data_1ZC0
# 
_entry.id   1ZC0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZC0         
RCSB  RCSB032549   
WWPDB D_1000032549 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZC0 
_pdbx_database_status.recvd_initial_deposition_date   2005-04-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Page, R.'     1 
'Mustelin, T.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structure of the hematopoietic tyrosine phosphatase (HePTP) catalytic domain: structure of a KIM phosphatase with phosphate bound at the active site.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            354 
_citation.page_first                150 
_citation.page_last                 163 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16226275 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.09.049 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mustelin, T.' 1 
primary 'Tautz, L.'    2 
primary 'Page, R.'     3 
# 
_cell.entry_id           1ZC0 
_cell.length_a           127.101 
_cell.length_b           127.101 
_cell.length_c           59.863 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1ZC0 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tyrosine-protein phosphatase, non-receptor type 7' 35335.988 1   3.1.3.48 ? 'Catalytic Phosphatase Domain' ? 
2 non-polymer syn 'PHOSPHATE ION'                                     94.971    1   ?        ? ?                              ? 
3 water       nat water                                               18.015    286 ?        ? ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein-tyrosine phosphatase LC-PTP, Hematopoietic protein-tyrosine phosphatase, HEPTP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSDKIHHHHHHMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPN
PQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTE
EETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHC
SAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSDKIHHHHHHMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPN
PQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTE
EETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHC
SAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  MET n 
1 14  ASN n 
1 15  THR n 
1 16  PRO n 
1 17  ARG n 
1 18  GLU n 
1 19  VAL n 
1 20  THR n 
1 21  LEU n 
1 22  HIS n 
1 23  PHE n 
1 24  LEU n 
1 25  ARG n 
1 26  THR n 
1 27  ALA n 
1 28  GLY n 
1 29  HIS n 
1 30  PRO n 
1 31  LEU n 
1 32  THR n 
1 33  ARG n 
1 34  TRP n 
1 35  ALA n 
1 36  LEU n 
1 37  GLN n 
1 38  ARG n 
1 39  GLN n 
1 40  PRO n 
1 41  PRO n 
1 42  SER n 
1 43  PRO n 
1 44  LYS n 
1 45  GLN n 
1 46  LEU n 
1 47  GLU n 
1 48  GLU n 
1 49  GLU n 
1 50  PHE n 
1 51  LEU n 
1 52  LYS n 
1 53  ILE n 
1 54  PRO n 
1 55  SER n 
1 56  ASN n 
1 57  PHE n 
1 58  VAL n 
1 59  SER n 
1 60  PRO n 
1 61  GLU n 
1 62  ASP n 
1 63  LEU n 
1 64  ASP n 
1 65  ILE n 
1 66  PRO n 
1 67  GLY n 
1 68  HIS n 
1 69  ALA n 
1 70  SER n 
1 71  LYS n 
1 72  ASP n 
1 73  ARG n 
1 74  TYR n 
1 75  LYS n 
1 76  THR n 
1 77  ILE n 
1 78  LEU n 
1 79  PRO n 
1 80  ASN n 
1 81  PRO n 
1 82  GLN n 
1 83  SER n 
1 84  ARG n 
1 85  VAL n 
1 86  CYS n 
1 87  LEU n 
1 88  GLY n 
1 89  ARG n 
1 90  ALA n 
1 91  GLN n 
1 92  SER n 
1 93  GLN n 
1 94  GLU n 
1 95  ASP n 
1 96  GLY n 
1 97  ASP n 
1 98  TYR n 
1 99  ILE n 
1 100 ASN n 
1 101 ALA n 
1 102 ASN n 
1 103 TYR n 
1 104 ILE n 
1 105 ARG n 
1 106 GLY n 
1 107 TYR n 
1 108 ASP n 
1 109 GLY n 
1 110 LYS n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 TYR n 
1 115 ILE n 
1 116 ALA n 
1 117 THR n 
1 118 GLN n 
1 119 GLY n 
1 120 PRO n 
1 121 MET n 
1 122 PRO n 
1 123 ASN n 
1 124 THR n 
1 125 VAL n 
1 126 SER n 
1 127 ASP n 
1 128 PHE n 
1 129 TRP n 
1 130 GLU n 
1 131 MET n 
1 132 VAL n 
1 133 TRP n 
1 134 GLN n 
1 135 GLU n 
1 136 GLU n 
1 137 VAL n 
1 138 SER n 
1 139 LEU n 
1 140 ILE n 
1 141 VAL n 
1 142 MET n 
1 143 LEU n 
1 144 THR n 
1 145 GLN n 
1 146 LEU n 
1 147 ARG n 
1 148 GLU n 
1 149 GLY n 
1 150 LYS n 
1 151 GLU n 
1 152 LYS n 
1 153 CYS n 
1 154 VAL n 
1 155 HIS n 
1 156 TYR n 
1 157 TRP n 
1 158 PRO n 
1 159 THR n 
1 160 GLU n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 TYR n 
1 165 GLY n 
1 166 PRO n 
1 167 PHE n 
1 168 GLN n 
1 169 ILE n 
1 170 ARG n 
1 171 ILE n 
1 172 GLN n 
1 173 ASP n 
1 174 MET n 
1 175 LYS n 
1 176 GLU n 
1 177 CYS n 
1 178 PRO n 
1 179 GLU n 
1 180 TYR n 
1 181 THR n 
1 182 VAL n 
1 183 ARG n 
1 184 GLN n 
1 185 LEU n 
1 186 THR n 
1 187 ILE n 
1 188 GLN n 
1 189 TYR n 
1 190 GLN n 
1 191 GLU n 
1 192 GLU n 
1 193 ARG n 
1 194 ARG n 
1 195 SER n 
1 196 VAL n 
1 197 LYS n 
1 198 HIS n 
1 199 ILE n 
1 200 LEU n 
1 201 PHE n 
1 202 SER n 
1 203 ALA n 
1 204 TRP n 
1 205 PRO n 
1 206 ASP n 
1 207 HIS n 
1 208 GLN n 
1 209 THR n 
1 210 PRO n 
1 211 GLU n 
1 212 SER n 
1 213 ALA n 
1 214 GLY n 
1 215 PRO n 
1 216 LEU n 
1 217 LEU n 
1 218 ARG n 
1 219 LEU n 
1 220 VAL n 
1 221 ALA n 
1 222 GLU n 
1 223 VAL n 
1 224 GLU n 
1 225 GLU n 
1 226 SER n 
1 227 PRO n 
1 228 GLU n 
1 229 THR n 
1 230 ALA n 
1 231 ALA n 
1 232 HIS n 
1 233 PRO n 
1 234 GLY n 
1 235 PRO n 
1 236 ILE n 
1 237 VAL n 
1 238 VAL n 
1 239 HIS n 
1 240 CYS n 
1 241 SER n 
1 242 ALA n 
1 243 GLY n 
1 244 ILE n 
1 245 GLY n 
1 246 ARG n 
1 247 THR n 
1 248 GLY n 
1 249 CYS n 
1 250 PHE n 
1 251 ILE n 
1 252 ALA n 
1 253 THR n 
1 254 ARG n 
1 255 ILE n 
1 256 GLY n 
1 257 CYS n 
1 258 GLN n 
1 259 GLN n 
1 260 LEU n 
1 261 LYS n 
1 262 ALA n 
1 263 ARG n 
1 264 GLY n 
1 265 GLU n 
1 266 VAL n 
1 267 ASP n 
1 268 ILE n 
1 269 LEU n 
1 270 GLY n 
1 271 ILE n 
1 272 VAL n 
1 273 CYS n 
1 274 GLN n 
1 275 LEU n 
1 276 ARG n 
1 277 LEU n 
1 278 ASP n 
1 279 ARG n 
1 280 GLY n 
1 281 GLY n 
1 282 MET n 
1 283 ILE n 
1 284 GLN n 
1 285 THR n 
1 286 ALA n 
1 287 GLU n 
1 288 GLN n 
1 289 TYR n 
1 290 GLN n 
1 291 PHE n 
1 292 LEU n 
1 293 HIS n 
1 294 HIS n 
1 295 THR n 
1 296 LEU n 
1 297 ALA n 
1 298 LEU n 
1 299 TYR n 
1 300 ALA n 
1 301 GLY n 
1 302 GLN n 
1 303 LEU n 
1 304 PRO n 
1 305 GLU n 
1 306 GLU n 
1 307 PRO n 
1 308 SER n 
1 309 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PTPN7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTN7_HUMAN 
_struct_ref.pdbx_db_accession          P35236 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQ
EDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQD
MKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIAT
RIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
;
_struct_ref.pdbx_align_begin           65 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ZC0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 14 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 309 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P35236 
_struct_ref_seq.db_align_beg                  65 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  360 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       44 
_struct_ref_seq.pdbx_auth_seq_align_end       339 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ZC0 MET A 1  ? UNP P35236 ? ? 'LEADER SEQUENCE' 31 1  
1 1ZC0 GLY A 2  ? UNP P35236 ? ? 'LEADER SEQUENCE' 32 2  
1 1ZC0 SER A 3  ? UNP P35236 ? ? 'LEADER SEQUENCE' 33 3  
1 1ZC0 ASP A 4  ? UNP P35236 ? ? 'LEADER SEQUENCE' 34 4  
1 1ZC0 LYS A 5  ? UNP P35236 ? ? 'LEADER SEQUENCE' 35 5  
1 1ZC0 ILE A 6  ? UNP P35236 ? ? 'LEADER SEQUENCE' 36 6  
1 1ZC0 HIS A 7  ? UNP P35236 ? ? 'LEADER SEQUENCE' 37 7  
1 1ZC0 HIS A 8  ? UNP P35236 ? ? 'LEADER SEQUENCE' 38 8  
1 1ZC0 HIS A 9  ? UNP P35236 ? ? 'LEADER SEQUENCE' 39 9  
1 1ZC0 HIS A 10 ? UNP P35236 ? ? 'LEADER SEQUENCE' 40 10 
1 1ZC0 HIS A 11 ? UNP P35236 ? ? 'LEADER SEQUENCE' 41 11 
1 1ZC0 HIS A 12 ? UNP P35236 ? ? 'LEADER SEQUENCE' 42 12 
1 1ZC0 MET A 13 ? UNP P35236 ? ? 'LEADER SEQUENCE' 43 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ZC0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.92 
_exptl_crystal.density_percent_sol   68.36 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.7 
_exptl_crystal_grow.pdbx_details    'Sodium/potassium phosphate, acetate, pH 6.7, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-07-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Single crystal Si(111) bent monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9797 1.0 
2 0.9791 1.0 
3 0.8856 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9797, 0.9791, 0.8856' 
# 
_reflns.entry_id                     1ZC0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50. 
_reflns.d_resolution_high            1.85 
_reflns.number_obs                   47311 
_reflns.number_all                   47368 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.92 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1ZC0 
_refine.ls_number_reflns_obs                     44913 
_refine.ls_number_reflns_all                     44913 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    99.78 
_refine.ls_R_factor_obs                          0.16257 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16134 
_refine.ls_R_factor_R_free                       0.18584 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2398 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.970 
_refine.correlation_coeff_Fo_to_Fc_free          0.961 
_refine.B_iso_mean                               34.029 
_refine.aniso_B[1][1]                            -0.38 
_refine.aniso_B[2][2]                            -0.38 
_refine.aniso_B[3][3]                            0.58 
_refine.aniso_B[1][2]                            -0.19 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.082 
_refine.pdbx_overall_ESU_R_Free                  0.083 
_refine.overall_SU_ML                            0.056 
_refine.overall_SU_B                             2.940 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2217 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             286 
_refine_hist.number_atoms_total               2508 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 2318 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.329  1.958  ? 3157 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.583  5.000  ? 284  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.978 23.431 ? 102  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.726 15.000 ? 378  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.860 15.000 ? 16   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.089  0.200  ? 348  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 1768 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.207  0.200  ? 1097 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.311  0.200  ? 1578 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.132  0.200  ? 259  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.218  0.200  ? 27   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.186  0.200  ? 27   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.849  3.000  ? 1474 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.852  5.000  ? 2328 'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.216  8.000  ? 966  'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.336  11.000 ? 829  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.847 
_refine_ls_shell.d_res_low                        1.895 
_refine_ls_shell.number_reflns_R_work             3214 
_refine_ls_shell.R_factor_R_work                  0.266 
_refine_ls_shell.percent_reflns_obs               98.33 
_refine_ls_shell.R_factor_R_free                  0.338 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             196 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ZC0 
_struct.title                     'Crystal structure of human hematopoietic tyrosine phosphatase (HePTP) catalytic domain' 
_struct.pdbx_descriptor           'Tyrosine-protein phosphatase, non-receptor type 7 (E.C.3.1.3.48)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZC0 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HePTP, human tyrosine phosphatase catalytic domain, LC-PTP, PTPN7, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 15  ? ALA A 27  ? THR A 45  ALA A 57  1 ? 13 
HELX_P HELX_P2  2  ARG A 33  ? GLN A 39  ? ARG A 63  GLN A 69  1 ? 7  
HELX_P HELX_P3  3  SER A 42  ? ILE A 53  ? SER A 72  ILE A 83  1 ? 12 
HELX_P HELX_P4  4  SER A 59  ? LEU A 63  ? SER A 89  LEU A 93  5 ? 5  
HELX_P HELX_P5  5  GLY A 67  ? ASP A 72  ? GLY A 97  ASP A 102 5 ? 6  
HELX_P HELX_P6  6  ASN A 80  ? GLN A 82  ? ASN A 110 GLN A 112 5 ? 3  
HELX_P HELX_P7  7  GLY A 106 ? LYS A 110 ? GLY A 136 LYS A 140 5 ? 5  
HELX_P HELX_P8  8  MET A 121 ? ASN A 123 ? MET A 151 ASN A 153 5 ? 3  
HELX_P HELX_P9  9  THR A 124 ? GLU A 135 ? THR A 154 GLU A 165 1 ? 12 
HELX_P HELX_P10 10 SER A 212 ? GLU A 225 ? SER A 242 GLU A 255 1 ? 14 
HELX_P HELX_P11 11 ILE A 244 ? GLY A 264 ? ILE A 274 GLY A 294 1 ? 21 
HELX_P HELX_P12 12 ASP A 267 ? ARG A 279 ? ASP A 297 ARG A 309 1 ? 13 
HELX_P HELX_P13 13 THR A 285 ? LEU A 303 ? THR A 315 LEU A 333 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
B 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 31  ? THR A 32  ? LEU A 61  THR A 62  
A 2 GLU A 265 ? VAL A 266 ? GLU A 295 VAL A 296 
B 1 ARG A 84  ? CYS A 86  ? ARG A 114 CYS A 116 
B 2 TYR A 98  ? ILE A 104 ? TYR A 128 ILE A 134 
B 3 TYR A 114 ? GLN A 118 ? TYR A 144 GLN A 148 
B 4 ILE A 236 ? CYS A 240 ? ILE A 266 CYS A 270 
B 5 LEU A 139 ? LEU A 143 ? LEU A 169 LEU A 173 
B 6 GLU A 192 ? PHE A 201 ? GLU A 222 PHE A 231 
B 7 TYR A 180 ? TYR A 189 ? TYR A 210 TYR A 219 
B 8 PHE A 167 ? GLU A 176 ? PHE A 197 GLU A 206 
B 9 GLU A 161 ? TYR A 164 ? GLU A 191 TYR A 194 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 31  ? N LEU A 61  O VAL A 266 ? O VAL A 296 
B 1 2 N VAL A 85  ? N VAL A 115 O ALA A 101 ? O ALA A 131 
B 2 3 N ILE A 104 ? N ILE A 134 O TYR A 114 ? O TYR A 144 
B 3 4 N ILE A 115 ? N ILE A 145 O VAL A 238 ? O VAL A 268 
B 4 5 O VAL A 237 ? O VAL A 267 N VAL A 141 ? N VAL A 171 
B 5 6 N MET A 142 ? N MET A 172 O ILE A 199 ? O ILE A 229 
B 6 7 O HIS A 198 ? O HIS A 228 N ARG A 183 ? N ARG A 213 
B 7 8 O GLN A 184 ? O GLN A 214 N GLN A 172 ? N GLN A 202 
B 8 9 O ILE A 169 ? O ILE A 199 N GLU A 162 ? N GLU A 192 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'BINDING SITE FOR RESIDUE PO4 A 436' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ASP A 206 ? ASP A 236 . ? 1_555 ? 
2  AC1 10 CYS A 240 ? CYS A 270 . ? 1_555 ? 
3  AC1 10 SER A 241 ? SER A 271 . ? 1_555 ? 
4  AC1 10 ALA A 242 ? ALA A 272 . ? 1_555 ? 
5  AC1 10 ILE A 244 ? ILE A 274 . ? 1_555 ? 
6  AC1 10 GLY A 245 ? GLY A 275 . ? 1_555 ? 
7  AC1 10 ARG A 246 ? ARG A 276 . ? 1_555 ? 
8  AC1 10 GLN A 284 ? GLN A 314 . ? 1_555 ? 
9  AC1 10 HOH C .   ? HOH A 438 . ? 1_555 ? 
10 AC1 10 HOH C .   ? HOH A 578 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZC0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZC0 
_atom_sites.fract_transf_matrix[1][1]   0.007868 
_atom_sites.fract_transf_matrix[1][2]   0.004542 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009085 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016705 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 15  ? 42.085 49.247 40.044  1.00 60.60 ? 45  THR A N   1 
ATOM   2    C CA  . THR A 1 15  ? 41.941 49.956 38.744  1.00 59.31 ? 45  THR A CA  1 
ATOM   3    C C   . THR A 1 15  ? 42.755 49.291 37.622  1.00 58.21 ? 45  THR A C   1 
ATOM   4    O O   . THR A 1 15  ? 43.515 49.973 36.933  1.00 57.71 ? 45  THR A O   1 
ATOM   5    C CB  . THR A 1 15  ? 42.356 51.448 38.878  1.00 59.66 ? 45  THR A CB  1 
ATOM   6    O OG1 . THR A 1 15  ? 43.555 51.556 39.667  1.00 59.58 ? 45  THR A OG1 1 
ATOM   7    C CG2 . THR A 1 15  ? 41.243 52.259 39.524  1.00 63.42 ? 45  THR A CG2 1 
ATOM   8    N N   . PRO A 1 16  ? 42.609 47.956 37.437  1.00 56.60 ? 46  PRO A N   1 
ATOM   9    C CA  . PRO A 1 16  ? 43.332 47.292 36.346  1.00 53.84 ? 46  PRO A CA  1 
ATOM   10   C C   . PRO A 1 16  ? 43.031 47.878 34.962  1.00 50.46 ? 46  PRO A C   1 
ATOM   11   O O   . PRO A 1 16  ? 43.935 47.945 34.132  1.00 50.09 ? 46  PRO A O   1 
ATOM   12   C CB  . PRO A 1 16  ? 42.859 45.833 36.436  1.00 53.56 ? 46  PRO A CB  1 
ATOM   13   C CG  . PRO A 1 16  ? 42.454 45.664 37.864  1.00 56.93 ? 46  PRO A CG  1 
ATOM   14   C CD  . PRO A 1 16  ? 41.822 46.986 38.225  1.00 57.72 ? 46  PRO A CD  1 
ATOM   15   N N   . ARG A 1 17  ? 41.789 48.298 34.721  1.00 46.82 ? 47  ARG A N   1 
ATOM   16   C CA  . ARG A 1 17  ? 41.443 48.938 33.440  1.00 44.88 ? 47  ARG A CA  1 
ATOM   17   C C   . ARG A 1 17  ? 42.192 50.261 33.289  1.00 41.13 ? 47  ARG A C   1 
ATOM   18   O O   . ARG A 1 17  ? 42.767 50.527 32.234  1.00 38.46 ? 47  ARG A O   1 
ATOM   19   C CB  . ARG A 1 17  ? 39.932 49.137 33.285  1.00 44.96 ? 47  ARG A CB  1 
ATOM   20   C CG  . ARG A 1 17  ? 39.500 49.763 31.952  1.00 50.01 ? 47  ARG A CG  1 
ATOM   21   C CD  . ARG A 1 17  ? 39.454 48.756 30.816  1.00 58.21 ? 47  ARG A CD  1 
ATOM   22   N N   . GLU A 1 18  ? 42.217 51.064 34.354  1.00 36.39 ? 48  GLU A N   1 
ATOM   23   C CA  . GLU A 1 18  ? 42.982 52.308 34.350  1.00 35.03 ? 48  GLU A CA  1 
ATOM   24   C C   . GLU A 1 18  ? 44.464 52.048 34.119  1.00 34.53 ? 48  GLU A C   1 
ATOM   25   O O   . GLU A 1 18  ? 45.115 52.777 33.363  1.00 32.91 ? 48  GLU A O   1 
ATOM   26   C CB  . GLU A 1 18  ? 42.785 53.101 35.642  1.00 36.40 ? 48  GLU A CB  1 
ATOM   27   C CG  . GLU A 1 18  ? 41.439 53.809 35.717  1.00 43.72 ? 48  GLU A CG  1 
ATOM   28   N N   . VAL A 1 19  ? 44.990 51.017 34.779  1.00 30.26 ? 49  VAL A N   1 
ATOM   29   C CA  . VAL A 1 19  ? 46.378 50.607 34.586  1.00 30.17 ? 49  VAL A CA  1 
ATOM   30   C C   . VAL A 1 19  ? 46.635 50.208 33.131  1.00 29.87 ? 49  VAL A C   1 
ATOM   31   O O   . VAL A 1 19  ? 47.631 50.637 32.542  1.00 29.56 ? 49  VAL A O   1 
ATOM   32   C CB  . VAL A 1 19  ? 46.770 49.461 35.556  1.00 31.73 ? 49  VAL A CB  1 
ATOM   33   C CG1 . VAL A 1 19  ? 48.144 48.892 35.226  1.00 35.28 ? 49  VAL A CG1 1 
ATOM   34   C CG2 . VAL A 1 19  ? 46.749 49.967 36.991  1.00 32.03 ? 49  VAL A CG2 1 
ATOM   35   N N   . THR A 1 20  ? 45.752 49.389 32.561  1.00 31.19 ? 50  THR A N   1 
ATOM   36   C CA  . THR A 1 20  ? 45.891 48.982 31.164  1.00 31.22 ? 50  THR A CA  1 
ATOM   37   C C   . THR A 1 20  ? 45.928 50.193 30.233  1.00 30.82 ? 50  THR A C   1 
ATOM   38   O O   . THR A 1 20  ? 46.827 50.321 29.380  1.00 27.77 ? 50  THR A O   1 
ATOM   39   C CB  . THR A 1 20  ? 44.762 48.003 30.749  1.00 33.60 ? 50  THR A CB  1 
ATOM   40   O OG1 . THR A 1 20  ? 45.002 46.737 31.374  1.00 41.26 ? 50  THR A OG1 1 
ATOM   41   C CG2 . THR A 1 20  ? 44.704 47.804 29.215  1.00 32.39 ? 50  THR A CG2 1 
ATOM   42   N N   . LEU A 1 21  ? 44.946 51.075 30.388  1.00 26.64 ? 51  LEU A N   1 
ATOM   43   C CA  . LEU A 1 21  ? 44.794 52.200 29.472  1.00 28.08 ? 51  LEU A CA  1 
ATOM   44   C C   . LEU A 1 21  ? 45.982 53.132 29.627  1.00 26.76 ? 51  LEU A C   1 
ATOM   45   O O   . LEU A 1 21  ? 46.501 53.629 28.637  1.00 27.19 ? 51  LEU A O   1 
ATOM   46   C CB  . LEU A 1 21  ? 43.470 52.941 29.713  1.00 26.21 ? 51  LEU A CB  1 
ATOM   47   C CG  . LEU A 1 21  ? 42.182 52.188 29.339  1.00 29.81 ? 51  LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 21  ? 40.905 52.983 29.740  1.00 29.50 ? 51  LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 21  ? 42.130 51.797 27.852  1.00 34.31 ? 51  LEU A CD2 1 
ATOM   50   N N   . HIS A 1 22  ? 46.437 53.353 30.862  1.00 27.59 ? 52  HIS A N   1 
ATOM   51   C CA  . HIS A 1 22  ? 47.588 54.227 31.063  1.00 27.61 ? 52  HIS A CA  1 
ATOM   52   C C   . HIS A 1 22  ? 48.829 53.711 30.337  1.00 28.23 ? 52  HIS A C   1 
ATOM   53   O O   . HIS A 1 22  ? 49.534 54.472 29.663  1.00 28.50 ? 52  HIS A O   1 
ATOM   54   C CB  . HIS A 1 22  ? 47.902 54.438 32.545  1.00 30.93 ? 52  HIS A CB  1 
ATOM   55   C CG  . HIS A 1 22  ? 49.110 55.292 32.770  1.00 34.91 ? 52  HIS A CG  1 
ATOM   56   N ND1 . HIS A 1 22  ? 49.104 56.655 32.558  1.00 40.67 ? 52  HIS A ND1 1 
ATOM   57   C CD2 . HIS A 1 22  ? 50.373 54.974 33.140  1.00 39.72 ? 52  HIS A CD2 1 
ATOM   58   C CE1 . HIS A 1 22  ? 50.305 57.142 32.812  1.00 38.53 ? 52  HIS A CE1 1 
ATOM   59   N NE2 . HIS A 1 22  ? 51.092 56.143 33.167  1.00 41.34 ? 52  HIS A NE2 1 
ATOM   60   N N   . PHE A 1 23  ? 49.094 52.415 30.474  1.00 27.31 ? 53  PHE A N   1 
ATOM   61   C CA  . PHE A 1 23  ? 50.241 51.804 29.810  1.00 24.36 ? 53  PHE A CA  1 
ATOM   62   C C   . PHE A 1 23  ? 50.139 51.991 28.303  1.00 25.50 ? 53  PHE A C   1 
ATOM   63   O O   . PHE A 1 23  ? 51.089 52.452 27.647  1.00 26.48 ? 53  PHE A O   1 
ATOM   64   C CB  . PHE A 1 23  ? 50.313 50.305 30.113  1.00 26.05 ? 53  PHE A CB  1 
ATOM   65   C CG  . PHE A 1 23  ? 51.523 49.635 29.505  1.00 28.27 ? 53  PHE A CG  1 
ATOM   66   C CD1 . PHE A 1 23  ? 52.675 49.429 30.257  1.00 33.35 ? 53  PHE A CD1 1 
ATOM   67   C CD2 . PHE A 1 23  ? 51.519 49.273 28.162  1.00 27.53 ? 53  PHE A CD2 1 
ATOM   68   C CE1 . PHE A 1 23  ? 53.807 48.825 29.679  1.00 35.60 ? 53  PHE A CE1 1 
ATOM   69   C CE2 . PHE A 1 23  ? 52.643 48.667 27.564  1.00 32.06 ? 53  PHE A CE2 1 
ATOM   70   C CZ  . PHE A 1 23  ? 53.793 48.450 28.330  1.00 34.99 ? 53  PHE A CZ  1 
ATOM   71   N N   . LEU A 1 24  ? 48.993 51.620 27.747  1.00 24.72 ? 54  LEU A N   1 
ATOM   72   C CA  . LEU A 1 24  ? 48.827 51.623 26.279  1.00 25.99 ? 54  LEU A CA  1 
ATOM   73   C C   . LEU A 1 24  ? 48.919 53.045 25.699  1.00 27.14 ? 54  LEU A C   1 
ATOM   74   O O   . LEU A 1 24  ? 49.441 53.248 24.593  1.00 26.92 ? 54  LEU A O   1 
ATOM   75   C CB  . LEU A 1 24  ? 47.498 50.972 25.903  1.00 25.74 ? 54  LEU A CB  1 
ATOM   76   C CG  . LEU A 1 24  ? 47.389 49.460 26.153  1.00 24.79 ? 54  LEU A CG  1 
ATOM   77   C CD1 . LEU A 1 24  ? 45.968 49.047 25.892  1.00 27.00 ? 54  LEU A CD1 1 
ATOM   78   C CD2 . LEU A 1 24  ? 48.374 48.645 25.220  1.00 23.47 ? 54  LEU A CD2 1 
ATOM   79   N N   . ARG A 1 25  ? 48.433 54.023 26.464  1.00 26.67 ? 55  ARG A N   1 
ATOM   80   C CA  . ARG A 1 25  ? 48.435 55.413 26.014  1.00 27.05 ? 55  ARG A CA  1 
ATOM   81   C C   . ARG A 1 25  ? 49.804 56.073 26.151  1.00 28.47 ? 55  ARG A C   1 
ATOM   82   O O   . ARG A 1 25  ? 50.039 57.115 25.535  1.00 31.68 ? 55  ARG A O   1 
ATOM   83   C CB  . ARG A 1 25  ? 47.376 56.235 26.760  1.00 26.29 ? 55  ARG A CB  1 
ATOM   84   C CG  . ARG A 1 25  ? 45.988 55.905 26.286  1.00 26.95 ? 55  ARG A CG  1 
ATOM   85   C CD  . ARG A 1 25  ? 44.891 56.589 27.104  1.00 28.96 ? 55  ARG A CD  1 
ATOM   86   N NE  . ARG A 1 25  ? 43.604 56.332 26.447  1.00 30.97 ? 55  ARG A NE  1 
ATOM   87   C CZ  . ARG A 1 25  ? 42.424 56.294 27.064  1.00 32.17 ? 55  ARG A CZ  1 
ATOM   88   N NH1 . ARG A 1 25  ? 42.339 56.501 28.371  1.00 25.00 ? 55  ARG A NH1 1 
ATOM   89   N NH2 . ARG A 1 25  ? 41.323 56.062 26.364  1.00 30.67 ? 55  ARG A NH2 1 
ATOM   90   N N   . THR A 1 26  ? 50.706 55.495 26.936  1.00 26.79 ? 56  THR A N   1 
ATOM   91   C CA  . THR A 1 26  ? 51.991 56.169 27.181  1.00 28.11 ? 56  THR A CA  1 
ATOM   92   C C   . THR A 1 26  ? 53.255 55.392 26.830  1.00 30.43 ? 56  THR A C   1 
ATOM   93   O O   . THR A 1 26  ? 54.318 55.991 26.743  1.00 30.41 ? 56  THR A O   1 
ATOM   94   C CB  . THR A 1 26  ? 52.142 56.610 28.657  1.00 30.69 ? 56  THR A CB  1 
ATOM   95   O OG1 . THR A 1 26  ? 52.152 55.449 29.498  1.00 34.58 ? 56  THR A OG1 1 
ATOM   96   C CG2 . THR A 1 26  ? 51.013 57.574 29.075  1.00 31.42 ? 56  THR A CG2 1 
ATOM   97   N N   . ALA A 1 27  ? 53.163 54.073 26.663  1.00 29.21 ? 57  ALA A N   1 
ATOM   98   C CA  . ALA A 1 27  ? 54.361 53.268 26.405  1.00 27.86 ? 57  ALA A CA  1 
ATOM   99   C C   . ALA A 1 27  ? 54.952 53.614 25.052  1.00 29.85 ? 57  ALA A C   1 
ATOM   100  O O   . ALA A 1 27  ? 54.216 53.935 24.111  1.00 28.10 ? 57  ALA A O   1 
ATOM   101  C CB  . ALA A 1 27  ? 54.035 51.783 26.447  1.00 29.18 ? 57  ALA A CB  1 
ATOM   102  N N   . GLY A 1 28  ? 56.269 53.500 24.937  1.00 28.86 ? 58  GLY A N   1 
ATOM   103  C CA  . GLY A 1 28  ? 56.913 53.766 23.648  1.00 28.89 ? 58  GLY A CA  1 
ATOM   104  C C   . GLY A 1 28  ? 58.377 53.416 23.697  1.00 30.77 ? 58  GLY A C   1 
ATOM   105  O O   . GLY A 1 28  ? 59.001 53.448 24.761  1.00 30.18 ? 58  GLY A O   1 
ATOM   106  N N   . HIS A 1 29  ? 58.936 53.062 22.547  1.00 28.80 ? 59  HIS A N   1 
ATOM   107  C CA  . HIS A 1 29  ? 60.362 52.760 22.482  1.00 29.36 ? 59  HIS A CA  1 
ATOM   108  C C   . HIS A 1 29  ? 60.806 53.183 21.082  1.00 31.05 ? 59  HIS A C   1 
ATOM   109  O O   . HIS A 1 29  ? 60.895 52.359 20.194  1.00 28.82 ? 59  HIS A O   1 
ATOM   110  C CB  . HIS A 1 29  ? 60.574 51.267 22.754  1.00 31.62 ? 59  HIS A CB  1 
ATOM   111  C CG  . HIS A 1 29  ? 62.003 50.830 22.728  1.00 41.86 ? 59  HIS A CG  1 
ATOM   112  N ND1 . HIS A 1 29  ? 62.373 49.509 22.882  1.00 49.79 ? 59  HIS A ND1 1 
ATOM   113  C CD2 . HIS A 1 29  ? 63.151 51.525 22.535  1.00 44.18 ? 59  HIS A CD2 1 
ATOM   114  C CE1 . HIS A 1 29  ? 63.690 49.415 22.807  1.00 50.99 ? 59  HIS A CE1 1 
ATOM   115  N NE2 . HIS A 1 29  ? 64.184 50.621 22.589  1.00 44.32 ? 59  HIS A NE2 1 
ATOM   116  N N   . PRO A 1 30  ? 61.035 54.493 20.872  1.00 31.47 ? 60  PRO A N   1 
ATOM   117  C CA  . PRO A 1 30  ? 61.438 54.956 19.533  1.00 31.84 ? 60  PRO A CA  1 
ATOM   118  C C   . PRO A 1 30  ? 62.765 54.347 19.068  1.00 31.37 ? 60  PRO A C   1 
ATOM   119  O O   . PRO A 1 30  ? 63.714 54.221 19.855  1.00 31.29 ? 60  PRO A O   1 
ATOM   120  C CB  . PRO A 1 30  ? 61.574 56.487 19.715  1.00 33.38 ? 60  PRO A CB  1 
ATOM   121  C CG  . PRO A 1 30  ? 60.722 56.787 20.906  1.00 35.72 ? 60  PRO A CG  1 
ATOM   122  C CD  . PRO A 1 30  ? 60.917 55.619 21.826  1.00 33.83 ? 60  PRO A CD  1 
ATOM   123  N N   . LEU A 1 31  ? 62.808 53.935 17.805  1.00 29.57 ? 61  LEU A N   1 
ATOM   124  C CA  . LEU A 1 31  ? 64.008 53.334 17.237  1.00 30.23 ? 61  LEU A CA  1 
ATOM   125  C C   . LEU A 1 31  ? 64.349 54.114 15.982  1.00 32.38 ? 61  LEU A C   1 
ATOM   126  O O   . LEU A 1 31  ? 63.535 54.197 15.057  1.00 31.15 ? 61  LEU A O   1 
ATOM   127  C CB  . LEU A 1 31  ? 63.753 51.864 16.860  1.00 31.15 ? 61  LEU A CB  1 
ATOM   128  C CG  . LEU A 1 31  ? 63.429 50.889 18.002  1.00 33.77 ? 61  LEU A CG  1 
ATOM   129  C CD1 . LEU A 1 31  ? 62.962 49.529 17.443  1.00 34.45 ? 61  LEU A CD1 1 
ATOM   130  C CD2 . LEU A 1 31  ? 64.645 50.723 18.923  1.00 35.03 ? 61  LEU A CD2 1 
ATOM   131  N N   . THR A 1 32  ? 65.546 54.682 15.932  1.00 32.52 ? 62  THR A N   1 
ATOM   132  C CA  . THR A 1 32  ? 65.966 55.328 14.698  1.00 32.84 ? 62  THR A CA  1 
ATOM   133  C C   . THR A 1 32  ? 66.145 54.260 13.629  1.00 32.38 ? 62  THR A C   1 
ATOM   134  O O   . THR A 1 32  ? 66.305 53.069 13.933  1.00 31.97 ? 62  THR A O   1 
ATOM   135  C CB  . THR A 1 32  ? 67.294 56.079 14.865  1.00 32.89 ? 62  THR A CB  1 
ATOM   136  O OG1 . THR A 1 32  ? 68.307 55.142 15.243  1.00 33.91 ? 62  THR A OG1 1 
ATOM   137  C CG2 . THR A 1 32  ? 67.171 57.179 15.930  1.00 35.66 ? 62  THR A CG2 1 
ATOM   138  N N   . ARG A 1 33  ? 66.095 54.685 12.379  1.00 33.86 ? 63  ARG A N   1 
ATOM   139  C CA  . ARG A 1 33  ? 66.438 53.825 11.257  1.00 36.96 ? 63  ARG A CA  1 
ATOM   140  C C   . ARG A 1 33  ? 67.762 53.082 11.542  1.00 36.39 ? 63  ARG A C   1 
ATOM   141  O O   . ARG A 1 33  ? 67.844 51.857 11.380  1.00 37.64 ? 63  ARG A O   1 
ATOM   142  C CB  . ARG A 1 33  ? 66.528 54.692 9.997   1.00 38.35 ? 63  ARG A CB  1 
ATOM   143  C CG  . ARG A 1 33  ? 66.348 53.942 8.724   1.00 49.72 ? 63  ARG A CG  1 
ATOM   144  C CD  . ARG A 1 33  ? 66.743 54.796 7.540   1.00 55.51 ? 63  ARG A CD  1 
ATOM   145  N NE  . ARG A 1 33  ? 67.495 54.002 6.572   1.00 57.47 ? 63  ARG A NE  1 
ATOM   146  C CZ  . ARG A 1 33  ? 67.767 54.390 5.332   1.00 61.25 ? 63  ARG A CZ  1 
ATOM   147  N NH1 . ARG A 1 33  ? 67.340 55.573 4.893   1.00 61.49 ? 63  ARG A NH1 1 
ATOM   148  N NH2 . ARG A 1 33  ? 68.458 53.586 4.531   1.00 57.95 ? 63  ARG A NH2 1 
ATOM   149  N N   . TRP A 1 34  ? 68.775 53.808 12.028  1.00 34.31 ? 64  TRP A N   1 
ATOM   150  C CA  . TRP A 1 34  ? 70.068 53.202 12.347  1.00 33.62 ? 64  TRP A CA  1 
ATOM   151  C C   . TRP A 1 34  ? 69.967 52.102 13.404  1.00 34.63 ? 64  TRP A C   1 
ATOM   152  O O   . TRP A 1 34  ? 70.438 50.977 13.191  1.00 33.74 ? 64  TRP A O   1 
ATOM   153  C CB  . TRP A 1 34  ? 71.118 54.257 12.769  1.00 35.80 ? 64  TRP A CB  1 
ATOM   154  C CG  . TRP A 1 34  ? 72.457 53.612 13.028  1.00 41.60 ? 64  TRP A CG  1 
ATOM   155  C CD1 . TRP A 1 34  ? 73.417 53.307 12.094  1.00 47.32 ? 64  TRP A CD1 1 
ATOM   156  C CD2 . TRP A 1 34  ? 72.962 53.139 14.286  1.00 45.46 ? 64  TRP A CD2 1 
ATOM   157  N NE1 . TRP A 1 34  ? 74.488 52.687 12.698  1.00 44.42 ? 64  TRP A NE1 1 
ATOM   158  C CE2 . TRP A 1 34  ? 74.236 52.570 14.039  1.00 44.76 ? 64  TRP A CE2 1 
ATOM   159  C CE3 . TRP A 1 34  ? 72.466 53.144 15.600  1.00 45.54 ? 64  TRP A CE3 1 
ATOM   160  C CZ2 . TRP A 1 34  ? 75.018 52.013 15.057  1.00 44.73 ? 64  TRP A CZ2 1 
ATOM   161  C CZ3 . TRP A 1 34  ? 73.248 52.592 16.611  1.00 44.78 ? 64  TRP A CZ3 1 
ATOM   162  C CH2 . TRP A 1 34  ? 74.503 52.029 16.332  1.00 44.96 ? 64  TRP A CH2 1 
ATOM   163  N N   . ALA A 1 35  ? 69.351 52.420 14.539  1.00 32.07 ? 65  ALA A N   1 
ATOM   164  C CA  . ALA A 1 35  ? 69.215 51.452 15.619  1.00 32.97 ? 65  ALA A CA  1 
ATOM   165  C C   . ALA A 1 35  ? 68.423 50.227 15.131  1.00 32.40 ? 65  ALA A C   1 
ATOM   166  O O   . ALA A 1 35  ? 68.800 49.087 15.388  1.00 33.50 ? 65  ALA A O   1 
ATOM   167  C CB  . ALA A 1 35  ? 68.523 52.087 16.802  1.00 33.61 ? 65  ALA A CB  1 
ATOM   168  N N   . LEU A 1 36  ? 67.346 50.475 14.397  1.00 30.11 ? 66  LEU A N   1 
ATOM   169  C CA  . LEU A 1 36  ? 66.541 49.391 13.859  1.00 32.59 ? 66  LEU A CA  1 
ATOM   170  C C   . LEU A 1 36  ? 67.373 48.422 12.987  1.00 33.79 ? 66  LEU A C   1 
ATOM   171  O O   . LEU A 1 36  ? 67.261 47.183 13.113  1.00 33.64 ? 66  LEU A O   1 
ATOM   172  C CB  . LEU A 1 36  ? 65.357 49.985 13.088  1.00 33.35 ? 66  LEU A CB  1 
ATOM   173  C CG  . LEU A 1 36  ? 64.360 48.987 12.521  1.00 35.84 ? 66  LEU A CG  1 
ATOM   174  C CD1 . LEU A 1 36  ? 63.629 48.244 13.655  1.00 31.19 ? 66  LEU A CD1 1 
ATOM   175  C CD2 . LEU A 1 36  ? 63.404 49.752 11.607  1.00 32.92 ? 66  LEU A CD2 1 
ATOM   176  N N   . GLN A 1 37  ? 68.234 48.980 12.136  1.00 34.61 ? 67  GLN A N   1 
ATOM   177  C CA  . GLN A 1 37  ? 69.060 48.169 11.229  1.00 34.53 ? 67  GLN A CA  1 
ATOM   178  C C   . GLN A 1 37  ? 70.317 47.584 11.872  1.00 37.10 ? 67  GLN A C   1 
ATOM   179  O O   . GLN A 1 37  ? 70.734 46.473 11.517  1.00 35.54 ? 67  GLN A O   1 
ATOM   180  C CB  . GLN A 1 37  ? 69.473 48.989 10.015  1.00 36.94 ? 67  GLN A CB  1 
ATOM   181  C CG  . GLN A 1 37  ? 68.360 49.258 9.028   1.00 36.71 ? 67  GLN A CG  1 
ATOM   182  C CD  . GLN A 1 37  ? 68.809 50.194 7.914   1.00 42.27 ? 67  GLN A CD  1 
ATOM   183  O OE1 . GLN A 1 37  ? 68.809 51.408 8.079   1.00 45.24 ? 67  GLN A OE1 1 
ATOM   184  N NE2 . GLN A 1 37  ? 69.185 49.630 6.774   1.00 35.12 ? 67  GLN A NE2 1 
