? 54.709  34.865 44.734  1.00 21.66 ? 59  GLU C O   1 
ATOM   3435 C  CB  . GLU C 1 60  ? 55.367  35.225 47.931  1.00 23.35 ? 59  GLU C CB  1 
ATOM   3436 C  CG  . GLU C 1 60  ? 56.580  35.429 48.821  1.00 27.22 ? 59  GLU C CG  1 
ATOM   3437 N  N   . ILE C 1 61  ? 53.092  35.950 45.851  1.00 20.97 ? 60  ILE C N   1 
ATOM   3438 C  CA  . ILE C 1 61  ? 51.987  35.602 44.929  1.00 21.42 ? 60  ILE C CA  1 
ATOM   3439 C  C   . ILE C 1 61  ? 52.146  36.331 43.577  1.00 20.64 ? 60  ILE C C   1 
ATOM   3440 O  O   . ILE C 1 61  ? 52.023  35.751 42.504  1.00 17.93 ? 60  ILE C O   1 
ATOM   3441 C  CB  . ILE C 1 61  ? 50.630  36.004 45.593  1.00 23.06 ? 60  ILE C CB  1 
ATOM   3442 C  CG1 . ILE C 1 61  ? 50.395  35.181 46.866  1.00 23.96 ? 60  ILE C CG1 1 
ATOM   3443 C  CG2 . ILE C 1 61  ? 49.439  35.833 44.653  1.00 24.74 ? 60  ILE C CG2 1 
ATOM   3444 C  CD1 . ILE C 1 61  ? 49.386  35.852 47.838  1.00 25.99 ? 60  ILE C CD1 1 
ATOM   3445 N  N   . MET C 1 62  ? 52.412  37.624 43.646  1.00 17.55 ? 61  MET C N   1 
ATOM   3446 C  CA  . MET C 1 62  ? 52.645  38.421 42.464  1.00 20.84 ? 61  MET C CA  1 
ATOM   3447 C  C   . MET C 1 62  ? 53.846  37.911 41.649  1.00 20.51 ? 61  MET C C   1 
ATOM   3448 O  O   . MET C 1 62  ? 53.799  37.862 40.403  1.00 20.39 ? 61  MET C O   1 
ATOM   3449 C  CB  . MET C 1 62  ? 52.818  39.881 42.871  1.00 21.72 ? 61  MET C CB  1 
ATOM   3450 C  CG  . MET C 1 62  ? 51.538  40.464 43.500  1.00 22.79 ? 61  MET C CG  1 
ATOM   3451 S  SD  . MET C 1 62  ? 51.886  41.936 44.479  1.00 31.29 ? 61  MET C SD  1 
ATOM   3452 C  CE  . MET C 1 62  ? 51.784  43.104 43.147  1.00 21.68 ? 61  MET C CE  1 
ATOM   3453 N  N   . GLU C 1 63  ? 54.889  37.470 42.347  1.00 19.62 ? 62  GLU C N   1 
ATOM   3454 C  CA  . GLU C 1 63  ? 56.071  36.918 41.678  1.00 20.17 ? 62  GLU C CA  1 
ATOM   3455 C  C   . GLU C 1 63  ? 55.781  35.585 40.932  1.00 20.69 ? 62  GLU C C   1 
ATOM   3456 O  O   . GLU C 1 63  ? 56.567  35.179 40.082  1.00 21.80 ? 62  GLU C O   1 
ATOM   3457 C  CB  . GLU C 1 63  ? 57.220  36.773 42.678  1.00 19.36 ? 62  GLU C CB  1 
ATOM   3458 C  CG  . GLU C 1 63  ? 57.861  38.100 43.035  1.00 21.59 ? 62  GLU C CG  1 
ATOM   3459 C  CD  . GLU C 1 63  ? 58.866  38.008 44.187  1.00 26.89 ? 62  GLU C CD  1 
ATOM   3460 O  OE1 . GLU C 1 63  ? 58.561  38.530 45.293  1.00 41.48 ? 62  GLU C OE1 1 
ATOM   3461 O  OE2 . GLU C 1 63  ? 59.950  37.425 43.990  1.00 30.14 ? 62  GLU C OE2 1 
ATOM   3462 N  N   . LYS C 1 64  ? 54.657  34.934 41.236  1.00 20.49 ? 63  LYS C N   1 
ATOM   3463 C  CA  . LYS C 1 64  ? 54.227  33.714 40.548  1.00 21.58 ? 63  LYS C CA  1 
ATOM   3464 C  C   . LYS C 1 64  ? 53.220  33.966 39.417  1.00 22.06 ? 63  LYS C C   1 
ATOM   3465 O  O   . LYS C 1 64  ? 52.748  33.020 38.782  1.00 22.80 ? 63  LYS C O   1 
ATOM   3466 C  CB  . LYS C 1 64  ? 53.565  32.740 41.539  1.00 23.88 ? 63  LYS C CB  1 
ATOM   3467 C  CG  . LYS C 1 64  ? 54.468  32.046 42.536  1.00 25.87 ? 63  LYS C CG  1 
ATOM   3468 C  CD  . LYS C 1 64  ? 53.654  31.534 43.719  1.00 30.94 ? 63  LYS C CD  1 
ATOM   3469 C  CE  . LYS C 1 64  ? 54.524  30.879 44.774  1.00 33.36 ? 63  LYS C CE  1 
ATOM   3470 N  NZ  . LYS C 1 64  ? 53.933  31.059 46.138  1.00 37.20 ? 63  LYS C NZ  1 
ATOM   3471 N  N   . GLY C 1 65  ? 52.850  35.212 39.158  1.00 20.45 ? 64  GLY C N   1 
ATOM   3472 C  CA  . GLY C 1 65  ? 51.861  35.495 38.120  1.00 20.65 ? 64  GLY C CA  1 
ATOM   3473 C  C   . GLY C 1 65  ? 50.402  35.256 38.482  1.00 20.92 ? 64  GLY C C   1 
ATOM   3474 O  O   . GLY C 1 65  ? 49.547  35.272 37.605  1.00 21.08 ? 64  GLY C O   1 
ATOM   3475 N  N   . GLN C 1 66  ? 50.116  35.139 39.782  1.00 20.44 ? 65  GLN C N   1 
ATOM   3476 C  CA  . GLN C 1 66  ? 48.798  34.755 40.291  1.00 20.09 ? 65  GLN C CA  1 
ATOM   3477 C  C   . GLN C 1 66  ? 48.030  35.896 40.939  1.00 18.83 ? 65  GLN C C   1 
ATOM   3478 O  O   . GLN C 1 66  ? 48.575  36.932 41.311  1.00 18.00 ? 65  GLN C O   1 
ATOM   3479 C  CB  . GLN C 1 66  ? 48.950  33.648 41.341  1.00 18.55 ? 65  GLN C CB  1 
ATOM   3480 C  CG  . GLN C 1 66  ? 49.605  32.395 40.831  1.00 23.95 ? 65  GLN C CG  1 
ATOM   3481 C  CD  . GLN C 1 66  ? 49.856  31.353 41.933  1.00 26.46 ? 65  GLN C CD  1 
ATOM   3482 O  OE1 . GLN C 1 66  ? 49.740  31.638 43.139  1.00 40.62 ? 65  GLN C OE1 1 
ATOM   3483 N  NE2 . GLN C 1 66  ? 50.223  30.144 41.518  1.00 31.33 ? 65  GLN C NE2 1 
ATOM   3484 N  N   . LEU C 1 67  ? 46.743  35.672 41.094  1.00 18.71 ? 66  LEU C N   1 
ATOM   3485 C  CA  . LEU C 1 67  ? 45.854  36.650 41.702  1.00 17.11 ? 66  LEU C CA  1 
ATOM   3486 C  C   . LEU C 1 67  ? 45.959  36.643 43.227  1.00 16.86 ? 66  LEU C C   1 
ATOM   3487 O  O   . LEU C 1 67  ? 45.913  35.590 43.866  1.00 13.94 ? 66  LEU C O   1 
ATOM   3488 C  CB  . LEU C 1 67  ? 44.412  36.364 41.267  1.00 19.25 ? 66  LEU C CB  1 
ATOM   3489 C  CG  . LEU C 1 67  ? 44.135  36.365 39.761  1.00 18.00 ? 66  LEU C CG  1 
ATOM   3490 C  CD1 . LEU C 1 67  ? 42.667  36.122 39.526  1.00 24.05 ? 66  LEU C CD1 1 
ATOM   3491 C  CD2 . LEU C 1 67  ? 44.567  37.683 39.108  1.00 22.65 ? 66  LEU C CD2 1 
ATOM   3492 N  N   . VAL C 1 68  ? 46.077  37.820 43.832  1.00 16.30 ? 67  VAL C N   1 
ATOM   3493 C  CA  . VAL C 1 68  ? 45.970  37.899 45.286  1.00 19.02 ? 67  VAL C CA  1 
ATOM   3494 C  C   . VAL C 1 68  ? 44.476  37.737 45.679  1.00 20.38 ? 67  VAL C C   1 
ATOM   3495 O  O   . VAL C 1 68  ? 43.594  37.849 44.820  1.00 22.02 ? 67  VAL C O   1 
ATOM   3496 C  CB  . VAL C 1 68  ? 46.628  39.174 45.860  1.00 18.12 ? 67  VAL C CB  1 
ATOM   3497 C  CG1 . VAL C 1 68  ? 48.019  39.356 45.250  1.00 19.94 ? 67  VAL C CG1 1 
ATOM   3498 C  CG2 . VAL C 1 68  ? 45.799  40.374 45.604  1.00 25.35 ? 67  VAL C CG2 1 
ATOM   3499 N  N   . PRO C 1 69  ? 44.202  37.425 46.957  1.00 20.88 ? 68  PRO C N   1 
ATOM   3500 C  CA  . PRO C 1 69  ? 42.849  37.276 47.478  1.00 20.76 ? 68  PRO C CA  1 
ATOM   3501 C  C   . PRO C 1 69  ? 41.952  38.463 47.210  1.00 17.97 ? 68  PRO C C   1 
ATOM   3502 O  O   . PRO C 1 69  ? 42.373  39.639 47.337  1.00 19.42 ? 68  PRO C O   1 
ATOM   3503 C  CB  . PRO C 1 69  ? 43.071  37.131 48.971  1.00 19.33 ? 68  PRO C CB  1 
ATOM   3504 C  CG  . PRO C 1 69  ? 44.397  36.555 49.075  1.00 23.38 ? 68  PRO C CG  1 
ATOM   3505 C  CD  . PRO C 1 69  ? 45.200  37.170 48.010  1.00 18.95 ? 68  PRO C CD  1 
ATOM   3506 N  N   . LEU C 1 70  ? 40.720  38.140 46.838  1.00 17.96 ? 69  LEU C N   1 
ATOM   3507 C  CA  . LEU C 1 70  ? 39.740  39.125 46.408  1.00 17.96 ? 69  LEU C CA  1 
ATOM   3508 C  C   . LEU C 1 70  ? 39.501  40.179 47.481  1.00 17.03 ? 69  LEU C C   1 
ATOM   3509 O  O   . LEU C 1 70  ? 39.507  41.361 47.178  1.00 19.00 ? 69  LEU C O   1 
ATOM   3510 C  CB  . LEU C 1 70  ? 38.415  38.444 46.030  1.00 20.14 ? 69  LEU C CB  1 
ATOM   3511 C  CG  . LEU C 1 70  ? 37.241  39.334 45.565  1.00 17.68 ? 69  LEU C CG  1 
ATOM   3512 C  CD1 . LEU C 1 70  ? 36.239  38.507 44.759  1.00 20.16 ? 69  LEU C CD1 1 
ATOM   3513 C  CD2 . LEU C 1 70  ? 36.507  40.036 46.748  1.00 18.10 ? 69  LEU C CD2 1 
ATOM   3514 N  N   . GLU C 1 71  ? 39.302  39.763 48.719  1.00 18.08 ? 70  GLU C N   1 
ATOM   3515 C  CA  . GLU C 1 71  ? 38.921  40.722 49.787  1.00 18.57 ? 70  GLU C CA  1 
ATOM   3516 C  C   . GLU C 1 71  ? 40.022  41.723 50.021  1.00 17.78 ? 70  GLU C C   1 
ATOM   3517 O  O   . GLU C 1 71  ? 39.753  42.907 50.198  1.00 16.28 ? 70  GLU C O   1 
ATOM   3518 C  CB  . GLU C 1 71  ? 38.554  40.019 51.094  1.00 18.94 ? 70  GLU C CB  1 
ATOM   3519 C  CG  . GLU C 1 71  ? 37.850  40.946 52.145  1.00 22.98 ? 70  GLU C CG  1 
ATOM   3520 C  CD  . GLU C 1 71  ? 36.485  41.497 51.684  1.00 26.24 ? 70  GLU C CD  1 
ATOM   3521 O  OE1 . GLU C 1 71  ? 35.847  40.875 50.796  1.00 18.68 ? 70  GLU C OE1 1 
ATOM   3522 O  OE2 . GLU C 1 71  ? 36.043  42.561 52.201  1.00 13.93 ? 70  GLU C OE2 1 
ATOM   3523 N  N   . THR C 1 72  ? 41.270  41.253 49.978  1.00 18.06 ? 71  THR C N   1 
ATOM   3524 C  CA  . THR C 1 72  ? 42.417  42.109 50.243  1.00 19.21 ? 71  THR C CA  1 
ATOM   3525 C  C   . THR C 1 72  ? 42.540  43.212 49.199  1.00 18.83 ? 71  THR C C   1 
ATOM   3526 O  O   . THR C 1 72  ? 42.794  44.390 49.524  1.00 17.38 ? 71  THR C O   1 
ATOM   3527 C  CB  . THR C 1 72  ? 43.710  41.312 50.236  1.00 19.57 ? 71  THR C CB  1 
ATOM   3528 O  OG1 . THR C 1 72  ? 43.603  40.286 51.233  1.00 22.79 ? 71  THR C OG1 1 
ATOM   3529 C  CG2 . THR C 1 72  ? 44.899  42.228 50.576  1.00 28.85 ? 71  THR C CG2 1 
ATOM   3530 N  N   . VAL C 1 73  ? 42.384  42.821 47.940  1.00 19.59 ? 72  VAL C N   1 
ATOM   3531 C  CA  . VAL C 1 73  ? 42.561  43.761 46.867  1.00 16.35 ? 72  VAL C CA  1 
ATOM   3532 C  C   . VAL C 1 73  ? 41.354  44.701 46.741  1.00 18.16 ? 72  VAL C C   1 
ATOM   3533 O  O   . VAL C 1 73  ? 41.514  45.902 46.491  1.00 18.51 ? 72  VAL C O   1 
ATOM   3534 C  CB  . VAL C 1 73  ? 42.939  43.048 45.523  1.00 20.45 ? 72  VAL C CB  1 
ATOM   3535 C  CG1 . VAL C 1 73  ? 41.842  42.117 45.023  1.00 17.55 ? 72  VAL C CG1 1 
ATOM   3536 C  CG2 . VAL C 1 73  ? 43.288  44.099 44.478  1.00 20.92 ? 72  VAL C CG2 1 
ATOM   3537 N  N   . LEU C 1 74  ? 40.150  44.164 46.906  1.00 19.15 ? 73  LEU C N   1 
ATOM   3538 C  CA  . LEU C 1 74  ? 38.931  45.007 46.922  1.00 16.88 ? 73  LEU C CA  1 
ATOM   3539 C  C   . LEU C 1 74  ? 38.929  46.047 48.038  1.00 16.73 ? 73  LEU C C   1 
ATOM   3540 O  O   . LEU C 1 74  ? 38.635  47.260 47.800  1.00 14.10 ? 73  LEU C O   1 
ATOM   3541 C  CB  . LEU C 1 74  ? 37.669  44.117 46.994  1.00 16.56 ? 73  LEU C CB  1 
ATOM   3542 C  CG  . LEU C 1 74  ? 36.366  44.896 46.956  1.00 17.88 ? 73  LEU C CG  1 
ATOM   3543 C  CD1 . LEU C 1 74  ? 36.271  45.792 45.694  1.00 18.22 ? 73  LEU C CD1 1 
ATOM   3544 C  CD2 . LEU C 1 74  ? 35.211  43.900 47.025  1.00 15.85 ? 73  LEU C CD2 1 
ATOM   3545 N  N   . ASP C 1 75  ? 39.275  45.643 49.258  1.00 15.03 ? 74  ASP C N   1 
ATOM   3546 C  CA  . ASP C 1 75  ? 39.379  46.652 50.332  1.00 16.34 ? 74  ASP C CA  1 
ATOM   3547 C  C   . ASP C 1 75  ? 40.393  47.787 50.080  1.00 17.24 ? 74  ASP C C   1 
ATOM   3548 O  O   . ASP C 1 75  ? 40.098  48.960 50.326  1.00 17.32 ? 74  ASP C O   1 
ATOM   3549 C  CB  . ASP C 1 75  ? 39.638  45.999 51.703  1.00 17.35 ? 74  ASP C CB  1 
ATOM   3550 C  CG  . ASP C 1 75  ? 38.419  45.264 52.247  1.00 18.40 ? 74  ASP C CG  1 
ATOM   3551 O  OD1 . ASP C 1 75  ? 37.247  45.577 51.880  1.00 15.89 ? 74  ASP C OD1 1 
ATOM   3552 O  OD2 . ASP C 1 75  ? 38.625  44.384 53.091  1.00 18.55 ? 74  ASP C OD2 1 
ATOM   3553 N  N   . MET C 1 76  ? 41.561  47.447 49.558  1.00 16.00 ? 75  MET C N   1 
ATOM   3554 C  CA  . MET C 1 76  ? 42.567  48.433 49.175  1.00 19.04 ? 75  MET C CA  1 
ATOM   3555 C  C   . MET C 1 76  ? 42.053  49.406 48.121  1.00 15.81 ? 75  MET C C   1 
ATOM   3556 O  O   . MET C 1 76  ? 42.246  50.606 48.218  1.00 15.21 ? 75  MET C O   1 
ATOM   3557 C  CB  . MET C 1 76  ? 43.748  47.684 48.572  1.00 18.96 ? 75  MET C CB  1 
ATOM   3558 C  CG  . MET C 1 76  ? 45.074  48.331 48.672  1.00 28.50 ? 75  MET C CG  1 
ATOM   3559 S  SD  . MET C 1 76  ? 46.283  47.101 48.078  1.00 33.05 ? 75  MET C SD  1 
ATOM   3560 C  CE  . MET C 1 76  ? 46.170  45.895 49.379  1.00 20.32 ? 75  MET C CE  1 
ATOM   3561 N  N   . LEU C 1 77  ? 41.409  48.842 47.096  1.00 16.80 ? 76  LEU C N   1 
ATOM   3562 C  CA  . LEU C 1 77  ? 40.809  49.604 46.012  1.00 17.39 ? 76  LEU C CA  1 
ATOM   3563 C  C   . LEU C 1 77  ? 39.728  50.531 46.539  1.00 16.02 ? 76  LEU C C   1 
ATOM   3564 O  O   . LEU C 1 77  ? 39.718  51.748 46.269  1.00 18.94 ? 76  LEU C O   1 
ATOM   3565 C  CB  . LEU C 1 77  ? 40.214  48.653 44.973  1.00 16.13 ? 76  LEU C CB  1 
ATOM   3566 C  CG  . LEU C 1 77  ? 39.564  49.349 43.778  1.00 19.46 ? 76  LEU C CG  1 
ATOM   3567 C  CD1 . LEU C 1 77  ? 40.464  50.394 43.123  1.00 18.80 ? 76  LEU C CD1 1 
ATOM   3568 C  CD2 . LEU C 1 77  ? 39.153  48.298 42.789  1.00 18.96 ? 76  LEU C CD2 1 
ATOM   3569 N  N   . ARG C 1 78  ? 38.811  49.990 47.315  1.00 13.32 ? 77  ARG C N   1 
ATOM   3570 C  CA  . ARG C 1 78  ? 37.710  50.819 47.822  1.00 16.34 ? 77  ARG C CA  1 
ATOM   3571 C  C   . ARG C 1 78  ? 38.222  51.968 48.703  1.00 15.65 ? 77  ARG C C   1 
ATOM   3572 O  O   . ARG C 1 78  ? 37.692  53.077 48.658  1.00 13.99 ? 77  ARG C O   1 
ATOM   3573 C  CB  . ARG C 1 78  ? 36.711  49.962 48.604  1.00 17.99 ? 77  ARG C CB  1 
ATOM   3574 C  CG  . ARG C 1 78  ? 35.373  50.660 48.864  1.00 18.21 ? 77  ARG C CG  1 
ATOM   3575 C  CD  . ARG C 1 78  ? 34.371  49.737 49.527  1.00 15.98 ? 77  ARG C CD  1 
ATOM   3576 N  NE  . ARG C 1 78  ? 33.180  50.446 50.002  1.00 18.64 ? 77  ARG C NE  1 
ATOM   3577 C  CZ  . ARG C 1 78  ? 33.148  51.207 51.090  1.00 24.04 ? 77  ARG C CZ  1 
ATOM   3578 N  NH1 . ARG C 1 78  ? 34.239  51.403 51.831  1.00 28.98 ? 77  ARG C NH1 1 
ATOM   3579 N  NH2 . ARG C 1 78  ? 32.016  51.786 51.445  1.00 30.91 ? 77  ARG C NH2 1 
ATOM   3580 N  N   . ASP C 1 79  ? 39.225  51.709 49.536  1.00 16.83 ? 78  ASP C N   1 
ATOM   3581 C  CA  . ASP C 1 79  ? 39.822  52.795 50.351  1.00 15.92 ? 78  ASP C CA  1 
ATOM   3582 C  C   . ASP C 1 79  ? 40.331  53.956 49.511  1.00 15.31 ? 78  ASP C C   1 
ATOM   3583 O  O   . ASP C 1 79  ? 40.170  55.150 49.866  1.00 17.84 ? 78  ASP C O   1 
ATOM   3584 C  CB  . ASP C 1 79  ? 40.996  52.274 51.165  1.00 17.55 ? 78  ASP C CB  1 
ATOM   3585 C  CG  . ASP C 1 79  ? 40.573  51.474 52.339  1.00 22.42 ? 78  ASP C CG  1 
ATOM   3586 O  OD1 . ASP C 1 79  ? 39.368  51.508 52.685  1.00 24.01 ? 78  ASP C OD1 1 
ATOM   3587 O  OD2 . ASP C 1 79  ? 41.457  50.809 52.922  1.00 27.77 ? 78  ASP C OD2 1 
ATOM   3588 N  N   . ALA C 1 80  ? 40.994  53.595 48.429  1.00 15.54 ? 79  ALA C N   1 
ATOM   3589 C  CA  . ALA C 1 80  ? 41.557  54.564 47.515  1.00 17.54 ? 79  ALA C CA  1 
ATOM   3590 C  C   . ALA C 1 80  ? 40.452  55.399 46.832  1.00 18.57 ? 79  ALA C C   1 
ATOM   3591 O  O   . ALA C 1 80  ? 40.616  56.601 46.652  1.00 19.65 ? 79  ALA C O   1 
ATOM   3592 C  CB  . ALA C 1 80  ? 42.450  53.863 46.490  1.00 16.85 ? 79  ALA C CB  1 
ATOM   3593 N  N   . MET C 1 81  ? 39.336  54.765 46.473  1.00 18.97 ? 80  MET C N   1 
ATOM   3594 C  CA  . MET C 1 81  ? 38.177  55.467 45.909  1.00 18.62 ? 80  MET C CA  1 
ATOM   3595 C  C   . MET C 1 81  ? 37.551  56.412 46.911  1.00 18.15 ? 80  MET C C   1 
ATOM   3596 O  O   . MET C 1 81  ? 37.240  57.564 46.589  1.00 17.16 ? 80  MET C O   1 
ATOM   3597 C  CB  . MET C 1 81  ? 37.133  54.465 45.390  1.00 17.57 ? 80  MET C CB  1 
ATOM   3598 C  CG  . MET C 1 81  ? 37.597  53.715 44.170  1.00 22.57 ? 80  MET C CG  1 
ATOM   3599 S  SD  . MET C 1 81  ? 36.359  52.577 43.485  1.00 21.06 ? 80  MET C SD  1 
ATOM   3600 C  CE  . MET C 1 81  ? 35.221  53.694 42.692  1.00 20.87 ? 80  MET C CE  1 
ATOM   3601 N  N   . VAL C 1 82  ? 37.378  55.943 48.144  1.00 15.46 ? 81  VAL C N   1 
ATOM   3602 C  CA  . VAL C 1 82  ? 36.787  56.754 49.194  1.00 15.65 ? 81  VAL C CA  1 
ATOM   3603 C  C   . VAL C 1 82  ? 37.628  58.024 49.439  1.00 15.39 ? 81  VAL C C   1 
ATOM   3604 O  O   . VAL C 1 82  ? 37.081  59.100 49.700  1.00 18.34 ? 81  VAL C O   1 
ATOM   3605 C  CB  . VAL C 1 82  ? 36.607  55.906 50.493  1.00 14.49 ? 81  VAL C CB  1 
ATOM   3606 C  CG1 . VAL C 1 82  ? 36.317  56.767 51.678  1.00 20.12 ? 81  VAL C CG1 1 
ATOM   3607 C  CG2 . VAL C 1 82  ? 35.506  54.849 50.294  1.00 13.20 ? 81  VAL C CG2 1 
ATOM   3608 N  N   . ALA C 1 83  ? 38.952  57.889 49.337  1.00 16.17 ? 82  ALA C N   1 
ATOM   3609 C  CA  . ALA C 1 83  ? 39.879  58.999 49.558  1.00 16.44 ? 82  ALA C CA  1 
ATOM   3610 C  C   . ALA C 1 83  ? 39.808  60.107 48.481  1.00 20.05 ? 82  ALA C C   1 
ATOM   3611 O  O   . ALA C 1 83  ? 40.069  61.268 48.787  1.00 18.48 ? 82  ALA C O   1 
ATOM   3612 C  CB  . ALA C 1 83  ? 41.294  58.478 49.679  1.00 16.89 ? 82  ALA C CB  1 
ATOM   3613 N  N   . LYS C 1 84  ? 39.405  59.783 47.248  1.00 20.83 ? 83  LYS C N   1 
ATOM   3614 C  CA  . LYS C 1 84  ? 39.384  60.797 46.189  1.00 23.03 ? 83  LYS C CA  1 
ATOM   3615 C  C   . LYS C 1 84  ? 37.977  61.174 45.677  1.00 24.93 ? 83  LYS C C   1 
ATOM   3616 O  O   . LYS C 1 84  ? 37.833  62.079 44.842  1.00 26.68 ? 83  LYS C O   1 
ATOM   3617 C  CB  . LYS C 1 84  ? 40.316  60.356 45.046  1.00 25.30 ? 83  LYS C CB  1 
ATOM   3618 C  CG  . LYS C 1 84  ? 41.807  60.648 45.345  1.00 25.61 ? 83  LYS C CG  1 
ATOM   3619 C  CD  . LYS C 1 84  ? 42.740  59.787 44.524  1.00 35.29 ? 83  LYS C CD  1 
ATOM   3620 N  N   . VAL C 1 85  ? 36.932  60.524 46.185  1.00 24.81 ? 84  VAL C N   1 
ATOM   3621 C  CA  . VAL C 1 85  ? 35.597  60.688 45.577  1.00 25.29 ? 84  VAL C CA  1 
ATOM   3622 C  C   . VAL C 1 85  ? 35.010  62.109 45.703  1.00 25.91 ? 84  VAL C C   1 
ATOM   3623 O  O   . VAL C 1 85  ? 34.370  62.609 44.760  1.00 26.16 ? 84  VAL C O   1 
ATOM   3624 C  CB  . VAL C 1 85  ? 34.603  59.623 46.098  1.00 25.02 ? 84  VAL C CB  1 
ATOM   3625 C  CG1 . VAL C 1 85  ? 34.151  59.958 47.466  1.00 23.64 ? 84  VAL C CG1 1 
ATOM   3626 C  CG2 . VAL C 1 85  ? 33.417  59.499 45.137  1.00 30.73 ? 84  VAL C CG2 1 
ATOM   3627 N  N   . ASN C 1 86  ? 35.257  62.765 46.833  1.00 24.47 ? 85  ASN C N   1 
ATOM   3628 C  CA  . ASN C 1 86  ? 34.781  64.142 47.049  1.00 27.67 ? 85  ASN C CA  1 
ATOM   3629 C  C   . ASN C 1 86  ? 35.268  65.176 46.010  1.00 28.07 ? 85  ASN C C   1 
ATOM   3630 O  O   . ASN C 1 86  ? 34.607  66.211 45.805  1.00 30.28 ? 85  ASN C O   1 
ATOM   3631 C  CB  . ASN C 1 86  ? 35.139  64.633 48.460  1.00 27.23 ? 85  ASN C CB  1 
ATOM   3632 C  CG  . ASN C 1 86  ? 34.135  64.182 49.521  1.00 33.73 ? 85  ASN C CG  1 
ATOM   3633 O  OD1 . ASN C 1 86  ? 33.578  63.083 49.463  1.00 38.63 ? 85  ASN C OD1 1 
ATOM   3634 N  ND2 . ASN C 1 86  ? 33.903  65.043 50.498  1.00 36.12 ? 85  ASN C ND2 1 
ATOM   3635 N  N   . THR C 1 87  ? 36.408  64.900 45.377  1.00 27.26 ? 86  THR C N   1 
ATOM   3636 C  CA  . THR C 1 87  ? 36.983  65.789 44.369  1.00 27.54 ? 86  THR C CA  1 
ATOM   3637 C  C   . THR C 1 87  ? 37.088  65.185 42.956  1.00 26.64 ? 86  THR C C   1 
ATOM   3638 O  O   . THR C 1 87  ? 37.392  65.897 42.010  1.00 27.51 ? 86  THR C O   1 
ATOM   3639 C  CB  . THR C 1 87  ? 38.392  66.238 44.791  1.00 29.60 ? 86  THR C CB  1 
ATOM   3640 O  OG1 . THR C 1 87  ? 39.213  65.089 45.014  1.00 28.03 ? 86  THR C OG1 1 
ATOM   3641 C  CG2 . THR C 1 87  ? 38.334  67.089 46.074  1.00 30.90 ? 86  THR C CG2 1 
ATOM   3642 N  N   . SER C 1 88  ? 36.830  63.892 42.807  1.00 23.48 ? 87  SER C N   1 
ATOM   3643 C  CA  . SER C 1 88  ? 37.045  63.211 41.541  1.00 22.19 ? 87  SER C CA  1 
ATOM   3644 C  C   . SER C 1 88  ? 35.986  63.545 40.475  1.00 22.16 ? 87  SER C C   1 
ATOM   3645 O  O   . SER C 1 88  ? 34.808  63.657 40.795  1.00 22.01 ? 87  SER C O   1 
ATOM   3646 C  CB  . SER C 1 88  ? 37.070  61.700 41.789  1.00 23.97 ? 87  SER C CB  1 
ATOM   3647 O  OG  . SER C 1 88  ? 37.200  60.985 40.586  1.00 26.88 ? 87  SER C OG  1 
ATOM   3648 N  N   . LYS C 1 89  ? 36.413  63.686 39.214  1.00 20.23 ? 88  LYS C N   1 
ATOM   3649 C  CA  . LYS C 1 89  ? 35.485  63.771 38.082  1.00 20.37 ? 88  LYS C CA  1 
ATOM   3650 C  C   . LYS C 1 89  ? 34.981  62.399 37.610  1.00 19.15 ? 88  LYS C C   1 
ATOM   3651 O  O   . LYS C 1 89  ? 34.046  62.309 36.821  1.00 20.61 ? 88  LYS C O   1 
ATOM   3652 C  CB  . LYS C 1 89  ? 36.133  64.491 36.907  1.00 19.67 ? 88  LYS C CB  1 
ATOM   3653 C  CG  . LYS C 1 89  ? 36.350  65.987 37.151  1.00 22.75 ? 88  LYS C CG  1 
ATOM   3654 C  CD  . LYS C 1 89  ? 36.981  66.658 35.922  1.00 23.17 ? 88  LYS C CD  1 
ATOM   3655 N  N   . GLY C 1 90  ? 35.581  61.333 38.099  1.00 19.45 ? 89  GLY C N   1 
ATOM   3656 C  CA  . GLY C 1 90  ? 35.312  60.005 37.565  1.00 17.31 ? 89  GLY C CA  1 
ATOM   3657 C  C   . GLY C 1 90  ? 36.537  59.136 37.764  1.00 18.73 ? 89  GLY C C   1 
ATOM   3658 O  O   . GLY C 1 90  ? 37.642  59.635 37.931  1.00 16.30 ? 89  GLY C O   1 
ATOM   3659 N  N   . PHE C 1 91  ? 36.334  57.826 37.739  1.00 15.18 ? 90  PHE C N   1 
ATOM   3660 C  CA  . PHE C 1 91  ? 37.400  56.857 38.063  1.00 16.17 ? 90  PHE C CA  1 
ATOM   3661 C  C   . PHE C 1 91  ? 37.696  55.958 36.900  1.00 18.91 ? 90  PHE C C   1 
ATOM   3662 O  O   . PHE C 1 91  ? 36.766  55.513 36.231  1.00 18.89 ? 90  PHE C O   1 
ATOM   3663 C  CB  . PHE C 1 91  ? 36.946  55.963 39.211  1.00 19.73 ? 90  PHE C CB  1 
ATOM   3664 C  CG  . PHE C 1 91  ? 36.952  56.640 40.513  1.00 16.66 ? 90  PHE C CG  1 
ATOM   3665 C  CD1 . PHE C 1 91  ? 35.790  57.151 41.060  1.00 28.48 ? 90  PHE C CD1 1 
ATOM   3666 C  CD2 . PHE C 1 91  ? 38.137  56.800 41.212  1.00 21.06 ? 90  PHE C CD2 1 
ATOM   3667 C  CE1 . PHE C 1 91  ? 35.824  57.812 42.286  1.00 21.48 ? 90  PHE C CE1 1 
ATOM   3668 C  CE2 . PHE C 1 91  ? 38.170  57.459 42.433  1.00 19.47 ? 90  PHE C CE2 1 
ATOM   3669 C  CZ  . PHE C 1 91  ? 37.021  57.960 42.970  1.00 21.08 ? 90  PHE C CZ  1 
ATOM   3670 N  N   . LEU C 1 92  ? 38.991  55.663 36.693  1.00 19.54 ? 91  LEU C N   1 
ATOM   3671 C  CA  . LEU C 1 92  ? 39.466  54.626 35.802  1.00 16.95 ? 91  LEU C CA  1 
ATOM   3672 C  C   . LEU C 1 92  ? 40.011  53.491 36.677  1.00 17.26 ? 91  LEU C C   1 
ATOM   3673 O  O   . LEU C 1 92  ? 40.986  53.678 37.420  1.00 19.28 ? 91  LEU C O   1 
ATOM   3674 C  CB  . LEU C 1 92  ? 40.594  55.128 34.928  1.00 15.15 ? 91  LEU C CB  1 
ATOM   3675 C  CG  . LEU C 1 92  ? 40.404  56.366 34.065  1.00 17.70 ? 91  LEU C CG  1 
ATOM   3676 C  CD1 . LEU C 1 92  ? 41.757  56.772 33.468  1.00 20.32 ? 91  LEU C CD1 1 
ATOM   3677 C  CD2 . LEU C 1 92  ? 39.388  56.149 32.977  1.00 23.54 ? 91  LEU C CD2 1 
ATOM   3678 N  N   . ILE C 1 93  ? 39.377  52.339 36.628  1.00 16.56 ? 92  ILE C N   1 
ATOM   3679 C  CA  . ILE C 1 93  ? 39.814  51.219 37.437  1.00 17.33 ? 92  ILE C CA  1 
ATOM   3680 C  C   . ILE C 1 93  ? 40.580  50.280 36.537  1.00 18.25 ? 92  ILE C C   1 
ATOM   3681 O  O   . ILE C 1 93  ? 40.000  49.594 35.684  1.00 19.32 ? 92  ILE C O   1 
ATOM   3682 C  CB  . ILE C 1 93  ? 38.656  50.491 38.108  1.00 19.78 ? 92  ILE C CB  1 
ATOM   3683 C  CG1 . ILE C 1 93  ? 37.658  51.473 38.758  1.00 19.10 ? 92  ILE C CG1 1 
ATOM   3684 C  CG2 . ILE C 1 93  ? 39.182  49.473 39.135  1.00 17.94 ? 92  ILE C CG2 1 
ATOM   3685 C  CD1 . ILE C 1 93  ? 38.159  52.226 39.921  1.00 19.15 ? 92  ILE C CD1 1 
ATOM   3686 N  N   . ASP C 1 94  ? 41.889  50.237 36.764  1.00 16.93 ? 93  ASP C N   1 
ATOM   3687 C  CA  . ASP C 1 94  ? 42.861  49.554 35.914  1.00 15.68 ? 93  ASP C CA  1 
ATOM   3688 C  C   . ASP C 1 94  ? 43.311  48.222 36.566  1.00 18.25 ? 93  ASP C C   1 
ATOM   3689 O  O   . ASP C 1 94  ? 43.939  48.216 37.628  1.00 19.28 ? 93  ASP C O   1 
ATOM   3690 C  CB  . ASP C 1 94  ? 44.032  50.518 35.745  1.00 14.34 ? 93  ASP C CB  1 
ATOM   3691 C  CG  . ASP C 1 94  ? 45.289  49.904 35.127  1.00 19.47 ? 93  ASP C CG  1 
ATOM   3692 O  OD1 . ASP C 1 94  ? 45.387  48.674 34.926  1.00 19.96 ? 93  ASP C OD1 1 
ATOM   3693 O  OD2 . ASP C 1 94  ? 46.230  50.709 34.890  1.00 18.69 ? 93  ASP C OD2 1 
ATOM   3694 N  N   . GLY C 1 95  ? 42.950  47.108 35.947  1.00 21.02 ? 94  GLY C N   1 
ATOM   3695 C  CA  . GLY C 1 95  ? 43.386  45.784 36.390  1.00 21.14 ? 94  GLY C CA  1 
ATOM   3696 C  C   . GLY C 1 95  ? 42.541  45.155 37.511  1.00 21.39 ? 94  GLY C C   1 
ATOM   3697 O  O   . GLY C 1 95  ? 42.942  44.162 38.113  1.00 19.84 ? 94  GLY C O   1 
ATOM   3698 N  N   . TYR C 1 96  ? 41.360  45.726 37.754  1.00 19.25 ? 95  TYR C N   1 
ATOM   3699 C  CA  . TYR C 1 96  ? 40.314  45.113 38.592  1.00 16.96 ? 95  TYR C CA  1 
ATOM   3700 C  C   . TYR C 1 96  ? 39.017  45.405 37.832  1.00 17.71 ? 95  TYR C C   1 
ATOM   3701 O  O   . TYR C 1 96  ? 38.845  46.546 37.394  1.00 17.10 ? 95  TYR C O   1 
ATOM   3702 C  CB  . TYR C 1 96  ? 40.292  45.748 40.011  1.00 17.66 ? 95  TYR C CB  1 
ATOM   3703 C  CG  . TYR C 1 96  ? 39.307  45.087 40.953  1.00 14.10 ? 95  TYR C CG  1 
ATOM   3704 C  CD1 . TYR C 1 96  ? 39.748  44.361 42.067  1.00 15.38 ? 95  TYR C CD1 1 
ATOM   3705 C  CD2 . TYR C 1 96  ? 37.945  45.139 40.704  1.00 16.06 ? 95  TYR C CD2 1 
ATOM   3706 C  CE1 . TYR C 1 96  ? 38.883  43.729 42.879  1.00 13.73 ? 95  TYR C CE1 1 
ATOM   3707 C  CE2 . TYR C 1 96  ? 37.048  44.479 41.540  1.00 12.95 ? 95  TYR C CE2 1 
ATOM   3708 C  CZ  . TYR C 1 96  ? 37.530  43.769 42.616  1.00 17.23 ? 95  TYR C CZ  1 
ATOM   3709 O  OH  . TYR C 1 96  ? 36.628  43.114 43.434  1.00 15.98 ? 95  TYR C OH  1 
ATOM   3710 N  N   . PRO C 1 97  ? 38.125  44.392 37.626  1.00 17.49 ? 96  PRO C N   1 
ATOM   3711 C  CA  . PRO C 1 97  ? 38.173  43.008 38.095  1.00 15.17 ? 96  PRO C CA  1 
ATOM   3712 C  C   . PRO C 1 97  ? 38.955  42.047 37.229  1.00 17.77 ? 96  PRO C C   1 
ATOM   3713 O  O   . PRO C 1 97  ? 38.910  42.139 36.001  1.00 19.82 ? 96  PRO C O   1 
ATOM   3714 C  CB  . PRO C 1 97  ? 36.691  42.588 38.057  1.00 17.97 ? 96  PRO C CB  1 
ATOM   3715 C  CG  . PRO C 1 97  ? 36.147  43.326 36.897  1.00 17.85 ? 96  PRO C CG  1 
ATOM   3716 C  CD  . PRO C 1 97  ? 36.881  44.648 36.870  1.00 17.45 ? 96  PRO C CD  1 
ATOM   3717 N  N   . ARG C 1 98  ? 39.624  41.095 37.872  1.00 18.58 ? 97  ARG C N   1 
ATOM   3718 C  CA  . ARG C 1 98  ? 40.392  40.064 37.159  1.00 18.75 ? 97  ARG C CA  1 
ATOM   3719 C  C   . ARG C 1 98  ? 39.635  38.739 37.033  1.00 20.23 ? 97  ARG C C   1 
ATOM   3720 O  O   . ARG C 1 98  ? 40.128  37.771 36.419  1.00 20.49 ? 97  ARG C O   1 
ATOM   3721 C  CB  . ARG C 1 98  ? 41.740  39.831 37.854  1.00 20.16 ? 97  ARG C CB  1 
ATOM   3722 C  CG  . ARG C 1 98  ? 42.693  40.999 37.803  1.00 22.25 ? 97  ARG C CG  1 
ATOM   3723 C  CD  . ARG C 1 98  ? 43.025  41.472 36.385  1.00 30.64 ? 97  ARG C CD  1 
ATOM   3724 N  NE  . ARG C 1 98  ? 43.484  40.361 35.561  1.00 38.49 ? 97  ARG C NE  1 
ATOM   3725 C  CZ  . ARG C 1 98  ? 44.706  39.832 35.601  1.00 37.86 ? 97  ARG C CZ  1 