ATOM   185  N N   . ARG A 1 38  ? 70.911 48.313 12.820  1.00 33.37 ? 68  ARG A N   1 
ATOM   186  C CA  . ARG A 1 38  ? 72.266 48.003 13.270  1.00 35.16 ? 68  ARG A CA  1 
ATOM   187  C C   . ARG A 1 38  ? 72.405 47.672 14.748  1.00 37.65 ? 68  ARG A C   1 
ATOM   188  O O   . ARG A 1 38  ? 73.378 47.042 15.145  1.00 40.47 ? 68  ARG A O   1 
ATOM   189  C CB  . ARG A 1 38  ? 73.216 49.167 12.941  1.00 33.84 ? 68  ARG A CB  1 
ATOM   190  C CG  . ARG A 1 38  ? 73.231 49.571 11.472  1.00 36.65 ? 68  ARG A CG  1 
ATOM   191  C CD  . ARG A 1 38  ? 73.745 48.411 10.653  1.00 39.98 ? 68  ARG A CD  1 
ATOM   192  N NE  . ARG A 1 38  ? 73.649 48.631 9.216   1.00 48.28 ? 68  ARG A NE  1 
ATOM   193  C CZ  . ARG A 1 38  ? 73.879 47.685 8.310   1.00 51.37 ? 68  ARG A CZ  1 
ATOM   194  N NH1 . ARG A 1 38  ? 74.201 46.447 8.691   1.00 42.13 ? 68  ARG A NH1 1 
ATOM   195  N NH2 . ARG A 1 38  ? 73.776 47.975 7.020   1.00 51.63 ? 68  ARG A NH2 1 
ATOM   196  N N   . GLN A 1 39  ? 71.486 48.140 15.578  1.00 35.58 ? 69  GLN A N   1 
ATOM   197  C CA  . GLN A 1 39  ? 71.590 47.854 17.002  1.00 35.64 ? 69  GLN A CA  1 
ATOM   198  C C   . GLN A 1 39  ? 70.189 47.743 17.601  1.00 34.40 ? 69  GLN A C   1 
ATOM   199  O O   . GLN A 1 39  ? 69.821 48.556 18.430  1.00 34.14 ? 69  GLN A O   1 
ATOM   200  C CB  . GLN A 1 39  ? 72.400 48.956 17.707  1.00 37.20 ? 69  GLN A CB  1 
ATOM   201  N N   . PRO A 1 40  ? 69.381 46.766 17.130  1.00 34.21 ? 70  PRO A N   1 
ATOM   202  C CA  . PRO A 1 40  ? 68.014 46.669 17.627  1.00 34.60 ? 70  PRO A CA  1 
ATOM   203  C C   . PRO A 1 40  ? 67.985 46.111 19.051  1.00 34.69 ? 70  PRO A C   1 
ATOM   204  O O   . PRO A 1 40  ? 69.000 45.611 19.531  1.00 32.46 ? 70  PRO A O   1 
ATOM   205  C CB  . PRO A 1 40  ? 67.376 45.681 16.648  1.00 35.56 ? 70  PRO A CB  1 
ATOM   206  C CG  . PRO A 1 40  ? 68.501 44.782 16.263  1.00 36.15 ? 70  PRO A CG  1 
ATOM   207  C CD  . PRO A 1 40  ? 69.658 45.733 16.107  1.00 36.40 ? 70  PRO A CD  1 
ATOM   208  N N   . PRO A 1 41  ? 66.833 46.187 19.728  1.00 34.33 ? 71  PRO A N   1 
ATOM   209  C CA  . PRO A 1 41  ? 66.801 45.531 21.035  1.00 34.55 ? 71  PRO A CA  1 
ATOM   210  C C   . PRO A 1 41  ? 67.044 44.031 20.832  1.00 31.70 ? 71  PRO A C   1 
ATOM   211  O O   . PRO A 1 41  ? 66.733 43.495 19.758  1.00 34.22 ? 71  PRO A O   1 
ATOM   212  C CB  . PRO A 1 41  ? 65.368 45.780 21.523  1.00 34.57 ? 71  PRO A CB  1 
ATOM   213  C CG  . PRO A 1 41  ? 64.899 46.987 20.732  1.00 37.62 ? 71  PRO A CG  1 
ATOM   214  C CD  . PRO A 1 41  ? 65.547 46.825 19.387  1.00 34.28 ? 71  PRO A CD  1 
ATOM   215  N N   . SER A 1 42  ? 67.634 43.386 21.831  1.00 31.66 ? 72  SER A N   1 
ATOM   216  C CA  . SER A 1 42  ? 68.001 41.973 21.722  1.00 29.94 ? 72  SER A CA  1 
ATOM   217  C C   . SER A 1 42  ? 66.723 41.135 21.687  1.00 28.91 ? 72  SER A C   1 
ATOM   218  O O   . SER A 1 42  ? 65.662 41.621 22.106  1.00 26.76 ? 72  SER A O   1 
ATOM   219  C CB  . SER A 1 42  ? 68.815 41.561 22.943  1.00 32.89 ? 72  SER A CB  1 
ATOM   220  O OG  . SER A 1 42  ? 67.978 41.551 24.097  1.00 32.21 ? 72  SER A OG  1 
ATOM   221  N N   . PRO A 1 43  ? 66.813 39.880 21.189  1.00 29.24 ? 73  PRO A N   1 
ATOM   222  C CA  . PRO A 1 43  ? 65.633 39.008 21.223  1.00 28.55 ? 73  PRO A CA  1 
ATOM   223  C C   . PRO A 1 43  ? 65.018 38.893 22.650  1.00 27.47 ? 73  PRO A C   1 
ATOM   224  O O   . PRO A 1 43  ? 63.791 38.950 22.772  1.00 25.22 ? 73  PRO A O   1 
ATOM   225  C CB  . PRO A 1 43  ? 66.188 37.668 20.744  1.00 30.17 ? 73  PRO A CB  1 
ATOM   226  C CG  . PRO A 1 43  ? 67.302 38.045 19.810  1.00 31.96 ? 73  PRO A CG  1 
ATOM   227  C CD  . PRO A 1 43  ? 67.958 39.226 20.508  1.00 29.57 ? 73  PRO A CD  1 
ATOM   228  N N   . LYS A 1 44  ? 65.848 38.782 23.697  1.00 26.09 ? 74  LYS A N   1 
ATOM   229  C CA  . LYS A 1 44  ? 65.275 38.677 25.065  1.00 27.77 ? 74  LYS A CA  1 
ATOM   230  C C   . LYS A 1 44  ? 64.544 39.952 25.464  1.00 28.62 ? 74  LYS A C   1 
ATOM   231  O O   . LYS A 1 44  ? 63.460 39.910 26.065  1.00 30.27 ? 74  LYS A O   1 
ATOM   232  C CB  . LYS A 1 44  ? 66.338 38.354 26.120  1.00 31.23 ? 74  LYS A CB  1 
ATOM   233  C CG  . LYS A 1 44  ? 65.756 38.167 27.585  1.00 30.98 ? 74  LYS A CG  1 
ATOM   234  C CD  . LYS A 1 44  ? 65.065 36.778 27.796  1.00 35.86 ? 74  LYS A CD  1 
ATOM   235  C CE  . LYS A 1 44  ? 64.413 36.604 29.208  1.00 34.24 ? 74  LYS A CE  1 
ATOM   236  N NZ  . LYS A 1 44  ? 65.384 36.468 30.334  1.00 36.10 ? 74  LYS A NZ  1 
ATOM   237  N N   . GLN A 1 45  ? 65.133 41.090 25.131  1.00 26.70 ? 75  GLN A N   1 
ATOM   238  C CA  . GLN A 1 45  ? 64.498 42.368 25.429  1.00 29.91 ? 75  GLN A CA  1 
ATOM   239  C C   . GLN A 1 45  ? 63.169 42.488 24.695  1.00 26.03 ? 75  GLN A C   1 
ATOM   240  O O   . GLN A 1 45  ? 62.212 42.994 25.258  1.00 26.02 ? 75  GLN A O   1 
ATOM   241  C CB  . GLN A 1 45  ? 65.391 43.531 25.041  1.00 29.65 ? 75  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 45  ? 66.568 43.766 25.984  1.00 33.21 ? 75  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 45  ? 67.485 44.899 25.485  1.00 40.68 ? 75  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 45  ? 67.810 45.009 24.285  1.00 39.28 ? 75  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 45  ? 67.903 45.750 26.417  1.00 53.48 ? 75  GLN A NE2 1 
ATOM   246  N N   . LEU A 1 46  ? 63.103 42.038 23.439  1.00 24.83 ? 76  LEU A N   1 
ATOM   247  C CA  . LEU A 1 46  ? 61.830 42.088 22.710  1.00 23.50 ? 76  LEU A CA  1 
ATOM   248  C C   . LEU A 1 46  ? 60.758 41.152 23.303  1.00 24.86 ? 76  LEU A C   1 
ATOM   249  O O   . LEU A 1 46  ? 59.565 41.487 23.299  1.00 24.53 ? 76  LEU A O   1 
ATOM   250  C CB  . LEU A 1 46  ? 62.040 41.802 21.217  1.00 24.07 ? 76  LEU A CB  1 
ATOM   251  C CG  . LEU A 1 46  ? 62.851 42.886 20.490  1.00 25.71 ? 76  LEU A CG  1 
ATOM   252  C CD1 . LEU A 1 46  ? 62.951 42.507 18.988  1.00 30.68 ? 76  LEU A CD1 1 
ATOM   253  C CD2 . LEU A 1 46  ? 62.207 44.285 20.660  1.00 30.87 ? 76  LEU A CD2 1 
ATOM   254  N N   . GLU A 1 47  ? 61.185 39.998 23.819  1.00 25.04 ? 77  GLU A N   1 
ATOM   255  C CA  . GLU A 1 47  ? 60.269 39.048 24.449  1.00 26.61 ? 77  GLU A CA  1 
ATOM   256  C C   . GLU A 1 47  ? 59.689 39.673 25.730  1.00 26.63 ? 77  GLU A C   1 
ATOM   257  O O   . GLU A 1 47  ? 58.479 39.629 25.958  1.00 25.09 ? 77  GLU A O   1 
ATOM   258  C CB  . GLU A 1 47  ? 60.990 37.736 24.782  1.00 26.07 ? 77  GLU A CB  1 
ATOM   259  C CG  . GLU A 1 47  ? 61.278 36.869 23.553  1.00 26.28 ? 77  GLU A CG  1 
ATOM   260  C CD  . GLU A 1 47  ? 62.037 35.580 23.909  1.00 26.65 ? 77  GLU A CD  1 
ATOM   261  O OE1 . GLU A 1 47  ? 62.501 35.409 25.081  1.00 26.55 ? 77  GLU A OE1 1 
ATOM   262  O OE2 . GLU A 1 47  ? 62.169 34.741 23.005  1.00 29.42 ? 77  GLU A OE2 1 
ATOM   263  N N   . GLU A 1 48  ? 60.552 40.268 26.542  1.00 26.07 ? 78  GLU A N   1 
ATOM   264  C CA  . GLU A 1 48  ? 60.092 40.894 27.793  1.00 27.19 ? 78  GLU A CA  1 
ATOM   265  C C   . GLU A 1 48  ? 59.182 42.076 27.513  1.00 25.94 ? 78  GLU A C   1 
ATOM   266  O O   . GLU A 1 48  ? 58.160 42.261 28.191  1.00 26.74 ? 78  GLU A O   1 
ATOM   267  C CB  . GLU A 1 48  ? 61.287 41.293 28.657  1.00 29.49 ? 78  GLU A CB  1 
ATOM   268  C CG  . GLU A 1 48  ? 61.995 40.043 29.184  1.00 31.60 ? 78  GLU A CG  1 
ATOM   269  C CD  . GLU A 1 48  ? 63.256 40.344 29.947  1.00 51.26 ? 78  GLU A CD  1 
ATOM   270  O OE1 . GLU A 1 48  ? 63.847 41.426 29.749  1.00 60.28 ? 78  GLU A OE1 1 
ATOM   271  O OE2 . GLU A 1 48  ? 63.680 39.477 30.730  1.00 46.45 ? 78  GLU A OE2 1 
ATOM   272  N N   . GLU A 1 49  ? 59.531 42.855 26.495  1.00 25.13 ? 79  GLU A N   1 
ATOM   273  C CA  . GLU A 1 49  ? 58.708 44.009 26.079  1.00 23.75 ? 79  GLU A CA  1 
ATOM   274  C C   . GLU A 1 49  ? 57.334 43.545 25.646  1.00 26.89 ? 79  GLU A C   1 
ATOM   275  O O   . GLU A 1 49  ? 56.319 44.095 26.089  1.00 25.77 ? 79  GLU A O   1 
ATOM   276  C CB  . GLU A 1 49  ? 59.386 44.759 24.921  1.00 25.05 ? 79  GLU A CB  1 
ATOM   277  C CG  . GLU A 1 49  ? 58.695 46.079 24.504  1.00 26.31 ? 79  GLU A CG  1 
ATOM   278  C CD  . GLU A 1 49  ? 59.611 46.888 23.622  1.00 35.77 ? 79  GLU A CD  1 
ATOM   279  O OE1 . GLU A 1 49  ? 60.459 47.620 24.165  1.00 33.40 ? 79  GLU A OE1 1 
ATOM   280  O OE2 . GLU A 1 49  ? 59.501 46.786 22.387  1.00 31.66 ? 79  GLU A OE2 1 
ATOM   281  N N   . PHE A 1 50  ? 57.291 42.534 24.775  1.00 24.55 ? 80  PHE A N   1 
ATOM   282  C CA  . PHE A 1 50  ? 56.008 42.042 24.293  1.00 26.32 ? 80  PHE A CA  1 
ATOM   283  C C   . PHE A 1 50  ? 55.118 41.550 25.442  1.00 26.74 ? 80  PHE A C   1 
ATOM   284  O O   . PHE A 1 50  ? 53.907 41.822 25.473  1.00 25.87 ? 80  PHE A O   1 
ATOM   285  C CB  . PHE A 1 50  ? 56.193 40.904 23.285  1.00 27.18 ? 80  PHE A CB  1 
ATOM   286  C CG  . PHE A 1 50  ? 54.883 40.448 22.669  1.00 25.55 ? 80  PHE A CG  1 
ATOM   287  C CD1 . PHE A 1 50  ? 54.227 41.260 21.750  1.00 24.65 ? 80  PHE A CD1 1 
ATOM   288  C CD2 . PHE A 1 50  ? 54.289 39.259 23.071  1.00 28.74 ? 80  PHE A CD2 1 
ATOM   289  C CE1 . PHE A 1 50  ? 53.008 40.878 21.194  1.00 27.22 ? 80  PHE A CE1 1 
ATOM   290  C CE2 . PHE A 1 50  ? 53.052 38.880 22.521  1.00 30.60 ? 80  PHE A CE2 1 
ATOM   291  C CZ  . PHE A 1 50  ? 52.450 39.683 21.572  1.00 26.51 ? 80  PHE A CZ  1 
ATOM   292  N N   . LEU A 1 51  ? 55.711 40.797 26.362  1.00 25.01 ? 81  LEU A N   1 
ATOM   293  C CA  . LEU A 1 51  ? 54.960 40.262 27.486  1.00 25.62 ? 81  LEU A CA  1 
ATOM   294  C C   . LEU A 1 51  ? 54.327 41.346 28.358  1.00 27.40 ? 81  LEU A C   1 
ATOM   295  O O   . LEU A 1 51  ? 53.293 41.114 28.997  1.00 29.93 ? 81  LEU A O   1 
ATOM   296  C CB  . LEU A 1 51  ? 55.858 39.362 28.357  1.00 27.29 ? 81  LEU A CB  1 
ATOM   297  C CG  . LEU A 1 51  ? 56.107 37.958 27.806  1.00 30.39 ? 81  LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 51  ? 57.194 37.224 28.655  1.00 28.58 ? 81  LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 51  ? 54.819 37.156 27.779  1.00 34.24 ? 81  LEU A CD2 1 
ATOM   300  N N   . LYS A 1 52  ? 54.945 42.518 28.396  1.00 26.80 ? 82  LYS A N   1 
ATOM   301  C CA  . LYS A 1 52  ? 54.439 43.621 29.218  1.00 29.59 ? 82  LYS A CA  1 
ATOM   302  C C   . LYS A 1 52  ? 53.235 44.332 28.616  1.00 27.08 ? 82  LYS A C   1 
ATOM   303  O O   . LYS A 1 52  ? 52.524 45.039 29.336  1.00 27.97 ? 82  LYS A O   1 
ATOM   304  C CB  . LYS A 1 52  ? 55.524 44.667 29.488  1.00 31.33 ? 82  LYS A CB  1 
ATOM   305  C CG  . LYS A 1 52  ? 56.558 44.273 30.545  1.00 38.84 ? 82  LYS A CG  1 
ATOM   306  C CD  . LYS A 1 52  ? 57.658 45.347 30.588  1.00 40.18 ? 82  LYS A CD  1 
ATOM   307  C CE  . LYS A 1 52  ? 58.678 45.094 31.705  1.00 56.88 ? 82  LYS A CE  1 
ATOM   308  N NZ  . LYS A 1 52  ? 59.883 44.326 31.256  1.00 53.59 ? 82  LYS A NZ  1 
ATOM   309  N N   . ILE A 1 53  ? 53.005 44.185 27.312  1.00 25.08 ? 83  ILE A N   1 
ATOM   310  C CA  . ILE A 1 53  ? 51.877 44.868 26.665  1.00 24.42 ? 83  ILE A CA  1 
ATOM   311  C C   . ILE A 1 53  ? 50.545 44.202 27.041  1.00 26.17 ? 83  ILE A C   1 
ATOM   312  O O   . ILE A 1 53  ? 50.345 43.023 26.741  1.00 26.65 ? 83  ILE A O   1 
ATOM   313  C CB  . ILE A 1 53  ? 52.014 44.883 25.106  1.00 23.61 ? 83  ILE A CB  1 
ATOM   314  C CG1 . ILE A 1 53  ? 53.433 45.306 24.681  1.00 24.11 ? 83  ILE A CG1 1 
ATOM   315  C CG2 . ILE A 1 53  ? 50.897 45.791 24.501  1.00 21.56 ? 83  ILE A CG2 1 
ATOM   316  C CD1 . ILE A 1 53  ? 53.718 45.164 23.127  1.00 24.87 ? 83  ILE A CD1 1 
ATOM   317  N N   . PRO A 1 54  ? 49.621 44.962 27.677  1.00 27.05 ? 84  PRO A N   1 
ATOM   318  C CA  . PRO A 1 54  ? 48.321 44.419 28.077  1.00 28.45 ? 84  PRO A CA  1 
ATOM   319  C C   . PRO A 1 54  ? 47.516 44.031 26.846  1.00 27.40 ? 84  PRO A C   1 
ATOM   320  O O   . PRO A 1 54  ? 47.704 44.621 25.768  1.00 25.43 ? 84  PRO A O   1 
ATOM   321  C CB  . PRO A 1 54  ? 47.639 45.599 28.779  1.00 30.36 ? 84  PRO A CB  1 
ATOM   322  C CG  . PRO A 1 54  ? 48.718 46.579 29.068  1.00 32.40 ? 84  PRO A CG  1 
ATOM   323  C CD  . PRO A 1 54  ? 49.765 46.382 28.037  1.00 26.80 ? 84  PRO A CD  1 
ATOM   324  N N   . SER A 1 55  ? 46.642 43.045 26.988  1.00 27.10 ? 85  SER A N   1 
ATOM   325  C CA  . SER A 1 55  ? 45.803 42.621 25.840  1.00 26.24 ? 85  SER A CA  1 
ATOM   326  C C   . SER A 1 55  ? 44.745 43.656 25.452  1.00 25.91 ? 85  SER A C   1 
ATOM   327  O O   . SER A 1 55  ? 44.458 43.841 24.263  1.00 25.88 ? 85  SER A O   1 
ATOM   328  C CB  . SER A 1 55  ? 45.077 41.324 26.170  1.00 27.12 ? 85  SER A CB  1 
ATOM   329  O OG  . SER A 1 55  ? 44.091 41.515 27.202  1.00 28.65 ? 85  SER A OG  1 
ATOM   330  N N   . ASN A 1 56  ? 44.160 44.303 26.462  1.00 26.21 ? 86  ASN A N   1 
ATOM   331  C CA  . ASN A 1 56  ? 42.954 45.127 26.273  1.00 27.10 ? 86  ASN A CA  1 
ATOM   332  C C   . ASN A 1 56  ? 41.776 44.323 25.725  1.00 27.86 ? 86  ASN A C   1 
ATOM   333  O O   . ASN A 1 56  ? 40.872 44.870 25.089  1.00 28.16 ? 86  ASN A O   1 
ATOM   334  C CB  . ASN A 1 56  ? 43.206 46.376 25.398  1.00 26.97 ? 86  ASN A CB  1 
ATOM   335  C CG  . ASN A 1 56  ? 42.209 47.480 25.674  1.00 31.49 ? 86  ASN A CG  1 
ATOM   336  O OD1 . ASN A 1 56  ? 41.682 47.579 26.784  1.00 27.42 ? 86  ASN A OD1 1 
ATOM   337  N ND2 . ASN A 1 56  ? 41.936 48.312 24.679  1.00 27.38 ? 86  ASN A ND2 1 
ATOM   338  N N   . PHE A 1 57  ? 41.770 43.021 25.994  1.00 29.48 ? 87  PHE A N   1 
ATOM   339  C CA  . PHE A 1 57  ? 40.611 42.204 25.674  1.00 30.11 ? 87  PHE A CA  1 
ATOM   340  C C   . PHE A 1 57  ? 39.399 42.677 26.445  1.00 29.65 ? 87  PHE A C   1 
ATOM   341  O O   . PHE A 1 57  ? 39.507 43.068 27.606  1.00 31.28 ? 87  PHE A O   1 
ATOM   342  C CB  . PHE A 1 57  ? 40.879 40.741 25.992  1.00 28.57 ? 87  PHE A CB  1 
ATOM   343  C CG  . PHE A 1 57  ? 41.637 40.030 24.902  1.00 34.01 ? 87  PHE A CG  1 
ATOM   344  C CD1 . PHE A 1 57  ? 41.280 40.219 23.566  1.00 38.83 ? 87  PHE A CD1 1 
ATOM   345  C CD2 . PHE A 1 57  ? 42.680 39.164 25.205  1.00 40.33 ? 87  PHE A CD2 1 
ATOM   346  C CE1 . PHE A 1 57  ? 41.961 39.573 22.552  1.00 38.58 ? 87  PHE A CE1 1 
ATOM   347  C CE2 . PHE A 1 57  ? 43.372 38.514 24.183  1.00 34.70 ? 87  PHE A CE2 1 
ATOM   348  C CZ  . PHE A 1 57  ? 42.986 38.714 22.865  1.00 31.38 ? 87  PHE A CZ  1 
ATOM   349  N N   . VAL A 1 58  ? 38.241 42.629 25.808  1.00 32.73 ? 88  VAL A N   1 
ATOM   350  C CA  . VAL A 1 58  ? 36.998 42.966 26.502  1.00 34.51 ? 88  VAL A CA  1 
ATOM   351  C C   . VAL A 1 58  ? 36.363 41.672 26.996  1.00 35.40 ? 88  VAL A C   1 
ATOM   352  O O   . VAL A 1 58  ? 36.429 40.635 26.330  1.00 36.29 ? 88  VAL A O   1 
ATOM   353  C CB  . VAL A 1 58  ? 36.017 43.838 25.627  1.00 37.89 ? 88  VAL A CB  1 
ATOM   354  C CG1 A VAL A 1 58  ? 35.856 43.243 24.237  0.50 38.60 ? 88  VAL A CG1 1 
ATOM   355  C CG1 B VAL A 1 58  ? 36.671 45.153 25.245  0.50 38.58 ? 88  VAL A CG1 1 
ATOM   356  C CG2 A VAL A 1 58  ? 34.677 44.019 26.271  0.50 33.90 ? 88  VAL A CG2 1 
ATOM   357  C CG2 B VAL A 1 58  ? 35.517 43.077 24.415  0.50 37.02 ? 88  VAL A CG2 1 
ATOM   358  N N   . SER A 1 59  ? 35.775 41.736 28.177  1.00 36.67 ? 89  SER A N   1 
ATOM   359  C CA  . SER A 1 59  ? 35.079 40.596 28.742  1.00 40.69 ? 89  SER A CA  1 
ATOM   360  C C   . SER A 1 59  ? 33.642 40.556 28.215  1.00 42.08 ? 89  SER A C   1 
ATOM   361  O O   . SER A 1 59  ? 33.078 41.604 27.857  1.00 39.26 ? 89  SER A O   1 
ATOM   362  C CB  . SER A 1 59  ? 35.065 40.725 30.256  1.00 42.35 ? 89  SER A CB  1 
ATOM   363  O OG  . SER A 1 59  ? 34.271 41.840 30.618  1.00 51.38 ? 89  SER A OG  1 
ATOM   364  N N   . PRO A 1 60  ? 33.029 39.355 28.177  1.00 45.55 ? 90  PRO A N   1 
ATOM   365  C CA  . PRO A 1 60  ? 31.641 39.245 27.721  1.00 46.92 ? 90  PRO A CA  1 
ATOM   366  C C   . PRO A 1 60  ? 30.715 40.235 28.440  1.00 47.23 ? 90  PRO A C   1 
ATOM   367  O O   . PRO A 1 60  ? 29.738 40.693 27.851  1.00 46.73 ? 90  PRO A O   1 
ATOM   368  C CB  . PRO A 1 60  ? 31.269 37.804 28.083  1.00 48.39 ? 90  PRO A CB  1 
ATOM   369  C CG  . PRO A 1 60  ? 32.553 37.069 28.045  1.00 49.28 ? 90  PRO A CG  1 
ATOM   370  C CD  . PRO A 1 60  ? 33.583 38.040 28.563  1.00 47.23 ? 90  PRO A CD  1 
ATOM   371  N N   . GLU A 1 61  ? 31.053 40.581 29.682  1.00 48.89 ? 91  GLU A N   1 
ATOM   372  C CA  . GLU A 1 61  ? 30.255 41.506 30.497  1.00 51.66 ? 91  GLU A CA  1 
ATOM   373  C C   . GLU A 1 61  ? 30.249 42.953 29.972  1.00 52.61 ? 91  GLU A C   1 
ATOM   374  O O   . GLU A 1 61  ? 29.274 43.676 30.174  1.00 52.45 ? 91  GLU A O   1 
ATOM   375  C CB  . GLU A 1 61  ? 30.720 41.476 31.958  1.00 52.29 ? 91  GLU A CB  1 
ATOM   376  C CG  . GLU A 1 61  ? 30.829 40.074 32.562  1.00 55.17 ? 91  GLU A CG  1 
ATOM   377  N N   . ASP A 1 62  ? 31.319 43.372 29.296  1.00 51.43 ? 92  ASP A N   1 
ATOM   378  C CA  . ASP A 1 62  ? 31.410 44.747 28.787  1.00 53.01 ? 92  ASP A CA  1 
ATOM   379  C C   . ASP A 1 62  ? 30.649 44.949 27.474  1.00 51.56 ? 92  ASP A C   1 
ATOM   380  O O   . ASP A 1 62  ? 30.630 46.052 26.922  1.00 50.92 ? 92  ASP A O   1 
ATOM   381  C CB  . ASP A 1 62  ? 32.866 45.178 28.586  1.00 55.16 ? 92  ASP A CB  1 
ATOM   382  C CG  . ASP A 1 62  ? 33.757 44.867 29.779  1.00 61.43 ? 92  ASP A CG  1 
ATOM   383  O OD1 . ASP A 1 62  ? 33.265 44.861 30.930  1.00 63.27 ? 92  ASP A OD1 1 
ATOM   384  O OD2 . ASP A 1 62  ? 34.972 44.643 29.545  1.00 71.95 ? 92  ASP A OD2 1 
ATOM   385  N N   . LEU A 1 63  ? 30.028 43.883 26.981  1.00 51.37 ? 93  LEU A N   1 
ATOM   386  C CA  . LEU A 1 63  ? 29.191 43.946 25.786  1.00 50.60 ? 93  LEU A CA  1 
ATOM   387  C C   . LEU A 1 63  ? 27.772 43.517 26.147  1.00 52.54 ? 93  LEU A C   1 
ATOM   388  O O   . LEU A 1 63  ? 27.570 42.440 26.709  1.00 53.43 ? 93  LEU A O   1 
ATOM   389  C CB  . LEU A 1 63  ? 29.762 43.003 24.720  1.00 50.55 ? 93  LEU A CB  1 
ATOM   390  C CG  A LEU A 1 63  ? 29.941 43.441 23.265  0.50 49.55 ? 93  LEU A CG  1 
ATOM   391  C CG  B LEU A 1 63  ? 30.946 43.431 23.855  0.50 45.18 ? 93  LEU A CG  1 
ATOM   392  C CD1 A LEU A 1 63  ? 30.821 44.687 23.130  0.50 44.91 ? 93  LEU A CD1 1 
ATOM   393  C CD1 B LEU A 1 63  ? 31.220 42.336 22.840  0.50 41.99 ? 93  LEU A CD1 1 
ATOM   394  C CD2 A LEU A 1 63  ? 30.517 42.287 22.462  0.50 49.10 ? 93  LEU A CD2 1 
ATOM   395  C CD2 B LEU A 1 63  ? 30.695 44.762 23.140  0.50 39.52 ? 93  LEU A CD2 1 
ATOM   396  N N   . ASP A 1 64  ? 26.790 44.363 25.853  1.00 52.38 ? 94  ASP A N   1 
ATOM   397  C CA  . ASP A 1 64  ? 25.401 43.998 26.095  1.00 54.00 ? 94  ASP A CA  1 
ATOM   398  C C   . ASP A 1 64  ? 24.687 43.848 24.758  1.00 53.35 ? 94  ASP A C   1 
ATOM   399  O O   . ASP A 1 64  ? 23.830 44.653 24.393  1.00 53.37 ? 94  ASP A O   1 
ATOM   400  C CB  . ASP A 1 64  ? 24.707 45.020 27.006  1.00 55.04 ? 94  ASP A CB  1 
ATOM   401  C CG  . ASP A 1 64  ? 23.310 44.578 27.434  1.00 62.10 ? 94  ASP A CG  1 
ATOM   402  O OD1 . ASP A 1 64  ? 23.085 43.356 27.604  1.00 68.05 ? 94  ASP A OD1 1 
ATOM   403  O OD2 . ASP A 1 64  ? 22.436 45.459 27.606  1.00 66.73 ? 94  ASP A OD2 1 
ATOM   404  N N   . ILE A 1 65  ? 25.066 42.810 24.023  1.00 52.50 ? 95  ILE A N   1 
ATOM   405  C CA  . ILE A 1 65  ? 24.545 42.595 22.682  1.00 52.23 ? 95  ILE A CA  1 
ATOM   406  C C   . ILE A 1 65  ? 24.012 41.171 22.593  1.00 54.07 ? 95  ILE A C   1 
ATOM   407  O O   . ILE A 1 65  ? 24.767 40.233 22.326  1.00 54.70 ? 95  ILE A O   1 
ATOM   408  C CB  . ILE A 1 65  ? 25.620 42.862 21.614  1.00 50.33 ? 95  ILE A CB  1 
ATOM   409  C CG1 . ILE A 1 65  ? 26.270 44.227 21.859  1.00 49.45 ? 95  ILE A CG1 1 
ATOM   410  C CG2 . ILE A 1 65  ? 25.020 42.753 20.199  1.00 48.97 ? 95  ILE A CG2 1 
ATOM   411  C CD1 . ILE A 1 65  ? 27.437 44.529 20.970  1.00 49.40 ? 95  ILE A CD1 1 
ATOM   412  N N   . PRO A 1 66  ? 22.705 41.002 22.833  1.00 54.71 ? 96  PRO A N   1 
ATOM   413  C CA  . PRO A 1 66  ? 22.153 39.659 22.929  1.00 54.73 ? 96  PRO A CA  1 
ATOM   414  C C   . PRO A 1 66  ? 22.415 38.843 21.664  1.00 53.34 ? 96  PRO A C   1 
ATOM   415  O O   . PRO A 1 66  ? 22.242 39.336 20.548  1.00 53.95 ? 96  PRO A O   1 
ATOM   416  C CB  . PRO A 1 66  ? 20.649 39.911 23.121  1.00 56.16 ? 96  PRO A CB  1 
ATOM   417  C CG  . PRO A 1 66  ? 20.576 41.292 23.713  1.00 56.97 ? 96  PRO A CG  1 
ATOM   418  C CD  . PRO A 1 66  ? 21.671 42.037 23.010  1.00 55.84 ? 96  PRO A CD  1 
ATOM   419  N N   . GLY A 1 67  ? 22.876 37.613 21.856  1.00 51.88 ? 97  GLY A N   1 
ATOM   420  C CA  . GLY A 1 67  ? 23.058 36.682 20.755  1.00 49.96 ? 97  GLY A CA  1 
ATOM   421  C C   . GLY A 1 67  ? 24.270 36.964 19.891  1.00 48.80 ? 97  GLY A C   1 
ATOM   422  O O   . GLY A 1 67  ? 24.387 36.401 18.799  1.00 50.56 ? 97  GLY A O   1 
ATOM   423  N N   . HIS A 1 68  ? 25.173 37.826 20.366  1.00 43.75 ? 98  HIS A N   1 
ATOM   424  C CA  . HIS A 1 68  ? 26.372 38.151 19.597  1.00 40.05 ? 98  HIS A CA  1 
ATOM   425  C C   . HIS A 1 68  ? 27.250 36.908 19.447  1.00 38.03 ? 98  HIS A C   1 
ATOM   426  O O   . HIS A 1 68  ? 27.956 36.768 18.444  1.00 37.39 ? 98  HIS A O   1 
ATOM   427  C CB  . HIS A 1 68  ? 27.151 39.339 20.203  1.00 38.83 ? 98  HIS A CB  1 
ATOM   428  C CG  . HIS A 1 68  ? 27.885 39.015 21.473  1.00 38.84 ? 98  HIS A CG  1 
ATOM   429  N ND1 . HIS A 1 68  ? 29.135 38.433 21.486  1.00 37.96 ? 98  HIS A ND1 1 
ATOM   430  C CD2 . HIS A 1 68  ? 27.547 39.199 22.772  1.00 41.35 ? 98  HIS A CD2 1 
ATOM   431  C CE1 . HIS A 1 68  ? 29.534 38.269 22.736  1.00 41.57 ? 98  HIS A CE1 1 
ATOM   432  N NE2 . HIS A 1 68  ? 28.588 38.724 23.537  1.00 44.57 ? 98  HIS A NE2 1 
ATOM   433  N N   . ALA A 1 69  ? 27.188 36.003 20.433  1.00 36.73 ? 99  ALA A N   1 
ATOM   434  C CA  . ALA A 1 69  ? 28.069 34.820 20.473  1.00 37.04 ? 99  ALA A CA  1 
ATOM   435  C C   . ALA A 1 69  ? 27.964 33.930 19.227  1.00 36.04 ? 99  ALA A C   1 
ATOM   436  O O   . ALA A 1 69  ? 28.961 33.347 18.791  1.00 36.20 ? 99  ALA A O   1 
ATOM   437  C CB  . ALA A 1 69  ? 27.841 34.005 21.751  1.00 37.54 ? 99  ALA A CB  1 
ATOM   438  N N   . SER A 1 70  ? 26.770 33.851 18.642  1.00 35.53 ? 100 SER A N   1 
ATOM   439  C CA  . SER A 1 70  ? 26.576 33.104 17.393  1.00 35.62 ? 100 SER A CA  1 
ATOM   440  C C   . SER A 1 70  ? 27.279 33.753 16.185  1.00 35.10 ? 100 SER A C   1 
ATOM   441  O O   . SER A 1 70  ? 27.396 33.141 15.118  1.00 35.43 ? 100 SER A O   1 
ATOM   442  C CB  . SER A 1 70  ? 25.088 32.927 17.102  1.00 36.40 ? 100 SER A CB  1 
ATOM   443  O OG  . SER A 1 70  ? 24.486 34.173 16.815  1.00 39.70 ? 100 SER A OG  1 
ATOM   444  N N   . LYS A 1 71  ? 27.746 34.985 16.361  1.00 32.77 ? 101 LYS A N   1 
ATOM   445  C CA  . LYS A 1 71  ? 28.405 35.737 15.286  1.00 30.78 ? 101 LYS A CA  1 
ATOM   446  C C   . LYS A 1 71  ? 29.899 35.922 15.540  1.00 29.57 ? 101 LYS A C   1 
ATOM   447  O O   . LYS A 1 71  ? 30.571 36.652 14.807  1.00 27.94 ? 101 LYS A O   1 
ATOM   448  C CB  . LYS A 1 71  ? 27.703 37.087 15.100  1.00 28.86 ? 101 LYS A CB  1 
ATOM   449  C CG  . LYS A 1 71  ? 26.254 36.936 14.664  1.00 31.49 ? 101 LYS A CG  1 
ATOM   450  C CD  . LYS A 1 71  ? 25.495 38.233 14.788  1.00 44.43 ? 101 LYS A CD  1 
ATOM   451  C CE  . LYS A 1 71  ? 24.031 38.056 14.357  1.00 51.38 ? 101 LYS A CE  1 
ATOM   452  N NZ  . LYS A 1 71  ? 23.923 38.010 12.860  1.00 58.41 ? 101 LYS A NZ  1 
ATOM   453  N N   . ASP A 1 72  ? 30.406 35.269 16.592  1.00 29.19 ? 102 ASP A N   1 
ATOM   454  C CA  . ASP A 1 72  ? 31.843 35.276 16.931  1.00 29.48 ? 102 ASP A CA  1 
ATOM   455  C C   . ASP A 1 72  ? 32.448 33.927 16.614  1.00 30.89 ? 102 ASP A C   1 
ATOM   456  O O   . ASP A 1 72  ? 31.889 32.884 16.996  1.00 29.43 ? 102 ASP A O   1 
ATOM   457  C CB  . ASP A 1 72  ? 32.052 35.563 18.426  1.00 29.04 ? 102 ASP A CB  1 
ATOM   458  C CG  . ASP A 1 72  ? 31.514 36.917 18.828  1.00 32.96 ? 102 ASP A CG  1 
ATOM   459  O OD1 . ASP A 1 72  ? 31.611 37.849 17.994  1.00 30.90 ? 102 ASP A OD1 1 
ATOM   460  O OD2 . ASP A 1 72  ? 30.977 37.049 19.955  1.00 30.55 ? 102 ASP A OD2 1 
ATOM   461  N N   . ARG A 1 73  ? 33.595 33.926 15.939  1.00 30.94 ? 103 ARG A N   1 
ATOM   462  C CA  . ARG A 1 73  ? 34.295 32.663 15.730  1.00 32.50 ? 103 ARG A CA  1 
ATOM   463  C C   . ARG A 1 73  ? 34.875 32.127 17.046  1.00 32.70 ? 103 ARG A C   1 
ATOM   464  O O   . ARG A 1 73  ? 34.864 30.915 17.292  1.00 32.12 ? 103 ARG A O   1 
ATOM   465  C CB  . ARG A 1 73  ? 35.351 32.777 14.626  1.00 30.76 ? 103 ARG A CB  1 
ATOM   466  C CG  . ARG A 1 73  ? 36.077 31.452 14.361  1.00 35.55 ? 103 ARG A CG  1 
ATOM   467  C CD  . ARG A 1 73  ? 36.952 31.493 13.118  1.00 33.48 ? 103 ARG A CD  1 
ATOM   468  N NE  . ARG A 1 73  ? 36.152 31.397 11.897  1.00 32.78 ? 103 ARG A NE  1 
ATOM   469  C CZ  . ARG A 1 73  ? 35.905 32.411 11.069  1.00 39.09 ? 103 ARG A CZ  1 
ATOM   470  N NH1 . ARG A 1 73  ? 36.416 33.619 11.298  1.00 32.15 ? 103 ARG A NH1 1 
ATOM   471  N NH2 . ARG A 1 73  ? 35.145 32.204 9.994   1.00 33.36 ? 103 ARG A NH2 1 
ATOM   472  N N   . TYR A 1 74  ? 35.349 33.032 17.896  1.00 33.11 ? 104 TYR A N   1 
ATOM   473  C CA  . TYR A 1 74  ? 35.989 32.671 19.158  1.00 33.94 ? 104 TYR A CA  1 
ATOM   474  C C   . TYR A 1 74  ? 35.322 33.389 20.329  1.00 37.30 ? 104 TYR A C   1 
ATOM   475  O O   . TYR A 1 74  ? 35.075 34.598 20.283  1.00 37.08 ? 104 TYR A O   1 
ATOM   476  C CB  . TYR A 1 74  ? 37.491 33.013 19.111  1.00 33.50 ? 104 TYR A CB  1 
ATOM   477  C CG  . TYR A 1 74  ? 38.210 32.338 17.956  1.00 34.87 ? 104 TYR A CG  1 
ATOM   478  C CD1 . TYR A 1 74  ? 38.588 30.981 18.031  1.00 39.48 ? 104 TYR A CD1 1 
ATOM   479  C CD2 . TYR A 1 74  ? 38.484 33.037 16.784  1.00 33.82 ? 104 TYR A CD2 1 
ATOM   480  C CE1 . TYR A 1 74  ? 39.228 30.353 16.963  1.00 40.69 ? 104 TYR A CE1 1 
ATOM   481  C CE2 . TYR A 1 74  ? 39.118 32.420 15.719  1.00 35.51 ? 104 TYR A CE2 1 
ATOM   482  C CZ  . TYR A 1 74  ? 39.491 31.082 15.815  1.00 39.95 ? 104 TYR A CZ  1 
ATOM   483  O OH  . TYR A 1 74  ? 40.130 30.507 14.737  1.00 41.36 ? 104 TYR A OH  1 
ATOM   484  N N   . LYS A 1 75  ? 35.057 32.641 21.392  1.00 38.42 ? 105 LYS A N   1 
ATOM   485  C CA  . LYS A 1 75  ? 34.336 33.169 22.553  1.00 39.46 ? 105 LYS A CA  1 
ATOM   486  C C   . LYS A 1 75  ? 35.024 34.343 23.262  1.00 36.18 ? 105 LYS A C   1 
ATOM   487  O O   . LYS A 1 75  ? 34.352 35.241 23.754  1.00 37.58 ? 105 LYS A O   1 
ATOM   488  C CB  . LYS A 1 75  ? 34.049 32.043 23.567  1.00 41.98 ? 105 LYS A CB  1 
ATOM   489  N N   . THR A 1 76  ? 36.349 34.352 23.306  1.00 34.45 ? 106 THR A N   1 
ATOM   490  C CA  . THR A 1 76  ? 37.062 35.384 24.061  1.00 34.37 ? 106 THR A CA  1 
ATOM   491  C C   . THR A 1 76  ? 37.638 36.523 23.210  1.00 33.80 ? 106 THR A C   1 
ATOM   492  O O   . THR A 1 76  ? 38.317 37.415 23.732  1.00 33.97 ? 106 THR A O   1 
ATOM   493  C CB  . THR A 1 76  ? 38.213 34.769 24.901  1.00 36.02 ? 106 THR A CB  1 
ATOM   494  O OG1 . THR A 1 76  ? 39.188 34.241 24.011  1.00 40.13 ? 106 THR A OG1 1 
ATOM   495  C CG2 . THR A 1 76  ? 37.698 33.655 25.786  1.00 39.73 ? 106 THR A CG2 1 
ATOM   496  N N   . ILE A 1 77  ? 37.390 36.500 21.902  1.00 30.92 ? 107 ILE A N   1 
ATOM   497  C CA  . ILE A 1 77  ? 37.888 37.571 21.024  1.00 29.25 ? 107 ILE A CA  1 
ATOM   498  C C   . ILE A 1 77  ? 36.683 38.391 20.553  1.00 31.03 ? 107 ILE A C   1 
ATOM   499  O O   . ILE A 1 77  ? 35.874 37.939 19.726  1.00 30.69 ? 107 ILE A O   1 
ATOM   500  C CB  . ILE A 1 77  ? 38.763 37.028 19.863  1.00 30.97 ? 107 ILE A CB  1 
ATOM   501  C CG1 . ILE A 1 77  ? 39.998 36.316 20.458  1.00 31.41 ? 107 ILE A CG1 1 
ATOM   502  C CG2 . ILE A 1 77  ? 39.206 38.178 18.912  1.00 28.25 ? 107 ILE A CG2 1 
ATOM   503  C CD1 . ILE A 1 77  ? 40.766 35.445 19.491  1.00 34.63 ? 107 ILE A CD1 1 
ATOM   504  N N   . LEU A 1 78  ? 36.544 39.566 21.159  1.00 28.43 ? 108 LEU A N   1 
ATOM   505  C CA  . LEU A 1 78  ? 35.330 40.375 21.031  1.00 28.35 ? 108 LEU A CA  1 
ATOM   506  C C   . LEU A 1 78  ? 35.705 41.791 20.637  1.00 26.97 ? 108 LEU A C   1 
ATOM   507  O O   . LEU A 1 78  ? 36.804 42.248 20.955  1.00 28.70 ? 108 LEU A O   1 
ATOM   508  C CB  . LEU A 1 78  ? 34.568 40.392 22.366  1.00 27.98 ? 108 LEU A CB  1 
ATOM   509  C CG  . LEU A 1 78  ? 34.081 39.057 22.934  1.00 31.54 ? 108 LEU A CG  1 
ATOM   510  C CD1 . LEU A 1 78  ? 33.463 39.252 24.317  1.00 31.52 ? 108 LEU A CD1 1 
ATOM   511  C CD2 . LEU A 1 78  ? 33.083 38.398 21.974  1.00 30.62 ? 108 LEU A CD2 1 
ATOM   512  N N   . PRO A 1 79  ? 34.810 42.490 19.930  1.00 26.60 ? 109 PRO A N   1 
ATOM   513  C CA  . PRO A 1 79  ? 35.173 43.840 19.523  1.00 27.59 ? 109 PRO A CA  1 
ATOM   514  C C   . PRO A 1 79  ? 35.020 44.847 20.659  1.00 27.46 ? 109 PRO A C   1 
ATOM   515  O O   . PRO A 1 79  ? 33.941 44.941 21.269  1.00 28.39 ? 109 PRO A O   1 
ATOM   516  C CB  . PRO A 1 79  ? 34.155 44.155 18.420  1.00 26.02 ? 109 PRO A CB  1 
ATOM   517  C CG  . PRO A 1 79  ? 32.906 43.410 18.878  1.00 23.94 ? 109 PRO A CG  1 
ATOM   518  C CD  . PRO A 1 79  ? 33.474 42.098 19.434  1.00 27.89 ? 109 PRO A CD  1 
ATOM   519  N N   . ASN A 1 80  ? 36.074 45.613 20.930  1.00 27.26 ? 110 ASN A N   1 
ATOM   520  C CA  . ASN A 1 80  ? 35.975 46.636 21.981  1.00 28.24 ? 110 ASN A CA  1 
ATOM   521  C C   . ASN A 1 80  ? 34.834 47.581 21.636  1.00 26.97 ? 110 ASN A C   1 
ATOM   522  O O   . ASN A 1 80  ? 34.777 48.076 20.508  1.00 26.13 ? 110 ASN A O   1 
ATOM   523  C CB  . ASN A 1 80  ? 37.290 47.402 22.125  1.00 26.83 ? 110 ASN A CB  1 
ATOM   524  C CG  . ASN A 1 80  ? 38.447 46.476 22.457  1.00 32.03 ? 110 ASN A CG  1 
ATOM   525  O OD1 . ASN A 1 80  ? 38.731 45.550 21.703  1.00 29.38 ? 110 ASN A OD1 1 
ATOM   526  N ND2 . ASN A 1 80  ? 39.067 46.677 23.617  1.00 30.66 ? 110 ASN A ND2 1 
ATOM   527  N N   . PRO A 1 81  ? 33.927 47.838 22.599  1.00 26.27 ? 111 PRO A N   1 
ATOM   528  C CA  . PRO A 1 81  ? 32.740 48.635 22.288  1.00 28.75 ? 111 PRO A CA  1 
ATOM   529  C C   . PRO A 1 81  ? 33.046 50.035 21.776  1.00 29.84 ? 111 PRO A C   1 
ATOM   530  O O   . PRO A 1 81  ? 32.283 50.567 20.975  1.00 30.98 ? 111 PRO A O   1 
ATOM   531  C CB  . PRO A 1 81  ? 31.970 48.707 23.631  1.00 29.37 ? 111 PRO A CB  1 
ATOM   532  C CG  . PRO A 1 81  ? 32.922 48.248 24.665  1.00 29.59 ? 111 PRO A CG  1 
ATOM   533  C CD  . PRO A 1 81  ? 33.927 47.359 24.003  1.00 28.51 ? 111 PRO A CD  1 
ATOM   534  N N   . GLN A 1 82  ? 34.140 50.624 22.241  1.00 28.75 ? 112 GLN A N   1 
ATOM   535  C CA  . GLN A 1 82  ? 34.474 52.005 21.898  1.00 30.93 ? 112 GLN A CA  1 
ATOM   536  C C   . GLN A 1 82  ? 34.766 52.228 20.387  1.00 30.30 ? 112 GLN A C   1 
ATOM   537  O O   . GLN A 1 82  ? 34.613 53.337 19.868  1.00 30.69 ? 112 GLN A O   1 
ATOM   538  C CB  . GLN A 1 82  ? 35.663 52.460 22.744  1.00 33.59 ? 112 GLN A CB  1 
ATOM   539  C CG  . GLN A 1 82  ? 35.388 52.447 24.300  1.00 35.74 ? 112 GLN A CG  1 
ATOM   540  C CD  . GLN A 1 82  ? 35.555 51.063 24.970  1.00 42.30 ? 112 GLN A CD  1 
ATOM   541  O OE1 . GLN A 1 82  ? 35.954 50.083 24.340  1.00 35.15 ? 112 GLN A OE1 1 
ATOM   542  N NE2 . GLN A 1 82  ? 35.232 50.995 26.261  1.00 43.62 ? 112 GLN A NE2 1 
ATOM   543  N N   . SER A 1 83  ? 35.191 51.176 19.699  1.00 27.17 ? 113 SER A N   1 