ATOM   3726 N  NH1 . ARG C 1 98  ? 44.964  38.795 34.839  1.00 27.29 ? 97  ARG C NH1 1 
ATOM   3727 N  NH2 . ARG C 1 98  ? 45.665  40.333 36.386  1.00 42.39 ? 97  ARG C NH2 1 
ATOM   3728 N  N   . GLU C 1 99  ? 38.433  38.682 37.594  1.00 19.42 ? 98  GLU C N   1 
ATOM   3729 C  CA  . GLU C 1 99  ? 37.592  37.493 37.458  1.00 20.58 ? 98  GLU C CA  1 
ATOM   3730 C  C   . GLU C 1 99  ? 36.156  37.976 37.708  1.00 18.80 ? 98  GLU C C   1 
ATOM   3731 O  O   . GLU C 1 99  ? 35.955  39.099 38.189  1.00 19.93 ? 98  GLU C O   1 
ATOM   3732 C  CB  . GLU C 1 99  ? 38.061  36.376 38.404  1.00 19.69 ? 98  GLU C CB  1 
ATOM   3733 C  CG  . GLU C 1 99  ? 37.971  36.785 39.875  1.00 26.93 ? 98  GLU C CG  1 
ATOM   3734 C  CD  . GLU C 1 99  ? 38.438  35.750 40.892  1.00 28.40 ? 98  GLU C CD  1 
ATOM   3735 O  OE1 . GLU C 1 99  ? 38.828  34.601 40.520  1.00 34.42 ? 98  GLU C OE1 1 
ATOM   3736 O  OE2 . GLU C 1 99  ? 38.393  36.115 42.094  1.00 36.69 ? 98  GLU C OE2 1 
ATOM   3737 N  N   . VAL C 1 100 ? 35.174  37.174 37.295  1.00 20.07 ? 99  VAL C N   1 
ATOM   3738 C  CA  . VAL C 1 100 ? 33.752  37.547 37.383  1.00 19.65 ? 99  VAL C CA  1 
ATOM   3739 C  C   . VAL C 1 100 ? 33.331  37.847 38.824  1.00 17.94 ? 99  VAL C C   1 
ATOM   3740 O  O   . VAL C 1 100 ? 32.666  38.852 39.076  1.00 18.78 ? 99  VAL C O   1 
ATOM   3741 C  CB  . VAL C 1 100 ? 32.819  36.455 36.760  1.00 21.94 ? 99  VAL C CB  1 
ATOM   3742 C  CG1 . VAL C 1 100 ? 31.351  36.789 36.991  1.00 22.43 ? 99  VAL C CG1 1 
ATOM   3743 C  CG2 . VAL C 1 100 ? 33.106  36.305 35.247  1.00 24.87 ? 99  VAL C CG2 1 
ATOM   3744 N  N   . GLN C 1 101 ? 33.712  37.000 39.771  1.00 16.16 ? 100 GLN C N   1 
ATOM   3745 C  CA  . GLN C 1 101 ? 33.370  37.284 41.167  1.00 18.00 ? 100 GLN C CA  1 
ATOM   3746 C  C   . GLN C 1 101 ? 33.923  38.575 41.725  1.00 16.53 ? 100 GLN C C   1 
ATOM   3747 O  O   . GLN C 1 101 ? 33.289  39.207 42.570  1.00 14.94 ? 100 GLN C O   1 
ATOM   3748 C  CB  . GLN C 1 101 ? 33.707  36.133 42.097  1.00 21.53 ? 100 GLN C CB  1 
ATOM   3749 C  CG  . GLN C 1 101 ? 35.103  35.599 42.067  1.00 34.15 ? 100 GLN C CG  1 
ATOM   3750 C  CD  . GLN C 1 101 ? 35.156  34.166 42.583  1.00 45.67 ? 100 GLN C CD  1 
ATOM   3751 O  OE1 . GLN C 1 101 ? 34.666  33.873 43.678  1.00 52.93 ? 100 GLN C OE1 1 
ATOM   3752 N  NE2 . GLN C 1 101 ? 35.749  33.263 41.793  1.00 55.35 ? 100 GLN C NE2 1 
ATOM   3753 N  N   . GLN C 1 102 ? 35.096  38.984 41.272  1.00 17.74 ? 101 GLN C N   1 
ATOM   3754 C  CA  . GLN C 1 102 ? 35.599  40.331 41.590  1.00 16.39 ? 101 GLN C CA  1 
ATOM   3755 C  C   . GLN C 1 102 ? 34.681  41.465 41.114  1.00 17.04 ? 101 GLN C C   1 
ATOM   3756 O  O   . GLN C 1 102 ? 34.513  42.487 41.795  1.00 19.19 ? 101 GLN C O   1 
ATOM   3757 C  CB  . GLN C 1 102 ? 37.009  40.521 41.008  1.00 14.48 ? 101 GLN C CB  1 
ATOM   3758 C  CG  . GLN C 1 102 ? 38.104  39.862 41.855  1.00 14.29 ? 101 GLN C CG  1 
ATOM   3759 C  CD  . GLN C 1 102 ? 39.545  40.245 41.475  1.00 16.44 ? 101 GLN C CD  1 
ATOM   3760 O  OE1 . GLN C 1 102 ? 39.761  41.120 40.645  1.00 14.53 ? 101 GLN C OE1 1 
ATOM   3761 N  NE2 . GLN C 1 102 ? 40.519  39.569 42.079  1.00 16.91 ? 101 GLN C NE2 1 
ATOM   3762 N  N   . GLY C 1 103 ? 34.103  41.303 39.929  1.00 18.15 ? 102 GLY C N   1 
ATOM   3763 C  CA  . GLY C 1 103 ? 33.174  42.296 39.386  1.00 17.39 ? 102 GLY C CA  1 
ATOM   3764 C  C   . GLY C 1 103 ? 31.901  42.376 40.201  1.00 16.43 ? 102 GLY C C   1 
ATOM   3765 O  O   . GLY C 1 103 ? 31.474  43.454 40.540  1.00 16.09 ? 102 GLY C O   1 
ATOM   3766 N  N   . GLU C 1 104 ? 31.323  41.216 40.524  1.00 16.77 ? 103 GLU C N   1 
ATOM   3767 C  CA  . GLU C 1 104 ? 30.105  41.132 41.311  1.00 19.94 ? 103 GLU C CA  1 
ATOM   3768 C  C   . GLU C 1 104 ? 30.274  41.808 42.670  1.00 18.15 ? 103 GLU C C   1 
ATOM   3769 O  O   . GLU C 1 104 ? 29.466  42.647 43.051  1.00 17.85 ? 103 GLU C O   1 
ATOM   3770 C  CB  . GLU C 1 104 ? 29.690  39.665 41.501  1.00 18.98 ? 103 GLU C CB  1 
ATOM   3771 C  CG  . GLU C 1 104 ? 29.318  38.967 40.178  1.00 27.78 ? 103 GLU C CG  1 
ATOM   3772 C  CD  . GLU C 1 104 ? 28.777  37.549 40.359  1.00 31.80 ? 103 GLU C CD  1 
ATOM   3773 O  OE1 . GLU C 1 104 ? 29.077  36.906 41.398  1.00 47.46 ? 103 GLU C OE1 1 
ATOM   3774 O  OE2 . GLU C 1 104 ? 28.047  37.085 39.450  1.00 48.46 ? 103 GLU C OE2 1 
ATOM   3775 N  N   . GLU C 1 105 ? 31.345  41.483 43.381  1.00 19.26 ? 104 GLU C N   1 
ATOM   3776 C  CA  . GLU C 1 105 ? 31.528  42.019 44.734  1.00 18.04 ? 104 GLU C CA  1 
ATOM   3777 C  C   . GLU C 1 105 ? 31.812  43.523 44.696  1.00 17.00 ? 104 GLU C C   1 
ATOM   3778 O  O   . GLU C 1 105 ? 31.367  44.256 45.566  1.00 16.43 ? 104 GLU C O   1 
ATOM   3779 C  CB  . GLU C 1 105 ? 32.621  41.251 45.460  1.00 21.36 ? 104 GLU C CB  1 
ATOM   3780 C  CG  . GLU C 1 105 ? 32.706  41.504 46.974  1.00 27.89 ? 104 GLU C CG  1 
ATOM   3781 C  CD  . GLU C 1 105 ? 31.422  41.166 47.771  1.00 36.71 ? 104 GLU C CD  1 
ATOM   3782 O  OE1 . GLU C 1 105 ? 30.543  40.442 47.248  1.00 25.82 ? 104 GLU C OE1 1 
ATOM   3783 O  OE2 . GLU C 1 105 ? 31.300  41.631 48.940  1.00 33.49 ? 104 GLU C OE2 1 
ATOM   3784 N  N   . PHE C 1 106 ? 32.525  43.978 43.680  1.00 16.22 ? 105 PHE C N   1 
ATOM   3785 C  CA  . PHE C 1 106 ? 32.708  45.432 43.454  1.00 17.15 ? 105 PHE C CA  1 
ATOM   3786 C  C   . PHE C 1 106 ? 31.380  46.195 43.247  1.00 16.65 ? 105 PHE C C   1 
ATOM   3787 O  O   . PHE C 1 106 ? 31.158  47.261 43.854  1.00 19.03 ? 105 PHE C O   1 
ATOM   3788 C  CB  . PHE C 1 106 ? 33.610  45.653 42.258  1.00 18.42 ? 105 PHE C CB  1 
ATOM   3789 C  CG  . PHE C 1 106 ? 33.914  47.103 41.970  1.00 18.06 ? 105 PHE C CG  1 
ATOM   3790 C  CD1 . PHE C 1 106 ? 35.180  47.609 42.215  1.00 18.24 ? 105 PHE C CD1 1 
ATOM   3791 C  CD2 . PHE C 1 106 ? 32.951  47.950 41.419  1.00 21.65 ? 105 PHE C CD2 1 
ATOM   3792 C  CE1 . PHE C 1 106 ? 35.483  48.940 41.930  1.00 13.31 ? 105 PHE C CE1 1 
ATOM   3793 C  CE2 . PHE C 1 106 ? 33.244  49.292 41.138  1.00 16.60 ? 105 PHE C CE2 1 
ATOM   3794 C  CZ  . PHE C 1 106 ? 34.509  49.782 41.390  1.00 18.49 ? 105 PHE C CZ  1 
ATOM   3795 N  N   . GLU C 1 107 ? 30.509  45.679 42.384  1.00 16.61 ? 106 GLU C N   1 
ATOM   3796 C  CA  . GLU C 1 107 ? 29.185  46.309 42.161  1.00 16.88 ? 106 GLU C CA  1 
ATOM   3797 C  C   . GLU C 1 107 ? 28.300  46.290 43.430  1.00 18.32 ? 106 GLU C C   1 
ATOM   3798 O  O   . GLU C 1 107 ? 27.604  47.269 43.704  1.00 16.57 ? 106 GLU C O   1 
ATOM   3799 C  CB  . GLU C 1 107 ? 28.461  45.665 40.970  1.00 17.59 ? 106 GLU C CB  1 
ATOM   3800 C  CG  . GLU C 1 107 ? 29.234  45.782 39.673  1.00 21.02 ? 106 GLU C CG  1 
ATOM   3801 C  CD  . GLU C 1 107 ? 28.443  45.325 38.475  1.00 26.17 ? 106 GLU C CD  1 
ATOM   3802 O  OE1 . GLU C 1 107 ? 27.478  46.038 38.143  1.00 27.90 ? 106 GLU C OE1 1 
ATOM   3803 O  OE2 . GLU C 1 107 ? 28.784  44.278 37.854  1.00 22.18 ? 106 GLU C OE2 1 
ATOM   3804 N  N   . ARG C 1 108 ? 28.350  45.203 44.209  1.00 19.79 ? 107 ARG C N   1 
ATOM   3805 C  CA  . ARG C 1 108 ? 27.564  45.102 45.448  1.00 20.44 ? 107 ARG C CA  1 
ATOM   3806 C  C   . ARG C 1 108 ? 28.051  46.120 46.478  1.00 20.73 ? 107 ARG C C   1 
ATOM   3807 O  O   . ARG C 1 108 ? 27.243  46.684 47.192  1.00 22.36 ? 107 ARG C O   1 
ATOM   3808 C  CB  . ARG C 1 108 ? 27.622  43.704 46.103  1.00 22.31 ? 107 ARG C CB  1 
ATOM   3809 C  CG  . ARG C 1 108 ? 27.364  42.490 45.222  1.00 26.17 ? 107 ARG C CG  1 
ATOM   3810 C  CD  . ARG C 1 108 ? 25.968  41.938 45.208  1.00 34.20 ? 107 ARG C CD  1 
ATOM   3811 N  NE  . ARG C 1 108 ? 25.363  41.706 46.524  1.00 44.30 ? 107 ARG C NE  1 
ATOM   3812 C  CZ  . ARG C 1 108 ? 24.373  40.841 46.772  1.00 40.87 ? 107 ARG C CZ  1 
ATOM   3813 N  NH1 . ARG C 1 108 ? 23.881  40.059 45.810  1.00 42.52 ? 107 ARG C NH1 1 
ATOM   3814 N  NH2 . ARG C 1 108 ? 23.893  40.735 48.009  1.00 41.29 ? 107 ARG C NH2 1 
ATOM   3815 N  N   . ARG C 1 109 ? 29.357  46.346 46.571  1.00 19.40 ? 108 ARG C N   1 
ATOM   3816 C  CA  . ARG C 1 109 ? 29.908  47.190 47.629  1.00 19.99 ? 108 ARG C CA  1 
ATOM   3817 C  C   . ARG C 1 109 ? 30.317  48.600 47.202  1.00 20.39 ? 108 ARG C C   1 
ATOM   3818 O  O   . ARG C 1 109 ? 30.622  49.444 48.068  1.00 20.29 ? 108 ARG C O   1 
ATOM   3819 C  CB  . ARG C 1 109 ? 31.111  46.518 48.286  1.00 20.44 ? 108 ARG C CB  1 
ATOM   3820 C  CG  . ARG C 1 109 ? 30.917  45.024 48.625  1.00 29.66 ? 108 ARG C CG  1 
ATOM   3821 C  CD  . ARG C 1 109 ? 31.351  44.704 50.062  1.00 37.10 ? 108 ARG C CD  1 
ATOM   3822 N  NE  . ARG C 1 109 ? 32.758  45.013 50.310  1.00 40.63 ? 108 ARG C NE  1 
ATOM   3823 C  CZ  . ARG C 1 109 ? 33.746  44.118 50.445  1.00 38.06 ? 108 ARG C CZ  1 
ATOM   3824 N  NH1 . ARG C 1 109 ? 34.958  44.583 50.663  1.00 28.75 ? 108 ARG C NH1 1 
ATOM   3825 N  NH2 . ARG C 1 109 ? 33.556  42.786 50.353  1.00 22.27 ? 108 ARG C NH2 1 
ATOM   3826 N  N   . ILE C 1 110 ? 30.376  48.859 45.901  1.00 18.12 ? 109 ILE C N   1 
ATOM   3827 C  CA  . ILE C 1 110 ? 30.737  50.181 45.417  1.00 18.40 ? 109 ILE C CA  1 
ATOM   3828 C  C   . ILE C 1 110 ? 29.666  50.689 44.422  1.00 19.62 ? 109 ILE C C   1 
ATOM   3829 O  O   . ILE C 1 110 ? 28.841  51.527 44.779  1.00 18.09 ? 109 ILE C O   1 
ATOM   3830 C  CB  . ILE C 1 110 ? 32.177  50.204 44.859  1.00 18.22 ? 109 ILE C CB  1 
ATOM   3831 C  CG1 . ILE C 1 110 ? 33.181  49.753 45.933  1.00 18.79 ? 109 ILE C CG1 1 
ATOM   3832 C  CG2 . ILE C 1 110 ? 32.561  51.621 44.387  1.00 19.92 ? 109 ILE C CG2 1 
ATOM   3833 C  CD1 . ILE C 1 110 ? 34.650  49.656 45.467  1.00 20.87 ? 109 ILE C CD1 1 
ATOM   3834 N  N   . GLY C 1 111 ? 29.675  50.192 43.190  1.00 18.74 ? 110 GLY C N   1 
ATOM   3835 C  CA  . GLY C 1 111 ? 28.642  50.547 42.227  1.00 19.26 ? 110 GLY C CA  1 
ATOM   3836 C  C   . GLY C 1 111 ? 28.929  49.932 40.883  1.00 19.58 ? 110 GLY C C   1 
ATOM   3837 O  O   . GLY C 1 111 ? 29.984  49.349 40.667  1.00 20.05 ? 110 GLY C O   1 
ATOM   3838 N  N   . GLN C 1 112 ? 27.992  50.043 39.968  1.00 18.78 ? 111 GLN C N   1 
ATOM   3839 C  CA  . GLN C 1 112 ? 28.145  49.324 38.717  1.00 20.07 ? 111 GLN C CA  1 
ATOM   3840 C  C   . GLN C 1 112 ? 28.971  50.189 37.753  1.00 20.34 ? 111 GLN C C   1 
ATOM   3841 O  O   . GLN C 1 112 ? 28.921  51.407 37.803  1.00 18.02 ? 111 GLN C O   1 
ATOM   3842 C  CB  . GLN C 1 112 ? 26.764  48.911 38.140  1.00 24.19 ? 111 GLN C CB  1 
ATOM   3843 C  CG  . GLN C 1 112 ? 25.796  50.044 37.932  1.00 24.34 ? 111 GLN C CG  1 
ATOM   3844 C  CD  . GLN C 1 112 ? 24.561  49.627 37.118  1.00 24.76 ? 111 GLN C CD  1 
ATOM   3845 O  OE1 . GLN C 1 112 ? 24.395  48.469 36.740  1.00 28.67 ? 111 GLN C OE1 1 
ATOM   3846 N  NE2 . GLN C 1 112 ? 23.705  50.583 36.851  1.00 16.37 ? 111 GLN C NE2 1 
ATOM   3847 N  N   . PRO C 1 113 ? 29.776  49.562 36.893  1.00 17.83 ? 112 PRO C N   1 
ATOM   3848 C  CA  . PRO C 1 113 ? 30.488  50.335 35.884  1.00 19.42 ? 112 PRO C CA  1 
ATOM   3849 C  C   . PRO C 1 113 ? 29.581  51.015 34.820  1.00 19.71 ? 112 PRO C C   1 
ATOM   3850 O  O   . PRO C 1 113 ? 28.535  50.471 34.441  1.00 18.77 ? 112 PRO C O   1 
ATOM   3851 C  CB  . PRO C 1 113 ? 31.391  49.282 35.256  1.00 20.19 ? 112 PRO C CB  1 
ATOM   3852 C  CG  . PRO C 1 113 ? 30.582  48.010 35.399  1.00 19.43 ? 112 PRO C CG  1 
ATOM   3853 C  CD  . PRO C 1 113 ? 30.088  48.126 36.797  1.00 19.46 ? 112 PRO C CD  1 
ATOM   3854 N  N   . THR C 1 114 ? 29.999  52.193 34.367  1.00 16.51 ? 113 THR C N   1 
ATOM   3855 C  CA  . THR C 1 114 ? 29.354  52.911 33.270  1.00 19.11 ? 113 THR C CA  1 
ATOM   3856 C  C   . THR C 1 114 ? 29.912  52.455 31.927  1.00 18.20 ? 113 THR C C   1 
ATOM   3857 O  O   . THR C 1 114 ? 29.208  52.449 30.914  1.00 18.37 ? 113 THR C O   1 
ATOM   3858 C  CB  . THR C 1 114 ? 29.576  54.425 33.436  1.00 22.06 ? 113 THR C CB  1 
ATOM   3859 O  OG1 . THR C 1 114 ? 29.186  54.796 34.761  1.00 32.95 ? 113 THR C OG1 1 
ATOM   3860 C  CG2 . THR C 1 114 ? 28.764  55.208 32.441  1.00 27.26 ? 113 THR C CG2 1 
ATOM   3861 N  N   . LEU C 1 115 ? 31.179  52.080 31.929  1.00 17.72 ? 114 LEU C N   1 
ATOM   3862 C  CA  . LEU C 1 115 ? 31.866  51.681 30.715  1.00 19.42 ? 114 LEU C CA  1 
ATOM   3863 C  C   . LEU C 1 115 ? 32.959  50.639 31.019  1.00 18.17 ? 114 LEU C C   1 
ATOM   3864 O  O   . LEU C 1 115 ? 33.520  50.626 32.108  1.00 19.39 ? 114 LEU C O   1 
ATOM   3865 C  CB  . LEU C 1 115 ? 32.437  52.926 30.036  1.00 20.99 ? 114 LEU C CB  1 
ATOM   3866 C  CG  . LEU C 1 115 ? 32.512  52.916 28.501  1.00 24.84 ? 114 LEU C CG  1 
ATOM   3867 C  CD1 . LEU C 1 115 ? 31.147  53.153 27.839  1.00 28.60 ? 114 LEU C CD1 1 
ATOM   3868 C  CD2 . LEU C 1 115 ? 33.547  53.926 28.009  1.00 27.58 ? 114 LEU C CD2 1 
ATOM   3869 N  N   . LEU C 1 116 ? 33.223  49.745 30.065  1.00 17.10 ? 115 LEU C N   1 
ATOM   3870 C  CA  . LEU C 1 116 ? 34.389  48.853 30.123  1.00 17.16 ? 115 LEU C CA  1 
ATOM   3871 C  C   . LEU C 1 116 ? 35.259  49.075 28.883  1.00 19.58 ? 115 LEU C C   1 
ATOM   3872 O  O   . LEU C 1 116 ? 34.832  48.826 27.731  1.00 16.15 ? 115 LEU C O   1 
ATOM   3873 C  CB  . LEU C 1 116 ? 33.974  47.390 30.243  1.00 20.06 ? 115 LEU C CB  1 
ATOM   3874 C  CG  . LEU C 1 116 ? 35.102  46.430 30.658  1.00 16.92 ? 115 LEU C CG  1 
ATOM   3875 C  CD1 . LEU C 1 116 ? 34.564  45.135 31.232  1.00 21.35 ? 115 LEU C CD1 1 
ATOM   3876 C  CD2 . LEU C 1 116 ? 36.007  46.141 29.473  1.00 25.02 ? 115 LEU C CD2 1 
ATOM   3877 N  N   . LEU C 1 117 ? 36.458  49.604 29.116  1.00 18.73 ? 116 LEU C N   1 
ATOM   3878 C  CA  . LEU C 1 117 ? 37.420  49.841 28.051  1.00 18.38 ? 116 LEU C CA  1 
ATOM   3879 C  C   . LEU C 1 117 ? 38.314  48.604 27.905  1.00 17.27 ? 116 LEU C C   1 
ATOM   3880 O  O   . LEU C 1 117 ? 39.079  48.256 28.797  1.00 17.02 ? 116 LEU C O   1 
ATOM   3881 C  CB  . LEU C 1 117 ? 38.237  51.085 28.386  1.00 20.84 ? 116 LEU C CB  1 
ATOM   3882 C  CG  . LEU C 1 117 ? 39.265  51.597 27.401  1.00 27.23 ? 116 LEU C CG  1 
ATOM   3883 C  CD1 . LEU C 1 117 ? 38.645  51.842 26.023  1.00 29.24 ? 116 LEU C CD1 1 
ATOM   3884 C  CD2 . LEU C 1 117 ? 39.894  52.889 27.988  1.00 24.28 ? 116 LEU C CD2 1 
ATOM   3885 N  N   . TYR C 1 118 ? 38.204  47.947 26.761  1.00 15.60 ? 117 TYR C N   1 
ATOM   3886 C  CA  . TYR C 1 118 ? 38.880  46.679 26.517  1.00 15.84 ? 117 TYR C CA  1 
ATOM   3887 C  C   . TYR C 1 118 ? 40.108  46.995 25.640  1.00 18.42 ? 117 TYR C C   1 
ATOM   3888 O  O   . TYR C 1 118 ? 39.982  47.355 24.463  1.00 17.82 ? 117 TYR C O   1 
ATOM   3889 C  CB  . TYR C 1 118 ? 37.898  45.728 25.843  1.00 18.36 ? 117 TYR C CB  1 
ATOM   3890 C  CG  . TYR C 1 118 ? 38.426  44.380 25.370  1.00 15.56 ? 117 TYR C CG  1 
ATOM   3891 C  CD1 . TYR C 1 118 ? 39.603  43.835 25.869  1.00 21.22 ? 117 TYR C CD1 1 
ATOM   3892 C  CD2 . TYR C 1 118 ? 37.702  43.641 24.450  1.00 19.52 ? 117 TYR C CD2 1 
ATOM   3893 C  CE1 . TYR C 1 118 ? 40.056  42.597 25.440  1.00 22.58 ? 117 TYR C CE1 1 
ATOM   3894 C  CE2 . TYR C 1 118 ? 38.136  42.382 24.020  1.00 20.82 ? 117 TYR C CE2 1 
ATOM   3895 C  CZ  . TYR C 1 118 ? 39.312  41.871 24.523  1.00 22.55 ? 117 TYR C CZ  1 
ATOM   3896 O  OH  . TYR C 1 118 ? 39.760  40.638 24.093  1.00 20.53 ? 117 TYR C OH  1 
ATOM   3897 N  N   . VAL C 1 119 ? 41.288  46.923 26.257  1.00 16.96 ? 118 VAL C N   1 
ATOM   3898 C  CA  . VAL C 1 119 ? 42.547  47.220 25.610  1.00 17.47 ? 118 VAL C CA  1 
ATOM   3899 C  C   . VAL C 1 119 ? 43.104  45.894 25.066  1.00 18.18 ? 118 VAL C C   1 
ATOM   3900 O  O   . VAL C 1 119 ? 43.708  45.106 25.794  1.00 18.29 ? 118 VAL C O   1 
ATOM   3901 C  CB  . VAL C 1 119 ? 43.517  47.895 26.596  1.00 18.06 ? 118 VAL C CB  1 
ATOM   3902 C  CG1 . VAL C 1 119 ? 44.847  48.245 25.945  1.00 21.02 ? 118 VAL C CG1 1 
ATOM   3903 C  CG2 . VAL C 1 119 ? 42.864  49.134 27.150  1.00 19.41 ? 118 VAL C CG2 1 
ATOM   3904 N  N   . ASP C 1 120 ? 42.863  45.667 23.780  1.00 18.75 ? 119 ASP C N   1 
ATOM   3905 C  CA  . ASP C 1 120 ? 43.164  44.358 23.157  1.00 18.93 ? 119 ASP C CA  1 
ATOM   3906 C  C   . ASP C 1 120 ? 44.488  44.294 22.365  1.00 19.17 ? 119 ASP C C   1 
ATOM   3907 O  O   . ASP C 1 120 ? 44.573  44.755 21.227  1.00 17.40 ? 119 ASP C O   1 
ATOM   3908 C  CB  . ASP C 1 120 ? 42.000  43.962 22.244  1.00 17.76 ? 119 ASP C CB  1 
ATOM   3909 C  CG  . ASP C 1 120 ? 42.178  42.578 21.634  1.00 24.22 ? 119 ASP C CG  1 
ATOM   3910 O  OD1 . ASP C 1 120 ? 42.804  41.708 22.283  1.00 25.30 ? 119 ASP C OD1 1 
ATOM   3911 O  OD2 . ASP C 1 120 ? 41.727  42.381 20.482  1.00 26.56 ? 119 ASP C OD2 1 
ATOM   3912 N  N   . ALA C 1 121 ? 45.495  43.664 22.968  1.00 21.77 ? 120 ALA C N   1 
ATOM   3913 C  CA  . ALA C 1 121 ? 46.796  43.452 22.335  1.00 22.15 ? 120 ALA C CA  1 
ATOM   3914 C  C   . ALA C 1 121 ? 46.999  41.959 22.169  1.00 21.54 ? 120 ALA C C   1 
ATOM   3915 O  O   . ALA C 1 121 ? 46.401  41.163 22.901  1.00 23.48 ? 120 ALA C O   1 
ATOM   3916 C  CB  . ALA C 1 121 ? 47.902  44.024 23.194  1.00 23.73 ? 120 ALA C CB  1 
ATOM   3917 N  N   . GLY C 1 122 ? 47.862  41.581 21.235  1.00 20.48 ? 121 GLY C N   1 
ATOM   3918 C  CA  . GLY C 1 122 ? 48.217  40.156 21.040  1.00 19.05 ? 121 GLY C CA  1 
ATOM   3919 C  C   . GLY C 1 122 ? 49.311  39.723 21.999  1.00 18.16 ? 121 GLY C C   1 
ATOM   3920 O  O   . GLY C 1 122 ? 50.062  40.552 22.498  1.00 19.39 ? 121 GLY C O   1 
ATOM   3921 N  N   . PRO C 1 123 ? 49.412  38.418 22.272  1.00 17.74 ? 122 PRO C N   1 
ATOM   3922 C  CA  . PRO C 1 123 ? 50.409  37.914 23.219  1.00 19.07 ? 122 PRO C CA  1 
ATOM   3923 C  C   . PRO C 1 123 ? 51.877  38.167 22.842  1.00 19.85 ? 122 PRO C C   1 
ATOM   3924 O  O   . PRO C 1 123 ? 52.674  38.448 23.722  1.00 19.41 ? 122 PRO C O   1 
ATOM   3925 C  CB  . PRO C 1 123 ? 50.107  36.401 23.292  1.00 19.30 ? 122 PRO C CB  1 
ATOM   3926 C  CG  . PRO C 1 123 ? 49.373  36.093 22.037  1.00 18.52 ? 122 PRO C CG  1 
ATOM   3927 C  CD  . PRO C 1 123 ? 48.578  37.335 21.722  1.00 17.49 ? 122 PRO C CD  1 
ATOM   3928 N  N   . GLU C 1 124 ? 52.258  38.085 21.566  1.00 18.85 ? 123 GLU C N   1 
ATOM   3929 C  CA  . GLU C 1 124 ? 53.664  38.351 21.242  1.00 20.75 ? 123 GLU C CA  1 
ATOM   3930 C  C   . GLU C 1 124 ? 54.007  39.827 21.533  1.00 19.93 ? 123 GLU C C   1 
ATOM   3931 O  O   . GLU C 1 124 ? 55.075  40.142 22.045  1.00 18.76 ? 123 GLU C O   1 
ATOM   3932 C  CB  . GLU C 1 124 ? 54.036  37.931 19.801  1.00 22.35 ? 123 GLU C CB  1 
ATOM   3933 C  CG  . GLU C 1 124 ? 53.456  38.761 18.687  1.00 31.09 ? 123 GLU C CG  1 
ATOM   3934 N  N   . THR C 1 125 ? 53.075  40.717 21.238  1.00 20.23 ? 124 THR C N   1 
ATOM   3935 C  CA  . THR C 1 125 ? 53.265  42.134 21.485  1.00 21.05 ? 124 THR C CA  1 
ATOM   3936 C  C   . THR C 1 125 ? 53.434  42.399 22.973  1.00 20.15 ? 124 THR C C   1 
ATOM   3937 O  O   . THR C 1 125 ? 54.324  43.157 23.369  1.00 19.93 ? 124 THR C O   1 
ATOM   3938 C  CB  . THR C 1 125 ? 52.064  42.909 20.961  1.00 21.94 ? 124 THR C CB  1 
ATOM   3939 O  OG1 . THR C 1 125 ? 51.967  42.668 19.552  1.00 24.17 ? 124 THR C OG1 1 
ATOM   3940 C  CG2 . THR C 1 125 ? 52.216  44.364 21.221  1.00 27.31 ? 124 THR C CG2 1 
ATOM   3941 N  N   . MET C 1 126 ? 52.577  41.783 23.787  1.00 18.91 ? 125 MET C N   1 
ATOM   3942 C  CA  . MET C 1 126 ? 52.630  41.958 25.253  1.00 18.52 ? 125 MET C CA  1 
ATOM   3943 C  C   . MET C 1 126 ? 53.952  41.403 25.813  1.00 17.42 ? 125 MET C C   1 
ATOM   3944 O  O   . MET C 1 126 ? 54.639  42.048 26.602  1.00 17.28 ? 125 MET C O   1 
ATOM   3945 C  CB  . MET C 1 126 ? 51.438  41.260 25.925  1.00 17.14 ? 125 MET C CB  1 
ATOM   3946 C  CG  . MET C 1 126 ? 50.127  41.953 25.696  1.00 21.49 ? 125 MET C CG  1 
ATOM   3947 S  SD  . MET C 1 126 ? 48.755  41.239 26.599  1.00 24.12 ? 125 MET C SD  1 
ATOM   3948 C  CE  . MET C 1 126 ? 48.133  39.972 25.545  1.00 24.91 ? 125 MET C CE  1 
ATOM   3949 N  N   . THR C 1 127 ? 54.293  40.189 25.406  1.00 18.18 ? 126 THR C N   1 
ATOM   3950 C  CA  . THR C 1 127 ? 55.553  39.593 25.796  1.00 16.96 ? 126 THR C CA  1 
ATOM   3951 C  C   . THR C 1 127 ? 56.756  40.478 25.457  1.00 18.49 ? 126 THR C C   1 
ATOM   3952 O  O   . THR C 1 127 ? 57.639  40.655 26.296  1.00 18.15 ? 126 THR C O   1 
ATOM   3953 C  CB  . THR C 1 127 ? 55.698  38.201 25.166  1.00 16.93 ? 126 THR C CB  1 
ATOM   3954 O  OG1 . THR C 1 127 ? 54.618  37.362 25.629  1.00 14.51 ? 126 THR C OG1 1 
ATOM   3955 C  CG2 . THR C 1 127 ? 57.011  37.600 25.542  1.00 14.65 ? 126 THR C CG2 1 
ATOM   3956 N  N   . GLN C 1 128 ? 56.789  41.048 24.251  1.00 19.16 ? 127 GLN C N   1 
ATOM   3957 C  CA  . GLN C 1 128 ? 57.928  41.884 23.847  1.00 20.60 ? 127 GLN C CA  1 
ATOM   3958 C  C   . GLN C 1 128 ? 58.046  43.157 24.707  1.00 19.05 ? 127 GLN C C   1 
ATOM   3959 O  O   . GLN C 1 128 ? 59.150  43.557 25.120  1.00 16.48 ? 127 GLN C O   1 
ATOM   3960 C  CB  . GLN C 1 128 ? 57.831  42.268 22.368  1.00 20.81 ? 127 GLN C CB  1 
ATOM   3961 C  CG  . GLN C 1 128 ? 57.928  41.099 21.427  1.00 27.94 ? 127 GLN C CG  1 
ATOM   3962 N  N   . ARG C 1 129 ? 56.906  43.778 24.987  1.00 18.18 ? 128 ARG C N   1 
ATOM   3963 C  CA  . ARG C 1 129 ? 56.879  45.013 25.792  1.00 17.34 ? 128 ARG C CA  1 
ATOM   3964 C  C   . ARG C 1 129 ? 57.373  44.770 27.210  1.00 18.62 ? 128 ARG C C   1 
ATOM   3965 O  O   . ARG C 1 129 ? 58.109  45.576 27.765  1.00 19.16 ? 128 ARG C O   1 
ATOM   3966 C  CB  . ARG C 1 129 ? 55.464  45.561 25.839  1.00 16.56 ? 128 ARG C CB  1 
ATOM   3967 C  CG  . ARG C 1 129 ? 54.998  46.070 24.509  1.00 15.40 ? 128 ARG C CG  1 
ATOM   3968 C  CD  . ARG C 1 129 ? 53.542  46.421 24.550  1.00 9.13  ? 128 ARG C CD  1 
ATOM   3969 N  NE  . ARG C 1 129 ? 53.085  46.963 23.290  1.00 16.88 ? 128 ARG C NE  1 
ATOM   3970 C  CZ  . ARG C 1 129 ? 51.847  47.381 23.060  1.00 21.53 ? 128 ARG C CZ  1 
ATOM   3971 N  NH1 . ARG C 1 129 ? 50.930  47.310 24.012  1.00 21.11 ? 128 ARG C NH1 1 
ATOM   3972 N  NH2 . ARG C 1 129 ? 51.524  47.828 21.854  1.00 19.82 ? 128 ARG C NH2 1 
ATOM   3973 N  N   . LEU C 1 130 ? 56.953  43.650 27.796  1.00 18.71 ? 129 LEU C N   1 
ATOM   3974 C  CA  . LEU C 1 130 ? 57.311  43.322 29.161  1.00 17.21 ? 129 LEU C CA  1 
ATOM   3975 C  C   . LEU C 1 130 ? 58.791  42.939 29.255  1.00 16.73 ? 129 LEU C C   1 
ATOM   3976 O  O   . LEU C 1 130 ? 59.462  43.283 30.233  1.00 16.27 ? 129 LEU C O   1 
ATOM   3977 C  CB  . LEU C 1 130 ? 56.416  42.206 29.704  1.00 16.93 ? 129 LEU C CB  1 
ATOM   3978 C  CG  . LEU C 1 130 ? 54.924  42.558 29.822  1.00 18.65 ? 129 LEU C CG  1 
ATOM   3979 C  CD1 . LEU C 1 130 ? 54.120  41.335 30.259  1.00 21.90 ? 129 LEU C CD1 1 
ATOM   3980 C  CD2 . LEU C 1 130 ? 54.713  43.729 30.763  1.00 23.09 ? 129 LEU C CD2 1 
ATOM   3981 N  N   . LEU C 1 131 ? 59.311  42.256 28.241  1.00 18.59 ? 130 LEU C N   1 
ATOM   3982 C  CA  . LEU C 1 131 ? 60.725  41.889 28.256  1.00 18.36 ? 130 LEU C CA  1 
ATOM   3983 C  C   . LEU C 1 131 ? 61.611  43.134 28.180  1.00 19.00 ? 130 LEU C C   1 
ATOM   3984 O  O   . LEU C 1 131 ? 62.621  43.207 28.886  1.00 19.92 ? 130 LEU C O   1 
ATOM   3985 C  CB  . LEU C 1 131 ? 61.055  40.880 27.159  1.00 19.19 ? 130 LEU C CB  1 
ATOM   3986 C  CG  . LEU C 1 131 ? 60.526  39.444 27.336  1.00 22.95 ? 130 LEU C CG  1 
ATOM   3987 C  CD1 . LEU C 1 131 ? 60.796  38.606 26.094  1.00 23.52 ? 130 LEU C CD1 1 
ATOM   3988 C  CD2 . LEU C 1 131 ? 61.125  38.766 28.560  1.00 22.12 ? 130 LEU C CD2 1 
ATOM   3989 N  N   . LYS C 1 132 ? 61.233  44.109 27.348  1.00 18.49 ? 131 LYS C N   1 
ATOM   3990 C  CA  . LYS C 1 132 ? 61.936  45.411 27.272  1.00 19.17 ? 131 LYS C CA  1 
ATOM   3991 C  C   . LYS C 1 132 ? 61.948  46.104 28.628  1.00 20.40 ? 131 LYS C C   1 
ATOM   3992 O  O   . LYS C 1 132 ? 63.011  46.519 29.129  1.00 18.97 ? 131 LYS C O   1 
ATOM   3993 C  CB  . LYS C 1 132 ? 61.279  46.315 26.202  1.00 16.97 ? 131 LYS C CB  1 
ATOM   3994 C  CG  . LYS C 1 132 ? 62.093  47.509 25.709  1.00 21.05 ? 131 LYS C CG  1 
ATOM   3995 N  N   . ARG C 1 133 ? 60.777  46.205 29.248  1.00 20.14 ? 132 ARG C N   1 
ATOM   3996 C  CA  . ARG C 1 133 ? 60.688  46.830 30.560  1.00 21.89 ? 132 ARG C CA  1 
ATOM   3997 C  C   . ARG C 1 133 ? 61.549  46.094 31.600  1.00 22.32 ? 132 ARG C C   1 
ATOM   3998 O  O   . ARG C 1 133 ? 62.147  46.731 32.449  1.00 24.73 ? 132 ARG C O   1 
ATOM   3999 C  CB  . ARG C 1 133 ? 59.236  46.914 31.052  1.00 19.67 ? 132 ARG C CB  1 
ATOM   4000 C  CG  . ARG C 1 133 ? 59.062  47.823 32.274  1.00 16.85 ? 132 ARG C CG  1 
ATOM   4001 C  CD  . ARG C 1 133 ? 57.617  48.103 32.589  1.00 19.89 ? 132 ARG C CD  1 
ATOM   4002 N  NE  . ARG C 1 133 ? 56.988  46.905 33.135  1.00 22.40 ? 132 ARG C NE  1 
ATOM   4003 C  CZ  . ARG C 1 133 ? 55.682  46.675 33.206  1.00 22.26 ? 132 ARG C CZ  1 
ATOM   4004 N  NH1 . ARG C 1 133 ? 54.805  47.575 32.788  1.00 21.17 ? 132 ARG C NH1 1 
ATOM   4005 N  NH2 . ARG C 1 133 ? 55.252  45.528 33.722  1.00 13.79 ? 132 ARG C NH2 1 
ATOM   4006 N  N   . GLY C 1 134 ? 61.595  44.765 31.523  1.00 24.03 ? 133 GLY C N   1 
ATOM   4007 C  CA  . GLY C 1 134 ? 62.402  43.960 32.429  1.00 25.29 ? 133 GLY C CA  1 
ATOM   4008 C  C   . GLY C 1 134 ? 63.874  44.357 32.397  1.00 29.62 ? 133 GLY C C   1 
ATOM   4009 O  O   . GLY C 1 134 ? 64.579  44.206 33.398  1.00 30.37 ? 133 GLY C O   1 
ATOM   4010 N  N   . GLU C 1 135 ? 64.349  44.868 31.265  1.00 32.60 ? 134 GLU C N   1 
ATOM   4011 C  CA  . GLU C 1 135 ? 65.769  45.251 31.161  1.00 37.64 ? 134 GLU C CA  1 
ATOM   4012 C  C   . GLU C 1 135 ? 66.075  46.473 32.010  1.00 40.91 ? 134 GLU C C   1 
ATOM   4013 O  O   . GLU C 1 135 ? 67.089  46.521 32.685  1.00 43.00 ? 134 GLU C O   1 
ATOM   4014 C  CB  . GLU C 1 135 ? 66.188  45.497 29.710  1.00 35.68 ? 134 GLU C CB  1 
ATOM   4015 C  CG  . GLU C 1 135 ? 66.122  44.272 28.837  1.00 35.88 ? 134 GLU C CG  1 
ATOM   4016 N  N   . THR C 1 136 ? 65.187  47.457 31.970  1.00 44.57 ? 135 THR C N   1 
ATOM   4017 C  CA  . THR C 1 136 ? 65.362  48.709 32.698  1.00 47.50 ? 135 THR C CA  1 