ATOM   544  C CA  . SER A 1 83  ? 35.598 51.283 18.296  1.00 26.73 ? 113 SER A CA  1 
ATOM   545  C C   . SER A 1 83  ? 34.917 50.236 17.426  1.00 26.04 ? 113 SER A C   1 
ATOM   546  O O   . SER A 1 83  ? 35.302 50.024 16.284  1.00 25.70 ? 113 SER A O   1 
ATOM   547  C CB  . SER A 1 83  ? 37.118 51.102 18.208  1.00 27.39 ? 113 SER A CB  1 
ATOM   548  O OG  . SER A 1 83  ? 37.512 49.854 18.774  1.00 26.57 ? 113 SER A OG  1 
ATOM   549  N N   . ARG A 1 84  ? 33.895 49.599 17.970  1.00 26.63 ? 114 ARG A N   1 
ATOM   550  C CA  . ARG A 1 84  ? 33.183 48.530 17.286  1.00 27.56 ? 114 ARG A CA  1 
ATOM   551  C C   . ARG A 1 84  ? 32.442 49.092 16.051  1.00 27.46 ? 114 ARG A C   1 
ATOM   552  O O   . ARG A 1 84  ? 31.857 50.173 16.113  1.00 25.33 ? 114 ARG A O   1 
ATOM   553  C CB  . ARG A 1 84  ? 32.208 47.915 18.297  1.00 30.71 ? 114 ARG A CB  1 
ATOM   554  C CG  . ARG A 1 84  ? 31.146 47.019 17.760  1.00 34.48 ? 114 ARG A CG  1 
ATOM   555  C CD  . ARG A 1 84  ? 30.351 46.365 18.917  1.00 27.42 ? 114 ARG A CD  1 
ATOM   556  N NE  . ARG A 1 84  ? 29.247 47.186 19.428  1.00 31.21 ? 114 ARG A NE  1 
ATOM   557  C CZ  . ARG A 1 84  ? 28.020 47.183 18.906  1.00 34.17 ? 114 ARG A CZ  1 
ATOM   558  N NH1 . ARG A 1 84  ? 27.737 46.430 17.838  1.00 30.02 ? 114 ARG A NH1 1 
ATOM   559  N NH2 . ARG A 1 84  ? 27.074 47.939 19.440  1.00 37.72 ? 114 ARG A NH2 1 
ATOM   560  N N   . VAL A 1 85  ? 32.479 48.361 14.939  1.00 27.53 ? 115 VAL A N   1 
ATOM   561  C CA  . VAL A 1 85  ? 31.698 48.742 13.758  1.00 26.08 ? 115 VAL A CA  1 
ATOM   562  C C   . VAL A 1 85  ? 30.239 48.323 13.985  1.00 27.25 ? 115 VAL A C   1 
ATOM   563  O O   . VAL A 1 85  ? 29.948 47.138 14.173  1.00 29.93 ? 115 VAL A O   1 
ATOM   564  C CB  . VAL A 1 85  ? 32.279 48.110 12.467  1.00 27.04 ? 115 VAL A CB  1 
ATOM   565  C CG1 . VAL A 1 85  ? 31.462 48.586 11.257  1.00 29.51 ? 115 VAL A CG1 1 
ATOM   566  C CG2 . VAL A 1 85  ? 33.753 48.495 12.288  1.00 26.47 ? 115 VAL A CG2 1 
ATOM   567  N N   . CYS A 1 86  ? 29.340 49.301 14.025  1.00 26.19 ? 116 CYS A N   1 
ATOM   568  C CA  . CYS A 1 86  ? 27.913 49.038 14.227  1.00 28.68 ? 116 CYS A CA  1 
ATOM   569  C C   . CYS A 1 86  ? 27.177 49.035 12.902  1.00 27.89 ? 116 CYS A C   1 
ATOM   570  O O   . CYS A 1 86  ? 27.305 49.980 12.123  1.00 29.69 ? 116 CYS A O   1 
ATOM   571  C CB  . CYS A 1 86  ? 27.310 50.097 15.124  1.00 28.33 ? 116 CYS A CB  1 
ATOM   572  S SG  . CYS A 1 86  ? 28.054 50.067 16.792  1.00 36.92 ? 116 CYS A SG  1 
ATOM   573  N N   . LEU A 1 87  ? 26.402 47.987 12.656  1.00 28.75 ? 117 LEU A N   1 
ATOM   574  C CA  . LEU A 1 87  ? 25.662 47.881 11.396  1.00 30.01 ? 117 LEU A CA  1 
ATOM   575  C C   . LEU A 1 87  ? 24.337 48.610 11.534  1.00 30.34 ? 117 LEU A C   1 
ATOM   576  O O   . LEU A 1 87  ? 23.520 48.253 12.374  1.00 31.05 ? 117 LEU A O   1 
ATOM   577  C CB  . LEU A 1 87  ? 25.431 46.418 11.015  1.00 28.64 ? 117 LEU A CB  1 
ATOM   578  C CG  . LEU A 1 87  ? 26.718 45.601 10.852  1.00 31.69 ? 117 LEU A CG  1 
ATOM   579  C CD1 . LEU A 1 87  ? 26.378 44.163 10.483  1.00 35.04 ? 117 LEU A CD1 1 
ATOM   580  C CD2 . LEU A 1 87  ? 27.651 46.253 9.813   1.00 31.70 ? 117 LEU A CD2 1 
ATOM   581  N N   . GLY A 1 88  ? 24.152 49.642 10.719  1.00 29.96 ? 118 GLY A N   1 
ATOM   582  C CA  . GLY A 1 88  ? 22.963 50.491 10.779  1.00 33.04 ? 118 GLY A CA  1 
ATOM   583  C C   . GLY A 1 88  ? 21.764 49.899 10.055  1.00 35.79 ? 118 GLY A C   1 
ATOM   584  O O   . GLY A 1 88  ? 20.628 50.378 10.223  1.00 35.86 ? 118 GLY A O   1 
ATOM   585  N N   . ARG A 1 89  ? 22.009 48.858 9.256   1.00 35.28 ? 119 ARG A N   1 
ATOM   586  C CA  . ARG A 1 89  ? 20.953 48.134 8.548   1.00 36.16 ? 119 ARG A CA  1 
ATOM   587  C C   . ARG A 1 89  ? 20.177 49.036 7.571   1.00 37.24 ? 119 ARG A C   1 
ATOM   588  O O   . ARG A 1 89  ? 18.992 48.804 7.331   1.00 35.38 ? 119 ARG A O   1 
ATOM   589  C CB  . ARG A 1 89  ? 19.961 47.495 9.543   1.00 36.64 ? 119 ARG A CB  1 
ATOM   590  C CG  . ARG A 1 89  ? 20.601 46.705 10.674  1.00 38.66 ? 119 ARG A CG  1 
ATOM   591  C CD  . ARG A 1 89  ? 21.402 45.545 10.133  1.00 40.64 ? 119 ARG A CD  1 
ATOM   592  N NE  . ARG A 1 89  ? 21.771 44.624 11.203  1.00 42.44 ? 119 ARG A NE  1 
ATOM   593  C CZ  . ARG A 1 89  ? 22.518 43.534 11.049  1.00 40.61 ? 119 ARG A CZ  1 
ATOM   594  N NH1 . ARG A 1 89  ? 22.995 43.197 9.857   1.00 38.44 ? 119 ARG A NH1 1 
ATOM   595  N NH2 . ARG A 1 89  ? 22.773 42.772 12.100  1.00 39.74 ? 119 ARG A NH2 1 
ATOM   596  N N   . ALA A 1 90  ? 20.828 50.054 7.013   1.00 38.46 ? 120 ALA A N   1 
ATOM   597  C CA  . ALA A 1 90  ? 20.149 50.908 6.025   1.00 41.89 ? 120 ALA A CA  1 
ATOM   598  C C   . ALA A 1 90  ? 19.650 50.102 4.817   1.00 43.53 ? 120 ALA A C   1 
ATOM   599  O O   . ALA A 1 90  ? 18.652 50.454 4.207   1.00 43.59 ? 120 ALA A O   1 
ATOM   600  C CB  . ALA A 1 90  ? 21.048 52.047 5.579   1.00 42.21 ? 120 ALA A CB  1 
ATOM   601  N N   . GLN A 1 91  ? 20.334 49.007 4.498   1.00 46.16 ? 121 GLN A N   1 
ATOM   602  C CA  . GLN A 1 91  ? 19.994 48.194 3.326   1.00 49.20 ? 121 GLN A CA  1 
ATOM   603  C C   . GLN A 1 91  ? 19.223 46.904 3.622   1.00 50.50 ? 121 GLN A C   1 
ATOM   604  O O   . GLN A 1 91  ? 18.930 46.138 2.699   1.00 51.04 ? 121 GLN A O   1 
ATOM   605  C CB  . GLN A 1 91  ? 21.261 47.861 2.536   1.00 49.04 ? 121 GLN A CB  1 
ATOM   606  C CG  . GLN A 1 91  ? 21.727 48.977 1.630   1.00 50.67 ? 121 GLN A CG  1 
ATOM   607  C CD  . GLN A 1 91  ? 22.228 50.173 2.392   1.00 46.67 ? 121 GLN A CD  1 
ATOM   608  O OE1 . GLN A 1 91  ? 23.143 50.058 3.194   1.00 45.33 ? 121 GLN A OE1 1 
ATOM   609  N NE2 . GLN A 1 91  ? 21.631 51.332 2.144   1.00 41.98 ? 121 GLN A NE2 1 
ATOM   610  N N   . SER A 1 92  ? 18.894 46.658 4.888   1.00 51.03 ? 122 SER A N   1 
ATOM   611  C CA  . SER A 1 92  ? 18.315 45.370 5.268   1.00 51.69 ? 122 SER A CA  1 
ATOM   612  C C   . SER A 1 92  ? 17.330 45.476 6.431   1.00 53.53 ? 122 SER A C   1 
ATOM   613  O O   . SER A 1 92  ? 17.172 46.541 7.045   1.00 53.68 ? 122 SER A O   1 
ATOM   614  C CB  . SER A 1 92  ? 19.429 44.356 5.596   1.00 51.83 ? 122 SER A CB  1 
ATOM   615  O OG  . SER A 1 92  ? 19.819 44.427 6.958   1.00 46.53 ? 122 SER A OG  1 
ATOM   616  N N   . GLN A 1 93  ? 16.672 44.359 6.731   1.00 54.36 ? 123 GLN A N   1 
ATOM   617  C CA  . GLN A 1 93  ? 15.744 44.297 7.852   1.00 55.52 ? 123 GLN A CA  1 
ATOM   618  C C   . GLN A 1 93  ? 16.288 43.436 9.006   1.00 55.91 ? 123 GLN A C   1 
ATOM   619  O O   . GLN A 1 93  ? 15.547 43.098 9.932   1.00 56.21 ? 123 GLN A O   1 
ATOM   620  C CB  . GLN A 1 93  ? 14.369 43.801 7.380   1.00 55.73 ? 123 GLN A CB  1 
ATOM   621  N N   . GLU A 1 94  ? 17.583 43.105 8.956   1.00 55.85 ? 124 GLU A N   1 
ATOM   622  C CA  . GLU A 1 94  ? 18.216 42.248 9.979   1.00 55.71 ? 124 GLU A CA  1 
ATOM   623  C C   . GLU A 1 94  ? 18.135 42.834 11.396  1.00 55.97 ? 124 GLU A C   1 
ATOM   624  O O   . GLU A 1 94  ? 18.169 44.056 11.574  1.00 54.97 ? 124 GLU A O   1 
ATOM   625  C CB  . GLU A 1 94  ? 19.655 41.883 9.588   1.00 55.27 ? 124 GLU A CB  1 
ATOM   626  C CG  . GLU A 1 94  ? 19.740 40.795 8.518   1.00 54.22 ? 124 GLU A CG  1 
ATOM   627  N N   . ASP A 1 95  ? 18.042 41.951 12.392  1.00 57.18 ? 125 ASP A N   1 
ATOM   628  C CA  . ASP A 1 95  ? 17.485 42.307 13.707  1.00 59.07 ? 125 ASP A CA  1 
ATOM   629  C C   . ASP A 1 95  ? 18.482 42.660 14.826  1.00 59.18 ? 125 ASP A C   1 
ATOM   630  O O   . ASP A 1 95  ? 18.291 42.250 15.980  1.00 62.08 ? 125 ASP A O   1 
ATOM   631  C CB  . ASP A 1 95  ? 16.515 41.203 14.181  1.00 60.14 ? 125 ASP A CB  1 
ATOM   632  N N   . GLY A 1 96  ? 19.516 43.430 14.492  1.00 55.43 ? 126 GLY A N   1 
ATOM   633  C CA  . GLY A 1 96  ? 20.499 43.920 15.469  1.00 52.05 ? 126 GLY A CA  1 
ATOM   634  C C   . GLY A 1 96  ? 21.567 44.731 14.746  1.00 48.23 ? 126 GLY A C   1 
ATOM   635  O O   . GLY A 1 96  ? 21.385 45.085 13.581  1.00 50.44 ? 126 GLY A O   1 
ATOM   636  N N   . ASP A 1 97  ? 22.679 45.031 15.413  1.00 41.18 ? 127 ASP A N   1 
ATOM   637  C CA  . ASP A 1 97  ? 23.720 45.841 14.768  1.00 36.00 ? 127 ASP A CA  1 
ATOM   638  C C   . ASP A 1 97  ? 25.107 45.190 14.796  1.00 32.38 ? 127 ASP A C   1 
ATOM   639  O O   . ASP A 1 97  ? 26.097 45.862 14.585  1.00 30.53 ? 127 ASP A O   1 
ATOM   640  C CB  . ASP A 1 97  ? 23.804 47.234 15.411  1.00 33.76 ? 127 ASP A CB  1 
ATOM   641  C CG  . ASP A 1 97  ? 24.427 47.221 16.826  1.00 40.79 ? 127 ASP A CG  1 
ATOM   642  O OD1 . ASP A 1 97  ? 24.843 46.147 17.349  1.00 37.18 ? 127 ASP A OD1 1 
ATOM   643  O OD2 . ASP A 1 97  ? 24.508 48.321 17.420  1.00 42.55 ? 127 ASP A OD2 1 
ATOM   644  N N   . TYR A 1 98  ? 25.174 43.894 15.074  1.00 31.34 ? 128 TYR A N   1 
ATOM   645  C CA  . TYR A 1 98  ? 26.462 43.313 15.487  1.00 28.85 ? 128 TYR A CA  1 
ATOM   646  C C   . TYR A 1 98  ? 27.305 42.666 14.393  1.00 29.45 ? 128 TYR A C   1 
ATOM   647  O O   . TYR A 1 98  ? 26.825 41.808 13.636  1.00 30.21 ? 128 TYR A O   1 
ATOM   648  C CB  . TYR A 1 98  ? 26.254 42.311 16.626  1.00 28.26 ? 128 TYR A CB  1 
ATOM   649  C CG  . TYR A 1 98  ? 27.572 41.762 17.156  1.00 27.57 ? 128 TYR A CG  1 
ATOM   650  C CD1 . TYR A 1 98  ? 28.340 42.495 18.055  1.00 27.89 ? 128 TYR A CD1 1 
ATOM   651  C CD2 . TYR A 1 98  ? 28.040 40.513 16.753  1.00 28.03 ? 128 TYR A CD2 1 
ATOM   652  C CE1 . TYR A 1 98  ? 29.557 41.980 18.557  1.00 27.65 ? 128 TYR A CE1 1 
ATOM   653  C CE2 . TYR A 1 98  ? 29.259 40.000 17.230  1.00 31.73 ? 128 TYR A CE2 1 
ATOM   654  C CZ  . TYR A 1 98  ? 30.001 40.740 18.134  1.00 29.69 ? 128 TYR A CZ  1 
ATOM   655  O OH  . TYR A 1 98  ? 31.191 40.242 18.621  1.00 30.73 ? 128 TYR A OH  1 
ATOM   656  N N   . ILE A 1 99  ? 28.582 43.065 14.362  1.00 29.67 ? 129 ILE A N   1 
ATOM   657  C CA  . ILE A 1 99  ? 29.632 42.335 13.662  1.00 28.96 ? 129 ILE A CA  1 
ATOM   658  C C   . ILE A 1 99  ? 30.930 42.407 14.494  1.00 28.42 ? 129 ILE A C   1 
ATOM   659  O O   . ILE A 1 99  ? 31.194 43.407 15.159  1.00 27.29 ? 129 ILE A O   1 
ATOM   660  C CB  . ILE A 1 99  ? 29.830 42.857 12.196  1.00 28.55 ? 129 ILE A CB  1 
ATOM   661  C CG1 . ILE A 1 99  ? 30.813 41.968 11.410  1.00 29.84 ? 129 ILE A CG1 1 
ATOM   662  C CG2 . ILE A 1 99  ? 30.219 44.356 12.160  1.00 27.73 ? 129 ILE A CG2 1 
ATOM   663  C CD1 . ILE A 1 99  ? 30.855 42.294 9.889   1.00 29.32 ? 129 ILE A CD1 1 
ATOM   664  N N   . ASN A 1 100 ? 31.717 41.336 14.467  1.00 27.90 ? 130 ASN A N   1 
ATOM   665  C CA  . ASN A 1 100 ? 32.982 41.306 15.190  1.00 28.11 ? 130 ASN A CA  1 
ATOM   666  C C   . ASN A 1 100 ? 34.052 42.021 14.367  1.00 26.98 ? 130 ASN A C   1 
ATOM   667  O O   . ASN A 1 100 ? 34.773 41.398 13.581  1.00 27.50 ? 130 ASN A O   1 
ATOM   668  C CB  . ASN A 1 100 ? 33.389 39.866 15.507  1.00 26.48 ? 130 ASN A CB  1 
ATOM   669  C CG  . ASN A 1 100 ? 34.497 39.795 16.532  1.00 26.74 ? 130 ASN A CG  1 
ATOM   670  O OD1 . ASN A 1 100 ? 35.413 40.616 16.536  1.00 29.59 ? 130 ASN A OD1 1 
ATOM   671  N ND2 . ASN A 1 100 ? 34.411 38.812 17.425  1.00 27.43 ? 130 ASN A ND2 1 
ATOM   672  N N   . ALA A 1 101 ? 34.109 43.338 14.531  1.00 27.67 ? 131 ALA A N   1 
ATOM   673  C CA  . ALA A 1 101 ? 34.960 44.214 13.740  1.00 26.88 ? 131 ALA A CA  1 
ATOM   674  C C   . ALA A 1 101 ? 35.152 45.520 14.502  1.00 26.65 ? 131 ALA A C   1 
ATOM   675  O O   . ALA A 1 101 ? 34.236 45.964 15.207  1.00 25.22 ? 131 ALA A O   1 
ATOM   676  C CB  . ALA A 1 101 ? 34.282 44.525 12.401  1.00 27.10 ? 131 ALA A CB  1 
ATOM   677  N N   . ASN A 1 102 ? 36.333 46.126 14.336  1.00 23.82 ? 132 ASN A N   1 
ATOM   678  C CA  . ASN A 1 102 ? 36.645 47.430 14.903  1.00 25.55 ? 132 ASN A CA  1 
ATOM   679  C C   . ASN A 1 102 ? 37.298 48.360 13.908  1.00 24.31 ? 132 ASN A C   1 
ATOM   680  O O   . ASN A 1 102 ? 38.120 47.934 13.087  1.00 24.89 ? 132 ASN A O   1 
ATOM   681  C CB  . ASN A 1 102 ? 37.643 47.273 16.050  1.00 23.64 ? 132 ASN A CB  1 
ATOM   682  C CG  . ASN A 1 102 ? 37.041 46.527 17.226  1.00 25.55 ? 132 ASN A CG  1 
ATOM   683  O OD1 . ASN A 1 102 ? 37.104 45.286 17.289  1.00 28.50 ? 132 ASN A OD1 1 
ATOM   684  N ND2 . ASN A 1 102 ? 36.449 47.269 18.157  1.00 24.48 ? 132 ASN A ND2 1 
ATOM   685  N N   . TYR A 1 103 ? 36.978 49.645 14.037  1.00 24.31 ? 133 TYR A N   1 
ATOM   686  C CA  . TYR A 1 103 ? 37.755 50.672 13.350  1.00 27.00 ? 133 TYR A CA  1 
ATOM   687  C C   . TYR A 1 103 ? 39.149 50.740 13.942  1.00 27.51 ? 133 TYR A C   1 
ATOM   688  O O   . TYR A 1 103 ? 39.310 50.692 15.165  1.00 24.05 ? 133 TYR A O   1 
ATOM   689  C CB  . TYR A 1 103 ? 37.102 52.027 13.542  1.00 26.19 ? 133 TYR A CB  1 
ATOM   690  C CG  . TYR A 1 103 ? 35.702 52.122 13.006  1.00 26.13 ? 133 TYR A CG  1 
ATOM   691  C CD1 . TYR A 1 103 ? 35.462 52.118 11.621  1.00 24.85 ? 133 TYR A CD1 1 
ATOM   692  C CD2 . TYR A 1 103 ? 34.606 52.218 13.874  1.00 25.97 ? 133 TYR A CD2 1 
ATOM   693  C CE1 . TYR A 1 103 ? 34.155 52.241 11.121  1.00 27.90 ? 133 TYR A CE1 1 
ATOM   694  C CE2 . TYR A 1 103 ? 33.307 52.331 13.387  1.00 31.75 ? 133 TYR A CE2 1 
ATOM   695  C CZ  . TYR A 1 103 ? 33.093 52.349 12.003  1.00 33.21 ? 133 TYR A CZ  1 
ATOM   696  O OH  . TYR A 1 103 ? 31.805 52.460 11.528  1.00 31.73 ? 133 TYR A OH  1 
ATOM   697  N N   . ILE A 1 104 ? 40.143 50.893 13.071  1.00 24.20 ? 134 ILE A N   1 
ATOM   698  C CA  . ILE A 1 104 ? 41.527 50.964 13.495  1.00 24.81 ? 134 ILE A CA  1 
ATOM   699  C C   . ILE A 1 104 ? 42.119 52.265 12.982  1.00 28.24 ? 134 ILE A C   1 
ATOM   700  O O   . ILE A 1 104 ? 42.033 52.564 11.785  1.00 26.48 ? 134 ILE A O   1 
ATOM   701  C CB  . ILE A 1 104 ? 42.361 49.791 12.945  1.00 23.68 ? 134 ILE A CB  1 
ATOM   702  C CG1 . ILE A 1 104 ? 41.702 48.416 13.197  1.00 24.93 ? 134 ILE A CG1 1 
ATOM   703  C CG2 . ILE A 1 104 ? 43.831 49.840 13.443  1.00 21.84 ? 134 ILE A CG2 1 
ATOM   704  C CD1 . ILE A 1 104 ? 41.563 47.984 14.719  1.00 22.59 ? 134 ILE A CD1 1 
ATOM   705  N N   . ARG A 1 105 ? 42.754 53.010 13.880  1.00 24.94 ? 135 ARG A N   1 
ATOM   706  C CA  . ARG A 1 105 ? 43.501 54.219 13.488  1.00 27.19 ? 135 ARG A CA  1 
ATOM   707  C C   . ARG A 1 105 ? 44.777 53.885 12.688  1.00 28.11 ? 135 ARG A C   1 
ATOM   708  O O   . ARG A 1 105 ? 45.425 52.848 12.913  1.00 26.79 ? 135 ARG A O   1 
ATOM   709  C CB  . ARG A 1 105 ? 43.847 55.068 14.735  1.00 25.63 ? 135 ARG A CB  1 
ATOM   710  C CG  . ARG A 1 105 ? 42.654 55.734 15.396  1.00 26.04 ? 135 ARG A CG  1 
ATOM   711  C CD  . ARG A 1 105 ? 43.000 56.351 16.775  1.00 26.71 ? 135 ARG A CD  1 
ATOM   712  N NE  . ARG A 1 105 ? 43.441 55.291 17.687  1.00 27.45 ? 135 ARG A NE  1 
ATOM   713  C CZ  . ARG A 1 105 ? 44.560 55.333 18.400  1.00 26.47 ? 135 ARG A CZ  1 
ATOM   714  N NH1 . ARG A 1 105 ? 45.317 56.425 18.391  1.00 29.85 ? 135 ARG A NH1 1 
ATOM   715  N NH2 . ARG A 1 105 ? 44.884 54.309 19.186  1.00 26.93 ? 135 ARG A NH2 1 
ATOM   716  N N   . GLY A 1 106 ? 45.148 54.762 11.759  1.00 27.92 ? 136 GLY A N   1 
ATOM   717  C CA  . GLY A 1 106 ? 46.392 54.559 11.034  1.00 27.99 ? 136 GLY A CA  1 
ATOM   718  C C   . GLY A 1 106 ? 47.515 55.464 11.477  1.00 28.76 ? 136 GLY A C   1 
ATOM   719  O O   . GLY A 1 106 ? 47.586 55.925 12.616  1.00 27.26 ? 136 GLY A O   1 
ATOM   720  N N   . TYR A 1 107 ? 48.401 55.733 10.533  1.00 28.15 ? 137 TYR A N   1 
ATOM   721  C CA  . TYR A 1 107 ? 49.574 56.542 10.763  1.00 28.66 ? 137 TYR A CA  1 
ATOM   722  C C   . TYR A 1 107 ? 49.176 57.878 11.385  1.00 30.57 ? 137 TYR A C   1 
ATOM   723  O O   . TYR A 1 107 ? 48.227 58.526 10.948  1.00 31.65 ? 137 TYR A O   1 
ATOM   724  C CB  . TYR A 1 107 ? 50.295 56.776 9.415   1.00 30.79 ? 137 TYR A CB  1 
ATOM   725  C CG  . TYR A 1 107 ? 51.396 57.767 9.536   1.00 30.43 ? 137 TYR A CG  1 
ATOM   726  C CD1 . TYR A 1 107 ? 52.562 57.452 10.208  1.00 31.59 ? 137 TYR A CD1 1 
ATOM   727  C CD2 . TYR A 1 107 ? 51.265 59.042 9.001   1.00 37.43 ? 137 TYR A CD2 1 
ATOM   728  C CE1 . TYR A 1 107 ? 53.589 58.395 10.347  1.00 33.87 ? 137 TYR A CE1 1 
ATOM   729  C CE2 . TYR A 1 107 ? 52.277 59.985 9.138   1.00 38.70 ? 137 TYR A CE2 1 
ATOM   730  C CZ  . TYR A 1 107 ? 53.437 59.649 9.809   1.00 35.99 ? 137 TYR A CZ  1 
ATOM   731  O OH  . TYR A 1 107 ? 54.454 60.573 9.956   1.00 40.47 ? 137 TYR A OH  1 
ATOM   732  N N   . ASP A 1 108 ? 49.886 58.257 12.437  1.00 32.21 ? 138 ASP A N   1 
ATOM   733  C CA  . ASP A 1 108 ? 49.682 59.544 13.085  1.00 35.16 ? 138 ASP A CA  1 
ATOM   734  C C   . ASP A 1 108 ? 48.305 59.650 13.788  1.00 35.26 ? 138 ASP A C   1 
ATOM   735  O O   . ASP A 1 108 ? 47.817 60.752 14.039  1.00 33.51 ? 138 ASP A O   1 
ATOM   736  C CB  . ASP A 1 108 ? 49.879 60.674 12.064  1.00 37.87 ? 138 ASP A CB  1 
ATOM   737  C CG  . ASP A 1 108 ? 50.392 61.957 12.697  1.00 52.20 ? 138 ASP A CG  1 
ATOM   738  O OD1 . ASP A 1 108 ? 51.168 61.881 13.677  1.00 60.26 ? 138 ASP A OD1 1 
ATOM   739  O OD2 . ASP A 1 108 ? 50.022 63.047 12.204  1.00 65.39 ? 138 ASP A OD2 1 
ATOM   740  N N   . GLY A 1 109 ? 47.694 58.511 14.106  1.00 31.82 ? 139 GLY A N   1 
ATOM   741  C CA  . GLY A 1 109 ? 46.369 58.500 14.743  1.00 31.34 ? 139 GLY A CA  1 
ATOM   742  C C   . GLY A 1 109 ? 45.191 58.826 13.834  1.00 31.09 ? 139 GLY A C   1 
ATOM   743  O O   . GLY A 1 109 ? 44.072 59.036 14.313  1.00 28.38 ? 139 GLY A O   1 
ATOM   744  N N   . LYS A 1 110 ? 45.407 58.845 12.515  1.00 27.50 ? 140 LYS A N   1 
ATOM   745  C CA  . LYS A 1 110 ? 44.313 59.130 11.588  1.00 29.14 ? 140 LYS A CA  1 
ATOM   746  C C   . LYS A 1 110 ? 43.163 58.128 11.768  1.00 26.35 ? 140 LYS A C   1 
ATOM   747  O O   . LYS A 1 110 ? 43.374 56.932 11.783  1.00 26.99 ? 140 LYS A O   1 
ATOM   748  C CB  . LYS A 1 110 ? 44.813 59.141 10.132  1.00 30.30 ? 140 LYS A CB  1 
ATOM   749  C CG  . LYS A 1 110 ? 43.724 59.398 9.106   1.00 33.09 ? 140 LYS A CG  1 
ATOM   750  C CD  . LYS A 1 110 ? 44.342 59.391 7.685   1.00 36.37 ? 140 LYS A CD  1 
ATOM   751  C CE  . LYS A 1 110 ? 43.299 59.769 6.660   1.00 43.90 ? 140 LYS A CE  1 
ATOM   752  N NZ  . LYS A 1 110 ? 42.619 61.039 7.039   1.00 52.33 ? 140 LYS A NZ  1 
ATOM   753  N N   . GLU A 1 111 ? 41.946 58.627 11.916  1.00 25.69 ? 141 GLU A N   1 
ATOM   754  C CA  . GLU A 1 111 ? 40.823 57.770 12.272  1.00 26.11 ? 141 GLU A CA  1 
ATOM   755  C C   . GLU A 1 111 ? 40.302 56.942 11.116  1.00 27.44 ? 141 GLU A C   1 
ATOM   756  O O   . GLU A 1 111 ? 40.319 57.399 9.958   1.00 27.39 ? 141 GLU A O   1 
ATOM   757  C CB  . GLU A 1 111 ? 39.694 58.593 12.893  1.00 28.55 ? 141 GLU A CB  1 
ATOM   758  C CG  . GLU A 1 111 ? 40.023 59.045 14.293  1.00 29.56 ? 141 GLU A CG  1 
ATOM   759  C CD  . GLU A 1 111 ? 38.943 59.937 14.905  1.00 44.11 ? 141 GLU A CD  1 
ATOM   760  O OE1 . GLU A 1 111 ? 37.913 60.194 14.240  1.00 39.20 ? 141 GLU A OE1 1 
ATOM   761  O OE2 . GLU A 1 111 ? 39.139 60.372 16.061  1.00 41.30 ? 141 GLU A OE2 1 
ATOM   762  N N   . LYS A 1 112 ? 39.906 55.706 11.438  1.00 24.96 ? 142 LYS A N   1 
ATOM   763  C CA  . LYS A 1 112 ? 39.180 54.800 10.533  1.00 24.87 ? 142 LYS A CA  1 
ATOM   764  C C   . LYS A 1 112 ? 39.941 54.505 9.251   1.00 26.57 ? 142 LYS A C   1 
ATOM   765  O O   . LYS A 1 112 ? 39.337 54.430 8.169   1.00 26.14 ? 142 LYS A O   1 
ATOM   766  C CB  . LYS A 1 112 ? 37.777 55.339 10.198  1.00 26.54 ? 142 LYS A CB  1 
ATOM   767  C CG  . LYS A 1 112 ? 36.919 55.531 11.431  1.00 26.75 ? 142 LYS A CG  1 
ATOM   768  C CD  . LYS A 1 112 ? 35.473 55.878 11.048  1.00 29.93 ? 142 LYS A CD  1 
ATOM   769  C CE  . LYS A 1 112 ? 34.599 55.894 12.317  1.00 34.41 ? 142 LYS A CE  1 
ATOM   770  N NZ  . LYS A 1 112 ? 33.175 56.141 11.954  1.00 38.68 ? 142 LYS A NZ  1 
ATOM   771  N N   . VAL A 1 113 ? 41.257 54.340 9.366   1.00 26.32 ? 143 VAL A N   1 
ATOM   772  C CA  . VAL A 1 113 ? 42.056 53.954 8.212   1.00 27.49 ? 143 VAL A CA  1 
ATOM   773  C C   . VAL A 1 113 ? 41.794 52.495 7.833   1.00 24.41 ? 143 VAL A C   1 
ATOM   774  O O   . VAL A 1 113 ? 41.829 52.144 6.624   1.00 25.28 ? 143 VAL A O   1 
ATOM   775  C CB  . VAL A 1 113 ? 43.579 54.232 8.433   1.00 25.38 ? 143 VAL A CB  1 
ATOM   776  C CG1 . VAL A 1 113 ? 44.396 53.778 7.242   1.00 25.18 ? 143 VAL A CG1 1 
ATOM   777  C CG2 . VAL A 1 113 ? 43.806 55.707 8.651   1.00 27.23 ? 143 VAL A CG2 1 
ATOM   778  N N   . TYR A 1 114 ? 41.578 51.650 8.849   1.00 24.90 ? 144 TYR A N   1 
ATOM   779  C CA  . TYR A 1 114 ? 41.316 50.212 8.638   1.00 24.46 ? 144 TYR A CA  1 
ATOM   780  C C   . TYR A 1 114 ? 40.092 49.824 9.427   1.00 25.04 ? 144 TYR A C   1 
ATOM   781  O O   . TYR A 1 114 ? 39.695 50.501 10.385  1.00 26.69 ? 144 TYR A O   1 
ATOM   782  C CB  . TYR A 1 114 ? 42.475 49.288 9.115   1.00 25.17 ? 144 TYR A CB  1 
ATOM   783  C CG  . TYR A 1 114 ? 43.821 49.787 8.686   1.00 27.41 ? 144 TYR A CG  1 
ATOM   784  C CD1 . TYR A 1 114 ? 44.370 49.386 7.465   1.00 26.04 ? 144 TYR A CD1 1 
ATOM   785  C CD2 . TYR A 1 114 ? 44.518 50.715 9.452   1.00 25.47 ? 144 TYR A CD2 1 
ATOM   786  C CE1 . TYR A 1 114 ? 45.606 49.898 7.025   1.00 26.88 ? 144 TYR A CE1 1 
ATOM   787  C CE2 . TYR A 1 114 ? 45.747 51.238 9.011   1.00 25.15 ? 144 TYR A CE2 1 
ATOM   788  C CZ  . TYR A 1 114 ? 46.284 50.810 7.808   1.00 28.91 ? 144 TYR A CZ  1 
ATOM   789  O OH  . TYR A 1 114 ? 47.500 51.324 7.384   1.00 29.55 ? 144 TYR A OH  1 
ATOM   790  N N   . ILE A 1 115 ? 39.533 48.694 9.028   1.00 25.46 ? 145 ILE A N   1 
ATOM   791  C CA  . ILE A 1 115 ? 38.653 47.919 9.888   1.00 25.61 ? 145 ILE A CA  1 
ATOM   792  C C   . ILE A 1 115 ? 39.321 46.563 10.005  1.00 26.44 ? 145 ILE A C   1 
ATOM   793  O O   . ILE A 1 115 ? 39.599 45.916 8.993   1.00 27.31 ? 145 ILE A O   1 
ATOM   794  C CB  . ILE A 1 115 ? 37.234 47.752 9.275   1.00 24.38 ? 145 ILE A CB  1 
ATOM   795  C CG1 . ILE A 1 115 ? 36.444 49.069 9.385   1.00 27.93 ? 145 ILE A CG1 1 
ATOM   796  C CG2 . ILE A 1 115 ? 36.462 46.581 9.943   1.00 26.34 ? 145 ILE A CG2 1 
ATOM   797  C CD1 . ILE A 1 115 ? 35.160 49.094 8.544   1.00 27.58 ? 145 ILE A CD1 1 
ATOM   798  N N   . ALA A 1 116 ? 39.580 46.126 11.247  1.00 25.19 ? 146 ALA A N   1 
ATOM   799  C CA  . ALA A 1 116 ? 40.083 44.783 11.474  1.00 24.96 ? 146 ALA A CA  1 
ATOM   800  C C   . ALA A 1 116 ? 38.886 43.917 11.850  1.00 25.03 ? 146 ALA A C   1 
ATOM   801  O O   . ALA A 1 116 ? 38.074 44.293 12.710  1.00 27.25 ? 146 ALA A O   1 
ATOM   802  C CB  . ALA A 1 116 ? 41.120 44.787 12.620  1.00 26.29 ? 146 ALA A CB  1 
ATOM   803  N N   . THR A 1 117 ? 38.779 42.747 11.240  1.00 24.66 ? 147 THR A N   1 
ATOM   804  C CA  . THR A 1 117 ? 37.630 41.903 11.513  1.00 24.13 ? 147 THR A CA  1 
ATOM   805  C C   . THR A 1 117 ? 38.031 40.454 11.341  1.00 25.19 ? 147 THR A C   1 
ATOM   806  O O   . THR A 1 117 ? 39.058 40.159 10.728  1.00 25.63 ? 147 THR A O   1 
ATOM   807  C CB  . THR A 1 117 ? 36.405 42.286 10.586  1.00 26.32 ? 147 THR A CB  1 
ATOM   808  O OG1 . THR A 1 117 ? 35.230 41.565 11.021  1.00 28.61 ? 147 THR A OG1 1 
ATOM   809  C CG2 . THR A 1 117 ? 36.689 41.985 9.120   1.00 26.22 ? 147 THR A CG2 1 
ATOM   810  N N   . GLN A 1 118 ? 37.247 39.555 11.925  1.00 27.62 ? 148 GLN A N   1 
ATOM   811  C CA  . GLN A 1 118 ? 37.416 38.122 11.688  1.00 29.57 ? 148 GLN A CA  1 
ATOM   812  C C   . GLN A 1 118 ? 36.970 37.773 10.259  1.00 30.25 ? 148 GLN A C   1 
ATOM   813  O O   . GLN A 1 118 ? 36.159 38.493 9.659   1.00 28.79 ? 148 GLN A O   1 
ATOM   814  C CB  . GLN A 1 118 ? 36.612 37.309 12.720  1.00 30.48 ? 148 GLN A CB  1 
ATOM   815  C CG  . GLN A 1 118 ? 35.119 37.320 12.438  1.00 27.99 ? 148 GLN A CG  1 
ATOM   816  C CD  . GLN A 1 118 ? 34.284 36.660 13.491  1.00 31.51 ? 148 GLN A CD  1 
ATOM   817  O OE1 . GLN A 1 118 ? 34.753 36.331 14.588  1.00 28.99 ? 148 GLN A OE1 1 
ATOM   818  N NE2 . GLN A 1 118 ? 33.026 36.454 13.162  1.00 27.94 ? 148 GLN A NE2 1 
ATOM   819  N N   . GLY A 1 119 ? 37.476 36.667 9.712   1.00 30.63 ? 149 GLY A N   1 
ATOM   820  C CA  . GLY A 1 119 ? 36.953 36.189 8.422   1.00 31.42 ? 149 GLY A CA  1 
ATOM   821  C C   . GLY A 1 119 ? 35.473 35.843 8.615   1.00 31.17 ? 149 GLY A C   1 
ATOM   822  O O   . GLY A 1 119 ? 35.087 35.311 9.662   1.00 32.37 ? 149 GLY A O   1 
ATOM   823  N N   . PRO A 1 120 ? 34.618 36.190 7.640   1.00 32.54 ? 150 PRO A N   1 
ATOM   824  C CA  . PRO A 1 120 ? 33.194 35.874 7.839   1.00 31.02 ? 150 PRO A CA  1 
ATOM   825  C C   . PRO A 1 120 ? 32.932 34.391 8.090   1.00 31.11 ? 150 PRO A C   1 
ATOM   826  O O   . PRO A 1 120 ? 33.679 33.531 7.609   1.00 31.32 ? 150 PRO A O   1 
ATOM   827  C CB  . PRO A 1 120 ? 32.512 36.322 6.523   1.00 32.20 ? 150 PRO A CB  1 
ATOM   828  C CG  . PRO A 1 120 ? 33.548 37.032 5.728   1.00 33.42 ? 150 PRO A CG  1 
ATOM   829  C CD  . PRO A 1 120 ? 34.890 36.926 6.391   1.00 31.05 ? 150 PRO A CD  1 
ATOM   830  N N   . MET A 1 121 ? 31.911 34.108 8.898   1.00 30.83 ? 151 MET A N   1 
ATOM   831  C CA  . MET A 1 121 ? 31.408 32.747 9.098   1.00 35.50 ? 151 MET A CA  1 
ATOM   832  C C   . MET A 1 121 ? 30.260 32.567 8.109   1.00 33.90 ? 151 MET A C   1 
ATOM   833  O O   . MET A 1 121 ? 29.765 33.548 7.568   1.00 32.15 ? 151 MET A O   1 
ATOM   834  C CB  . MET A 1 121 ? 30.885 32.564 10.530  1.00 33.39 ? 151 MET A CB  1 
ATOM   835  C CG  . MET A 1 121 ? 31.956 32.802 11.619  1.00 40.39 ? 151 MET A CG  1 
ATOM   836  S SD  . MET A 1 121 ? 31.222 32.991 13.272  1.00 46.87 ? 151 MET A SD  1 
ATOM   837  C CE  . MET A 1 121 ? 30.973 31.275 13.692  1.00 53.45 ? 151 MET A CE  1 
ATOM   838  N N   . PRO A 1 122 ? 29.836 31.318 7.852   1.00 35.10 ? 152 PRO A N   1 
ATOM   839  C CA  . PRO A 1 122 ? 28.720 31.177 6.909   1.00 36.00 ? 152 PRO A CA  1 
ATOM   840  C C   . PRO A 1 122 ? 27.528 32.080 7.268   1.00 34.50 ? 152 PRO A C   1 
ATOM   841  O O   . PRO A 1 122 ? 26.925 32.679 6.374   1.00 36.02 ? 152 PRO A O   1 
ATOM   842  C CB  . PRO A 1 122 ? 28.356 29.693 7.026   1.00 34.77 ? 152 PRO A CB  1 
ATOM   843  C CG  . PRO A 1 122 ? 29.632 29.042 7.407   1.00 38.36 ? 152 PRO A CG  1 
ATOM   844  C CD  . PRO A 1 122 ? 30.315 30.010 8.336   1.00 37.06 ? 152 PRO A CD  1 
ATOM   845  N N   . ASN A 1 123 ? 27.221 32.212 8.558   1.00 32.37 ? 153 ASN A N   1 
ATOM   846  C CA  . ASN A 1 123 ? 26.086 33.034 8.981   1.00 34.08 ? 153 ASN A CA  1 
ATOM   847  C C   . ASN A 1 123 ? 26.358 34.540 9.070   1.00 33.15 ? 153 ASN A C   1 
ATOM   848  O O   . ASN A 1 123 ? 25.443 35.302 9.369   1.00 32.79 ? 153 ASN A O   1 
ATOM   849  C CB  . ASN A 1 123 ? 25.509 32.537 10.311  1.00 33.97 ? 153 ASN A CB  1 
ATOM   850  C CG  . ASN A 1 123 ? 26.484 32.706 11.469  1.00 38.34 ? 153 ASN A CG  1 
ATOM   851  O OD1 . ASN A 1 123 ? 27.643 32.297 11.383  1.00 39.94 ? 153 ASN A OD1 1 
ATOM   852  N ND2 . ASN A 1 123 ? 26.012 33.299 12.561  1.00 35.88 ? 153 ASN A ND2 1 
ATOM   853  N N   . THR A 1 124 ? 27.595 34.980 8.807   1.00 32.86 ? 154 THR A N   1 
ATOM   854  C CA  . THR A 1 124 ? 27.879 36.424 8.847   1.00 30.95 ? 154 THR A CA  1 
ATOM   855  C C   . THR A 1 124 ? 28.367 37.001 7.527   1.00 31.22 ? 154 THR A C   1 
ATOM   856  O O   . THR A 1 124 ? 28.778 38.165 7.483   1.00 29.97 ? 154 THR A O   1 
ATOM   857  C CB  . THR A 1 124 ? 28.885 36.808 9.978   1.00 28.81 ? 154 THR A CB  1 
ATOM   858  O OG1 . THR A 1 124 ? 30.192 36.326 9.640   1.00 30.61 ? 154 THR A OG1 1 
ATOM   859  C CG2 . THR A 1 124 ? 28.456 36.217 11.324  1.00 28.10 ? 154 THR A CG2 1 
ATOM   860  N N   . VAL A 1 125 ? 28.319 36.207 6.453   1.00 31.73 ? 155 VAL A N   1 
ATOM   861  C CA  . VAL A 1 125 ? 28.692 36.706 5.121   1.00 29.81 ? 155 VAL A CA  1 
ATOM   862  C C   . VAL A 1 125 ? 27.877 37.942 4.721   1.00 31.45 ? 155 VAL A C   1 
ATOM   863  O O   . VAL A 1 125 ? 28.432 38.933 4.218   1.00 30.54 ? 155 VAL A O   1 
ATOM   864  C CB  . VAL A 1 125 ? 28.568 35.613 4.014   1.00 32.43 ? 155 VAL A CB  1 
ATOM   865  C CG1 . VAL A 1 125 ? 28.789 36.215 2.628   1.00 30.37 ? 155 VAL A CG1 1 
ATOM   866  C CG2 . VAL A 1 125 ? 29.580 34.500 4.254   1.00 34.07 ? 155 VAL A CG2 1 
ATOM   867  N N   . SER A 1 126 ? 26.560 37.884 4.924   1.00 31.66 ? 156 SER A N   1 
ATOM   868  C CA  . SER A 1 126 ? 25.711 39.014 4.555   1.00 33.04 ? 156 SER A CA  1 
ATOM   869  C C   . SER A 1 126 ? 26.049 40.243 5.388   1.00 31.65 ? 156 SER A C   1 
ATOM   870  O O   . SER A 1 126 ? 26.068 41.356 4.863   1.00 30.74 ? 156 SER A O   1 
ATOM   871  C CB  . SER A 1 126 ? 24.226 38.653 4.684   1.00 35.81 ? 156 SER A CB  1 
ATOM   872  O OG  . SER A 1 126 ? 23.899 37.638 3.744   1.00 43.08 ? 156 SER A OG  1 
ATOM   873  N N   . ASP A 1 127 ? 26.299 40.036 6.684   1.00 30.71 ? 157 ASP A N   1 
ATOM   874  C CA  . ASP A 1 127 ? 26.752 41.112 7.578   1.00 28.98 ? 157 ASP A CA  1 
ATOM   875  C C   . ASP A 1 127 ? 28.060 41.740 7.069   1.00 28.64 ? 157 ASP A C   1 
ATOM   876  O O   . ASP A 1 127 ? 28.220 42.963 7.079   1.00 28.32 ? 157 ASP A O   1 
ATOM   877  C CB  . ASP A 1 127 ? 26.972 40.584 9.006   1.00 29.97 ? 157 ASP A CB  1 
ATOM   878  C CG  . ASP A 1 127 ? 25.681 40.197 9.709   1.00 33.86 ? 157 ASP A CG  1 
ATOM   879  O OD1 . ASP A 1 127 ? 24.606 40.699 9.338   1.00 34.31 ? 157 ASP A OD1 1 
ATOM   880  O OD2 . ASP A 1 127 ? 25.734 39.376 10.655  1.00 35.59 ? 157 ASP A OD2 1 
ATOM   881  N N   . PHE A 1 128 ? 29.008 40.896 6.662   1.00 27.82 ? 158 PHE A N   1 
ATOM   882  C CA  . PHE A 1 128 ? 30.279 41.372 6.144   1.00 26.83 ? 158 PHE A CA  1 
ATOM   883  C C   . PHE A 1 128 ? 30.070 42.298 4.940   1.00 27.51 ? 158 PHE A C   1 
ATOM   884  O O   . PHE A 1 128 ? 30.647 43.381 4.888   1.00 25.83 ? 158 PHE A O   1 
ATOM   885  C CB  . PHE A 1 128 ? 31.174 40.188 5.760   1.00 25.80 ? 158 PHE A CB  1 
ATOM   886  C CG  . PHE A 1 128 ? 32.506 40.593 5.190   1.00 28.20 ? 158 PHE A CG  1 
ATOM   887  C CD1 . PHE A 1 128 ? 33.594 40.830 6.029   1.00 29.27 ? 158 PHE A CD1 1 
ATOM   888  C CD2 . PHE A 1 128 ? 32.669 40.759 3.794   1.00 25.68 ? 158 PHE A CD2 1 
ATOM   889  C CE1 . PHE A 1 128 ? 34.839 41.204 5.490   1.00 28.64 ? 158 PHE A CE1 1 
ATOM   890  C CE2 . PHE A 1 128 ? 33.905 41.143 3.252   1.00 25.92 ? 158 PHE A CE2 1 
ATOM   891  C CZ  . PHE A 1 128 ? 34.986 41.370 4.097   1.00 28.65 ? 158 PHE A CZ  1 
ATOM   892  N N   . TRP A 1 129 ? 29.246 41.885 3.977   1.00 27.89 ? 159 TRP A N   1 
ATOM   893  C CA  . TRP A 1 129 ? 29.014 42.741 2.797   1.00 28.00 ? 159 TRP A CA  1 
ATOM   894  C C   . TRP A 1 129 ? 28.242 44.011 3.137   1.00 26.86 ? 159 TRP A C   1 
ATOM   895  O O   . TRP A 1 129 ? 28.506 45.079 2.589   1.00 28.72 ? 159 TRP A O   1 
ATOM   896  C CB  . TRP A 1 129 ? 28.348 41.961 1.665   1.00 28.29 ? 159 TRP A CB  1 
ATOM   897  C CG  . TRP A 1 129 ? 29.306 40.970 1.018   1.00 28.17 ? 159 TRP A CG  1 
ATOM   898  C CD1 . TRP A 1 129 ? 29.177 39.613 0.981   1.00 30.05 ? 159 TRP A CD1 1 
ATOM   899  C CD2 . TRP A 1 129 ? 30.535 41.277 0.334   1.00 29.19 ? 159 TRP A CD2 1 
ATOM   900  N NE1 . TRP A 1 129 ? 30.253 39.048 0.318   1.00 29.56 ? 159 TRP A NE1 1 
ATOM   901  C CE2 . TRP A 1 129 ? 31.097 40.047 -0.090  1.00 30.33 ? 159 TRP A CE2 1 
ATOM   902  C CE3 . TRP A 1 129 ? 31.224 42.468 0.055   1.00 26.83 ? 159 TRP A CE3 1 
ATOM   903  C CZ2 . TRP A 1 129 ? 32.307 39.974 -0.794  1.00 32.85 ? 159 TRP A CZ2 1 