ATOM   4018 C  C   . THR C 1 136 ? 64.344  48.761 33.829  1.00 48.66 ? 135 THR C C   1 
ATOM   4019 O  O   . THR C 1 136 ? 63.292  49.378 33.690  1.00 50.20 ? 135 THR C O   1 
ATOM   4020 C  CB  . THR C 1 136 ? 65.166  49.924 31.746  1.00 47.89 ? 135 THR C CB  1 
ATOM   4021 O  OG1 . THR C 1 136 ? 64.091  49.662 30.829  1.00 48.35 ? 135 THR C OG1 1 
ATOM   4022 C  CG2 . THR C 1 136 ? 66.437  50.192 30.947  1.00 51.19 ? 135 THR C CG2 1 
ATOM   4023 N  N   . SER C 1 137 ? 64.645  48.100 34.941  1.00 49.21 ? 136 SER C N   1 
ATOM   4024 C  CA  . SER C 1 137 ? 63.642  47.890 35.990  1.00 49.10 ? 136 SER C CA  1 
ATOM   4025 C  C   . SER C 1 137 ? 64.259  47.761 37.396  1.00 48.48 ? 136 SER C C   1 
ATOM   4026 O  O   . SER C 1 137 ? 65.477  47.634 37.517  1.00 49.77 ? 136 SER C O   1 
ATOM   4027 C  CB  . SER C 1 137 ? 62.823  46.652 35.641  1.00 48.94 ? 136 SER C CB  1 
ATOM   4028 O  OG  . SER C 1 137 ? 61.601  47.010 35.011  1.00 52.66 ? 136 SER C OG  1 
ATOM   4029 N  N   . GLY C 1 138 ? 63.455  47.791 38.464  1.00 46.69 ? 137 GLY C N   1 
ATOM   4030 C  CA  . GLY C 1 138 ? 61.995  47.918 38.428  1.00 44.51 ? 137 GLY C CA  1 
ATOM   4031 C  C   . GLY C 1 138 ? 61.252  46.679 38.926  1.00 42.75 ? 137 GLY C C   1 
ATOM   4032 O  O   . GLY C 1 138 ? 61.581  46.097 39.969  1.00 43.02 ? 137 GLY C O   1 
ATOM   4033 N  N   . ARG C 1 139 ? 60.240  46.268 38.169  1.00 37.95 ? 138 ARG C N   1 
ATOM   4034 C  CA  . ARG C 1 139 ? 59.314  45.258 38.629  1.00 33.06 ? 138 ARG C CA  1 
ATOM   4035 C  C   . ARG C 1 139 ? 59.915  43.874 38.710  1.00 29.70 ? 138 ARG C C   1 
ATOM   4036 O  O   . ARG C 1 139 ? 60.686  43.450 37.848  1.00 28.69 ? 138 ARG C O   1 
ATOM   4037 C  CB  . ARG C 1 139 ? 58.061  45.223 37.758  1.00 31.41 ? 138 ARG C CB  1 
ATOM   4038 C  CG  . ARG C 1 139 ? 57.104  46.283 38.164  1.00 28.44 ? 138 ARG C CG  1 
ATOM   4039 C  CD  . ARG C 1 139 ? 55.990  46.429 37.213  1.00 31.16 ? 138 ARG C CD  1 
ATOM   4040 N  NE  . ARG C 1 139 ? 55.127  45.246 37.136  1.00 24.58 ? 138 ARG C NE  1 
ATOM   4041 C  CZ  . ARG C 1 139 ? 53.881  45.301 36.668  1.00 18.43 ? 138 ARG C CZ  1 
ATOM   4042 N  NH1 . ARG C 1 139 ? 53.378  46.462 36.280  1.00 16.35 ? 138 ARG C NH1 1 
ATOM   4043 N  NH2 . ARG C 1 139 ? 53.139  44.207 36.598  1.00 18.84 ? 138 ARG C NH2 1 
ATOM   4044 N  N   . VAL C 1 140 ? 59.485  43.163 39.743  1.00 26.07 ? 139 VAL C N   1 
ATOM   4045 C  CA  . VAL C 1 140 ? 59.963  41.822 40.047  1.00 27.31 ? 139 VAL C CA  1 
ATOM   4046 C  C   . VAL C 1 140 ? 59.188  40.734 39.265  1.00 25.93 ? 139 VAL C C   1 
ATOM   4047 O  O   . VAL C 1 140 ? 59.485  39.562 39.391  1.00 24.55 ? 139 VAL C O   1 
ATOM   4048 C  CB  . VAL C 1 140 ? 59.861  41.615 41.613  1.00 28.85 ? 139 VAL C CB  1 
ATOM   4049 C  CG1 . VAL C 1 140 ? 58.498  41.123 42.042  1.00 34.38 ? 139 VAL C CG1 1 
ATOM   4050 C  CG2 . VAL C 1 140 ? 60.919  40.729 42.125  1.00 34.45 ? 139 VAL C CG2 1 
ATOM   4051 N  N   . ASP C 1 141 ? 58.195  41.112 38.457  1.00 23.24 ? 140 ASP C N   1 
ATOM   4052 C  CA  . ASP C 1 141 ? 57.381  40.113 37.771  1.00 18.97 ? 140 ASP C CA  1 
ATOM   4053 C  C   . ASP C 1 141 ? 57.571  40.088 36.222  1.00 20.04 ? 140 ASP C C   1 
ATOM   4054 O  O   . ASP C 1 141 ? 56.864  39.363 35.522  1.00 19.90 ? 140 ASP C O   1 
ATOM   4055 C  CB  . ASP C 1 141 ? 55.904  40.242 38.181  1.00 19.61 ? 140 ASP C CB  1 
ATOM   4056 C  CG  . ASP C 1 141 ? 55.283  41.583 37.819  1.00 20.27 ? 140 ASP C CG  1 
ATOM   4057 O  OD1 . ASP C 1 141 ? 56.035  42.512 37.445  1.00 17.78 ? 140 ASP C OD1 1 
ATOM   4058 O  OD2 . ASP C 1 141 ? 54.038  41.712 37.927  1.00 23.22 ? 140 ASP C OD2 1 
ATOM   4059 N  N   . ASP C 1 142 ? 58.544  40.842 35.707  1.00 17.30 ? 141 ASP C N   1 
ATOM   4060 C  CA  . ASP C 1 142 ? 58.746  40.978 34.258  1.00 16.96 ? 141 ASP C CA  1 
ATOM   4061 C  C   . ASP C 1 142 ? 59.751  39.986 33.631  1.00 17.03 ? 141 ASP C C   1 
ATOM   4062 O  O   . ASP C 1 142 ? 60.239  40.216 32.514  1.00 19.48 ? 141 ASP C O   1 
ATOM   4063 C  CB  . ASP C 1 142 ? 59.189  42.420 33.901  1.00 18.07 ? 141 ASP C CB  1 
ATOM   4064 C  CG  . ASP C 1 142 ? 58.075  43.481 34.070  1.00 18.34 ? 141 ASP C CG  1 
ATOM   4065 O  OD1 . ASP C 1 142 ? 58.421  44.668 34.305  1.00 18.22 ? 141 ASP C OD1 1 
ATOM   4066 O  OD2 . ASP C 1 142 ? 56.883  43.170 33.952  1.00 19.32 ? 141 ASP C OD2 1 
ATOM   4067 N  N   . ASN C 1 143 ? 60.044  38.877 34.295  1.00 16.35 ? 142 ASN C N   1 
ATOM   4068 C  CA  . ASN C 1 143 ? 60.910  37.845 33.712  1.00 14.88 ? 142 ASN C CA  1 
ATOM   4069 C  C   . ASN C 1 143 ? 60.103  36.877 32.837  1.00 16.01 ? 142 ASN C C   1 
ATOM   4070 O  O   . ASN C 1 143 ? 58.882  36.754 33.005  1.00 15.83 ? 142 ASN C O   1 
ATOM   4071 C  CB  . ASN C 1 143 ? 61.666  37.082 34.807  1.00 11.99 ? 142 ASN C CB  1 
ATOM   4072 C  CG  . ASN C 1 143 ? 60.729  36.389 35.787  1.00 16.09 ? 142 ASN C CG  1 
ATOM   4073 O  OD1 . ASN C 1 143 ? 60.272  36.984 36.756  1.00 28.93 ? 142 ASN C OD1 1 
ATOM   4074 N  ND2 . ASN C 1 143 ? 60.432  35.151 35.530  1.00 10.98 ? 142 ASN C ND2 1 
ATOM   4075 N  N   . GLU C 1 144 ? 60.813  36.196 31.933  1.00 15.30 ? 143 GLU C N   1 
ATOM   4076 C  CA  A GLU C 1 144 ? 60.170  35.367 30.907  0.50 17.61 ? 143 GLU C CA  1 
ATOM   4077 C  CA  B GLU C 1 144 ? 60.247  35.281 30.918  0.50 16.56 ? 143 GLU C CA  1 
ATOM   4078 C  C   . GLU C 1 144 ? 59.165  34.367 31.478  1.00 17.17 ? 143 GLU C C   1 
ATOM   4079 O  O   . GLU C 1 144 ? 58.030  34.288 30.983  1.00 14.82 ? 143 GLU C O   1 
ATOM   4080 C  CB  A GLU C 1 144 ? 61.212  34.642 30.041  0.50 18.34 ? 143 GLU C CB  1 
ATOM   4081 C  CB  B GLU C 1 144 ? 61.357  34.361 30.349  0.50 17.13 ? 143 GLU C CB  1 
ATOM   4082 C  CG  A GLU C 1 144 ? 60.726  34.365 28.616  0.50 21.54 ? 143 GLU C CG  1 
ATOM   4083 C  CG  B GLU C 1 144 ? 62.285  34.977 29.275  0.50 18.35 ? 143 GLU C CG  1 
ATOM   4084 C  CD  A GLU C 1 144 ? 61.841  34.048 27.623  0.50 20.24 ? 143 GLU C CD  1 
ATOM   4085 C  CD  B GLU C 1 144 ? 63.739  35.210 29.716  0.50 18.30 ? 143 GLU C CD  1 
ATOM   4086 O  OE1 A GLU C 1 144 ? 63.021  34.396 27.875  0.50 21.97 ? 143 GLU C OE1 1 
ATOM   4087 O  OE1 B GLU C 1 144 ? 64.463  35.964 29.026  0.50 11.92 ? 143 GLU C OE1 1 
ATOM   4088 O  OE2 A GLU C 1 144 ? 61.525  33.443 26.572  0.50 24.62 ? 143 GLU C OE2 1 
ATOM   4089 O  OE2 B GLU C 1 144 ? 64.176  34.661 30.742  0.50 16.22 ? 143 GLU C OE2 1 
ATOM   4090 N  N   . GLU C 1 145 ? 59.559  33.648 32.515  1.00 16.51 ? 144 GLU C N   1 
ATOM   4091 C  CA  . GLU C 1 145 ? 58.705  32.629 33.113  1.00 19.45 ? 144 GLU C CA  1 
ATOM   4092 C  C   . GLU C 1 145 ? 57.453  33.241 33.775  1.00 20.01 ? 144 GLU C C   1 
ATOM   4093 O  O   . GLU C 1 145 ? 56.358  32.663 33.720  1.00 21.25 ? 144 GLU C O   1 
ATOM   4094 C  CB  . GLU C 1 145 ? 59.496  31.806 34.138  1.00 19.82 ? 144 GLU C CB  1 
ATOM   4095 C  CG  . GLU C 1 145 ? 60.770  31.191 33.625  1.00 19.11 ? 144 GLU C CG  1 
ATOM   4096 C  CD  . GLU C 1 145 ? 61.974  32.128 33.733  1.00 19.39 ? 144 GLU C CD  1 
ATOM   4097 O  OE1 . GLU C 1 145 ? 61.764  33.337 33.926  1.00 18.40 ? 144 GLU C OE1 1 
ATOM   4098 O  OE2 . GLU C 1 145 ? 63.125  31.660 33.640  1.00 25.59 ? 144 GLU C OE2 1 
ATOM   4099 N  N   . THR C 1 146 ? 57.584  34.419 34.378  1.00 18.64 ? 145 THR C N   1 
ATOM   4100 C  CA  . THR C 1 146 ? 56.440  35.003 35.072  1.00 15.81 ? 145 THR C CA  1 
ATOM   4101 C  C   . THR C 1 146 ? 55.511  35.670 34.050  1.00 13.41 ? 145 THR C C   1 
ATOM   4102 O  O   . THR C 1 146 ? 54.317  35.650 34.224  1.00 14.59 ? 145 THR C O   1 
ATOM   4103 C  CB  . THR C 1 146 ? 56.859  35.932 36.225  1.00 17.86 ? 145 THR C CB  1 
ATOM   4104 O  OG1 . THR C 1 146 ? 57.648  35.163 37.137  1.00 19.38 ? 145 THR C OG1 1 
ATOM   4105 C  CG2 . THR C 1 146 ? 55.631  36.467 36.984  1.00 11.95 ? 145 THR C CG2 1 
ATOM   4106 N  N   . ILE C 1 147 ? 56.065  36.202 32.966  1.00 15.27 ? 146 ILE C N   1 
ATOM   4107 C  CA  . ILE C 1 147 ? 55.236  36.728 31.857  1.00 16.62 ? 146 ILE C CA  1 
ATOM   4108 C  C   . ILE C 1 147 ? 54.320  35.637 31.309  1.00 15.00 ? 146 ILE C C   1 
ATOM   4109 O  O   . ILE C 1 147 ? 53.138  35.882 31.087  1.00 16.52 ? 146 ILE C O   1 
ATOM   4110 C  CB  . ILE C 1 147 ? 56.083  37.323 30.726  1.00 19.12 ? 146 ILE C CB  1 
ATOM   4111 C  CG1 . ILE C 1 147 ? 56.806  38.573 31.227  1.00 16.55 ? 146 ILE C CG1 1 
ATOM   4112 C  CG2 . ILE C 1 147 ? 55.193  37.646 29.490  1.00 17.42 ? 146 ILE C CG2 1 
ATOM   4113 C  CD1 . ILE C 1 147 ? 57.979  39.026 30.389  1.00 16.92 ? 146 ILE C CD1 1 
ATOM   4114 N  N   . LYS C 1 148 ? 54.838  34.423 31.152  1.00 16.29 ? 147 LYS C N   1 
ATOM   4115 C  CA  . LYS C 1 148 ? 54.016  33.280 30.703  1.00 15.42 ? 147 LYS C CA  1 
ATOM   4116 C  C   . LYS C 1 148 ? 52.876  32.932 31.654  1.00 15.93 ? 147 LYS C C   1 
ATOM   4117 O  O   . LYS C 1 148 ? 51.746  32.760 31.225  1.00 14.01 ? 147 LYS C O   1 
ATOM   4118 C  CB  . LYS C 1 148 ? 54.878  32.045 30.421  1.00 17.62 ? 147 LYS C CB  1 
ATOM   4119 C  CG  . LYS C 1 148 ? 55.769  32.180 29.183  1.00 24.15 ? 147 LYS C CG  1 
ATOM   4120 C  CD  . LYS C 1 148 ? 56.340  30.827 28.762  1.00 31.82 ? 147 LYS C CD  1 
ATOM   4121 C  CE  . LYS C 1 148 ? 57.782  30.920 28.220  1.00 35.19 ? 147 LYS C CE  1 
ATOM   4122 N  NZ  . LYS C 1 148 ? 58.808  30.710 29.317  1.00 38.34 ? 147 LYS C NZ  1 
ATOM   4123 N  N   . LYS C 1 149 ? 53.153  32.890 32.956  1.00 16.16 ? 148 LYS C N   1 
ATOM   4124 C  CA  . LYS C 1 149 ? 52.128  32.606 33.951  1.00 16.54 ? 148 LYS C CA  1 
ATOM   4125 C  C   . LYS C 1 149 ? 51.112  33.728 34.034  1.00 14.72 ? 148 LYS C C   1 
ATOM   4126 O  O   . LYS C 1 149 ? 49.935  33.465 34.207  1.00 14.59 ? 148 LYS C O   1 
ATOM   4127 C  CB  . LYS C 1 149 ? 52.756  32.362 35.329  1.00 17.61 ? 148 LYS C CB  1 
ATOM   4128 C  CG  . LYS C 1 149 ? 53.638  31.125 35.443  1.00 23.02 ? 148 LYS C CG  1 
ATOM   4129 C  CD  . LYS C 1 149 ? 54.342  31.106 36.811  1.00 24.71 ? 148 LYS C CD  1 
ATOM   4130 C  CE  . LYS C 1 149 ? 55.312  29.913 36.979  1.00 33.62 ? 148 LYS C CE  1 
ATOM   4131 N  NZ  . LYS C 1 149 ? 54.864  28.882 37.988  1.00 41.44 ? 148 LYS C NZ  1 
ATOM   4132 N  N   . ARG C 1 150 ? 51.552  34.977 33.874  1.00 14.95 ? 149 ARG C N   1 
ATOM   4133 C  CA  . ARG C 1 150 ? 50.637  36.122 33.842  1.00 14.65 ? 149 ARG C CA  1 
ATOM   4134 C  C   . ARG C 1 150 ? 49.680  36.064 32.645  1.00 16.73 ? 149 ARG C C   1 
ATOM   4135 O  O   . ARG C 1 150 ? 48.508  36.417 32.749  1.00 16.34 ? 149 ARG C O   1 
ATOM   4136 C  CB  . ARG C 1 150 ? 51.408  37.457 33.839  1.00 15.32 ? 149 ARG C CB  1 
ATOM   4137 C  CG  . ARG C 1 150 ? 52.058  37.770 35.205  1.00 16.49 ? 149 ARG C CG  1 
ATOM   4138 C  CD  . ARG C 1 150 ? 53.174  38.764 35.097  1.00 18.94 ? 149 ARG C CD  1 
ATOM   4139 N  NE  . ARG C 1 150 ? 52.676  40.047 34.667  1.00 16.51 ? 149 ARG C NE  1 
ATOM   4140 C  CZ  . ARG C 1 150 ? 53.418  41.077 34.271  1.00 20.03 ? 149 ARG C CZ  1 
ATOM   4141 N  NH1 . ARG C 1 150 ? 54.748  41.013 34.262  1.00 17.12 ? 149 ARG C NH1 1 
ATOM   4142 N  NH2 . ARG C 1 150 ? 52.807  42.204 33.915  1.00 21.76 ? 149 ARG C NH2 1 
ATOM   4143 N  N   . LEU C 1 151 ? 50.174  35.628 31.500  1.00 16.88 ? 150 LEU C N   1 
ATOM   4144 C  CA  . LEU C 1 151 ? 49.310  35.496 30.321  1.00 14.22 ? 150 LEU C CA  1 
ATOM   4145 C  C   . LEU C 1 151 ? 48.284  34.380 30.551  1.00 15.02 ? 150 LEU C C   1 
ATOM   4146 O  O   . LEU C 1 151 ? 47.112  34.546 30.254  1.00 17.94 ? 150 LEU C O   1 
ATOM   4147 C  CB  . LEU C 1 151 ? 50.144  35.286 29.058  1.00 14.50 ? 150 LEU C CB  1 
ATOM   4148 C  CG  . LEU C 1 151 ? 50.909  36.471 28.487  1.00 17.28 ? 150 LEU C CG  1 
ATOM   4149 C  CD1 . LEU C 1 151 ? 51.888  36.001 27.435  1.00 23.69 ? 150 LEU C CD1 1 
ATOM   4150 C  CD2 . LEU C 1 151 ? 50.005  37.540 27.883  1.00 23.78 ? 150 LEU C CD2 1 
ATOM   4151 N  N   . GLU C 1 152 ? 48.701  33.251 31.108  1.00 15.42 ? 151 GLU C N   1 
ATOM   4152 C  CA  . GLU C 1 152 ? 47.768  32.162 31.368  1.00 19.92 ? 151 GLU C CA  1 
ATOM   4153 C  C   . GLU C 1 152 ? 46.633  32.558 32.325  1.00 18.98 ? 151 GLU C C   1 
ATOM   4154 O  O   . GLU C 1 152 ? 45.472  32.271 32.057  1.00 19.59 ? 151 GLU C O   1 
ATOM   4155 C  CB  . GLU C 1 152 ? 48.510  30.941 31.899  1.00 21.01 ? 151 GLU C CB  1 
ATOM   4156 C  CG  . GLU C 1 152 ? 49.450  30.339 30.887  1.00 26.76 ? 151 GLU C CG  1 
ATOM   4157 C  CD  . GLU C 1 152 ? 50.274  29.165 31.437  1.00 31.35 ? 151 GLU C CD  1 
ATOM   4158 O  OE1 . GLU C 1 152 ? 50.050  28.765 32.614  1.00 40.85 ? 151 GLU C OE1 1 
ATOM   4159 O  OE2 . GLU C 1 152 ? 51.142  28.653 30.675  1.00 40.18 ? 151 GLU C OE2 1 
ATOM   4160 N  N   . THR C 1 153 ? 46.968  33.239 33.423  1.00 19.36 ? 152 THR C N   1 
ATOM   4161 C  CA  . THR C 1 153 ? 45.967  33.782 34.343  1.00 17.43 ? 152 THR C CA  1 
ATOM   4162 C  C   . THR C 1 153 ? 45.029  34.762 33.628  1.00 16.44 ? 152 THR C C   1 
ATOM   4163 O  O   . THR C 1 153 ? 43.831  34.771 33.858  1.00 20.01 ? 152 THR C O   1 
ATOM   4164 C  CB  . THR C 1 153 ? 46.686  34.507 35.488  1.00 17.04 ? 152 THR C CB  1 
ATOM   4165 O  OG1 . THR C 1 153 ? 47.526  33.556 36.155  1.00 22.98 ? 152 THR C OG1 1 
ATOM   4166 C  CG2 . THR C 1 153 ? 45.713  35.121 36.486  1.00 21.51 ? 152 THR C CG2 1 
ATOM   4167 N  N   . TYR C 1 154 ? 45.571  35.593 32.767  1.00 17.25 ? 153 TYR C N   1 
ATOM   4168 C  CA  . TYR C 1 154 ? 44.728  36.571 32.084  1.00 17.37 ? 153 TYR C CA  1 
ATOM   4169 C  C   . TYR C 1 154 ? 43.690  35.825 31.208  1.00 18.00 ? 153 TYR C C   1 
ATOM   4170 O  O   . TYR C 1 154 ? 42.494  36.060 31.351  1.00 18.93 ? 153 TYR C O   1 
ATOM   4171 C  CB  . TYR C 1 154 ? 45.528  37.549 31.276  1.00 19.34 ? 153 TYR C CB  1 
ATOM   4172 C  CG  . TYR C 1 154 ? 44.630  38.389 30.395  1.00 19.32 ? 153 TYR C CG  1 
ATOM   4173 C  CD1 . TYR C 1 154 ? 43.856  39.388 30.929  1.00 15.88 ? 153 TYR C CD1 1 
ATOM   4174 C  CD2 . TYR C 1 154 ? 44.520  38.122 29.028  1.00 20.92 ? 153 TYR C CD2 1 
ATOM   4175 C  CE1 . TYR C 1 154 ? 43.019  40.143 30.131  1.00 18.06 ? 153 TYR C CE1 1 
ATOM   4176 C  CE2 . TYR C 1 154 ? 43.702  38.869 28.217  1.00 17.82 ? 153 TYR C CE2 1 
ATOM   4177 C  CZ  . TYR C 1 154 ? 42.949  39.876 28.767  1.00 18.59 ? 153 TYR C CZ  1 
ATOM   4178 O  OH  . TYR C 1 154 ? 42.092  40.605 27.962  1.00 20.85 ? 153 TYR C OH  1 
ATOM   4179 N  N   . TYR C 1 155 ? 44.144  34.919 30.339  1.00 17.70 ? 154 TYR C N   1 
ATOM   4180 C  CA  . TYR C 1 155 ? 43.235  34.217 29.410  1.00 19.83 ? 154 TYR C CA  1 
ATOM   4181 C  C   . TYR C 1 155 ? 42.235  33.283 30.121  1.00 20.98 ? 154 TYR C C   1 
ATOM   4182 O  O   . TYR C 1 155 ? 41.095  33.152 29.677  1.00 21.64 ? 154 TYR C O   1 
ATOM   4183 C  CB  . TYR C 1 155 ? 43.989  33.429 28.329  1.00 19.75 ? 154 TYR C CB  1 
ATOM   4184 C  CG  . TYR C 1 155 ? 44.729  34.306 27.359  1.00 19.21 ? 154 TYR C CG  1 
ATOM   4185 C  CD1 . TYR C 1 155 ? 46.115  34.303 27.317  1.00 17.77 ? 154 TYR C CD1 1 
ATOM   4186 C  CD2 . TYR C 1 155 ? 44.042  35.221 26.546  1.00 22.62 ? 154 TYR C CD2 1 
ATOM   4187 C  CE1 . TYR C 1 155 ? 46.814  35.144 26.453  1.00 20.87 ? 154 TYR C CE1 1 
ATOM   4188 C  CE2 . TYR C 1 155 ? 44.729  36.078 25.680  1.00 19.88 ? 154 TYR C CE2 1 
ATOM   4189 C  CZ  . TYR C 1 155 ? 46.124  36.032 25.642  1.00 26.15 ? 154 TYR C CZ  1 
ATOM   4190 O  OH  . TYR C 1 155 ? 46.839  36.853 24.783  1.00 25.90 ? 154 TYR C OH  1 
ATOM   4191 N  N   . LYS C 1 156 ? 42.631  32.691 31.241  1.00 19.98 ? 155 LYS C N   1 
ATOM   4192 C  CA  . LYS C 1 156 ? 41.741  31.797 31.999  1.00 21.13 ? 155 LYS C CA  1 
ATOM   4193 C  C   . LYS C 1 156 ? 40.687  32.489 32.907  1.00 19.67 ? 155 LYS C C   1 
ATOM   4194 O  O   . LYS C 1 156 ? 39.514  32.085 32.916  1.00 17.29 ? 155 LYS C O   1 
ATOM   4195 C  CB  . LYS C 1 156 ? 42.579  30.864 32.867  1.00 22.83 ? 155 LYS C CB  1 
ATOM   4196 C  CG  . LYS C 1 156 ? 41.787  29.686 33.422  1.00 23.30 ? 155 LYS C CG  1 
ATOM   4197 C  CD  . LYS C 1 156 ? 42.599  28.852 34.424  1.00 27.07 ? 155 LYS C CD  1 
ATOM   4198 C  CE  . LYS C 1 156 ? 41.889  27.521 34.712  1.00 36.28 ? 155 LYS C CE  1 
ATOM   4199 N  NZ  . LYS C 1 156 ? 42.572  26.666 35.739  1.00 42.72 ? 155 LYS C NZ  1 
ATOM   4200 N  N   . ALA C 1 157 ? 41.113  33.486 33.688  1.00 18.86 ? 156 ALA C N   1 
ATOM   4201 C  CA  . ALA C 1 157 ? 40.269  34.124 34.688  1.00 18.71 ? 156 ALA C CA  1 
ATOM   4202 C  C   . ALA C 1 157 ? 39.631  35.421 34.192  1.00 18.20 ? 156 ALA C C   1 
ATOM   4203 O  O   . ALA C 1 157 ? 38.462  35.702 34.492  1.00 19.50 ? 156 ALA C O   1 
ATOM   4204 C  CB  . ALA C 1 157 ? 41.093  34.424 35.954  1.00 19.96 ? 156 ALA C CB  1 
ATOM   4205 N  N   . THR C 1 158 ? 40.403  36.217 33.462  1.00 17.46 ? 157 THR C N   1 
ATOM   4206 C  CA  . THR C 1 158 ? 40.016  37.582 33.132  1.00 19.06 ? 157 THR C CA  1 
ATOM   4207 C  C   . THR C 1 158 ? 39.260  37.717 31.799  1.00 20.05 ? 157 THR C C   1 
ATOM   4208 O  O   . THR C 1 158 ? 38.302  38.476 31.694  1.00 20.73 ? 157 THR C O   1 
ATOM   4209 C  CB  . THR C 1 158 ? 41.244  38.490 33.177  1.00 20.83 ? 157 THR C CB  1 
ATOM   4210 O  OG1 . THR C 1 158 ? 41.957  38.261 34.401  1.00 23.05 ? 157 THR C OG1 1 
ATOM   4211 C  CG2 . THR C 1 158 ? 40.843  39.946 33.114  1.00 20.16 ? 157 THR C CG2 1 
ATOM   4212 N  N   . GLU C 1 159 ? 39.657  36.991 30.767  1.00 20.57 ? 158 GLU C N   1 
ATOM   4213 C  CA  . GLU C 1 159 ? 38.938  37.146 29.509  1.00 23.60 ? 158 GLU C CA  1 
ATOM   4214 C  C   . GLU C 1 159 ? 37.395  36.920 29.650  1.00 21.51 ? 158 GLU C C   1 
ATOM   4215 O  O   . GLU C 1 159 ? 36.615  37.692 29.067  1.00 22.81 ? 158 GLU C O   1 
ATOM   4216 C  CB  . GLU C 1 159 ? 39.579  36.304 28.390  1.00 27.46 ? 158 GLU C CB  1 
ATOM   4217 C  CG  . GLU C 1 159 ? 39.777  37.101 27.101  1.00 28.27 ? 158 GLU C CG  1 
ATOM   4218 C  CD  . GLU C 1 159 ? 40.429  36.285 26.012  1.00 28.61 ? 158 GLU C CD  1 
ATOM   4219 O  OE1 . GLU C 1 159 ? 40.167  35.067 25.929  1.00 21.38 ? 158 GLU C OE1 1 
ATOM   4220 O  OE2 . GLU C 1 159 ? 41.203  36.868 25.237  1.00 27.51 ? 158 GLU C OE2 1 
ATOM   4221 N  N   . PRO C 1 160 ? 36.951  35.912 30.453  1.00 20.27 ? 159 PRO C N   1 
ATOM   4222 C  CA  . PRO C 1 160 ? 35.529  35.773 30.769  1.00 21.25 ? 159 PRO C CA  1 
ATOM   4223 C  C   . PRO C 1 160 ? 34.816  37.004 31.332  1.00 22.31 ? 159 PRO C C   1 
ATOM   4224 O  O   . PRO C 1 160 ? 33.606  37.065 31.232  1.00 22.96 ? 159 PRO C O   1 
ATOM   4225 C  CB  . PRO C 1 160 ? 35.485  34.613 31.779  1.00 21.34 ? 159 PRO C CB  1 
ATOM   4226 C  CG  . PRO C 1 160 ? 36.695  33.834 31.501  1.00 15.16 ? 159 PRO C CG  1 
ATOM   4227 C  CD  . PRO C 1 160 ? 37.735  34.811 31.045  1.00 21.35 ? 159 PRO C CD  1 
ATOM   4228 N  N   . VAL C 1 161 ? 35.544  37.966 31.914  1.00 22.64 ? 160 VAL C N   1 
ATOM   4229 C  CA  . VAL C 1 161 ? 34.947  39.209 32.372  1.00 22.12 ? 160 VAL C CA  1 
ATOM   4230 C  C   . VAL C 1 161 ? 34.409  40.043 31.203  1.00 22.14 ? 160 VAL C C   1 
ATOM   4231 O  O   . VAL C 1 161 ? 33.407  40.757 31.350  1.00 21.89 ? 160 VAL C O   1 
ATOM   4232 C  CB  . VAL C 1 161 ? 35.972  40.053 33.197  1.00 26.41 ? 160 VAL C CB  1 
ATOM   4233 C  CG1 . VAL C 1 161 ? 35.470  41.466 33.425  1.00 27.13 ? 160 VAL C CG1 1 
ATOM   4234 C  CG2 . VAL C 1 161 ? 36.284  39.340 34.528  1.00 25.20 ? 160 VAL C CG2 1 
ATOM   4235 N  N   . ILE C 1 162 ? 35.069  39.976 30.051  1.00 22.41 ? 161 ILE C N   1 
ATOM   4236 C  CA  . ILE C 1 162 ? 34.611  40.724 28.862  1.00 21.87 ? 161 ILE C CA  1 
ATOM   4237 C  C   . ILE C 1 162 ? 33.232  40.265 28.442  1.00 21.48 ? 161 ILE C C   1 
ATOM   4238 O  O   . ILE C 1 162 ? 32.314  41.072 28.285  1.00 21.66 ? 161 ILE C O   1 
ATOM   4239 C  CB  . ILE C 1 162 ? 35.589  40.592 27.643  1.00 20.53 ? 161 ILE C CB  1 
ATOM   4240 C  CG1 . ILE C 1 162 ? 37.011  40.975 28.026  1.00 25.98 ? 161 ILE C CG1 1 
ATOM   4241 C  CG2 . ILE C 1 162 ? 35.111  41.490 26.470  1.00 23.10 ? 161 ILE C CG2 1 
ATOM   4242 C  CD1 . ILE C 1 162 ? 37.129  42.346 28.612  1.00 29.07 ? 161 ILE C CD1 1 
ATOM   4243 N  N   . ALA C 1 163 ? 33.075  38.959 28.283  1.00 22.10 ? 162 ALA C N   1 
ATOM   4244 C  CA  . ALA C 1 163 ? 31.799  38.376 27.885  1.00 22.74 ? 162 ALA C CA  1 
ATOM   4245 C  C   . ALA C 1 163 ? 30.715  38.696 28.893  1.00 22.63 ? 162 ALA C C   1 
ATOM   4246 O  O   . ALA C 1 163 ? 29.564  38.933 28.537  1.00 23.44 ? 162 ALA C O   1 
ATOM   4247 C  CB  . ALA C 1 163 ? 31.932  36.868 27.751  1.00 21.57 ? 162 ALA C CB  1 
ATOM   4248 N  N   . PHE C 1 164 ? 31.101  38.683 30.165  1.00 22.11 ? 163 PHE C N   1 
ATOM   4249 C  CA  . PHE C 1 164 ? 30.204  38.989 31.269  1.00 22.09 ? 163 PHE C CA  1 
ATOM   4250 C  C   . PHE C 1 164 ? 29.606  40.417 31.136  1.00 20.25 ? 163 PHE C C   1 
ATOM   4251 O  O   . PHE C 1 164 ? 28.414  40.611 31.322  1.00 21.88 ? 163 PHE C O   1 
ATOM   4252 C  CB  . PHE C 1 164 ? 30.995  38.797 32.570  1.00 24.01 ? 163 PHE C CB  1 
ATOM   4253 C  CG  . PHE C 1 164 ? 30.199  38.946 33.817  1.00 24.47 ? 163 PHE C CG  1 
ATOM   4254 C  CD1 . PHE C 1 164 ? 29.446  37.890 34.306  1.00 33.58 ? 163 PHE C CD1 1 
ATOM   4255 C  CD2 . PHE C 1 164 ? 30.260  40.126 34.549  1.00 29.74 ? 163 PHE C CD2 1 
ATOM   4256 C  CE1 . PHE C 1 164 ? 28.722  38.021 35.495  1.00 34.98 ? 163 PHE C CE1 1 
ATOM   4257 C  CE2 . PHE C 1 164 ? 29.544  40.272 35.744  1.00 35.66 ? 163 PHE C CE2 1 
ATOM   4258 C  CZ  . PHE C 1 164 ? 28.776  39.214 36.216  1.00 31.84 ? 163 PHE C CZ  1 
ATOM   4259 N  N   . TYR C 1 165 ? 30.401  41.404 30.753  1.00 18.90 ? 164 TYR C N   1 
ATOM   4260 C  CA  . TYR C 1 165 ? 29.904  42.786 30.656  1.00 17.91 ? 164 TYR C CA  1 
ATOM   4261 C  C   . TYR C 1 165 ? 29.410  43.214 29.260  1.00 18.78 ? 164 TYR C C   1 
ATOM   4262 O  O   . TYR C 1 165 ? 28.650  44.184 29.161  1.00 19.00 ? 164 TYR C O   1 
ATOM   4263 C  CB  . TYR C 1 165 ? 30.952  43.776 31.187  1.00 19.63 ? 164 TYR C CB  1 
ATOM   4264 C  CG  . TYR C 1 165 ? 31.063  43.755 32.690  1.00 19.96 ? 164 TYR C CG  1 
ATOM   4265 C  CD1 . TYR C 1 165 ? 32.131  43.115 33.327  1.00 19.62 ? 164 TYR C CD1 1 
ATOM   4266 C  CD2 . TYR C 1 165 ? 30.098  44.364 33.483  1.00 18.80 ? 164 TYR C CD2 1 
ATOM   4267 C  CE1 . TYR C 1 165 ? 32.232  43.086 34.741  1.00 25.64 ? 164 TYR C CE1 1 
ATOM   4268 C  CE2 . TYR C 1 165 ? 30.192  44.349 34.878  1.00 22.43 ? 164 TYR C CE2 1 
ATOM   4269 C  CZ  . TYR C 1 165 ? 31.255  43.704 35.497  1.00 25.47 ? 164 TYR C CZ  1 
ATOM   4270 O  OH  . TYR C 1 165 ? 31.326  43.677 36.862  1.00 21.63 ? 164 TYR C OH  1 
ATOM   4271 N  N   . GLU C 1 166 ? 29.796  42.482 28.210  1.00 20.86 ? 165 GLU C N   1 
ATOM   4272 C  CA  . GLU C 1 166 ? 29.360  42.754 26.819  1.00 23.80 ? 165 GLU C CA  1 
ATOM   4273 C  C   . GLU C 1 166 ? 27.867  42.707 26.731  1.00 21.69 ? 165 GLU C C   1 
ATOM   4274 O  O   . GLU C 1 166 ? 27.277  43.523 26.053  1.00 20.44 ? 165 GLU C O   1 
ATOM   4275 C  CB  . GLU C 1 166 ? 29.894  41.704 25.817  1.00 25.40 ? 165 GLU C CB  1 
ATOM   4276 C  CG  . GLU C 1 166 ? 31.263  42.014 25.246  1.00 31.72 ? 165 GLU C CG  1 
ATOM   4277 C  CD  . GLU C 1 166 ? 31.577  41.281 23.945  1.00 30.58 ? 165 GLU C CD  1 
ATOM   4278 O  OE1 . GLU C 1 166 ? 31.104  40.143 23.741  1.00 41.70 ? 165 GLU C OE1 1 
ATOM   4279 O  OE2 . GLU C 1 166 ? 32.321  41.853 23.131  1.00 41.71 ? 165 GLU C OE2 1 
ATOM   4280 N  N   . LYS C 1 167 ? 27.285  41.696 27.388  1.00 22.29 ? 166 LYS C N   1 
ATOM   4281 C  CA  . LYS C 1 167 ? 25.847  41.563 27.576  1.00 22.85 ? 166 LYS C CA  1 
ATOM   4282 C  C   . LYS C 1 167 ? 25.115  42.881 27.869  1.00 20.57 ? 166 LYS C C   1 
ATOM   4283 O  O   . LYS C 1 167 ? 24.038  43.145 27.314  1.00 22.95 ? 166 LYS C O   1 
ATOM   4284 C  CB  . LYS C 1 167 ? 25.576  40.569 28.726  1.00 25.05 ? 166 LYS C CB  1 
ATOM   4285 C  CG  . LYS C 1 167 ? 25.831  39.111 28.356  1.00 28.01 ? 166 LYS C CG  1 
ATOM   4286 C  CD  . LYS C 1 167 ? 25.663  38.220 29.579  1.00 38.66 ? 166 LYS C CD  1 
ATOM   4287 C  CE  . LYS C 1 167 ? 26.316  36.856 29.392  1.00 43.81 ? 166 LYS C CE  1 
ATOM   4288 N  NZ  . LYS C 1 167 ? 25.569  35.996 28.444  1.00 49.71 ? 166 LYS C NZ  1 
ATOM   4289 N  N   . ARG C 1 168 ? 25.688  43.695 28.741  1.00 18.07 ? 167 ARG C N   1 
ATOM   4290 C  CA  . ARG C 1 168 ? 25.056  44.930 29.175  1.00 17.31 ? 167 ARG C CA  1 
ATOM   4291 C  C   . ARG C 1 168 ? 25.269  46.132 28.254  1.00 17.86 ? 167 ARG C C   1 
ATOM   4292 O  O   . ARG C 1 168 ? 24.805  47.240 28.566  1.00 14.40 ? 167 ARG C O   1 
ATOM   4293 C  CB  . ARG C 1 168 ? 25.604  45.323 30.529  1.00 19.56 ? 167 ARG C CB  1 
ATOM   4294 C  CG  . ARG C 1 168 ? 25.396  44.336 31.643  1.00 24.52 ? 167 ARG C CG  1 
ATOM   4295 C  CD  . ARG C 1 168 ? 25.889  45.059 32.892  1.00 25.45 ? 167 ARG C CD  1 
ATOM   4296 N  NE  . ARG C 1 168 ? 26.224  44.148 33.936  1.00 34.02 ? 167 ARG C NE  1 
ATOM   4297 C  CZ  . ARG C 1 168 ? 26.637  44.516 35.133  1.00 17.79 ? 167 ARG C CZ  1 
ATOM   4298 N  NH1 . ARG C 1 168 ? 26.751  45.808 35.440  1.00 25.30 ? 167 ARG C NH1 1 
ATOM   4299 N  NH2 . ARG C 1 168 ? 26.908  43.570 36.017  1.00 28.43 ? 167 ARG C NH2 1 
ATOM   4300 N  N   . GLY C 1 169 ? 26.002  45.933 27.162  1.00 16.47 ? 168 GLY C N   1 
ATOM   4301 C  CA  . GLY C 1 169 ? 26.191  46.976 26.163  1.00 18.01 ? 168 GLY C CA  1 
ATOM   4302 C  C   . GLY C 1 169 ? 27.299  47.969 26.445  1.00 15.41 ? 168 GLY C C   1 
ATOM   4303 O  O   . GLY C 1 169 ? 27.488  48.905 25.660  1.00 18.60 ? 168 GLY C O   1 
ATOM   4304 N  N   . ILE C 1 170 ? 28.065  47.751 27.507  1.00 15.23 ? 169 ILE C N   1 
ATOM   4305 C  CA  . ILE C 1 170 ? 29.028  48.759 28.009  1.00 16.09 ? 169 ILE C CA  1 
ATOM   4306 C  C   . ILE C 1 170 ? 30.491  48.583 27.554  1.00 17.40 ? 169 ILE C C   1 
ATOM   4307 O  O   . ILE C 1 170 ? 31.339  49.404 27.902  1.00 14.53 ? 169 ILE C O   1 
ATOM   4308 C  CB  . ILE C 1 170 ? 29.007  48.869 29.560  1.00 16.27 ? 169 ILE C CB  1 
ATOM   4309 C  CG1 . ILE C 1 170 ? 29.624  47.631 30.207  1.00 18.71 ? 169 ILE C CG1 1 