ATOM   904  C CZ3 . TRP A 1 129 ? 32.434 42.395 -0.653  1.00 31.29 ? 159 TRP A CZ3 1 
ATOM   905  C CH2 . TRP A 1 129 ? 32.961 41.150 -1.064  1.00 29.69 ? 159 TRP A CH2 1 
ATOM   906  N N   . GLU A 1 130 ? 27.338 43.902 4.103   1.00 27.06 ? 160 GLU A N   1 
ATOM   907  C CA  . GLU A 1 130 ? 26.614 45.061 4.605   1.00 28.91 ? 160 GLU A CA  1 
ATOM   908  C C   . GLU A 1 130 ? 27.607 46.087 5.181   1.00 27.77 ? 160 GLU A C   1 
ATOM   909  O O   . GLU A 1 130 ? 27.462 47.294 4.957   1.00 25.43 ? 160 GLU A O   1 
ATOM   910  C CB  . GLU A 1 130 ? 25.650 44.589 5.694   1.00 31.56 ? 160 GLU A CB  1 
ATOM   911  C CG  . GLU A 1 130 ? 24.408 45.361 5.843   1.00 44.27 ? 160 GLU A CG  1 
ATOM   912  C CD  . GLU A 1 130 ? 23.474 44.732 6.875   1.00 47.27 ? 160 GLU A CD  1 
ATOM   913  O OE1 . GLU A 1 130 ? 22.858 43.675 6.593   1.00 50.29 ? 160 GLU A OE1 1 
ATOM   914  O OE2 . GLU A 1 130 ? 23.365 45.307 7.968   1.00 56.27 ? 160 GLU A OE2 1 
ATOM   915  N N   . MET A 1 131 ? 28.606 45.608 5.929   1.00 25.96 ? 161 MET A N   1 
ATOM   916  C CA  . MET A 1 131 ? 29.673 46.480 6.431   1.00 26.05 ? 161 MET A CA  1 
ATOM   917  C C   . MET A 1 131 ? 30.468 47.109 5.302   1.00 26.20 ? 161 MET A C   1 
ATOM   918  O O   . MET A 1 131 ? 30.764 48.295 5.346   1.00 27.00 ? 161 MET A O   1 
ATOM   919  C CB  . MET A 1 131 ? 30.649 45.713 7.336   1.00 25.18 ? 161 MET A CB  1 
ATOM   920  C CG  . MET A 1 131 ? 31.725 46.587 7.924   1.00 27.08 ? 161 MET A CG  1 
ATOM   921  S SD  . MET A 1 131 ? 32.728 45.639 9.116   1.00 31.54 ? 161 MET A SD  1 
ATOM   922  C CE  . MET A 1 131 ? 33.608 44.540 8.007   1.00 29.51 ? 161 MET A CE  1 
ATOM   923  N N   . VAL A 1 132 ? 30.846 46.296 4.315   1.00 25.99 ? 162 VAL A N   1 
ATOM   924  C CA  . VAL A 1 132 ? 31.598 46.799 3.159   1.00 26.23 ? 162 VAL A CA  1 
ATOM   925  C C   . VAL A 1 132 ? 30.820 47.944 2.490   1.00 27.49 ? 162 VAL A C   1 
ATOM   926  O O   . VAL A 1 132 ? 31.403 48.988 2.149   1.00 26.71 ? 162 VAL A O   1 
ATOM   927  C CB  . VAL A 1 132 ? 31.911 45.664 2.159   1.00 27.72 ? 162 VAL A CB  1 
ATOM   928  C CG1 . VAL A 1 132 ? 32.328 46.228 0.786   1.00 26.01 ? 162 VAL A CG1 1 
ATOM   929  C CG2 . VAL A 1 132 ? 33.019 44.775 2.717   1.00 27.24 ? 162 VAL A CG2 1 
ATOM   930  N N   . TRP A 1 133 ? 29.512 47.754 2.306   1.00 24.99 ? 163 TRP A N   1 
ATOM   931  C CA  . TRP A 1 133 ? 28.687 48.827 1.697   1.00 27.18 ? 163 TRP A CA  1 
ATOM   932  C C   . TRP A 1 133 ? 28.584 50.056 2.613   1.00 25.90 ? 163 TRP A C   1 
ATOM   933  O O   . TRP A 1 133 ? 28.808 51.198 2.202   1.00 24.78 ? 163 TRP A O   1 
ATOM   934  C CB  . TRP A 1 133 ? 27.268 48.321 1.381   1.00 24.02 ? 163 TRP A CB  1 
ATOM   935  C CG  . TRP A 1 133 ? 26.489 49.338 0.604   1.00 25.24 ? 163 TRP A CG  1 
ATOM   936  C CD1 . TRP A 1 133 ? 25.631 50.264 1.094   1.00 26.12 ? 163 TRP A CD1 1 
ATOM   937  C CD2 . TRP A 1 133 ? 26.532 49.522 -0.819  1.00 24.41 ? 163 TRP A CD2 1 
ATOM   938  N NE1 . TRP A 1 133 ? 25.124 51.042 0.053   1.00 25.50 ? 163 TRP A NE1 1 
ATOM   939  C CE2 . TRP A 1 133 ? 25.665 50.596 -1.130  1.00 27.29 ? 163 TRP A CE2 1 
ATOM   940  C CE3 . TRP A 1 133 ? 27.221 48.876 -1.858  1.00 26.95 ? 163 TRP A CE3 1 
ATOM   941  C CZ2 . TRP A 1 133 ? 25.456 51.043 -2.456  1.00 26.73 ? 163 TRP A CZ2 1 
ATOM   942  C CZ3 . TRP A 1 133 ? 27.011 49.314 -3.186  1.00 25.38 ? 163 TRP A CZ3 1 
ATOM   943  C CH2 . TRP A 1 133 ? 26.136 50.389 -3.461  1.00 24.71 ? 163 TRP A CH2 1 
ATOM   944  N N   . GLN A 1 134 ? 28.239 49.821 3.866   1.00 26.62 ? 164 GLN A N   1 
ATOM   945  C CA  . GLN A 1 134 ? 27.984 50.927 4.779   1.00 26.68 ? 164 GLN A CA  1 
ATOM   946  C C   . GLN A 1 134 ? 29.229 51.811 4.930   1.00 25.80 ? 164 GLN A C   1 
ATOM   947  O O   . GLN A 1 134 ? 29.125 53.028 5.015   1.00 23.71 ? 164 GLN A O   1 
ATOM   948  C CB  . GLN A 1 134 ? 27.585 50.354 6.157   1.00 28.62 ? 164 GLN A CB  1 
ATOM   949  C CG  . GLN A 1 134 ? 27.516 51.371 7.257   1.00 33.99 ? 164 GLN A CG  1 
ATOM   950  C CD  . GLN A 1 134 ? 27.162 50.702 8.576   1.00 35.67 ? 164 GLN A CD  1 
ATOM   951  O OE1 . GLN A 1 134 ? 26.043 50.211 8.743   1.00 31.84 ? 164 GLN A OE1 1 
ATOM   952  N NE2 . GLN A 1 134 ? 28.114 50.662 9.501   1.00 32.68 ? 164 GLN A NE2 1 
ATOM   953  N N   . GLU A 1 135 ? 30.399 51.181 4.974   1.00 26.31 ? 165 GLU A N   1 
ATOM   954  C CA  . GLU A 1 135 ? 31.656 51.893 5.265   1.00 25.15 ? 165 GLU A CA  1 
ATOM   955  C C   . GLU A 1 135 ? 32.388 52.362 4.017   1.00 27.07 ? 165 GLU A C   1 
ATOM   956  O O   . GLU A 1 135 ? 33.474 52.946 4.106   1.00 28.15 ? 165 GLU A O   1 
ATOM   957  C CB  . GLU A 1 135 ? 32.577 51.024 6.124   1.00 24.91 ? 165 GLU A CB  1 
ATOM   958  C CG  . GLU A 1 135 ? 31.925 50.677 7.460   1.00 26.85 ? 165 GLU A CG  1 
ATOM   959  C CD  . GLU A 1 135 ? 31.762 51.885 8.386   1.00 34.38 ? 165 GLU A CD  1 
ATOM   960  O OE1 . GLU A 1 135 ? 32.578 52.815 8.339   1.00 37.20 ? 165 GLU A OE1 1 
ATOM   961  O OE2 . GLU A 1 135 ? 30.798 51.902 9.170   1.00 38.79 ? 165 GLU A OE2 1 
ATOM   962  N N   . GLU A 1 136 ? 31.774 52.131 2.860   1.00 26.79 ? 166 GLU A N   1 
ATOM   963  C CA  . GLU A 1 136 ? 32.348 52.562 1.580   1.00 25.54 ? 166 GLU A CA  1 
ATOM   964  C C   . GLU A 1 136 ? 33.759 51.988 1.408   1.00 27.07 ? 166 GLU A C   1 
ATOM   965  O O   . GLU A 1 136 ? 34.679 52.691 0.995   1.00 28.03 ? 166 GLU A O   1 
ATOM   966  C CB  . GLU A 1 136 ? 32.368 54.085 1.465   1.00 29.37 ? 166 GLU A CB  1 
ATOM   967  C CG  . GLU A 1 136 ? 30.965 54.666 1.567   1.00 31.04 ? 166 GLU A CG  1 
ATOM   968  C CD  . GLU A 1 136 ? 30.925 56.178 1.527   1.00 48.53 ? 166 GLU A CD  1 
ATOM   969  O OE1 . GLU A 1 136 ? 31.947 56.812 1.190   1.00 52.25 ? 166 GLU A OE1 1 
ATOM   970  O OE2 . GLU A 1 136 ? 29.854 56.734 1.852   1.00 50.15 ? 166 GLU A OE2 1 
ATOM   971  N N   . VAL A 1 137 ? 33.897 50.707 1.727   1.00 26.22 ? 167 VAL A N   1 
ATOM   972  C CA  . VAL A 1 137 ? 35.170 50.002 1.625   1.00 26.58 ? 167 VAL A CA  1 
ATOM   973  C C   . VAL A 1 137 ? 35.465 49.754 0.137   1.00 28.54 ? 167 VAL A C   1 
ATOM   974  O O   . VAL A 1 137 ? 34.565 49.329 -0.589  1.00 29.42 ? 167 VAL A O   1 
ATOM   975  C CB  . VAL A 1 137 ? 35.085 48.662 2.375   1.00 27.61 ? 167 VAL A CB  1 
ATOM   976  C CG1 . VAL A 1 137 ? 36.280 47.744 2.038   1.00 25.78 ? 167 VAL A CG1 1 
ATOM   977  C CG2 . VAL A 1 137 ? 34.984 48.917 3.928   1.00 25.38 ? 167 VAL A CG2 1 
ATOM   978  N N   . SER A 1 138 ? 36.697 50.022 -0.305  1.00 27.00 ? 168 SER A N   1 
ATOM   979  C CA  . SER A 1 138 ? 37.097 49.681 -1.684  1.00 26.71 ? 168 SER A CA  1 
ATOM   980  C C   . SER A 1 138 ? 38.291 48.720 -1.773  1.00 27.69 ? 168 SER A C   1 
ATOM   981  O O   . SER A 1 138 ? 38.703 48.317 -2.868  1.00 26.50 ? 168 SER A O   1 
ATOM   982  C CB  . SER A 1 138 ? 37.395 50.964 -2.470  1.00 29.40 ? 168 SER A CB  1 
ATOM   983  O OG  . SER A 1 138 ? 38.441 51.670 -1.820  1.00 31.46 ? 168 SER A OG  1 
ATOM   984  N N   . LEU A 1 139 ? 38.847 48.352 -0.621  1.00 25.17 ? 169 LEU A N   1 
ATOM   985  C CA  . LEU A 1 139 ? 39.976 47.422 -0.570  1.00 25.39 ? 169 LEU A CA  1 
ATOM   986  C C   . LEU A 1 139 ? 39.795 46.468 0.607   1.00 25.64 ? 169 LEU A C   1 
ATOM   987  O O   . LEU A 1 139 ? 39.553 46.912 1.738   1.00 26.73 ? 169 LEU A O   1 
ATOM   988  C CB  . LEU A 1 139 ? 41.287 48.196 -0.414  1.00 25.02 ? 169 LEU A CB  1 
ATOM   989  C CG  . LEU A 1 139 ? 42.574 47.355 -0.347  1.00 30.00 ? 169 LEU A CG  1 
ATOM   990  C CD1 . LEU A 1 139 ? 42.816 46.541 -1.662  1.00 32.60 ? 169 LEU A CD1 1 
ATOM   991  C CD2 . LEU A 1 139 ? 43.730 48.304 -0.134  1.00 32.84 ? 169 LEU A CD2 1 
ATOM   992  N N   . ILE A 1 140 ? 39.900 45.167 0.323   1.00 25.03 ? 170 ILE A N   1 
ATOM   993  C CA  . ILE A 1 140 ? 39.877 44.115 1.365   1.00 25.65 ? 170 ILE A CA  1 
ATOM   994  C C   . ILE A 1 140 ? 41.163 43.319 1.260   1.00 27.01 ? 170 ILE A C   1 
ATOM   995  O O   . ILE A 1 140 ? 41.533 42.879 0.169   1.00 26.71 ? 170 ILE A O   1 
ATOM   996  C CB  . ILE A 1 140 ? 38.694 43.124 1.188   1.00 26.98 ? 170 ILE A CB  1 
ATOM   997  C CG1 . ILE A 1 140 ? 37.347 43.867 1.271   1.00 24.91 ? 170 ILE A CG1 1 
ATOM   998  C CG2 . ILE A 1 140 ? 38.764 41.971 2.240   1.00 26.12 ? 170 ILE A CG2 1 
ATOM   999  C CD1 . ILE A 1 140 ? 36.178 43.073 0.626   1.00 24.79 ? 170 ILE A CD1 1 
ATOM   1000 N N   . VAL A 1 141 ? 41.823 43.138 2.403   1.00 24.98 ? 171 VAL A N   1 
ATOM   1001 C CA  . VAL A 1 141 ? 43.050 42.337 2.504   1.00 27.08 ? 171 VAL A CA  1 
ATOM   1002 C C   . VAL A 1 141 ? 42.730 41.140 3.384   1.00 27.13 ? 171 VAL A C   1 
ATOM   1003 O O   . VAL A 1 141 ? 42.374 41.289 4.567   1.00 26.43 ? 171 VAL A O   1 
ATOM   1004 C CB  . VAL A 1 141 ? 44.210 43.152 3.137   1.00 28.33 ? 171 VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 141 ? 45.482 42.288 3.271   1.00 28.00 ? 171 VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 141 ? 44.495 44.406 2.268   1.00 28.96 ? 171 VAL A CG2 1 
ATOM   1007 N N   . MET A 1 142 ? 42.858 39.963 2.787   1.00 26.84 ? 172 MET A N   1 
ATOM   1008 C CA  . MET A 1 142 ? 42.606 38.688 3.447   1.00 28.95 ? 172 MET A CA  1 
ATOM   1009 C C   . MET A 1 142 ? 43.925 37.932 3.692   1.00 28.17 ? 172 MET A C   1 
ATOM   1010 O O   . MET A 1 142 ? 44.696 37.669 2.753   1.00 28.42 ? 172 MET A O   1 
ATOM   1011 C CB  . MET A 1 142 ? 41.663 37.861 2.573   1.00 29.84 ? 172 MET A CB  1 
ATOM   1012 C CG  . MET A 1 142 ? 41.523 36.417 3.011   1.00 30.64 ? 172 MET A CG  1 
ATOM   1013 S SD  . MET A 1 142 ? 40.144 35.677 2.114   1.00 34.35 ? 172 MET A SD  1 
ATOM   1014 C CE  . MET A 1 142 ? 40.374 33.999 2.687   1.00 35.40 ? 172 MET A CE  1 
ATOM   1015 N N   . LEU A 1 143 ? 44.169 37.573 4.952   1.00 25.65 ? 173 LEU A N   1 
ATOM   1016 C CA  . LEU A 1 143 ? 45.397 36.857 5.333   1.00 25.45 ? 173 LEU A CA  1 
ATOM   1017 C C   . LEU A 1 143 ? 45.040 35.442 5.761   1.00 29.32 ? 173 LEU A C   1 
ATOM   1018 O O   . LEU A 1 143 ? 44.228 35.248 6.672   1.00 28.14 ? 173 LEU A O   1 
ATOM   1019 C CB  . LEU A 1 143 ? 46.088 37.615 6.485   1.00 25.58 ? 173 LEU A CB  1 
ATOM   1020 C CG  . LEU A 1 143 ? 46.217 39.118 6.184   1.00 29.64 ? 173 LEU A CG  1 
ATOM   1021 C CD1 . LEU A 1 143 ? 46.514 39.911 7.437   1.00 32.35 ? 173 LEU A CD1 1 
ATOM   1022 C CD2 . LEU A 1 143 ? 47.257 39.403 5.075   1.00 26.52 ? 173 LEU A CD2 1 
ATOM   1023 N N   . THR A 1 144 ? 45.662 34.449 5.127   1.00 27.61 ? 174 THR A N   1 
ATOM   1024 C CA  . THR A 1 144 ? 45.245 33.077 5.334   1.00 29.10 ? 174 THR A CA  1 
ATOM   1025 C C   . THR A 1 144 ? 46.397 32.111 5.045   1.00 29.89 ? 174 THR A C   1 
ATOM   1026 O O   . THR A 1 144 ? 47.460 32.526 4.575   1.00 30.54 ? 174 THR A O   1 
ATOM   1027 C CB  . THR A 1 144 ? 43.982 32.728 4.471   1.00 30.91 ? 174 THR A CB  1 
ATOM   1028 O OG1 . THR A 1 144 ? 43.470 31.455 4.875   1.00 37.16 ? 174 THR A OG1 1 
ATOM   1029 C CG2 . THR A 1 144 ? 44.308 32.678 2.982   1.00 31.18 ? 174 THR A CG2 1 
ATOM   1030 N N   . GLN A 1 145 ? 46.178 30.832 5.339   1.00 32.37 ? 175 GLN A N   1 
ATOM   1031 C CA  . GLN A 1 145 ? 47.085 29.765 4.912   1.00 36.36 ? 175 GLN A CA  1 
ATOM   1032 C C   . GLN A 1 145 ? 46.303 28.757 4.059   1.00 40.98 ? 175 GLN A C   1 
ATOM   1033 O O   . GLN A 1 145 ? 45.142 28.478 4.341   1.00 43.16 ? 175 GLN A O   1 
ATOM   1034 C CB  . GLN A 1 145 ? 47.725 29.086 6.137   1.00 36.43 ? 175 GLN A CB  1 
ATOM   1035 C CG  . GLN A 1 145 ? 48.658 27.852 5.833   1.00 39.53 ? 175 GLN A CG  1 
ATOM   1036 C CD  A GLN A 1 145 ? 49.787 28.153 4.834   0.75 48.97 ? 175 GLN A CD  1 
ATOM   1037 C CD  B GLN A 1 145 ? 48.714 26.858 6.988   0.25 36.35 ? 175 GLN A CD  1 
ATOM   1038 O OE1 A GLN A 1 145 ? 50.642 29.004 5.074   0.75 47.35 ? 175 GLN A OE1 1 
ATOM   1039 O OE1 B GLN A 1 145 ? 47.887 26.900 7.905   0.25 36.88 ? 175 GLN A OE1 1 
ATOM   1040 N NE2 A GLN A 1 145 ? 49.792 27.434 3.711   0.75 53.88 ? 175 GLN A NE2 1 
ATOM   1041 N NE2 B GLN A 1 145 ? 49.694 25.959 6.947   0.25 41.89 ? 175 GLN A NE2 1 
ATOM   1042 N N   . LEU A 1 146 ? 46.932 28.222 3.015   1.00 47.20 ? 176 LEU A N   1 
ATOM   1043 C CA  . LEU A 1 146 ? 46.316 27.199 2.126   1.00 51.65 ? 176 LEU A CA  1 
ATOM   1044 C C   . LEU A 1 146 ? 45.507 26.071 2.818   1.00 55.21 ? 176 LEU A C   1 
ATOM   1045 O O   . LEU A 1 146 ? 44.408 25.719 2.373   1.00 56.92 ? 176 LEU A O   1 
ATOM   1046 C CB  . LEU A 1 146 ? 47.398 26.573 1.233   1.00 52.08 ? 176 LEU A CB  1 
ATOM   1047 N N   . ARG A 1 147 ? 46.046 25.517 3.904   1.00 59.02 ? 177 ARG A N   1 
ATOM   1048 C CA  . ARG A 1 147 ? 45.408 24.395 4.626   1.00 61.46 ? 177 ARG A CA  1 
ATOM   1049 C C   . ARG A 1 147 ? 44.185 24.766 5.490   1.00 62.63 ? 177 ARG A C   1 
ATOM   1050 O O   . ARG A 1 147 ? 43.470 23.878 5.970   1.00 64.05 ? 177 ARG A O   1 
ATOM   1051 C CB  . ARG A 1 147 ? 46.443 23.666 5.499   1.00 61.33 ? 177 ARG A CB  1 
ATOM   1052 N N   . GLU A 1 148 ? 43.942 26.065 5.672   1.00 62.47 ? 178 GLU A N   1 
ATOM   1053 C CA  . GLU A 1 148 ? 42.978 26.556 6.662   1.00 60.78 ? 178 GLU A CA  1 
ATOM   1054 C C   . GLU A 1 148 ? 41.549 25.999 6.530   1.00 62.28 ? 178 GLU A C   1 
ATOM   1055 O O   . GLU A 1 148 ? 40.936 26.048 5.463   1.00 62.83 ? 178 GLU A O   1 
ATOM   1056 C CB  . GLU A 1 148 ? 42.963 28.089 6.667   1.00 59.71 ? 178 GLU A CB  1 
ATOM   1057 C CG  . GLU A 1 148 ? 42.943 28.686 8.065   1.00 45.64 ? 178 GLU A CG  1 
ATOM   1058 C CD  . GLU A 1 148 ? 43.265 30.159 8.094   1.00 33.00 ? 178 GLU A CD  1 
ATOM   1059 O OE1 A GLU A 1 148 ? 42.403 30.993 7.721   0.50 28.34 ? 178 GLU A OE1 1 
ATOM   1060 O OE1 B GLU A 1 148 ? 43.331 30.835 7.052   0.50 42.26 ? 178 GLU A OE1 1 
ATOM   1061 O OE2 A GLU A 1 148 ? 44.447 30.470 8.335   0.50 28.08 ? 178 GLU A OE2 1 
ATOM   1062 O OE2 B GLU A 1 148 ? 43.352 30.656 9.233   0.50 33.41 ? 178 GLU A OE2 1 
ATOM   1063 N N   . CYS A 1 153 ? 37.685 29.777 7.676   1.00 60.46 ? 183 CYS A N   1 
ATOM   1064 C CA  . CYS A 1 153 ? 37.424 30.838 6.703   1.00 60.79 ? 183 CYS A CA  1 
ATOM   1065 C C   . CYS A 1 153 ? 36.584 30.338 5.541   1.00 60.88 ? 183 CYS A C   1 
ATOM   1066 O O   . CYS A 1 153 ? 36.837 29.252 5.003   1.00 61.94 ? 183 CYS A O   1 
ATOM   1067 C CB  . CYS A 1 153 ? 38.738 31.438 6.177   1.00 61.41 ? 183 CYS A CB  1 
ATOM   1068 N N   . VAL A 1 154 ? 35.595 31.144 5.157   1.00 60.37 ? 184 VAL A N   1 
ATOM   1069 C CA  . VAL A 1 154 ? 34.679 30.798 4.069   1.00 58.42 ? 184 VAL A CA  1 
ATOM   1070 C C   . VAL A 1 154 ? 35.016 31.553 2.778   1.00 56.68 ? 184 VAL A C   1 
ATOM   1071 O O   . VAL A 1 154 ? 35.654 32.607 2.811   1.00 55.94 ? 184 VAL A O   1 
ATOM   1072 C CB  . VAL A 1 154 ? 33.192 31.026 4.469   1.00 58.91 ? 184 VAL A CB  1 
ATOM   1073 C CG1 . VAL A 1 154 ? 32.915 30.426 5.842   1.00 60.33 ? 184 VAL A CG1 1 
ATOM   1074 C CG2 . VAL A 1 154 ? 32.828 32.501 4.449   1.00 57.91 ? 184 VAL A CG2 1 
ATOM   1075 N N   . HIS A 1 155 ? 34.598 30.976 1.655   1.00 54.53 ? 185 HIS A N   1 
ATOM   1076 C CA  . HIS A 1 155 ? 34.669 31.601 0.338   1.00 52.84 ? 185 HIS A CA  1 
ATOM   1077 C C   . HIS A 1 155 ? 33.456 32.514 0.198   1.00 48.05 ? 185 HIS A C   1 
ATOM   1078 O O   . HIS A 1 155 ? 32.423 32.115 -0.335  1.00 51.61 ? 185 HIS A O   1 
ATOM   1079 C CB  . HIS A 1 155 ? 34.691 30.487 -0.718  1.00 53.98 ? 185 HIS A CB  1 
ATOM   1080 C CG  A HIS A 1 155 ? 34.747 30.956 -2.140  0.50 55.59 ? 185 HIS A CG  1 
ATOM   1081 C CG  B HIS A 1 155 ? 36.071 30.118 -1.166  0.50 56.57 ? 185 HIS A CG  1 
ATOM   1082 N ND1 A HIS A 1 155 ? 33.642 30.950 -2.968  0.50 58.55 ? 185 HIS A ND1 1 
ATOM   1083 N ND1 B HIS A 1 155 ? 36.880 29.256 -0.456  0.50 60.21 ? 185 HIS A ND1 1 
ATOM   1084 C CD2 A HIS A 1 155 ? 35.787 31.369 -2.904  0.50 58.42 ? 185 HIS A CD2 1 
ATOM   1085 C CD2 B HIS A 1 155 ? 36.789 30.503 -2.248  0.50 58.11 ? 185 HIS A CD2 1 
ATOM   1086 C CE1 A HIS A 1 155 ? 33.993 31.371 -4.171  0.50 54.94 ? 185 HIS A CE1 1 
ATOM   1087 C CE1 B HIS A 1 155 ? 38.035 29.122 -1.084  0.50 60.34 ? 185 HIS A CE1 1 
ATOM   1088 N NE2 A HIS A 1 155 ? 35.288 31.638 -4.157  0.50 58.79 ? 185 HIS A NE2 1 
ATOM   1089 N NE2 B HIS A 1 155 ? 38.005 29.868 -2.174  0.50 59.49 ? 185 HIS A NE2 1 
ATOM   1090 N N   . TYR A 1 156 ? 33.593 33.747 0.688   1.00 41.44 ? 186 TYR A N   1 
ATOM   1091 C CA  . TYR A 1 156 ? 32.475 34.696 0.785   1.00 37.51 ? 186 TYR A CA  1 
ATOM   1092 C C   . TYR A 1 156 ? 32.345 35.582 -0.453  1.00 36.50 ? 186 TYR A C   1 
ATOM   1093 O O   . TYR A 1 156 ? 31.507 36.472 -0.497  1.00 37.81 ? 186 TYR A O   1 
ATOM   1094 C CB  . TYR A 1 156 ? 32.623 35.576 2.041   1.00 35.38 ? 186 TYR A CB  1 
ATOM   1095 C CG  . TYR A 1 156 ? 33.906 36.392 2.056   1.00 32.44 ? 186 TYR A CG  1 
ATOM   1096 C CD1 . TYR A 1 156 ? 33.984 37.627 1.397   1.00 31.46 ? 186 TYR A CD1 1 
ATOM   1097 C CD2 . TYR A 1 156 ? 35.051 35.911 2.704   1.00 33.92 ? 186 TYR A CD2 1 
ATOM   1098 C CE1 . TYR A 1 156 ? 35.168 38.387 1.400   1.00 32.35 ? 186 TYR A CE1 1 
ATOM   1099 C CE2 . TYR A 1 156 ? 36.251 36.664 2.718   1.00 33.26 ? 186 TYR A CE2 1 
ATOM   1100 C CZ  . TYR A 1 156 ? 36.294 37.893 2.064   1.00 33.03 ? 186 TYR A CZ  1 
ATOM   1101 O OH  . TYR A 1 156 ? 37.473 38.622 2.063   1.00 33.69 ? 186 TYR A OH  1 
ATOM   1102 N N   . TRP A 1 157 ? 33.192 35.359 -1.449  1.00 35.37 ? 187 TRP A N   1 
ATOM   1103 C CA  . TRP A 1 157 ? 33.071 36.061 -2.721  1.00 37.12 ? 187 TRP A CA  1 
ATOM   1104 C C   . TRP A 1 157 ? 32.686 35.013 -3.773  1.00 38.92 ? 187 TRP A C   1 
ATOM   1105 O O   . TRP A 1 157 ? 32.920 33.819 -3.563  1.00 38.99 ? 187 TRP A O   1 
ATOM   1106 C CB  . TRP A 1 157 ? 34.393 36.764 -3.075  1.00 37.89 ? 187 TRP A CB  1 
ATOM   1107 C CG  . TRP A 1 157 ? 35.508 35.795 -3.230  1.00 37.41 ? 187 TRP A CG  1 
ATOM   1108 C CD1 . TRP A 1 157 ? 35.888 35.155 -4.385  1.00 42.53 ? 187 TRP A CD1 1 
ATOM   1109 C CD2 . TRP A 1 157 ? 36.364 35.299 -2.193  1.00 39.01 ? 187 TRP A CD2 1 
ATOM   1110 N NE1 . TRP A 1 157 ? 36.934 34.298 -4.124  1.00 39.32 ? 187 TRP A NE1 1 
ATOM   1111 C CE2 . TRP A 1 157 ? 37.250 34.372 -2.789  1.00 39.48 ? 187 TRP A CE2 1 
ATOM   1112 C CE3 . TRP A 1 157 ? 36.472 35.550 -0.816  1.00 37.02 ? 187 TRP A CE3 1 
ATOM   1113 C CZ2 . TRP A 1 157 ? 38.232 33.698 -2.056  1.00 38.29 ? 187 TRP A CZ2 1 
ATOM   1114 C CZ3 . TRP A 1 157 ? 37.445 34.880 -0.088  1.00 38.96 ? 187 TRP A CZ3 1 
ATOM   1115 C CH2 . TRP A 1 157 ? 38.311 33.961 -0.712  1.00 40.81 ? 187 TRP A CH2 1 
ATOM   1116 N N   . PRO A 1 158 ? 32.096 35.442 -4.901  1.00 40.30 ? 188 PRO A N   1 
ATOM   1117 C CA  . PRO A 1 158 ? 31.593 34.461 -5.845  1.00 41.21 ? 188 PRO A CA  1 
ATOM   1118 C C   . PRO A 1 158 ? 32.643 34.008 -6.852  1.00 42.14 ? 188 PRO A C   1 
ATOM   1119 O O   . PRO A 1 158 ? 33.696 34.642 -7.000  1.00 41.12 ? 188 PRO A O   1 
ATOM   1120 C CB  . PRO A 1 158 ? 30.496 35.240 -6.570  1.00 42.39 ? 188 PRO A CB  1 
ATOM   1121 C CG  . PRO A 1 158 ? 31.044 36.605 -6.650  1.00 41.54 ? 188 PRO A CG  1 
ATOM   1122 C CD  . PRO A 1 158 ? 31.824 36.818 -5.366  1.00 41.36 ? 188 PRO A CD  1 
ATOM   1123 N N   . THR A 1 159 ? 32.343 32.923 -7.555  1.00 43.35 ? 189 THR A N   1 
ATOM   1124 C CA  . THR A 1 159 ? 33.180 32.485 -8.662  1.00 44.74 ? 189 THR A CA  1 
ATOM   1125 C C   . THR A 1 159 ? 32.975 33.380 -9.888  1.00 43.46 ? 189 THR A C   1 
ATOM   1126 O O   . THR A 1 159 ? 33.943 33.747 -10.563 1.00 43.20 ? 189 THR A O   1 
ATOM   1127 C CB  . THR A 1 159 ? 32.946 30.984 -8.967  1.00 47.35 ? 189 THR A CB  1 
ATOM   1128 O OG1 . THR A 1 159 ? 33.793 30.217 -8.103  1.00 51.24 ? 189 THR A OG1 1 
ATOM   1129 C CG2 . THR A 1 159 ? 33.269 30.632 -10.424 1.00 47.88 ? 189 THR A CG2 1 
ATOM   1130 N N   . GLU A 1 160 ? 31.717 33.734 -10.151 1.00 41.38 ? 190 GLU A N   1 
ATOM   1131 C CA  . GLU A 1 160 ? 31.366 34.653 -11.228 1.00 40.87 ? 190 GLU A CA  1 
ATOM   1132 C C   . GLU A 1 160 ? 30.466 35.790 -10.700 1.00 40.54 ? 190 GLU A C   1 
ATOM   1133 O O   . GLU A 1 160 ? 30.834 36.968 -10.770 1.00 40.30 ? 190 GLU A O   1 
ATOM   1134 C CB  . GLU A 1 160 ? 30.695 33.889 -12.379 1.00 41.78 ? 190 GLU A CB  1 
ATOM   1135 C CG  . GLU A 1 160 ? 30.331 34.742 -13.594 1.00 45.47 ? 190 GLU A CG  1 
ATOM   1136 N N   . GLU A 1 161 ? 29.304 35.428 -10.159 1.00 38.66 ? 191 GLU A N   1 
ATOM   1137 C CA  . GLU A 1 161 ? 28.332 36.397 -9.668  1.00 39.02 ? 191 GLU A CA  1 
ATOM   1138 C C   . GLU A 1 161 ? 27.455 35.720 -8.619  1.00 39.56 ? 191 GLU A C   1 
ATOM   1139 O O   . GLU A 1 161 ? 27.053 34.573 -8.799  1.00 40.26 ? 191 GLU A O   1 
ATOM   1140 C CB  . GLU A 1 161 ? 27.480 36.929 -10.839 1.00 39.00 ? 191 GLU A CB  1 
ATOM   1141 C CG  . GLU A 1 161 ? 26.254 37.765 -10.462 1.00 39.16 ? 191 GLU A CG  1 
ATOM   1142 C CD  . GLU A 1 161 ? 25.615 38.461 -11.673 1.00 41.66 ? 191 GLU A CD  1 
ATOM   1143 N N   . GLU A 1 162 ? 27.188 36.410 -7.515  1.00 36.63 ? 192 GLU A N   1 
ATOM   1144 C CA  . GLU A 1 162 ? 26.249 35.921 -6.504  1.00 37.49 ? 192 GLU A CA  1 
ATOM   1145 C C   . GLU A 1 162 ? 25.598 37.088 -5.794  1.00 37.52 ? 192 GLU A C   1 
ATOM   1146 O O   . GLU A 1 162 ? 26.119 38.200 -5.797  1.00 37.61 ? 192 GLU A O   1 
ATOM   1147 C CB  . GLU A 1 162 ? 26.945 35.028 -5.460  1.00 38.59 ? 192 GLU A CB  1 
ATOM   1148 N N   . THR A 1 163 ? 24.466 36.814 -5.164  1.00 39.14 ? 193 THR A N   1 
ATOM   1149 C CA  . THR A 1 163 ? 23.748 37.792 -4.370  1.00 40.49 ? 193 THR A CA  1 
ATOM   1150 C C   . THR A 1 163 ? 23.919 37.445 -2.884  1.00 39.67 ? 193 THR A C   1 
ATOM   1151 O O   . THR A 1 163 ? 23.805 36.283 -2.498  1.00 40.12 ? 193 THR A O   1 
ATOM   1152 C CB  . THR A 1 163 ? 22.271 37.796 -4.797  1.00 42.42 ? 193 THR A CB  1 
ATOM   1153 O OG1 . THR A 1 163 ? 22.173 38.406 -6.091  1.00 51.22 ? 193 THR A OG1 1 
ATOM   1154 C CG2 . THR A 1 163 ? 21.404 38.574 -3.827  1.00 47.88 ? 193 THR A CG2 1 
ATOM   1155 N N   . TYR A 1 164 ? 24.247 38.440 -2.064  1.00 36.95 ? 194 TYR A N   1 
ATOM   1156 C CA  . TYR A 1 164 ? 24.348 38.253 -0.609  1.00 35.73 ? 194 TYR A CA  1 
ATOM   1157 C C   . TYR A 1 164 ? 23.440 39.270 0.065   1.00 37.34 ? 194 TYR A C   1 
ATOM   1158 O O   . TYR A 1 164 ? 23.743 40.468 0.087   1.00 37.85 ? 194 TYR A O   1 
ATOM   1159 C CB  . TYR A 1 164 ? 25.789 38.427 -0.135  1.00 35.38 ? 194 TYR A CB  1 
ATOM   1160 C CG  . TYR A 1 164 ? 26.782 37.547 -0.863  1.00 32.48 ? 194 TYR A CG  1 
ATOM   1161 C CD1 . TYR A 1 164 ? 27.109 36.284 -0.383  1.00 35.81 ? 194 TYR A CD1 1 
ATOM   1162 C CD2 . TYR A 1 164 ? 27.386 37.979 -2.035  1.00 39.50 ? 194 TYR A CD2 1 
ATOM   1163 C CE1 . TYR A 1 164 ? 28.030 35.473 -1.053  1.00 35.41 ? 194 TYR A CE1 1 
ATOM   1164 C CE2 . TYR A 1 164 ? 28.297 37.180 -2.718  1.00 38.90 ? 194 TYR A CE2 1 
ATOM   1165 C CZ  . TYR A 1 164 ? 28.614 35.930 -2.218  1.00 38.42 ? 194 TYR A CZ  1 
ATOM   1166 O OH  . TYR A 1 164 ? 29.521 35.155 -2.896  1.00 37.29 ? 194 TYR A OH  1 
ATOM   1167 N N   . GLY A 1 165 ? 22.313 38.799 0.592   1.00 36.70 ? 195 GLY A N   1 
ATOM   1168 C CA  . GLY A 1 165 ? 21.284 39.701 1.068   1.00 36.55 ? 195 GLY A CA  1 
ATOM   1169 C C   . GLY A 1 165 ? 20.867 40.575 -0.104  1.00 36.61 ? 195 GLY A C   1 
ATOM   1170 O O   . GLY A 1 165 ? 20.599 40.059 -1.189  1.00 37.45 ? 195 GLY A O   1 
ATOM   1171 N N   . PRO A 1 166 ? 20.859 41.908 0.089   1.00 36.51 ? 196 PRO A N   1 
ATOM   1172 C CA  . PRO A 1 166 ? 20.465 42.832 -0.969  1.00 35.16 ? 196 PRO A CA  1 
ATOM   1173 C C   . PRO A 1 166 ? 21.560 43.152 -2.003  1.00 34.48 ? 196 PRO A C   1 
ATOM   1174 O O   . PRO A 1 166 ? 21.290 43.893 -2.962  1.00 35.74 ? 196 PRO A O   1 
ATOM   1175 C CB  . PRO A 1 166 ? 20.086 44.096 -0.187  1.00 35.89 ? 196 PRO A CB  1 
ATOM   1176 C CG  . PRO A 1 166 ? 20.988 44.086 0.969   1.00 34.05 ? 196 PRO A CG  1 
ATOM   1177 C CD  . PRO A 1 166 ? 21.222 42.622 1.327   1.00 36.63 ? 196 PRO A CD  1 
ATOM   1178 N N   . PHE A 1 167 ? 22.761 42.600 -1.836  1.00 32.44 ? 197 PHE A N   1 
ATOM   1179 C CA  . PHE A 1 167 ? 23.907 42.989 -2.671  1.00 33.14 ? 197 PHE A CA  1 
ATOM   1180 C C   . PHE A 1 167 ? 24.206 41.991 -3.769  1.00 34.95 ? 197 PHE A C   1 
ATOM   1181 O O   . PHE A 1 167 ? 24.200 40.789 -3.521  1.00 37.67 ? 197 PHE A O   1 
ATOM   1182 C CB  . PHE A 1 167 ? 25.163 43.213 -1.804  1.00 31.98 ? 197 PHE A CB  1 
ATOM   1183 C CG  . PHE A 1 167 ? 24.952 44.199 -0.712  1.00 33.01 ? 197 PHE A CG  1 
ATOM   1184 C CD1 . PHE A 1 167 ? 24.807 45.545 -1.002  1.00 28.63 ? 197 PHE A CD1 1 
ATOM   1185 C CD2 . PHE A 1 167 ? 24.873 43.784 0.614   1.00 31.94 ? 197 PHE A CD2 1 
ATOM   1186 C CE1 . PHE A 1 167 ? 24.571 46.479 0.011   1.00 33.90 ? 197 PHE A CE1 1 
ATOM   1187 C CE2 . PHE A 1 167 ? 24.630 44.704 1.636   1.00 30.52 ? 197 PHE A CE2 1 
ATOM   1188 C CZ  . PHE A 1 167 ? 24.487 46.049 1.345   1.00 35.38 ? 197 PHE A CZ  1 
ATOM   1189 N N   . GLN A 1 168 ? 24.455 42.482 -4.984  1.00 33.07 ? 198 GLN A N   1 
ATOM   1190 C CA  . GLN A 1 168 ? 24.981 41.622 -6.034  1.00 33.10 ? 198 GLN A CA  1 
ATOM   1191 C C   . GLN A 1 168 ? 26.479 41.821 -6.175  1.00 32.75 ? 198 GLN A C   1 
ATOM   1192 O O   . GLN A 1 168 ? 26.937 42.942 -6.378  1.00 32.68 ? 198 GLN A O   1 
ATOM   1193 C CB  . GLN A 1 168 ? 24.305 41.894 -7.376  1.00 33.60 ? 198 GLN A CB  1 
ATOM   1194 C CG  . GLN A 1 168 ? 24.957 41.093 -8.480  1.00 40.63 ? 198 GLN A CG  1 
ATOM   1195 C CD  . GLN A 1 168 ? 24.129 41.040 -9.725  1.00 51.93 ? 198 GLN A CD  1 
ATOM   1196 O OE1 . GLN A 1 168 ? 23.589 39.991 -10.069 1.00 59.42 ? 198 GLN A OE1 1 
ATOM   1197 N NE2 . GLN A 1 168 ? 24.015 42.170 -10.416 1.00 51.44 ? 198 GLN A NE2 1 
ATOM   1198 N N   . ILE A 1 169 ? 27.238 40.729 -6.064  1.00 31.87 ? 199 ILE A N   1 
ATOM   1199 C CA  . ILE A 1 169 ? 28.686 40.773 -6.174  1.00 31.99 ? 199 ILE A CA  1 
ATOM   1200 C C   . ILE A 1 169 ? 29.101 40.034 -7.439  1.00 33.03 ? 199 ILE A C   1 
ATOM   1201 O O   . ILE A 1 169 ? 28.637 38.916 -7.681  1.00 33.12 ? 199 ILE A O   1 
ATOM   1202 C CB  . ILE A 1 169 ? 29.373 40.098 -4.951  1.00 34.09 ? 199 ILE A CB  1 
ATOM   1203 C CG1 . ILE A 1 169 ? 28.787 40.615 -3.628  1.00 41.51 ? 199 ILE A CG1 1 
ATOM   1204 C CG2 . ILE A 1 169 ? 30.900 40.257 -5.027  1.00 32.52 ? 199 ILE A CG2 1 
ATOM   1205 C CD1 . ILE A 1 169 ? 29.485 41.799 -3.043  1.00 47.95 ? 199 ILE A CD1 1 
ATOM   1206 N N   . ARG A 1 170 ? 29.969 40.665 -8.232  1.00 32.02 ? 200 ARG A N   1 
ATOM   1207 C CA  . ARG A 1 170 ? 30.496 40.078 -9.455  1.00 34.87 ? 200 ARG A CA  1 
ATOM   1208 C C   . ARG A 1 170 ? 32.009 40.168 -9.449  1.00 34.30 ? 200 ARG A C   1 
ATOM   1209 O O   . ARG A 1 170 ? 32.563 41.135 -8.940  1.00 34.75 ? 200 ARG A O   1 
ATOM   1210 C CB  . ARG A 1 170 ? 29.974 40.810 -10.701 1.00 34.54 ? 200 ARG A CB  1 
ATOM   1211 C CG  . ARG A 1 170 ? 28.475 40.729 -10.904 1.00 38.76 ? 200 ARG A CG  1 
ATOM   1212 C CD  . ARG A 1 170 ? 28.034 41.321 -12.260 1.00 39.62 ? 200 ARG A CD  1 
ATOM   1213 N N   . ILE A 1 171 ? 32.671 39.170 -10.035 1.00 33.68 ? 201 ILE A N   1 
ATOM   1214 C CA  . ILE A 1 171 ? 34.117 39.209 -10.207 1.00 34.15 ? 201 ILE A CA  1 
ATOM   1215 C C   . ILE A 1 171 ? 34.428 39.725 -11.610 1.00 34.44 ? 201 ILE A C   1 
ATOM   1216 O O   . ILE A 1 171 ? 33.987 39.141 -12.606 1.00 33.29 ? 201 ILE A O   1 
ATOM   1217 C CB  . ILE A 1 171 ? 34.793 37.819 -9.908  1.00 34.76 ? 201 ILE A CB  1 
ATOM   1218 C CG1 . ILE A 1 171 ? 36.295 37.897 -10.117 1.00 35.71 ? 201 ILE A CG1 1 
ATOM   1219 C CG2 . ILE A 1 171 ? 34.251 36.748 -10.803 1.00 42.49 ? 201 ILE A CG2 1 
ATOM   1220 C CD1 . ILE A 1 171 ? 37.083 36.862 -9.317  1.00 47.13 ? 201 ILE A CD1 1 
ATOM   1221 N N   . GLN A 1 172 ? 35.141 40.845 -11.688 1.00 33.74 ? 202 GLN A N   1 
ATOM   1222 C CA  . GLN A 1 172 ? 35.507 41.429 -12.983 1.00 37.97 ? 202 GLN A CA  1 
ATOM   1223 C C   . GLN A 1 172 ? 36.829 40.878 -13.499 1.00 39.51 ? 202 GLN A C   1 
ATOM   1224 O O   . GLN A 1 172 ? 37.027 40.763 -14.707 1.00 39.18 ? 202 GLN A O   1 
ATOM   1225 C CB  . GLN A 1 172 ? 35.570 42.958 -12.913 1.00 38.84 ? 202 GLN A CB  1 
ATOM   1226 C CG  . GLN A 1 172 ? 34.363 43.614 -12.234 1.00 44.26 ? 202 GLN A CG  1 
ATOM   1227 N N   . ASP A 1 173 ? 37.726 40.522 -12.582 1.00 39.44 ? 203 ASP A N   1 
ATOM   1228 C CA  . ASP A 1 173 ? 39.080 40.080 -12.934 1.00 40.74 ? 203 ASP A CA  1 
ATOM   1229 C C   . ASP A 1 173 ? 39.727 39.340 -11.774 1.00 39.51 ? 203 ASP A C   1 
ATOM   1230 O O   . ASP A 1 173 ? 39.420 39.609 -10.609 1.00 32.84 ? 203 ASP A O   1 
ATOM   1231 C CB  . ASP A 1 173 ? 39.941 41.291 -13.299 1.00 42.70 ? 203 ASP A CB  1 
ATOM   1232 C CG  . ASP A 1 173 ? 41.250 40.902 -13.965 1.00 54.86 ? 203 ASP A CG  1 
ATOM   1233 O OD1 . ASP A 1 173 ? 42.107 40.242 -13.298 1.00 64.74 ? 203 ASP A OD1 1 
ATOM   1234 O OD2 . ASP A 1 173 ? 41.429 41.277 -15.159 1.00 65.30 ? 203 ASP A OD2 1 
ATOM   1235 N N   . MET A 1 174 ? 40.619 38.407 -12.107 1.00 39.60 ? 204 MET A N   1 
ATOM   1236 C CA  . MET A 1 174 ? 41.424 37.681 -11.129 1.00 40.60 ? 204 MET A CA  1 
ATOM   1237 C C   . MET A 1 174 ? 42.853 37.545 -11.656 1.00 40.87 ? 204 MET A C   1 
ATOM   1238 O O   . MET A 1 174 ? 43.076 37.072 -12.774 1.00 39.58 ? 204 MET A O   1 
ATOM   1239 C CB  . MET A 1 174 ? 40.794 36.317 -10.820 1.00 40.55 ? 204 MET A CB  1 
ATOM   1240 C CG  . MET A 1 174 ? 41.423 35.581 -9.639  1.00 42.92 ? 204 MET A CG  1 
ATOM   1241 S SD  A MET A 1 174 ? 40.646 34.022 -9.189  0.50 44.31 ? 204 MET A SD  1 
ATOM   1242 S SD  B MET A 1 174 ? 42.736 34.443 -10.091 0.50 52.58 ? 204 MET A SD  1 
ATOM   1243 C CE  A MET A 1 174 ? 40.879 33.033 -10.668 0.50 41.49 ? 204 MET A CE  1 
ATOM   1244 C CE  B MET A 1 174 ? 42.391 33.081 -8.976  0.50 49.59 ? 204 MET A CE  1 
ATOM   1245 N N   . LYS A 1 175 ? 43.812 37.990 -10.860 1.00 41.11 ? 205 LYS A N   1 
ATOM   1246 C CA  . LYS A 1 175 ? 45.219 38.002 -11.242 1.00 43.01 ? 205 LYS A CA  1 
ATOM   1247 C C   . LYS A 1 175 ? 46.059 37.317 -10.149 1.00 44.12 ? 205 LYS A C   1 
ATOM   1248 O O   . LYS A 1 175 ? 46.068 37.764 -8.993  1.00 39.72 ? 205 LYS A O   1 
ATOM   1249 C CB  . LYS A 1 175 ? 45.669 39.456 -11.428 1.00 43.43 ? 205 LYS A CB  1 
ATOM   1250 C CG  . LYS A 1 175 ? 47.133 39.650 -11.777 1.00 48.26 ? 205 LYS A CG  1 
ATOM   1251 C CD  . LYS A 1 175 ? 47.601 41.065 -11.426 1.00 53.62 ? 205 LYS A CD  1 
ATOM   1252 N N   . GLU A 1 176 ? 46.750 36.237 -10.513 1.00 44.13 ? 206 GLU A N   1 
ATOM   1253 C CA  . GLU A 1 176 ? 47.633 35.538 -9.578  1.00 47.84 ? 206 GLU A CA  1 
ATOM   1254 C C   . GLU A 1 176 ? 49.043 36.108 -9.627  1.00 49.72 ? 206 GLU A C   1 
ATOM   1255 O O   . GLU A 1 176 ? 49.723 36.010 -10.642 1.00 51.43 ? 206 GLU A O   1 
ATOM   1256 C CB  . GLU A 1 176 ? 47.660 34.029 -9.859  1.00 48.40 ? 206 GLU A CB  1 
ATOM   1257 C CG  . GLU A 1 176 ? 46.411 33.294 -9.381  1.00 53.07 ? 206 GLU A CG  1 
ATOM   1258 N N   . CYS A 1 177 ? 49.470 36.721 -8.531  1.00 50.98 ? 207 CYS A N   1 
ATOM   1259 C CA  . CYS A 1 177 ? 50.838 37.190 -8.387  1.00 51.84 ? 207 CYS A CA  1 
ATOM   1260 C C   . CYS A 1 177 ? 51.604 36.137 -7.581  1.00 53.27 ? 207 CYS A C   1 
ATOM   1261 O O   . CYS A 1 177 ? 50.976 35.273 -6.952  1.00 51.71 ? 207 CYS A O   1 
ATOM   1262 C CB  . CYS A 1 177 ? 50.857 38.573 -7.729  1.00 52.20 ? 207 CYS A CB  1 
ATOM   1263 S SG  A CYS A 1 177 ? 49.828 39.822 -8.542  0.50 50.52 ? 207 CYS A SG  1 
ATOM   1264 S SG  B CYS A 1 177 ? 52.102 38.835 -6.456  0.50 54.28 ? 207 CYS A SG  1 
ATOM   1265 N N   . PRO A 1 178 ? 52.958 36.158 -7.641  1.00 54.93 ? 208 PRO A N   1 
ATOM   1266 C CA  . PRO A 1 178 ? 53.757 35.178 -6.897  1.00 53.12 ? 208 PRO A CA  1 
ATOM   1267 C C   . PRO A 1 178 ? 53.293 34.915 -5.465  1.00 50.91 ? 208 PRO A C   1 
ATOM   1268 O O   . PRO A 1 178 ? 53.292 33.766 -5.033  1.00 51.37 ? 208 PRO A O   1 
ATOM   1269 C CB  . PRO A 1 178 ? 55.159 35.795 -6.912  1.00 53.29 ? 208 PRO A CB  1 
ATOM   1270 C CG  . PRO A 1 178 ? 55.220 36.490 -8.226  1.00 55.57 ? 208 PRO A CG  1 
ATOM   1271 C CD  . PRO A 1 178 ? 53.824 37.051 -8.445  1.00 56.66 ? 208 PRO A CD  1 
ATOM   1272 N N   . GLU A 1 179 ? 52.855 35.956 -4.755  1.00 46.59 ? 209 GLU A N   1 
ATOM   1273 C CA  . GLU A 1 179 ? 52.631 35.846 -3.321  1.00 42.43 ? 209 GLU A CA  1 
ATOM   1274 C C   . GLU A 1 179 ? 51.198 36.161 -2.864  1.00 39.09 ? 209 GLU A C   1 
ATOM   1275 O O   . GLU A 1 179 ? 50.844 35.974 -1.697  1.00 37.08 ? 209 GLU A O   1 
ATOM   1276 C CB  . GLU A 1 179 ? 53.652 36.716 -2.595  1.00 43.58 ? 209 GLU A CB  1 
ATOM   1277 C CG  . GLU A 1 179 ? 55.093 36.186 -2.773  1.00 44.63 ? 209 GLU A CG  1 
ATOM   1278 C CD  . GLU A 1 179 ? 56.088 37.271 -3.129  1.00 41.23 ? 209 GLU A CD  1 
ATOM   1279 O OE1 . GLU A 1 179 ? 55.684 38.452 -3.249  1.00 35.71 ? 209 GLU A OE1 1 
ATOM   1280 O OE2 . GLU A 1 179 ? 57.282 36.943 -3.274  1.00 41.07 ? 209 GLU A OE2 1 
ATOM   1281 N N   . TYR A 1 180 ? 50.366 36.608 -3.795  1.00 35.92 ? 210 TYR A N   1 
ATOM   1282 C CA  . TYR A 1 180 ? 48.974 36.894 -3.466  1.00 34.53 ? 210 TYR A CA  1 
ATOM   1283 C C   . TYR A 1 180 ? 48.156 36.923 -4.744  1.00 33.32 ? 210 TYR A C   1 
ATOM   1284 O O   . TYR A 1 180 ? 48.719 36.977 -5.841  1.00 33.60 ? 210 TYR A O   1 
ATOM   1285 C CB  . TYR A 1 180 ? 48.860 38.212 -2.690  1.00 33.18 ? 210 TYR A CB  1 
ATOM   1286 C CG  . TYR A 1 180 ? 49.591 39.368 -3.326  1.00 35.57 ? 210 TYR A CG  1 
ATOM   1287 C CD1 . TYR A 1 180 ? 49.042 40.052 -4.411  1.00 33.61 ? 210 TYR A CD1 1 
ATOM   1288 C CD2 . TYR A 1 180 ? 50.840 39.782 -2.835  1.00 36.41 ? 210 TYR A CD2 1 
ATOM   1289 C CE1 . TYR A 1 180 ? 49.713 41.112 -5.002  1.00 36.91 ? 210 TYR A CE1 1 
ATOM   1290 C CE2 . TYR A 1 180 ? 51.524 40.838 -3.419  1.00 40.94 ? 210 TYR A CE2 1 
ATOM   1291 C CZ  . TYR A 1 180 ? 50.956 41.499 -4.500  1.00 37.20 ? 210 TYR A CZ  1 
ATOM   1292 O OH  . TYR A 1 180 ? 51.632 42.553 -5.068  1.00 40.69 ? 210 TYR A OH  1 
ATOM   1293 N N   . THR A 1 181 ? 46.836 36.845 -4.584  1.00 30.89 ? 211 THR A N   1 
ATOM   1294 C CA  . THR A 1 181 ? 45.897 36.884 -5.691  1.00 31.07 ? 211 THR A CA  1 
ATOM   1295 C C   . THR A 1 181 ? 45.089 38.150 -5.566  1.00 31.56 ? 211 THR A C   1 
ATOM   1296 O O   . THR A 1 181 ? 44.552 38.441 -4.494  1.00 28.36 ? 211 THR A O   1 
ATOM   1297 C CB  . THR A 1 181 ? 44.931 35.671 -5.660  1.00 33.08 ? 211 THR A CB  1 
ATOM   1298 O OG1 . THR A 1 181 ? 45.684 34.455 -5.717  1.00 38.55 ? 211 THR A OG1 1 
ATOM   1299 C CG2 . THR A 1 181 ? 43.947 35.718 -6.845  1.00 32.14 ? 211 THR A CG2 1 
ATOM   1300 N N   . VAL A 1 182 ? 44.992 38.899 -6.663  1.00 29.76 ? 212 VAL A N   1 
ATOM   1301 C CA  . VAL A 1 182 ? 44.171 40.108 -6.680  1.00 30.99 ? 212 VAL A CA  1 
ATOM   1302 C C   . VAL A 1 182 ? 42.895 39.852 -7.472  1.00 31.68 ? 212 VAL A C   1 
ATOM   1303 O O   . VAL A 1 182 ? 42.951 39.429 -8.632  1.00 30.25 ? 212 VAL A O   1 
ATOM   1304 C CB  . VAL A 1 182 ? 44.921 41.313 -7.287  1.00 31.43 ? 212 VAL A CB  1 
ATOM   1305 C CG1 . VAL A 1 182 ? 44.031 42.553 -7.284  1.00 32.19 ? 212 VAL A CG1 1 
ATOM   1306 C CG2 . VAL A 1 182 ? 46.214 41.582 -6.523  1.00 31.66 ? 212 VAL A CG2 1 
ATOM   1307 N N   . ARG A 1 183 ? 41.748 40.074 -6.824  1.00 30.61 ? 213 ARG A N   1 
ATOM   1308 C CA  . ARG A 1 183 ? 40.455 39.995 -7.488  1.00 30.13 ? 213 ARG A CA  1 
ATOM   1309 C C   . ARG A 1 183 ? 39.843 41.376 -7.544  1.00 31.62 ? 213 ARG A C   1 
ATOM   1310 O O   . ARG A 1 183 ? 39.825 42.106 -6.549  1.00 31.08 ? 213 ARG A O   1 
ATOM   1311 C CB  . ARG A 1 183 ? 39.487 39.048 -6.764  1.00 30.35 ? 213 ARG A CB  1 
ATOM   1312 C CG  . ARG A 1 183 ? 39.821 37.594 -6.911  1.00 33.71 ? 213 ARG A CG  1 
ATOM   1313 C CD  . ARG A 1 183 ? 39.003 36.745 -5.975  1.00 35.26 ? 213 ARG A CD  1 
ATOM   1314 N NE  . ARG A 1 183 ? 39.197 35.317 -6.222  1.00 37.68 ? 213 ARG A NE  1 
ATOM   1315 C CZ  . ARG A 1 183 ? 40.113 34.545 -5.633  1.00 42.31 ? 213 ARG A CZ  1 
ATOM   1316 N NH1 . ARG A 1 183 ? 40.976 35.039 -4.752  1.00 38.13 ? 213 ARG A NH1 1 
ATOM   1317 N NH2 . ARG A 1 183 ? 40.170 33.259 -5.940  1.00 44.65 ? 213 ARG A NH2 1 
ATOM   1318 N N   . GLN A 1 184 ? 39.351 41.736 -8.721  1.00 30.17 ? 214 GLN A N   1 
ATOM   1319 C CA  . GLN A 1 184 ? 38.573 42.954 -8.876  1.00 30.24 ? 214 GLN A CA  1 
ATOM   1320 C C   . GLN A 1 184 ? 37.107 42.568 -8.834  1.00 31.14 ? 214 GLN A C   1 
ATOM   1321 O O   . GLN A 1 184 ? 36.633 41.797 -9.673  1.00 31.45 ? 214 GLN A O   1 
ATOM   1322 C CB  . GLN A 1 184 ? 38.928 43.652 -10.197 1.00 30.68 ? 214 GLN A CB  1 
ATOM   1323 C CG  . GLN A 1 184 ? 40.323 44.280 -10.176 1.00 35.52 ? 214 GLN A CG  1 
ATOM   1324 C CD  . GLN A 1 184 ? 40.412 45.515 -9.274  1.00 40.06 ? 214 GLN A CD  1 
ATOM   1325 O OE1 . GLN A 1 184 ? 39.393 46.059 -8.824  1.00 45.28 ? 214 GLN A OE1 1 
ATOM   1326 N NE2 . GLN A 1 184 ? 41.637 45.970 -9.021  1.00 43.27 ? 214 GLN A NE2 1 
ATOM   1327 N N   . LEU A 1 185 ? 36.396 43.096 -7.843  1.00 30.97 ? 215 LEU A N   1 
ATOM   1328 C CA  . LEU A 1 185 ? 34.993 42.781 -7.645  1.00 29.24 ? 215 LEU A CA  1 
ATOM   1329 C C   . LEU A 1 185 ? 34.183 44.058 -7.838  1.00 29.84 ? 215 LEU A C   1 
ATOM   1330 O O   . LEU A 1 185 ? 34.728 45.170 -7.785  1.00 29.14 ? 215 LEU A O   1 
ATOM   1331 C CB  . LEU A 1 185 ? 34.742 42.270 -6.211  1.00 30.89 ? 215 LEU A CB  1 
ATOM   1332 C CG  . LEU A 1 185 ? 35.600 41.129 -5.645  1.00 35.61 ? 215 LEU A CG  1 
ATOM   1333 C CD1 . LEU A 1 185 ? 35.310 40.918 -4.186  1.00 34.66 ? 215 LEU A CD1 1 
ATOM   1334 C CD2 . LEU A 1 185 ? 35.356 39.836 -6.431  1.00 34.31 ? 215 LEU A CD2 1 
ATOM   1335 N N   . THR A 1 186 ? 32.880 43.885 -8.037  1.00 28.57 ? 216 THR A N   1 
ATOM   1336 C CA  . THR A 1 186 ? 31.927 44.984 -7.903  1.00 29.75 ? 216 THR A CA  1 
ATOM   1337 C C   . THR A 1 186 ? 30.820 44.572 -6.948  1.00 29.28 ? 216 THR A C   1 
ATOM   1338 O O   . THR A 1 186 ? 30.458 43.390 -6.866  1.00 31.73 ? 216 THR A O   1 
ATOM   1339 C CB  . THR A 1 186 ? 31.306 45.414 -9.260  1.00 29.77 ? 216 THR A CB  1 
ATOM   1340 O OG1 . THR A 1 186 ? 30.665 44.292 -9.883  1.00 31.32 ? 216 THR A OG1 1 
ATOM   1341 C CG2 . THR A 1 186 ? 32.368 45.995 -10.185 1.00 30.72 ? 216 THR A CG2 1 
ATOM   1342 N N   . ILE A 1 187 ? 30.284 45.550 -6.221  1.00 26.96 ? 217 ILE A N   1 
ATOM   1343 C CA  . ILE A 1 187 ? 29.158 45.314 -5.364  1.00 24.08 ? 217 ILE A CA  1 
ATOM   1344 C C   . ILE A 1 187 ? 28.068 46.296 -5.734  1.00 25.23 ? 217 ILE A C   1 
ATOM   1345 O O   . ILE A 1 187 ? 28.330 47.505 -5.892  1.00 24.38 ? 217 ILE A O   1 
ATOM   1346 C CB  . ILE A 1 187 ? 29.555 45.421 -3.851  1.00 24.30 ? 217 ILE A CB  1 
ATOM   1347 C CG1 . ILE A 1 187 ? 28.324 45.268 -2.950  1.00 24.92 ? 217 ILE A CG1 1 
ATOM   1348 C CG2 . ILE A 1 187 ? 30.280 46.744 -3.547  1.00 26.10 ? 217 ILE A CG2 1 
ATOM   1349 C CD1 . ILE A 1 187 ? 28.674 45.234 -1.417  1.00 25.02 ? 217 ILE A CD1 1 
ATOM   1350 N N   . GLN A 1 188 ? 26.857 45.778 -5.939  1.00 25.24 ? 218 GLN A N   1 
ATOM   1351 C CA  . GLN A 1 188 ? 25.759 46.626 -6.385  1.00 24.60 ? 218 GLN A CA  1 
ATOM   1352 C C   . GLN A 1 188 ? 24.569 46.536 -5.446  1.00 26.22 ? 218 GLN A C   1 
ATOM   1353 O O   . GLN A 1 188 ? 24.145 45.441 -5.070  1.00 27.91 ? 218 GLN A O   1 
ATOM   1354 C CB  . GLN A 1 188 ? 25.322 46.282 -7.824  1.00 23.39 ? 218 GLN A CB  1 
ATOM   1355 C CG  . GLN A 1 188 ? 24.178 47.186 -8.335  1.00 22.59 ? 218 GLN A CG  1 
ATOM   1356 C CD  . GLN A 1 188 ? 24.042 47.218 -9.845  1.00 25.19 ? 218 GLN A CD  1 
ATOM   1357 O OE1 . GLN A 1 188 ? 24.814 46.587 -10.571 1.00 25.65 ? 218 GLN A OE1 1 
ATOM   1358 N NE2 . GLN A 1 188 ? 23.059 47.975 -10.326 1.00 25.47 ? 218 GLN A NE2 1 
ATOM   1359 N N   . TYR A 1 189 ? 24.033 47.701 -5.090  1.00 26.38 ? 219 TYR A N   1 
ATOM   1360 C CA  . TYR A 1 189 ? 22.791 47.805 -4.355  1.00 27.38 ? 219 TYR A CA  1 
ATOM   1361 C C   . TYR A 1 189 ? 21.901 48.774 -5.121  1.00 27.65 ? 219 TYR A C   1 
ATOM   1362 O O   . TYR A 1 189 ? 22.287 49.930 -5.322  1.00 25.94 ? 219 TYR A O   1 
ATOM   1363 C CB  . TYR A 1 189 ? 23.040 48.317 -2.922  1.00 27.73 ? 219 TYR A CB  1 
ATOM   1364 C CG  . TYR A 1 189 ? 21.749 48.521 -2.184  1.00 31.40 ? 219 TYR A CG  1 
ATOM   1365 C CD1 . TYR A 1 189 ? 21.017 47.431 -1.709  1.00 33.34 ? 219 TYR A CD1 1 
ATOM   1366 C CD2 . TYR A 1 189 ? 21.225 49.799 -2.005  1.00 28.66 ? 219 TYR A CD2 1 
ATOM   1367 C CE1 . TYR A 1 189 ? 19.789 47.617 -1.058  1.00 37.53 ? 219 TYR A CE1 1 
ATOM   1368 C CE2 . TYR A 1 189 ? 20.011 49.996 -1.364  1.00 31.24 ? 219 TYR A CE2 1 
ATOM   1369 C CZ  . TYR A 1 189 ? 19.302 48.903 -0.888  1.00 39.75 ? 219 TYR A CZ  1 
ATOM   1370 O OH  . TYR A 1 189 ? 18.101 49.096 -0.253  1.00 35.98 ? 219 TYR A OH  1 
ATOM   1371 N N   . GLN A 1 190 ? 20.713 48.314 -5.531  1.00 27.66 ? 220 GLN A N   1 
ATOM   1372 C CA  . GLN A 1 190 ? 19.799 49.102 -6.364  1.00 29.22 ? 220 GLN A CA  1 
ATOM   1373 C C   . GLN A 1 190 ? 20.592 49.633 -7.561  1.00 27.23 ? 220 GLN A C   1 
ATOM   1374 O O   . GLN A 1 190 ? 21.222 48.838 -8.262  1.00 28.29 ? 220 GLN A O   1 
ATOM   1375 C CB  . GLN A 1 190 ? 19.130 50.240 -5.576  1.00 30.84 ? 220 GLN A CB  1 
ATOM   1376 C CG  . GLN A 1 190 ? 18.330 49.790 -4.350  1.00 39.48 ? 220 GLN A CG  1 
ATOM   1377 C CD  . GLN A 1 190 ? 16.957 49.296 -4.712  1.00 48.09 ? 220 GLN A CD  1 
ATOM   1378 O OE1 . GLN A 1 190 ? 16.162 50.021 -5.302  1.00 52.78 ? 220 GLN A OE1 1 
ATOM   1379 N NE2 . GLN A 1 190 ? 16.669 48.050 -4.370  1.00 57.46 ? 220 GLN A NE2 1 
ATOM   1380 N N   . GLU A 1 191 ? 20.616 50.955 -7.741  1.00 23.41 ? 221 GLU A N   1 
ATOM   1381 C CA  . GLU A 1 191 ? 21.219 51.591 -8.925  1.00 22.91 ? 221 GLU A CA  1 
ATOM   1382 C C   . GLU A 1 191 ? 22.728 51.759 -8.832  1.00 25.24 ? 221 GLU A C   1 
ATOM   1383 O O   . GLU A 1 191 ? 23.386 52.030 -9.830  1.00 24.62 ? 221 GLU A O   1 
ATOM   1384 C CB  . GLU A 1 191 ? 20.560 52.951 -9.183  1.00 23.74 ? 221 GLU A CB  1 
ATOM   1385 C CG  . GLU A 1 191 ? 21.116 54.158 -8.408  1.00 25.93 ? 221 GLU A CG  1 
ATOM   1386 C CD  . GLU A 1 191 ? 20.917 54.102 -6.882  1.00 25.93 ? 221 GLU A CD  1 
ATOM   1387 O OE1 . GLU A 1 191 ? 19.982 53.419 -6.401  1.00 25.63 ? 221 GLU A OE1 1 
ATOM   1388 O OE2 . GLU A 1 191 ? 21.694 54.777 -6.163  1.00 29.02 ? 221 GLU A OE2 1 
ATOM   1389 N N   . GLU A 1 192 ? 23.277 51.627 -7.628  1.00 21.41 ? 222 GLU A N   1 
ATOM   1390 C CA  . GLU A 1 192 ? 24.670 51.991 -7.408  1.00 23.94 ? 222 GLU A CA  1 
ATOM   1391 C C   . GLU A 1 192 ? 25.594 50.782 -7.390  1.00 24.77 ? 222 GLU A C   1 
ATOM   1392 O O   . GLU A 1 192 ? 25.381 49.840 -6.626  1.00 24.95 ? 222 GLU A O   1 
ATOM   1393 C CB  . GLU A 1 192 ? 24.799 52.788 -6.103  1.00 25.51 ? 222 GLU A CB  1 
ATOM   1394 C CG  . GLU A 1 192 ? 26.214 53.344 -5.856  1.00 26.10 ? 222 GLU A CG  1 
ATOM   1395 C CD  . GLU A 1 192 ? 26.300 54.132 -4.548  1.00 30.17 ? 222 GLU A CD  1 
ATOM   1396 O OE1 . GLU A 1 192 ? 25.245 54.591 -4.045  1.00 32.24 ? 222 GLU A OE1 1 
ATOM   1397 O OE2 . GLU A 1 192 ? 27.433 54.302 -4.041  1.00 27.79 ? 222 GLU A OE2 1 
ATOM   1398 N N   . ARG A 1 193 ? 26.629 50.822 -8.231  1.00 23.69 ? 223 ARG A N   1 
ATOM   1399 C CA  . ARG A 1 193 ? 27.629 49.749 -8.291  1.00 24.24 ? 223 ARG A CA  1 
ATOM   1400 C C   . ARG A 1 193 ? 29.009 50.337 -8.003  1.00 26.03 ? 223 ARG A C   1 
ATOM   1401 O O   . ARG A 1 193 ? 29.376 51.357 -8.598  1.00 26.26 ? 223 ARG A O   1 
ATOM   1402 C CB  . ARG A 1 193 ? 27.608 49.073 -9.681  1.00 23.61 ? 223 ARG A CB  1 
ATOM   1403 C CG  . ARG A 1 193 ? 28.522 47.816 -9.753  1.00 24.29 ? 223 ARG A CG  1 
ATOM   1404 C CD  . ARG A 1 193 ? 28.289 47.009 -11.045 1.00 25.94 ? 223 ARG A CD  1 
ATOM   1405 N NE  . ARG A 1 193 ? 28.468 47.832 -12.238 1.00 26.91 ? 223 ARG A NE  1 
ATOM   1406 C CZ  . ARG A 1 193 ? 27.481 48.284 -13.008 1.00 31.68 ? 223 ARG A CZ  1 
ATOM   1407 N NH1 . ARG A 1 193 ? 26.205 48.002 -12.742 1.00 28.69 ? 223 ARG A NH1 1 
ATOM   1408 N NH2 . ARG A 1 193 ? 27.770 49.028 -14.061 1.00 27.36 ? 223 ARG A NH2 1 
ATOM   1409 N N   . ARG A 1 194 ? 29.755 49.695 -7.093  1.00 24.98 ? 224 ARG A N   1 
ATOM   1410 C CA  . ARG A 1 194 ? 31.063 50.159 -6.646  1.00 25.01 ? 224 ARG A CA  1 
ATOM   1411 C C   . ARG A 1 194 ? 32.122 49.110 -6.922  1.00 27.02 ? 224 ARG A C   1 
ATOM   1412 O O   . ARG A 1 194 ? 31.829 47.915 -6.882  1.00 27.54 ? 224 ARG A O   1 
ATOM   1413 C CB  . ARG A 1 194 ? 31.041 50.395 -5.128  1.00 24.70 ? 224 ARG A CB  1 
ATOM   1414 C CG  . ARG A 1 194 ? 29.949 51.360 -4.697  1.00 23.87 ? 224 ARG A CG  1 
ATOM   1415 C CD  . ARG A 1 194 ? 30.027 51.537 -3.176  1.00 21.24 ? 224 ARG A CD  1 
ATOM   1416 N NE  . ARG A 1 194 ? 29.005 52.453 -2.683  1.00 24.97 ? 224 ARG A NE  1 
ATOM   1417 C CZ  . ARG A 1 194 ? 28.681 52.538 -1.399  1.00 27.96 ? 224 ARG A CZ  1 
ATOM   1418 N NH1 . ARG A 1 194 ? 29.313 51.758 -0.540  1.00 26.84 ? 224 ARG A NH1 1 
ATOM   1419 N NH2 . ARG A 1 194 ? 27.745 53.393 -0.981  1.00 25.89 ? 224 ARG A NH2 1 
ATOM   1420 N N   . SER A 1 195 ? 33.352 49.556 -7.171  1.00 27.54 ? 225 SER A N   1 
ATOM   1421 C CA  . SER A 1 195 ? 34.501 48.643 -7.295  1.00 27.27 ? 225 SER A CA  1 
ATOM   1422 C C   . SER A 1 195 ? 35.095 48.296 -5.939  1.00 27.69 ? 225 SER A C   1 
ATOM   1423 O O   . SER A 1 195 ? 35.147 49.137 -5.039  1.00 28.62 ? 225 SER A O   1 
ATOM   1424 C CB  . SER A 1 195 ? 35.583 49.265 -8.159  1.00 29.60 ? 225 SER A CB  1 
ATOM   1425 O OG  . SER A 1 195 ? 35.050 49.524 -9.440  1.00 38.69 ? 225 SER A OG  1 
ATOM   1426 N N   . VAL A 1 196 ? 35.500 47.043 -5.773  1.00 27.21 ? 226 VAL A N   1 
ATOM   1427 C CA  . VAL A 1 196 ? 36.206 46.652 -4.554  1.00 26.44 ? 226 VAL A CA  1 
ATOM   1428 C C   . VAL A 1 196 ? 37.372 45.783 -5.012  1.00 29.70 ? 226 VAL A C   1 
ATOM   1429 O O   . VAL A 1 196 ? 37.172 44.807 -5.741  1.00 31.56 ? 226 VAL A O   1 
ATOM   1430 C CB  . VAL A 1 196 ? 35.328 45.849 -3.572  1.00 28.95 ? 226 VAL A CB  1 
ATOM   1431 C CG1 . VAL A 1 196 ? 36.141 45.484 -2.306  1.00 27.90 ? 226 VAL A CG1 1 
ATOM   1432 C CG2 . VAL A 1 196 ? 34.083 46.628 -3.144  1.00 27.28 ? 226 VAL A CG2 1 
ATOM   1433 N N   . LYS A 1 197 ? 38.587 46.158 -4.616  1.00 27.24 ? 227 LYS A N   1 
ATOM   1434 C CA  . LYS A 1 197 ? 39.764 45.308 -4.848  1.00 27.50 ? 227 LYS A CA  1 
ATOM   1435 C C   . LYS A 1 197 ? 39.932 44.364 -3.658  1.00 27.93 ? 227 LYS A C   1 
ATOM   1436 O O   . LYS A 1 197 ? 39.829 44.785 -2.510  1.00 27.46 ? 227 LYS A O   1 
ATOM   1437 C CB  . LYS A 1 197 ? 40.994 46.197 -5.043  1.00 27.37 ? 227 LYS A CB  1 
ATOM   1438 C CG  . LYS A 1 197 ? 42.325 45.464 -5.235  1.00 31.03 ? 227 LYS A CG  1 
ATOM   1439 C CD  . LYS A 1 197 ? 43.421 46.500 -5.520  1.00 31.57 ? 227 LYS A CD  1 
ATOM   1440 C CE  . LYS A 1 197 ? 44.740 45.837 -5.815  1.00 34.25 ? 227 LYS A CE  1 
ATOM   1441 N NZ  . LYS A 1 197 ? 45.802 46.864 -5.964  1.00 33.02 ? 227 LYS A NZ  1 
ATOM   1442 N N   . HIS A 1 198 ? 40.173 43.087 -3.939  1.00 26.23 ? 228 HIS A N   1 
ATOM   1443 C CA  . HIS A 1 198 ? 40.320 42.069 -2.908  1.00 26.91 ? 228 HIS A CA  1 
ATOM   1444 C C   . HIS A 1 198 ? 41.699 41.440 -3.113  1.00 28.54 ? 228 HIS A C   1 
ATOM   1445 O O   . HIS A 1 198 ? 42.029 41.013 -4.227  1.00 28.80 ? 228 HIS A O   1 
ATOM   1446 C CB  . HIS A 1 198 ? 39.208 41.016 -3.078  1.00 27.91 ? 228 HIS A CB  1 
ATOM   1447 C CG  . HIS A 1 198 ? 39.186 39.965 -2.013  1.00 32.28 ? 228 HIS A CG  1 
ATOM   1448 N ND1 . HIS A 1 198 ? 39.958 38.825 -2.073  1.00 31.79 ? 228 HIS A ND1 1 
ATOM   1449 C CD2 . HIS A 1 198 ? 38.491 39.891 -0.849  1.00 29.09 ? 228 HIS A CD2 1 
ATOM   1450 C CE1 . HIS A 1 198 ? 39.734 38.087 -0.999  1.00 32.59 ? 228 HIS A CE1 1 
ATOM   1451 N NE2 . HIS A 1 198 ? 38.851 38.715 -0.239  1.00 31.22 ? 228 HIS A NE2 1 
ATOM   1452 N N   . ILE A 1 199 ? 42.507 41.425 -2.058  1.00 25.26 ? 229 ILE A N   1 
ATOM   1453 C CA  . ILE A 1 199 ? 43.830 40.784 -2.100  1.00 26.70 ? 229 ILE A CA  1 
ATOM   1454 C C   . ILE A 1 199 ? 43.872 39.627 -1.111  1.00 29.32 ? 229 ILE A C   1 
ATOM   1455 O O   . ILE A 1 199 ? 43.630 39.812 0.107   1.00 28.63 ? 229 ILE A O   1 
ATOM   1456 C CB  . ILE A 1 199 ? 44.972 41.759 -1.753  1.00 27.29 ? 229 ILE A CB  1 
ATOM   1457 C CG1 . ILE A 1 199 ? 44.901 43.026 -2.614  1.00 29.08 ? 229 ILE A CG1 1 
ATOM   1458 C CG2 . ILE A 1 199 ? 46.329 41.069 -1.948  1.00 25.00 ? 229 ILE A CG2 1 
ATOM   1459 C CD1 . ILE A 1 199 ? 45.784 44.176 -2.122  1.00 29.17 ? 229 ILE A CD1 1 
ATOM   1460 N N   . LEU A 1 200 ? 44.168 38.435 -1.630  1.00 27.37 ? 230 LEU A N   1 
ATOM   1461 C CA  . LEU A 1 200 ? 44.246 37.258 -0.771  1.00 28.44 ? 230 LEU A CA  1 
ATOM   1462 C C   . LEU A 1 200 ? 45.701 36.842 -0.665  1.00 29.81 ? 230 LEU A C   1 
ATOM   1463 O O   . LEU A 1 200 ? 46.311 36.463 -1.665  1.00 29.14 ? 230 LEU A O   1 
ATOM   1464 C CB  . LEU A 1 200 ? 43.403 36.134 -1.360  1.00 31.96 ? 230 LEU A CB  1 
ATOM   1465 C CG  . LEU A 1 200 ? 43.125 34.910 -0.463  1.00 36.03 ? 230 LEU A CG  1 
ATOM   1466 C CD1 . LEU A 1 200 ? 41.969 34.103 -1.075  1.00 37.56 ? 230 LEU A CD1 1 
ATOM   1467 C CD2 . LEU A 1 200 ? 44.356 34.053 -0.267  1.00 36.18 ? 230 LEU A CD2 1 
ATOM   1468 N N   . PHE A 1 201 ? 46.249 36.934 0.542   1.00 27.09 ? 231 PHE A N   1 
ATOM   1469 C CA  . PHE A 1 201 ? 47.629 36.585 0.807   1.00 28.54 ? 231 PHE A CA  1 
ATOM   1470 C C   . PHE A 1 201 ? 47.582 35.244 1.523   1.00 29.29 ? 231 PHE A C   1 
ATOM   1471 O O   . PHE A 1 201 ? 47.067 35.151 2.638   1.00 28.71 ? 231 PHE A O   1 
ATOM   1472 C CB  . PHE A 1 201 ? 48.253 37.652 1.709   1.00 27.81 ? 231 PHE A CB  1 
ATOM   1473 C CG  . PHE A 1 201 ? 49.738 37.458 1.977   1.00 33.01 ? 231 PHE A CG  1 
ATOM   1474 C CD1 . PHE A 1 201 ? 50.696 38.059 1.147   1.00 31.42 ? 231 PHE A CD1 1 
ATOM   1475 C CD2 . PHE A 1 201 ? 50.174 36.723 3.081   1.00 31.00 ? 231 PHE A CD2 1 
ATOM   1476 C CE1 . PHE A 1 201 ? 52.090 37.892 1.403   1.00 34.40 ? 231 PHE A CE1 1 
ATOM   1477 C CE2 . PHE A 1 201 ? 51.553 36.548 3.356   1.00 32.17 ? 231 PHE A CE2 1 
ATOM   1478 C CZ  . PHE A 1 201 ? 52.511 37.132 2.516   1.00 36.06 ? 231 PHE A CZ  1 
ATOM   1479 N N   . SER A 1 202 ? 48.082 34.203 0.884   1.00 29.72 ? 232 SER A N   1 
ATOM   1480 C CA  . SER A 1 202 ? 48.092 32.907 1.527   1.00 34.77 ? 232 SER A CA  1 
ATOM   1481 C C   . SER A 1 202 ? 49.481 32.619 2.148   1.00 35.23 ? 232 SER A C   1 
ATOM   1482 O O   . SER A 1 202 ? 50.313 33.510 2.268   1.00 39.29 ? 232 SER A O   1 
ATOM   1483 C CB  . SER A 1 202 ? 47.618 31.824 0.577   1.00 38.16 ? 232 SER A CB  1 
ATOM   1484 O OG  A SER A 1 202 ? 48.321 31.914 -0.651  0.50 35.63 ? 232 SER A OG  1 
ATOM   1485 O OG  B SER A 1 202 ? 47.782 30.562 1.214   0.50 44.63 ? 232 SER A OG  1 
ATOM   1486 N N   . ALA A 1 203 ? 49.741 31.411 2.585   1.00 37.44 ? 233 ALA A N   1 
ATOM   1487 C CA  . ALA A 1 203 ? 51.059 31.157 3.198   1.00 36.27 ? 233 ALA A CA  1 
ATOM   1488 C C   . ALA A 1 203 ? 51.353 32.012 4.458   1.00 34.18 ? 233 ALA A C   1 
ATOM   1489 O O   . ALA A 1 203 ? 52.509 32.325 4.739   1.00 32.25 ? 233 ALA A O   1 
ATOM   1490 C CB  . ALA A 1 203 ? 52.196 31.338 2.163   1.00 36.14 ? 233 ALA A CB  1 
ATOM   1491 N N   . TRP A 1 204 ? 50.318 32.390 5.199   1.00 29.04 ? 234 TRP A N   1 
ATOM   1492 C CA  . TRP A 1 204 ? 50.524 32.994 6.513   1.00 26.84 ? 234 TRP A CA  1 
ATOM   1493 C C   . TRP A 1 204 ? 49.753 32.170 7.565   1.00 29.62 ? 234 TRP A C   1 
ATOM   1494 O O   . TRP A 1 204 ? 48.574 32.443 7.807   1.00 27.67 ? 234 TRP A O   1 
ATOM   1495 C CB  . TRP A 1 204 ? 50.045 34.444 6.546   1.00 25.80 ? 234 TRP A CB  1 
ATOM   1496 C CG  . TRP A 1 204 ? 50.612 35.241 7.719   1.00 25.13 ? 234 TRP A CG  1 
ATOM   1497 C CD1 . TRP A 1 204 ? 51.158 34.745 8.891   1.00 25.91 ? 234 TRP A CD1 1 
ATOM   1498 C CD2 . TRP A 1 204 ? 50.707 36.650 7.798   1.00 26.52 ? 234 TRP A CD2 1 
ATOM   1499 N NE1 . TRP A 1 204 ? 51.582 35.782 9.679   1.00 26.77 ? 234 TRP A NE1 1 
ATOM   1500 C CE2 . TRP A 1 204 ? 51.308 36.964 9.033   1.00 28.23 ? 234 TRP A CE2 1 
ATOM   1501 C CE3 . TRP A 1 204 ? 50.326 37.700 6.929   1.00 27.94 ? 234 TRP A CE3 1 
ATOM   1502 C CZ2 . TRP A 1 204 ? 51.547 38.283 9.429   1.00 27.22 ? 234 TRP A CZ2 1 
ATOM   1503 C CZ3 . TRP A 1 204 ? 50.559 39.008 7.324   1.00 28.85 ? 234 TRP A CZ3 1 
ATOM   1504 C CH2 . TRP A 1 204 ? 51.171 39.288 8.559   1.00 28.36 ? 234 TRP A CH2 1 
ATOM   1505 N N   . PRO A 1 205 ? 50.413 31.168 8.178   1.00 30.81 ? 235 PRO A N   1 
ATOM   1506 C CA  . PRO A 1 205 ? 49.697 30.344 9.142   1.00 33.04 ? 235 PRO A CA  1 
ATOM   1507 C C   . PRO A 1 205 ? 49.343 31.123 10.401  1.00 31.27 ? 235 PRO A C   1 
ATOM   1508 O O   . PRO A 1 205 ? 50.083 31.994 10.847  1.00 28.88 ? 235 PRO A O   1 
ATOM   1509 C CB  . PRO A 1 205 ? 50.707 29.230 9.481   1.00 33.63 ? 235 PRO A CB  1 
ATOM   1510 C CG  . PRO A 1 205 ? 51.721 29.277 8.410   1.00 36.43 ? 235 PRO A CG  1 
ATOM   1511 C CD  . PRO A 1 205 ? 51.805 30.719 8.018   1.00 33.04 ? 235 PRO A CD  1 
ATOM   1512 N N   . ASP A 1 206 ? 48.182 30.799 10.935  1.00 31.49 ? 236 ASP A N   1 
ATOM   1513 C CA  . ASP A 1 206 ? 47.735 31.299 12.190  1.00 31.21 ? 236 ASP A CA  1 
ATOM   1514 C C   . ASP A 1 206 ? 48.816 31.114 13.285  1.00 27.39 ? 236 ASP A C   1 
ATOM   1515 O O   . ASP A 1 206 ? 49.518 30.102 13.301  1.00 27.10 ? 236 ASP A O   1 
ATOM   1516 C CB  . ASP A 1 206 ? 46.497 30.486 12.536  1.00 33.92 ? 236 ASP A CB  1 
ATOM   1517 C CG  . ASP A 1 206 ? 45.645 31.182 13.477  1.00 41.28 ? 236 ASP A CG  1 
ATOM   1518 O OD1 . ASP A 1 206 ? 46.102 32.239 13.970  1.00 45.95 ? 236 ASP A OD1 1 
ATOM   1519 O OD2 . ASP A 1 206 ? 44.522 30.681 13.729  1.00 47.29 ? 236 ASP A OD2 1 
ATOM   1520 N N   . HIS A 1 207 ? 48.977 32.122 14.145  1.00 26.41 ? 237 HIS A N   1 
ATOM   1521 C CA  . HIS A 1 207 ? 49.970 32.109 15.251  1.00 27.06 ? 237 HIS A CA  1 
ATOM   1522 C C   . HIS A 1 207 ? 51.420 32.001 14.815  1.00 28.52 ? 237 HIS A C   1 
ATOM   1523 O O   . HIS A 1 207 ? 52.282 31.678 15.626  1.00 28.30 ? 237 HIS A O   1 
ATOM   1524 C CB  . HIS A 1 207 ? 49.646 31.023 16.305  1.00 27.93 ? 237 HIS A CB  1 
ATOM   1525 C CG  A HIS A 1 207 ? 48.398 31.338 17.073  0.50 33.15 ? 237 HIS A CG  1 
ATOM   1526 C CG  B HIS A 1 207 ? 48.198 30.639 16.383  0.50 28.59 ? 237 HIS A CG  1 
ATOM   1527 N ND1 A HIS A 1 207 ? 48.396 32.141 18.194  0.50 34.48 ? 237 HIS A ND1 1 
ATOM   1528 N ND1 B HIS A 1 207 ? 47.218 31.513 16.799  0.50 25.86 ? 237 HIS A ND1 1 
ATOM   1529 C CD2 A HIS A 1 207 ? 47.103 31.025 16.833  0.50 32.61 ? 237 HIS A CD2 1 
ATOM   1530 C CD2 B HIS A 1 207 ? 47.571 29.466 16.123  0.50 33.93 ? 237 HIS A CD2 1 
ATOM   1531 C CE1 A HIS A 1 207 ? 47.157 32.272 18.636  0.50 32.40 ? 237 HIS A CE1 1 
ATOM   1532 C CE1 B HIS A 1 207 ? 46.046 30.902 16.777  0.50 31.64 ? 237 HIS A CE1 1 
ATOM   1533 N NE2 A HIS A 1 207 ? 46.353 31.610 17.825  0.50 34.59 ? 237 HIS A NE2 1 
ATOM   1534 N NE2 B HIS A 1 207 ? 46.233 29.658 16.367  0.50 34.21 ? 237 HIS A NE2 1 
ATOM   1535 N N   . GLN A 1 208 ? 51.678 32.286 13.543  1.00 28.22 ? 238 GLN A N   1 
ATOM   1536 C CA  . GLN A 1 208 ? 53.020 32.214 12.983  1.00 28.33 ? 238 GLN A CA  1 
ATOM   1537 C C   . GLN A 1 208 ? 53.319 33.471 12.167  1.00 27.90 ? 238 GLN A C   1 
ATOM   1538 O O   . GLN A 1 208 ? 52.500 34.385 12.103  1.00 26.78 ? 238 GLN A O   1 
ATOM   1539 C CB  . GLN A 1 208 ? 53.109 30.978 12.092  1.00 29.72 ? 238 GLN A CB  1 
ATOM   1540 C CG  . GLN A 1 208 ? 52.963 29.668 12.868  1.00 34.23 ? 238 GLN A CG  1 
ATOM   1541 C CD  . GLN A 1 208 ? 53.175 28.453 11.994  1.00 47.84 ? 238 GLN A CD  1 
ATOM   1542 O OE1 . GLN A 1 208 ? 54.002 28.464 11.076  1.00 47.54 ? 238 GLN A OE1 1 
ATOM   1543 N NE2 . GLN A 1 208 ? 52.423 27.394 12.268  1.00 52.65 ? 238 GLN A NE2 1 
ATOM   1544 N N   . THR A 1 209 ? 54.510 33.523 11.563  1.00 27.81 ? 239 THR A N   1 
ATOM   1545 C CA  . THR A 1 209 ? 54.870 34.649 10.705  1.00 28.00 ? 239 THR A CA  1 
ATOM   1546 C C   . THR A 1 209 ? 54.821 34.154 9.252   1.00 30.55 ? 239 THR A C   1 
ATOM   1547 O O   . THR A 1 209 ? 54.796 32.932 9.029   1.00 30.10 ? 239 THR A O   1 
ATOM   1548 C CB  . THR A 1 209 ? 56.316 35.137 10.989  1.00 28.48 ? 239 THR A CB  1 
ATOM   1549 O OG1 . THR A 1 209 ? 57.235 34.115 10.589  1.00 33.09 ? 239 THR A OG1 1 
ATOM   1550 C CG2 . THR A 1 209 ? 56.519 35.466 12.481  1.00 30.27 ? 239 THR A CG2 1 
ATOM   1551 N N   . PRO A 1 210 ? 54.847 35.086 8.269   1.00 29.49 ? 240 PRO A N   1 
ATOM   1552 C CA  . PRO A 1 210 ? 55.074 34.697 6.878   1.00 30.96 ? 240 PRO A CA  1 
ATOM   1553 C C   . PRO A 1 210 ? 56.452 34.036 6.740   1.00 32.62 ? 240 PRO A C   1 
ATOM   1554 O O   . PRO A 1 210 ? 57.290 34.117 7.658   1.00 30.04 ? 240 PRO A O   1 
ATOM   1555 C CB  . PRO A 1 210 ? 55.053 36.034 6.131   1.00 31.58 ? 240 PRO A CB  1 
ATOM   1556 C CG  . PRO A 1 210 ? 54.380 37.008 7.040   1.00 34.53 ? 240 PRO A CG  1 
ATOM   1557 C CD  . PRO A 1 210 ? 54.723 36.549 8.422   1.00 28.59 ? 240 PRO A CD  1 
ATOM   1558 N N   . GLU A 1 211 ? 56.692 33.410 5.587   1.00 32.72 ? 241 GLU A N   1 
ATOM   1559 C CA  . GLU A 1 211 ? 57.917 32.648 5.373   1.00 35.57 ? 241 GLU A CA  1 
ATOM   1560 C C   . GLU A 1 211 ? 59.116 33.589 5.447   1.00 32.83 ? 241 GLU A C   1 
ATOM   1561 O O   . GLU A 1 211 ? 60.137 33.257 6.024   1.00 35.88 ? 241 GLU A O   1 
ATOM   1562 C CB  . GLU A 1 211 ? 57.870 31.937 4.007   1.00 37.52 ? 241 GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 211 ? 56.697 30.949 3.835   1.00 45.22 ? 241 GLU A CG  1 
ATOM   1564 N N   . SER A 1 212 ? 58.958 34.789 4.901   1.00 31.14 ? 242 SER A N   1 
ATOM   1565 C CA  . SER A 1 212 ? 60.020 35.803 4.956   1.00 27.98 ? 242 SER A CA  1 
ATOM   1566 C C   . SER A 1 212 ? 59.312 37.143 4.851   1.00 26.13 ? 242 SER A C   1 
ATOM   1567 O O   . SER A 1 212 ? 58.104 37.196 4.613   1.00 28.31 ? 242 SER A O   1 
ATOM   1568 C CB  . SER A 1 212 ? 61.020 35.592 3.803   1.00 27.99 ? 242 SER A CB  1 
ATOM   1569 O OG  . SER A 1 212 ? 60.326 35.730 2.586   1.00 26.80 ? 242 SER A OG  1 
ATOM   1570 N N   . ALA A 1 213 ? 60.040 38.236 5.030   1.00 24.98 ? 243 ALA A N   1 
ATOM   1571 C CA  . ALA A 1 213 ? 59.389 39.547 5.059   1.00 25.52 ? 243 ALA A CA  1 
ATOM   1572 C C   . ALA A 1 213 ? 59.144 40.133 3.662   1.00 26.69 ? 243 ALA A C   1 
ATOM   1573 O O   . ALA A 1 213 ? 58.242 40.937 3.486   1.00 28.04 ? 243 ALA A O   1 
ATOM   1574 C CB  . ALA A 1 213 ? 60.196 40.522 5.886   1.00 30.84 ? 243 ALA A CB  1 
ATOM   1575 N N   . GLY A 1 214 ? 59.963 39.741 2.697   1.00 26.84 ? 244 GLY A N   1 
ATOM   1576 C CA  . GLY A 1 214 ? 59.826 40.211 1.300   1.00 27.06 ? 244 GLY A CA  1 
ATOM   1577 C C   . GLY A 1 214 ? 58.378 40.231 0.790   1.00 25.58 ? 244 GLY A C   1 
ATOM   1578 O O   . GLY A 1 214 ? 57.880 41.274 0.367   1.00 26.42 ? 244 GLY A O   1 
ATOM   1579 N N   . PRO A 1 215 ? 57.701 39.064 0.788   1.00 27.45 ? 245 PRO A N   1 
ATOM   1580 C CA  . PRO A 1 215 ? 56.303 38.989 0.344   1.00 27.24 ? 245 PRO A CA  1 
ATOM   1581 C C   . PRO A 1 215 ? 55.348 39.905 1.121   1.00 26.78 ? 245 PRO A C   1 
ATOM   1582 O O   . PRO A 1 215 ? 54.432 40.478 0.522   1.00 26.46 ? 245 PRO A O   1 
ATOM   1583 C CB  . PRO A 1 215 ? 55.942 37.510 0.551   1.00 25.54 ? 245 PRO A CB  1 
ATOM   1584 C CG  . PRO A 1 215 ? 57.261 36.797 0.485   1.00 29.11 ? 245 PRO A CG  1 
ATOM   1585 C CD  . PRO A 1 215 ? 58.243 37.737 1.123   1.00 28.66 ? 245 PRO A CD  1 
ATOM   1586 N N   . LEU A 1 216 ? 55.534 40.009 2.443   1.00 24.92 ? 246 LEU A N   1 
ATOM   1587 C CA  . LEU A 1 216 ? 54.752 40.949 3.246   1.00 25.31 ? 246 LEU A CA  1 
ATOM   1588 C C   . LEU A 1 216 ? 54.951 42.397 2.802   1.00 24.44 ? 246 LEU A C   1 
ATOM   1589 O O   . LEU A 1 216 ? 53.978 43.154 2.683   1.00 25.21 ? 246 LEU A O   1 
ATOM   1590 C CB  . LEU A 1 216 ? 55.085 40.812 4.730   1.00 25.81 ? 246 LEU A CB  1 
ATOM   1591 C CG  . LEU A 1 216 ? 54.293 41.743 5.664   1.00 26.46 ? 246 LEU A CG  1 
ATOM   1592 C CD1 . LEU A 1 216 ? 52.774 41.635 5.446   1.00 27.76 ? 246 LEU A CD1 1 
ATOM   1593 C CD2 . LEU A 1 216 ? 54.634 41.387 7.128   1.00 28.66 ? 246 LEU A CD2 1 
ATOM   1594 N N   . LEU A 1 217 ? 56.201 42.788 2.554   1.00 25.32 ? 247 LEU A N   1 
ATOM   1595 C CA  . LEU A 1 217 ? 56.433 44.154 2.095   1.00 25.10 ? 247 LEU A CA  1 
ATOM   1596 C C   . LEU A 1 217 ? 55.849 44.388 0.689   1.00 26.78 ? 247 LEU A C   1 
ATOM   1597 O O   . LEU A 1 217 ? 55.380 45.483 0.384   1.00 27.29 ? 247 LEU A O   1 
ATOM   1598 C CB  . LEU A 1 217 ? 57.927 44.508 2.156   1.00 24.45 ? 247 LEU A CB  1 
ATOM   1599 C CG  . LEU A 1 217 ? 58.488 44.622 3.588   1.00 30.42 ? 247 LEU A CG  1 
ATOM   1600 C CD1 . LEU A 1 217 ? 59.996 44.765 3.468   1.00 27.64 ? 247 LEU A CD1 1 
ATOM   1601 C CD2 . LEU A 1 217 ? 57.887 45.823 4.312   1.00 27.74 ? 247 LEU A CD2 1 
ATOM   1602 N N   . ARG A 1 218 ? 55.889 43.369 -0.170  1.00 26.67 ? 248 ARG A N   1 
ATOM   1603 C CA  . ARG A 1 218 ? 55.232 43.495 -1.485  1.00 27.36 ? 248 ARG A CA  1 
ATOM   1604 C C   . ARG A 1 218 ? 53.707 43.597 -1.361  1.00 27.95 ? 248 ARG A C   1 
ATOM   1605 O O   . ARG A 1 218 ? 53.046 44.303 -2.146  1.00 25.70 ? 248 ARG A O   1 
ATOM   1606 C CB  . ARG A 1 218 ? 55.672 42.380 -2.444  1.00 28.03 ? 248 ARG A CB  1 
ATOM   1607 C CG  . ARG A 1 218 ? 57.117 42.530 -2.868  1.00 29.87 ? 248 ARG A CG  1 
ATOM   1608 C CD  . ARG A 1 218 ? 57.484 41.473 -3.923  1.00 34.37 ? 248 ARG A CD  1 
ATOM   1609 N NE  . ARG A 1 218 ? 57.799 40.171 -3.334  1.00 33.32 ? 248 ARG A NE  1 
ATOM   1610 C CZ  . ARG A 1 218 ? 58.970 39.856 -2.778  1.00 37.52 ? 248 ARG A CZ  1 
ATOM   1611 N NH1 . ARG A 1 218 ? 59.960 40.757 -2.713  1.00 37.37 ? 248 ARG A NH1 1 
ATOM   1612 N NH2 . ARG A 1 218 ? 59.155 38.635 -2.285  1.00 33.24 ? 248 ARG A NH2 1 
ATOM   1613 N N   . LEU A 1 219 ? 53.150 42.946 -0.337  1.00 26.08 ? 249 LEU A N   1 
ATOM   1614 C CA  . LEU A 1 219 ? 51.721 43.065 -0.053  1.00 27.34 ? 249 LEU A CA  1 
ATOM   1615 C C   . LEU A 1 219 ? 51.400 44.490 0.387   1.00 28.60 ? 249 LEU A C   1 
ATOM   1616 O O   . LEU A 1 219 ? 50.450 45.112 -0.109  1.00 27.11 ? 249 LEU A O   1 
ATOM   1617 C CB  . LEU A 1 219 ? 51.279 42.039 1.022   1.00 25.78 ? 249 LEU A CB  1 
ATOM   1618 C CG  . LEU A 1 219 ? 49.831 42.167 1.507   1.00 30.35 ? 249 LEU A CG  1 
ATOM   1619 C CD1 . LEU A 1 219 ? 48.854 41.994 0.337   1.00 30.90 ? 249 LEU A CD1 1 
ATOM   1620 C CD2 . LEU A 1 219 ? 49.548 41.134 2.617   1.00 30.35 ? 249 LEU A CD2 1 
ATOM   1621 N N   . VAL A 1 220 ? 52.192 45.018 1.323   1.00 27.46 ? 250 VAL A N   1 
ATOM   1622 C CA  . VAL A 1 220 ? 52.015 46.405 1.752   1.00 28.33 ? 250 VAL A CA  1 