ATOM   4310 C  CG2 . ILE C 1 170 ? 27.587  49.153 30.059  1.00 13.96 ? 169 ILE C CG2 1 
ATOM   4311 C  CD1 . ILE C 1 170 ? 29.838  47.768 31.698  1.00 19.09 ? 169 ILE C CD1 1 
ATOM   4312 N  N   . VAL C 1 171 ? 30.794  47.527 26.798  1.00 15.27 ? 170 VAL C N   1 
ATOM   4313 C  CA  . VAL C 1 171 ? 32.165  47.292 26.338  1.00 16.17 ? 170 VAL C CA  1 
ATOM   4314 C  C   . VAL C 1 171 ? 32.528  48.165 25.117  1.00 16.30 ? 170 VAL C C   1 
ATOM   4315 O  O   . VAL C 1 171 ? 31.771  48.270 24.140  1.00 13.46 ? 170 VAL C O   1 
ATOM   4316 C  CB  . VAL C 1 171 ? 32.399  45.805 26.036  1.00 17.36 ? 170 VAL C CB  1 
ATOM   4317 C  CG1 . VAL C 1 171 ? 33.799  45.561 25.451  1.00 18.43 ? 170 VAL C CG1 1 
ATOM   4318 C  CG2 . VAL C 1 171 ? 32.235  45.030 27.311  1.00 14.48 ? 170 VAL C CG2 1 
ATOM   4319 N  N   . ARG C 1 172 ? 33.691  48.791 25.190  1.00 14.36 ? 171 ARG C N   1 
ATOM   4320 C  CA  . ARG C 1 172 ? 34.247  49.520 24.049  1.00 16.49 ? 171 ARG C CA  1 
ATOM   4321 C  C   . ARG C 1 172 ? 35.658  49.015 23.793  1.00 15.83 ? 171 ARG C C   1 
ATOM   4322 O  O   . ARG C 1 172 ? 36.486  49.049 24.674  1.00 14.04 ? 171 ARG C O   1 
ATOM   4323 C  CB  . ARG C 1 172 ? 34.245  51.028 24.339  1.00 16.91 ? 171 ARG C CB  1 
ATOM   4324 C  CG  . ARG C 1 172 ? 32.879  51.573 24.727  1.00 17.63 ? 171 ARG C CG  1 
ATOM   4325 C  CD  . ARG C 1 172 ? 31.934  51.699 23.557  1.00 17.44 ? 171 ARG C CD  1 
ATOM   4326 N  NE  . ARG C 1 172 ? 30.669  52.316 23.978  1.00 21.19 ? 171 ARG C NE  1 
ATOM   4327 C  CZ  . ARG C 1 172 ? 29.649  51.661 24.542  1.00 20.56 ? 171 ARG C CZ  1 
ATOM   4328 N  NH1 . ARG C 1 172 ? 29.707  50.364 24.720  1.00 20.59 ? 171 ARG C NH1 1 
ATOM   4329 N  NH2 . ARG C 1 172 ? 28.545  52.308 24.894  1.00 19.67 ? 171 ARG C NH2 1 
ATOM   4330 N  N   . LYS C 1 173 ? 35.934  48.560 22.586  1.00 14.51 ? 172 LYS C N   1 
ATOM   4331 C  CA  . LYS C 1 173 ? 37.177  47.830 22.330  1.00 18.54 ? 172 LYS C CA  1 
ATOM   4332 C  C   . LYS C 1 173 ? 38.150  48.678 21.535  1.00 18.83 ? 172 LYS C C   1 
ATOM   4333 O  O   . LYS C 1 173 ? 37.739  49.398 20.598  1.00 18.42 ? 172 LYS C O   1 
ATOM   4334 C  CB  . LYS C 1 173 ? 36.869  46.545 21.578  1.00 18.83 ? 172 LYS C CB  1 
ATOM   4335 C  CG  . LYS C 1 173 ? 38.044  45.556 21.448  1.00 25.35 ? 172 LYS C CG  1 
ATOM   4336 C  CD  . LYS C 1 173 ? 37.634  44.346 20.599  1.00 24.12 ? 172 LYS C CD  1 
ATOM   4337 C  CE  . LYS C 1 173 ? 38.656  43.196 20.599  1.00 29.71 ? 172 LYS C CE  1 
ATOM   4338 N  NZ  . LYS C 1 173 ? 38.108  41.943 19.937  1.00 36.41 ? 172 LYS C NZ  1 
ATOM   4339 N  N   . VAL C 1 174 ? 39.429  48.591 21.903  1.00 19.04 ? 173 VAL C N   1 
ATOM   4340 C  CA  . VAL C 1 174 ? 40.487  49.265 21.165  1.00 19.94 ? 173 VAL C CA  1 
ATOM   4341 C  C   . VAL C 1 174 ? 41.596  48.299 20.794  1.00 20.18 ? 173 VAL C C   1 
ATOM   4342 O  O   . VAL C 1 174 ? 42.048  47.504 21.615  1.00 20.68 ? 173 VAL C O   1 
ATOM   4343 C  CB  . VAL C 1 174 ? 41.087  50.489 21.921  1.00 21.41 ? 173 VAL C CB  1 
ATOM   4344 C  CG1 . VAL C 1 174 ? 39.967  51.464 22.362  1.00 29.78 ? 173 VAL C CG1 1 
ATOM   4345 C  CG2 . VAL C 1 174 ? 41.889  50.070 23.100  1.00 21.84 ? 173 VAL C CG2 1 
ATOM   4346 N  N   . ASN C 1 175 ? 42.015  48.369 19.532  1.00 19.27 ? 174 ASN C N   1 
ATOM   4347 C  CA  . ASN C 1 175 ? 43.184  47.651 19.061  1.00 17.83 ? 174 ASN C CA  1 
ATOM   4348 C  C   . ASN C 1 175 ? 44.415  48.274 19.718  1.00 18.65 ? 174 ASN C C   1 
ATOM   4349 O  O   . ASN C 1 175 ? 44.776  49.410 19.421  1.00 18.39 ? 174 ASN C O   1 
ATOM   4350 C  CB  . ASN C 1 175 ? 43.249  47.754 17.528  1.00 19.56 ? 174 ASN C CB  1 
ATOM   4351 C  CG  . ASN C 1 175 ? 44.398  46.980 16.938  1.00 19.49 ? 174 ASN C CG  1 
ATOM   4352 O  OD1 . ASN C 1 175 ? 45.363  46.666 17.626  1.00 23.91 ? 174 ASN C OD1 1 
ATOM   4353 N  ND2 . ASN C 1 175 ? 44.306  46.667 15.643  1.00 23.23 ? 174 ASN C ND2 1 
ATOM   4354 N  N   . ALA C 1 176 ? 45.049  47.533 20.618  1.00 19.73 ? 175 ALA C N   1 
ATOM   4355 C  CA  . ALA C 1 176 ? 46.147  48.064 21.438  1.00 21.43 ? 175 ALA C CA  1 
ATOM   4356 C  C   . ALA C 1 176 ? 47.529  47.842 20.807  1.00 21.81 ? 175 ALA C C   1 
ATOM   4357 O  O   . ALA C 1 176 ? 48.542  48.122 21.427  1.00 20.64 ? 175 ALA C O   1 
ATOM   4358 C  CB  . ALA C 1 176 ? 46.080  47.491 22.844  1.00 24.34 ? 175 ALA C CB  1 
ATOM   4359 N  N   . GLU C 1 177 ? 47.541  47.385 19.559  1.00 21.99 ? 176 GLU C N   1 
ATOM   4360 C  CA  . GLU C 1 177 ? 48.746  47.266 18.755  1.00 25.69 ? 176 GLU C CA  1 
ATOM   4361 C  C   . GLU C 1 177 ? 48.991  48.624 18.108  1.00 27.06 ? 176 GLU C C   1 
ATOM   4362 O  O   . GLU C 1 177 ? 48.044  49.343 17.786  1.00 31.41 ? 176 GLU C O   1 
ATOM   4363 C  CB  . GLU C 1 177 ? 48.553  46.200 17.659  1.00 27.49 ? 176 GLU C CB  1 
ATOM   4364 C  CG  . GLU C 1 177 ? 47.912  44.875 18.153  1.00 29.55 ? 176 GLU C CG  1 
ATOM   4365 C  CD  . GLU C 1 177 ? 48.912  43.772 18.409  1.00 34.81 ? 176 GLU C CD  1 
ATOM   4366 O  OE1 . GLU C 1 177 ? 49.557  43.314 17.450  1.00 45.43 ? 176 GLU C OE1 1 
ATOM   4367 O  OE2 . GLU C 1 177 ? 49.044  43.338 19.555  1.00 33.28 ? 176 GLU C OE2 1 
ATOM   4368 N  N   . GLY C 1 178 ? 50.253  48.980 17.925  1.00 26.74 ? 177 GLY C N   1 
ATOM   4369 C  CA  . GLY C 1 178 ? 50.594  50.233 17.278  1.00 26.44 ? 177 GLY C CA  1 
ATOM   4370 C  C   . GLY C 1 178 ? 51.099  51.237 18.285  1.00 25.61 ? 177 GLY C C   1 
ATOM   4371 O  O   . GLY C 1 178 ? 51.334  50.905 19.445  1.00 24.37 ? 177 GLY C O   1 
ATOM   4372 N  N   . SER C 1 179 ? 51.268  52.472 17.830  1.00 23.69 ? 178 SER C N   1 
ATOM   4373 C  CA  . SER C 1 179 ? 51.841  53.521 18.665  1.00 21.63 ? 178 SER C CA  1 
ATOM   4374 C  C   . SER C 1 179 ? 50.876  54.004 19.757  1.00 19.25 ? 178 SER C C   1 
ATOM   4375 O  O   . SER C 1 179 ? 49.653  53.850 19.658  1.00 17.52 ? 178 SER C O   1 
ATOM   4376 C  CB  . SER C 1 179 ? 52.271  54.701 17.800  1.00 20.55 ? 178 SER C CB  1 
ATOM   4377 O  OG  . SER C 1 179 ? 51.142  55.382 17.324  1.00 17.36 ? 178 SER C OG  1 
ATOM   4378 N  N   . VAL C 1 180 ? 51.448  54.607 20.789  1.00 17.72 ? 179 VAL C N   1 
ATOM   4379 C  CA  . VAL C 1 180 ? 50.673  55.128 21.918  1.00 18.75 ? 179 VAL C CA  1 
ATOM   4380 C  C   . VAL C 1 180 ? 49.552  56.083 21.445  1.00 18.06 ? 179 VAL C C   1 
ATOM   4381 O  O   . VAL C 1 180 ? 48.418  56.030 21.943  1.00 13.55 ? 179 VAL C O   1 
ATOM   4382 C  CB  . VAL C 1 180 ? 51.594  55.842 22.937  1.00 18.00 ? 179 VAL C CB  1 
ATOM   4383 C  CG1 . VAL C 1 180 ? 50.773  56.623 23.968  1.00 16.74 ? 179 VAL C CG1 1 
ATOM   4384 C  CG2 . VAL C 1 180 ? 52.547  54.840 23.622  1.00 17.66 ? 179 VAL C CG2 1 
ATOM   4385 N  N   . ASP C 1 181 ? 49.872  56.965 20.502  1.00 18.60 ? 180 ASP C N   1 
ATOM   4386 C  CA  . ASP C 1 181 ? 48.912  57.980 20.062  1.00 20.88 ? 180 ASP C CA  1 
ATOM   4387 C  C   . ASP C 1 181 ? 47.877  57.370 19.115  1.00 19.78 ? 180 ASP C C   1 
ATOM   4388 O  O   . ASP C 1 181 ? 46.731  57.827 19.077  1.00 18.41 ? 180 ASP C O   1 
ATOM   4389 C  CB  . ASP C 1 181 ? 49.611  59.195 19.429  1.00 24.61 ? 180 ASP C CB  1 
ATOM   4390 C  CG  . ASP C 1 181 ? 50.314  60.094 20.469  1.00 32.15 ? 180 ASP C CG  1 
ATOM   4391 O  OD1 . ASP C 1 181 ? 50.375  59.741 21.670  1.00 39.80 ? 180 ASP C OD1 1 
ATOM   4392 O  OD2 . ASP C 1 181 ? 50.812  61.168 20.074  1.00 46.06 ? 180 ASP C OD2 1 
ATOM   4393 N  N   . SER C 1 182 ? 48.257  56.325 18.378  1.00 18.39 ? 181 SER C N   1 
ATOM   4394 C  CA  . SER C 1 182 ? 47.282  55.633 17.520  1.00 18.90 ? 181 SER C CA  1 
ATOM   4395 C  C   . SER C 1 182 ? 46.246  54.941 18.396  1.00 17.77 ? 181 SER C C   1 
ATOM   4396 O  O   . SER C 1 182 ? 45.051  54.978 18.106  1.00 15.40 ? 181 SER C O   1 
ATOM   4397 C  CB  . SER C 1 182 ? 47.940  54.641 16.541  1.00 17.53 ? 181 SER C CB  1 
ATOM   4398 O  OG  . SER C 1 182 ? 48.549  53.545 17.200  1.00 21.45 ? 181 SER C OG  1 
ATOM   4399 N  N   . VAL C 1 183 ? 46.718  54.333 19.483  1.00 16.72 ? 182 VAL C N   1 
ATOM   4400 C  CA  . VAL C 1 183 ? 45.825  53.687 20.438  1.00 17.47 ? 182 VAL C CA  1 
ATOM   4401 C  C   . VAL C 1 183 ? 44.935  54.695 21.148  1.00 17.17 ? 182 VAL C C   1 
ATOM   4402 O  O   . VAL C 1 183 ? 43.724  54.470 21.257  1.00 16.99 ? 182 VAL C O   1 
ATOM   4403 C  CB  . VAL C 1 183 ? 46.601  52.864 21.484  1.00 19.05 ? 182 VAL C CB  1 
ATOM   4404 C  CG1 . VAL C 1 183 ? 45.634  52.191 22.467  1.00 19.48 ? 182 VAL C CG1 1 
ATOM   4405 C  CG2 . VAL C 1 183 ? 47.485  51.796 20.794  1.00 20.05 ? 182 VAL C CG2 1 
ATOM   4406 N  N   . PHE C 1 184 ? 45.528  55.796 21.623  1.00 15.69 ? 183 PHE C N   1 
ATOM   4407 C  CA  . PHE C 1 184 ? 44.768  56.852 22.326  1.00 18.04 ? 183 PHE C CA  1 
ATOM   4408 C  C   . PHE C 1 184 ? 43.724  57.517 21.448  1.00 16.67 ? 183 PHE C C   1 
ATOM   4409 O  O   . PHE C 1 184 ? 42.657  57.882 21.943  1.00 17.26 ? 183 PHE C O   1 
ATOM   4410 C  CB  . PHE C 1 184 ? 45.686  57.931 22.944  1.00 18.62 ? 183 PHE C CB  1 
ATOM   4411 C  CG  . PHE C 1 184 ? 44.955  58.911 23.884  1.00 22.22 ? 183 PHE C CG  1 
ATOM   4412 C  CD1 . PHE C 1 184 ? 44.192  58.446 24.964  1.00 20.16 ? 183 PHE C CD1 1 
ATOM   4413 C  CD2 . PHE C 1 184 ? 45.035  60.298 23.675  1.00 21.13 ? 183 PHE C CD2 1 
ATOM   4414 C  CE1 . PHE C 1 184 ? 43.538  59.337 25.808  1.00 22.32 ? 183 PHE C CE1 1 
ATOM   4415 C  CE2 . PHE C 1 184 ? 44.377  61.190 24.511  1.00 15.43 ? 183 PHE C CE2 1 
ATOM   4416 C  CZ  . PHE C 1 184 ? 43.630  60.716 25.581  1.00 18.42 ? 183 PHE C CZ  1 
ATOM   4417 N  N   . SER C 1 185 ? 44.017  57.682 20.151  1.00 18.05 ? 184 SER C N   1 
ATOM   4418 C  CA  . SER C 1 185 ? 43.008  58.164 19.216  1.00 16.57 ? 184 SER C CA  1 
ATOM   4419 C  C   . SER C 1 185 ? 41.701  57.381 19.345  1.00 16.83 ? 184 SER C C   1 
ATOM   4420 O  O   . SER C 1 185 ? 40.627  57.987 19.419  1.00 14.85 ? 184 SER C O   1 
ATOM   4421 C  CB  . SER C 1 185 ? 43.497  58.087 17.768  1.00 19.64 ? 184 SER C CB  1 
ATOM   4422 O  OG  . SER C 1 185 ? 42.533  58.655 16.884  1.00 19.87 ? 184 SER C OG  1 
ATOM   4423 N  N   . GLN C 1 186 ? 41.803  56.047 19.382  1.00 15.17 ? 185 GLN C N   1 
ATOM   4424 C  CA  . GLN C 1 186 ? 40.630  55.167 19.478  1.00 16.08 ? 185 GLN C CA  1 
ATOM   4425 C  C   . GLN C 1 186 ? 39.923  55.328 20.825  1.00 18.36 ? 185 GLN C C   1 
ATOM   4426 O  O   . GLN C 1 186 ? 38.701  55.404 20.898  1.00 19.47 ? 185 GLN C O   1 
ATOM   4427 C  CB  . GLN C 1 186 ? 41.056  53.709 19.337  1.00 17.34 ? 185 GLN C CB  1 
ATOM   4428 C  CG  . GLN C 1 186 ? 41.824  53.368 18.055  1.00 20.73 ? 185 GLN C CG  1 
ATOM   4429 C  CD  . GLN C 1 186 ? 42.278  51.907 18.062  1.00 18.37 ? 185 GLN C CD  1 
ATOM   4430 O  OE1 . GLN C 1 186 ? 41.454  51.003 18.092  1.00 19.38 ? 185 GLN C OE1 1 
ATOM   4431 N  NE2 . GLN C 1 186 ? 43.585  51.687 18.090  1.00 19.94 ? 185 GLN C NE2 1 
ATOM   4432 N  N   . VAL C 1 187 ? 40.714  55.360 21.896  1.00 19.08 ? 186 VAL C N   1 
ATOM   4433 C  CA  . VAL C 1 187 ? 40.211  55.654 23.234  1.00 18.41 ? 186 VAL C CA  1 
ATOM   4434 C  C   . VAL C 1 187 ? 39.420  56.980 23.308  1.00 18.55 ? 186 VAL C C   1 
ATOM   4435 O  O   . VAL C 1 187 ? 38.380  57.033 23.967  1.00 17.38 ? 186 VAL C O   1 
ATOM   4436 C  CB  . VAL C 1 187 ? 41.356  55.707 24.270  1.00 18.49 ? 186 VAL C CB  1 
ATOM   4437 C  CG1 . VAL C 1 187 ? 40.816  56.156 25.649  1.00 21.64 ? 186 VAL C CG1 1 
ATOM   4438 C  CG2 . VAL C 1 187 ? 42.054  54.341 24.339  1.00 13.32 ? 186 VAL C CG2 1 
ATOM   4439 N  N   . CYS C 1 188 ? 39.917  58.036 22.657  1.00 19.05 ? 187 CYS C N   1 
ATOM   4440 C  CA  . CYS C 1 188 ? 39.203  59.313 22.705  1.00 19.36 ? 187 CYS C CA  1 
ATOM   4441 C  C   . CYS C 1 188 ? 37.839  59.209 22.029  1.00 19.80 ? 187 CYS C C   1 
ATOM   4442 O  O   . CYS C 1 188 ? 36.857  59.768 22.514  1.00 22.18 ? 187 CYS C O   1 
ATOM   4443 C  CB  . CYS C 1 188 ? 40.028  60.435 22.093  1.00 22.82 ? 187 CYS C CB  1 
ATOM   4444 S  SG  . CYS C 1 188 ? 41.421  60.900 23.130  1.00 28.76 ? 187 CYS C SG  1 
ATOM   4445 N  N   . THR C 1 189 ? 37.766  58.484 20.923  1.00 18.92 ? 188 THR C N   1 
ATOM   4446 C  CA  . THR C 1 189 ? 36.492  58.323 20.226  1.00 20.01 ? 188 THR C CA  1 
ATOM   4447 C  C   . THR C 1 189 ? 35.430  57.779 21.192  1.00 19.73 ? 188 THR C C   1 
ATOM   4448 O  O   . THR C 1 189 ? 34.327  58.324 21.271  1.00 17.39 ? 188 THR C O   1 
ATOM   4449 C  CB  . THR C 1 189 ? 36.638  57.405 19.003  1.00 18.31 ? 188 THR C CB  1 
ATOM   4450 O  OG1 . THR C 1 189 ? 37.542  58.017 18.066  1.00 19.56 ? 188 THR C OG1 1 
ATOM   4451 C  CG2 . THR C 1 189 ? 35.299  57.168 18.337  1.00 18.44 ? 188 THR C CG2 1 
ATOM   4452 N  N   . HIS C 1 190 ? 35.780  56.746 21.954  1.00 19.38 ? 189 HIS C N   1 
ATOM   4453 C  CA  . HIS C 1 190 ? 34.826  56.145 22.912  1.00 19.44 ? 189 HIS C CA  1 
ATOM   4454 C  C   . HIS C 1 190 ? 34.471  57.057 24.072  1.00 20.40 ? 189 HIS C C   1 
ATOM   4455 O  O   . HIS C 1 190 ? 33.316  57.142 24.494  1.00 19.44 ? 189 HIS C O   1 
ATOM   4456 C  CB  . HIS C 1 190 ? 35.384  54.845 23.494  1.00 21.79 ? 189 HIS C CB  1 
ATOM   4457 C  CG  . HIS C 1 190 ? 35.566  53.765 22.474  1.00 20.68 ? 189 HIS C CG  1 
ATOM   4458 N  ND1 . HIS C 1 190 ? 34.597  53.449 21.543  1.00 16.72 ? 189 HIS C ND1 1 
ATOM   4459 C  CD2 . HIS C 1 190 ? 36.618  52.951 22.217  1.00 16.08 ? 189 HIS C CD2 1 
ATOM   4460 C  CE1 . HIS C 1 190 ? 35.035  52.463 20.780  1.00 22.40 ? 189 HIS C CE1 1 
ATOM   4461 N  NE2 . HIS C 1 190 ? 36.252  52.131 21.180  1.00 15.99 ? 189 HIS C NE2 1 
ATOM   4462 N  N   . LEU C 1 191 ? 35.484  57.691 24.643  1.00 21.63 ? 190 LEU C N   1 
ATOM   4463 C  CA  . LEU C 1 191 ? 35.268  58.543 25.814  1.00 22.73 ? 190 LEU C CA  1 
ATOM   4464 C  C   . LEU C 1 191 ? 34.476  59.810 25.464  1.00 21.41 ? 190 LEU C C   1 
ATOM   4465 O  O   . LEU C 1 191 ? 33.682  60.271 26.265  1.00 22.23 ? 190 LEU C O   1 
ATOM   4466 C  CB  . LEU C 1 191 ? 36.601  58.938 26.432  1.00 21.26 ? 190 LEU C CB  1 
ATOM   4467 C  CG  . LEU C 1 191 ? 37.363  57.898 27.236  1.00 28.22 ? 190 LEU C CG  1 
ATOM   4468 C  CD1 . LEU C 1 191 ? 38.536  58.572 27.899  1.00 28.47 ? 190 LEU C CD1 1 
ATOM   4469 C  CD2 . LEU C 1 191 ? 36.457  57.234 28.273  1.00 29.12 ? 190 LEU C CD2 1 
ATOM   4470 N  N   . ASP C 1 192 ? 34.710  60.370 24.284  1.00 20.84 ? 191 ASP C N   1 
ATOM   4471 C  CA  . ASP C 1 192 ? 33.949  61.546 23.827  1.00 21.38 ? 191 ASP C CA  1 
ATOM   4472 C  C   . ASP C 1 192 ? 32.464  61.208 23.668  1.00 23.48 ? 191 ASP C C   1 
ATOM   4473 O  O   . ASP C 1 192 ? 31.601  62.020 23.974  1.00 24.69 ? 191 ASP C O   1 
ATOM   4474 C  CB  . ASP C 1 192 ? 34.484  62.078 22.488  1.00 21.40 ? 191 ASP C CB  1 
ATOM   4475 C  CG  . ASP C 1 192 ? 35.794  62.831 22.619  1.00 23.30 ? 191 ASP C CG  1 
ATOM   4476 O  OD1 . ASP C 1 192 ? 36.232  63.096 23.758  1.00 34.71 ? 191 ASP C OD1 1 
ATOM   4477 O  OD2 . ASP C 1 192 ? 36.397  63.154 21.565  1.00 31.44 ? 191 ASP C OD2 1 
ATOM   4478 N  N   . ALA C 1 193 ? 32.178  60.001 23.197  1.00 25.21 ? 192 ALA C N   1 
ATOM   4479 C  CA  . ALA C 1 193 ? 30.808  59.552 22.983  1.00 26.35 ? 192 ALA C CA  1 
ATOM   4480 C  C   . ALA C 1 193 ? 30.060  59.415 24.306  1.00 27.86 ? 192 ALA C C   1 
ATOM   4481 O  O   . ALA C 1 193 ? 28.870  59.701 24.390  1.00 27.67 ? 192 ALA C O   1 
ATOM   4482 C  CB  . ALA C 1 193 ? 30.813  58.209 22.235  1.00 26.30 ? 192 ALA C CB  1 
ATOM   4483 N  N   . LEU C 1 194 ? 30.772  58.951 25.324  1.00 29.85 ? 193 LEU C N   1 
ATOM   4484 C  CA  . LEU C 1 194 ? 30.212  58.771 26.658  1.00 32.51 ? 193 LEU C CA  1 
ATOM   4485 C  C   . LEU C 1 194 ? 29.915  60.090 27.371  1.00 33.67 ? 193 LEU C C   1 
ATOM   4486 O  O   . LEU C 1 194 ? 28.924  60.180 28.087  1.00 33.87 ? 193 LEU C O   1 
ATOM   4487 C  CB  . LEU C 1 194 ? 31.151  57.918 27.518  1.00 31.67 ? 193 LEU C CB  1 
ATOM   4488 N  N   . LEU C 1 195 ? 30.741  61.116 27.158  1.00 36.82 ? 194 LEU C N   1 
ATOM   4489 C  CA  . LEU C 1 195 ? 30.706  62.336 27.990  1.00 37.66 ? 194 LEU C CA  1 
ATOM   4490 C  C   . LEU C 1 195 ? 30.029  63.579 27.372  1.00 38.16 ? 194 LEU C C   1 
ATOM   4491 O  O   . LEU C 1 195 ? 29.837  63.686 26.158  1.00 40.37 ? 194 LEU C O   1 
ATOM   4492 C  CB  . LEU C 1 195 ? 32.130  62.687 28.415  1.00 37.24 ? 194 LEU C CB  1 
ATOM   4493 C  CG  . LEU C 1 195 ? 32.850  61.600 29.216  1.00 40.77 ? 194 LEU C CG  1 
ATOM   4494 C  CD1 . LEU C 1 195 ? 34.332  61.946 29.440  1.00 42.81 ? 194 LEU C CD1 1 
ATOM   4495 C  CD2 . LEU C 1 195 ? 32.134  61.352 30.546  1.00 42.20 ? 194 LEU C CD2 1 
HETATM 4496 ZN ZN  . ZN  D 2 .   ? 24.901  47.399 -0.880  1.00 9.77  ? 601 ZN  A ZN  1 
HETATM 4497 ZN ZN  . ZN  E 2 .   ? 22.857  55.395 2.288   1.00 15.35 ? 641 ZN  A ZN  1 
HETATM 4498 S  S   . SO4 F 3 .   ? 0.852   39.352 15.860  1.00 55.11 ? 702 SO4 A S   1 
HETATM 4499 O  O1  . SO4 F 3 .   ? 1.596   38.096 15.892  1.00 62.68 ? 702 SO4 A O1  1 
HETATM 4500 O  O2  . SO4 F 3 .   ? -0.504  39.107 15.369  1.00 59.70 ? 702 SO4 A O2  1 
HETATM 4501 O  O3  . SO4 F 3 .   ? 0.800   39.911 17.214  1.00 61.77 ? 702 SO4 A O3  1 
HETATM 4502 O  O4  . SO4 F 3 .   ? 1.528   40.307 14.986  1.00 60.41 ? 702 SO4 A O4  1 
HETATM 4503 P  PA  . AP5 G 4 .   ? 24.630  43.482 1.537   1.00 8.92  ? 631 AP5 A PA  1 
HETATM 4504 O  O1A . AP5 G 4 .   ? 23.174  43.798 1.456   1.00 12.65 ? 631 AP5 A O1A 1 
HETATM 4505 O  O2A . AP5 G 4 .   ? 25.568  44.496 2.002   1.00 10.83 ? 631 AP5 A O2A 1 
HETATM 4506 O  O3A . AP5 G 4 .   ? 25.264  42.903 0.131   1.00 6.36  ? 631 AP5 A O3A 1 
HETATM 4507 P  PB  . AP5 G 4 .   ? 24.600  42.732 -1.328  1.00 10.99 ? 631 AP5 A PB  1 
HETATM 4508 O  O1B . AP5 G 4 .   ? 24.452  41.252 -1.624  1.00 27.77 ? 631 AP5 A O1B 1 
HETATM 4509 O  O2B . AP5 G 4 .   ? 23.327  43.523 -1.527  1.00 18.61 ? 631 AP5 A O2B 1 
HETATM 4510 O  O3B . AP5 G 4 .   ? 25.727  43.321 -2.244  1.00 17.03 ? 631 AP5 A O3B 1 
HETATM 4511 P  PG  . AP5 G 4 .   ? 26.349  44.806 -2.288  1.00 11.02 ? 631 AP5 A PG  1 
HETATM 4512 O  O1G . AP5 G 4 .   ? 26.014  45.670 -1.118  1.00 13.10 ? 631 AP5 A O1G 1 
HETATM 4513 O  O2G . AP5 G 4 .   ? 27.761  44.441 -2.477  1.00 11.20 ? 631 AP5 A O2G 1 
HETATM 4514 O  O3G . AP5 G 4 .   ? 25.860  45.339 -3.708  1.00 13.70 ? 631 AP5 A O3G 1 
HETATM 4515 P  PD  . AP5 G 4 .   ? 24.855  46.521 -4.111  1.00 10.08 ? 631 AP5 A PD  1 
HETATM 4516 O  O1D . AP5 G 4 .   ? 23.768  45.861 -4.886  1.00 7.50  ? 631 AP5 A O1D 1 
HETATM 4517 O  O2D . AP5 G 4 .   ? 24.590  47.404 -2.905  1.00 8.65  ? 631 AP5 A O2D 1 
HETATM 4518 O  O3D . AP5 G 4 .   ? 25.762  47.275 -5.214  1.00 10.42 ? 631 AP5 A O3D 1 
HETATM 4519 P  PE  . AP5 G 4 .   ? 26.799  48.525 -5.046  1.00 11.33 ? 631 AP5 A PE  1 
HETATM 4520 O  O1E . AP5 G 4 .   ? 27.569  48.448 -3.752  1.00 10.35 ? 631 AP5 A O1E 1 
HETATM 4521 O  O2E . AP5 G 4 .   ? 25.977  49.747 -5.313  1.00 8.45  ? 631 AP5 A O2E 1 
HETATM 4522 O  O5F . AP5 G 4 .   ? 24.723  42.229 2.565   1.00 10.07 ? 631 AP5 A O5F 1 
HETATM 4523 C  C5F . AP5 G 4 .   ? 25.985  41.747 2.963   1.00 7.75  ? 631 AP5 A C5F 1 
HETATM 4524 C  C4F . AP5 G 4 .   ? 25.789  40.424 3.708   1.00 6.88  ? 631 AP5 A C4F 1 
HETATM 4525 O  O4F . AP5 G 4 .   ? 25.161  40.792 4.940   1.00 6.75  ? 631 AP5 A O4F 1 
HETATM 4526 C  C3F . AP5 G 4 .   ? 24.855  39.420 3.071   1.00 7.29  ? 631 AP5 A C3F 1 
HETATM 4527 O  O3F . AP5 G 4 .   ? 25.503  38.551 2.130   1.00 15.11 ? 631 AP5 A O3F 1 
HETATM 4528 C  C2F . AP5 G 4 .   ? 24.368  38.722 4.325   1.00 10.52 ? 631 AP5 A C2F 1 
HETATM 4529 O  O2F . AP5 G 4 .   ? 25.451  37.889 4.755   1.00 9.03  ? 631 AP5 A O2F 1 
HETATM 4530 C  C1F . AP5 G 4 .   ? 24.134  39.862 5.313   1.00 8.84  ? 631 AP5 A C1F 1 
HETATM 4531 N  N9A . AP5 G 4 .   ? 22.763  40.463 5.169   1.00 10.31 ? 631 AP5 A N9A 1 
HETATM 4532 C  C8A . AP5 G 4 .   ? 22.448  41.682 4.671   1.00 9.06  ? 631 AP5 A C8A 1 
HETATM 4533 N  N7A . AP5 G 4 .   ? 21.110  41.825 4.657   1.00 12.15 ? 631 AP5 A N7A 1 
HETATM 4534 C  C5A . AP5 G 4 .   ? 20.589  40.714 5.209   1.00 6.71  ? 631 AP5 A C5A 1 
HETATM 4535 C  C6A . AP5 G 4 .   ? 19.284  40.258 5.467   1.00 11.49 ? 631 AP5 A C6A 1 
HETATM 4536 N  N6A . AP5 G 4 .   ? 18.201  40.969 5.198   1.00 7.09  ? 631 AP5 A N6A 1 
HETATM 4537 N  N1A . AP5 G 4 .   ? 19.083  39.027 5.998   1.00 8.38  ? 631 AP5 A N1A 1 
HETATM 4538 C  C2A . AP5 G 4 .   ? 20.124  38.239 6.323   1.00 8.43  ? 631 AP5 A C2A 1 
HETATM 4539 N  N3A . AP5 G 4 .   ? 21.381  38.612 6.077   1.00 7.64  ? 631 AP5 A N3A 1 
HETATM 4540 C  C4A . AP5 G 4 .   ? 21.636  39.860 5.522   1.00 8.03  ? 631 AP5 A C4A 1 
HETATM 4541 O  O5J . AP5 G 4 .   ? 27.676  48.323 -6.360  1.00 10.17 ? 631 AP5 A O5J 1 
HETATM 4542 C  C5J . AP5 G 4 .   ? 28.712  47.276 -6.413  1.00 7.95  ? 631 AP5 A C5J 1 
HETATM 4543 C  C4J . AP5 G 4 .   ? 29.931  47.711 -7.195  1.00 6.76  ? 631 AP5 A C4J 1 
HETATM 4544 O  O4J . AP5 G 4 .   ? 29.516  47.962 -8.526  1.00 11.53 ? 631 AP5 A O4J 1 
HETATM 4545 C  C3J . AP5 G 4 .   ? 30.480  49.031 -6.679  1.00 12.62 ? 631 AP5 A C3J 1 
HETATM 4546 O  O3J . AP5 G 4 .   ? 31.888  49.019 -6.776  1.00 12.33 ? 631 AP5 A O3J 1 
HETATM 4547 C  C2J . AP5 G 4 .   ? 29.851  50.082 -7.568  1.00 15.44 ? 631 AP5 A C2J 1 
HETATM 4548 O  O2J . AP5 G 4 .   ? 30.639  51.253 -7.704  1.00 12.29 ? 631 AP5 A O2J 1 
HETATM 4549 C  C1J . AP5 G 4 .   ? 29.731  49.350 -8.880  1.00 9.57  ? 631 AP5 A C1J 1 
HETATM 4550 N  N9B . AP5 G 4 .   ? 28.602  49.782 -9.734  1.00 12.95 ? 631 AP5 A N9B 1 
HETATM 4551 C  C8B . AP5 G 4 .   ? 27.339  50.102 -9.372  1.00 12.26 ? 631 AP5 A C8B 1 
HETATM 4552 N  N7B . AP5 G 4 .   ? 26.617  50.379 -10.484 1.00 15.56 ? 631 AP5 A N7B 1 
HETATM 4553 C  C5B . AP5 G 4 .   ? 27.431  50.249 -11.547 1.00 13.22 ? 631 AP5 A C5B 1 
HETATM 4554 C  C6B . AP5 G 4 .   ? 27.264  50.410 -12.929 1.00 18.48 ? 631 AP5 A C6B 1 
HETATM 4555 N  N6B . AP5 G 4 .   ? 26.082  50.790 -13.479 1.00 16.36 ? 631 AP5 A N6B 1 
HETATM 4556 N  N1B . AP5 G 4 .   ? 28.311  50.176 -13.739 1.00 15.96 ? 631 AP5 A N1B 1 
HETATM 4557 C  C2B . AP5 G 4 .   ? 29.499  49.804 -13.235 1.00 20.06 ? 631 AP5 A C2B 1 
HETATM 4558 N  N3B . AP5 G 4 .   ? 29.692  49.652 -11.911 1.00 14.39 ? 631 AP5 A N3B 1 
HETATM 4559 C  C4B . AP5 G 4 .   ? 28.669  49.858 -11.059 1.00 12.64 ? 631 AP5 A C4B 1 
HETATM 4560 ZN ZN  . ZN  H 2 .   ? -0.148  48.449 36.972  1.00 13.87 ? 611 ZN  B ZN  1 
HETATM 4561 ZN ZN  . ZN  I 2 .   ? 14.774  40.279 19.374  1.00 18.45 ? 642 ZN  B ZN  1 
HETATM 4562 ZN ZN  . ZN  J 2 .   ? 1.217   56.447 34.356  1.00 20.47 ? 643 ZN  B ZN  1 
HETATM 4563 S  S   . SO4 K 3 .   ? 7.852   63.301 28.575  1.00 68.88 ? 701 SO4 B S   1 
HETATM 4564 O  O1  . SO4 K 3 .   ? 8.714   63.947 27.580  1.00 65.17 ? 701 SO4 B O1  1 
HETATM 4565 O  O2  . SO4 K 3 .   ? 6.445   63.360 28.175  1.00 69.59 ? 701 SO4 B O2  1 
HETATM 4566 O  O3  . SO4 K 3 .   ? 8.245   61.901 28.719  1.00 72.08 ? 701 SO4 B O3  1 
HETATM 4567 O  O4  . SO4 K 3 .   ? 8.012   63.992 29.856  1.00 77.14 ? 701 SO4 B O4  1 
HETATM 4568 S  S   . SO4 L 3 .   ? 19.903  57.571 14.343  1.00 78.39 ? 703 SO4 B S   1 
HETATM 4569 O  O1  . SO4 L 3 .   ? 20.097  56.131 14.141  1.00 79.73 ? 703 SO4 B O1  1 
HETATM 4570 O  O2  . SO4 L 3 .   ? 19.794  57.850 15.773  1.00 76.07 ? 703 SO4 B O2  1 
HETATM 4571 O  O3  . SO4 L 3 .   ? 21.009  58.337 13.761  1.00 80.99 ? 703 SO4 B O3  1 
HETATM 4572 O  O4  . SO4 L 3 .   ? 18.661  57.981 13.701  1.00 86.16 ? 703 SO4 B O4  1 
HETATM 4573 P  PA  . AP5 M 4 .   ? 0.193   44.681 34.321  1.00 17.06 ? 632 AP5 B PA  1 
HETATM 4574 O  O1A . AP5 M 4 .   ? 1.598   45.221 34.438  1.00 18.27 ? 632 AP5 B O1A 1 
HETATM 4575 O  O2A . AP5 M 4 .   ? -0.796  45.734 33.984  1.00 14.44 ? 632 AP5 B O2A 1 
HETATM 4576 O  O3A . AP5 M 4 .   ? -0.335  44.010 35.670  1.00 12.58 ? 632 AP5 B O3A 1 
HETATM 4577 P  PB  . AP5 M 4 .   ? 0.398   43.841 37.095  1.00 16.47 ? 632 AP5 B PB  1 
HETATM 4578 O  O1B . AP5 M 4 .   ? 0.453   42.365 37.354  1.00 18.84 ? 632 AP5 B O1B 1 
HETATM 4579 O  O2B . AP5 M 4 .   ? 1.601   44.707 37.196  1.00 24.41 ? 632 AP5 B O2B 1 
HETATM 4580 O  O3B . AP5 M 4 .   ? -0.742  44.330 38.094  1.00 14.15 ? 632 AP5 B O3B 1 
HETATM 4581 P  PG  . AP5 M 4 .   ? -1.518  45.687 38.197  1.00 14.41 ? 632 AP5 B PG  1 
HETATM 4582 O  O1G . AP5 M 4 .   ? -0.997  46.671 37.136  1.00 10.92 ? 632 AP5 B O1G 1 
HETATM 4583 O  O2G . AP5 M 4 .   ? -2.915  45.265 38.378  1.00 18.12 ? 632 AP5 B O2G 1 
HETATM 4584 O  O3G . AP5 M 4 .   ? -0.928  46.088 39.675  1.00 13.64 ? 632 AP5 B O3G 1 
HETATM 4585 P  PD  . AP5 M 4 .   ? 0.055   47.296 40.132  1.00 17.09 ? 632 AP5 B PD  1 
HETATM 4586 O  O1D . AP5 M 4 .   ? 1.178   46.549 40.785  1.00 19.47 ? 632 AP5 B O1D 1 
HETATM 4587 O  O2D . AP5 M 4 .   ? 0.246   48.353 39.093  1.00 12.29 ? 632 AP5 B O2D 1 
HETATM 4588 O  O3D . AP5 M 4 .   ? -0.822  47.963 41.337  1.00 19.73 ? 632 AP5 B O3D 1 
HETATM 4589 P  PE  . AP5 M 4 .   ? -1.854  49.191 41.233  1.00 18.20 ? 632 AP5 B PE  1 
HETATM 4590 O  O1E . AP5 M 4 .   ? -2.684  49.037 39.950  1.00 16.59 ? 632 AP5 B O1E 1 
HETATM 4591 O  O2E . AP5 M 4 .   ? -1.077  50.456 41.429  1.00 23.00 ? 632 AP5 B O2E 1 
HETATM 4592 O  O5F . AP5 M 4 .   ? 0.200   43.428 33.308  1.00 15.46 ? 632 AP5 B O5F 1 
HETATM 4593 C  C5F . AP5 M 4 .   ? -1.050  42.931 32.807  1.00 17.53 ? 632 AP5 B C5F 1 
HETATM 4594 C  C4F . AP5 M 4 .   ? -0.780  41.754 31.885  1.00 13.61 ? 632 AP5 B C4F 1 
HETATM 4595 O  O4F . AP5 M 4 .   ? -0.146  42.184 30.667  1.00 11.50 ? 632 AP5 B O4F 1 
HETATM 4596 C  C3F . AP5 M 4 .   ? 0.195   40.728 32.453  1.00 13.65 ? 632 AP5 B C3F 1 
HETATM 4597 O  O3F . AP5 M 4 .   ? -0.421  39.888 33.440  1.00 11.87 ? 632 AP5 B O3F 1 
HETATM 4598 C  C2F . AP5 M 4 .   ? 0.668   40.055 31.181  1.00 17.43 ? 632 AP5 B C2F 1 
HETATM 4599 O  O2F . AP5 M 4 .   ? -0.298  39.117 30.657  1.00 15.72 ? 632 AP5 B O2F 1 
HETATM 4600 C  C1F . AP5 M 4 .   ? 0.858   41.254 30.269  1.00 13.63 ? 632 AP5 B C1F 1 
HETATM 4601 N  N9A . AP5 M 4 .   ? 2.212   41.888 30.438  1.00 10.78 ? 632 AP5 B N9A 1 