ATOM   1623 C C   . VAL A 1 220 ? 52.111 47.371 0.554   1.00 31.22 ? 250 VAL A C   1 
ATOM   1624 O O   . VAL A 1 220 ? 51.294 48.288 0.434   1.00 30.18 ? 250 VAL A O   1 
ATOM   1625 C CB  . VAL A 1 220 ? 53.022 46.794 2.857   1.00 28.76 ? 250 VAL A CB  1 
ATOM   1626 C CG1 . VAL A 1 220 ? 52.895 48.281 3.224   1.00 33.33 ? 250 VAL A CG1 1 
ATOM   1627 C CG2 . VAL A 1 220 ? 52.776 45.898 4.104   1.00 31.60 ? 250 VAL A CG2 1 
ATOM   1628 N N   . ALA A 1 221 ? 53.094 47.166 -0.322  1.00 28.70 ? 251 ALA A N   1 
ATOM   1629 C CA  . ALA A 1 221 ? 53.221 48.012 -1.530  1.00 31.86 ? 251 ALA A CA  1 
ATOM   1630 C C   . ALA A 1 221 ? 51.995 47.904 -2.444  1.00 31.73 ? 251 ALA A C   1 
ATOM   1631 O O   . ALA A 1 221 ? 51.529 48.914 -3.002  1.00 33.76 ? 251 ALA A O   1 
ATOM   1632 C CB  . ALA A 1 221 ? 54.479 47.653 -2.295  1.00 31.99 ? 251 ALA A CB  1 
ATOM   1633 N N   . GLU A 1 222 ? 51.480 46.692 -2.607  1.00 31.08 ? 252 GLU A N   1 
ATOM   1634 C CA  . GLU A 1 222 ? 50.256 46.451 -3.383  1.00 33.19 ? 252 GLU A CA  1 
ATOM   1635 C C   . GLU A 1 222 ? 49.060 47.253 -2.843  1.00 34.39 ? 252 GLU A C   1 
ATOM   1636 O O   . GLU A 1 222 ? 48.273 47.825 -3.618  1.00 32.46 ? 252 GLU A O   1 
ATOM   1637 C CB  . GLU A 1 222 ? 49.927 44.956 -3.428  1.00 33.17 ? 252 GLU A CB  1 
ATOM   1638 C CG  . GLU A 1 222 ? 48.710 44.598 -4.286  1.00 33.30 ? 252 GLU A CG  1 
ATOM   1639 C CD  . GLU A 1 222 ? 48.941 44.769 -5.797  1.00 42.91 ? 252 GLU A CD  1 
ATOM   1640 O OE1 . GLU A 1 222 ? 50.036 44.444 -6.296  1.00 42.42 ? 252 GLU A OE1 1 
ATOM   1641 O OE2 . GLU A 1 222 ? 48.002 45.202 -6.485  1.00 40.36 ? 252 GLU A OE2 1 
ATOM   1642 N N   . VAL A 1 223 ? 48.936 47.305 -1.514  1.00 33.79 ? 253 VAL A N   1 
ATOM   1643 C CA  . VAL A 1 223 ? 47.930 48.132 -0.855  1.00 35.36 ? 253 VAL A CA  1 
ATOM   1644 C C   . VAL A 1 223 ? 48.170 49.607 -1.146  1.00 38.27 ? 253 VAL A C   1 
ATOM   1645 O O   . VAL A 1 223 ? 47.241 50.322 -1.517  1.00 38.25 ? 253 VAL A O   1 
ATOM   1646 C CB  . VAL A 1 223 ? 47.925 47.859 0.686   1.00 33.97 ? 253 VAL A CB  1 
ATOM   1647 C CG1 . VAL A 1 223 ? 47.125 48.927 1.478   1.00 35.92 ? 253 VAL A CG1 1 
ATOM   1648 C CG2 . VAL A 1 223 ? 47.397 46.434 0.938   1.00 30.90 ? 253 VAL A CG2 1 
ATOM   1649 N N   . GLU A 1 224 ? 49.414 50.055 -0.983  1.00 41.62 ? 254 GLU A N   1 
ATOM   1650 C CA  . GLU A 1 224 ? 49.766 51.467 -1.178  1.00 47.61 ? 254 GLU A CA  1 
ATOM   1651 C C   . GLU A 1 224 ? 49.444 51.956 -2.580  1.00 50.72 ? 254 GLU A C   1 
ATOM   1652 O O   . GLU A 1 224 ? 48.962 53.073 -2.754  1.00 52.45 ? 254 GLU A O   1 
ATOM   1653 C CB  . GLU A 1 224 ? 51.252 51.718 -0.901  1.00 46.90 ? 254 GLU A CB  1 
ATOM   1654 C CG  . GLU A 1 224 ? 51.673 51.507 0.540   1.00 53.65 ? 254 GLU A CG  1 
ATOM   1655 C CD  . GLU A 1 224 ? 51.320 52.668 1.463   1.00 60.57 ? 254 GLU A CD  1 
ATOM   1656 O OE1 . GLU A 1 224 ? 50.678 53.658 1.027   1.00 56.88 ? 254 GLU A OE1 1 
ATOM   1657 O OE2 . GLU A 1 224 ? 51.706 52.587 2.645   1.00 57.80 ? 254 GLU A OE2 1 
ATOM   1658 N N   . GLU A 1 225 ? 49.697 51.110 -3.571  1.00 52.24 ? 255 GLU A N   1 
ATOM   1659 C CA  . GLU A 1 225 ? 49.563 51.503 -4.965  1.00 55.34 ? 255 GLU A CA  1 
ATOM   1660 C C   . GLU A 1 225 ? 48.123 51.375 -5.452  1.00 56.29 ? 255 GLU A C   1 
ATOM   1661 O O   . GLU A 1 225 ? 47.811 51.757 -6.579  1.00 57.09 ? 255 GLU A O   1 
ATOM   1662 C CB  . GLU A 1 225 ? 50.540 50.716 -5.858  1.00 55.40 ? 255 GLU A CB  1 
ATOM   1663 C CG  . GLU A 1 225 ? 50.074 49.313 -6.242  1.00 59.10 ? 255 GLU A CG  1 
ATOM   1664 N N   . SER A 1 226 ? 47.249 50.842 -4.602  1.00 56.58 ? 256 SER A N   1 
ATOM   1665 C CA  . SER A 1 226 ? 45.838 50.705 -4.943  1.00 57.71 ? 256 SER A CA  1 
ATOM   1666 C C   . SER A 1 226 ? 45.231 52.095 -5.136  1.00 61.21 ? 256 SER A C   1 
ATOM   1667 O O   . SER A 1 226 ? 45.302 52.932 -4.231  1.00 60.67 ? 256 SER A O   1 
ATOM   1668 C CB  . SER A 1 226 ? 45.077 49.910 -3.874  1.00 57.06 ? 256 SER A CB  1 
ATOM   1669 O OG  . SER A 1 226 ? 45.547 48.570 -3.795  1.00 50.30 ? 256 SER A OG  1 
ATOM   1670 N N   . PRO A 1 227 ? 44.666 52.353 -6.333  1.00 64.49 ? 257 PRO A N   1 
ATOM   1671 C CA  . PRO A 1 227 ? 44.130 53.674 -6.668  1.00 67.18 ? 257 PRO A CA  1 
ATOM   1672 C C   . PRO A 1 227 ? 42.995 54.072 -5.736  1.00 69.51 ? 257 PRO A C   1 
ATOM   1673 O O   . PRO A 1 227 ? 42.124 53.248 -5.432  1.00 69.88 ? 257 PRO A O   1 
ATOM   1674 C CB  . PRO A 1 227 ? 43.606 53.490 -8.096  1.00 67.19 ? 257 PRO A CB  1 
ATOM   1675 C CG  . PRO A 1 227 ? 44.372 52.312 -8.633  1.00 67.24 ? 257 PRO A CG  1 
ATOM   1676 C CD  . PRO A 1 227 ? 44.513 51.405 -7.452  1.00 65.26 ? 257 PRO A CD  1 
ATOM   1677 N N   . GLU A 1 228 ? 43.033 55.315 -5.260  1.00 72.00 ? 258 GLU A N   1 
ATOM   1678 C CA  . GLU A 1 228 ? 41.960 55.859 -4.430  1.00 74.25 ? 258 GLU A CA  1 
ATOM   1679 C C   . GLU A 1 228 ? 41.194 56.905 -5.235  1.00 75.19 ? 258 GLU A C   1 
ATOM   1680 O O   . GLU A 1 228 ? 41.791 57.813 -5.825  1.00 77.05 ? 258 GLU A O   1 
ATOM   1681 C CB  . GLU A 1 228 ? 42.510 56.454 -3.127  1.00 74.71 ? 258 GLU A CB  1 
ATOM   1682 N N   . THR A 1 229 ? 39.874 56.759 -5.282  1.00 74.57 ? 259 THR A N   1 
ATOM   1683 C CA  . THR A 1 229 ? 39.037 57.675 -6.049  1.00 73.69 ? 259 THR A CA  1 
ATOM   1684 C C   . THR A 1 229 ? 38.265 58.623 -5.130  1.00 72.25 ? 259 THR A C   1 
ATOM   1685 O O   . THR A 1 229 ? 38.165 59.817 -5.413  1.00 73.08 ? 259 THR A O   1 
ATOM   1686 C CB  . THR A 1 229 ? 38.058 56.911 -6.976  1.00 73.88 ? 259 THR A CB  1 
ATOM   1687 N N   . ALA A 1 230 ? 37.755 58.085 -4.022  1.00 69.53 ? 260 ALA A N   1 
ATOM   1688 C CA  . ALA A 1 230 ? 36.833 58.799 -3.127  1.00 67.55 ? 260 ALA A CA  1 
ATOM   1689 C C   . ALA A 1 230 ? 37.411 60.058 -2.480  1.00 65.59 ? 260 ALA A C   1 
ATOM   1690 O O   . ALA A 1 230 ? 38.610 60.128 -2.195  1.00 66.07 ? 260 ALA A O   1 
ATOM   1691 C CB  . ALA A 1 230 ? 36.310 57.853 -2.053  1.00 67.38 ? 260 ALA A CB  1 
ATOM   1692 N N   . ALA A 1 231 ? 36.542 61.044 -2.252  1.00 62.96 ? 261 ALA A N   1 
ATOM   1693 C CA  . ALA A 1 231 ? 36.910 62.275 -1.550  1.00 61.00 ? 261 ALA A CA  1 
ATOM   1694 C C   . ALA A 1 231 ? 37.253 61.971 -0.094  1.00 60.19 ? 261 ALA A C   1 
ATOM   1695 O O   . ALA A 1 231 ? 38.153 62.584 0.487   1.00 61.23 ? 261 ALA A O   1 
ATOM   1696 C CB  . ALA A 1 231 ? 35.785 63.292 -1.621  1.00 59.78 ? 261 ALA A CB  1 
ATOM   1697 N N   . HIS A 1 232 ? 36.524 61.022 0.485   1.00 56.79 ? 262 HIS A N   1 
ATOM   1698 C CA  . HIS A 1 232 ? 36.751 60.600 1.859   1.00 54.45 ? 262 HIS A CA  1 
ATOM   1699 C C   . HIS A 1 232 ? 36.918 59.071 1.863   1.00 51.55 ? 262 HIS A C   1 
ATOM   1700 O O   . HIS A 1 232 ? 35.942 58.341 2.088   1.00 51.69 ? 262 HIS A O   1 
ATOM   1701 C CB  . HIS A 1 232 ? 35.590 61.055 2.755   1.00 54.54 ? 262 HIS A CB  1 
ATOM   1702 N N   . PRO A 1 233 ? 38.150 58.588 1.586   1.00 47.41 ? 263 PRO A N   1 
ATOM   1703 C CA  . PRO A 1 233 ? 38.402 57.148 1.444   1.00 44.96 ? 263 PRO A CA  1 
ATOM   1704 C C   . PRO A 1 233 ? 37.871 56.361 2.646   1.00 42.00 ? 263 PRO A C   1 
ATOM   1705 O O   . PRO A 1 233 ? 38.015 56.790 3.807   1.00 41.51 ? 263 PRO A O   1 
ATOM   1706 C CB  . PRO A 1 233 ? 39.933 57.054 1.365   1.00 44.41 ? 263 PRO A CB  1 
ATOM   1707 C CG  . PRO A 1 233 ? 40.359 58.378 0.852   1.00 49.27 ? 263 PRO A CG  1 
ATOM   1708 C CD  . PRO A 1 233 ? 39.379 59.382 1.396   1.00 47.66 ? 263 PRO A CD  1 
ATOM   1709 N N   . GLY A 1 234 ? 37.230 55.235 2.366   1.00 36.49 ? 264 GLY A N   1 
ATOM   1710 C CA  . GLY A 1 234 ? 36.683 54.419 3.428   1.00 33.26 ? 264 GLY A CA  1 
ATOM   1711 C C   . GLY A 1 234 ? 37.829 53.618 4.046   1.00 30.41 ? 264 GLY A C   1 
ATOM   1712 O O   . GLY A 1 234 ? 38.962 53.632 3.546   1.00 29.21 ? 264 GLY A O   1 
ATOM   1713 N N   . PRO A 1 235 ? 37.536 52.906 5.132   1.00 30.23 ? 265 PRO A N   1 
ATOM   1714 C CA  . PRO A 1 235 ? 38.577 52.081 5.716   1.00 27.50 ? 265 PRO A CA  1 
ATOM   1715 C C   . PRO A 1 235 ? 38.955 50.914 4.816   1.00 28.51 ? 265 PRO A C   1 
ATOM   1716 O O   . PRO A 1 235 ? 38.127 50.416 4.043   1.00 26.73 ? 265 PRO A O   1 
ATOM   1717 C CB  . PRO A 1 235 ? 37.950 51.540 7.003   1.00 29.53 ? 265 PRO A CB  1 
ATOM   1718 C CG  . PRO A 1 235 ? 36.599 52.179 7.133   1.00 32.51 ? 265 PRO A CG  1 
ATOM   1719 C CD  . PRO A 1 235 ? 36.252 52.855 5.858   1.00 28.92 ? 265 PRO A CD  1 
ATOM   1720 N N   . ILE A 1 236 ? 40.209 50.491 4.924   1.00 26.43 ? 266 ILE A N   1 
ATOM   1721 C CA  . ILE A 1 236 ? 40.656 49.234 4.325   1.00 26.75 ? 266 ILE A CA  1 
ATOM   1722 C C   . ILE A 1 236 ? 40.271 48.096 5.273   1.00 26.56 ? 266 ILE A C   1 
ATOM   1723 O O   . ILE A 1 236 ? 40.610 48.149 6.459   1.00 25.99 ? 266 ILE A O   1 
ATOM   1724 C CB  . ILE A 1 236 ? 42.166 49.253 4.149   1.00 25.41 ? 266 ILE A CB  1 
ATOM   1725 C CG1 . ILE A 1 236 ? 42.560 50.410 3.215   1.00 25.98 ? 266 ILE A CG1 1 
ATOM   1726 C CG2 . ILE A 1 236 ? 42.682 47.884 3.678   1.00 24.79 ? 266 ILE A CG2 1 
ATOM   1727 C CD1 . ILE A 1 236 ? 44.060 50.801 3.327   1.00 30.21 ? 266 ILE A CD1 1 
ATOM   1728 N N   . VAL A 1 237 ? 39.546 47.092 4.773   1.00 25.24 ? 267 VAL A N   1 
ATOM   1729 C CA  . VAL A 1 237 ? 39.200 45.919 5.597   1.00 24.47 ? 267 VAL A CA  1 
ATOM   1730 C C   . VAL A 1 237 ? 40.396 44.963 5.568   1.00 25.46 ? 267 VAL A C   1 
ATOM   1731 O O   . VAL A 1 237 ? 40.933 44.629 4.500   1.00 26.97 ? 267 VAL A O   1 
ATOM   1732 C CB  . VAL A 1 237 ? 37.902 45.211 5.121   1.00 24.39 ? 267 VAL A CB  1 
ATOM   1733 C CG1 . VAL A 1 237 ? 37.710 43.817 5.783   1.00 26.73 ? 267 VAL A CG1 1 
ATOM   1734 C CG2 . VAL A 1 237 ? 36.675 46.118 5.408   1.00 26.47 ? 267 VAL A CG2 1 
ATOM   1735 N N   . VAL A 1 238 ? 40.827 44.550 6.753   1.00 23.99 ? 268 VAL A N   1 
ATOM   1736 C CA  . VAL A 1 238 ? 41.890 43.538 6.863   1.00 23.53 ? 268 VAL A CA  1 
ATOM   1737 C C   . VAL A 1 238 ? 41.314 42.453 7.739   1.00 25.85 ? 268 VAL A C   1 
ATOM   1738 O O   . VAL A 1 238 ? 40.765 42.750 8.810   1.00 26.23 ? 268 VAL A O   1 
ATOM   1739 C CB  . VAL A 1 238 ? 43.137 44.120 7.531   1.00 24.19 ? 268 VAL A CB  1 
ATOM   1740 C CG1 . VAL A 1 238 ? 44.295 43.062 7.534   1.00 25.27 ? 268 VAL A CG1 1 
ATOM   1741 C CG2 . VAL A 1 238 ? 43.621 45.426 6.825   1.00 25.09 ? 268 VAL A CG2 1 
ATOM   1742 N N   . HIS A 1 239 ? 41.402 41.204 7.291   1.00 25.55 ? 269 HIS A N   1 
ATOM   1743 C CA  . HIS A 1 239 ? 40.836 40.103 8.070   1.00 26.71 ? 269 HIS A CA  1 
ATOM   1744 C C   . HIS A 1 239 ? 41.672 38.857 8.010   1.00 27.59 ? 269 HIS A C   1 
ATOM   1745 O O   . HIS A 1 239 ? 42.446 38.640 7.062   1.00 28.08 ? 269 HIS A O   1 
ATOM   1746 C CB  . HIS A 1 239 ? 39.347 39.826 7.709   1.00 25.84 ? 269 HIS A CB  1 
ATOM   1747 C CG  . HIS A 1 239 ? 39.137 39.082 6.428   1.00 27.71 ? 269 HIS A CG  1 
ATOM   1748 N ND1 . HIS A 1 239 ? 39.303 37.716 6.319   1.00 29.91 ? 269 HIS A ND1 1 
ATOM   1749 C CD2 . HIS A 1 239 ? 38.716 39.510 5.210   1.00 30.34 ? 269 HIS A CD2 1 
ATOM   1750 C CE1 . HIS A 1 239 ? 39.008 37.337 5.085   1.00 32.78 ? 269 HIS A CE1 1 
ATOM   1751 N NE2 . HIS A 1 239 ? 38.634 38.404 4.398   1.00 31.94 ? 269 HIS A NE2 1 
ATOM   1752 N N   . CYS A 1 240 ? 41.530 38.056 9.063   1.00 26.97 ? 270 CYS A N   1 
ATOM   1753 C CA  . CYS A 1 240 ? 42.083 36.727 9.151   1.00 28.51 ? 270 CYS A CA  1 
ATOM   1754 C C   . CYS A 1 240 ? 41.152 35.987 10.115  1.00 30.47 ? 270 CYS A C   1 
ATOM   1755 O O   . CYS A 1 240 ? 40.186 36.584 10.611  1.00 32.52 ? 270 CYS A O   1 
ATOM   1756 C CB  . CYS A 1 240 ? 43.513 36.782 9.717   1.00 26.68 ? 270 CYS A CB  1 
ATOM   1757 S SG  . CYS A 1 240 ? 43.640 37.581 11.359  1.00 28.63 ? 270 CYS A SG  1 
ATOM   1758 N N   . SER A 1 241 ? 41.452 34.731 10.435  1.00 28.68 ? 271 SER A N   1 
ATOM   1759 C CA  . SER A 1 241 ? 40.472 33.898 11.145  1.00 28.11 ? 271 SER A CA  1 
ATOM   1760 C C   . SER A 1 241 ? 39.920 34.580 12.417  1.00 28.33 ? 271 SER A C   1 
ATOM   1761 O O   . SER A 1 241 ? 38.709 34.680 12.600  1.00 28.63 ? 271 SER A O   1 
ATOM   1762 C CB  . SER A 1 241 ? 41.081 32.536 11.486  1.00 29.39 ? 271 SER A CB  1 
ATOM   1763 O OG  A SER A 1 241 ? 41.415 31.828 10.292  0.50 30.95 ? 271 SER A OG  1 
ATOM   1764 O OG  B SER A 1 241 ? 40.083 31.665 11.994  0.50 31.39 ? 271 SER A OG  1 
ATOM   1765 N N   . ALA A 1 242 ? 40.813 35.024 13.299  1.00 25.79 ? 272 ALA A N   1 
ATOM   1766 C CA  . ALA A 1 242 ? 40.372 35.678 14.553  1.00 26.45 ? 272 ALA A CA  1 
ATOM   1767 C C   . ALA A 1 242 ? 40.293 37.199 14.402  1.00 27.65 ? 272 ALA A C   1 
ATOM   1768 O O   . ALA A 1 242 ? 39.626 37.870 15.209  1.00 28.03 ? 272 ALA A O   1 
ATOM   1769 C CB  . ALA A 1 242 ? 41.301 35.302 15.708  1.00 28.30 ? 272 ALA A CB  1 
ATOM   1770 N N   . GLY A 1 243 ? 40.950 37.740 13.366  1.00 24.22 ? 273 GLY A N   1 
ATOM   1771 C CA  . GLY A 1 243 ? 40.993 39.172 13.152  1.00 25.66 ? 273 GLY A CA  1 
ATOM   1772 C C   . GLY A 1 243 ? 41.917 39.940 14.100  1.00 27.39 ? 273 GLY A C   1 
ATOM   1773 O O   . GLY A 1 243 ? 41.758 41.140 14.262  1.00 27.65 ? 273 GLY A O   1 
ATOM   1774 N N   . ILE A 1 244 ? 42.901 39.280 14.710  1.00 25.39 ? 274 ILE A N   1 
ATOM   1775 C CA  . ILE A 1 244 ? 43.818 40.013 15.597  1.00 24.86 ? 274 ILE A CA  1 
ATOM   1776 C C   . ILE A 1 244 ? 45.320 39.751 15.419  1.00 23.78 ? 274 ILE A C   1 
ATOM   1777 O O   . ILE A 1 244 ? 46.105 40.683 15.513  1.00 25.89 ? 274 ILE A O   1 
ATOM   1778 C CB  . ILE A 1 244 ? 43.436 39.882 17.132  1.00 27.39 ? 274 ILE A CB  1 
ATOM   1779 C CG1 . ILE A 1 244 ? 43.412 38.419 17.559  1.00 28.29 ? 274 ILE A CG1 1 
ATOM   1780 C CG2 . ILE A 1 244 ? 42.053 40.547 17.425  1.00 27.34 ? 274 ILE A CG2 1 
ATOM   1781 C CD1 . ILE A 1 244 ? 43.417 38.207 19.102  1.00 28.97 ? 274 ILE A CD1 1 
ATOM   1782 N N   . GLY A 1 245 ? 45.717 38.501 15.177  1.00 24.35 ? 275 GLY A N   1 
ATOM   1783 C CA  . GLY A 1 245 ? 47.139 38.189 15.084  1.00 24.33 ? 275 GLY A CA  1 
ATOM   1784 C C   . GLY A 1 245 ? 47.718 38.689 13.778  1.00 26.35 ? 275 GLY A C   1 
ATOM   1785 O O   . GLY A 1 245 ? 48.495 39.645 13.738  1.00 26.07 ? 275 GLY A O   1 
ATOM   1786 N N   . ARG A 1 246 ? 47.311 38.044 12.702  1.00 26.36 ? 276 ARG A N   1 
ATOM   1787 C CA  . ARG A 1 246 ? 47.861 38.365 11.399  1.00 26.04 ? 276 ARG A CA  1 
ATOM   1788 C C   . ARG A 1 246 ? 47.394 39.728 10.939  1.00 27.33 ? 276 ARG A C   1 
ATOM   1789 O O   . ARG A 1 246 ? 48.174 40.471 10.336  1.00 26.06 ? 276 ARG A O   1 
ATOM   1790 C CB  . ARG A 1 246 ? 47.500 37.275 10.407  1.00 25.52 ? 276 ARG A CB  1 
ATOM   1791 C CG  . ARG A 1 246 ? 48.272 35.967 10.727  1.00 25.93 ? 276 ARG A CG  1 
ATOM   1792 C CD  . ARG A 1 246 ? 47.674 34.771 10.036  1.00 27.62 ? 276 ARG A CD  1 
ATOM   1793 N NE  . ARG A 1 246 ? 46.390 34.382 10.649  1.00 27.36 ? 276 ARG A NE  1 
ATOM   1794 C CZ  . ARG A 1 246 ? 45.610 33.413 10.178  1.00 31.97 ? 276 ARG A CZ  1 
ATOM   1795 N NH1 . ARG A 1 246 ? 45.986 32.728 9.087   1.00 27.19 ? 276 ARG A NH1 1 
ATOM   1796 N NH2 . ARG A 1 246 ? 44.454 33.124 10.794  1.00 28.05 ? 276 ARG A NH2 1 
ATOM   1797 N N   . THR A 1 247 ? 46.127 40.058 11.212  1.00 25.85 ? 277 THR A N   1 
ATOM   1798 C CA  . THR A 1 247 ? 45.633 41.413 10.925  1.00 24.71 ? 277 THR A CA  1 
ATOM   1799 C C   . THR A 1 247 ? 46.472 42.464 11.628  1.00 25.43 ? 277 THR A C   1 
ATOM   1800 O O   . THR A 1 247 ? 46.854 43.470 11.022  1.00 25.45 ? 277 THR A O   1 
ATOM   1801 C CB  . THR A 1 247 ? 44.134 41.559 11.273  1.00 27.27 ? 277 THR A CB  1 
ATOM   1802 O OG1 A THR A 1 247 ? 43.973 41.487 12.708  0.50 29.34 ? 277 THR A OG1 1 
ATOM   1803 O OG1 B THR A 1 247 ? 43.388 40.726 10.372  0.50 27.95 ? 277 THR A OG1 1 
ATOM   1804 C CG2 A THR A 1 247 ? 43.305 40.518 10.567  0.50 29.42 ? 277 THR A CG2 1 
ATOM   1805 C CG2 B THR A 1 247 ? 43.621 42.962 11.150  0.50 23.52 ? 277 THR A CG2 1 
ATOM   1806 N N   . GLY A 1 248 ? 46.754 42.269 12.923  1.00 25.42 ? 278 GLY A N   1 
ATOM   1807 C CA  . GLY A 1 248 ? 47.582 43.236 13.628  1.00 25.53 ? 278 GLY A CA  1 
ATOM   1808 C C   . GLY A 1 248 ? 48.989 43.335 13.058  1.00 26.83 ? 278 GLY A C   1 
ATOM   1809 O O   . GLY A 1 248 ? 49.523 44.428 12.949  1.00 26.76 ? 278 GLY A O   1 
ATOM   1810 N N   . CYS A 1 249 ? 49.599 42.208 12.678  1.00 25.24 ? 279 CYS A N   1 
ATOM   1811 C CA  . CYS A 1 249 ? 50.943 42.241 12.089  1.00 25.67 ? 279 CYS A CA  1 
ATOM   1812 C C   . CYS A 1 249 ? 50.945 43.031 10.793  1.00 25.79 ? 279 CYS A C   1 
ATOM   1813 O O   . CYS A 1 249 ? 51.831 43.850 10.570  1.00 24.71 ? 279 CYS A O   1 
ATOM   1814 C CB  . CYS A 1 249 ? 51.462 40.835 11.779  1.00 26.78 ? 279 CYS A CB  1 
ATOM   1815 S SG  . CYS A 1 249 ? 51.822 39.862 13.277  1.00 30.79 ? 279 CYS A SG  1 
ATOM   1816 N N   . PHE A 1 250 ? 49.931 42.799 9.967   1.00 23.55 ? 280 PHE A N   1 
ATOM   1817 C CA  . PHE A 1 250 ? 49.859 43.495 8.677   1.00 24.88 ? 280 PHE A CA  1 
ATOM   1818 C C   . PHE A 1 250 ? 49.696 44.995 8.910   1.00 24.10 ? 280 PHE A C   1 
ATOM   1819 O O   . PHE A 1 250 ? 50.434 45.819 8.328   1.00 25.02 ? 280 PHE A O   1 
ATOM   1820 C CB  . PHE A 1 250 ? 48.693 42.981 7.810   1.00 24.74 ? 280 PHE A CB  1 
ATOM   1821 C CG  . PHE A 1 250 ? 48.490 43.830 6.587   1.00 25.32 ? 280 PHE A CG  1 
ATOM   1822 C CD1 . PHE A 1 250 ? 49.319 43.669 5.472   1.00 33.82 ? 280 PHE A CD1 1 
ATOM   1823 C CD2 . PHE A 1 250 ? 47.564 44.883 6.607   1.00 29.33 ? 280 PHE A CD2 1 
ATOM   1824 C CE1 . PHE A 1 250 ? 49.188 44.510 4.356   1.00 32.01 ? 280 PHE A CE1 1 
ATOM   1825 C CE2 . PHE A 1 250 ? 47.430 45.720 5.504   1.00 34.17 ? 280 PHE A CE2 1 
ATOM   1826 C CZ  . PHE A 1 250 ? 48.237 45.527 4.380   1.00 35.51 ? 280 PHE A CZ  1 
ATOM   1827 N N   . ILE A 1 251 ? 48.727 45.372 9.744   1.00 24.24 ? 281 ILE A N   1 
ATOM   1828 C CA  . ILE A 1 251 ? 48.523 46.816 9.997   1.00 24.63 ? 281 ILE A CA  1 
ATOM   1829 C C   . ILE A 1 251 ? 49.748 47.476 10.641  1.00 25.26 ? 281 ILE A C   1 
ATOM   1830 O O   . ILE A 1 251 ? 50.183 48.565 10.216  1.00 24.92 ? 281 ILE A O   1 
ATOM   1831 C CB  . ILE A 1 251 ? 47.232 47.092 10.780  1.00 22.37 ? 281 ILE A CB  1 
ATOM   1832 C CG1 . ILE A 1 251 ? 46.023 46.630 9.949   1.00 26.70 ? 281 ILE A CG1 1 
ATOM   1833 C CG2 . ILE A 1 251 ? 47.166 48.606 11.198  1.00 22.61 ? 281 ILE A CG2 1 
ATOM   1834 C CD1 . ILE A 1 251 ? 44.656 46.587 10.727  1.00 27.41 ? 281 ILE A CD1 1 
ATOM   1835 N N   . ALA A 1 252 ? 50.329 46.822 11.641  1.00 25.47 ? 282 ALA A N   1 
ATOM   1836 C CA  . ALA A 1 252 ? 51.517 47.373 12.293  1.00 25.24 ? 282 ALA A CA  1 
ATOM   1837 C C   . ALA A 1 252 ? 52.656 47.557 11.297  1.00 25.73 ? 282 ALA A C   1 
ATOM   1838 O O   . ALA A 1 252 ? 53.374 48.548 11.377  1.00 25.03 ? 282 ALA A O   1 
ATOM   1839 C CB  . ALA A 1 252 ? 51.978 46.488 13.451  1.00 26.60 ? 282 ALA A CB  1 
ATOM   1840 N N   . THR A 1 253 ? 52.810 46.609 10.376  1.00 24.48 ? 283 THR A N   1 
ATOM   1841 C CA  . THR A 1 253 ? 53.865 46.709 9.347   1.00 25.03 ? 283 THR A CA  1 
ATOM   1842 C C   . THR A 1 253 ? 53.642 47.958 8.486   1.00 25.53 ? 283 THR A C   1 
ATOM   1843 O O   . THR A 1 253 ? 54.565 48.741 8.246   1.00 26.12 ? 283 THR A O   1 
ATOM   1844 C CB  . THR A 1 253 ? 53.930 45.440 8.482   1.00 25.34 ? 283 THR A CB  1 
ATOM   1845 O OG1 . THR A 1 253 ? 54.234 44.314 9.321   1.00 26.47 ? 283 THR A OG1 1 
ATOM   1846 C CG2 . THR A 1 253 ? 55.060 45.553 7.421   1.00 23.76 ? 283 THR A CG2 1 
ATOM   1847 N N   . ARG A 1 254 ? 52.412 48.150 8.033   1.00 23.81 ? 284 ARG A N   1 
ATOM   1848 C CA  . ARG A 1 254 ? 52.142 49.280 7.152   1.00 26.74 ? 284 ARG A CA  1 
ATOM   1849 C C   . ARG A 1 254 ? 52.388 50.591 7.882   1.00 27.22 ? 284 ARG A C   1 
ATOM   1850 O O   . ARG A 1 254 ? 53.068 51.468 7.358   1.00 24.10 ? 284 ARG A O   1 
ATOM   1851 C CB  . ARG A 1 254 ? 50.738 49.224 6.556   1.00 25.32 ? 284 ARG A CB  1 
ATOM   1852 C CG  . ARG A 1 254 ? 50.474 50.514 5.691   1.00 30.03 ? 284 ARG A CG  1 
ATOM   1853 C CD  . ARG A 1 254 ? 49.425 50.313 4.693   1.00 36.99 ? 284 ARG A CD  1 
ATOM   1854 N NE  . ARG A 1 254 ? 49.318 51.492 3.813   1.00 33.68 ? 284 ARG A NE  1 
ATOM   1855 C CZ  . ARG A 1 254 ? 48.337 52.386 3.837   1.00 37.58 ? 284 ARG A CZ  1 
ATOM   1856 N NH1 . ARG A 1 254 ? 47.354 52.313 4.731   1.00 28.89 ? 284 ARG A NH1 1 
ATOM   1857 N NH2 . ARG A 1 254 ? 48.350 53.371 2.948   1.00 34.36 ? 284 ARG A NH2 1 
ATOM   1858 N N   . ILE A 1 255 ? 51.900 50.709 9.119   1.00 23.87 ? 285 ILE A N   1 
ATOM   1859 C CA  . ILE A 1 255 ? 52.089 51.943 9.880   1.00 24.31 ? 285 ILE A CA  1 
ATOM   1860 C C   . ILE A 1 255 ? 53.549 52.183 10.158  1.00 24.90 ? 285 ILE A C   1 
ATOM   1861 O O   . ILE A 1 255 ? 54.021 53.326 10.051  1.00 24.27 ? 285 ILE A O   1 
ATOM   1862 C CB  . ILE A 1 255 ? 51.314 51.886 11.214  1.00 22.72 ? 285 ILE A CB  1 
ATOM   1863 C CG1 . ILE A 1 255 ? 49.804 51.906 10.908  1.00 24.08 ? 285 ILE A CG1 1 
ATOM   1864 C CG2 . ILE A 1 255 ? 51.704 53.106 12.099  1.00 26.68 ? 285 ILE A CG2 1 
ATOM   1865 C CD1 . ILE A 1 255 ? 48.899 51.650 12.175  1.00 26.48 ? 285 ILE A CD1 1 
ATOM   1866 N N   . GLY A 1 256 ? 54.276 51.112 10.515  1.00 24.14 ? 286 GLY A N   1 
ATOM   1867 C CA  . GLY A 1 256 ? 55.723 51.203 10.746  1.00 23.09 ? 286 GLY A CA  1 
ATOM   1868 C C   . GLY A 1 256 ? 56.468 51.692 9.491   1.00 23.69 ? 286 GLY A C   1 
ATOM   1869 O O   . GLY A 1 256 ? 57.382 52.517 9.591   1.00 24.62 ? 286 GLY A O   1 
ATOM   1870 N N   . CYS A 1 257 ? 56.088 51.177 8.327   1.00 24.12 ? 287 CYS A N   1 
ATOM   1871 C CA  . CYS A 1 257 ? 56.694 51.630 7.063   1.00 24.72 ? 287 CYS A CA  1 
ATOM   1872 C C   . CYS A 1 257 ? 56.424 53.124 6.864   1.00 24.71 ? 287 CYS A C   1 
ATOM   1873 O O   . CYS A 1 257 ? 57.317 53.884 6.466   1.00 26.64 ? 287 CYS A O   1 
ATOM   1874 C CB  . CYS A 1 257 ? 56.118 50.831 5.896   1.00 25.20 ? 287 CYS A CB  1 
ATOM   1875 S SG  . CYS A 1 257 ? 56.753 49.118 5.864   1.00 30.10 ? 287 CYS A SG  1 
ATOM   1876 N N   . GLN A 1 258 ? 55.190 53.536 7.122   1.00 25.88 ? 288 GLN A N   1 
ATOM   1877 C CA  . GLN A 1 258 ? 54.819 54.939 6.971   1.00 25.64 ? 288 GLN A CA  1 
ATOM   1878 C C   . GLN A 1 258 ? 55.631 55.841 7.908   1.00 26.25 ? 288 GLN A C   1 
ATOM   1879 O O   . GLN A 1 258 ? 56.116 56.917 7.500   1.00 26.79 ? 288 GLN A O   1 
ATOM   1880 C CB  . GLN A 1 258 ? 53.320 55.082 7.216   1.00 24.23 ? 288 GLN A CB  1 
ATOM   1881 C CG  . GLN A 1 258 ? 52.492 54.491 6.080   1.00 25.27 ? 288 GLN A CG  1 
ATOM   1882 C CD  . GLN A 1 258 ? 51.035 54.514 6.421   1.00 31.64 ? 288 GLN A CD  1 
ATOM   1883 O OE1 . GLN A 1 258 ? 50.628 54.044 7.484   1.00 31.34 ? 288 GLN A OE1 1 
ATOM   1884 N NE2 . GLN A 1 258 ? 50.242 55.091 5.547   1.00 31.39 ? 288 GLN A NE2 1 
ATOM   1885 N N   . GLN A 1 259 ? 55.790 55.410 9.158   1.00 25.09 ? 289 GLN A N   1 
ATOM   1886 C CA  . GLN A 1 259 ? 56.638 56.144 10.108  1.00 25.34 ? 289 GLN A CA  1 
ATOM   1887 C C   . GLN A 1 259 ? 58.093 56.257 9.636   1.00 27.18 ? 289 GLN A C   1 
ATOM   1888 O O   . GLN A 1 259 ? 58.683 57.345 9.661   1.00 27.39 ? 289 GLN A O   1 
ATOM   1889 C CB  . GLN A 1 259 ? 56.616 55.489 11.496  1.00 26.77 ? 289 GLN A CB  1 
ATOM   1890 C CG  . GLN A 1 259 ? 55.266 55.634 12.200  1.00 28.65 ? 289 GLN A CG  1 
ATOM   1891 C CD  . GLN A 1 259 ? 55.337 55.254 13.670  1.00 30.08 ? 289 GLN A CD  1 
ATOM   1892 O OE1 . GLN A 1 259 ? 56.420 55.008 14.206  1.00 30.94 ? 289 GLN A OE1 1 
ATOM   1893 N NE2 . GLN A 1 259 ? 54.179 55.201 14.329  1.00 29.97 ? 289 GLN A NE2 1 
ATOM   1894 N N   . LEU A 1 260 ? 58.675 55.140 9.205   1.00 26.79 ? 290 LEU A N   1 
ATOM   1895 C CA  . LEU A 1 260 ? 60.058 55.159 8.734   1.00 27.44 ? 290 LEU A CA  1 
ATOM   1896 C C   . LEU A 1 260 ? 60.226 56.079 7.540   1.00 26.61 ? 290 LEU A C   1 
ATOM   1897 O O   . LEU A 1 260 ? 61.203 56.842 7.455   1.00 26.70 ? 290 LEU A O   1 
ATOM   1898 C CB  . LEU A 1 260 ? 60.501 53.743 8.354   1.00 27.84 ? 290 LEU A CB  1 
ATOM   1899 C CG  . LEU A 1 260 ? 60.922 52.902 9.551   1.00 28.69 ? 290 LEU A CG  1 
ATOM   1900 C CD1 . LEU A 1 260 ? 61.041 51.428 9.109   1.00 30.09 ? 290 LEU A CD1 1 
ATOM   1901 C CD2 . LEU A 1 260 ? 62.234 53.410 10.155  1.00 27.92 ? 290 LEU A CD2 1 
ATOM   1902 N N   . LYS A 1 261 ? 59.293 56.007 6.604   1.00 26.12 ? 291 LYS A N   1 
ATOM   1903 C CA  . LYS A 1 261 ? 59.405 56.830 5.395   1.00 26.69 ? 291 LYS A CA  1 
ATOM   1904 C C   . LYS A 1 261 ? 59.272 58.318 5.723   1.00 29.32 ? 291 LYS A C   1 
ATOM   1905 O O   . LYS A 1 261 ? 60.034 59.142 5.193   1.00 30.14 ? 291 LYS A O   1 
ATOM   1906 C CB  . LYS A 1 261 ? 58.346 56.454 4.368   1.00 27.97 ? 291 LYS A CB  1 
ATOM   1907 C CG  . LYS A 1 261 ? 58.539 57.181 3.052   1.00 32.27 ? 291 LYS A CG  1 
ATOM   1908 C CD  . LYS A 1 261 ? 57.649 56.649 1.952   1.00 34.89 ? 291 LYS A CD  1 
ATOM   1909 C CE  . LYS A 1 261 ? 57.879 57.459 0.686   1.00 46.06 ? 291 LYS A CE  1 
ATOM   1910 N NZ  . LYS A 1 261 ? 56.794 57.223 -0.293  1.00 50.81 ? 291 LYS A NZ  1 
ATOM   1911 N N   . ALA A 1 262 ? 58.327 58.659 6.597   1.00 28.52 ? 292 ALA A N   1 
ATOM   1912 C CA  . ALA A 1 262 ? 58.052 60.072 6.913   1.00 29.59 ? 292 ALA A CA  1 
ATOM   1913 C C   . ALA A 1 262 ? 59.037 60.661 7.914   1.00 31.85 ? 292 ALA A C   1 
ATOM   1914 O O   . ALA A 1 262 ? 59.425 61.816 7.788   1.00 31.48 ? 292 ALA A O   1 
ATOM   1915 C CB  . ALA A 1 262 ? 56.643 60.242 7.424   1.00 31.03 ? 292 ALA A CB  1 
ATOM   1916 N N   . ARG A 1 263 ? 59.465 59.876 8.896   1.00 31.91 ? 293 ARG A N   1 
ATOM   1917 C CA  . ARG A 1 263 ? 60.241 60.426 10.020  1.00 32.76 ? 293 ARG A CA  1 
ATOM   1918 C C   . ARG A 1 263 ? 61.633 59.837 10.207  1.00 31.27 ? 293 ARG A C   1 
ATOM   1919 O O   . ARG A 1 263 ? 62.417 60.325 11.030  1.00 30.96 ? 293 ARG A O   1 
ATOM   1920 C CB  . ARG A 1 263 ? 59.442 60.246 11.315  1.00 35.44 ? 293 ARG A CB  1 
ATOM   1921 C CG  . ARG A 1 263 ? 58.050 60.903 11.271  1.00 44.87 ? 293 ARG A CG  1 
ATOM   1922 C CD  . ARG A 1 263 ? 57.467 61.058 12.664  1.00 64.89 ? 293 ARG A CD  1 
ATOM   1923 N NE  . ARG A 1 263 ? 56.535 59.991 13.048  1.00 70.40 ? 293 ARG A NE  1 
ATOM   1924 C CZ  . ARG A 1 263 ? 55.214 60.149 13.144  1.00 73.71 ? 293 ARG A CZ  1 
ATOM   1925 N NH1 . ARG A 1 263 ? 54.657 61.326 12.865  1.00 76.51 ? 293 ARG A NH1 1 
ATOM   1926 N NH2 . ARG A 1 263 ? 54.445 59.134 13.524  1.00 68.55 ? 293 ARG A NH2 1 
ATOM   1927 N N   . GLY A 1 264 ? 61.935 58.755 9.493   1.00 29.25 ? 294 GLY A N   1 
ATOM   1928 C CA  . GLY A 1 264 ? 63.232 58.104 9.640   1.00 30.04 ? 294 GLY A CA  1 
ATOM   1929 C C   . GLY A 1 264 ? 63.422 57.426 10.988  1.00 30.03 ? 294 GLY A C   1 
ATOM   1930 O O   . GLY A 1 264 ? 64.543 57.143 11.399  1.00 27.88 ? 294 GLY A O   1 
ATOM   1931 N N   . GLU A 1 265 ? 62.313 57.165 11.676  1.00 28.13 ? 295 GLU A N   1 
ATOM   1932 C CA  . GLU A 1 265 ? 62.335 56.398 12.916  1.00 31.89 ? 295 GLU A CA  1 
ATOM   1933 C C   . GLU A 1 265 ? 60.984 55.738 13.084  1.00 31.00 ? 295 GLU A C   1 
ATOM   1934 O O   . GLU A 1 265 ? 60.018 56.110 12.420  1.00 31.03 ? 295 GLU A O   1 
ATOM   1935 C CB  . GLU A 1 265 ? 62.704 57.267 14.137  1.00 34.21 ? 295 GLU A CB  1 
ATOM   1936 C CG  . GLU A 1 265 ? 61.708 58.338 14.535  1.00 41.25 ? 295 GLU A CG  1 
ATOM   1937 C CD  . GLU A 1 265 ? 62.042 58.974 15.910  1.00 40.18 ? 295 GLU A CD  1 
ATOM   1938 N N   . VAL A 1 266 ? 60.922 54.738 13.955  1.00 27.80 ? 296 VAL A N   1 
ATOM   1939 C CA  . VAL A 1 266 ? 59.679 54.011 14.164  1.00 29.53 ? 296 VAL A CA  1 
ATOM   1940 C C   . VAL A 1 266 ? 59.567 53.644 15.657  1.00 29.76 ? 296 VAL A C   1 
ATOM   1941 O O   . VAL A 1 266 ? 60.569 53.335 16.307  1.00 30.63 ? 296 VAL A O   1 
ATOM   1942 C CB  . VAL A 1 266 ? 59.582 52.763 13.218  1.00 30.05 ? 296 VAL A CB  1 
ATOM   1943 C CG1 . VAL A 1 266 ? 60.692 51.766 13.493  1.00 28.52 ? 296 VAL A CG1 1 
ATOM   1944 C CG2 . VAL A 1 266 ? 58.200 52.075 13.311  1.00 28.56 ? 296 VAL A CG2 1 
ATOM   1945 N N   . ASP A 1 267 ? 58.356 53.715 16.191  1.00 28.62 ? 297 ASP A N   1 
ATOM   1946 C CA  . ASP A 1 267 ? 58.116 53.314 17.572  1.00 26.76 ? 297 ASP A CA  1 
ATOM   1947 C C   . ASP A 1 267 ? 57.180 52.119 17.511  1.00 25.32 ? 297 ASP A C   1 
ATOM   1948 O O   . ASP A 1 267 ? 55.965 52.264 17.491  1.00 25.59 ? 297 ASP A O   1 
ATOM   1949 C CB  . ASP A 1 267 ? 57.525 54.481 18.352  1.00 29.73 ? 297 ASP A CB  1 
ATOM   1950 C CG  . ASP A 1 267 ? 57.291 54.152 19.825  1.00 32.15 ? 297 ASP A CG  1 
ATOM   1951 O OD1 . ASP A 1 267 ? 57.450 52.980 20.254  1.00 28.88 ? 297 ASP A OD1 1 
ATOM   1952 O OD2 . ASP A 1 267 ? 56.942 55.097 20.556  1.00 32.83 ? 297 ASP A OD2 1 
ATOM   1953 N N   . ILE A 1 268 ? 57.772 50.938 17.428  1.00 23.51 ? 298 ILE A N   1 
ATOM   1954 C CA  . ILE A 1 268 ? 57.002 49.725 17.217  1.00 24.95 ? 298 ILE A CA  1 
ATOM   1955 C C   . ILE A 1 268 ? 56.169 49.402 18.458  1.00 25.71 ? 298 ILE A C   1 
ATOM   1956 O O   . ILE A 1 268 ? 55.003 49.022 18.358  1.00 25.22 ? 298 ILE A O   1 
ATOM   1957 C CB  . ILE A 1 268 ? 57.903 48.571 16.841  1.00 25.34 ? 298 ILE A CB  1 
ATOM   1958 C CG1 . ILE A 1 268 ? 58.526 48.853 15.460  1.00 25.86 ? 298 ILE A CG1 1 
ATOM   1959 C CG2 . ILE A 1 268 ? 57.094 47.271 16.808  1.00 25.46 ? 298 ILE A CG2 1 
ATOM   1960 C CD1 . ILE A 1 268 ? 59.770 47.948 15.113  1.00 27.30 ? 298 ILE A CD1 1 
ATOM   1961 N N   . LEU A 1 269 ? 56.768 49.565 19.632  1.00 23.20 ? 299 LEU A N   1 
ATOM   1962 C CA  . LEU A 1 269 ? 56.006 49.338 20.863  1.00 24.02 ? 299 LEU A CA  1 
ATOM   1963 C C   . LEU A 1 269 ? 54.766 50.240 20.875  1.00 24.23 ? 299 LEU A C   1 
ATOM   1964 O O   . LEU A 1 269 ? 53.641 49.785 21.192  1.00 25.99 ? 299 LEU A O   1 
ATOM   1965 C CB  . LEU A 1 269 ? 56.915 49.615 22.065  1.00 23.94 ? 299 LEU A CB  1 
ATOM   1966 C CG  . LEU A 1 269 ? 56.200 49.650 23.434  1.00 27.23 ? 299 LEU A CG  1 
ATOM   1967 C CD1 . LEU A 1 269 ? 55.430 48.355 23.724  1.00 26.06 ? 299 LEU A CD1 1 
ATOM   1968 C CD2 . LEU A 1 269 ? 57.188 49.956 24.556  1.00 24.94 ? 299 LEU A CD2 1 
ATOM   1969 N N   . GLY A 1 270 ? 54.955 51.519 20.535  1.00 24.91 ? 300 GLY A N   1 
ATOM   1970 C CA  . GLY A 1 270 ? 53.836 52.466 20.457  1.00 25.18 ? 300 GLY A CA  1 
ATOM   1971 C C   . GLY A 1 270 ? 52.779 52.050 19.453  1.00 24.66 ? 300 GLY A C   1 
ATOM   1972 O O   . GLY A 1 270 ? 51.587 52.139 19.729  1.00 25.84 ? 300 GLY A O   1 
ATOM   1973 N N   . ILE A 1 271 ? 53.202 51.602 18.271  1.00 24.94 ? 301 ILE A N   1 
ATOM   1974 C CA  . ILE A 1 271 ? 52.246 51.166 17.254  1.00 25.19 ? 301 ILE A CA  1 
ATOM   1975 C C   . ILE A 1 271 ? 51.355 50.039 17.777  1.00 24.69 ? 301 ILE A C   1 
ATOM   1976 O O   . ILE A 1 271 ? 50.134 50.085 17.634  1.00 24.73 ? 301 ILE A O   1 
ATOM   1977 C CB  . ILE A 1 271 ? 52.993 50.700 15.973  1.00 26.24 ? 301 ILE A CB  1 
ATOM   1978 C CG1 . ILE A 1 271 ? 53.532 51.928 15.221  1.00 26.42 ? 301 ILE A CG1 1 
ATOM   1979 C CG2 . ILE A 1 271 ? 52.047 49.888 15.075  1.00 27.17 ? 301 ILE A CG2 1 
ATOM   1980 C CD1 . ILE A 1 271 ? 54.639 51.582 14.175  1.00 26.48 ? 301 ILE A CD1 1 
ATOM   1981 N N   . VAL A 1 272 ? 51.976 49.042 18.391  1.00 24.37 ? 302 VAL A N   1 
ATOM   1982 C CA  . VAL A 1 272 ? 51.240 47.889 18.901  1.00 24.76 ? 302 VAL A CA  1 
ATOM   1983 C C   . VAL A 1 272 ? 50.279 48.334 20.018  1.00 25.12 ? 302 VAL A C   1 
ATOM   1984 O O   . VAL A 1 272 ? 49.122 47.901 20.066  1.00 23.76 ? 302 VAL A O   1 
ATOM   1985 C CB  . VAL A 1 272 ? 52.196 46.776 19.342  1.00 25.45 ? 302 VAL A CB  1 
ATOM   1986 C CG1 . VAL A 1 272 ? 51.443 45.631 19.997  1.00 24.98 ? 302 VAL A CG1 1 
ATOM   1987 C CG2 . VAL A 1 272 ? 52.948 46.233 18.100  1.00 24.47 ? 302 VAL A CG2 1 
ATOM   1988 N N   . CYS A 1 273 ? 50.754 49.217 20.896  1.00 25.09 ? 303 CYS A N   1 
ATOM   1989 C CA  . CYS A 1 273 ? 49.890 49.748 21.956  1.00 25.18 ? 303 CYS A CA  1 
ATOM   1990 C C   . CYS A 1 273 ? 48.677 50.463 21.381  1.00 25.74 ? 303 CYS A C   1 
ATOM   1991 O O   . CYS A 1 273 ? 47.557 50.270 21.857  1.00 24.29 ? 303 CYS A O   1 
ATOM   1992 C CB  . CYS A 1 273 ? 50.669 50.711 22.854  1.00 27.46 ? 303 CYS A CB  1 
ATOM   1993 S SG  . CYS A 1 273 ? 51.800 49.848 23.954  1.00 29.01 ? 303 CYS A SG  1 
ATOM   1994 N N   . GLN A 1 274 ? 48.885 51.308 20.370  1.00 23.88 ? 304 GLN A N   1 
ATOM   1995 C CA  . GLN A 1 274 ? 47.748 51.998 19.751  1.00 25.36 ? 304 GLN A CA  1 
ATOM   1996 C C   . GLN A 1 274 ? 46.779 51.022 19.076  1.00 25.67 ? 304 GLN A C   1 
ATOM   1997 O O   . GLN A 1 274 ? 45.548 51.204 19.155  1.00 26.05 ? 304 GLN A O   1 
ATOM   1998 C CB  . GLN A 1 274 ? 48.221 53.095 18.780  1.00 24.90 ? 304 GLN A CB  1 
ATOM   1999 C CG  . GLN A 1 274 ? 49.049 54.226 19.442  1.00 28.08 ? 304 GLN A CG  1 
ATOM   2000 C CD  . GLN A 1 274 ? 48.326 54.956 20.583  1.00 33.38 ? 304 GLN A CD  1 
ATOM   2001 O OE1 . GLN A 1 274 ? 47.136 55.237 20.512  1.00 29.93 ? 304 GLN A OE1 1 
ATOM   2002 N NE2 . GLN A 1 274 ? 49.069 55.294 21.619  1.00 34.07 ? 304 GLN A NE2 1 
ATOM   2003 N N   . LEU A 1 275 ? 47.298 49.981 18.430  1.00 22.18 ? 305 LEU A N   1 
ATOM   2004 C CA  . LEU A 1 275 ? 46.424 48.974 17.835  1.00 21.88 ? 305 LEU A CA  1 
ATOM   2005 C C   . LEU A 1 275 ? 45.541 48.308 18.906  1.00 24.35 ? 305 LEU A C   1 
ATOM   2006 O O   . LEU A 1 275 ? 44.359 48.035 18.665  1.00 25.38 ? 305 LEU A O   1 
ATOM   2007 C CB  . LEU A 1 275 ? 47.249 47.871 17.145  1.00 21.64 ? 305 LEU A CB  1 
ATOM   2008 C CG  . LEU A 1 275 ? 47.935 48.382 15.856  1.00 22.55 ? 305 LEU A CG  1 
ATOM   2009 C CD1 . LEU A 1 275 ? 48.695 47.215 15.243  1.00 25.40 ? 305 LEU A CD1 1 
ATOM   2010 C CD2 . LEU A 1 275 ? 46.862 48.922 14.909  1.00 24.67 ? 305 LEU A CD2 1 
ATOM   2011 N N   . ARG A 1 276 ? 46.136 48.020 20.068  1.00 23.63 ? 306 ARG A N   1 
ATOM   2012 C CA  . ARG A 1 276 ? 45.396 47.377 21.144  1.00 25.71 ? 306 ARG A CA  1 
ATOM   2013 C C   . ARG A 1 276 ? 44.302 48.225 21.775  1.00 23.26 ? 306 ARG A C   1 
ATOM   2014 O O   . ARG A 1 276 ? 43.291 47.674 22.244  1.00 25.55 ? 306 ARG A O   1 
ATOM   2015 C CB  . ARG A 1 276 ? 46.348 46.828 22.189  1.00 25.40 ? 306 ARG A CB  1 
ATOM   2016 C CG  . ARG A 1 276 ? 47.019 45.615 21.550  1.00 28.60 ? 306 ARG A CG  1 
ATOM   2017 C CD  . ARG A 1 276 ? 47.579 44.705 22.519  1.00 32.12 ? 306 ARG A CD  1 
ATOM   2018 N NE  . ARG A 1 276 ? 48.262 43.583 21.874  1.00 25.72 ? 306 ARG A NE  1 
ATOM   2019 C CZ  . ARG A 1 276 ? 48.960 42.713 22.572  1.00 28.72 ? 306 ARG A CZ  1 
ATOM   2020 N NH1 . ARG A 1 276 ? 49.023 42.865 23.905  1.00 25.03 ? 306 ARG A NH1 1 
ATOM   2021 N NH2 . ARG A 1 276 ? 49.568 41.715 21.966  1.00 26.11 ? 306 ARG A NH2 1 
ATOM   2022 N N   . LEU A 1 277 ? 44.521 49.533 21.797  1.00 23.62 ? 307 LEU A N   1 
ATOM   2023 C CA  . LEU A 1 277 ? 43.454 50.486 22.171  1.00 25.72 ? 307 LEU A CA  1 
ATOM   2024 C C   . LEU A 1 277 ? 42.263 50.369 21.216  1.00 29.07 ? 307 LEU A C   1 
ATOM   2025 O O   . LEU A 1 277 ? 41.112 50.451 21.646  1.00 27.20 ? 307 LEU A O   1 
ATOM   2026 C CB  . LEU A 1 277 ? 43.966 51.919 22.232  1.00 24.51 ? 307 LEU A CB  1 
ATOM   2027 C CG  . LEU A 1 277 ? 44.901 52.186 23.418  1.00 25.48 ? 307 LEU A CG  1 
ATOM   2028 C CD1 . LEU A 1 277 ? 45.683 53.456 23.259  1.00 25.84 ? 307 LEU A CD1 1 
ATOM   2029 C CD2 . LEU A 1 277 ? 44.107 52.193 24.772  1.00 26.82 ? 307 LEU A CD2 1 
ATOM   2030 N N   . ASP A 1 278 ? 42.544 50.099 19.935  1.00 26.91 ? 308 ASP A N   1 
ATOM   2031 C CA  . ASP A 1 278 ? 41.518 49.987 18.885  1.00 24.64 ? 308 ASP A CA  1 
ATOM   2032 C C   . ASP A 1 278 ? 40.831 48.627 18.846  1.00 24.22 ? 308 ASP A C   1 
ATOM   2033 O O   . ASP A 1 278 ? 39.614 48.533 18.582  1.00 26.41 ? 308 ASP A O   1 
ATOM   2034 C CB  . ASP A 1 278 ? 42.148 50.305 17.472  1.00 24.63 ? 308 ASP A CB  1 
ATOM   2035 C CG  . ASP A 1 278 ? 42.763 51.712 17.375  1.00 36.14 ? 308 ASP A CG  1 
ATOM   2036 O OD1 . ASP A 1 278 ? 42.404 52.592 18.201  1.00 37.47 ? 308 ASP A OD1 1 
ATOM   2037 O OD2 . ASP A 1 278 ? 43.622 51.961 16.460  1.00 31.73 ? 308 ASP A OD2 1 
ATOM   2038 N N   . ARG A 1 279 ? 41.582 47.552 19.093  1.00 22.31 ? 309 ARG A N   1 
ATOM   2039 C CA  . ARG A 1 279 ? 40.992 46.209 19.116  1.00 23.60 ? 309 ARG A CA  1 
ATOM   2040 C C   . ARG A 1 279 ? 41.904 45.335 19.977  1.00 24.51 ? 309 ARG A C   1 
ATOM   2041 O O   . ARG A 1 279 ? 43.113 45.239 19.727  1.00 23.43 ? 309 ARG A O   1 
ATOM   2042 C CB  . ARG A 1 279 ? 40.849 45.621 17.699  1.00 23.96 ? 309 ARG A CB  1 
ATOM   2043 C CG  . ARG A 1 279 ? 40.339 44.170 17.617  1.00 24.19 ? 309 ARG A CG  1 
ATOM   2044 C CD  . ARG A 1 279 ? 39.985 43.833 16.139  1.00 24.26 ? 309 ARG A CD  1 
ATOM   2045 N NE  . ARG A 1 279 ? 39.667 42.422 15.886  1.00 25.43 ? 309 ARG A NE  1 
ATOM   2046 C CZ  . ARG A 1 279 ? 38.447 41.892 16.004  1.00 31.58 ? 309 ARG A CZ  1 
ATOM   2047 N NH1 . ARG A 1 279 ? 37.424 42.637 16.428  1.00 26.85 ? 309 ARG A NH1 1 
ATOM   2048 N NH2 . ARG A 1 279 ? 38.252 40.611 15.720  1.00 28.52 ? 309 ARG A NH2 1 
ATOM   2049 N N   . GLY A 1 280 ? 41.326 44.729 21.013  1.00 25.84 ? 310 GLY A N   1 
ATOM   2050 C CA  . GLY A 1 280 ? 42.134 43.963 21.967  1.00 25.27 ? 310 GLY A CA  1 
ATOM   2051 C C   . GLY A 1 280 ? 42.879 42.810 21.316  1.00 22.97 ? 310 GLY A C   1 
ATOM   2052 O O   . GLY A 1 280 ? 42.337 42.090 20.479  1.00 25.65 ? 310 GLY A O   1 
ATOM   2053 N N   . GLY A 1 281 ? 44.137 42.630 21.717  1.00 23.55 ? 311 GLY A N   1 
ATOM   2054 C CA  . GLY A 1 281 ? 44.871 41.419 21.372  1.00 25.34 ? 311 GLY A CA  1 
ATOM   2055 C C   . GLY A 1 281 ? 45.668 41.475 20.056  1.00 24.94 ? 311 GLY A C   1 
ATOM   2056 O O   . GLY A 1 281 ? 46.304 40.482 19.683  1.00 25.00 ? 311 GLY A O   1 
ATOM   2057 N N   . MET A 1 282 ? 45.645 42.625 19.375  1.00 23.45 ? 312 MET A N   1 
ATOM   2058 C CA  . MET A 1 282 ? 46.330 42.752 18.051  1.00 24.58 ? 312 MET A CA  1 
ATOM   2059 C C   . MET A 1 282 ? 47.818 42.403 18.189  1.00 24.50 ? 312 MET A C   1 
ATOM   2060 O O   . MET A 1 282 ? 48.500 42.922 19.094  1.00 24.39 ? 312 MET A O   1 
ATOM   2061 C CB  . MET A 1 282 ? 46.195 44.180 17.518  1.00 25.38 ? 312 MET A CB  1 
ATOM   2062 C CG  . MET A 1 282 ? 44.723 44.603 17.278  1.00 29.41 ? 312 MET A CG  1 
ATOM   2063 S SD  . MET A 1 282 ? 44.140 44.003 15.683  1.00 36.74 ? 312 MET A SD  1 
ATOM   2064 C CE  . MET A 1 282 ? 44.602 45.384 14.653  1.00 34.31 ? 312 MET A CE  1 
ATOM   2065 N N   . ILE A 1 283 ? 48.291 41.553 17.269  1.00 24.06 ? 313 ILE A N   1 
ATOM   2066 C CA  . ILE A 1 283 ? 49.624 40.878 17.321  1.00 23.60 ? 313 ILE A CA  1 
ATOM   2067 C C   . ILE A 1 283 ? 49.651 39.857 18.469  1.00 24.98 ? 313 ILE A C   1 
ATOM   2068 O O   . ILE A 1 283 ? 49.699 40.230 19.644  1.00 24.57 ? 313 ILE A O   1 
ATOM   2069 C CB  . ILE A 1 283 ? 50.814 41.845 17.448  1.00 24.34 ? 313 ILE A CB  1 
ATOM   2070 C CG1 . ILE A 1 283 ? 50.744 42.877 16.298  1.00 30.18 ? 313 ILE A CG1 1 
ATOM   2071 C CG2 . ILE A 1 283 ? 52.161 41.035 17.465  1.00 23.62 ? 313 ILE A CG2 1 
ATOM   2072 C CD1 . ILE A 1 283 ? 52.019 43.431 15.896  1.00 35.47 ? 313 ILE A CD1 1 
ATOM   2073 N N   . GLN A 1 284 ? 49.636 38.588 18.105  1.00 23.34 ? 314 GLN A N   1 
ATOM   2074 C CA  . GLN A 1 284 ? 49.412 37.528 19.067  1.00 24.02 ? 314 GLN A CA  1 
ATOM   2075 C C   . GLN A 1 284 ? 50.661 37.009 19.788  1.00 26.34 ? 314 GLN A C   1 
ATOM   2076 O O   . GLN A 1 284 ? 50.603 36.707 20.983  1.00 25.03 ? 314 GLN A O   1 
ATOM   2077 C CB  . GLN A 1 284 ? 48.614 36.402 18.399  1.00 24.27 ? 314 GLN A CB  1 
ATOM   2078 C CG  A GLN A 1 284 ? 47.088 36.711 18.492  0.50 24.56 ? 314 GLN A CG  1 
ATOM   2079 C CG  B GLN A 1 284 ? 48.297 35.220 19.262  0.50 25.31 ? 314 GLN A CG  1 
ATOM   2080 C CD  A GLN A 1 284 ? 46.218 35.658 17.842  0.50 25.99 ? 314 GLN A CD  1 
ATOM   2081 C CD  B GLN A 1 284 ? 47.923 33.976 18.462  0.50 27.76 ? 314 GLN A CD  1 
ATOM   2082 O OE1 A GLN A 1 284 ? 46.491 35.229 16.742  0.50 27.49 ? 314 GLN A OE1 1 
ATOM   2083 O OE1 B GLN A 1 284 ? 47.671 34.035 17.252  0.50 31.49 ? 314 GLN A OE1 1 
ATOM   2084 N NE2 A GLN A 1 284 ? 45.177 35.223 18.538  0.50 27.37 ? 314 GLN A NE2 1 
ATOM   2085 N NE2 B GLN A 1 284 ? 47.892 32.837 19.141  0.50 37.68 ? 314 GLN A NE2 1 
ATOM   2086 N N   . THR A 1 285 ? 51.796 36.937 19.104  1.00 24.14 ? 315 THR A N   1 
ATOM   2087 C CA  . THR A 1 285 ? 52.949 36.219 19.691  1.00 24.22 ? 315 THR A CA  1 
ATOM   2088 C C   . THR A 1 285 ? 54.196 37.079 19.716  1.00 26.30 ? 315 THR A C   1 
ATOM   2089 O O   . THR A 1 285 ? 54.364 37.989 18.888  1.00 22.99 ? 315 THR A O   1 
ATOM   2090 C CB  . THR A 1 285 ? 53.273 34.909 18.919  1.00 25.09 ? 315 THR A CB  1 
ATOM   2091 O OG1 . THR A 1 285 ? 53.917 35.226 17.669  1.00 24.88 ? 315 THR A OG1 1 
ATOM   2092 C CG2 . THR A 1 285 ? 51.982 34.072 18.632  1.00 25.11 ? 315 THR A CG2 1 
ATOM   2093 N N   . ALA A 1 286 ? 55.105 36.768 20.648  1.00 22.90 ? 316 ALA A N   1 
ATOM   2094 C CA  . ALA A 1 286 ? 56.407 37.433 20.682  1.00 23.69 ? 316 ALA A CA  1 
ATOM   2095 C C   . ALA A 1 286 ? 57.170 37.221 19.372  1.00 23.17 ? 316 ALA A C   1 
ATOM   2096 O O   . ALA A 1 286 ? 57.903 38.117 18.929  1.00 21.35 ? 316 ALA A O   1 
ATOM   2097 C CB  . ALA A 1 286 ? 57.239 36.914 21.883  1.00 24.72 ? 316 ALA A CB  1 
ATOM   2098 N N   . GLU A 1 287 ? 57.031 36.044 18.760  1.00 21.71 ? 317 GLU A N   1 
ATOM   2099 C CA  . GLU A 1 287 ? 57.707 35.782 17.492  1.00 25.82 ? 317 GLU A CA  1 
ATOM   2100 C C   . GLU A 1 287 ? 57.215 36.746 16.409  1.00 24.62 ? 317 GLU A C   1 
ATOM   2101 O O   . GLU A 1 287 ? 58.002 37.240 15.586  1.00 22.33 ? 317 GLU A O   1 
ATOM   2102 C CB  . GLU A 1 287 ? 57.487 34.327 17.068  1.00 27.29 ? 317 GLU A CB  1 
ATOM   2103 C CG  . GLU A 1 287 ? 58.142 33.970 15.732  1.00 31.35 ? 317 GLU A CG  1 
ATOM   2104 C CD  . GLU A 1 287 ? 57.897 32.518 15.290  1.00 39.63 ? 317 GLU A CD  1 
ATOM   2105 O OE1 . GLU A 1 287 ? 56.763 31.986 15.471  1.00 42.04 ? 317 GLU A OE1 1 
ATOM   2106 O OE2 . GLU A 1 287 ? 58.849 31.923 14.731  1.00 53.69 ? 317 GLU A OE2 1 
ATOM   2107 N N   . GLN A 1 288 ? 55.900 36.992 16.380  1.00 22.15 ? 318 GLN A N   1 
ATOM   2108 C CA  . GLN A 1 288 ? 55.334 37.970 15.411  1.00 22.17 ? 318 GLN A CA  1 
ATOM   2109 C C   . GLN A 1 288 ? 55.864 39.361 15.698  1.00 21.87 ? 318 GLN A C   1 
ATOM   2110 O O   . GLN A 1 288 ? 56.174 40.114 14.779  1.00 21.06 ? 318 GLN A O   1 
ATOM   2111 C CB  . GLN A 1 288 ? 53.801 37.973 15.491  1.00 22.21 ? 318 GLN A CB  1 
ATOM   2112 C CG  . GLN A 1 288 ? 53.183 36.686 14.906  1.00 21.59 ? 318 GLN A CG  1 
ATOM   2113 C CD  . GLN A 1 288 ? 51.669 36.608 15.152  1.00 22.39 ? 318 GLN A CD  1 
ATOM   2114 O OE1 . GLN A 1 288 ? 51.133 37.285 16.048  1.00 24.44 ? 318 GLN A OE1 1 
ATOM   2115 N NE2 . GLN A 1 288 ? 50.983 35.768 14.364  1.00 22.98 ? 318 GLN A NE2 1 
ATOM   2116 N N   . TYR A 1 289 ? 55.994 39.703 16.979  1.00 22.64 ? 319 TYR A N   1 
ATOM   2117 C CA  . TYR A 1 289 ? 56.519 41.024 17.360  1.00 23.42 ? 319 TYR A CA  1 
ATOM   2118 C C   . TYR A 1 289 ? 57.982 41.183 16.948  1.00 24.67 ? 319 TYR A C   1 
ATOM   2119 O O   . TYR A 1 289 ? 58.403 42.237 16.464  1.00 24.09 ? 319 TYR A O   1 
ATOM   2120 C CB  . TYR A 1 289 ? 56.372 41.181 18.874  1.00 23.06 ? 319 TYR A CB  1 
ATOM   2121 C CG  . TYR A 1 289 ? 56.669 42.554 19.438  1.00 25.00 ? 319 TYR A CG  1 
ATOM   2122 C CD1 . TYR A 1 289 ? 55.801 43.655 19.175  1.00 22.78 ? 319 TYR A CD1 1 
ATOM   2123 C CD2 . TYR A 1 289 ? 57.748 42.747 20.304  1.00 25.24 ? 319 TYR A CD2 1 
ATOM   2124 C CE1 . TYR A 1 289 ? 56.055 44.910 19.733  1.00 24.86 ? 319 TYR A CE1 1 
ATOM   2125 C CE2 . TYR A 1 289 ? 58.010 44.007 20.867  1.00 25.48 ? 319 TYR A CE2 1 
ATOM   2126 C CZ  . TYR A 1 289 ? 57.150 45.069 20.587  1.00 25.12 ? 319 TYR A CZ  1 
ATOM   2127 O OH  . TYR A 1 289 ? 57.391 46.311 21.129  1.00 26.25 ? 319 TYR A OH  1 
ATOM   2128 N N   . GLN A 1 290 ? 58.759 40.121 17.103  1.00 22.44 ? 320 GLN A N   1 
ATOM   2129 C CA  . GLN A 1 290 ? 60.149 40.160 16.648  1.00 23.00 ? 320 GLN A CA  1 
ATOM   2130 C C   . GLN A 1 290 ? 60.214 40.230 15.115  1.00 22.59 ? 320 GLN A C   1 
ATOM   2131 O O   . GLN A 1 290 ? 61.076 40.898 14.544  1.00 24.26 ? 320 GLN A O   1 
ATOM   2132 C CB  . GLN A 1 290 ? 60.877 38.917 17.142  1.00 23.72 ? 320 GLN A CB  1 
ATOM   2133 C CG  . GLN A 1 290 ? 61.084 38.979 18.671  1.00 25.75 ? 320 GLN A CG  1 
ATOM   2134 C CD  . GLN A 1 290 ? 61.684 37.704 19.192  1.00 42.43 ? 320 GLN A CD  1 
ATOM   2135 O OE1 . GLN A 1 290 ? 61.296 36.614 18.770  1.00 43.51 ? 320 GLN A OE1 1 
ATOM   2136 N NE2 . GLN A 1 290 ? 62.635 37.824 20.108  1.00 34.78 ? 320 GLN A NE2 1 
ATOM   2137 N N   . PHE A 1 291 ? 59.297 39.552 14.464  1.00 21.27 ? 321 PHE A N   1 
ATOM   2138 C CA  . PHE A 1 291 ? 59.246 39.564 12.981  1.00 22.34 ? 321 PHE A CA  1 
ATOM   2139 C C   . PHE A 1 291 ? 58.945 40.980 12.459  1.00 24.04 ? 321 PHE A C   1 
ATOM   2140 O O   . PHE A 1 291 ? 59.435 41.399 11.393  1.00 22.31 ? 321 PHE A O   1 
ATOM   2141 C CB  . PHE A 1 291 ? 58.183 38.581 12.482  1.00 22.06 ? 321 PHE A CB  1 
ATOM   2142 C CG  . PHE A 1 291 ? 58.233 38.353 10.971  1.00 25.04 ? 321 PHE A CG  1 
ATOM   2143 C CD1 . PHE A 1 291 ? 59.145 37.456 10.422  1.00 29.35 ? 321 PHE A CD1 1 
ATOM   2144 C CD2 . PHE A 1 291 ? 57.369 39.037 10.128  1.00 27.89 ? 321 PHE A CD2 1 
ATOM   2145 C CE1 . PHE A 1 291 ? 59.199 37.241 9.023   1.00 29.25 ? 321 PHE A CE1 1 
ATOM   2146 C CE2 . PHE A 1 291 ? 57.423 38.833 8.735   1.00 24.24 ? 321 PHE A CE2 1 
ATOM   2147 C CZ  . PHE A 1 291 ? 58.335 37.925 8.198   1.00 25.41 ? 321 PHE A CZ  1 
ATOM   2148 N N   . LEU A 1 292 ? 58.118 41.718 13.187  1.00 22.14 ? 322 LEU A N   1 
ATOM   2149 C CA  . LEU A 1 292 ? 57.850 43.134 12.812  1.00 21.00 ? 322 LEU A CA  1 
ATOM   2150 C C   . LEU A 1 292 ? 59.136 43.934 12.796  1.00 22.84 ? 322 LEU A C   1 
ATOM   2151 O O   . LEU A 1 292 ? 59.325 44.777 11.922  1.00 22.93 ? 322 LEU A O   1 
ATOM   2152 C CB  . LEU A 1 292 ? 56.918 43.768 13.847  1.00 23.45 ? 322 LEU A CB  1 
ATOM   2153 C CG  A LEU A 1 292 ? 55.416 43.555 13.910  0.50 23.70 ? 322 LEU A CG  1 
ATOM   2154 C CG  B LEU A 1 292 ? 56.318 45.133 13.623  0.50 17.79 ? 322 LEU A CG  1 
ATOM   2155 C CD1 A LEU A 1 292 ? 54.882 44.455 15.008  0.50 24.34 ? 322 LEU A CD1 1 
ATOM   2156 C CD1 B LEU A 1 292 ? 55.734 45.258 12.244  0.50 20.11 ? 322 LEU A CD1 1 
ATOM   2157 C CD2 A LEU A 1 292 ? 54.725 43.918 12.605  0.50 26.10 ? 322 LEU A CD2 1 
ATOM   2158 C CD2 B LEU A 1 292 ? 55.233 45.318 14.691  0.50 21.80 ? 322 LEU A CD2 1 
ATOM   2159 N N   . HIS A 1 293 ? 60.007 43.697 13.785  1.00 21.12 ? 323 HIS A N   1 
ATOM   2160 C CA  . HIS A 1 293 ? 61.289 44.389 13.854  1.00 20.83 ? 323 HIS A CA  1 
ATOM   2161 C C   . HIS A 1 293 ? 62.187 44.005 12.658  1.00 23.59 ? 323 HIS A C   1 
ATOM   2162 O O   . HIS A 1 293 ? 62.821 44.864 12.047  1.00 25.15 ? 323 HIS A O   1 
ATOM   2163 C CB  . HIS A 1 293 ? 61.999 44.100 15.181  1.00 20.30 ? 323 HIS A CB  1 
ATOM   2164 C CG  . HIS A 1 293 ? 61.392 44.817 16.359  1.00 23.58 ? 323 HIS A CG  1 
ATOM   2165 N ND1 . HIS A 1 293 ? 60.190 44.442 16.927  1.00 26.63 ? 323 HIS A ND1 1 
ATOM   2166 C CD2 . HIS A 1 293 ? 61.838 45.875 17.088  1.00 25.34 ? 323 HIS A CD2 1 
ATOM   2167 C CE1 . HIS A 1 293 ? 59.910 45.253 17.940  1.00 25.43 ? 323 HIS A CE1 1 
ATOM   2168 N NE2 . HIS A 1 293 ? 60.893 46.132 18.057  1.00 26.11 ? 323 HIS A NE2 1 
ATOM   2169 N N   . HIS A 1 294 ? 62.203 42.717 12.326  1.00 21.85 ? 324 HIS A N   1 
ATOM   2170 C CA  . HIS A 1 294 ? 62.932 42.209 11.148  1.00 23.07 ? 324 HIS A CA  1 
ATOM   2171 C C   . HIS A 1 294 ? 62.415 42.845 9.844   1.00 24.02 ? 324 HIS A C   1 
ATOM   2172 O O   . HIS A 1 294 ? 63.198 43.336 9.013   1.00 22.11 ? 324 HIS A O   1 
ATOM   2173 C CB  . HIS A 1 294 ? 62.747 40.681 11.089  1.00 22.07 ? 324 HIS A CB  1 
ATOM   2174 C CG  . HIS A 1 294 ? 63.288 40.048 9.831   1.00 26.71 ? 324 HIS A CG  1 
ATOM   2175 N ND1 . HIS A 1 294 ? 64.629 39.781 9.656   1.00 25.29 ? 324 HIS A ND1 1 
ATOM   2176 C CD2 . HIS A 1 294 ? 62.668 39.635 8.691   1.00 27.54 ? 324 HIS A CD2 1 
ATOM   2177 C CE1 . HIS A 1 294 ? 64.816 39.218 8.466   1.00 28.43 ? 324 HIS A CE1 1 
ATOM   2178 N NE2 . HIS A 1 294 ? 63.643 39.111 7.864   1.00 27.92 ? 324 HIS A NE2 1 
ATOM   2179 N N   . THR A 1 295 ? 61.101 42.822 9.665   1.00 22.34 ? 325 THR A N   1 
ATOM   2180 C CA  . THR A 1 295 ? 60.448 43.336 8.446   1.00 22.65 ? 325 THR A CA  1 
ATOM   2181 C C   . THR A 1 295 ? 60.781 44.817 8.276   1.00 24.04 ? 325 THR A C   1 
ATOM   2182 O O   . THR A 1 295 ? 61.088 45.298 7.181   1.00 22.34 ? 325 THR A O   1 
ATOM   2183 C CB  . THR A 1 295 ? 58.905 43.150 8.536   1.00 21.81 ? 325 THR A CB  1 
ATOM   2184 O OG1 . THR A 1 295 ? 58.622 41.744 8.648   1.00 24.57 ? 325 THR A OG1 1 
ATOM   2185 C CG2 . THR A 1 295 ? 58.190 43.696 7.274   1.00 22.91 ? 325 THR A CG2 1 
ATOM   2186 N N   . LEU A 1 296 ? 60.680 45.561 9.362   1.00 22.30 ? 326 LEU A N   1 
ATOM   2187 C CA  . LEU A 1 296 ? 60.875 47.009 9.257   1.00 24.00 ? 326 LEU A CA  1 
ATOM   2188 C C   . LEU A 1 296 ? 62.357 47.372 9.037   1.00 23.59 ? 326 LEU A C   1 
ATOM   2189 O O   . LEU A 1 296 ? 62.653 48.370 8.361   1.00 25.59 ? 326 LEU A O   1 
ATOM   2190 C CB  . LEU A 1 296 ? 60.232 47.737 10.459  1.00 22.15 ? 326 LEU A CB  1 
ATOM   2191 C CG  . LEU A 1 296 ? 58.683 47.641 10.457  1.00 21.57 ? 326 LEU A CG  1 
ATOM   2192 C CD1 . LEU A 1 296 ? 58.130 48.195 11.776  1.00 25.39 ? 326 LEU A CD1 1 
ATOM   2193 C CD2 . LEU A 1 296 ? 58.028 48.367 9.272   1.00 25.12 ? 326 LEU A CD2 1 
ATOM   2194 N N   . ALA A 1 297 ? 63.275 46.586 9.615   1.00 23.75 ? 327 ALA A N   1 
ATOM   2195 C CA  . ALA A 1 297 ? 64.712 46.731 9.336   1.00 23.37 ? 327 ALA A CA  1 
ATOM   2196 C C   . ALA A 1 297 ? 64.956 46.530 7.827   1.00 26.47 ? 327 ALA A C   1 
ATOM   2197 O O   . ALA A 1 297 ? 65.740 47.263 7.206   1.00 27.28 ? 327 ALA A O   1 
ATOM   2198 C CB  . ALA A 1 297 ? 65.521 45.730 10.140  1.00 23.08 ? 327 ALA A CB  1 
ATOM   2199 N N   . LEU A 1 298 ? 64.299 45.528 7.250   1.00 23.83 ? 328 LEU A N   1 
ATOM   2200 C CA  . LEU A 1 298 ? 64.379 45.323 5.795   1.00 26.02 ? 328 LEU A CA  1 
ATOM   2201 C C   . LEU A 1 298 ? 63.826 46.506 5.001   1.00 29.56 ? 328 LEU A C   1 
ATOM   2202 O O   . LEU A 1 298 ? 64.448 46.967 4.031   1.00 28.46 ? 328 LEU A O   1 
ATOM   2203 C CB  . LEU A 1 298 ? 63.637 44.041 5.420   1.00 25.23 ? 328 LEU A CB  1 
ATOM   2204 C CG  A LEU A 1 298 ? 64.112 43.136 4.306   0.50 35.23 ? 328 LEU A CG  1 
ATOM   2205 C CG  B LEU A 1 298 ? 64.374 42.799 5.898   0.50 20.41 ? 328 LEU A CG  1 
ATOM   2206 C CD1 A LEU A 1 298 ? 65.406 42.458 4.717   0.50 36.06 ? 328 LEU A CD1 1 
ATOM   2207 C CD1 B LEU A 1 298 ? 63.560 41.592 5.519   0.50 25.92 ? 328 LEU A CD1 1 
ATOM   2208 C CD2 A LEU A 1 298 ? 63.028 42.103 4.061   0.50 30.24 ? 328 LEU A CD2 1 
ATOM   2209 C CD2 B LEU A 1 298 ? 65.804 42.701 5.353   0.50 22.84 ? 328 LEU A CD2 1 
ATOM   2210 N N   . TYR A 1 299 ? 62.653 47.006 5.389   1.00 27.08 ? 329 TYR A N   1 
ATOM   2211 C CA  . TYR A 1 299 ? 62.075 48.148 4.682   1.00 28.44 ? 329 TYR A CA  1 
ATOM   2212 C C   . TYR A 1 299 ? 62.979 49.368 4.780   1.00 27.47 ? 329 TYR A C   1 
ATOM   2213 O O   . TYR A 1 299 ? 63.097 50.135 3.818   1.00 29.45 ? 329 TYR A O   1 
ATOM   2214 C CB  . TYR A 1 299 ? 60.677 48.484 5.239   1.00 26.57 ? 329 TYR A CB  1 
ATOM   2215 C CG  . TYR A 1 299 ? 60.026 49.658 4.568   1.00 23.08 ? 329 TYR A CG  1 
ATOM   2216 C CD1 . TYR A 1 299 ? 59.424 49.510 3.310   1.00 29.97 ? 329 TYR A CD1 1 
ATOM   2217 C CD2 . TYR A 1 299 ? 59.967 50.906 5.197   1.00 25.75 ? 329 TYR A CD2 1 
ATOM   2218 C CE1 . TYR A 1 299 ? 58.799 50.587 2.693   1.00 33.29 ? 329 TYR A CE1 1 
ATOM   2219 C CE2 . TYR A 1 299 ? 59.336 51.991 4.574   1.00 26.20 ? 329 TYR A CE2 1 
ATOM   2220 C CZ  . TYR A 1 299 ? 58.776 51.813 3.328   1.00 30.36 ? 329 TYR A CZ  1 
ATOM   2221 O OH  . TYR A 1 299 ? 58.165 52.874 2.723   1.00 32.57 ? 329 TYR A OH  1 
ATOM   2222 N N   . ALA A 1 300 ? 63.582 49.568 5.947   1.00 26.29 ? 330 ALA A N   1 
ATOM   2223 C CA  . ALA A 1 300 ? 64.470 50.714 6.172   1.00 29.25 ? 330 ALA A CA  1 
ATOM   2224 C C   . ALA A 1 300 ? 65.581 50.776 5.111   1.00 30.28 ? 330 ALA A C   1 
ATOM   2225 O O   . ALA A 1 300 ? 65.964 51.866 4.671   1.00 30.09 ? 330 ALA A O   1 
ATOM   2226 C CB  . ALA A 1 300 ? 65.088 50.671 7.579   1.00 26.98 ? 330 ALA A CB  1 
ATOM   2227 N N   . GLY A 1 301 ? 66.093 49.618 4.705   1.00 30.87 ? 331 GLY A N   1 
ATOM   2228 C CA  . GLY A 1 301 ? 67.179 49.567 3.703   1.00 28.56 ? 331 GLY A CA  1 
ATOM   2229 C C   . GLY A 1 301 ? 66.729 50.037 2.342   1.00 30.43 ? 331 GLY A C   1 
ATOM   2230 O O   . GLY A 1 301 ? 67.544 50.433 1.513   1.00 29.67 ? 331 GLY A O   1 
ATOM   2231 N N   . GLN A 1 302 ? 65.431 50.009 2.092   1.00 28.94 ? 332 GLN A N   1 
ATOM   2232 C CA  . GLN A 1 302 ? 64.909 50.421 0.800   1.00 34.26 ? 332 GLN A CA  1 
ATOM   2233 C C   . GLN A 1 302 ? 64.751 51.928 0.709   1.00 33.31 ? 332 GLN A C   1 
ATOM   2234 O O   . GLN A 1 302 ? 64.569 52.447 -0.380  1.00 35.46 ? 332 GLN A O   1 
ATOM   2235 C CB  . GLN A 1 302 ? 63.552 49.770 0.509   1.00 35.34 ? 332 GLN A CB  1 
ATOM   2236 C CG  . GLN A 1 302 ? 63.557 48.254 0.402   1.00 41.30 ? 332 GLN A CG  1 
ATOM   2237 C CD  . GLN A 1 302 ? 62.127 47.689 0.429   1.00 43.40 ? 332 GLN A CD  1 
ATOM   2238 O OE1 . GLN A 1 302 ? 61.150 48.435 0.300   1.00 50.67 ? 332 GLN A OE1 1 
ATOM   2239 N NE2 . GLN A 1 302 ? 62.008 46.378 0.607   1.00 60.12 ? 332 GLN A NE2 1 
ATOM   2240 N N   . LEU A 1 303 ? 64.820 52.630 1.838   1.00 31.38 ? 333 LEU A N   1 
ATOM   2241 C CA  . LEU A 1 303 ? 64.562 54.074 1.831   1.00 33.28 ? 333 LEU A CA  1 
ATOM   2242 C C   . LEU A 1 303 ? 65.807 54.859 1.423   1.00 36.68 ? 333 LEU A C   1 
ATOM   2243 O O   . LEU A 1 303 ? 66.917 54.512 1.833   1.00 38.03 ? 333 LEU A O   1 
ATOM   2244 C CB  . LEU A 1 303 ? 64.122 54.546 3.218   1.00 33.26 ? 333 LEU A CB  1 
ATOM   2245 C CG  . LEU A 1 303 ? 62.747 54.005 3.635   1.00 32.80 ? 333 LEU A CG  1 
ATOM   2246 C CD1 . LEU A 1 303 ? 62.550 54.291 5.123   1.00 37.89 ? 333 LEU A CD1 1 
ATOM   2247 C CD2 . LEU A 1 303 ? 61.646 54.614 2.805   1.00 37.47 ? 333 LEU A CD2 1 
ATOM   2248 N N   . PRO A 1 304 ? 65.615 55.955 0.679   1.00 42.89 ? 334 PRO A N   1 
ATOM   2249 C CA  . PRO A 1 304 ? 66.742 56.818 0.269   1.00 46.92 ? 334 PRO A CA  1 
ATOM   2250 C C   . PRO A 1 304 ? 67.479 57.441 1.456   1.00 50.63 ? 334 PRO A C   1 
ATOM   2251 O O   . PRO A 1 304 ? 66.914 57.539 2.555   1.00 52.68 ? 334 PRO A O   1 
ATOM   2252 C CB  . PRO A 1 304 ? 66.067 57.915 -0.555  1.00 47.52 ? 334 PRO A CB  1 
ATOM   2253 C CG  . PRO A 1 304 ? 64.630 57.894 -0.153  1.00 48.45 ? 334 PRO A CG  1 
ATOM   2254 C CD  . PRO A 1 304 ? 64.322 56.459 0.186   1.00 42.24 ? 334 PRO A CD  1 
HETATM 2255 P P   . PO4 B 2 .   ? 44.649 35.235 13.935  1.00 26.86 ? 436 PO4 A P   1 
HETATM 2256 O O1  . PO4 B 2 .   ? 44.880 34.157 15.004  1.00 25.07 ? 436 PO4 A O1  1 
HETATM 2257 O O2  . PO4 B 2 .   ? 43.660 34.658 12.977  1.00 26.85 ? 436 PO4 A O2  1 
HETATM 2258 O O3  . PO4 B 2 .   ? 45.952 35.528 13.215  1.00 26.69 ? 436 PO4 A O3  1 
HETATM 2259 O O4  . PO4 B 2 .   ? 44.168 36.451 14.661  1.00 27.26 ? 436 PO4 A O4  1 
HETATM 2260 O O   . HOH C 3 .   ? 49.138 51.863 15.677  1.00 26.51 ? 437 HOH A O   1 
HETATM 2261 O O   . HOH C 3 .   ? 48.134 34.843 14.663  1.00 24.41 ? 438 HOH A O   1 
HETATM 2262 O O   . HOH C 3 .   ? 29.513 45.258 16.026  1.00 32.05 ? 439 HOH A O   1 
HETATM 2263 O O   . HOH C 3 .   ? 60.260 36.153 14.437  1.00 30.10 ? 440 HOH A O   1 
HETATM 2264 O O   . HOH C 3 .   ? 30.378 38.871 13.188  1.00 30.45 ? 441 HOH A O   1 
HETATM 2265 O O   . HOH C 3 .   ? 60.936 47.856 20.269  1.00 29.11 ? 442 HOH A O   1 
HETATM 2266 O O   . HOH C 3 .   ? 59.656 50.067 19.488  1.00 26.90 ? 443 HOH A O   1 
HETATM 2267 O O   . HOH C 3 .   ? 46.266 52.404 15.570  1.00 28.70 ? 444 HOH A O   1 
HETATM 2268 O O   . HOH C 3 .   ? 41.610 37.841 -4.092  1.00 30.34 ? 445 HOH A O   1 
HETATM 2269 O O   . HOH C 3 .   ? 39.415 54.979 14.076  1.00 28.03 ? 446 HOH A O   1 
HETATM 2270 O O   . HOH C 3 .   ? 66.697 45.773 2.728   1.00 27.79 ? 447 HOH A O   1 
HETATM 2271 O O   . HOH C 3 .   ? 38.775 50.608 1.483   1.00 29.73 ? 448 HOH A O   1 
HETATM 2272 O O   . HOH C 3 .   ? 47.292 55.064 15.292  1.00 29.60 ? 449 HOH A O   1 
HETATM 2273 O O   . HOH C 3 .   ? 62.662 44.787 27.247  1.00 34.46 ? 450 HOH A O   1 
HETATM 2274 O O   . HOH C 3 .   ? 31.910 37.981 10.893  1.00 30.75 ? 451 HOH A O   1 
HETATM 2275 O O   . HOH C 3 .   ? 48.128 53.881 8.205   1.00 25.27 ? 452 HOH A O   1 
HETATM 2276 O O   . HOH C 3 .   ? 31.430 49.630 -0.623  1.00 30.09 ? 453 HOH A O   1 
HETATM 2277 O O   . HOH C 3 .   ? 41.641 53.869 4.559   1.00 31.68 ? 454 HOH A O   1 
HETATM 2278 O O   . HOH C 3 .   ? 63.831 34.987 20.810  1.00 29.56 ? 455 HOH A O   1 
HETATM 2279 O O   . HOH C 3 .   ? 37.795 55.992 6.523   1.00 33.69 ? 456 HOH A O   1 
HETATM 2280 O O   . HOH C 3 .   ? 51.648 56.318 13.901  1.00 31.15 ? 457 HOH A O   1 
HETATM 2281 O O   . HOH C 3 .   ? 51.647 54.329 23.425  1.00 31.20 ? 458 HOH A O   1 
HETATM 2282 O O   . HOH C 3 .   ? 27.347 53.647 1.951   1.00 33.54 ? 459 HOH A O   1 
HETATM 2283 O O   . HOH C 3 .   ? 35.524 35.864 17.888  1.00 34.06 ? 460 HOH A O   1 
HETATM 2284 O O   . HOH C 3 .   ? 29.790 52.097 13.464  1.00 37.15 ? 461 HOH A O   1 
HETATM 2285 O O   . HOH C 3 .   ? 46.070 56.983 22.286  1.00 32.53 ? 462 HOH A O   1 
HETATM 2286 O O   . HOH C 3 .   ? 54.423 33.029 16.316  1.00 36.88 ? 463 HOH A O   1 
HETATM 2287 O O   . HOH C 3 .   ? 39.620 53.143 16.203  1.00 30.00 ? 464 HOH A O   1 
HETATM 2288 O O   . HOH C 3 .   ? 54.428 54.727 17.266  1.00 36.40 ? 465 HOH A O   1 
HETATM 2289 O O   . HOH C 3 .   ? 40.399 50.940 24.188  1.00 32.07 ? 466 HOH A O   1 
HETATM 2290 O O   . HOH C 3 .   ? 44.005 44.166 29.288  1.00 30.03 ? 467 HOH A O   1 
HETATM 2291 O O   . HOH C 3 .   ? 54.914 57.908 5.235   1.00 32.03 ? 468 HOH A O   1 
HETATM 2292 O O   . HOH C 3 .   ? 46.191 42.289 29.827  1.00 32.97 ? 469 HOH A O   1 
HETATM 2293 O O   . HOH C 3 .   ? 23.771 56.442 -6.179  1.00 43.32 ? 470 HOH A O   1 
HETATM 2294 O O   . HOH C 3 .   ? 56.438 31.427 12.425  1.00 36.51 ? 471 HOH A O   1 
HETATM 2295 O O   . HOH C 3 .   ? 39.981 35.029 7.066   1.00 38.97 ? 472 HOH A O   1 
HETATM 2296 O O   . HOH C 3 .   ? 36.051 33.541 6.499   1.00 48.04 ? 473 HOH A O   1 
HETATM 2297 O O   . HOH C 3 .   ? 39.807 56.462 29.835  1.00 36.96 ? 474 HOH A O   1 
HETATM 2298 O O   . HOH C 3 .   ? 69.119 56.745 11.680  1.00 40.35 ? 475 HOH A O   1 
HETATM 2299 O O   . HOH C 3 .   ? 33.686 39.613 9.582   1.00 31.69 ? 476 HOH A O   1 
HETATM 2300 O O   . HOH C 3 .   ? 51.379 41.012 24.886  1.00 40.25 ? 477 HOH A O   1 
HETATM 2301 O O   . HOH C 3 .   ? 60.276 34.662 21.059  1.00 35.14 ? 478 HOH A O   1 
HETATM 2302 O O   . HOH C 3 .   ? 41.436 61.438 11.849  1.00 38.80 ? 479 HOH A O   1 
HETATM 2303 O O   . HOH C 3 .   ? 54.064 44.874 -4.548  1.00 36.81 ? 480 HOH A O   1 
HETATM 2304 O O   . HOH C 3 .   ? 59.219 33.740 1.251   1.00 37.57 ? 481 HOH A O   1 
HETATM 2305 O O   . HOH C 3 .   ? 27.934 39.525 12.178  1.00 34.60 ? 482 HOH A O   1 
HETATM 2306 O O   . HOH C 3 .   ? 68.567 37.917 23.602  1.00 32.52 ? 483 HOH A O   1 
HETATM 2307 O O   . HOH C 3 .   ? 55.961 42.172 10.106  1.00 28.92 ? 484 HOH A O   1 
HETATM 2308 O O   . HOH C 3 .   ? 63.815 35.005 32.508  1.00 36.46 ? 485 HOH A O   1 
HETATM 2309 O O   . HOH C 3 .   ? 25.005 37.587 7.797   1.00 41.23 ? 486 HOH A O   1 
HETATM 2310 O O   . HOH C 3 .   ? 51.321 55.530 2.930   1.00 48.39 ? 487 HOH A O   1 
HETATM 2311 O O   . HOH C 3 .   ? 40.297 53.590 18.988  1.00 35.52 ? 488 HOH A O   1 
HETATM 2312 O O   . HOH C 3 .   ? 54.085 37.921 11.650  1.00 36.94 ? 489 HOH A O   1 
HETATM 2313 O O   . HOH C 3 .   ? 22.294 47.352 5.623   1.00 48.34 ? 490 HOH A O   1 
HETATM 2314 O O   . HOH C 3 .   ? 63.679 40.628 15.293  1.00 34.64 ? 491 HOH A O   1 
HETATM 2315 O O   . HOH C 3 .   ? 28.107 43.803 -8.815  1.00 34.35 ? 492 HOH A O   1 
HETATM 2316 O O   . HOH C 3 .   ? 29.753 54.828 -6.256  1.00 45.82 ? 493 HOH A O   1 
HETATM 2317 O O   . HOH C 3 .   ? 45.528 54.297 3.744   1.00 38.38 ? 494 HOH A O   1 
HETATM 2318 O O   . HOH C 3 .   ? 56.276 33.544 20.204  1.00 35.42 ? 495 HOH A O   1 
HETATM 2319 O O   . HOH C 3 .   ? 46.690 38.522 21.473  1.00 32.09 ? 496 HOH A O   1 
HETATM 2320 O O   . HOH C 3 .   ? 49.863 51.408 33.749  1.00 50.79 ? 497 HOH A O   1 
HETATM 2321 O O   . HOH C 3 .   ? 55.705 53.770 3.646   1.00 36.70 ? 498 HOH A O   1 
HETATM 2322 O O   . HOH C 3 .   ? 57.522 52.656 27.341  1.00 38.86 ? 499 HOH A O   1 
HETATM 2323 O O   . HOH C 3 .   ? 38.354 50.653 21.316  1.00 34.90 ? 500 HOH A O   1 
HETATM 2324 O O   . HOH C 3 .   ? 66.503 41.588 17.918  1.00 35.14 ? 501 HOH A O   1 
HETATM 2325 O O   . HOH C 3 .   ? 39.640 41.435 20.767  1.00 37.16 ? 502 HOH A O   1 
HETATM 2326 O O   . HOH C 3 .   ? 65.464 45.085 13.978  1.00 43.00 ? 503 HOH A O   1 
HETATM 2327 O O   . HOH C 3 .   ? 36.135 59.080 12.582  1.00 49.37 ? 504 HOH A O   1 
HETATM 2328 O O   . HOH C 3 .   ? 59.840 34.016 12.820  1.00 44.27 ? 505 HOH A O   1 
HETATM 2329 O O   . HOH C 3 .   ? 39.135 49.606 -5.247  1.00 45.75 ? 506 HOH A O   1 
HETATM 2330 O O   . HOH C 3 .   ? 29.451 32.607 -9.363  1.00 49.69 ? 507 HOH A O   1 
HETATM 2331 O O   . HOH C 3 .   ? 25.317 35.246 5.810   1.00 43.73 ? 508 HOH A O   1 
HETATM 2332 O O   . HOH C 3 .   ? 70.501 51.086 4.531   1.00 48.92 ? 509 HOH A O   1 
HETATM 2333 O O   . HOH C 3 .   ? 44.280 56.954 30.513  1.00 40.61 ? 510 HOH A O   1 
HETATM 2334 O O   . HOH C 3 .   ? 33.556 52.350 -7.328  1.00 46.09 ? 511 HOH A O   1 
HETATM 2335 O O   . HOH C 3 .   ? 63.266 58.122 6.090   1.00 46.98 ? 512 HOH A O   1 
HETATM 2336 O O   . HOH C 3 .   ? 31.448 35.205 21.737  1.00 47.50 ? 513 HOH A O   1 
HETATM 2337 O O   . HOH C 3 .   ? 54.620 55.616 21.863  1.00 36.28 ? 514 HOH A O   1 
HETATM 2338 O O   . HOH C 3 .   ? 67.963 46.682 5.340   1.00 41.21 ? 515 HOH A O   1 
HETATM 2339 O O   . HOH C 3 .   ? 56.429 47.944 1.106   1.00 36.24 ? 516 HOH A O   1 
HETATM 2340 O O   . HOH C 3 .   ? 36.732 46.238 -9.156  1.00 46.17 ? 517 HOH A O   1 
HETATM 2341 O O   . HOH C 3 .   ? 32.249 52.586 17.176  1.00 43.68 ? 518 HOH A O   1 
HETATM 2342 O O   . HOH C 3 .   ? 42.443 33.659 7.889   1.00 31.90 ? 519 HOH A O   1 