HETATM 4602 C  C8A . AP5 M 4 .   ? 2.518   43.080 31.000  1.00 11.38 ? 632 AP5 B C8A 1 
HETATM 4603 N  N7A . AP5 M 4 .   ? 3.860   43.318 30.883  1.00 10.68 ? 632 AP5 B N7A 1 
HETATM 4604 C  C5A . AP5 M 4 .   ? 4.392   42.220 30.264  1.00 9.32  ? 632 AP5 B C5A 1 
HETATM 4605 C  C6A . AP5 M 4 .   ? 5.686   41.846 29.881  1.00 14.83 ? 632 AP5 B C6A 1 
HETATM 4606 N  N6A . AP5 M 4 .   ? 6.743   42.630 30.183  1.00 13.72 ? 632 AP5 B N6A 1 
HETATM 4607 N  N1A . AP5 M 4 .   ? 5.883   40.670 29.233  1.00 16.17 ? 632 AP5 B N1A 1 
HETATM 4608 C  C2A . AP5 M 4 .   ? 4.837   39.879 28.945  1.00 13.95 ? 632 AP5 B C2A 1 
HETATM 4609 N  N3A . AP5 M 4 .   ? 3.578   40.188 29.288  1.00 13.79 ? 632 AP5 B N3A 1 
HETATM 4610 C  C4A . AP5 M 4 .   ? 3.346   41.358 29.962  1.00 10.36 ? 632 AP5 B C4A 1 
HETATM 4611 O  O5J . AP5 M 4 .   ? -2.847  48.955 42.461  1.00 15.48 ? 632 AP5 B O5J 1 
HETATM 4612 C  C5J . AP5 M 4 .   ? -3.714  47.802 42.600  1.00 20.34 ? 632 AP5 B C5J 1 
HETATM 4613 C  C4J . AP5 M 4 .   ? -4.989  48.185 43.366  1.00 20.98 ? 632 AP5 B C4J 1 
HETATM 4614 O  O4J . AP5 M 4 .   ? -4.707  48.429 44.760  1.00 23.51 ? 632 AP5 B O4J 1 
HETATM 4615 C  C3J . AP5 M 4 .   ? -5.539  49.497 42.834  1.00 22.09 ? 632 AP5 B C3J 1 
HETATM 4616 O  O3J . AP5 M 4 .   ? -6.958  49.448 42.883  1.00 29.40 ? 632 AP5 B O3J 1 
HETATM 4617 C  C2J . AP5 M 4 .   ? -4.955  50.558 43.747  1.00 24.86 ? 632 AP5 B C2J 1 
HETATM 4618 O  O2J . AP5 M 4 .   ? -5.735  51.756 43.871  1.00 22.54 ? 632 AP5 B O2J 1 
HETATM 4619 C  C1J . AP5 M 4 .   ? -4.832  49.847 45.063  1.00 22.75 ? 632 AP5 B C1J 1 
HETATM 4620 N  N9B . AP5 M 4 .   ? -3.683  50.285 45.895  1.00 23.11 ? 632 AP5 B N9B 1 
HETATM 4621 C  C8B . AP5 M 4 .   ? -2.449  50.650 45.500  1.00 31.03 ? 632 AP5 B C8B 1 
HETATM 4622 N  N7B . AP5 M 4 .   ? -1.678  50.932 46.578  1.00 26.92 ? 632 AP5 B N7B 1 
HETATM 4623 C  C5B . AP5 M 4 .   ? -2.447  50.718 47.675  1.00 31.95 ? 632 AP5 B C5B 1 
HETATM 4624 C  C6B . AP5 M 4 .   ? -2.228  50.828 49.049  1.00 27.91 ? 632 AP5 B C6B 1 
HETATM 4625 N  N6B . AP5 M 4 .   ? -1.035  51.237 49.558  1.00 28.20 ? 632 AP5 B N6B 1 
HETATM 4626 N  N1B . AP5 M 4 .   ? -3.238  50.541 49.897  1.00 24.35 ? 632 AP5 B N1B 1 
HETATM 4627 C  C2B . AP5 M 4 .   ? -4.441  50.156 49.451  1.00 30.49 ? 632 AP5 B C2B 1 
HETATM 4628 N  N3B . AP5 M 4 .   ? -4.677  50.041 48.135  1.00 29.83 ? 632 AP5 B N3B 1 
HETATM 4629 C  C4B . AP5 M 4 .   ? -3.701  50.314 47.232  1.00 29.66 ? 632 AP5 B C4B 1 
HETATM 4630 ZN ZN  . ZN  N 2 .   ? 49.696  48.497 34.667  1.00 12.96 ? 621 ZN  C ZN  1 
HETATM 4631 ZN ZN  . ZN  O 2 .   ? 48.115  56.616 37.229  1.00 19.22 ? 644 ZN  C ZN  1 
HETATM 4632 ZN ZN  . ZN  P 2 .   ? 37.075  43.514 53.804  0.50 15.49 ? 645 ZN  C ZN  1 
HETATM 4633 P  PA  . AP5 Q 4 .   ? 49.239  44.773 37.230  1.00 15.16 ? 633 AP5 C PA  1 
HETATM 4634 O  O1A . AP5 Q 4 .   ? 47.818  45.245 37.020  1.00 17.60 ? 633 AP5 C O1A 1 
HETATM 4635 O  O2A . AP5 Q 4 .   ? 50.243  45.768 37.649  1.00 14.08 ? 633 AP5 C O2A 1 
HETATM 4636 O  O3A . AP5 Q 4 .   ? 49.907  44.063 35.928  1.00 16.73 ? 633 AP5 C O3A 1 
HETATM 4637 P  PB  . AP5 Q 4 .   ? 49.237  43.804 34.488  1.00 17.21 ? 633 AP5 C PB  1 
HETATM 4638 O  O1B . AP5 Q 4 .   ? 49.204  42.307 34.245  1.00 23.75 ? 633 AP5 C O1B 1 
HETATM 4639 O  O2B . AP5 Q 4 .   ? 47.954  44.521 34.356  1.00 24.21 ? 633 AP5 C O2B 1 
HETATM 4640 O  O3B . AP5 Q 4 .   ? 50.333  44.367 33.490  1.00 14.60 ? 633 AP5 C O3B 1 
HETATM 4641 P  PG  . AP5 Q 4 .   ? 51.133  45.727 33.494  1.00 13.20 ? 633 AP5 C PG  1 
HETATM 4642 O  O1G . AP5 Q 4 .   ? 50.601  46.632 34.549  1.00 11.56 ? 633 AP5 C O1G 1 
HETATM 4643 O  O2G . AP5 Q 4 .   ? 52.524  45.211 33.489  1.00 17.43 ? 633 AP5 C O2G 1 
HETATM 4644 O  O3G . AP5 Q 4 .   ? 50.691  46.248 32.030  1.00 17.56 ? 633 AP5 C O3G 1 
HETATM 4645 P  PD  . AP5 Q 4 .   ? 49.766  47.453 31.511  1.00 17.57 ? 633 AP5 C PD  1 
HETATM 4646 O  O1D . AP5 Q 4 .   ? 48.643  46.846 30.763  1.00 15.18 ? 633 AP5 C O1D 1 
HETATM 4647 O  O2D . AP5 Q 4 .   ? 49.389  48.448 32.562  1.00 10.24 ? 633 AP5 C O2D 1 
HETATM 4648 O  O3D . AP5 Q 4 .   ? 50.719  48.092 30.375  1.00 18.81 ? 633 AP5 C O3D 1 
HETATM 4649 P  PE  . AP5 Q 4 .   ? 51.722  49.345 30.546  1.00 15.97 ? 633 AP5 C PE  1 
HETATM 4650 O  O1E . AP5 Q 4 .   ? 52.418  49.107 31.859  1.00 11.75 ? 633 AP5 C O1E 1 
HETATM 4651 O  O2E . AP5 Q 4 .   ? 51.031  50.669 30.383  1.00 16.93 ? 633 AP5 C O2E 1 
HETATM 4652 O  O5F . AP5 Q 4 .   ? 49.177  43.517 38.253  1.00 10.21 ? 633 AP5 C O5F 1 
HETATM 4653 C  C5F . AP5 Q 4 .   ? 50.406  43.053 38.780  1.00 14.37 ? 633 AP5 C C5F 1 
HETATM 4654 C  C4F . AP5 Q 4 .   ? 50.110  41.823 39.619  1.00 15.11 ? 633 AP5 C C4F 1 
HETATM 4655 O  O4F . AP5 Q 4 .   ? 49.459  42.227 40.832  1.00 14.70 ? 633 AP5 C O4F 1 
HETATM 4656 C  C3F . AP5 Q 4 .   ? 49.176  40.806 38.985  1.00 15.38 ? 633 AP5 C C3F 1 
HETATM 4657 O  O3F . AP5 Q 4 .   ? 49.872  39.856 38.177  1.00 15.63 ? 633 AP5 C O3F 1 
HETATM 4658 C  C2F . AP5 Q 4 .   ? 48.545  40.189 40.218  1.00 15.78 ? 633 AP5 C C2F 1 
HETATM 4659 O  O2F . AP5 Q 4 .   ? 49.412  39.235 40.832  1.00 14.41 ? 633 AP5 C O2F 1 
HETATM 4660 C  C1F . AP5 Q 4 .   ? 48.394  41.339 41.193  1.00 10.55 ? 633 AP5 C C1F 1 
HETATM 4661 N  N9A . AP5 Q 4 .   ? 47.047  41.929 40.993  1.00 9.04  ? 633 AP5 C N9A 1 
HETATM 4662 C  C8A . AP5 Q 4 .   ? 46.798  43.103 40.423  1.00 8.74  ? 633 AP5 C C8A 1 
HETATM 4663 N  N7A . AP5 Q 4 .   ? 45.470  43.327 40.387  1.00 10.31 ? 633 AP5 C N7A 1 
HETATM 4664 C  C5A . AP5 Q 4 .   ? 44.853  42.255 40.929  1.00 10.77 ? 633 AP5 C C5A 1 
HETATM 4665 C  C6A . AP5 Q 4 .   ? 43.502  41.902 41.130  1.00 10.46 ? 633 AP5 C C6A 1 
HETATM 4666 N  N6A . AP5 Q 4 .   ? 42.504  42.719 40.786  1.00 10.65 ? 633 AP5 C N6A 1 
HETATM 4667 N  N1A . AP5 Q 4 .   ? 43.210  40.743 41.717  1.00 9.39  ? 633 AP5 C N1A 1 
HETATM 4668 C  C2A . AP5 Q 4 .   ? 44.200  39.929 42.082  1.00 9.86  ? 633 AP5 C C2A 1 
HETATM 4669 N  N3A . AP5 Q 4 .   ? 45.497  40.216 41.882  1.00 14.39 ? 633 AP5 C N3A 1 
HETATM 4670 C  C4A . AP5 Q 4 .   ? 45.853  41.373 41.304  1.00 9.38  ? 633 AP5 C C4A 1 
HETATM 4671 O  O5J . AP5 Q 4 .   ? 52.732  49.119 29.302  1.00 14.17 ? 633 AP5 C O5J 1 
HETATM 4672 C  C5J . AP5 Q 4 .   ? 53.644  48.002 29.195  1.00 21.19 ? 633 AP5 C C5J 1 
HETATM 4673 C  C4J . AP5 Q 4 .   ? 54.973  48.463 28.574  1.00 18.66 ? 633 AP5 C C4J 1 
HETATM 4674 O  O4J . AP5 Q 4 .   ? 54.790  48.855 27.208  1.00 16.55 ? 633 AP5 C O4J 1 
HETATM 4675 C  C3J . AP5 Q 4 .   ? 55.547  49.688 29.227  1.00 18.98 ? 633 AP5 C C3J 1 
HETATM 4676 O  O3J . AP5 Q 4 .   ? 56.971  49.522 29.210  1.00 24.45 ? 633 AP5 C O3J 1 
HETATM 4677 C  C2J . AP5 Q 4 .   ? 55.064  50.851 28.348  1.00 19.09 ? 633 AP5 C C2J 1 
HETATM 4678 O  O2J . AP5 Q 4 .   ? 55.926  51.970 28.344  1.00 23.80 ? 633 AP5 C O2J 1 
HETATM 4679 C  C1J . AP5 Q 4 .   ? 55.059  50.241 26.958  1.00 19.49 ? 633 AP5 C C1J 1 
HETATM 4680 N  N9B . AP5 Q 4 .   ? 53.994  50.603 26.009  1.00 17.73 ? 633 AP5 C N9B 1 
HETATM 4681 C  C8B . AP5 Q 4 .   ? 52.720  50.946 26.312  1.00 20.22 ? 633 AP5 C C8B 1 
HETATM 4682 N  N7B . AP5 Q 4 .   ? 52.036  51.115 25.166  1.00 23.84 ? 633 AP5 C N7B 1 
HETATM 4683 C  C5B . AP5 Q 4 .   ? 52.878  50.891 24.137  1.00 20.02 ? 633 AP5 C C5B 1 
HETATM 4684 C  C6B . AP5 Q 4 .   ? 52.726  50.919 22.749  1.00 18.78 ? 633 AP5 C C6B 1 
HETATM 4685 N  N6B . AP5 Q 4 .   ? 51.549  51.227 22.220  1.00 21.37 ? 633 AP5 C N6B 1 
HETATM 4686 N  N1B . AP5 Q 4 .   ? 53.780  50.627 21.939  1.00 20.46 ? 633 AP5 C N1B 1 
HETATM 4687 C  C2B . AP5 Q 4 .   ? 54.986  50.308 22.483  1.00 20.18 ? 633 AP5 C C2B 1 
HETATM 4688 N  N3B . AP5 Q 4 .   ? 55.149  50.239 23.831  1.00 19.72 ? 633 AP5 C N3B 1 
HETATM 4689 C  C4B . AP5 Q 4 .   ? 54.108  50.536 24.673  1.00 18.40 ? 633 AP5 C C4B 1 
HETATM 4690 O  O   . HOH R 5 .   ? 26.659  48.531 -1.284  1.00 9.91  ? 703 HOH A O   1 
HETATM 4691 O  O   . HOH R 5 .   ? 25.310  47.181 1.247   1.00 6.53  ? 704 HOH A O   1 
HETATM 4692 O  O   . HOH R 5 .   ? 23.038  48.976 -11.535 1.00 17.77 ? 705 HOH A O   1 
HETATM 4693 O  O   . HOH R 5 .   ? 0.385   47.638 7.227   1.00 16.77 ? 706 HOH A O   1 
HETATM 4694 O  O   . HOH R 5 .   ? 28.122  38.316 2.256   1.00 10.93 ? 707 HOH A O   1 
HETATM 4695 O  O   . HOH R 5 .   ? 19.873  41.536 -9.787  1.00 9.73  ? 708 HOH A O   1 
HETATM 4696 O  O   . HOH R 5 .   ? 21.226  41.788 1.246   1.00 14.43 ? 709 HOH A O   1 
HETATM 4697 O  O   . HOH R 5 .   ? 25.242  39.049 -0.583  1.00 11.05 ? 710 HOH A O   1 
HETATM 4698 O  O   . HOH R 5 .   ? 14.631  44.922 -0.214  1.00 16.84 ? 711 HOH A O   1 
HETATM 4699 O  O   . HOH R 5 .   ? 18.048  42.233 -2.485  1.00 14.18 ? 712 HOH A O   1 
HETATM 4700 O  O   . HOH R 5 .   ? 30.720  34.191 -9.464  1.00 21.51 ? 713 HOH A O   1 
HETATM 4701 O  O   . HOH R 5 .   ? 33.373  32.392 8.161   1.00 13.42 ? 714 HOH A O   1 
HETATM 4702 O  O   . HOH R 5 .   ? 33.420  43.882 5.384   1.00 17.35 ? 715 HOH A O   1 
HETATM 4703 O  O   . HOH R 5 .   ? 16.725  38.393 -10.075 1.00 15.34 ? 716 HOH A O   1 
HETATM 4704 O  O   . HOH R 5 .   ? 11.793  47.977 17.570  1.00 18.34 ? 717 HOH A O   1 
HETATM 4705 O  O   . HOH R 5 .   ? 29.028  42.250 4.191   1.00 16.77 ? 718 HOH A O   1 
HETATM 4706 O  O   . HOH R 5 .   ? 20.455  62.324 -7.826  1.00 16.59 ? 719 HOH A O   1 
HETATM 4707 O  O   . HOH R 5 .   ? 23.920  51.365 -11.024 1.00 16.31 ? 720 HOH A O   1 
HETATM 4708 O  O   . HOH R 5 .   ? 6.197   58.928 2.898   1.00 20.67 ? 721 HOH A O   1 
HETATM 4709 O  O   . HOH R 5 .   ? 19.467  49.416 14.813  1.00 12.61 ? 722 HOH A O   1 
HETATM 4710 O  O   . HOH R 5 .   ? 21.903  45.656 2.500   1.00 11.15 ? 723 HOH A O   1 
HETATM 4711 O  O   . HOH R 5 .   ? -2.457  45.450 0.138   1.00 18.26 ? 724 HOH A O   1 
HETATM 4712 O  O   . HOH R 5 .   ? 33.106  47.730 -8.950  1.00 12.62 ? 725 HOH A O   1 
HETATM 4713 O  O   . HOH R 5 .   ? 19.665  42.910 16.450  1.00 16.48 ? 726 HOH A O   1 
HETATM 4714 O  O   . HOH R 5 .   ? 10.986  32.105 3.527   1.00 18.71 ? 727 HOH A O   1 
HETATM 4715 O  O   . HOH R 5 .   ? 11.688  59.096 14.726  1.00 17.90 ? 728 HOH A O   1 
HETATM 4716 O  O   . HOH R 5 .   ? 21.917  51.883 6.674   1.00 17.11 ? 729 HOH A O   1 
HETATM 4717 O  O   . HOH R 5 .   ? 24.978  51.047 1.125   1.00 13.53 ? 730 HOH A O   1 
HETATM 4718 O  O   . HOH R 5 .   ? 12.102  32.831 0.100   1.00 11.36 ? 731 HOH A O   1 
HETATM 4719 O  O   . HOH R 5 .   ? 32.949  26.552 2.758   1.00 24.83 ? 732 HOH A O   1 
HETATM 4720 O  O   . HOH R 5 .   ? 25.676  56.824 -6.256  1.00 13.36 ? 733 HOH A O   1 
HETATM 4721 O  O   . HOH R 5 .   ? 23.168  60.370 -0.870  1.00 13.21 ? 734 HOH A O   1 
HETATM 4722 O  O   . HOH R 5 .   ? 3.979   44.032 -9.941  1.00 18.48 ? 735 HOH A O   1 
HETATM 4723 O  O   . HOH R 5 .   ? 1.272   51.027 -3.528  1.00 18.82 ? 736 HOH A O   1 
HETATM 4724 O  O   . HOH R 5 .   ? 35.563  33.991 8.488   1.00 17.86 ? 737 HOH A O   1 
HETATM 4725 O  O   . HOH R 5 .   ? 23.687  36.701 1.271   1.00 19.54 ? 738 HOH A O   1 
HETATM 4726 O  O   . HOH R 5 .   ? 0.238   50.967 1.537   1.00 19.19 ? 739 HOH A O   1 
HETATM 4727 O  O   . HOH R 5 .   ? 32.092  29.113 -3.344  1.00 19.83 ? 740 HOH A O   1 
HETATM 4728 O  O   . HOH R 5 .   ? 16.109  42.598 -0.568  1.00 14.39 ? 741 HOH A O   1 
HETATM 4729 O  O   . HOH R 5 .   ? 20.711  37.749 -12.329 1.00 18.35 ? 742 HOH A O   1 
HETATM 4730 O  O   . HOH R 5 .   ? 2.692   39.029 4.432   1.00 25.06 ? 743 HOH A O   1 
HETATM 4731 O  O   . HOH R 5 .   ? 3.121   52.589 4.541   1.00 22.25 ? 744 HOH A O   1 
HETATM 4732 O  O   . HOH R 5 .   ? 5.700   53.409 -11.466 1.00 21.24 ? 745 HOH A O   1 
HETATM 4733 O  O   . HOH R 5 .   ? 3.026   51.014 2.426   1.00 21.07 ? 746 HOH A O   1 
HETATM 4734 O  O   . HOH R 5 .   ? 24.105  48.023 13.923  1.00 23.45 ? 747 HOH A O   1 
HETATM 4735 O  O   . HOH R 5 .   ? -2.736  38.830 -7.361  1.00 17.02 ? 748 HOH A O   1 
HETATM 4736 O  O   . HOH R 5 .   ? 27.129  31.133 -8.033  1.00 20.12 ? 749 HOH A O   1 
HETATM 4737 O  O   . HOH R 5 .   ? 20.634  50.343 -18.026 1.00 26.30 ? 750 HOH A O   1 
HETATM 4738 O  O   . HOH R 5 .   ? 13.692  61.452 4.608   1.00 17.51 ? 751 HOH A O   1 
HETATM 4739 O  O   . HOH R 5 .   ? 2.773   50.241 5.628   1.00 23.72 ? 752 HOH A O   1 
HETATM 4740 O  O   . HOH R 5 .   ? 28.888  32.369 13.208  1.00 22.33 ? 753 HOH A O   1 
HETATM 4741 O  O   . HOH R 5 .   ? 36.041  35.879 10.279  1.00 26.98 ? 754 HOH A O   1 
HETATM 4742 O  O   . HOH R 5 .   ? 29.652  53.229 -9.587  1.00 20.83 ? 755 HOH A O   1 
HETATM 4743 O  O   . HOH R 5 .   ? 10.549  38.941 14.345  1.00 20.50 ? 756 HOH A O   1 
HETATM 4744 O  O   . HOH R 5 .   ? 21.750  31.390 4.056   1.00 21.63 ? 757 HOH A O   1 
HETATM 4745 O  O   . HOH R 5 .   ? 0.698   41.032 -11.474 1.00 33.83 ? 758 HOH A O   1 
HETATM 4746 O  O   . HOH R 5 .   ? 33.088  34.412 -8.272  1.00 23.40 ? 759 HOH A O   1 
HETATM 4747 O  O   . HOH R 5 .   ? 22.461  42.318 16.983  1.00 29.20 ? 760 HOH A O   1 
HETATM 4748 O  O   . HOH R 5 .   ? 38.086  38.186 7.938   1.00 19.92 ? 761 HOH A O   1 
HETATM 4749 O  O   . HOH R 5 .   ? 17.788  61.323 3.647   1.00 32.62 ? 762 HOH A O   1 
HETATM 4750 O  O   . HOH R 5 .   ? 5.092   55.021 20.338  1.00 17.87 ? 763 HOH A O   1 
HETATM 4751 O  O   . HOH R 5 .   ? 20.934  29.006 -6.016  1.00 20.35 ? 764 HOH A O   1 
HETATM 4752 O  O   . HOH R 5 .   ? 5.023   34.054 -5.164  1.00 32.29 ? 765 HOH A O   1 
HETATM 4753 O  O   . HOH R 5 .   ? 8.482   47.093 -14.425 1.00 23.33 ? 766 HOH A O   1 
HETATM 4754 O  O   . HOH R 5 .   ? 16.300  32.972 10.662  1.00 32.59 ? 767 HOH A O   1 
HETATM 4755 O  O   . HOH R 5 .   ? 33.265  43.591 8.096   1.00 26.61 ? 768 HOH A O   1 
HETATM 4756 O  O   . HOH R 5 .   ? 16.863  35.264 7.969   1.00 23.22 ? 769 HOH A O   1 
HETATM 4757 O  O   . HOH R 5 .   ? 28.614  49.823 8.055   1.00 23.30 ? 770 HOH A O   1 
HETATM 4758 O  O   . HOH R 5 .   ? -1.200  55.103 10.793  1.00 19.75 ? 771 HOH A O   1 
HETATM 4759 O  O   . HOH R 5 .   ? 4.216   36.226 -9.239  1.00 20.79 ? 772 HOH A O   1 
HETATM 4760 O  O   . HOH R 5 .   ? 25.205  53.501 -0.362  1.00 22.32 ? 773 HOH A O   1 
HETATM 4761 O  O   . HOH R 5 .   ? 31.620  41.383 7.865   1.00 20.01 ? 774 HOH A O   1 
HETATM 4762 O  O   . HOH R 5 .   ? 19.257  38.826 17.962  1.00 21.17 ? 775 HOH A O   1 
HETATM 4763 O  O   . HOH R 5 .   ? 2.946   53.048 -11.387 1.00 20.80 ? 776 HOH A O   1 
HETATM 4764 O  O   . HOH R 5 .   ? 19.562  58.226 4.296   1.00 21.67 ? 777 HOH A O   1 
HETATM 4765 O  O   . HOH R 5 .   ? 39.120  35.644 -4.686  1.00 32.00 ? 778 HOH A O   1 
HETATM 4766 O  O   . HOH R 5 .   ? 1.496   45.386 10.878  1.00 31.87 ? 779 HOH A O   1 
HETATM 4767 O  O   . HOH R 5 .   ? 37.080  36.238 4.964   1.00 18.67 ? 780 HOH A O   1 
HETATM 4768 O  O   . HOH R 5 .   ? 32.712  46.034 9.535   1.00 23.51 ? 781 HOH A O   1 
HETATM 4769 O  O   . HOH R 5 .   ? 10.278  30.805 -1.128  1.00 26.73 ? 782 HOH A O   1 
HETATM 4770 O  O   . HOH R 5 .   ? 21.993  40.012 -2.854  1.00 22.05 ? 783 HOH A O   1 
HETATM 4771 O  O   . HOH R 5 .   ? 26.962  53.484 -2.209  1.00 28.50 ? 784 HOH A O   1 
HETATM 4772 O  O   . HOH R 5 .   ? 29.017  53.350 -5.767  1.00 35.14 ? 785 HOH A O   1 
HETATM 4773 O  O   . HOH R 5 .   ? 20.523  41.629 -1.645  1.00 26.52 ? 786 HOH A O   1 
HETATM 4774 O  O   . HOH R 5 .   ? 15.639  34.485 14.120  1.00 20.15 ? 787 HOH A O   1 
HETATM 4775 O  O   . HOH R 5 .   ? 0.109   50.276 5.925   1.00 35.39 ? 788 HOH A O   1 
HETATM 4776 O  O   . HOH R 5 .   ? 32.323  48.628 -11.536 1.00 26.50 ? 789 HOH A O   1 
HETATM 4777 O  O   . HOH R 5 .   ? 2.385   46.398 13.420  1.00 30.29 ? 790 HOH A O   1 
HETATM 4778 O  O   . HOH R 5 .   ? 13.635  59.298 -16.191 1.00 31.70 ? 791 HOH A O   1 
HETATM 4779 O  O   . HOH R 5 .   ? 28.756  32.291 -9.861  1.00 32.48 ? 792 HOH A O   1 
HETATM 4780 O  O   . HOH R 5 .   ? 36.955  40.487 0.240   1.00 29.53 ? 793 HOH A O   1 
HETATM 4781 O  O   . HOH R 5 .   ? 18.563  39.808 -11.333 1.00 28.43 ? 794 HOH A O   1 
HETATM 4782 O  O   . HOH R 5 .   ? 29.503  46.707 -14.889 1.00 17.06 ? 795 HOH A O   1 
HETATM 4783 O  O   . HOH R 5 .   ? 35.832  32.549 4.204   1.00 20.55 ? 796 HOH A O   1 
HETATM 4784 O  O   . HOH R 5 .   ? 33.434  47.656 7.711   1.00 32.22 ? 797 HOH A O   1 
HETATM 4785 O  O   . HOH R 5 .   ? 1.897   49.645 -7.438  1.00 24.82 ? 798 HOH A O   1 
HETATM 4786 O  O   . HOH R 5 .   ? 6.677   43.405 -12.623 1.00 22.86 ? 799 HOH A O   1 
HETATM 4787 O  O   . HOH R 5 .   ? 1.055   37.497 2.982   1.00 27.62 ? 800 HOH A O   1 
HETATM 4788 O  O   . HOH R 5 .   ? 36.466  42.615 -12.504 1.00 26.95 ? 801 HOH A O   1 
HETATM 4789 O  O   . HOH R 5 .   ? 28.048  50.352 1.470   1.00 22.82 ? 802 HOH A O   1 
HETATM 4790 O  O   . HOH R 5 .   ? 39.309  41.222 -6.649  1.00 26.36 ? 803 HOH A O   1 
HETATM 4791 O  O   . HOH R 5 .   ? 34.715  30.905 15.399  1.00 26.87 ? 804 HOH A O   1 
HETATM 4792 O  O   . HOH R 5 .   ? 32.486  29.819 4.189   1.00 29.70 ? 805 HOH A O   1 
HETATM 4793 O  O   . HOH R 5 .   ? 38.266  39.741 -4.388  1.00 24.96 ? 806 HOH A O   1 
HETATM 4794 O  O   . HOH R 5 .   ? 35.335  35.146 3.057   1.00 24.49 ? 807 HOH A O   1 
HETATM 4795 O  O   . HOH R 5 .   ? 31.502  41.986 5.259   1.00 26.42 ? 808 HOH A O   1 
HETATM 4796 O  O   . HOH R 5 .   ? 6.384   53.031 -14.083 1.00 26.74 ? 809 HOH A O   1 
HETATM 4797 O  O   . HOH R 5 .   ? 29.561  48.446 0.335   1.00 27.47 ? 810 HOH A O   1 
HETATM 4798 O  O   . HOH R 5 .   ? 36.187  40.275 -13.822 1.00 30.89 ? 811 HOH A O   1 
HETATM 4799 O  O   . HOH R 5 .   ? 16.201  60.557 7.272   1.00 30.34 ? 812 HOH A O   1 
HETATM 4800 O  O   . HOH R 5 .   ? 9.554   42.273 -12.715 1.00 33.56 ? 813 HOH A O   1 
HETATM 4801 O  O   . HOH R 5 .   ? 1.868   56.909 -0.802  1.00 35.23 ? 814 HOH A O   1 
HETATM 4802 O  O   . HOH R 5 .   ? 32.427  30.016 11.874  1.00 24.47 ? 815 HOH A O   1 
HETATM 4803 O  O   . HOH R 5 .   ? 25.418  29.905 -0.540  1.00 22.74 ? 816 HOH A O   1 
HETATM 4804 O  O   . HOH R 5 .   ? 30.498  27.978 3.968   1.00 34.74 ? 817 HOH A O   1 
HETATM 4805 O  O   . HOH R 5 .   ? 7.387   33.271 -4.311  1.00 18.32 ? 818 HOH A O   1 
HETATM 4806 O  O   . HOH R 5 .   ? 14.099  29.070 -5.218  1.00 31.26 ? 819 HOH A O   1 
HETATM 4807 O  O   . HOH R 5 .   ? 28.027  51.139 -2.897  1.00 33.62 ? 820 HOH A O   1 
HETATM 4808 O  O   . HOH R 5 .   ? 26.654  57.011 -16.043 1.00 31.77 ? 821 HOH A O   1 
HETATM 4809 O  O   . HOH R 5 .   ? 33.618  31.561 1.115   1.00 29.93 ? 822 HOH A O   1 
HETATM 4810 O  O   . HOH R 5 .   ? 1.666   38.525 -2.018  1.00 34.10 ? 823 HOH A O   1 
HETATM 4811 O  O   . HOH R 5 .   ? 29.856  49.250 5.877   1.00 33.61 ? 824 HOH A O   1 
HETATM 4812 O  O   . HOH R 5 .   ? 7.949   40.642 -11.087 1.00 37.99 ? 825 HOH A O   1 
HETATM 4813 O  O   . HOH R 5 .   ? 1.536   60.188 5.698   1.00 49.08 ? 826 HOH A O   1 
HETATM 4814 O  O   . HOH R 5 .   ? 20.363  45.316 17.050  1.00 33.87 ? 827 HOH A O   1 
HETATM 4815 O  O   . HOH R 5 .   ? 35.607  40.612 10.084  1.00 38.28 ? 828 HOH A O   1 
HETATM 4816 O  O   . HOH R 5 .   ? 20.282  65.425 -7.160  1.00 42.21 ? 829 HOH A O   1 
HETATM 4817 O  O   . HOH R 5 .   ? 19.879  37.085 19.941  1.00 43.89 ? 830 HOH A O   1 
HETATM 4818 O  O   . HOH R 5 .   ? 25.165  39.996 24.189  1.00 39.87 ? 831 HOH A O   1 
HETATM 4819 O  O   . HOH R 5 .   ? 4.168   46.503 15.423  1.00 26.93 ? 832 HOH A O   1 
HETATM 4820 O  O   . HOH R 5 .   ? 22.662  29.607 -7.969  1.00 31.51 ? 833 HOH A O   1 
HETATM 4821 O  O   . HOH R 5 .   ? 4.966   36.269 9.851   1.00 30.47 ? 834 HOH A O   1 
HETATM 4822 O  O   . HOH R 5 .   ? 1.662   35.149 3.486   1.00 38.82 ? 835 HOH A O   1 
HETATM 4823 O  O   . HOH R 5 .   ? 8.673   31.596 -6.347  1.00 40.95 ? 836 HOH A O   1 
HETATM 4824 O  O   . HOH R 5 .   ? 7.239   58.592 -15.131 1.00 28.59 ? 837 HOH A O   1 
HETATM 4825 O  O   . HOH R 5 .   ? 23.867  49.183 -0.561  1.00 7.19  ? 838 HOH A O   1 
HETATM 4826 O  O   . HOH R 5 .   ? 23.066  36.957 -1.234  1.00 18.03 ? 839 HOH A O   1 
HETATM 4827 O  O   . HOH R 5 .   ? 22.351  57.346 2.092   1.00 15.04 ? 840 HOH A O   1 
HETATM 4828 O  O   . HOH R 5 .   ? 7.497   31.578 -2.257  1.00 31.35 ? 841 HOH A O   1 
HETATM 4829 O  O   . HOH R 5 .   ? 34.789  45.780 11.238  1.00 26.89 ? 842 HOH A O   1 
HETATM 4830 O  O   . HOH R 5 .   ? 34.558  38.595 -13.840 1.00 31.07 ? 843 HOH A O   1 
HETATM 4831 O  O   . HOH R 5 .   ? 30.860  31.775 14.913  1.00 30.03 ? 844 HOH A O   1 
HETATM 4832 O  O   . HOH R 5 .   ? 23.162  46.499 -0.623  1.00 9.18  ? 845 HOH A O   1 
HETATM 4833 O  O   . HOH R 5 .   ? 22.352  55.126 4.310   1.00 11.36 ? 846 HOH A O   1 
HETATM 4834 O  O   . HOH R 5 .   ? 29.294  30.780 11.340  1.00 29.96 ? 847 HOH A O   1 
HETATM 4835 O  O   . HOH R 5 .   ? 35.401  36.184 13.176  1.00 32.19 ? 848 HOH A O   1 
HETATM 4836 O  O   . HOH R 5 .   ? 35.354  41.823 14.262  1.00 25.51 ? 849 HOH A O   1 
HETATM 4837 O  O   . HOH R 5 .   ? 4.222   32.085 2.045   1.00 46.93 ? 850 HOH A O   1 
HETATM 4838 O  O   . HOH R 5 .   ? 13.194  61.514 13.522  1.00 32.12 ? 851 HOH A O   1 
HETATM 4839 O  O   . HOH R 5 .   ? 1.593   55.542 2.470   1.00 40.41 ? 852 HOH A O   1 
HETATM 4840 O  O   . HOH R 5 .   ? 33.139  45.173 21.793  1.00 28.97 ? 853 HOH A O   1 
HETATM 4841 O  O   . HOH R 5 .   ? 33.925  48.461 20.512  1.00 35.10 ? 854 HOH A O   1 
HETATM 4842 O  O   . HOH R 5 .   ? 31.627  48.789 -0.446  1.00 37.22 ? 855 HOH A O   1 
HETATM 4843 O  O   . HOH R 5 .   ? 33.036  46.479 -13.345 1.00 38.19 ? 856 HOH A O   1 
HETATM 4844 O  O   . HOH R 5 .   ? -0.325  50.104 15.340  1.00 44.51 ? 857 HOH A O   1 
HETATM 4845 O  O   . HOH R 5 .   ? -0.922  38.853 19.346  1.00 31.13 ? 858 HOH A O   1 
HETATM 4846 O  O   . HOH R 5 .   ? 24.624  52.215 -20.689 1.00 28.33 ? 859 HOH A O   1 
HETATM 4847 O  O   . HOH R 5 .   ? 5.908   54.391 -16.056 1.00 38.63 ? 860 HOH A O   1 
HETATM 4848 O  O   . HOH R 5 .   ? 6.653   60.396 5.000   1.00 35.69 ? 861 HOH A O   1 
HETATM 4849 O  O   . HOH R 5 .   ? 10.775  32.588 -8.056  1.00 37.73 ? 862 HOH A O   1 
HETATM 4850 O  O   . HOH R 5 .   ? 18.167  28.554 -7.362  1.00 33.37 ? 863 HOH A O   1 
HETATM 4851 O  O   . HOH R 5 .   ? 15.675  31.642 -8.688  1.00 40.66 ? 864 HOH A O   1 
HETATM 4852 O  O   . HOH R 5 .   ? 24.506  31.300 -8.974  1.00 31.70 ? 865 HOH A O   1 
HETATM 4853 O  O   . HOH R 5 .   ? 19.537  26.868 -14.513 1.00 41.06 ? 866 HOH A O   1 
HETATM 4854 O  O   . HOH R 5 .   ? 11.939  50.751 -17.718 1.00 36.40 ? 867 HOH A O   1 
HETATM 4855 O  O   . HOH R 5 .   ? 17.883  54.131 -19.509 1.00 36.60 ? 868 HOH A O   1 
HETATM 4856 O  O   . HOH R 5 .   ? 19.333  42.453 -16.781 1.00 40.66 ? 869 HOH A O   1 
HETATM 4857 O  O   . HOH R 5 .   ? 30.746  49.708 9.707   1.00 37.96 ? 870 HOH A O   1 
HETATM 4858 O  O   . HOH R 5 .   ? 31.586  49.773 20.273  1.00 36.73 ? 871 HOH A O   1 
HETATM 4859 O  O   . HOH R 5 .   ? 18.433  54.916 11.951  1.00 25.09 ? 872 HOH A O   1 
HETATM 4860 O  O   . HOH R 5 .   ? 1.866   34.487 -2.306  1.00 35.23 ? 873 HOH A O   1 
HETATM 4861 O  O   . HOH R 5 .   ? 5.978   36.417 -11.067 1.00 42.09 ? 874 HOH A O   1 
HETATM 4862 O  O   . HOH R 5 .   ? 11.294  29.213 -2.495  1.00 41.59 ? 875 HOH A O   1 
HETATM 4863 O  O   . HOH R 5 .   ? -0.066  51.897 17.678  1.00 41.31 ? 876 HOH A O   1 
HETATM 4864 O  O   . HOH R 5 .   ? 39.034  42.796 -10.959 1.00 36.84 ? 877 HOH A O   1 
HETATM 4865 O  O   . HOH R 5 .   ? 18.642  52.133 15.367  1.00 37.05 ? 878 HOH A O   1 
HETATM 4866 O  O   . HOH R 5 .   ? 27.732  46.749 19.026  1.00 34.17 ? 879 HOH A O   1 
HETATM 4867 O  O   . HOH R 5 .   ? 37.323  45.513 15.796  1.00 40.60 ? 880 HOH A O   1 
HETATM 4868 O  O   . HOH R 5 .   ? 0.545   35.106 20.108  1.00 38.45 ? 881 HOH A O   1 
HETATM 4869 O  O   . HOH R 5 .   ? 37.833  44.791 6.625   1.00 55.15 ? 882 HOH A O   1 
HETATM 4870 O  O   . HOH R 5 .   ? -2.220  51.635 13.292  1.00 38.67 ? 883 HOH A O   1 
HETATM 4871 O  O   . HOH R 5 .   ? 17.714  37.943 21.304  1.00 35.18 ? 884 HOH A O   1 
HETATM 4872 O  O   . HOH R 5 .   ? 22.733  65.635 -6.700  1.00 39.46 ? 885 HOH A O   1 
HETATM 4873 O  O   . HOH R 5 .   ? -1.616  35.212 -3.251  1.00 20.00 ? 886 HOH A O   1 
HETATM 4874 O  O   . HOH R 5 .   ? -1.159  37.439 -3.106  1.00 20.00 ? 887 HOH A O   1 
HETATM 4875 O  O   . HOH R 5 .   ? -2.700  38.829 -4.458  1.00 20.00 ? 888 HOH A O   1 
HETATM 4876 O  O   . HOH R 5 .   ? 35.184  39.567 12.644  1.00 20.00 ? 889 HOH A O   1 
HETATM 4877 O  O   . HOH R 5 .   ? 18.911  29.803 -14.349 1.00 20.00 ? 890 HOH A O   1 
HETATM 4878 O  O   . HOH S 5 .   ? 0.517   52.227 56.807  1.00 44.80 ? 434 HOH B O   1 
HETATM 4879 O  O   . HOH S 5 .   ? 2.779   52.574 58.527  1.00 51.11 ? 436 HOH B O   1 
HETATM 4880 O  O   . HOH S 5 .   ? -0.611  48.370 34.761  1.00 9.21  ? 704 HOH B O   1 
HETATM 4881 O  O   . HOH S 5 .   ? -3.113  39.261 33.250  1.00 17.33 ? 705 HOH B O   1 
HETATM 4882 O  O   . HOH S 5 .   ? 4.366   52.248 21.748  1.00 15.99 ? 706 HOH B O   1 
HETATM 4883 O  O   . HOH S 5 .   ? 14.138  34.382 30.931  1.00 22.51 ? 707 HOH B O   1 
HETATM 4884 O  O   . HOH S 5 .   ? 13.183  34.852 34.691  1.00 19.02 ? 708 HOH B O   1 
HETATM 4885 O  O   . HOH S 5 .   ? 18.378  41.090 18.199  1.00 13.87 ? 709 HOH B O   1 
HETATM 4886 O  O   . HOH S 5 .   ? -3.590  42.701 14.063  1.00 19.04 ? 710 HOH B O   1 
HETATM 4887 O  O   . HOH S 5 .   ? -0.130  39.977 36.223  1.00 14.35 ? 711 HOH B O   1 
HETATM 4888 O  O   . HOH S 5 .   ? 6.925   43.305 37.913  1.00 16.40 ? 712 HOH B O   1 
HETATM 4889 O  O   . HOH S 5 .   ? 19.783  51.697 20.413  1.00 25.87 ? 713 HOH B O   1 
HETATM 4890 O  O   . HOH S 5 .   ? 3.791   43.004 34.250  1.00 19.78 ? 714 HOH B O   1 
HETATM 4891 O  O   . HOH S 5 .   ? -8.749  45.076 30.376  1.00 28.51 ? 715 HOH B O   1 
HETATM 4892 O  O   . HOH S 5 .   ? 20.633  52.294 22.748  1.00 19.30 ? 716 HOH B O   1 
HETATM 4893 O  O   . HOH S 5 .   ? 21.095  45.466 45.054  1.00 22.89 ? 717 HOH B O   1 
HETATM 4894 O  O   . HOH S 5 .   ? -0.003  50.199 22.546  1.00 21.98 ? 718 HOH B O   1 
HETATM 4895 O  O   . HOH S 5 .   ? 22.350  50.060 22.466  1.00 25.68 ? 719 HOH B O   1 
HETATM 4896 O  O   . HOH S 5 .   ? 10.163  46.499 35.740  1.00 21.99 ? 720 HOH B O   1 
HETATM 4897 O  O   . HOH S 5 .   ? 4.429   51.925 18.590  1.00 19.02 ? 721 HOH B O   1 
HETATM 4898 O  O   . HOH S 5 .   ? -5.131  28.587 31.312  1.00 24.79 ? 722 HOH B O   1 
HETATM 4899 O  O   . HOH S 5 .   ? -7.921  33.244 27.368  1.00 21.89 ? 723 HOH B O   1 
HETATM 4900 O  O   . HOH S 5 .   ? 25.009  49.635 42.267  1.00 21.16 ? 724 HOH B O   1 
HETATM 4901 O  O   . HOH S 5 .   ? 5.362   42.406 45.284  1.00 18.24 ? 725 HOH B O   1 
HETATM 4902 O  O   . HOH S 5 .   ? 2.699   47.305 33.424  1.00 15.93 ? 726 HOH B O   1 
HETATM 4903 O  O   . HOH S 5 .   ? 11.529  44.290 19.963  1.00 20.20 ? 727 HOH B O   1 
HETATM 4904 O  O   . HOH S 5 .   ? 0.963   51.969 47.086  1.00 24.82 ? 728 HOH B O   1 
HETATM 4905 O  O   . HOH S 5 .   ? 8.717   43.704 35.916  1.00 17.12 ? 729 HOH B O   1 
HETATM 4906 O  O   . HOH S 5 .   ? -7.922  27.653 32.901  1.00 30.06 ? 730 HOH B O   1 
HETATM 4907 O  O   . HOH S 5 .   ? 1.757   49.640 47.586  1.00 26.10 ? 731 HOH B O   1 
HETATM 4908 O  O   . HOH S 5 .   ? 5.617   57.379 24.431  1.00 20.29 ? 732 HOH B O   1 
HETATM 4909 O  O   . HOH S 5 .   ? 10.208  63.158 32.148  1.00 20.17 ? 733 HOH B O   1 
HETATM 4910 O  O   . HOH S 5 .   ? -11.948 34.656 28.834  1.00 17.78 ? 734 HOH B O   1 
HETATM 4911 O  O   . HOH S 5 .   ? -10.097 34.640 26.690  1.00 23.10 ? 735 HOH B O   1 
HETATM 4912 O  O   . HOH S 5 .   ? -5.837  50.712 39.187  1.00 37.07 ? 736 HOH B O   1 
HETATM 4913 O  O   . HOH S 5 .   ? 4.496   59.620 32.241  1.00 23.70 ? 737 HOH B O   1 
HETATM 4914 O  O   . HOH S 5 .   ? 27.567  41.933 39.017  1.00 25.52 ? 738 HOH B O   1 
HETATM 4915 O  O   . HOH S 5 .   ? -7.045  29.964 38.490  1.00 26.11 ? 739 HOH B O   1 
HETATM 4916 O  O   . HOH S 5 .   ? 20.669  55.362 16.514  1.00 24.37 ? 740 HOH B O   1 
HETATM 4917 O  O   . HOH S 5 .   ? -0.512  51.899 35.025  1.00 19.53 ? 741 HOH B O   1 
HETATM 4918 O  O   . HOH S 5 .   ? 5.504   44.925 16.665  1.00 28.09 ? 742 HOH B O   1 
HETATM 4919 O  O   . HOH S 5 .   ? -4.085  43.106 31.515  1.00 21.07 ? 743 HOH B O   1 
HETATM 4920 O  O   . HOH S 5 .   ? -3.541  34.361 22.129  1.00 29.62 ? 744 HOH B O   1 
HETATM 4921 O  O   . HOH S 5 .   ? -9.997  36.539 32.276  1.00 29.07 ? 745 HOH B O   1 
HETATM 4922 O  O   . HOH S 5 .   ? 4.743   38.042 47.623  1.00 27.89 ? 746 HOH B O   1 
HETATM 4923 O  O   . HOH S 5 .   ? 11.788  50.386 18.683  1.00 18.44 ? 747 HOH B O   1 
HETATM 4924 O  O   . HOH S 5 .   ? -0.901  54.274 36.913  1.00 26.44 ? 748 HOH B O   1 
HETATM 4925 O  O   . HOH S 5 .   ? 23.287  49.196 25.304  1.00 25.74 ? 749 HOH B O   1 
HETATM 4926 O  O   . HOH S 5 .   ? -5.098  34.559 44.655  1.00 35.41 ? 750 HOH B O   1 
HETATM 4927 O  O   . HOH S 5 .   ? 1.992   37.977 36.777  1.00 20.13 ? 751 HOH B O   1 
HETATM 4928 O  O   . HOH S 5 .   ? 15.611  42.870 48.075  1.00 27.17 ? 752 HOH B O   1 
HETATM 4929 O  O   . HOH S 5 .   ? -12.279 39.368 26.927  1.00 40.68 ? 753 HOH B O   1 
HETATM 4930 O  O   . HOH S 5 .   ? 3.850   33.121 30.875  1.00 21.26 ? 754 HOH B O   1 
HETATM 4931 O  O   . HOH S 5 .   ? 0.132   37.520 52.263  1.00 31.11 ? 755 HOH B O   1 
HETATM 4932 O  O   . HOH S 5 .   ? 6.816   40.478 46.668  1.00 32.75 ? 756 HOH B O   1 
HETATM 4933 O  O   . HOH S 5 .   ? -4.779  49.000 35.982  1.00 35.91 ? 757 HOH B O   1 
HETATM 4934 O  O   . HOH S 5 .   ? 19.035  54.845 46.414  1.00 25.59 ? 758 HOH B O   1 
HETATM 4935 O  O   . HOH S 5 .   ? -13.004 40.437 40.606  1.00 27.30 ? 759 HOH B O   1 
HETATM 4936 O  O   . HOH S 5 .   ? 24.392  48.836 46.452  1.00 42.12 ? 760 HOH B O   1 
HETATM 4937 O  O   . HOH S 5 .   ? 19.523  60.838 26.397  1.00 23.94 ? 761 HOH B O   1 
HETATM 4938 O  O   . HOH S 5 .   ? 15.140  32.892 35.438  1.00 25.15 ? 762 HOH B O   1 
HETATM 4939 O  O   . HOH S 5 .   ? -9.610  28.482 43.839  1.00 27.71 ? 763 HOH B O   1 
HETATM 4940 O  O   . HOH S 5 .   ? -11.134 42.574 48.394  1.00 33.40 ? 764 HOH B O   1 
HETATM 4941 O  O   . HOH S 5 .   ? -1.108  57.640 42.715  1.00 24.28 ? 765 HOH B O   1 
HETATM 4942 O  O   . HOH S 5 .   ? 6.043   42.527 52.435  1.00 42.20 ? 766 HOH B O   1 
HETATM 4943 O  O   . HOH S 5 .   ? 3.817   32.749 28.310  1.00 35.35 ? 767 HOH B O   1 
HETATM 4944 O  O   . HOH S 5 .   ? -8.015  35.188 43.612  1.00 25.70 ? 768 HOH B O   1 
HETATM 4945 O  O   . HOH S 5 .   ? 21.584  37.566 43.794  1.00 40.02 ? 769 HOH B O   1 
HETATM 4946 O  O   . HOH S 5 .   ? 20.209  54.507 29.734  1.00 35.75 ? 770 HOH B O   1 
HETATM 4947 O  O   . HOH S 5 .   ? 3.773   62.796 44.624  1.00 35.18 ? 771 HOH B O   1 
HETATM 4948 O  O   . HOH S 5 .   ? 15.834  61.399 28.216  1.00 26.82 ? 772 HOH B O   1 
HETATM 4949 O  O   . HOH S 5 .   ? -0.084  30.701 35.646  1.00 25.62 ? 773 HOH B O   1 
HETATM 4950 O  O   . HOH S 5 .   ? -10.342 34.118 31.475  1.00 22.77 ? 774 HOH B O   1 
HETATM 4951 O  O   . HOH S 5 .   ? -3.503  32.599 44.749  1.00 36.20 ? 775 HOH B O   1 
HETATM 4952 O  O   . HOH S 5 .   ? -1.927  49.346 37.375  1.00 14.50 ? 776 HOH B O   1 
HETATM 4953 O  O   . HOH S 5 .   ? 9.284   37.201 21.013  1.00 26.33 ? 777 HOH B O   1 
HETATM 4954 O  O   . HOH S 5 .   ? 1.372   37.896 33.790  1.00 28.38 ? 778 HOH B O   1 
HETATM 4955 O  O   . HOH S 5 .   ? -8.192  46.987 26.616  1.00 24.73 ? 779 HOH B O   1 
HETATM 4956 O  O   . HOH S 5 .   ? -6.905  42.211 27.773  1.00 30.17 ? 780 HOH B O   1 
HETATM 4957 O  O   . HOH S 5 .   ? -8.370  44.549 27.826  1.00 29.94 ? 781 HOH B O   1 
HETATM 4958 O  O   . HOH S 5 .   ? 22.196  41.924 30.289  1.00 27.93 ? 782 HOH B O   1 
HETATM 4959 O  O   . HOH S 5 .   ? 8.120   37.265 26.947  1.00 33.99 ? 783 HOH B O   1 
HETATM 4960 O  O   . HOH S 5 .   ? -0.656  62.237 44.550  1.00 43.54 ? 784 HOH B O   1 
HETATM 4961 O  O   . HOH S 5 .   ? 22.801  53.091 40.816  1.00 40.33 ? 785 HOH B O   1 
HETATM 4962 O  O   . HOH S 5 .   ? 23.726  59.496 31.642  1.00 31.93 ? 786 HOH B O   1 
HETATM 4963 O  O   . HOH S 5 .   ? -1.166  28.816 37.550  1.00 36.92 ? 787 HOH B O   1 
HETATM 4964 O  O   . HOH S 5 .   ? -10.774 40.292 49.968  1.00 36.75 ? 788 HOH B O   1 
HETATM 4965 O  O   . HOH S 5 .   ? 8.392   35.359 23.938  1.00 41.77 ? 789 HOH B O   1 
HETATM 4966 O  O   . HOH S 5 .   ? -9.026  38.347 49.696  1.00 39.24 ? 790 HOH B O   1 
HETATM 4967 O  O   . HOH S 5 .   ? 3.279   41.176 38.337  1.00 28.39 ? 791 HOH B O   1 
HETATM 4968 O  O   . HOH S 5 .   ? 22.878  51.428 42.904  1.00 29.54 ? 792 HOH B O   1 
HETATM 4969 O  O   . HOH S 5 .   ? 24.253  47.511 23.167  1.00 42.42 ? 793 HOH B O   1 
HETATM 4970 O  O   . HOH S 5 .   ? 2.908   31.575 32.700  1.00 39.32 ? 794 HOH B O   1 
HETATM 4971 O  O   . HOH S 5 .   ? 11.763  64.350 49.595  1.00 37.97 ? 795 HOH B O   1 
HETATM 4972 O  O   . HOH S 5 .   ? -8.162  32.208 33.949  1.00 29.73 ? 796 HOH B O   1 
HETATM 4973 O  O   . HOH S 5 .   ? -3.550  51.862 39.613  1.00 33.87 ? 797 HOH B O   1 
HETATM 4974 O  O   . HOH S 5 .   ? 11.128  60.035 52.497  1.00 29.68 ? 798 HOH B O   1 
HETATM 4975 O  O   . HOH S 5 .   ? 18.658  53.478 17.635  1.00 35.08 ? 799 HOH B O   1 
HETATM 4976 O  O   . HOH S 5 .   ? 4.406   43.005 37.172  1.00 40.94 ? 800 HOH B O   1 
HETATM 4977 O  O   . HOH S 5 .   ? -11.191 44.201 26.654  1.00 26.80 ? 801 HOH B O   1 
HETATM 4978 O  O   . HOH S 5 .   ? 26.270  57.632 31.376  1.00 50.74 ? 802 HOH B O   1 
HETATM 4979 O  O   . HOH S 5 .   ? -8.141  47.969 45.147  1.00 28.61 ? 803 HOH B O   1 
HETATM 4980 O  O   . HOH S 5 .   ? -10.224 37.042 25.196  1.00 33.77 ? 804 HOH B O   1 
HETATM 4981 O  O   . HOH S 5 .   ? 0.740   50.121 36.610  1.00 11.83 ? 805 HOH B O   1 
HETATM 4982 O  O   . HOH S 5 .   ? 1.716   58.203 34.453  1.00 20.67 ? 806 HOH B O   1 
HETATM 4983 O  O   . HOH S 5 .   ? 23.407  40.462 37.063  1.00 34.62 ? 807 HOH B O   1 
HETATM 4984 O  O   . HOH S 5 .   ? -1.886  57.467 52.298  1.00 36.76 ? 808 HOH B O   1 
HETATM 4985 O  O   . HOH S 5 .   ? -14.213 41.320 42.714  1.00 31.37 ? 809 HOH B O   1 
HETATM 4986 O  O   . HOH S 5 .   ? 4.448   56.765 22.217  1.00 30.73 ? 810 HOH B O   1 
HETATM 4987 O  O   . HOH S 5 .   ? 1.657   47.377 36.474  1.00 17.07 ? 811 HOH B O   1 
HETATM 4988 O  O   . HOH S 5 .   ? 1.775   56.421 32.462  1.00 17.99 ? 812 HOH B O   1 
HETATM 4989 O  O   . HOH S 5 .   ? 3.684   57.700 29.528  1.00 32.12 ? 813 HOH B O   1 
HETATM 4990 O  O   . HOH S 5 .   ? -1.763  31.917 42.885  1.00 28.62 ? 814 HOH B O   1 
HETATM 4991 O  O   . HOH S 5 .   ? 11.331  32.482 33.025  1.00 37.42 ? 815 HOH B O   1 
HETATM 4992 O  O   . HOH S 5 .   ? 16.541  48.036 49.846  1.00 32.16 ? 816 HOH B O   1 
HETATM 4993 O  O   . HOH S 5 .   ? 4.718   48.100 18.449  1.00 42.45 ? 817 HOH B O   1 
HETATM 4994 O  O   . HOH S 5 .   ? 3.955   45.159 19.138  1.00 31.91 ? 818 HOH B O   1 
HETATM 4995 O  O   . HOH S 5 .   ? -0.361  40.161 52.361  1.00 39.37 ? 819 HOH B O   1 
HETATM 4996 O  O   . HOH S 5 .   ? -6.900  49.977 36.392  1.00 43.01 ? 820 HOH B O   1 
HETATM 4997 O  O   . HOH S 5 .   ? 23.192  56.859 45.471  1.00 34.96 ? 821 HOH B O   1 
HETATM 4998 O  O   . HOH S 5 .   ? -8.659  43.481 20.042  1.00 29.21 ? 822 HOH B O   1 
HETATM 4999 O  O   . HOH S 5 .   ? 4.958   41.515 17.245  1.00 39.76 ? 823 HOH B O   1 
HETATM 5000 O  O   . HOH S 5 .   ? -9.631  37.812 22.688  1.00 61.54 ? 824 HOH B O   1 
HETATM 5001 O  O   . HOH S 5 .   ? 27.588  55.946 20.954  1.00 32.04 ? 825 HOH B O   1 
HETATM 5002 O  O   . HOH S 5 .   ? 12.812  50.812 53.504  1.00 40.62 ? 826 HOH B O   1 
HETATM 5003 O  O   . HOH S 5 .   ? 23.421  40.054 31.692  1.00 38.29 ? 827 HOH B O   1 
HETATM 5004 O  O   . HOH S 5 .   ? 25.951  40.364 37.388  1.00 32.69 ? 828 HOH B O   1 
HETATM 5005 O  O   . HOH S 5 .   ? 2.634   49.559 18.694  1.00 35.68 ? 829 HOH B O   1 
HETATM 5006 O  O   . HOH S 5 .   ? 2.331   53.378 29.596  1.00 29.32 ? 830 HOH B O   1 
HETATM 5007 O  O   . HOH S 5 .   ? 15.214  41.016 49.811  1.00 36.69 ? 831 HOH B O   1 
HETATM 5008 O  O   . HOH S 5 .   ? 29.059  51.742 20.815  1.00 43.70 ? 832 HOH B O   1 
HETATM 5009 O  O   . HOH S 5 .   ? 22.500  56.051 32.793  1.00 37.12 ? 833 HOH B O   1 
HETATM 5010 O  O   . HOH S 5 .   ? -10.640 42.106 25.807  1.00 34.89 ? 834 HOH B O   1 
HETATM 5011 O  O   . HOH S 5 .   ? 17.890  62.562 24.850  1.00 34.29 ? 835 HOH B O   1 
HETATM 5012 O  O   . HOH S 5 .   ? 12.154  61.952 21.660  1.00 26.81 ? 836 HOH B O   1 
HETATM 5013 O  O   . HOH S 5 .   ? 2.254   55.749 27.867  1.00 34.66 ? 837 HOH B O   1 
HETATM 5014 O  O   . HOH S 5 .   ? -7.328  48.599 47.789  1.00 38.34 ? 838 HOH B O   1 
HETATM 5015 O  O   . HOH S 5 .   ? -4.351  46.958 51.055  1.00 31.71 ? 839 HOH B O   1 
HETATM 5016 O  O   . HOH S 5 .   ? -3.784  54.071 51.652  1.00 37.77 ? 840 HOH B O   1 
HETATM 5017 O  O   . HOH S 5 .   ? 6.206   38.841 18.015  1.00 48.56 ? 841 HOH B O   1 
HETATM 5018 O  O   . HOH S 5 .   ? 16.975  37.383 25.952  1.00 39.18 ? 842 HOH B O   1 
HETATM 5019 O  O   . HOH T 5 .   ? 50.075  48.325 36.844  1.00 12.57 ? 646 HOH C O   1 
HETATM 5020 O  O   . HOH T 5 .   ? 47.923  47.501 35.102  1.00 13.71 ? 647 HOH C O   1 
HETATM 5021 O  O   . HOH T 5 .   ? 42.648  43.677 33.107  1.00 15.47 ? 648 HOH C O   1 
HETATM 5022 O  O   . HOH T 5 .   ? 52.405  39.426 38.537  1.00 12.72 ? 649 HOH C O   1 
HETATM 5023 O  O   . HOH T 5 .   ? 43.457  40.657 24.397  1.00 23.78 ? 650 HOH C O   1 
HETATM 5024 O  O   . HOH T 5 .   ? 39.966  55.815 52.549  1.00 22.69 ? 651 HOH C O   1 
HETATM 5025 O  O   . HOH T 5 .   ? 44.176  51.859 49.541  1.00 15.17 ? 652 HOH C O   1 
HETATM 5026 O  O   . HOH T 5 .   ? 24.454  49.800 27.752  1.00 25.47 ? 653 HOH C O   1 
HETATM 5027 O  O   . HOH T 5 .   ? 40.890  44.219 34.867  1.00 16.57 ? 654 HOH C O   1 
HETATM 5028 O  O   . HOH T 5 .   ? 34.942  34.566 39.255  1.00 33.34 ? 655 HOH C O   1 
HETATM 5029 O  O   . HOH T 5 .   ? 50.358  54.433 34.874  1.00 22.78 ? 656 HOH C O   1 
HETATM 5030 O  O   . HOH T 5 .   ? 40.799  42.750 54.141  1.00 26.06 ? 657 HOH C O   1 
HETATM 5031 O  O   . HOH T 5 .   ? 57.807  44.973 41.518  1.00 28.65 ? 658 HOH C O   1 
HETATM 5032 O  O   . HOH T 5 .   ? 45.755  43.126 37.008  1.00 22.18 ? 659 HOH C O   1 
HETATM 5033 O  O   . HOH T 5 .   ? 49.869  52.082 36.499  1.00 19.14 ? 660 HOH C O   1 
HETATM 5034 O  O   . HOH T 5 .   ? 44.681  42.754 25.990  1.00 17.87 ? 661 HOH C O   1 
HETATM 5035 O  O   . HOH T 5 .   ? 44.850  59.751 39.116  1.00 23.25 ? 662 HOH C O   1 
HETATM 5036 O  O   . HOH T 5 .   ? 49.552  40.151 35.422  1.00 16.16 ? 663 HOH C O   1 
HETATM 5037 O  O   . HOH T 5 .   ? 22.354  47.686 35.383  1.00 19.37 ? 664 HOH C O   1 
HETATM 5038 O  O   . HOH T 5 .   ? 39.463  46.536 34.951  1.00 24.97 ? 665 HOH C O   1 
HETATM 5039 O  O   . HOH T 5 .   ? 28.658  55.037 53.821  1.00 27.03 ? 666 HOH C O   1 
HETATM 5040 O  O   . HOH T 5 .   ? 28.054  41.129 49.269  1.00 40.14 ? 667 HOH C O   1 
HETATM 5041 O  O   . HOH T 5 .   ? 41.704  39.678 25.559  1.00 22.49 ? 668 HOH C O   1 
HETATM 5042 O  O   . HOH T 5 .   ? 38.944  36.804 49.498  1.00 17.63 ? 669 HOH C O   1 
HETATM 5043 O  O   . HOH T 5 .   ? 48.335  49.969 23.939  1.00 25.59 ? 670 HOH C O   1 
HETATM 5044 O  O   . HOH T 5 .   ? 39.770  35.261 46.781  1.00 33.34 ? 671 HOH C O   1 
HETATM 5045 O  O   . HOH T 5 .   ? 46.610  47.273 37.991  1.00 16.63 ? 672 HOH C O   1 
HETATM 5046 O  O   . HOH T 5 .   ? 45.484  38.982 23.467  1.00 28.14 ? 673 HOH C O   1 
HETATM 5047 O  O   . HOH T 5 .   ? 58.308  48.196 27.133  1.00 23.02 ? 674 HOH C O   1 
HETATM 5048 O  O   . HOH T 5 .   ? 53.297  43.548 40.357  1.00 23.08 ? 675 HOH C O   1 
HETATM 5049 O  O   . HOH T 5 .   ? 52.361  34.609 49.791  1.00 36.08 ? 676 HOH C O   1 
HETATM 5050 O  O   . HOH T 5 .   ? 48.598  50.357 49.083  1.00 26.10 ? 677 HOH C O   1 
HETATM 5051 O  O   . HOH T 5 .   ? 56.021  43.155 41.360  1.00 29.84 ? 678 HOH C O   1 
HETATM 5052 O  O   . HOH T 5 .   ? 55.121  34.924 26.891  1.00 33.30 ? 679 HOH C O   1 
HETATM 5053 O  O   . HOH T 5 .   ? 47.614  38.202 34.613  1.00 21.36 ? 680 HOH C O   1 
HETATM 5054 O  O   . HOH T 5 .   ? 38.643  55.791 16.462  1.00 24.79 ? 681 HOH C O   1 
HETATM 5055 O  O   . HOH T 5 .   ? 28.955  45.765 25.137  1.00 23.14 ? 682 HOH C O   1 
HETATM 5056 O  O   . HOH T 5 .   ? 29.276  35.932 30.418  1.00 28.54 ? 683 HOH C O   1 
HETATM 5057 O  O   . HOH T 5 .   ? 49.586  52.306 24.663  1.00 22.77 ? 684 HOH C O   1 
HETATM 5058 O  O   . HOH T 5 .   ? 40.912  37.276 43.539  1.00 32.35 ? 685 HOH C O   1 
HETATM 5059 O  O   . HOH T 5 .   ? 55.984  42.465 44.180  1.00 27.35 ? 686 HOH C O   1 
HETATM 5060 O  O   . HOH T 5 .   ? 26.895  51.989 27.074  1.00 28.19 ? 687 HOH C O   1 
HETATM 5061 O  O   . HOH T 5 .   ? 55.003  53.974 26.478  1.00 32.12 ? 688 HOH C O   1 
HETATM 5062 O  O   . HOH T 5 .   ? 26.021  49.528 44.954  1.00 33.44 ? 689 HOH C O   1 
HETATM 5063 O  O   . HOH T 5 .   ? 54.995  28.800 40.552  1.00 41.48 ? 690 HOH C O   1 
HETATM 5064 O  O   . HOH T 5 .   ? 39.705  58.504 52.949  1.00 27.69 ? 691 HOH C O   1 
HETATM 5065 O  O   . HOH T 5 .   ? 43.242  45.409 51.918  1.00 29.72 ? 692 HOH C O   1 
HETATM 5066 O  O   . HOH T 5 .   ? 38.692  64.588 21.578  1.00 42.32 ? 693 HOH C O   1 
HETATM 5067 O  O   . HOH T 5 .   ? 57.609  35.111 28.386  1.00 26.94 ? 694 HOH C O   1 
HETATM 5068 O  O   . HOH T 5 .   ? 26.672  49.804 48.232  1.00 48.30 ? 695 HOH C O   1 
HETATM 5069 O  O   . HOH T 5 .   ? 54.462  54.395 29.745  1.00 34.05 ? 696 HOH C O   1 
HETATM 5070 O  O   . HOH T 5 .   ? 31.483  55.166 24.213  1.00 25.07 ? 697 HOH C O   1 
HETATM 5071 O  O   . HOH T 5 .   ? 53.483  32.814 26.653  1.00 40.29 ? 698 HOH C O   1 
HETATM 5072 O  O   . HOH T 5 .   ? 29.033  54.834 40.554  1.00 27.95 ? 699 HOH C O   1 
HETATM 5073 O  O   . HOH T 5 .   ? 41.149  40.344 53.969  1.00 33.62 ? 700 HOH C O   1 
HETATM 5074 O  O   . HOH T 5 .   ? 48.248  37.671 37.390  1.00 33.10 ? 701 HOH C O   1 
HETATM 5075 O  O   . HOH T 5 .   ? 56.980  47.105 45.495  1.00 29.89 ? 702 HOH C O   1 
HETATM 5076 O  O   . HOH T 5 .   ? 57.733  49.040 24.699  1.00 29.34 ? 703 HOH C O   1 
HETATM 5077 O  O   . HOH T 5 .   ? 22.065  41.826 27.447  1.00 44.56 ? 704 HOH C O   1 
HETATM 5078 O  O   . HOH T 5 .   ? 40.955  39.242 21.239  1.00 41.69 ? 705 HOH C O   1 
HETATM 5079 O  O   . HOH T 5 .   ? 43.371  57.405 46.612  1.00 25.25 ? 706 HOH C O   1 
HETATM 5080 O  O   . HOH T 5 .   ? 46.217  63.370 26.972  1.00 29.12 ? 707 HOH C O   1 
HETATM 5081 O  O   . HOH T 5 .   ? 34.039  46.643 51.760  1.00 30.10 ? 708 HOH C O   1 
HETATM 5082 O  O   . HOH T 5 .   ? 34.657  43.123 22.525  1.00 28.45 ? 709 HOH C O   1 
HETATM 5083 O  O   . HOH T 5 .   ? 53.129  52.079 32.154  1.00 28.82 ? 710 HOH C O   1 
HETATM 5084 O  O   . HOH T 5 .   ? 56.774  44.358 52.538  1.00 31.06 ? 711 HOH C O   1 
HETATM 5085 O  O   . HOH T 5 .   ? 54.871  47.515 20.789  1.00 32.39 ? 712 HOH C O   1 
HETATM 5086 O  O   . HOH T 5 .   ? 29.569  53.820 36.989  1.00 25.62 ? 713 HOH C O   1 
HETATM 5087 O  O   . HOH T 5 .   ? 39.141  63.276 38.862  1.00 28.13 ? 714 HOH C O   1 
HETATM 5088 O  O   . HOH T 5 .   ? 33.298  60.547 19.736  1.00 33.92 ? 715 HOH C O   1 
HETATM 5089 O  O   . HOH T 5 .   ? 39.750  32.836 27.299  1.00 33.00 ? 716 HOH C O   1 
HETATM 5090 O  O   . HOH T 5 .   ? 32.289  54.504 53.042  1.00 35.74 ? 717 HOH C O   1 
HETATM 5091 O  O   . HOH T 5 .   ? 27.487  52.612 40.068  1.00 34.81 ? 718 HOH C O   1 
HETATM 5092 O  O   . HOH T 5 .   ? 38.123  53.983 53.572  1.00 30.43 ? 719 HOH C O   1 
HETATM 5093 O  O   . HOH T 5 .   ? 41.513  48.538 54.045  1.00 30.87 ? 720 HOH C O   1 
HETATM 5094 O  O   . HOH T 5 .   ? 52.659  51.260 36.234  1.00 37.67 ? 721 HOH C O   1 
HETATM 5095 O  O   . HOH T 5 .   ? 37.185  49.928 51.938  1.00 38.00 ? 722 HOH C O   1 
HETATM 5096 O  O   . HOH T 5 .   ? 43.995  51.190 52.309  1.00 32.56 ? 723 HOH C O   1 
HETATM 5097 O  O   . HOH T 5 .   ? 36.326  34.679 35.711  1.00 20.72 ? 724 HOH C O   1 
HETATM 5098 O  O   . HOH T 5 .   ? 61.090  37.181 41.913  1.00 28.48 ? 725 HOH C O   1 
HETATM 5099 O  O   . HOH T 5 .   ? 60.314  50.374 28.074  1.00 36.89 ? 726 HOH C O   1 
HETATM 5100 O  O   . HOH T 5 .   ? 43.974  54.570 50.182  1.00 24.97 ? 727 HOH C O   1 
HETATM 5101 O  O   . HOH T 5 .   ? 28.447  52.590 47.379  1.00 31.20 ? 728 HOH C O   1 
HETATM 5102 O  O   . HOH T 5 .   ? 28.588  49.885 51.137  1.00 44.14 ? 729 HOH C O   1 
HETATM 5103 O  O   . HOH T 5 .   ? 54.709  49.630 36.075  1.00 42.48 ? 730 HOH C O   1 
HETATM 5104 O  O   . HOH T 5 .   ? 51.444  43.189 57.897  1.00 39.14 ? 731 HOH C O   1 
HETATM 5105 O  O   . HOH T 5 .   ? 51.603  49.557 34.386  1.00 14.60 ? 732 HOH C O   1 
HETATM 5106 O  O   . HOH T 5 .   ? 47.586  58.554 37.241  1.00 15.91 ? 733 HOH C O   1 
HETATM 5107 O  O   . HOH T 5 .   ? 25.293  43.114 23.207  1.00 41.39 ? 734 HOH C O   1 
HETATM 5108 O  O   . HOH T 5 .   ? 57.267  32.509 38.038  1.00 40.42 ? 735 HOH C O   1 
HETATM 5109 O  O   . HOH T 5 .   ? 40.221  60.439 18.183  1.00 38.67 ? 736 HOH C O   1 
HETATM 5110 O  O   . HOH T 5 .   ? 36.375  48.023 53.597  0.50 30.86 ? 737 HOH C O   1 
HETATM 5111 O  O   . HOH T 5 .   ? 60.859  35.090 44.982  1.00 35.12 ? 738 HOH C O   1 
HETATM 5112 O  O   . HOH T 5 .   ? 50.631  37.754 19.358  1.00 37.97 ? 739 HOH C O   1 
HETATM 5113 O  O   . HOH T 5 .   ? 46.365  41.272 32.906  1.00 27.80 ? 740 HOH C O   1 
HETATM 5114 O  O   . HOH T 5 .   ? 48.748  50.317 34.974  1.00 11.73 ? 741 HOH C O   1 
HETATM 5115 O  O   . HOH T 5 .   ? 47.611  56.597 39.111  1.00 18.84 ? 742 HOH C O   1 
HETATM 5116 O  O   . HOH T 5 .   ? 63.590  36.813 31.661  1.00 32.62 ? 743 HOH C O   1 
HETATM 5117 O  O   . HOH T 5 .   ? 53.496  51.912 57.195  1.00 26.84 ? 744 HOH C O   1 
HETATM 5118 O  O   . HOH T 5 .   ? 35.685  55.718 14.640  1.00 33.48 ? 745 HOH C O   1 
HETATM 5119 O  O   . HOH T 5 .   ? 42.136  60.234 52.799  1.00 33.96 ? 746 HOH C O   1 
HETATM 5120 O  O   . HOH T 5 .   ? 51.454  31.984 28.475  1.00 26.75 ? 747 HOH C O   1 
HETATM 5121 O  O   . HOH T 5 .   ? 56.399  29.988 33.486  1.00 31.90 ? 748 HOH C O   1 
HETATM 5122 O  O   . HOH T 5 .   ? 44.235  58.472 52.488  1.00 39.37 ? 749 HOH C O   1 
HETATM 5123 O  O   . HOH T 5 .   ? 36.952  62.126 48.891  1.00 27.71 ? 750 HOH C O   1 
HETATM 5124 O  O   . HOH T 5 .   ? 43.740  54.718 15.522  1.00 35.69 ? 751 HOH C O   1 
HETATM 5125 O  O   . HOH T 5 .   ? 44.861  56.219 48.622  1.00 33.68 ? 752 HOH C O   1 
HETATM 5126 O  O   . HOH T 5 .   ? 50.918  40.246 19.124  1.00 45.50 ? 753 HOH C O   1 
HETATM 5127 O  O   . HOH T 5 .   ? 44.118  40.619 19.349  1.00 48.50 ? 754 HOH C O   1 
HETATM 5128 O  O   . HOH T 5 .   ? 31.104  45.869 22.335  1.00 36.60 ? 755 HOH C O   1 
HETATM 5129 O  O   . HOH T 5 .   ? 45.639  33.062 40.368  1.00 26.62 ? 756 HOH C O   1 
HETATM 5130 O  O   . HOH T 5 .   ? 20.022  61.255 50.386  1.00 33.01 ? 757 HOH C O   1 
HETATM 5131 O  O   . HOH T 5 .   ? 26.920  57.607 36.925  1.00 46.80 ? 758 HOH C O   1 
HETATM 5132 O  O   . HOH T 5 .   ? 45.065  30.272 30.221  1.00 33.58 ? 759 HOH C O   1 
HETATM 5133 O  O   . HOH T 5 .   ? 34.296  33.282 34.433  1.00 30.08 ? 760 HOH C O   1 
HETATM 5134 O  O   . HOH T 5 .   ? 31.731  35.235 31.164  1.00 31.75 ? 761 HOH C O   1 
HETATM 5135 O  O   . HOH T 5 .   ? 64.160  41.399 29.936  1.00 27.94 ? 762 HOH C O   1 
HETATM 5136 O  O   . HOH T 5 .   ? 43.345  62.494 38.673  1.00 37.79 ? 763 HOH C O   1 
HETATM 5137 O  O   . HOH T 5 .   ? 28.068  42.322 21.896  1.00 42.87 ? 764 HOH C O   1 
HETATM 5138 O  O   . HOH T 5 .   ? 28.642  55.330 24.678  1.00 37.13 ? 765 HOH C O   1 
HETATM 5139 O  O   . HOH T 5 .   ? 27.085  53.416 29.395  1.00 30.59 ? 766 HOH C O   1 
HETATM 5140 O  O   . HOH T 5 .   ? 44.303  40.390 12.552  1.00 44.33 ? 767 HOH C O   1 
HETATM 5141 O  O   . HOH T 5 .   ? 45.460  37.921 14.673  1.00 42.94 ? 768 HOH C O   1 
HETATM 5142 O  O   . HOH T 5 .   ? 61.196  53.143 52.794  1.00 44.59 ? 769 HOH C O   1 
HETATM 5143 O  O   . HOH T 5 .   ? 32.715  63.409 33.191  1.00 47.17 ? 770 HOH C O   1 
HETATM 5144 O  O   . HOH T 5 .   ? 41.236  62.990 42.388  1.00 49.43 ? 771 HOH C O   1 
HETATM 5145 O  O   . HOH T 5 .   ? 31.716  33.628 33.259  1.00 37.61 ? 772 HOH C O   1 
HETATM 5146 O  O   . HOH T 5 .   ? 38.815  43.399 16.483  1.00 20.00 ? 773 HOH C O   1 
HETATM 5147 O  O   . HOH T 5 .   ? 55.234  54.107 57.883  1.00 20.00 ? 774 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   0   SER SER A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   GLU 3   2   2   GLU GLU A . n 
A 1 4   GLU 4   3   3   GLU GLU A . n 
A 1 5   LYS 5   4   4   LYS LYS A . n 
A 1 6   LEU 6   5   5   LEU LEU A . n 
A 1 7   LYS 7   6   6   LYS LYS A . n 
A 1 8   LYS 8   7   7   LYS LYS A . n 
A 1 9   THR 9   8   8   THR THR A . n 
A 1 10  ASN 10  9   9   ASN ASN A . n 
A 1 11  ILE 11  10  10  ILE ILE A . n 
A 1 12  ILE 12  11  11  ILE ILE A . n 
A 1 13  PHE 13  12  12  PHE PHE A . n 
A 1 14  VAL 14  13  13  VAL VAL A . n 
A 1 15  VAL 15  14  14  VAL VAL A . n 
A 1 16  GLY 16  15  15  GLY GLY A . n 
A 1 17  GLY 17  16  16  GLY GLY A . n 
A 1 18  PRO 18  17  17  PRO PRO A . n 
A 1 19  GLY 19  18  18  GLY GLY A . n 
A 1 20  SER 20  19  19  SER SER A . n 
A 1 21  GLY 21  20  20  GLY GLY A . n 
A 1 22  LYS 22  21  21  LYS LYS A . n 
A 1 23  GLY 23  22  22  GLY GLY A . n 
A 1 24  THR 24  23  23  THR THR A . n 
A 1 25  GLN 25  24  24  GLN GLN A . n 
A 1 26  CYS 26  25  25  CYS CYS A . n 
A 1 27  GLU 27  26  26  GLU GLU A . n 
A 1 28  LYS 28  27  27  LYS LYS A . n 
A 1 29  ILE 29  28  28  ILE ILE A . n 
A 1 30  VAL 30  29  29  VAL VAL A . n 
A 1 31  GLN 31  30  30  GLN GLN A . n 
A 1 32  LYS 32  31  31  LYS LYS A . n 
A 1 33  TYR 33  32  32  TYR TYR A . n 
A 1 34  GLY 34  33  33  GLY GLY A . n 
A 1 35  TYR 35  34  34  TYR TYR A . n 
A 1 36  THR 36  35  35  THR THR A . n 
A 1 37  HIS 37  36  36  HIS HIS A . n 
A 1 38  LEU 38  37  37  LEU LEU A . n 
A 1 39  SER 39  38  38  SER SER A . n 
A 1 40  THR 40  39  39  THR THR A . n 
A 1 41  GLY 41  40  40  GLY GLY A . n 
A 1 42  ASP 42  41  41  ASP ASP A . n 
A 1 43  LEU 43  42  42  LEU LEU A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  ARG 45  44  44  ARG ARG A . n 
A 1 46  SER 46  45  45  SER SER A . n 
A 1 47  GLU 47  46  46  GLU GLU A . n 
A 1 48  VAL 48  47  47  VAL VAL A . n 
A 1 49  SER 49  48  48  SER SER A . n 
A 1 50  SER 50  49  49  SER SER A . n 
A 1 51  GLY 51  50  50  GLY GLY A . n 
A 1 52  SER 52  51  51  SER SER A . n 
A 1 53  ALA 53  52  52  ALA ALA A . n 
A 1 54  ARG 54  53  53  ARG ARG A . n 
A 1 55  GLY 55  54  54  GLY GLY A . n 
A 1 56  LYS 56  55  55  LYS LYS A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  LEU 58  57  57  LEU LEU A . n 
A 1 59  SER 59  58  58  SER SER A . n 
A 1 60  GLU 60  59  59  GLU GLU A . n 
A 1 61  ILE 61  60  60  ILE ILE A . n 
A 1 62  MET 62  61  61  MET MET A . n 
A 1 63  GLU 63  62  62  GLU GLU A . n 
A 1 64  LYS 64  63  63  LYS LYS A . n 
A 1 65  GLY 65  64  64  GLY GLY A . n 
A 1 66  GLN 66  65  65  GLN GLN A . n 
A 1 67  LEU 67  66  66  LEU LEU A . n 
A 1 68  VAL 68  67  67  VAL VAL A . n 
A 1 69  PRO 69  68  68  PRO PRO A . n 
A 1 70  LEU 70  69  69  LEU LEU A . n 
A 1 71  GLU 71  70  70  GLU GLU A . n 
A 1 72  THR 72  71  71  THR THR A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  LEU 74  73  73  LEU LEU A . n 
A 1 75  ASP 75  74  74  ASP ASP A . n 
A 1 76  MET 76  75  75  MET MET A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  ARG 78  77  77  ARG ARG A . n 
A 1 79  ASP 79  78  78  ASP ASP A . n 
A 1 80  ALA 80  79  79  ALA ALA A . n 
A 1 81  MET 81  80  80  MET MET A . n 
A 1 82  VAL 82  81  81  VAL VAL A . n 
A 1 83  ALA 83  82  82  ALA ALA A . n 
A 1 84  LYS 84  83  83  LYS LYS A . n 
A 1 85  VAL 85  84  84  VAL VAL A . n 
A 1 86  ASN 86  85  85  ASN ASN A . n 
A 1 87  THR 87  86  86  THR THR A . n 
A 1 88  SER 88  87  87  SER SER A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  GLY 90  89  89  GLY GLY A . n 
A 1 91  PHE 91  90  90  PHE PHE A . n 
A 1 92  LEU 92  91  91  LEU LEU A . n 
A 1 93  ILE 93  92  92  ILE ILE A . n 
A 1 94  ASP 94  93  93  ASP ASP A . n 
A 1 95  GLY 95  94  94  GLY GLY A . n 
A 1 96  TYR 96  95  95  TYR TYR A . n 
A 1 97  PRO 97  96  96  PRO PRO A . n 
A 1 98  ARG 98  97  97  ARG ARG A . n 
A 1 99  GLU 99  98  98  GLU GLU A . n 
A 1 100 VAL 100 99  99  VAL VAL A . n 
A 1 101 GLN 101 100 100 GLN GLN A . n 
A 1 102 GLN 102 101 101 GLN GLN A . n 
A 1 103 GLY 103 102 102 GLY GLY A . n 
A 1 104 GLU 104 103 103 GLU GLU A . n 
A 1 105 GLU 105 104 104 GLU GLU A . n 
A 1 106 PHE 106 105 105 PHE PHE A . n 
A 1 107 GLU 107 106 106 GLU GLU A . n 
A 1 108 ARG 108 107 107 ARG ARG A . n 
A 1 109 ARG 109 108 108 ARG ARG A . n 
A 1 110 ILE 110 109 109 ILE ILE A . n 
A 1 111 GLY 111 110 110 GLY GLY A . n 
A 1 112 GLN 112 111 111 GLN GLN A . n 
A 1 113 PRO 113 112 112 PRO PRO A . n 
A 1 114 THR 114 113 113 THR THR A . n 
A 1 115 LEU 115 114 114 LEU LEU A . n 
A 1 116 LEU 116 115 115 LEU LEU A . n 
A 1 117 LEU 117 116 116 LEU LEU A . n 
A 1 118 TYR 118 117 117 TYR TYR A . n 
A 1 119 VAL 119 118 118 VAL VAL A . n 
A 1 120 ASP 120 119 119 ASP ASP A . n 
A 1 121 ALA 121 120 120 ALA ALA A . n 
A 1 122 GLY 122 121 121 GLY GLY A . n 
A 1 123 PRO 123 122 122 PRO PRO A . n 
A 1 124 GLU 124 123 123 GLU GLU A . n 
A 1 125 THR 125 124 124 THR THR A . n 
A 1 126 MET 126 125 125 MET MET A . n 
A 1 127 THR 127 126 126 THR THR A . n 
A 1 128 GLN 128 127 127 GLN GLN A . n 
A 1 129 ARG 129 128 128 ARG ARG A . n 
A 1 130 LEU 130 129 129 LEU LEU A . n 
A 1 131 LEU 131 130 130 LEU LEU A . n 
A 1 132 LYS 132 131 131 LYS LYS A . n 
A 1 133 ARG 133 132 132 ARG ARG A . n 
A 1 134 GLY 134 133 133 GLY GLY A . n 
A 1 135 GLU 135 134 134 GLU GLU A . n 
A 1 136 THR 136 135 135 THR THR A . n 
A 1 137 SER 137 136 136 SER SER A . n 
A 1 138 GLY 138 137 137 GLY GLY A . n 
A 1 139 ARG 139 138 138 ARG ARG A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 ASP 141 140 140 ASP ASP A . n 
A 1 142 ASP 142 141 141 ASP ASP A . n 
A 1 143 ASN 143 142 142 ASN ASN A . n 
A 1 144 GLU 144 143 143 GLU GLU A . n 
A 1 145 GLU 145 144 144 GLU GLU A . n 
A 1 146 THR 146 145 145 THR THR A . n 
A 1 147 ILE 147 146 146 ILE ILE A . n 
A 1 148 LYS 148 147 147 LYS LYS A . n 
A 1 149 LYS 149 148 148 LYS LYS A . n 
A 1 150 ARG 150 149 149 ARG ARG A . n 
A 1 151 LEU 151 150 150 LEU LEU A . n 
A 1 152 GLU 152 151 151 GLU GLU A . n 
A 1 153 THR 153 152 152 THR THR A . n 
A 1 154 TYR 154 153 153 TYR TYR A . n 
A 1 155 TYR 155 154 154 TYR TYR A . n 
A 1 156 LYS 156 155 155 LYS LYS A . n 
A 1 157 ALA 157 156 156 ALA ALA A . n 
A 1 158 THR 158 157 157 THR THR A . n 
A 1 159 GLU 159 158 158 GLU GLU A . n 
A 1 160 PRO 160 159 159 PRO PRO A . n 
A 1 161 VAL 161 160 160 VAL VAL A . n 
A 1 162 ILE 162 161 161 ILE ILE A . n 
A 1 163 ALA 163 162 162 ALA ALA A . n 
A 1 164 PHE 164 163 163 PHE PHE A . n 
A 1 165 TYR 165 164 164 TYR TYR A . n 
A 1 166 GLU 166 165 165 GLU GLU A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 ARG 168 167 167 ARG ARG A . n 
A 1 169 GLY 169 168 168 GLY GLY A . n 
A 1 170 ILE 170 169 169 ILE ILE A . n 
A 1 171 VAL 171 170 170 VAL VAL A . n 
A 1 172 ARG 172 171 171 ARG ARG A . n 
A 1 173 LYS 173 172 172 LYS LYS A . n 
A 1 174 VAL 174 173 173 VAL VAL A . n 
A 1 175 ASN 175 174 174 ASN ASN A . n 
A 1 176 ALA 176 175 175 ALA ALA A . n 
A 1 177 GLU 177 176 176 GLU GLU A . n 
A 1 178 GLY 178 177 177 GLY GLY A . n 
A 1 179 SER 179 178 178 SER SER A . n 
A 1 180 VAL 180 179 179 VAL VAL A . n 
A 1 181 ASP 181 180 180 ASP ASP A . n 
A 1 182 SER 182 181 181 SER SER A . n 
A 1 183 VAL 183 182 182 VAL VAL A . n 
A 1 184 PHE 184 183 183 PHE PHE A . n 
A 1 185 SER 185 184 184 SER SER A . n 
A 1 186 GLN 186 185 185 GLN GLN A . n 
A 1 187 VAL 187 186 186 VAL VAL A . n 
A 1 188 CYS 188 187 187 CYS CYS A . n 
A 1 189 THR 189 188 188 THR THR A . n 
A 1 190 HIS 190 189 189 HIS HIS A . n 
A 1 191 LEU 191 190 190 LEU LEU A . n 
A 1 192 ASP 192 191 191 ASP ASP A . n 
A 1 193 ALA 193 192 192 ALA ALA A . n 
A 1 194 LEU 194 193 193 LEU LEU A . n 
A 1 195 LEU 195 194 194 LEU LEU A . n 
A 1 196 ASN 196 195 ?   ?   ?   A . n 
B 1 1   SER 1   0   0   SER SER B . n 
B 1 2   MET 2   1   1   MET MET B . n 
B 1 3   GLU 3   2   2   GLU GLU B . n 
B 1 4   GLU 4   3   3   GLU GLU B . n 
B 1 5   LYS 5   4   4   LYS LYS B . n 
B 1 6   LEU 6   5   5   LEU LEU B . n 
B 1 7   LYS 7   6   6   LYS LYS B . n 
B 1 8   LYS 8   7   7   LYS LYS B . n 
B 1 9   THR 9   8   8   THR THR B . n 
B 1 10  ASN 10  9   9   ASN ASN B . n 
B 1 11  ILE 11  10  10  ILE ILE B . n 
B 1 12  ILE 12  11  11  ILE ILE B . n 
B 1 13  PHE 13  12  12  PHE PHE B . n 
B 1 14  VAL 14  13  13  VAL VAL B . n 
B 1 15  VAL 15  14  14  VAL VAL B . n 
B 1 16  GLY 16  15  15  GLY GLY B . n 
B 1 17  GLY 17  16  16  GLY GLY B . n 
B 1 18  PRO 18  17  17  PRO PRO B . n 
B 1 19  GLY 19  18  18  GLY GLY B . n 
B 1 20  SER 20  19  19  SER SER B . n 
B 1 21  GLY 21  20  20  GLY GLY B . n 
B 1 22  LYS 22  21  21  LYS LYS B . n 
B 1 23  GLY 23  22  22  GLY GLY B . n 
B 1 24  THR 24  23  23  THR THR B . n 
B 1 25  GLN 25  24  24  GLN GLN B . n 
B 1 26  CYS 26  25  25  CYS CYS B . n 
B 1 27  GLU 27  26  26  GLU GLU B . n 
B 1 28  LYS 28  27  27  LYS LYS B . n 
B 1 29  ILE 29  28  28  ILE ILE B . n 
B 1 30  VAL 30  29  29  VAL VAL B . n 
B 1 31  GLN 31  30  30  GLN GLN B . n 
B 1 32  LYS 32  31  31  LYS LYS B . n 
B 1 33  TYR 33  32  32  TYR TYR B . n 
B 1 34  GLY 34  33  33  GLY GLY B . n 
B 1 35  TYR 35  34  34  TYR TYR B . n 
B 1 36  THR 36  35  35  THR THR B . n 
B 1 37  HIS 37  36  36  HIS HIS B . n 
B 1 38  LEU 38  37  37  LEU LEU B . n 
B 1 39  SER 39  38  38  SER SER B . n 
B 1 40  THR 40  39  39  THR THR B . n 
B 1 41  GLY 41  40  40  GLY GLY B . n 
B 1 42  ASP 42  41  41  ASP ASP B . n 
B 1 43  LEU 43  42  42  LEU LEU B . n 
B 1 44  LEU 44  43  43  LEU LEU B . n 
B 1 45  ARG 45  44  44  ARG ARG B . n 
B 1 46  SER 46  45  45  SER SER B . n 
B 1 47  GLU 47  46  46  GLU GLU B . n 
B 1 48  VAL 48  47  47  VAL VAL B . n 
B 1 49  SER 49  48  48  SER SER B . n 
B 1 50  SER 50  49  49  SER SER B . n 
B 1 51  GLY 51  50  50  GLY GLY B . n 
B 1 52  SER 52  51  51  SER SER B . n 
B 1 53  ALA 53  52  52  ALA ALA B . n 
B 1 54  ARG 54  53  53  ARG ARG B . n 
B 1 55  GLY 55  54  54  GLY GLY B . n 
B 1 56  LYS 56  55  55  LYS LYS B . n 
B 1 57  LYS 57  56  56  LYS LYS B . n 
B 1 58  LEU 58  57  57  LEU LEU B . n 
B 1 59  SER 59  58  58  SER SER B . n 
B 1 60  GLU 60  59  59  GLU GLU B . n 
B 1 61  ILE 61  60  60  ILE ILE B . n 
B 1 62  MET 62  61  61  MET MET B . n 
B 1 63  GLU 63  62  62  GLU GLU B . n 
B 1 64  LYS 64  63  63  LYS LYS B . n 
B 1 65  GLY 65  64  64  GLY GLY B . n 
B 1 66  GLN 66  65  65  GLN GLN B . n 
B 1 67  LEU 67  66  66  LEU LEU B . n 
B 1 68  VAL 68  67  67  VAL VAL B . n 
B 1 69  PRO 69  68  68  PRO PRO B . n 
B 1 70  LEU 70  69  69  LEU LEU B . n 
B 1 71  GLU 71  70  70  GLU GLU B . n 
B 1 72  THR 72  71  71  THR THR B . n 
B 1 73  VAL 73  72  72  VAL VAL B . n 
B 1 74  LEU 74  73  73  LEU LEU B . n 
B 1 75  ASP 75  74  74  ASP ASP B . n 
B 1 76  MET 76  75  75  MET MET B . n 
B 1 77  LEU 77  76  76  LEU LEU B . n 
B 1 78  ARG 78  77  77  ARG ARG B . n 
B 1 79  ASP 79  78  78  ASP ASP B . n 
B 1 80  ALA 80  79  79  ALA ALA B . n 
B 1 81  MET 81  80  80  MET MET B . n 
B 1 82  VAL 82  81  81  VAL VAL B . n 
B 1 83  ALA 83  82  82  ALA ALA B . n 
B 1 84  LYS 84  83  83  LYS LYS B . n 
B 1 85  VAL 85  84  84  VAL VAL B . n 
B 1 86  ASN 86  85  85  ASN ASN B . n 
B 1 87  THR 87  86  86  THR THR B . n 
B 1 88  SER 88  87  87  SER SER B . n 
B 1 89  LYS 89  88  88  LYS LYS B . n 
B 1 90  GLY 90  89  89  GLY GLY B . n 
B 1 91  PHE 91  90  90  PHE PHE B . n 
B 1 92  LEU 92  91  91  LEU LEU B . n 
B 1 93  ILE 93  92  92  ILE ILE B . n 
B 1 94  ASP 94  93  93  ASP ASP B . n 
B 1 95  GLY 95  94  94  GLY GLY B . n 
B 1 96  TYR 96  95  95  TYR TYR B . n 
B 1 97  PRO 97  96  96  PRO PRO B . n 
B 1 98  ARG 98  97  97  ARG ARG B . n 
B 1 99  GLU 99  98  98  GLU GLU B . n 
B 1 100 VAL 100 99  99  VAL VAL B . n 
B 1 101 GLN 101 100 100 GLN GLN B . n 
B 1 102 GLN 102 101 101 GLN GLN B . n 
B 1 103 GLY 103 102 102 GLY GLY B . n 
B 1 104 GLU 104 103 103 GLU GLU B . n 
B 1 105 GLU 105 104 104 GLU GLU B . n 
B 1 106 PHE 106 105 105 PHE PHE B . n 
B 1 107 GLU 107 106 106 GLU GLU B . n 
B 1 108 ARG 108 107 107 ARG ARG B . n 
B 1 109 ARG 109 108 108 ARG ARG B . n 
B 1 110 ILE 110 109 109 ILE ILE B . n 
B 1 111 GLY 111 110 110 GLY GLY B . n 
B 1 112 GLN 112 111 111 GLN GLN B . n 
B 1 113 PRO 113 112 112 PRO PRO B . n 
B 1 114 THR 114 113 113 THR THR B . n 
B 1 115 LEU 115 114 114 LEU LEU B . n 
B 1 116 LEU 116 115 115 LEU LEU B . n 
B 1 117 LEU 117 116 116 LEU LEU B . n 
B 1 118 TYR 118 117 117 TYR TYR B . n 
B 1 119 VAL 119 118 118 VAL VAL B . n 
B 1 120 ASP 120 119 119 ASP ASP B . n 
B 1 121 ALA 121 120 120 ALA ALA B . n 
B 1 122 GLY 122 121 121 GLY GLY B . n 
B 1 123 PRO 123 122 122 PRO PRO B . n 
B 1 124 GLU 124 123 123 GLU GLU B . n 
B 1 125 THR 125 124 124 THR THR B . n 
B 1 126 MET 126 125 125 MET MET B . n 
B 1 127 THR 127 126 126 THR THR B . n 
B 1 128 GLN 128 127 127 GLN GLN B . n 
B 1 129 ARG 129 128 128 ARG ARG B . n 
B 1 130 LEU 130 129 129 LEU LEU B . n 
B 1 131 LEU 131 130 130 LEU LEU B . n 
B 1 132 LYS 132 131 131 LYS LYS B . n 
B 1 133 ARG 133 132 132 ARG ARG B . n 
B 1 134 GLY 134 133 133 GLY GLY B . n 
B 1 135 GLU 135 134 134 GLU GLU B . n 
B 1 136 THR 136 135 135 THR THR B . n 
B 1 137 SER 137 136 136 SER SER B . n 
B 1 138 GLY 138 137 137 GLY GLY B . n 
B 1 139 ARG 139 138 138 ARG ARG B . n 
B 1 140 VAL 140 139 139 VAL VAL B . n 
B 1 141 ASP 141 140 140 ASP ASP B . n 
B 1 142 ASP 142 141 141 ASP ASP B . n 
B 1 143 ASN 143 142 142 ASN ASN B . n 
B 1 144 GLU 144 143 143 GLU GLU B . n 
B 1 145 GLU 145 144 144 GLU GLU B . n 
B 1 146 THR 146 145 145 THR THR B . n 
B 1 147 ILE 147 146 146 ILE ILE B . n 
B 1 148 LYS 148 147 147 LYS LYS B . n 
B 1 149 LYS 149 148 148 LYS LYS B . n 
B 1 150 ARG 150 149 149 ARG ARG B . n 
B 1 151 LEU 151 150 150 LEU LEU B . n 
B 1 152 GLU 152 151 151 GLU GLU B . n 
B 1 153 THR 153 152 152 THR THR B . n 
B 1 154 TYR 154 153 153 TYR TYR B . n 
B 1 155 TYR 155 154 154 TYR TYR B . n 
B 1 156 LYS 156 155 155 LYS LYS B . n 
B 1 157 ALA 157 156 156 ALA ALA B . n 
B 1 158 THR 158 157 157 THR THR B . n 
B 1 159 GLU 159 158 158 GLU GLU B . n 
B 1 160 PRO 160 159 159 PRO PRO B . n 
B 1 161 VAL 161 160 160 VAL VAL B . n 
B 1 162 ILE 162 161 161 ILE ILE B . n 
B 1 163 ALA 163 162 162 ALA ALA B . n 
B 1 164 PHE 164 163 163 PHE PHE B . n 
B 1 165 TYR 165 164 164 TYR TYR B . n 
B 1 166 GLU 166 165 165 GLU GLU B . n 
B 1 167 LYS 167 166 166 LYS LYS B . n 
B 1 168 ARG 168 167 167 ARG ARG B . n 
B 1 169 GLY 169 168 168 GLY GLY B . n 
B 1 170 ILE 170 169 169 ILE ILE B . n 
B 1 171 VAL 171 170 170 VAL VAL B . n 
B 1 172 ARG 172 171 171 ARG ARG B . n 
B 1 173 LYS 173 172 172 LYS LYS B . n 
B 1 174 VAL 174 173 173 VAL VAL B . n 
B 1 175 ASN 175 174 174 ASN ASN B . n 
B 1 176 ALA 176 175 175 ALA ALA B . n 
B 1 177 GLU 177 176 176 GLU GLU B . n 
B 1 178 GLY 178 177 177 GLY GLY B . n 
B 1 179 SER 179 178 178 SER SER B . n 
B 1 180 VAL 180 179 179 VAL VAL B . n 
B 1 181 ASP 181 180 180 ASP ASP B . n 
B 1 182 SER 182 181 181 SER SER B . n 
B 1 183 VAL 183 182 182 VAL VAL B . n 
B 1 184 PHE 184 183 183 PHE PHE B . n 
B 1 185 SER 185 184 184 SER SER B . n 
B 1 186 GLN 186 185 185 GLN GLN B . n 
B 1 187 VAL 187 186 186 VAL VAL B . n 
B 1 188 CYS 188 187 187 CYS CYS B . n 
B 1 189 THR 189 188 188 THR THR B . n 
B 1 190 HIS 190 189 189 HIS HIS B . n 
B 1 191 LEU 191 190 190 LEU LEU B . n 
B 1 192 ASP 192 191 191 ASP ASP B . n 
B 1 193 ALA 193 192 192 ALA ALA B . n 
B 1 194 LEU 194 193 193 LEU LEU B . n 
B 1 195 LEU 195 194 194 LEU LEU B . n 
B 1 196 ASN 196 195 ?   ?   ?   B . n 
C 1 1   SER 1   0   0   SER SER C . n 
C 1 2   MET 2   1   1   MET MET C . n 
C 1 3   GLU 3   2   2   GLU GLU C . n 
C 1 4   GLU 4   3   3   GLU GLU C . n 
C 1 5   LYS 5   4   4   LYS LYS C . n 
C 1 6   LEU 6   5   5   LEU LEU C . n 
C 1 7   LYS 7   6   6   LYS LYS C . n 
C 1 8   LYS 8   7   7   LYS LYS C . n 
C 1 9   THR 9   8   8   THR THR C . n 
C 1 10  ASN 10  9   9   ASN ASN C . n 
C 1 11  ILE 11  10  10  ILE ILE C . n 
C 1 12  ILE 12  11  11  ILE ILE C . n 
C 1 13  PHE 13  12  12  PHE PHE C . n 
C 1 14  VAL 14  13  13  VAL VAL C . n 
C 1 15  VAL 15  14  14  VAL VAL C . n 
C 1 16  GLY 16  15  15  GLY GLY C . n 
C 1 17  GLY 17  16  16  GLY GLY C . n 
C 1 18  PRO 18  17  17  PRO PRO C . n 
C 1 19  GLY 19  18  18  GLY GLY C . n 
C 1 20  SER 20  19  19  SER SER C . n 
C 1 21  GLY 21  20  20  GLY GLY C . n 
C 1 22  LYS 22  21  21  LYS LYS C . n 
C 1 23  GLY 23  22  22  GLY GLY C . n 
C 1 24  THR 24  23  23  THR THR C . n 
C 1 25  GLN 25  24  24  GLN GLN C . n 
C 1 26  CYS 26  25  25  CYS CYS C . n 
C 1 27  GLU 27  26  26  GLU GLU C . n 
C 1 28  LYS 28  27  27  LYS LYS C . n 
C 1 29  ILE 29  28  28  ILE ILE C . n 
C 1 30  VAL 30  29  29  VAL VAL C . n 
C 1 31  GLN 31  30  30  GLN GLN C . n 
C 1 32  LYS 32  31  31  LYS LYS C . n 
C 1 33  TYR 33  32  32  TYR TYR C . n 
C 1 34  GLY 34  33  33  GLY GLY C . n 
C 1 35  TYR 35  34  34  TYR TYR C . n 
C 1 36  THR 36  35  35  THR THR C . n 
C 1 37  HIS 37  36  36  HIS HIS C . n 
C 1 38  LEU 38  37  37  LEU LEU C . n 
C 1 39  SER 39  38  38  SER SER C . n 
C 1 40  THR 40  39  39  THR THR C . n 
C 1 41  GLY 41  40  40  GLY GLY C . n 
C 1 42  ASP 42  41  41  ASP ASP C . n 
C 1 43  LEU 43  42  42  LEU LEU C . n 
C 1 44  LEU 44  43  43  LEU LEU C . n 
C 1 45  ARG 45  44  44  ARG ARG C . n 
C 1 46  SER 46  45  45  SER SER C . n 
C 1 47  GLU 47  46  46  GLU GLU C . n 
C 1 48  VAL 48  47  47  VAL VAL C . n 
C 1 49  SER 49  48  48  SER SER C . n 
C 1 50  SER 50  49  49  SER SER C . n 
C 1 51  GLY 51  50  50  GLY GLY C . n 
C 1 52  SER 52  51  51  SER SER C . n 
C 1 53  ALA 53  52  52  ALA ALA C . n 
C 1 54  ARG 54  53  53  ARG ARG C . n 
C 1 55  GLY 55  54  54  GLY GLY C . n 
C 1 56  LYS 56  55  55  LYS LYS C . n 
C 1 57  LYS 57  56  56  LYS LYS C . n 
C 1 58  LEU 58  57  57  LEU LEU C . n 
C 1 59  SER 59  58  58  SER SER C . n 
C 1 60  GLU 60  59  59  GLU GLU C . n 
C 1 61  ILE 61  60  60  ILE ILE C . n 
C 1 62  MET 62  61  61  MET MET C . n 
C 1 63  GLU 63  62  62  GLU GLU C . n 
C 1 64  LYS 64  63  63  LYS LYS C . n 
C 1 65  GLY 65  64  64  GLY GLY C . n 
C 1 66  GLN 66  65  65  GLN GLN C . n 
C 1 67  LEU 67  66  66  LEU LEU C . n 
C 1 68  VAL 68  67  67  VAL VAL C . n 
C 1 69  PRO 69  68  68  PRO PRO C . n 
C 1 70  LEU 70  69  69  LEU LEU C . n 
C 1 71  GLU 71  70  70  GLU GLU C . n 
C 1 72  THR 72  71  71  THR THR C . n 
C 1 73  VAL 73  72  72  VAL VAL C . n 
C 1 74  LEU 74  73  73  LEU LEU C . n 
C 1 75  ASP 75  74  74  ASP ASP C . n 
C 1 76  MET 76  75  75  MET MET C . n 
C 1 77  LEU 77  76  76  LEU LEU C . n 
C 1 78  ARG 78  77  77  ARG ARG C . n 
C 1 79  ASP 79  78  78  ASP ASP C . n 
C 1 80  ALA 80  79  79  ALA ALA C . n 
C 1 81  MET 81  80  80  MET MET C . n 
C 1 82  VAL 82  81  81  VAL VAL C . n 
C 1 83  ALA 83  82  82  ALA ALA C . n 
C 1 84  LYS 84  83  83  LYS LYS C . n 
C 1 85  VAL 85  84  84  VAL VAL C . n 
C 1 86  ASN 86  85  85  ASN ASN C . n 
C 1 87  THR 87  86  86  THR THR C . n 
C 1 88  SER 88  87  87  SER SER C . n 
C 1 89  LYS 89  88  88  LYS LYS C . n 
C 1 90  GLY 90  89  89  GLY GLY C . n 
C 1 91  PHE 91  90  90  PHE PHE C . n 
C 1 92  LEU 92  91  91  LEU LEU C . n 
C 1 93  ILE 93  92  92  ILE ILE C . n 
C 1 94  ASP 94  93  93  ASP ASP C . n 
C 1 95  GLY 95  94  94  GLY GLY C . n 
C 1 96  TYR 96  95  95  TYR TYR C . n 
C 1 97  PRO 97  96  96  PRO PRO C . n 
C 1 98  ARG 98  97  97  ARG ARG C . n 
C 1 99  GLU 99  98  98  GLU GLU C . n 
C 1 100 VAL 100 99  99  VAL VAL C . n 
C 1 101 GLN 101 100 100 GLN GLN C . n 
C 1 102 GLN 102 101 101 GLN GLN C . n 
C 1 103 GLY 103 102 102 GLY GLY C . n 
C 1 104 GLU 104 103 103 GLU GLU C . n 
C 1 105 GLU 105 104 104 GLU GLU C . n 
C 1 106 PHE 106 105 105 PHE PHE C . n 
C 1 107 GLU 107 106 106 GLU GLU C . n 
C 1 108 ARG 108 107 107 ARG ARG C . n 
C 1 109 ARG 109 108 108 ARG ARG C . n 
C 1 110 ILE 110 109 109 ILE ILE C . n 
C 1 111 GLY 111 110 110 GLY GLY C . n 
C 1 112 GLN 112 111 111 GLN GLN C . n 
C 1 113 PRO 113 112 112 PRO PRO C . n 
C 1 114 THR 114 113 113 THR THR C . n 
C 1 115 LEU 115 114 114 LEU LEU C . n 
C 1 116 LEU 116 115 115 LEU LEU C . n 
C 1 117 LEU 117 116 116 LEU LEU C . n 
C 1 118 TYR 118 117 117 TYR TYR C . n 
C 1 119 VAL 119 118 118 VAL VAL C . n 
C 1 120 ASP 120 119 119 ASP ASP C . n 
C 1 121 ALA 121 120 120 ALA ALA C . n 
C 1 122 GLY 122 121 121 GLY GLY C . n 
C 1 123 PRO 123 122 122 PRO PRO C . n 
C 1 124 GLU 124 123 123 GLU GLU C . n 
C 1 125 THR 125 124 124 THR THR C . n 
C 1 126 MET 126 125 125 MET MET C . n 
C 1 127 THR 127 126 126 THR THR C . n 
C 1 128 GLN 128 127 127 GLN GLN C . n 
C 1 129 ARG 129 128 128 ARG ARG C . n 
C 1 130 LEU 130 129 129 LEU LEU C . n 
C 1 131 LEU 131 130 130 LEU LEU C . n 
C 1 132 LYS 132 131 131 LYS LYS C . n 
C 1 133 ARG 133 132 132 ARG ARG C . n 
C 1 134 GLY 134 133 133 GLY GLY C . n 
C 1 135 GLU 135 134 134 GLU GLU C . n 
C 1 136 THR 136 135 135 THR THR C . n 
C 1 137 SER 137 136 136 SER SER C . n 
C 1 138 GLY 138 137 137 GLY GLY C . n 
C 1 139 ARG 139 138 138 ARG ARG C . n 
C 1 140 VAL 140 139 139 VAL VAL C . n 
C 1 141 ASP 141 140 140 ASP ASP C . n 
C 1 142 ASP 142 141 141 ASP ASP C . n 
C 1 143 ASN 143 142 142 ASN ASN C . n 
C 1 144 GLU 144 143 143 GLU GLU C . n 
C 1 145 GLU 145 144 144 GLU GLU C . n 
C 1 146 THR 146 145 145 THR THR C . n 
C 1 147 ILE 147 146 146 ILE ILE C . n 
C 1 148 LYS 148 147 147 LYS LYS C . n 
C 1 149 LYS 149 148 148 LYS LYS C . n 
C 1 150 ARG 150 149 149 ARG ARG C . n 
C 1 151 LEU 151 150 150 LEU LEU C . n 
C 1 152 GLU 152 151 151 GLU GLU C . n 
C 1 153 THR 153 152 152 THR THR C . n 
C 1 154 TYR 154 153 153 TYR TYR C . n 
C 1 155 TYR 155 154 154 TYR TYR C . n 
C 1 156 LYS 156 155 155 LYS LYS C . n 
C 1 157 ALA 157 156 156 ALA ALA C . n 
C 1 158 THR 158 157 157 THR THR C . n 
C 1 159 GLU 159 158 158 GLU GLU C . n 
C 1 160 PRO 160 159 159 PRO PRO C . n 
C 1 161 VAL 161 160 160 VAL VAL C . n 
C 1 162 ILE 162 161 161 ILE ILE C . n 
C 1 163 ALA 163 162 162 ALA ALA C . n 
C 1 164 PHE 164 163 163 PHE PHE C . n 
C 1 165 TYR 165 164 164 TYR TYR C . n 
C 1 166 GLU 166 165 165 GLU GLU C . n 
C 1 167 LYS 167 166 166 LYS LYS C . n 
C 1 168 ARG 168 167 167 ARG ARG C . n 
C 1 169 GLY 169 168 168 GLY GLY C . n 
C 1 170 ILE 170 169 169 ILE ILE C . n 
C 1 171 VAL 171 170 170 VAL VAL C . n 
C 1 172 ARG 172 171 171 ARG ARG C . n 
C 1 173 LYS 173 172 172 LYS LYS C . n 
C 1 174 VAL 174 173 173 VAL VAL C . n 
C 1 175 ASN 175 174 174 ASN ASN C . n 
C 1 176 ALA 176 175 175 ALA ALA C . n 
C 1 177 GLU 177 176 176 GLU GLU C . n 
C 1 178 GLY 178 177 177 GLY GLY C . n 
C 1 179 SER 179 178 178 SER SER C . n 
C 1 180 VAL 180 179 179 VAL VAL C . n 
C 1 181 ASP 181 180 180 ASP ASP C . n 
C 1 182 SER 182 181 181 SER SER C . n 
C 1 183 VAL 183 182 182 VAL VAL C . n 
C 1 184 PHE 184 183 183 PHE PHE C . n 
C 1 185 SER 185 184 184 SER SER C . n 
C 1 186 GLN 186 185 185 GLN GLN C . n 
C 1 187 VAL 187 186 186 VAL VAL C . n 
C 1 188 CYS 188 187 187 CYS CYS C . n 
C 1 189 THR 189 188 188 THR THR C . n 
C 1 190 HIS 190 189 189 HIS HIS C . n 
C 1 191 LEU 191 190 190 LEU LEU C . n 
C 1 192 ASP 192 191 191 ASP ASP C . n 
C 1 193 ALA 193 192 192 ALA ALA C . n 
C 1 194 LEU 194 193 193 LEU LEU C . n 
C 1 195 LEU 195 194 194 LEU LEU C . n 
C 1 196 ASN 196 195 ?   ?   ?   C . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 ZN  1   601 601 ZN  ZN  A . 
E 2 ZN  1   641 641 ZN  ZN  A . 
F 3 SO4 1   702 702 SO4 SO4 A . 
G 4 AP5 1   631 631 AP5 AP5 A . 
H 2 ZN  1   611 611 ZN  ZN  B . 
I 2 ZN  1   642 642 ZN  ZN  B . 
J 2 ZN  1   643 643 ZN  ZN  B . 
K 3 SO4 1   701 701 SO4 SO4 B . 
L 3 SO4 1   703 703 SO4 SO4 B . 
M 4 AP5 1   632 632 AP5 AP5 B . 
N 2 ZN  1   621 621 ZN  ZN  C . 
O 2 ZN  1   644 644 ZN  ZN  C . 
P 2 ZN  1   645 645 ZN  ZN  C . 
Q 4 AP5 1   633 633 AP5 AP5 C . 
R 5 HOH 1   703 602 HOH HOH A . 
R 5 HOH 2   704 603 HOH HOH A . 
R 5 HOH 3   705 5   HOH HOH A . 
R 5 HOH 4   706 6   HOH HOH A . 
R 5 HOH 5   707 7   HOH HOH A . 
R 5 HOH 6   708 8   HOH HOH A . 
R 5 HOH 7   709 9   HOH HOH A . 
R 5 HOH 8   710 10  HOH HOH A . 
R 5 HOH 9   711 11  HOH HOH A . 
R 5 HOH 10  712 12  HOH HOH A . 
R 5 HOH 11  713 15  HOH HOH A . 
R 5 HOH 12  714 17  HOH HOH A . 
R 5 HOH 13  715 19  HOH HOH A . 
R 5 HOH 14  716 20  HOH HOH A . 
R 5 HOH 15  717 21  HOH HOH A . 
R 5 HOH 16  718 23  HOH HOH A . 
R 5 HOH 17  719 25  HOH HOH A . 
R 5 HOH 18  720 26  HOH HOH A . 
R 5 HOH 19  721 28  HOH HOH A . 
R 5 HOH 20  722 29  HOH HOH A . 
R 5 HOH 21  723 30  HOH HOH A . 
R 5 HOH 22  724 32  HOH HOH A . 
R 5 HOH 23  725 33  HOH HOH A . 
R 5 HOH 24  726 36  HOH HOH A . 
R 5 HOH 25  727 40  HOH HOH A . 
R 5 HOH 26  728 41  HOH HOH A . 
R 5 HOH 27  729 43  HOH HOH A . 
R 5 HOH 28  730 44  HOH HOH A . 
R 5 HOH 29  731 45  HOH HOH A . 
R 5 HOH 30  732 46  HOH HOH A . 
R 5 HOH 31  733 48  HOH HOH A . 
R 5 HOH 32  734 49  HOH HOH A . 
R 5 HOH 33  735 51  HOH HOH A . 
R 5 HOH 34  736 52  HOH HOH A . 
R 5 HOH 35  737 53  HOH HOH A . 
R 5 HOH 36  738 55  HOH HOH A . 
R 5 HOH 37  739 58  HOH HOH A . 
R 5 HOH 38  740 61  HOH HOH A . 
R 5 HOH 39  741 66  HOH HOH A . 
R 5 HOH 40  742 70  HOH HOH A . 
R 5 HOH 41  743 75  HOH HOH A . 
R 5 HOH 42  744 76  HOH HOH A . 
R 5 HOH 43  745 79  HOH HOH A . 
R 5 HOH 44  746 84  HOH HOH A . 
R 5 HOH 45  747 87  HOH HOH A . 
R 5 HOH 46  748 88  HOH HOH A . 
R 5 HOH 47  749 90  HOH HOH A . 
R 5 HOH 48  750 91  HOH HOH A . 
R 5 HOH 49  751 93  HOH HOH A . 
R 5 HOH 50  752 97  HOH HOH A . 
R 5 HOH 51  753 102 HOH HOH A . 
R 5 HOH 52  754 103 HOH HOH A . 
R 5 HOH 53  755 108 HOH HOH A . 
R 5 HOH 54  756 116 HOH HOH A . 
R 5 HOH 55  757 119 HOH HOH A . 
R 5 HOH 56  758 122 HOH HOH A . 
R 5 HOH 57  759 126 HOH HOH A . 
R 5 HOH 58  760 128 HOH HOH A . 
R 5 HOH 59  761 131 HOH HOH A . 
R 5 HOH 60  762 132 HOH HOH A . 
R 5 HOH 61  763 133 HOH HOH A . 
R 5 HOH 62  764 134 HOH HOH A . 
R 5 HOH 63  765 135 HOH HOH A . 
R 5 HOH 64  766 138 HOH HOH A . 
R 5 HOH 65  767 141 HOH HOH A . 
R 5 HOH 66  768 142 HOH HOH A . 
R 5 HOH 67  769 144 HOH HOH A . 
R 5 HOH 68  770 146 HOH HOH A . 
R 5 HOH 69  771 148 HOH HOH A . 
R 5 HOH 70  772 150 HOH HOH A . 
R 5 HOH 71  773 151 HOH HOH A . 
R 5 HOH 72  774 152 HOH HOH A . 
R 5 HOH 73  775 155 HOH HOH A . 
R 5 HOH 74  776 157 HOH HOH A . 
R 5 HOH 75  777 160 HOH HOH A . 
R 5 HOH 76  778 164 HOH HOH A . 
R 5 HOH 77  779 165 HOH HOH A . 
R 5 HOH 78  780 167 HOH HOH A . 
R 5 HOH 79  781 169 HOH HOH A . 
R 5 HOH 80  782 170 HOH HOH A . 
R 5 HOH 81  783 172 HOH HOH A . 
R 5 HOH 82  784 178 HOH HOH A . 
R 5 HOH 83  785 181 HOH HOH A . 
R 5 HOH 84  786 182 HOH HOH A . 
R 5 HOH 85  787 183 HOH HOH A . 
R 5 HOH 86  788 185 HOH HOH A . 
R 5 HOH 87  789 187 HOH HOH A . 
R 5 HOH 88  790 191 HOH HOH A . 
R 5 HOH 89  791 192 HOH HOH A . 
R 5 HOH 90  792 195 HOH HOH A . 
R 5 HOH 91  793 202 HOH HOH A . 
R 5 HOH 92  794 203 HOH HOH A . 
R 5 HOH 93  795 205 HOH HOH A . 
R 5 HOH 94  796 210 HOH HOH A . 
R 5 HOH 95  797 212 HOH HOH A . 
R 5 HOH 96  798 216 HOH HOH A . 
R 5 HOH 97  799 219 HOH HOH A . 
R 5 HOH 98  800 221 HOH HOH A . 
R 5 HOH 99  801 222 HOH HOH A . 
R 5 HOH 100 802 228 HOH HOH A . 
R 5 HOH 101 803 231 HOH HOH A . 
R 5 HOH 102 804 233 HOH HOH A . 
R 5 HOH 103 805 236 HOH HOH A . 
R 5 HOH 104 806 240 HOH HOH A . 
R 5 HOH 105 807 241 HOH HOH A . 
R 5 HOH 106 808 243 HOH HOH A . 
R 5 HOH 107 809 245 HOH HOH A . 
R 5 HOH 108 810 246 HOH HOH A . 
R 5 HOH 109 811 249 HOH HOH A . 
R 5 HOH 110 812 250 HOH HOH A . 
R 5 HOH 111 813 253 HOH HOH A . 
R 5 HOH 112 814 255 HOH HOH A . 
R 5 HOH 113 815 259 HOH HOH A . 
R 5 HOH 114 816 263 HOH HOH A . 
R 5 HOH 115 817 267 HOH HOH A . 
R 5 HOH 116 818 270 HOH HOH A . 
R 5 HOH 117 819 275 HOH HOH A . 
R 5 HOH 118 820 276 HOH HOH A . 
R 5 HOH 119 821 280 HOH HOH A . 
R 5 HOH 120 822 283 HOH HOH A . 
R 5 HOH 121 823 288 HOH HOH A . 
R 5 HOH 122 824 290 HOH HOH A . 
R 5 HOH 123 825 296 HOH HOH A . 
R 5 HOH 124 826 297 HOH HOH A . 
R 5 HOH 125 827 299 HOH HOH A . 
R 5 HOH 126 828 303 HOH HOH A . 
R 5 HOH 127 829 304 HOH HOH A . 
R 5 HOH 128 830 307 HOH HOH A . 
R 5 HOH 129 831 309 HOH HOH A . 
R 5 HOH 130 832 310 HOH HOH A . 
R 5 HOH 131 833 313 HOH HOH A . 
R 5 HOH 132 834 321 HOH HOH A . 
R 5 HOH 133 835 325 HOH HOH A . 
R 5 HOH 134 836 327 HOH HOH A . 
R 5 HOH 135 837 328 HOH HOH A . 
R 5 HOH 136 838 331 HOH HOH A . 
R 5 HOH 137 839 333 HOH HOH A . 
R 5 HOH 138 840 336 HOH HOH A . 
R 5 HOH 139 841 348 HOH HOH A . 
R 5 HOH 140 842 349 HOH HOH A . 
R 5 HOH 141 843 352 HOH HOH A . 
R 5 HOH 142 844 354 HOH HOH A . 
R 5 HOH 143 845 356 HOH HOH A . 
R 5 HOH 144 846 358 HOH HOH A . 
R 5 HOH 145 847 361 HOH HOH A . 
R 5 HOH 146 848 362 HOH HOH A . 
R 5 HOH 147 849 363 HOH HOH A . 
R 5 HOH 148 850 367 HOH HOH A . 
R 5 HOH 149 851 369 HOH HOH A . 
R 5 HOH 150 852 370 HOH HOH A . 
R 5 HOH 151 853 372 HOH HOH A . 
R 5 HOH 152 854 373 HOH HOH A . 
R 5 HOH 153 855 380 HOH HOH A . 
R 5 HOH 154 856 385 HOH HOH A . 
R 5 HOH 155 857 386 HOH HOH A . 
R 5 HOH 156 858 387 HOH HOH A . 
R 5 HOH 157 859 388 HOH HOH A . 
R 5 HOH 158 860 396 HOH HOH A . 
R 5 HOH 159 861 397 HOH HOH A . 
R 5 HOH 160 862 402 HOH HOH A . 
R 5 HOH 161 863 404 HOH HOH A . 
R 5 HOH 162 864 405 HOH HOH A . 
R 5 HOH 163 865 407 HOH HOH A . 
R 5 HOH 164 866 408 HOH HOH A . 
R 5 HOH 165 867 410 HOH HOH A . 
R 5 HOH 166 868 411 HOH HOH A . 
R 5 HOH 167 869 413 HOH HOH A . 
R 5 HOH 168 870 419 HOH HOH A . 
R 5 HOH 169 871 421 HOH HOH A . 
R 5 HOH 170 872 423 HOH HOH A . 
R 5 HOH 171 873 426 HOH HOH A . 
R 5 HOH 172 874 427 HOH HOH A . 
R 5 HOH 173 875 428 HOH HOH A . 
R 5 HOH 174 876 447 HOH HOH A . 
R 5 HOH 175 877 457 HOH HOH A . 
R 5 HOH 176 878 458 HOH HOH A . 
R 5 HOH 177 879 460 HOH HOH A . 
R 5 HOH 178 880 465 HOH HOH A . 
R 5 HOH 179 881 468 HOH HOH A . 
R 5 HOH 180 882 471 HOH HOH A . 
R 5 HOH 181 883 474 HOH HOH A . 
R 5 HOH 182 884 488 HOH HOH A . 
R 5 HOH 183 885 492 HOH HOH A . 
R 5 HOH 184 886 494 HOH HOH A . 
R 5 HOH 185 887 495 HOH HOH A . 
R 5 HOH 186 888 496 HOH HOH A . 
R 5 HOH 187 889 498 HOH HOH A . 
R 5 HOH 188 890 500 HOH HOH A . 
S 5 HOH 1   434 434 HOH HOH B . 
S 5 HOH 2   436 436 HOH HOH B . 
S 5 HOH 3   704 613 HOH HOH B . 
S 5 HOH 4   705 13  HOH HOH B . 
S 5 HOH 5   706 16  HOH HOH B . 
S 5 HOH 6   707 22  HOH HOH B . 
S 5 HOH 7   708 24  HOH HOH B . 
S 5 HOH 8   709 31  HOH HOH B . 
S 5 HOH 9   710 34  HOH HOH B . 
S 5 HOH 10  711 35  HOH HOH B . 
S 5 HOH 11  712 37  HOH HOH B . 
S 5 HOH 12  713 42  HOH HOH B . 
S 5 HOH 13  714 47  HOH HOH B . 
S 5 HOH 14  715 54  HOH HOH B . 
S 5 HOH 15  716 56  HOH HOH B . 
S 5 HOH 16  717 59  HOH HOH B . 
S 5 HOH 17  718 63  HOH HOH B . 
S 5 HOH 18  719 64  HOH HOH B . 
S 5 HOH 19  720 68  HOH HOH B . 
S 5 HOH 20  721 71  HOH HOH B . 
S 5 HOH 21  722 72  HOH HOH B . 
S 5 HOH 22  723 73  HOH HOH B . 
S 5 HOH 23  724 77  HOH HOH B . 
S 5 HOH 24  725 80  HOH HOH B . 
S 5 HOH 25  726 82  HOH HOH B . 
S 5 HOH 26  727 83  HOH HOH B . 
S 5 HOH 27  728 86  HOH HOH B . 
S 5 HOH 28  729 92  HOH HOH B . 
S 5 HOH 29  730 94  HOH HOH B . 
S 5 HOH 30  731 95  HOH HOH B . 
S 5 HOH 31  732 99  HOH HOH B . 
S 5 HOH 32  733 100 HOH HOH B . 
S 5 HOH 33  734 106 HOH HOH B . 
S 5 HOH 34  735 107 HOH HOH B . 
S 5 HOH 35  736 110 HOH HOH B . 
S 5 HOH 36  737 111 HOH HOH B . 
S 5 HOH 37  738 113 HOH HOH B . 
S 5 HOH 38  739 117 HOH HOH B . 
S 5 HOH 39  740 123 HOH HOH B . 
S 5 HOH 40  741 124 HOH HOH B . 
S 5 HOH 41  742 125 HOH HOH B . 
S 5 HOH 42  743 127 HOH HOH B . 
S 5 HOH 43  744 130 HOH HOH B . 
S 5 HOH 44  745 139 HOH HOH B . 
S 5 HOH 45  746 143 HOH HOH B . 
S 5 HOH 46  747 147 HOH HOH B . 
S 5 HOH 47  748 154 HOH HOH B . 
S 5 HOH 48  749 158 HOH HOH B . 
S 5 HOH 49  750 159 HOH HOH B . 
S 5 HOH 50  751 161 HOH HOH B . 
S 5 HOH 51  752 163 HOH HOH B . 
S 5 HOH 52  753 174 HOH HOH B . 
S 5 HOH 53  754 175 HOH HOH B . 
S 5 HOH 54  755 176 HOH HOH B . 
S 5 HOH 55  756 177 HOH HOH B . 
S 5 HOH 56  757 193 HOH HOH B . 
S 5 HOH 57  758 198 HOH HOH B . 
S 5 HOH 58  759 200 HOH HOH B . 
S 5 HOH 59  760 204 HOH HOH B . 
S 5 HOH 60  761 206 HOH HOH B . 
S 5 HOH 61  762 208 HOH HOH B . 
S 5 HOH 62  763 209 HOH HOH B . 
S 5 HOH 63  764 211 HOH HOH B . 
S 5 HOH 64  765 213 HOH HOH B . 
S 5 HOH 65  766 214 HOH HOH B . 
S 5 HOH 66  767 215 HOH HOH B . 
S 5 HOH 67  768 217 HOH HOH B . 
S 5 HOH 68  769 218 HOH HOH B . 
S 5 HOH 69  770 224 HOH HOH B . 
S 5 HOH 70  771 225 HOH HOH B . 
S 5 HOH 71  772 226 HOH HOH B . 
S 5 HOH 72  773 227 HOH HOH B . 
S 5 HOH 73  774 235 HOH HOH B . 
S 5 HOH 74  775 238 HOH HOH B . 
S 5 HOH 75  776 248 HOH HOH B . 
S 5 HOH 76  777 251 HOH HOH B . 
S 5 HOH 77  778 252 HOH HOH B . 
S 5 HOH 78  779 254 HOH HOH B . 
S 5 HOH 79  780 257 HOH HOH B . 
S 5 HOH 80  781 258 HOH HOH B . 
S 5 HOH 81  782 260 HOH HOH B . 
S 5 HOH 82  783 272 HOH HOH B . 
S 5 HOH 83  784 279 HOH HOH B . 
S 5 HOH 84  785 284 HOH HOH B . 
S 5 HOH 85  786 285 HOH HOH B . 
S 5 HOH 86  787 291 HOH HOH B . 
S 5 HOH 87  788 292 HOH HOH B . 
S 5 HOH 88  789 293 HOH HOH B . 
S 5 HOH 89  790 298 HOH HOH B . 
S 5 HOH 90  791 300 HOH HOH B . 
S 5 HOH 91  792 301 HOH HOH B . 
S 5 HOH 92  793 302 HOH HOH B . 
S 5 HOH 93  794 305 HOH HOH B . 
S 5 HOH 94  795 306 HOH HOH B . 
S 5 HOH 95  796 314 HOH HOH B . 
S 5 HOH 96  797 315 HOH HOH B . 
S 5 HOH 97  798 316 HOH HOH B . 
S 5 HOH 98  799 317 HOH HOH B . 
S 5 HOH 99  800 319 HOH HOH B . 
S 5 HOH 100 801 322 HOH HOH B . 
S 5 HOH 101 802 324 HOH HOH B . 
S 5 HOH 102 803 326 HOH HOH B . 
S 5 HOH 103 804 329 HOH HOH B . 
S 5 HOH 104 805 335 HOH HOH B . 
S 5 HOH 105 806 337 HOH HOH B . 
S 5 HOH 106 807 341 HOH HOH B . 
S 5 HOH 107 808 343 HOH HOH B . 
S 5 HOH 108 809 350 HOH HOH B . 
S 5 HOH 109 810 353 HOH HOH B . 
S 5 HOH 110 811 357 HOH HOH B . 
S 5 HOH 111 812 359 HOH HOH B . 
S 5 HOH 112 813 364 HOH HOH B . 
S 5 HOH 113 814 374 HOH HOH B . 
S 5 HOH 114 815 375 HOH HOH B . 
S 5 HOH 115 816 376 HOH HOH B . 
S 5 HOH 116 817 377 HOH HOH B . 
S 5 HOH 117 818 378 HOH HOH B . 
S 5 HOH 118 819 379 HOH HOH B . 
S 5 HOH 119 820 389 HOH HOH B . 
S 5 HOH 120 821 391 HOH HOH B . 
S 5 HOH 121 822 395 HOH HOH B . 
S 5 HOH 122 823 401 HOH HOH B . 
S 5 HOH 123 824 416 HOH HOH B . 
S 5 HOH 124 825 425 HOH HOH B . 
S 5 HOH 125 826 431 HOH HOH B . 
S 5 HOH 126 827 443 HOH HOH B . 
S 5 HOH 127 828 444 HOH HOH B . 
S 5 HOH 128 829 448 HOH HOH B . 
S 5 HOH 129 830 453 HOH HOH B . 
S 5 HOH 130 831 456 HOH HOH B . 
S 5 HOH 131 832 461 HOH HOH B . 
S 5 HOH 132 833 464 HOH HOH B . 
S 5 HOH 133 834 470 HOH HOH B . 
S 5 HOH 134 835 472 HOH HOH B . 
S 5 HOH 135 836 473 HOH HOH B . 
S 5 HOH 136 837 476 HOH HOH B . 
S 5 HOH 137 838 483 HOH HOH B . 
S 5 HOH 138 839 484 HOH HOH B . 
S 5 HOH 139 840 485 HOH HOH B . 
S 5 HOH 140 841 486 HOH HOH B . 
S 5 HOH 141 842 487 HOH HOH B . 
T 5 HOH 1   646 623 HOH HOH C . 
T 5 HOH 2   647 625 HOH HOH C . 
T 5 HOH 3   648 14  HOH HOH C . 
T 5 HOH 4   649 27  HOH HOH C . 
T 5 HOH 5   650 38  HOH HOH C . 
T 5 HOH 6   651 39  HOH HOH C . 
T 5 HOH 7   652 50  HOH HOH C . 
T 5 HOH 8   653 57  HOH HOH C . 
T 5 HOH 9   654 60  HOH HOH C . 
T 5 HOH 10  655 62  HOH HOH C . 
T 5 HOH 11  656 65  HOH HOH C . 
T 5 HOH 12  657 67  HOH HOH C . 
T 5 HOH 13  658 69  HOH HOH C . 
T 5 HOH 14  659 74  HOH HOH C . 
T 5 HOH 15  660 78  HOH HOH C . 
T 5 HOH 16  661 81  HOH HOH C . 
T 5 HOH 17  662 85  HOH HOH C . 
T 5 HOH 18  663 89  HOH HOH C . 
T 5 HOH 19  664 96  HOH HOH C . 
T 5 HOH 20  665 98  HOH HOH C . 
T 5 HOH 21  666 101 HOH HOH C . 
T 5 HOH 22  667 104 HOH HOH C . 
T 5 HOH 23  668 105 HOH HOH C . 
T 5 HOH 24  669 109 HOH HOH C . 
T 5 HOH 25  670 112 HOH HOH C . 
T 5 HOH 26  671 114 HOH HOH C . 
T 5 HOH 27  672 115 HOH HOH C . 
T 5 HOH 28  673 118 HOH HOH C . 
T 5 HOH 29  674 120 HOH HOH C . 
T 5 HOH 30  675 121 HOH HOH C . 
T 5 HOH 31  676 129 HOH HOH C . 
T 5 HOH 32  677 136 HOH HOH C . 
T 5 HOH 33  678 137 HOH HOH C . 
T 5 HOH 34  679 140 HOH HOH C . 
T 5 HOH 35  680 145 HOH HOH C . 
T 5 HOH 36  681 149 HOH HOH C . 
T 5 HOH 37  682 153 HOH HOH C . 
T 5 HOH 38  683 162 HOH HOH C . 
T 5 HOH 39  684 166 HOH HOH C . 
T 5 HOH 40  685 168 HOH HOH C . 
T 5 HOH 41  686 171 HOH HOH C . 
T 5 HOH 42  687 173 HOH HOH C . 
T 5 HOH 43  688 179 HOH HOH C . 
T 5 HOH 44  689 180 HOH HOH C . 
T 5 HOH 45  690 184 HOH HOH C . 
T 5 HOH 46  691 186 HOH HOH C . 
T 5 HOH 47  692 188 HOH HOH C . 
T 5 HOH 48  693 189 HOH HOH C . 
T 5 HOH 49  694 190 HOH HOH C . 
T 5 HOH 50  695 194 HOH HOH C . 
T 5 HOH 51  696 196 HOH HOH C . 
T 5 HOH 52  697 197 HOH HOH C . 
T 5 HOH 53  698 199 HOH HOH C . 
T 5 HOH 54  699 201 HOH HOH C . 
T 5 HOH 55  700 207 HOH HOH C . 
T 5 HOH 56  701 220 HOH HOH C . 
T 5 HOH 57  702 223 HOH HOH C . 
T 5 HOH 58  703 229 HOH HOH C . 
T 5 HOH 59  704 230 HOH HOH C . 
T 5 HOH 60  705 232 HOH HOH C . 
T 5 HOH 61  706 234 HOH HOH C . 
T 5 HOH 62  707 237 HOH HOH C . 
T 5 HOH 63  708 239 HOH HOH C . 
T 5 HOH 64  709 242 HOH HOH C . 
T 5 HOH 65  710 256 HOH HOH C . 
T 5 HOH 66  711 261 HOH HOH C . 
T 5 HOH 67  712 262 HOH HOH C . 
T 5 HOH 68  713 264 HOH HOH C . 
T 5 HOH 69  714 266 HOH HOH C . 
T 5 HOH 70  715 269 HOH HOH C . 
T 5 HOH 71  716 271 HOH HOH C . 
T 5 HOH 72  717 273 HOH HOH C . 
T 5 HOH 73  718 274 HOH HOH C . 
T 5 HOH 74  719 278 HOH HOH C . 
T 5 HOH 75  720 282 HOH HOH C . 
T 5 HOH 76  721 286 HOH HOH C . 
T 5 HOH 77  722 287 HOH HOH C . 
T 5 HOH 78  723 289 HOH HOH C . 
T 5 HOH 79  724 294 HOH HOH C . 
T 5 HOH 80  725 295 HOH HOH C . 
T 5 HOH 81  726 308 HOH HOH C . 
T 5 HOH 82  727 311 HOH HOH C . 
T 5 HOH 83  728 318 HOH HOH C . 
T 5 HOH 84  729 320 HOH HOH C . 
T 5 HOH 85  730 323 HOH HOH C . 
T 5 HOH 86  731 330 HOH HOH C . 
T 5 HOH 87  732 332 HOH HOH C . 
T 5 HOH 88  733 334 HOH HOH C . 
T 5 HOH 89  734 338 HOH HOH C . 
T 5 HOH 90  735 339 HOH HOH C . 
T 5 HOH 91  736 340 HOH HOH C . 
T 5 HOH 92  737 344 HOH HOH C . 
T 5 HOH 93  738 346 HOH HOH C . 
T 5 HOH 94  739 347 HOH HOH C . 
T 5 HOH 95  740 351 HOH HOH C . 
T 5 HOH 96  741 355 HOH HOH C . 
T 5 HOH 97  742 360 HOH HOH C . 
T 5 HOH 98  743 365 HOH HOH C . 
T 5 HOH 99  744 368 HOH HOH C . 
T 5 HOH 100 745 371 HOH HOH C . 
T 5 HOH 101 746 382 HOH HOH C . 
T 5 HOH 102 747 390 HOH HOH C . 
T 5 HOH 103 748 398 HOH HOH C . 
T 5 HOH 104 749 399 HOH HOH C . 
T 5 HOH 105 750 400 HOH HOH C . 
T 5 HOH 106 751 406 HOH HOH C . 
T 5 HOH 107 752 409 HOH HOH C . 
T 5 HOH 108 753 417 HOH HOH C . 
T 5 HOH 109 754 418 HOH HOH C . 
T 5 HOH 110 755 422 HOH HOH C . 
T 5 HOH 111 756 429 HOH HOH C . 
T 5 HOH 112 757 432 HOH HOH C . 
T 5 HOH 113 758 439 HOH HOH C . 
T 5 HOH 114 759 440 HOH HOH C . 
T 5 HOH 115 760 445 HOH HOH C . 
T 5 HOH 116 761 446 HOH HOH C . 
T 5 HOH 117 762 451 HOH HOH C . 
T 5 HOH 118 763 454 HOH HOH C . 
T 5 HOH 119 764 459 HOH HOH C . 
T 5 HOH 120 765 462 HOH HOH C . 
T 5 HOH 121 766 463 HOH HOH C . 
T 5 HOH 122 767 466 HOH HOH C . 
T 5 HOH 123 768 467 HOH HOH C . 
T 5 HOH 124 769 477 HOH HOH C . 
T 5 HOH 125 770 478 HOH HOH C . 
T 5 HOH 126 771 479 HOH HOH C . 
T 5 HOH 127 772 491 HOH HOH C . 
T 5 HOH 128 773 497 HOH HOH C . 
T 5 HOH 129 774 499 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric   2 
2 author_defined_assembly              ?    dimeric   2 
3 author_defined_assembly              ?    monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,D,E,F,G,H,I,J,K,L,M,R,S 
2 1 B,C,H,I,J,K,L,M,N,O,P,Q,S,T 
3 1 C,N,O,P,Q,T                 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5140  ? 
1 MORE         -208  ? 
1 'SSA (A^2)'  17130 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O1G ? G AP5 .   ? A AP5 631 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O2D ? G AP5 .   ? A AP5 631 ? 1_555 88.3  ? 
2   O1G ? G AP5 .   ? A AP5 631 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 703 ? 1_555 88.8  ? 
3   O2D ? G AP5 .   ? A AP5 631 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 703 ? 1_555 86.4  ? 
4   O1G ? G AP5 .   ? A AP5 631 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 838 ? 1_555 176.6 ? 
5   O2D ? G AP5 .   ? A AP5 631 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 838 ? 1_555 94.2  ? 
6   O   ? R HOH .   ? A HOH 703 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 838 ? 1_555 89.1  ? 
7   O1G ? G AP5 .   ? A AP5 631 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 845 ? 1_555 96.2  ? 
8   O2D ? G AP5 .   ? A AP5 631 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 845 ? 1_555 89.8  ? 
9   O   ? R HOH .   ? A HOH 703 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 845 ? 1_555 173.6 ? 
10  O   ? R HOH .   ? A HOH 838 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 845 ? 1_555 86.2  ? 
11  O1G ? G AP5 .   ? A AP5 631 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 704 ? 1_555 85.9  ? 
12  O2D ? G AP5 .   ? A AP5 631 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 704 ? 1_555 174.0 ? 
13  O   ? R HOH .   ? A HOH 703 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 704 ? 1_555 94.8  ? 
14  O   ? R HOH .   ? A HOH 838 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 704 ? 1_555 91.7  ? 
15  O   ? R HOH .   ? A HOH 845 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 O   ? R HOH .   ? A HOH 704 ? 1_555 89.6  ? 
16  ND1 ? A HIS 37  ? A HIS 36  ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE2 ? A GLU 27  ? A GLU 26  ? 1_555 91.9  ? 
17  ND1 ? A HIS 37  ? A HIS 36  ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 O   ? R HOH .   ? A HOH 846 ? 1_555 95.4  ? 
18  OE2 ? A GLU 27  ? A GLU 26  ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 O   ? R HOH .   ? A HOH 846 ? 1_555 170.1 ? 
19  ND1 ? A HIS 37  ? A HIS 36  ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 O   ? R HOH .   ? A HOH 840 ? 1_555 119.2 ? 
20  OE2 ? A GLU 27  ? A GLU 26  ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 O   ? R HOH .   ? A HOH 840 ? 1_555 83.1  ? 
21  O   ? R HOH .   ? A HOH 846 ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 O   ? R HOH .   ? A HOH 840 ? 1_555 99.0  ? 
22  ND1 ? A HIS 37  ? A HIS 36  ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE1 ? A GLU 145 ? A GLU 144 ? 4_555 139.9 ? 
23  OE2 ? A GLU 27  ? A GLU 26  ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE1 ? A GLU 145 ? A GLU 144 ? 4_555 74.6  ? 
24  O   ? R HOH .   ? A HOH 846 ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE1 ? A GLU 145 ? A GLU 144 ? 4_555 95.6  ? 
25  O   ? R HOH .   ? A HOH 840 ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE1 ? A GLU 145 ? A GLU 144 ? 4_555 96.8  ? 
26  ND1 ? A HIS 37  ? A HIS 36  ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE2 ? A GLU 145 ? A GLU 144 ? 4_555 92.1  ? 
27  OE2 ? A GLU 27  ? A GLU 26  ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE2 ? A GLU 145 ? A GLU 144 ? 4_555 94.4  ? 
28  O   ? R HOH .   ? A HOH 846 ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE2 ? A GLU 145 ? A GLU 144 ? 4_555 78.8  ? 
29  O   ? R HOH .   ? A HOH 840 ? 1_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE2 ? A GLU 145 ? A GLU 144 ? 4_555 148.6 ? 
30  OE1 ? A GLU 145 ? A GLU 144 ? 4_555 ZN ? E ZN . ? A ZN 641 ? 1_555 OE2 ? A GLU 145 ? A GLU 144 ? 4_555 52.8  ? 
31  O   ? S HOH .   ? B HOH 704 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O1G ? M AP5 .   ? B AP5 632 ? 1_555 87.8  ? 
32  O   ? S HOH .   ? B HOH 704 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O2D ? M AP5 .   ? B AP5 632 ? 1_555 175.3 ? 
33  O1G ? M AP5 .   ? B AP5 632 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O2D ? M AP5 .   ? B AP5 632 ? 1_555 87.5  ? 
34  O   ? S HOH .   ? B HOH 704 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 776 ? 1_555 91.7  ? 
35  O1G ? M AP5 .   ? B AP5 632 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 776 ? 1_555 90.3  ? 
36  O2D ? M AP5 .   ? B AP5 632 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 776 ? 1_555 89.1  ? 
37  O   ? S HOH .   ? B HOH 704 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 805 ? 1_555 86.6  ? 
38  O1G ? M AP5 .   ? B AP5 632 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 805 ? 1_555 173.5 ? 
39  O2D ? M AP5 .   ? B AP5 632 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 805 ? 1_555 98.0  ? 
40  O   ? S HOH .   ? B HOH 776 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 805 ? 1_555 93.3  ? 
41  O   ? S HOH .   ? B HOH 704 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 811 ? 1_555 85.9  ? 
42  O1G ? M AP5 .   ? B AP5 632 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 811 ? 1_555 86.1  ? 
43  O2D ? M AP5 .   ? B AP5 632 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 811 ? 1_555 93.0  ? 
44  O   ? S HOH .   ? B HOH 776 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 811 ? 1_555 175.7 ? 
45  O   ? S HOH .   ? B HOH 805 ? 1_555 ZN ? H ZN . ? B ZN 611 ? 1_555 O   ? S HOH .   ? B HOH 811 ? 1_555 90.1  ? 
46  OE1 ? B GLU 105 ? B GLU 104 ? 1_555 ZN ? I ZN . ? B ZN 642 ? 1_555 OE2 ? A GLU 71  ? A GLU 70  ? 1_555 109.4 ? 
47  OE1 ? B GLU 105 ? B GLU 104 ? 1_555 ZN ? I ZN . ? B ZN 642 ? 1_555 OE1 ? B GLU 71  ? B GLU 70  ? 1_555 119.9 ? 
48  OE2 ? A GLU 71  ? A GLU 70  ? 1_555 ZN ? I ZN . ? B ZN 642 ? 1_555 OE1 ? B GLU 71  ? B GLU 70  ? 1_555 107.1 ? 
49  OE1 ? B GLU 105 ? B GLU 104 ? 1_555 ZN ? I ZN . ? B ZN 642 ? 1_555 OD2 ? A ASP 75  ? A ASP 74  ? 1_555 95.6  ? 
50  OE2 ? A GLU 71  ? A GLU 70  ? 1_555 ZN ? I ZN . ? B ZN 642 ? 1_555 OD2 ? A ASP 75  ? A ASP 74  ? 1_555 103.0 ? 
51  OE1 ? B GLU 71  ? B GLU 70  ? 1_555 ZN ? I ZN . ? B ZN 642 ? 1_555 OD2 ? A ASP 75  ? A ASP 74  ? 1_555 120.3 ? 
52  ND1 ? B HIS 37  ? B HIS 36  ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 OE2 ? B GLU 27  ? B GLU 26  ? 1_555 93.9  ? 
53  ND1 ? B HIS 37  ? B HIS 36  ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 O   ? S HOH .   ? B HOH 806 ? 1_555 111.8 ? 
54  OE2 ? B GLU 27  ? B GLU 26  ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 O   ? S HOH .   ? B HOH 806 ? 1_555 88.7  ? 
55  ND1 ? B HIS 37  ? B HIS 36  ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 O   ? S HOH .   ? B HOH 812 ? 1_555 92.5  ? 
56  OE2 ? B GLU 27  ? B GLU 26  ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 O   ? S HOH .   ? B HOH 812 ? 1_555 173.5 ? 
57  O   ? S HOH .   ? B HOH 806 ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 O   ? S HOH .   ? B HOH 812 ? 1_555 89.2  ? 
58  ND1 ? B HIS 37  ? B HIS 36  ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 OE1 ? C GLU 145 ? C GLU 144 ? 3_455 141.4 ? 
59  OE2 ? B GLU 27  ? B GLU 26  ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 OE1 ? C GLU 145 ? C GLU 144 ? 3_455 77.8  ? 
60  O   ? S HOH .   ? B HOH 806 ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 OE1 ? C GLU 145 ? C GLU 144 ? 3_455 105.7 ? 
61  O   ? S HOH .   ? B HOH 812 ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 OE1 ? C GLU 145 ? C GLU 144 ? 3_455 96.8  ? 
62  ND1 ? B HIS 37  ? B HIS 36  ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 OE2 ? C GLU 145 ? C GLU 144 ? 3_455 91.6  ? 
63  OE2 ? B GLU 27  ? B GLU 26  ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 OE2 ? C GLU 145 ? C GLU 144 ? 3_455 99.4  ? 
64  O   ? S HOH .   ? B HOH 806 ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 OE2 ? C GLU 145 ? C GLU 144 ? 3_455 154.7 ? 
65  O   ? S HOH .   ? B HOH 812 ? 1_555 ZN ? J ZN . ? B ZN 643 ? 1_555 OE2 ? C GLU 145 ? C GLU 144 ? 3_455 80.1  ? 
66  OE1 ? C GLU 145 ? C GLU 144 ? 3_455 ZN ? J ZN . ? B ZN 643 ? 1_555 OE2 ? C GLU 145 ? C GLU 144 ? 3_455 53.7  ? 
67  O   ? T HOH .   ? C HOH 732 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O   ? T HOH .   ? C HOH 646 ? 1_555 90.8  ? 
68  O   ? T HOH .   ? C HOH 732 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O   ? T HOH .   ? C HOH 741 ? 1_555 89.6  ? 
69  O   ? T HOH .   ? C HOH 646 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O   ? T HOH .   ? C HOH 741 ? 1_555 90.0  ? 
70  O   ? T HOH .   ? C HOH 732 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O   ? T HOH .   ? C HOH 647 ? 1_555 175.3 ? 
71  O   ? T HOH .   ? C HOH 646 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O   ? T HOH .   ? C HOH 647 ? 1_555 84.4  ? 
72  O   ? T HOH .   ? C HOH 741 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O   ? T HOH .   ? C HOH 647 ? 1_555 90.0  ? 
73  O   ? T HOH .   ? C HOH 732 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O2D ? Q AP5 .   ? C AP5 633 ? 1_555 90.6  ? 
74  O   ? T HOH .   ? C HOH 646 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O2D ? Q AP5 .   ? C AP5 633 ? 1_555 174.0 ? 
75  O   ? T HOH .   ? C HOH 741 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O2D ? Q AP5 .   ? C AP5 633 ? 1_555 95.8  ? 
76  O   ? T HOH .   ? C HOH 647 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O2D ? Q AP5 .   ? C AP5 633 ? 1_555 94.2  ? 
77  O   ? T HOH .   ? C HOH 732 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O1G ? Q AP5 .   ? C AP5 633 ? 1_555 92.7  ? 
78  O   ? T HOH .   ? C HOH 646 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O1G ? Q AP5 .   ? C AP5 633 ? 1_555 84.9  ? 
79  O   ? T HOH .   ? C HOH 741 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O1G ? Q AP5 .   ? C AP5 633 ? 1_555 174.5 ? 
80  O   ? T HOH .   ? C HOH 647 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O1G ? Q AP5 .   ? C AP5 633 ? 1_555 87.3  ? 
81  O2D ? Q AP5 .   ? C AP5 633 ? 1_555 ZN ? N ZN . ? C ZN 621 ? 1_555 O1G ? Q AP5 .   ? C AP5 633 ? 1_555 89.2  ? 
82  O   ? T HOH .   ? C HOH 733 ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 O   ? T HOH .   ? C HOH 742 ? 1_555 86.3  ? 
83  O   ? T HOH .   ? C HOH 733 ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE2 ? C GLU 27  ? C GLU 26  ? 1_555 94.7  ? 
84  O   ? T HOH .   ? C HOH 742 ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE2 ? C GLU 27  ? C GLU 26  ? 1_555 168.3 ? 
85  O   ? T HOH .   ? C HOH 733 ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 ND1 ? C HIS 37  ? C HIS 36  ? 1_555 118.0 ? 
86  O   ? T HOH .   ? C HOH 742 ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 ND1 ? C HIS 37  ? C HIS 36  ? 1_555 96.0  ? 
87  OE2 ? C GLU 27  ? C GLU 26  ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 ND1 ? C HIS 37  ? C HIS 36  ? 1_555 93.7  ? 
88  O   ? T HOH .   ? C HOH 733 ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE1 ? B GLU 145 ? B GLU 144 ? 3_555 100.9 ? 
89  O   ? T HOH .   ? C HOH 742 ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE1 ? B GLU 145 ? B GLU 144 ? 3_555 87.4  ? 
90  OE2 ? C GLU 27  ? C GLU 26  ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE1 ? B GLU 145 ? B GLU 144 ? 3_555 81.0  ? 
91  ND1 ? C HIS 37  ? C HIS 36  ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE1 ? B GLU 145 ? B GLU 144 ? 3_555 141.1 ? 
92  O   ? T HOH .   ? C HOH 733 ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE2 ? B GLU 145 ? B GLU 144 ? 3_555 149.6 ? 
93  O   ? T HOH .   ? C HOH 742 ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE2 ? B GLU 145 ? B GLU 144 ? 3_555 80.7  ? 
94  OE2 ? C GLU 27  ? C GLU 26  ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE2 ? B GLU 145 ? B GLU 144 ? 3_555 92.8  ? 
95  ND1 ? C HIS 37  ? C HIS 36  ? 1_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE2 ? B GLU 145 ? B GLU 144 ? 3_555 90.8  ? 
96  OE1 ? B GLU 145 ? B GLU 144 ? 3_555 ZN ? O ZN . ? C ZN 644 ? 1_555 OE2 ? B GLU 145 ? B GLU 144 ? 3_555 51.4  ? 
97  OD2 ? C ASP 75  ? C ASP 74  ? 1_555 ZN ? P ZN . ? C ZN 645 ? 1_555 OE2 ? C GLU 71  ? C GLU 70  ? 1_555 108.4 ? 
98  OD2 ? C ASP 75  ? C ASP 74  ? 1_555 ZN ? P ZN . ? C ZN 645 ? 1_555 OD2 ? C ASP 75  ? C ASP 74  ? 2_656 129.1 ? 
99  OE2 ? C GLU 71  ? C GLU 70  ? 1_555 ZN ? P ZN . ? C ZN 645 ? 1_555 OD2 ? C ASP 75  ? C ASP 74  ? 2_656 86.8  ? 
100 OD2 ? C ASP 75  ? C ASP 74  ? 1_555 ZN ? P ZN . ? C ZN 645 ? 1_555 OE2 ? C GLU 71  ? C GLU 70  ? 2_656 104.3 ? 
101 OE2 ? C GLU 71  ? C GLU 70  ? 1_555 ZN ? P ZN . ? C ZN 645 ? 1_555 OE2 ? C GLU 71  ? C GLU 70  ? 2_656 121.9 ? 
102 OD2 ? C ASP 75  ? C ASP 74  ? 2_656 ZN ? P ZN . ? C ZN 645 ? 1_555 OE2 ? C GLU 71  ? C GLU 70  ? 2_656 107.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-04-26 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
5 'Structure model' 1 4 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Database references'       
6 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software        
2 5 'Structure model' audit_author    
3 5 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.name'        
2 5 'Structure model' '_audit_author.name'    
3 5 'Structure model' '_citation_author.name' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 17.9795 45.8371 0.5029  -0.0844 -0.1999 -0.0825 -0.0072 -0.0038 -0.0203 1.7744 0.9049 1.0860 -0.3707 -0.1659 0.0672 
0.0150  0.0262  0.0523  -0.0019 0.0010  0.0038  -0.0196 -0.0484 -0.0159 'X-RAY DIFFRACTION' 
2 ? refined 6.7304  47.2682 35.1792 -0.0735 -0.0319 -0.0820 -0.0029 -0.0016 -0.0152 1.9710 1.3508 1.5076 0.4823  0.3053  0.2459 
0.0320  -0.3023 -0.0040 0.0181  -0.0289 -0.0070 -0.0095 -0.0354 -0.0031 'X-RAY DIFFRACTION' 
3 ? refined 42.7412 47.2974 35.8303 -0.0553 -0.0833 -0.0794 -0.0092 -0.0005 -0.0201 2.5540 1.4869 1.9836 -0.4605 -0.0133 0.1688 
-0.0492 0.0481  0.0547  -0.0602 -0.0211 -0.0111 -0.0047 -0.0203 0.0704  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 0 A 1 A 194 A 195 ? 'X-RAY DIFFRACTION' ? 
2 2 B 0 B 1 B 194 B 195 ? 'X-RAY DIFFRACTION' ? 
3 3 C 0 C 1 C 194 C 195 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005 ? 1 
EVAL15 'data reduction' .        ? 2 
SADABS 'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    134 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    877 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 800 ? ? 1_555 O A HOH 887 ? ? 2_555 0.17 
2 1 O A HOH 743 ? ? 1_555 O A HOH 888 ? ? 2_555 0.20 
3 1 O A HOH 835 ? ? 1_555 O A HOH 886 ? ? 2_555 0.25 
4 1 O A HOH 890 ? ? 1_555 O C HOH 751 ? ? 4_545 2.18 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              93 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              93 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              93 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                112.83 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            -5.47 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 109 ? ? -127.55 -77.12 
2 1 VAL A 139 ? ? -98.68  33.00  
3 1 ASP A 140 ? ? -142.23 33.34  
4 1 ILE B 109 ? ? -131.33 -76.96 
5 1 ILE C 109 ? ? -127.24 -76.81 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 7   ? CE  ? A LYS 8   CE  
2  1 Y 1 A LYS 7   ? NZ  ? A LYS 8   NZ  
3  1 Y 1 A LYS 56  ? CD  ? A LYS 57  CD  
4  1 Y 1 A LYS 56  ? CE  ? A LYS 57  CE  
5  1 Y 1 A LYS 56  ? NZ  ? A LYS 57  NZ  
6  1 Y 1 A LYS 63  ? CD  ? A LYS 64  CD  
7  1 Y 1 A LYS 63  ? CE  ? A LYS 64  CE  
8  1 Y 1 A LYS 63  ? NZ  ? A LYS 64  NZ  
9  1 Y 1 A GLU 123 ? CD  ? A GLU 124 CD  
10 1 Y 1 A GLU 123 ? OE1 ? A GLU 124 OE1 
11 1 Y 1 A GLU 123 ? OE2 ? A GLU 124 OE2 
12 1 Y 1 A GLN 127 ? CD  ? A GLN 128 CD  
13 1 Y 1 A GLN 127 ? OE1 ? A GLN 128 OE1 
14 1 Y 1 A GLN 127 ? NE2 ? A GLN 128 NE2 
15 1 Y 1 A GLU 143 ? CD  ? A GLU 144 CD  
16 1 Y 1 A GLU 143 ? OE1 ? A GLU 144 OE1 
17 1 Y 1 A GLU 143 ? OE2 ? A GLU 144 OE2 
18 1 Y 1 A LYS 155 ? CE  ? A LYS 156 CE  
19 1 Y 1 A LYS 155 ? NZ  ? A LYS 156 NZ  
20 1 Y 1 B GLU 3   ? OE1 ? B GLU 4   OE1 
21 1 Y 1 B GLU 3   ? OE2 ? B GLU 4   OE2 
22 1 Y 1 B LYS 7   ? CD  ? B LYS 8   CD  
23 1 Y 1 B LYS 7   ? CE  ? B LYS 8   CE  
24 1 Y 1 B LYS 7   ? NZ  ? B LYS 8   NZ  
25 1 Y 1 B LYS 55  ? CD  ? B LYS 56  CD  
26 1 Y 1 B LYS 55  ? CE  ? B LYS 56  CE  
27 1 Y 1 B LYS 55  ? NZ  ? B LYS 56  NZ  
28 1 Y 1 B LYS 56  ? CD  ? B LYS 57  CD  
29 1 Y 1 B LYS 56  ? CE  ? B LYS 57  CE  
30 1 Y 1 B LYS 56  ? NZ  ? B LYS 57  NZ  
31 1 Y 1 B GLN 100 ? CG  ? B GLN 101 CG  
32 1 Y 1 B GLN 100 ? CD  ? B GLN 101 CD  
33 1 Y 1 B GLN 100 ? OE1 ? B GLN 101 OE1 
34 1 Y 1 B GLN 100 ? NE2 ? B GLN 101 NE2 
35 1 Y 1 B GLU 123 ? CG  ? B GLU 124 CG  
36 1 Y 1 B GLU 123 ? CD  ? B GLU 124 CD  
37 1 Y 1 B GLU 123 ? OE1 ? B GLU 124 OE1 
38 1 Y 1 B GLU 123 ? OE2 ? B GLU 124 OE2 
39 1 Y 1 B GLN 127 ? CD  ? B GLN 128 CD  
40 1 Y 1 B GLN 127 ? OE1 ? B GLN 128 OE1 
41 1 Y 1 B GLN 127 ? NE2 ? B GLN 128 NE2 
42 1 Y 1 B LYS 131 ? CD  ? B LYS 132 CD  
43 1 Y 1 B LYS 131 ? CE  ? B LYS 132 CE  
44 1 Y 1 B LYS 131 ? NZ  ? B LYS 132 NZ  
45 1 Y 1 B GLU 151 ? CD  ? B GLU 152 CD  
46 1 Y 1 B GLU 151 ? OE1 ? B GLU 152 OE1 
47 1 Y 1 B GLU 151 ? OE2 ? B GLU 152 OE2 
48 1 Y 1 B LYS 155 ? CE  ? B LYS 156 CE  
49 1 Y 1 B LYS 155 ? NZ  ? B LYS 156 NZ  
50 1 Y 1 B LYS 166 ? CE  ? B LYS 167 CE  
51 1 Y 1 B LYS 166 ? NZ  ? B LYS 167 NZ  
52 1 Y 1 B LEU 193 ? CD1 ? B LEU 194 CD1 
53 1 Y 1 B LEU 193 ? CD2 ? B LEU 194 CD2 
54 1 Y 1 C GLU 2   ? CD  ? C GLU 3   CD  
55 1 Y 1 C GLU 2   ? OE1 ? C GLU 3   OE1 
56 1 Y 1 C GLU 2   ? OE2 ? C GLU 3   OE2 
57 1 Y 1 C LYS 7   ? CE  ? C LYS 8   CE  
58 1 Y 1 C LYS 7   ? NZ  ? C LYS 8   NZ  
59 1 Y 1 C ARG 53  ? CD  ? C ARG 54  CD  
60 1 Y 1 C ARG 53  ? NE  ? C ARG 54  NE  
61 1 Y 1 C ARG 53  ? CZ  ? C ARG 54  CZ  
62 1 Y 1 C ARG 53  ? NH1 ? C ARG 54  NH1 
63 1 Y 1 C ARG 53  ? NH2 ? C ARG 54  NH2 
64 1 Y 1 C LYS 55  ? CE  ? C LYS 56  CE  
65 1 Y 1 C LYS 55  ? NZ  ? C LYS 56  NZ  
66 1 Y 1 C LYS 56  ? CE  ? C LYS 57  CE  
67 1 Y 1 C LYS 56  ? NZ  ? C LYS 57  NZ  
68 1 Y 1 C GLU 59  ? CD  ? C GLU 60  CD  
69 1 Y 1 C GLU 59  ? OE1 ? C GLU 60  OE1 
70 1 Y 1 C GLU 59  ? OE2 ? C GLU 60  OE2 
71 1 Y 1 C LYS 83  ? CE  ? C LYS 84  CE  
72 1 Y 1 C LYS 83  ? NZ  ? C LYS 84  NZ  
73 1 Y 1 C LYS 88  ? CE  ? C LYS 89  CE  
74 1 Y 1 C LYS 88  ? NZ  ? C LYS 89  NZ  
75 1 Y 1 C GLU 123 ? CD  ? C GLU 124 CD  
76 1 Y 1 C GLU 123 ? OE1 ? C GLU 124 OE1 
77 1 Y 1 C GLU 123 ? OE2 ? C GLU 124 OE2 
78 1 Y 1 C GLN 127 ? CD  ? C GLN 128 CD  
79 1 Y 1 C GLN 127 ? OE1 ? C GLN 128 OE1 
80 1 Y 1 C GLN 127 ? NE2 ? C GLN 128 NE2 
81 1 Y 1 C LYS 131 ? CD  ? C LYS 132 CD  
82 1 Y 1 C LYS 131 ? CE  ? C LYS 132 CE  
83 1 Y 1 C LYS 131 ? NZ  ? C LYS 132 NZ  
84 1 Y 1 C GLU 134 ? CD  ? C GLU 135 CD  
85 1 Y 1 C GLU 134 ? OE1 ? C GLU 135 OE1 
86 1 Y 1 C GLU 134 ? OE2 ? C GLU 135 OE2 
87 1 Y 1 C LEU 193 ? CG  ? C LEU 194 CG  
88 1 Y 1 C LEU 193 ? CD1 ? C LEU 194 CD1 
89 1 Y 1 C LEU 193 ? CD2 ? C LEU 194 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASN 195 ? A ASN 196 
2 1 Y 1 B ASN 195 ? B ASN 196 
3 1 Y 1 C ASN 195 ? C ASN 196 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                         ZN  
3 'SULFATE ION'                      SO4 
4 "BIS(ADENOSINE)-5'-PENTAPHOSPHATE" AP5 
5 water                              HOH 
#