HETATM 2343 O O   . HOH C 3 .   ? 38.620 42.911 22.990  1.00 47.59 ? 520 HOH A O   1 
HETATM 2344 O O   . HOH C 3 .   ? 16.500 48.538 8.480   1.00 47.79 ? 521 HOH A O   1 
HETATM 2345 O O   . HOH C 3 .   ? 47.533 58.291 8.139   1.00 53.68 ? 522 HOH A O   1 
HETATM 2346 O O   . HOH C 3 .   ? 29.158 54.016 -8.851  1.00 50.08 ? 523 HOH A O   1 
HETATM 2347 O O   . HOH C 3 .   ? 29.759 49.678 21.089  1.00 46.32 ? 524 HOH A O   1 
HETATM 2348 O O   . HOH C 3 .   ? 66.916 54.577 18.452  1.00 43.53 ? 525 HOH A O   1 
HETATM 2349 O O   . HOH C 3 .   ? 25.220 55.036 -1.544  1.00 42.42 ? 526 HOH A O   1 
HETATM 2350 O O   . HOH C 3 .   ? 24.445 40.824 12.923  1.00 44.81 ? 527 HOH A O   1 
HETATM 2351 O O   . HOH C 3 .   ? 74.423 49.372 4.041   1.00 48.10 ? 528 HOH A O   1 
HETATM 2352 O O   . HOH C 3 .   ? 52.599 45.880 31.646  1.00 45.20 ? 529 HOH A O   1 
HETATM 2353 O O   . HOH C 3 .   ? 51.935 54.981 17.644  1.00 38.37 ? 530 HOH A O   1 
HETATM 2354 O O   . HOH C 3 .   ? 32.677 55.170 19.551  1.00 41.74 ? 531 HOH A O   1 
HETATM 2355 O O   . HOH C 3 .   ? 53.233 29.639 17.101  1.00 43.12 ? 532 HOH A O   1 
HETATM 2356 O O   . HOH C 3 .   ? 34.122 60.028 -0.323  1.00 55.36 ? 533 HOH A O   1 
HETATM 2357 O O   . HOH C 3 .   ? 33.739 50.427 -2.902  1.00 44.43 ? 534 HOH A O   1 
HETATM 2358 O O   . HOH C 3 .   ? 66.344 40.111 11.701  1.00 37.23 ? 535 HOH A O   1 
HETATM 2359 O O   . HOH C 3 .   ? 28.071 55.174 5.885   1.00 49.75 ? 536 HOH A O   1 
HETATM 2360 O O   . HOH C 3 .   ? 61.945 35.086 16.059  1.00 49.61 ? 537 HOH A O   1 
HETATM 2361 O O   . HOH C 3 .   ? 61.256 36.800 -1.367  1.00 41.74 ? 538 HOH A O   1 
HETATM 2362 O O   . HOH C 3 .   ? 36.760 54.306 16.925  1.00 44.13 ? 539 HOH A O   1 
HETATM 2363 O O   . HOH C 3 .   ? 38.096 40.147 23.677  1.00 41.85 ? 540 HOH A O   1 
HETATM 2364 O O   . HOH C 3 .   ? 58.049 41.123 30.573  1.00 43.24 ? 541 HOH A O   1 
HETATM 2365 O O   . HOH C 3 .   ? 73.450 50.993 8.411   1.00 57.37 ? 542 HOH A O   1 
HETATM 2366 O O   . HOH C 3 .   ? 50.285 54.291 15.645  1.00 35.21 ? 543 HOH A O   1 
HETATM 2367 O O   . HOH C 3 .   ? 47.302 55.917 6.724   1.00 33.51 ? 544 HOH A O   1 
HETATM 2368 O O   . HOH C 3 .   ? 64.610 39.546 17.725  1.00 36.77 ? 545 HOH A O   1 
HETATM 2369 O O   . HOH C 3 .   ? 42.119 56.519 5.173   1.00 39.38 ? 546 HOH A O   1 
HETATM 2370 O O   . HOH C 3 .   ? 38.360 49.104 25.102  1.00 42.68 ? 547 HOH A O   1 
HETATM 2371 O O   . HOH C 3 .   ? 38.825 53.331 21.247  1.00 45.88 ? 548 HOH A O   1 
HETATM 2372 O O   . HOH C 3 .   ? 54.161 56.089 3.211   1.00 38.17 ? 549 HOH A O   1 
HETATM 2373 O O   . HOH C 3 .   ? 45.470 36.205 21.467  1.00 40.57 ? 550 HOH A O   1 
HETATM 2374 O O   . HOH C 3 .   ? 39.902 53.100 1.140   1.00 41.10 ? 551 HOH A O   1 
HETATM 2375 O O   . HOH C 3 .   ? 54.950 57.111 17.676  1.00 52.30 ? 552 HOH A O   1 
HETATM 2376 O O   . HOH C 3 .   ? 40.933 59.382 17.679  1.00 46.16 ? 553 HOH A O   1 
HETATM 2377 O O   . HOH C 3 .   ? 37.626 34.112 4.707   1.00 50.33 ? 554 HOH A O   1 
HETATM 2378 O O   . HOH C 3 .   ? 60.096 43.325 -0.467  1.00 47.31 ? 555 HOH A O   1 
HETATM 2379 O O   . HOH C 3 .   ? 62.433 42.914 0.901   1.00 43.21 ? 556 HOH A O   1 
HETATM 2380 O O   . HOH C 3 .   ? 43.284 32.919 18.000  1.00 52.16 ? 557 HOH A O   1 
HETATM 2381 O O   . HOH C 3 .   ? 52.097 55.476 20.466  1.00 39.97 ? 558 HOH A O   1 
HETATM 2382 O O   . HOH C 3 .   ? 56.186 60.046 3.818   1.00 47.63 ? 559 HOH A O   1 
HETATM 2383 O O   . HOH C 3 .   ? 48.449 57.889 23.450  1.00 39.46 ? 560 HOH A O   1 
HETATM 2384 O O   . HOH C 3 .   ? 23.723 51.123 7.428   1.00 44.18 ? 561 HOH A O   1 
HETATM 2385 O O   . HOH C 3 .   ? 26.016 44.087 -10.490 1.00 42.65 ? 562 HOH A O   1 
HETATM 2386 O O   . HOH C 3 .   ? 42.751 41.507 -10.678 1.00 45.76 ? 563 HOH A O   1 
HETATM 2387 O O   . HOH C 3 .   ? 51.893 34.453 0.322   1.00 42.07 ? 564 HOH A O   1 
HETATM 2388 O O   . HOH C 3 .   ? 64.347 44.026 29.228  1.00 48.41 ? 565 HOH A O   1 
HETATM 2389 O O   . HOH C 3 .   ? 32.426 55.207 9.466   1.00 49.31 ? 566 HOH A O   1 
HETATM 2390 O O   . HOH C 3 .   ? 70.559 46.750 6.731   1.00 50.58 ? 567 HOH A O   1 
HETATM 2391 O O   . HOH C 3 .   ? 42.630 32.670 -4.261  1.00 51.94 ? 568 HOH A O   1 
HETATM 2392 O O   . HOH C 3 .   ? 31.335 53.073 19.843  1.00 49.60 ? 569 HOH A O   1 
HETATM 2393 O O   . HOH C 3 .   ? 34.119 54.585 16.722  1.00 49.21 ? 570 HOH A O   1 
HETATM 2394 O O   . HOH C 3 .   ? 48.569 56.726 16.910  1.00 42.27 ? 571 HOH A O   1 
HETATM 2395 O O   . HOH C 3 .   ? 29.205 54.123 9.323   1.00 50.15 ? 572 HOH A O   1 
HETATM 2396 O O   . HOH C 3 .   ? 44.070 39.471 28.959  1.00 45.50 ? 573 HOH A O   1 
HETATM 2397 O O   . HOH C 3 .   ? 25.025 35.521 2.782   1.00 49.81 ? 574 HOH A O   1 
HETATM 2398 O O   . HOH C 3 .   ? 31.019 32.638 20.614  1.00 54.56 ? 575 HOH A O   1 
HETATM 2399 O O   . HOH C 3 .   ? 44.029 55.267 32.739  1.00 41.14 ? 576 HOH A O   1 
HETATM 2400 O O   . HOH C 3 .   ? 45.522 52.360 -0.778  1.00 55.77 ? 577 HOH A O   1 
HETATM 2401 O O   . HOH C 3 .   ? 42.860 31.955 14.682  1.00 41.43 ? 578 HOH A O   1 
HETATM 2402 O O   . HOH C 3 .   ? 40.703 57.635 7.231   1.00 42.87 ? 579 HOH A O   1 
HETATM 2403 O O   . HOH C 3 .   ? 26.778 52.721 -10.342 1.00 46.94 ? 580 HOH A O   1 
HETATM 2404 O O   . HOH C 3 .   ? 77.294 47.273 12.047  1.00 48.43 ? 581 HOH A O   1 
HETATM 2405 O O   . HOH C 3 .   ? 68.936 41.035 16.991  1.00 47.33 ? 582 HOH A O   1 
HETATM 2406 O O   . HOH C 3 .   ? 72.710 47.267 4.383   1.00 48.18 ? 583 HOH A O   1 
HETATM 2407 O O   . HOH C 3 .   ? 37.132 36.888 16.091  1.00 42.69 ? 584 HOH A O   1 
HETATM 2408 O O   . HOH C 3 .   ? 65.437 42.804 15.457  1.00 42.11 ? 585 HOH A O   1 
HETATM 2409 O O   . HOH C 3 .   ? 39.022 48.445 -7.653  1.00 51.41 ? 586 HOH A O   1 
HETATM 2410 O O   . HOH C 3 .   ? 54.120 51.796 3.029   1.00 54.44 ? 587 HOH A O   1 
HETATM 2411 O O   . HOH C 3 .   ? 24.470 51.208 4.816   1.00 46.95 ? 588 HOH A O   1 
HETATM 2412 O O   . HOH C 3 .   ? 30.321 53.673 15.535  1.00 44.72 ? 589 HOH A O   1 
HETATM 2413 O O   . HOH C 3 .   ? 33.805 29.924 9.561   1.00 47.92 ? 590 HOH A O   1 
HETATM 2414 O O   . HOH C 3 .   ? 58.702 47.797 -0.144  1.00 44.42 ? 591 HOH A O   1 
HETATM 2415 O O   . HOH C 3 .   ? 21.703 44.258 -6.126  1.00 47.53 ? 592 HOH A O   1 
HETATM 2416 O O   . HOH C 3 .   ? 38.277 32.503 22.398  1.00 55.80 ? 593 HOH A O   1 
HETATM 2417 O O   . HOH C 3 .   ? 42.372 48.577 -8.477  1.00 50.85 ? 594 HOH A O   1 
HETATM 2418 O O   . HOH C 3 .   ? 28.302 56.362 -2.578  1.00 47.78 ? 595 HOH A O   1 
HETATM 2419 O O   . HOH C 3 .   ? 69.352 41.088 26.214  1.00 55.18 ? 596 HOH A O   1 
HETATM 2420 O O   . HOH C 3 .   ? 37.319 31.800 -6.021  1.00 55.88 ? 597 HOH A O   1 
HETATM 2421 O O   . HOH C 3 .   ? 53.738 29.115 5.279   1.00 57.06 ? 598 HOH A O   1 
HETATM 2422 O O   . HOH C 3 .   ? 74.800 45.118 10.880  1.00 54.42 ? 599 HOH A O   1 
HETATM 2423 O O   . HOH C 3 .   ? 58.536 63.705 5.856   1.00 59.51 ? 600 HOH A O   1 
HETATM 2424 O O   . HOH C 3 .   ? 22.970 41.650 15.664  1.00 51.23 ? 601 HOH A O   1 
HETATM 2425 O O   . HOH C 3 .   ? 21.224 48.789 13.627  1.00 53.89 ? 602 HOH A O   1 
HETATM 2426 O O   . HOH C 3 .   ? 29.993 31.180 17.472  1.00 52.92 ? 603 HOH A O   1 
HETATM 2427 O O   . HOH C 3 .   ? 73.055 50.308 6.029   1.00 55.85 ? 604 HOH A O   1 
HETATM 2428 O O   . HOH C 3 .   ? 62.308 40.027 -1.579  1.00 56.66 ? 605 HOH A O   1 
HETATM 2429 O O   . HOH C 3 .   ? 38.059 54.070 -0.737  1.00 54.77 ? 606 HOH A O   1 
HETATM 2430 O O   . HOH C 3 .   ? 52.019 57.329 23.352  1.00 46.33 ? 607 HOH A O   1 
HETATM 2431 O O   . HOH C 3 .   ? 53.699 53.241 30.244  1.00 61.23 ? 608 HOH A O   1 
HETATM 2432 O O   . HOH C 3 .   ? 56.536 46.066 -4.511  1.00 53.23 ? 609 HOH A O   1 
HETATM 2433 O O   . HOH C 3 .   ? 49.858 46.917 32.491  1.00 56.43 ? 610 HOH A O   1 
HETATM 2434 O O   . HOH C 3 .   ? 57.611 34.364 -2.674  1.00 50.32 ? 611 HOH A O   1 
HETATM 2435 O O   . HOH C 3 .   ? 51.875 38.789 28.891  1.00 50.01 ? 612 HOH A O   1 
HETATM 2436 O O   . HOH C 3 .   ? 23.821 53.810 -11.764 1.00 47.25 ? 613 HOH A O   1 
HETATM 2437 O O   . HOH C 3 .   ? 60.172 48.541 26.542  1.00 46.71 ? 614 HOH A O   1 
HETATM 2438 O O   . HOH C 3 .   ? 54.475 34.656 1.196   1.00 45.43 ? 615 HOH A O   1 
HETATM 2439 O O   . HOH C 3 .   ? 23.022 44.272 18.075  1.00 58.35 ? 616 HOH A O   1 
HETATM 2440 O O   . HOH C 3 .   ? 57.839 57.279 15.080  1.00 55.88 ? 617 HOH A O   1 
HETATM 2441 O O   . HOH C 3 .   ? 54.257 62.844 8.735   1.00 52.23 ? 618 HOH A O   1 
HETATM 2442 O O   . HOH C 3 .   ? 38.148 51.930 -6.222  1.00 64.05 ? 619 HOH A O   1 
HETATM 2443 O O   . HOH C 3 .   ? 45.183 56.797 5.114   1.00 43.91 ? 620 HOH A O   1 
HETATM 2444 O O   . HOH C 3 .   ? 67.056 42.517 12.713  1.00 50.20 ? 621 HOH A O   1 
HETATM 2445 O O   . HOH C 3 .   ? 35.263 56.485 7.238   1.00 52.71 ? 622 HOH A O   1 
HETATM 2446 O O   . HOH C 3 .   ? 51.629 49.365 33.902  1.00 54.58 ? 623 HOH A O   1 
HETATM 2447 O O   . HOH C 3 .   ? 54.698 57.752 23.433  1.00 54.18 ? 624 HOH A O   1 
HETATM 2448 O O   . HOH C 3 .   ? 59.339 45.744 -1.281  1.00 59.15 ? 625 HOH A O   1 
HETATM 2449 O O   . HOH C 3 .   ? 47.520 46.082 32.669  1.00 46.93 ? 626 HOH A O   1 
HETATM 2450 O O   . HOH C 3 .   ? 68.517 44.517 11.903  1.00 52.09 ? 627 HOH A O   1 
HETATM 2451 O O   . HOH C 3 .   ? 54.627 42.403 -6.125  1.00 53.33 ? 628 HOH A O   1 
HETATM 2452 O O   . HOH C 3 .   ? 45.133 48.104 -8.286  1.00 49.53 ? 629 HOH A O   1 
HETATM 2453 O O   . HOH C 3 .   ? 54.499 57.516 1.002   1.00 58.43 ? 630 HOH A O   1 
HETATM 2454 O O   . HOH C 3 .   ? 55.059 50.417 0.666   1.00 56.14 ? 631 HOH A O   1 
HETATM 2455 O O   . HOH C 3 .   ? 29.435 52.243 -11.707 1.00 59.32 ? 632 HOH A O   1 
HETATM 2456 O O   . HOH C 3 .   ? 23.812 50.645 16.636  1.00 56.43 ? 633 HOH A O   1 
HETATM 2457 O O   . HOH C 3 .   ? 30.082 32.750 -1.885  1.00 56.66 ? 634 HOH A O   1 
HETATM 2458 O O   . HOH C 3 .   ? 16.467 51.835 0.413   1.00 56.36 ? 635 HOH A O   1 
HETATM 2459 O O   . HOH C 3 .   ? 60.636 45.571 28.722  1.00 50.95 ? 636 HOH A O   1 
HETATM 2460 O O   . HOH C 3 .   ? 32.164 50.039 -10.299 1.00 58.15 ? 637 HOH A O   1 
HETATM 2461 O O   . HOH C 3 .   ? 17.418 50.716 -9.072  1.00 51.11 ? 638 HOH A O   1 
HETATM 2462 O O   . HOH C 3 .   ? 48.974 37.630 22.952  1.00 46.40 ? 639 HOH A O   1 
HETATM 2463 O O   . HOH C 3 .   ? 62.764 53.389 -1.716  1.00 57.39 ? 640 HOH A O   1 
HETATM 2464 O O   . HOH C 3 .   ? 60.244 51.439 26.842  1.00 62.93 ? 641 HOH A O   1 
HETATM 2465 O O   . HOH C 3 .   ? 37.337 56.462 15.476  1.00 50.09 ? 642 HOH A O   1 
HETATM 2466 O O   . HOH C 3 .   ? 21.210 36.095 0.857   1.00 65.88 ? 643 HOH A O   1 
HETATM 2467 O O   . HOH C 3 .   ? 35.687 54.684 -0.232  1.00 54.49 ? 644 HOH A O   1 
HETATM 2468 O O   . HOH C 3 .   ? 64.290 54.688 22.469  1.00 54.01 ? 645 HOH A O   1 
HETATM 2469 O O   . HOH C 3 .   ? 67.672 34.925 30.275  1.00 53.74 ? 646 HOH A O   1 
HETATM 2470 O O   . HOH C 3 .   ? 37.322 30.196 21.758  1.00 57.37 ? 647 HOH A O   1 
HETATM 2471 O O   . HOH C 3 .   ? 43.306 54.193 2.581   1.00 45.62 ? 648 HOH A O   1 
HETATM 2472 O O   . HOH C 3 .   ? 62.521 58.375 3.259   1.00 55.46 ? 649 HOH A O   1 
HETATM 2473 O O   . HOH C 3 .   ? 56.292 33.121 0.052   1.00 56.13 ? 650 HOH A O   1 
HETATM 2474 O O   . HOH C 3 .   ? 32.511 30.851 19.425  1.00 59.37 ? 651 HOH A O   1 
HETATM 2475 O O   . HOH C 3 .   ? 69.733 51.613 2.191   1.00 59.34 ? 652 HOH A O   1 
HETATM 2476 O O   . HOH C 3 .   ? 57.570 31.479 9.692   1.00 57.16 ? 653 HOH A O   1 
HETATM 2477 O O   . HOH C 3 .   ? 52.249 46.386 -6.155  1.00 64.98 ? 654 HOH A O   1 
HETATM 2478 O O   . HOH C 3 .   ? 43.917 59.367 16.991  1.00 51.82 ? 655 HOH A O   1 
HETATM 2479 O O   . HOH C 3 .   ? 37.189 27.987 20.239  1.00 57.12 ? 656 HOH A O   1 
HETATM 2480 O O   . HOH C 3 .   ? 69.161 60.029 1.778   1.00 64.12 ? 657 HOH A O   1 
HETATM 2481 O O   . HOH C 3 .   ? 54.916 40.557 12.143  1.00 32.05 ? 658 HOH A O   1 
HETATM 2482 O O   . HOH C 3 .   ? 41.539 43.142 29.361  1.00 47.42 ? 659 HOH A O   1 
HETATM 2483 O O   . HOH C 3 .   ? 54.416 33.661 3.620   1.00 49.98 ? 660 HOH A O   1 
HETATM 2484 O O   . HOH C 3 .   ? 24.248 47.764 7.963   1.00 49.46 ? 661 HOH A O   1 
HETATM 2485 O O   . HOH C 3 .   ? 20.411 41.712 -5.659  1.00 51.69 ? 662 HOH A O   1 
HETATM 2486 O O   . HOH C 3 .   ? 47.860 44.282 -8.951  1.00 61.20 ? 663 HOH A O   1 
HETATM 2487 O O   . HOH C 3 .   ? 66.012 41.980 28.786  1.00 53.71 ? 664 HOH A O   1 
HETATM 2488 O O   . HOH C 3 .   ? 59.962 34.396 -1.211  1.00 49.60 ? 665 HOH A O   1 
HETATM 2489 O O   . HOH C 3 .   ? 24.706 48.065 4.473   1.00 52.75 ? 666 HOH A O   1 
HETATM 2490 O O   . HOH C 3 .   ? 49.140 34.022 -1.587  1.00 53.82 ? 667 HOH A O   1 
HETATM 2491 O O   . HOH C 3 .   ? 31.237 48.956 -12.595 1.00 58.36 ? 668 HOH A O   1 
HETATM 2492 O O   . HOH C 3 .   ? 22.294 54.527 2.756   1.00 53.01 ? 669 HOH A O   1 
HETATM 2493 O O   . HOH C 3 .   ? 36.811 55.009 19.725  1.00 50.51 ? 670 HOH A O   1 
HETATM 2494 O O   . HOH C 3 .   ? 50.074 29.700 -0.778  1.00 60.41 ? 671 HOH A O   1 
HETATM 2495 O O   . HOH C 3 .   ? 42.903 52.187 -0.174  1.00 66.29 ? 672 HOH A O   1 
HETATM 2496 O O   . HOH C 3 .   ? 44.327 27.577 15.840  1.00 56.91 ? 673 HOH A O   1 
HETATM 2497 O O   . HOH C 3 .   ? 19.462 45.842 -5.008  1.00 54.44 ? 674 HOH A O   1 
HETATM 2498 O O   . HOH C 3 .   ? 43.519 37.975 -15.508 1.00 60.64 ? 675 HOH A O   1 
HETATM 2499 O O   . HOH C 3 .   ? 46.229 29.105 9.630   1.00 40.21 ? 676 HOH A O   1 
HETATM 2500 O O   . HOH C 3 .   ? 30.938 50.761 -15.008 1.00 63.95 ? 677 HOH A O   1 
HETATM 2501 O O   . HOH C 3 .   ? 26.912 44.242 -13.019 1.00 59.15 ? 678 HOH A O   1 
HETATM 2502 O O   . HOH C 3 .   ? 25.664 40.415 25.224  1.00 60.39 ? 679 HOH A O   1 
HETATM 2503 O O   . HOH C 3 .   ? 55.449 30.534 8.063   1.00 61.05 ? 680 HOH A O   1 
HETATM 2504 O O   . HOH C 3 .   ? 43.042 29.477 11.829  1.00 49.72 ? 681 HOH A O   1 
HETATM 2505 O O   . HOH C 3 .   ? 70.981 37.606 19.159  1.00 64.46 ? 682 HOH A O   1 
HETATM 2506 O O   . HOH C 3 .   ? 67.851 49.646 19.933  1.00 52.59 ? 683 HOH A O   1 
HETATM 2507 O O   . HOH C 3 .   ? 33.462 55.251 5.495   1.00 51.15 ? 684 HOH A O   1 
HETATM 2508 O O   . HOH C 3 .   ? 31.621 55.890 14.241  1.00 56.64 ? 685 HOH A O   1 
HETATM 2509 O O   . HOH C 3 .   ? 26.918 52.644 12.189  1.00 55.41 ? 686 HOH A O   1 
HETATM 2510 O O   . HOH C 3 .   ? 21.229 37.311 3.753   1.00 57.50 ? 687 HOH A O   1 
HETATM 2511 O O   . HOH C 3 .   ? 67.780 52.600 20.013  1.00 52.66 ? 688 HOH A O   1 
HETATM 2512 O O   . HOH C 3 .   ? 46.565 35.379 -13.314 1.00 57.34 ? 689 HOH A O   1 
HETATM 2513 O O   . HOH C 3 .   ? 34.345 57.098 0.162   1.00 60.33 ? 690 HOH A O   1 
HETATM 2514 O O   . HOH C 3 .   ? 55.772 40.822 31.973  1.00 63.09 ? 691 HOH A O   1 
HETATM 2515 O O   . HOH C 3 .   ? 57.080 57.687 19.590  1.00 58.87 ? 692 HOH A O   1 
HETATM 2516 O O   . HOH C 3 .   ? 33.312 59.101 11.223  1.00 63.10 ? 693 HOH A O   1 
HETATM 2517 O O   . HOH C 3 .   ? 63.044 43.942 31.553  1.00 60.50 ? 694 HOH A O   1 
HETATM 2518 O O   . HOH C 3 .   ? 70.979 44.296 18.833  1.00 66.01 ? 695 HOH A O   1 
HETATM 2519 O O   . HOH C 3 .   ? 41.315 51.473 -2.534  1.00 55.02 ? 696 HOH A O   1 
HETATM 2520 O O   . HOH C 3 .   ? 52.694 52.470 32.509  1.00 64.21 ? 697 HOH A O   1 
HETATM 2521 O O   . HOH C 3 .   ? 33.878 57.374 3.409   1.00 58.71 ? 698 HOH A O   1 
HETATM 2522 O O   . HOH C 3 .   ? 57.954 52.777 0.254   1.00 50.38 ? 699 HOH A O   1 
HETATM 2523 O O   . HOH C 3 .   ? 57.621 57.012 22.742  1.00 59.11 ? 700 HOH A O   1 
HETATM 2524 O O   . HOH C 3 .   ? 64.379 38.335 13.339  1.00 58.66 ? 701 HOH A O   1 
HETATM 2525 O O   . HOH C 3 .   ? 63.182 33.202 14.136  1.00 58.41 ? 702 HOH A O   1 
HETATM 2526 O O   . HOH C 3 .   ? 49.269 27.585 12.784  1.00 45.60 ? 703 HOH A O   1 
HETATM 2527 O O   . HOH C 3 .   ? 54.641 51.477 -2.514  1.00 61.09 ? 704 HOH A O   1 
HETATM 2528 O O   . HOH C 3 .   ? 36.980 59.544 9.822   1.00 54.49 ? 705 HOH A O   1 
HETATM 2529 O O   . HOH C 3 .   ? 75.525 46.396 13.938  1.00 63.86 ? 706 HOH A O   1 
HETATM 2530 O O   . HOH C 3 .   ? 17.831 52.994 3.965   1.00 59.26 ? 707 HOH A O   1 
HETATM 2531 O O   . HOH C 3 .   ? 59.452 57.547 17.236  1.00 53.91 ? 708 HOH A O   1 
HETATM 2532 O O   . HOH C 3 .   ? 34.736 29.368 20.689  1.00 67.90 ? 709 HOH A O   1 
HETATM 2533 O O   . HOH C 3 .   ? 64.331 41.853 32.802  1.00 67.86 ? 710 HOH A O   1 
HETATM 2534 O O   . HOH C 3 .   ? 53.615 62.419 6.327   1.00 65.74 ? 711 HOH A O   1 
HETATM 2535 O O   . HOH C 3 .   ? 70.155 56.336 9.206   1.00 62.45 ? 712 HOH A O   1 
HETATM 2536 O O   . HOH C 3 .   ? 70.190 36.504 21.457  1.00 46.15 ? 713 HOH A O   1 
HETATM 2537 O O   . HOH C 3 .   ? 38.760 31.096 9.337   1.00 49.03 ? 714 HOH A O   1 
HETATM 2538 O O   . HOH C 3 .   ? 36.340 28.390 11.421  1.00 54.69 ? 715 HOH A O   1 
HETATM 2539 O O   . HOH C 3 .   ? 38.035 25.927 7.072   1.00 63.92 ? 716 HOH A O   1 
HETATM 2540 O O   . HOH C 3 .   ? 35.204 27.156 8.116   1.00 61.69 ? 717 HOH A O   1 
HETATM 2541 O O   . HOH C 3 .   ? 40.683 30.289 6.266   1.00 85.70 ? 718 HOH A O   1 
HETATM 2542 O O   . HOH C 3 .   ? 35.073 48.336 27.591  1.00 54.71 ? 719 HOH A O   1 
HETATM 2543 O O   . HOH C 3 .   ? 33.071 29.164 15.515  1.00 59.65 ? 720 HOH A O   1 
HETATM 2544 O O   . HOH C 3 .   ? 39.841 59.847 8.893   1.00 55.81 ? 721 HOH A O   1 
HETATM 2545 O O   . HOH C 3 .   ? 38.321 33.335 8.396   1.00 54.30 ? 722 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   31  ?   ?   ?   A . n 
A 1 2   GLY 2   32  ?   ?   ?   A . n 
A 1 3   SER 3   33  ?   ?   ?   A . n 
A 1 4   ASP 4   34  ?   ?   ?   A . n 
A 1 5   LYS 5   35  ?   ?   ?   A . n 
A 1 6   ILE 6   36  ?   ?   ?   A . n 
A 1 7   HIS 7   37  ?   ?   ?   A . n 
A 1 8   HIS 8   38  ?   ?   ?   A . n 
A 1 9   HIS 9   39  ?   ?   ?   A . n 
A 1 10  HIS 10  40  ?   ?   ?   A . n 
A 1 11  HIS 11  41  ?   ?   ?   A . n 
A 1 12  HIS 12  42  ?   ?   ?   A . n 
A 1 13  MET 13  43  ?   ?   ?   A . n 
A 1 14  ASN 14  44  ?   ?   ?   A . n 
A 1 15  THR 15  45  45  THR THR A . n 
A 1 16  PRO 16  46  46  PRO PRO A . n 
A 1 17  ARG 17  47  47  ARG ARG A . n 
A 1 18  GLU 18  48  48  GLU GLU A . n 
A 1 19  VAL 19  49  49  VAL VAL A . n 
A 1 20  THR 20  50  50  THR THR A . n 
A 1 21  LEU 21  51  51  LEU LEU A . n 
A 1 22  HIS 22  52  52  HIS HIS A . n 
A 1 23  PHE 23  53  53  PHE PHE A . n 
A 1 24  LEU 24  54  54  LEU LEU A . n 
A 1 25  ARG 25  55  55  ARG ARG A . n 
A 1 26  THR 26  56  56  THR THR A . n 
A 1 27  ALA 27  57  57  ALA ALA A . n 
A 1 28  GLY 28  58  58  GLY GLY A . n 
A 1 29  HIS 29  59  59  HIS HIS A . n 
A 1 30  PRO 30  60  60  PRO PRO A . n 
A 1 31  LEU 31  61  61  LEU LEU A . n 
A 1 32  THR 32  62  62  THR THR A . n 
A 1 33  ARG 33  63  63  ARG ARG A . n 
A 1 34  TRP 34  64  64  TRP TRP A . n 
A 1 35  ALA 35  65  65  ALA ALA A . n 
A 1 36  LEU 36  66  66  LEU LEU A . n 
A 1 37  GLN 37  67  67  GLN GLN A . n 
A 1 38  ARG 38  68  68  ARG ARG A . n 
A 1 39  GLN 39  69  69  GLN GLN A . n 
A 1 40  PRO 40  70  70  PRO PRO A . n 
A 1 41  PRO 41  71  71  PRO PRO A . n 
A 1 42  SER 42  72  72  SER SER A . n 
A 1 43  PRO 43  73  73  PRO PRO A . n 
A 1 44  LYS 44  74  74  LYS LYS A . n 
A 1 45  GLN 45  75  75  GLN GLN A . n 
A 1 46  LEU 46  76  76  LEU LEU A . n 
A 1 47  GLU 47  77  77  GLU GLU A . n 
A 1 48  GLU 48  78  78  GLU GLU A . n 
A 1 49  GLU 49  79  79  GLU GLU A . n 
A 1 50  PHE 50  80  80  PHE PHE A . n 
A 1 51  LEU 51  81  81  LEU LEU A . n 
A 1 52  LYS 52  82  82  LYS LYS A . n 
A 1 53  ILE 53  83  83  ILE ILE A . n 
A 1 54  PRO 54  84  84  PRO PRO A . n 
A 1 55  SER 55  85  85  SER SER A . n 
A 1 56  ASN 56  86  86  ASN ASN A . n 
A 1 57  PHE 57  87  87  PHE PHE A . n 
A 1 58  VAL 58  88  88  VAL VAL A . n 
A 1 59  SER 59  89  89  SER SER A . n 
A 1 60  PRO 60  90  90  PRO PRO A . n 
A 1 61  GLU 61  91  91  GLU GLU A . n 
A 1 62  ASP 62  92  92  ASP ASP A . n 
A 1 63  LEU 63  93  93  LEU LEU A . n 
A 1 64  ASP 64  94  94  ASP ASP A . n 
A 1 65  ILE 65  95  95  ILE ILE A . n 
A 1 66  PRO 66  96  96  PRO PRO A . n 
A 1 67  GLY 67  97  97  GLY GLY A . n 
A 1 68  HIS 68  98  98  HIS HIS A . n 
A 1 69  ALA 69  99  99  ALA ALA A . n 
A 1 70  SER 70  100 100 SER SER A . n 
A 1 71  LYS 71  101 101 LYS LYS A . n 
A 1 72  ASP 72  102 102 ASP ASP A . n 
A 1 73  ARG 73  103 103 ARG ARG A . n 
A 1 74  TYR 74  104 104 TYR TYR A . n 
A 1 75  LYS 75  105 105 LYS LYS A . n 
A 1 76  THR 76  106 106 THR THR A . n 
A 1 77  ILE 77  107 107 ILE ILE A . n 
A 1 78  LEU 78  108 108 LEU LEU A . n 
A 1 79  PRO 79  109 109 PRO PRO A . n 
A 1 80  ASN 80  110 110 ASN ASN A . n 
A 1 81  PRO 81  111 111 PRO PRO A . n 
A 1 82  GLN 82  112 112 GLN GLN A . n 
A 1 83  SER 83  113 113 SER SER A . n 
A 1 84  ARG 84  114 114 ARG ARG A . n 
A 1 85  VAL 85  115 115 VAL VAL A . n 
A 1 86  CYS 86  116 116 CYS CYS A . n 
A 1 87  LEU 87  117 117 LEU LEU A . n 
A 1 88  GLY 88  118 118 GLY GLY A . n 
A 1 89  ARG 89  119 119 ARG ARG A . n 
A 1 90  ALA 90  120 120 ALA ALA A . n 
A 1 91  GLN 91  121 121 GLN GLN A . n 
A 1 92  SER 92  122 122 SER SER A . n 
A 1 93  GLN 93  123 123 GLN GLN A . n 
A 1 94  GLU 94  124 124 GLU GLU A . n 
A 1 95  ASP 95  125 125 ASP ASP A . n 
A 1 96  GLY 96  126 126 GLY GLY A . n 
A 1 97  ASP 97  127 127 ASP ASP A . n 
A 1 98  TYR 98  128 128 TYR TYR A . n 
A 1 99  ILE 99  129 129 ILE ILE A . n 
A 1 100 ASN 100 130 130 ASN ASN A . n 
A 1 101 ALA 101 131 131 ALA ALA A . n 
A 1 102 ASN 102 132 132 ASN ASN A . n 
A 1 103 TYR 103 133 133 TYR TYR A . n 
A 1 104 ILE 104 134 134 ILE ILE A . n 
A 1 105 ARG 105 135 135 ARG ARG A . n 
A 1 106 GLY 106 136 136 GLY GLY A . n 
A 1 107 TYR 107 137 137 TYR TYR A . n 
A 1 108 ASP 108 138 138 ASP ASP A . n 
A 1 109 GLY 109 139 139 GLY GLY A . n 
A 1 110 LYS 110 140 140 LYS LYS A . n 
A 1 111 GLU 111 141 141 GLU GLU A . n 
A 1 112 LYS 112 142 142 LYS LYS A . n 
A 1 113 VAL 113 143 143 VAL VAL A . n 
A 1 114 TYR 114 144 144 TYR TYR A . n 
A 1 115 ILE 115 145 145 ILE ILE A . n 
A 1 116 ALA 116 146 146 ALA ALA A . n 
A 1 117 THR 117 147 147 THR THR A . n 
A 1 118 GLN 118 148 148 GLN GLN A . n 
A 1 119 GLY 119 149 149 GLY GLY A . n 
A 1 120 PRO 120 150 150 PRO PRO A . n 
A 1 121 MET 121 151 151 MET MET A . n 
A 1 122 PRO 122 152 152 PRO PRO A . n 
A 1 123 ASN 123 153 153 ASN ASN A . n 
A 1 124 THR 124 154 154 THR THR A . n 
A 1 125 VAL 125 155 155 VAL VAL A . n 
A 1 126 SER 126 156 156 SER SER A . n 
A 1 127 ASP 127 157 157 ASP ASP A . n 
A 1 128 PHE 128 158 158 PHE PHE A . n 
A 1 129 TRP 129 159 159 TRP TRP A . n 
A 1 130 GLU 130 160 160 GLU GLU A . n 
A 1 131 MET 131 161 161 MET MET A . n 
A 1 132 VAL 132 162 162 VAL VAL A . n 
A 1 133 TRP 133 163 163 TRP TRP A . n 
A 1 134 GLN 134 164 164 GLN GLN A . n 
A 1 135 GLU 135 165 165 GLU GLU A . n 
A 1 136 GLU 136 166 166 GLU GLU A . n 
A 1 137 VAL 137 167 167 VAL VAL A . n 
A 1 138 SER 138 168 168 SER SER A . n 
A 1 139 LEU 139 169 169 LEU LEU A . n 
A 1 140 ILE 140 170 170 ILE ILE A . n 
A 1 141 VAL 141 171 171 VAL VAL A . n 
A 1 142 MET 142 172 172 MET MET A . n 
A 1 143 LEU 143 173 173 LEU LEU A . n 
A 1 144 THR 144 174 174 THR THR A . n 
A 1 145 GLN 145 175 175 GLN GLN A . n 
A 1 146 LEU 146 176 176 LEU LEU A . n 
A 1 147 ARG 147 177 177 ARG ARG A . n 
A 1 148 GLU 148 178 178 GLU GLU A . n 
A 1 149 GLY 149 179 ?   ?   ?   A . n 
A 1 150 LYS 150 180 ?   ?   ?   A . n 
A 1 151 GLU 151 181 ?   ?   ?   A . n 
A 1 152 LYS 152 182 ?   ?   ?   A . n 
A 1 153 CYS 153 183 183 CYS CYS A . n 
A 1 154 VAL 154 184 184 VAL VAL A . n 
A 1 155 HIS 155 185 185 HIS HIS A . n 
A 1 156 TYR 156 186 186 TYR TYR A . n 
A 1 157 TRP 157 187 187 TRP TRP A . n 
A 1 158 PRO 158 188 188 PRO PRO A . n 
A 1 159 THR 159 189 189 THR THR A . n 
A 1 160 GLU 160 190 190 GLU GLU A . n 
A 1 161 GLU 161 191 191 GLU GLU A . n 
A 1 162 GLU 162 192 192 GLU GLU A . n 
A 1 163 THR 163 193 193 THR THR A . n 
A 1 164 TYR 164 194 194 TYR TYR A . n 
A 1 165 GLY 165 195 195 GLY GLY A . n 
A 1 166 PRO 166 196 196 PRO PRO A . n 
A 1 167 PHE 167 197 197 PHE PHE A . n 
A 1 168 GLN 168 198 198 GLN GLN A . n 
A 1 169 ILE 169 199 199 ILE ILE A . n 
A 1 170 ARG 170 200 200 ARG ARG A . n 
A 1 171 ILE 171 201 201 ILE ILE A . n 
A 1 172 GLN 172 202 202 GLN GLN A . n 
A 1 173 ASP 173 203 203 ASP ASP A . n 
A 1 174 MET 174 204 204 MET MET A . n 
A 1 175 LYS 175 205 205 LYS LYS A . n 
A 1 176 GLU 176 206 206 GLU GLU A . n 
A 1 177 CYS 177 207 207 CYS CYS A . n 
A 1 178 PRO 178 208 208 PRO PRO A . n 
A 1 179 GLU 179 209 209 GLU GLU A . n 
A 1 180 TYR 180 210 210 TYR TYR A . n 
A 1 181 THR 181 211 211 THR THR A . n 
A 1 182 VAL 182 212 212 VAL VAL A . n 
A 1 183 ARG 183 213 213 ARG ARG A . n 
A 1 184 GLN 184 214 214 GLN GLN A . n 
A 1 185 LEU 185 215 215 LEU LEU A . n 
A 1 186 THR 186 216 216 THR THR A . n 
A 1 187 ILE 187 217 217 ILE ILE A . n 
A 1 188 GLN 188 218 218 GLN GLN A . n 
A 1 189 TYR 189 219 219 TYR TYR A . n 
A 1 190 GLN 190 220 220 GLN GLN A . n 
A 1 191 GLU 191 221 221 GLU GLU A . n 
A 1 192 GLU 192 222 222 GLU GLU A . n 
A 1 193 ARG 193 223 223 ARG ARG A . n 
A 1 194 ARG 194 224 224 ARG ARG A . n 
A 1 195 SER 195 225 225 SER SER A . n 
A 1 196 VAL 196 226 226 VAL VAL A . n 
A 1 197 LYS 197 227 227 LYS LYS A . n 
A 1 198 HIS 198 228 228 HIS HIS A . n 
A 1 199 ILE 199 229 229 ILE ILE A . n 
A 1 200 LEU 200 230 230 LEU LEU A . n 
A 1 201 PHE 201 231 231 PHE PHE A . n 
A 1 202 SER 202 232 232 SER SER A . n 
A 1 203 ALA 203 233 233 ALA ALA A . n 
A 1 204 TRP 204 234 234 TRP TRP A . n 
A 1 205 PRO 205 235 235 PRO PRO A . n 
A 1 206 ASP 206 236 236 ASP ASP A . n 
A 1 207 HIS 207 237 237 HIS HIS A . n 
A 1 208 GLN 208 238 238 GLN GLN A . n 
A 1 209 THR 209 239 239 THR THR A . n 
A 1 210 PRO 210 240 240 PRO PRO A . n 
A 1 211 GLU 211 241 241 GLU GLU A . n 
A 1 212 SER 212 242 242 SER SER A . n 
A 1 213 ALA 213 243 243 ALA ALA A . n 
A 1 214 GLY 214 244 244 GLY GLY A . n 
A 1 215 PRO 215 245 245 PRO PRO A . n 
A 1 216 LEU 216 246 246 LEU LEU A . n 
A 1 217 LEU 217 247 247 LEU LEU A . n 
A 1 218 ARG 218 248 248 ARG ARG A . n 
A 1 219 LEU 219 249 249 LEU LEU A . n 
A 1 220 VAL 220 250 250 VAL VAL A . n 
A 1 221 ALA 221 251 251 ALA ALA A . n 
A 1 222 GLU 222 252 252 GLU GLU A . n 
A 1 223 VAL 223 253 253 VAL VAL A . n 
A 1 224 GLU 224 254 254 GLU GLU A . n 
A 1 225 GLU 225 255 255 GLU GLU A . n 
A 1 226 SER 226 256 256 SER SER A . n 
A 1 227 PRO 227 257 257 PRO PRO A . n 
A 1 228 GLU 228 258 258 GLU GLU A . n 
A 1 229 THR 229 259 259 THR THR A . n 
A 1 230 ALA 230 260 260 ALA ALA A . n 
A 1 231 ALA 231 261 261 ALA ALA A . n 
A 1 232 HIS 232 262 262 HIS HIS A . n 
A 1 233 PRO 233 263 263 PRO PRO A . n 
A 1 234 GLY 234 264 264 GLY GLY A . n 
A 1 235 PRO 235 265 265 PRO PRO A . n 
A 1 236 ILE 236 266 266 ILE ILE A . n 
A 1 237 VAL 237 267 267 VAL VAL A . n 
A 1 238 VAL 238 268 268 VAL VAL A . n 
A 1 239 HIS 239 269 269 HIS HIS A . n 
A 1 240 CYS 240 270 270 CYS CYS A . n 
A 1 241 SER 241 271 271 SER SER A . n 
A 1 242 ALA 242 272 272 ALA ALA A . n 
A 1 243 GLY 243 273 273 GLY GLY A . n 
A 1 244 ILE 244 274 274 ILE ILE A . n 
A 1 245 GLY 245 275 275 GLY GLY A . n 
A 1 246 ARG 246 276 276 ARG ARG A . n 
A 1 247 THR 247 277 277 THR THR A . n 
A 1 248 GLY 248 278 278 GLY GLY A . n 
A 1 249 CYS 249 279 279 CYS CYS A . n 
A 1 250 PHE 250 280 280 PHE PHE A . n 
A 1 251 ILE 251 281 281 ILE ILE A . n 
A 1 252 ALA 252 282 282 ALA ALA A . n 
A 1 253 THR 253 283 283 THR THR A . n 
A 1 254 ARG 254 284 284 ARG ARG A . n 
A 1 255 ILE 255 285 285 ILE ILE A . n 
A 1 256 GLY 256 286 286 GLY GLY A . n 
A 1 257 CYS 257 287 287 CYS CYS A . n 
A 1 258 GLN 258 288 288 GLN GLN A . n 
A 1 259 GLN 259 289 289 GLN GLN A . n 
A 1 260 LEU 260 290 290 LEU LEU A . n 
A 1 261 LYS 261 291 291 LYS LYS A . n 
A 1 262 ALA 262 292 292 ALA ALA A . n 
A 1 263 ARG 263 293 293 ARG ARG A . n 
A 1 264 GLY 264 294 294 GLY GLY A . n 
A 1 265 GLU 265 295 295 GLU GLU A . n 
A 1 266 VAL 266 296 296 VAL VAL A . n 
A 1 267 ASP 267 297 297 ASP ASP A . n 
A 1 268 ILE 268 298 298 ILE ILE A . n 
A 1 269 LEU 269 299 299 LEU LEU A . n 
A 1 270 GLY 270 300 300 GLY GLY A . n 
A 1 271 ILE 271 301 301 ILE ILE A . n 
A 1 272 VAL 272 302 302 VAL VAL A . n 
A 1 273 CYS 273 303 303 CYS CYS A . n 
A 1 274 GLN 274 304 304 GLN GLN A . n 
A 1 275 LEU 275 305 305 LEU LEU A . n 
A 1 276 ARG 276 306 306 ARG ARG A . n 
A 1 277 LEU 277 307 307 LEU LEU A . n 
A 1 278 ASP 278 308 308 ASP ASP A . n 
A 1 279 ARG 279 309 309 ARG ARG A . n 
A 1 280 GLY 280 310 310 GLY GLY A . n 
A 1 281 GLY 281 311 311 GLY GLY A . n 
A 1 282 MET 282 312 312 MET MET A . n 
A 1 283 ILE 283 313 313 ILE ILE A . n 
A 1 284 GLN 284 314 314 GLN GLN A . n 
A 1 285 THR 285 315 315 THR THR A . n 
A 1 286 ALA 286 316 316 ALA ALA A . n 
A 1 287 GLU 287 317 317 GLU GLU A . n 
A 1 288 GLN 288 318 318 GLN GLN A . n 
A 1 289 TYR 289 319 319 TYR TYR A . n 
A 1 290 GLN 290 320 320 GLN GLN A . n 
A 1 291 PHE 291 321 321 PHE PHE A . n 
A 1 292 LEU 292 322 322 LEU LEU A . n 
A 1 293 HIS 293 323 323 HIS HIS A . n 
A 1 294 HIS 294 324 324 HIS HIS A . n 
A 1 295 THR 295 325 325 THR THR A . n 
A 1 296 LEU 296 326 326 LEU LEU A . n 
A 1 297 ALA 297 327 327 ALA ALA A . n 
A 1 298 LEU 298 328 328 LEU LEU A . n 
A 1 299 TYR 299 329 329 TYR TYR A . n 
A 1 300 ALA 300 330 330 ALA ALA A . n 
A 1 301 GLY 301 331 331 GLY GLY A . n 
A 1 302 GLN 302 332 332 GLN GLN A . n 
A 1 303 LEU 303 333 333 LEU LEU A . n 
A 1 304 PRO 304 334 334 PRO PRO A . n 
A 1 305 GLU 305 335 ?   ?   ?   A . n 
A 1 306 GLU 306 336 ?   ?   ?   A . n 
A 1 307 PRO 307 337 ?   ?   ?   A . n 
A 1 308 SER 308 338 ?   ?   ?   A . n 
A 1 309 PRO 309 339 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1   436 436 PO4 PO4 A . 
C 3 HOH 1   437 1   HOH HOH A . 
C 3 HOH 2   438 2   HOH HOH A . 
C 3 HOH 3   439 3   HOH HOH A . 
C 3 HOH 4   440 4   HOH HOH A . 
C 3 HOH 5   441 5   HOH HOH A . 
C 3 HOH 6   442 6   HOH HOH A . 
C 3 HOH 7   443 7   HOH HOH A . 
C 3 HOH 8   444 8   HOH HOH A . 
C 3 HOH 9   445 9   HOH HOH A . 
C 3 HOH 10  446 10  HOH HOH A . 
C 3 HOH 11  447 11  HOH HOH A . 
C 3 HOH 12  448 12  HOH HOH A . 
C 3 HOH 13  449 13  HOH HOH A . 
C 3 HOH 14  450 14  HOH HOH A . 
C 3 HOH 15  451 15  HOH HOH A . 
C 3 HOH 16  452 16  HOH HOH A . 
C 3 HOH 17  453 17  HOH HOH A . 
C 3 HOH 18  454 18  HOH HOH A . 
C 3 HOH 19  455 19  HOH HOH A . 
C 3 HOH 20  456 20  HOH HOH A . 
C 3 HOH 21  457 21  HOH HOH A . 
C 3 HOH 22  458 22  HOH HOH A . 
C 3 HOH 23  459 23  HOH HOH A . 
C 3 HOH 24  460 24  HOH HOH A . 
C 3 HOH 25  461 25  HOH HOH A . 
C 3 HOH 26  462 26  HOH HOH A . 
C 3 HOH 27  463 27  HOH HOH A . 
C 3 HOH 28  464 28  HOH HOH A . 
C 3 HOH 29  465 29  HOH HOH A . 
C 3 HOH 30  466 30  HOH HOH A . 
C 3 HOH 31  467 31  HOH HOH A . 
C 3 HOH 32  468 32  HOH HOH A . 
C 3 HOH 33  469 33  HOH HOH A . 
C 3 HOH 34  470 34  HOH HOH A . 
C 3 HOH 35  471 35  HOH HOH A . 
C 3 HOH 36  472 36  HOH HOH A . 
C 3 HOH 37  473 37  HOH HOH A . 
C 3 HOH 38  474 38  HOH HOH A . 
C 3 HOH 39  475 39  HOH HOH A . 
C 3 HOH 40  476 40  HOH HOH A . 
C 3 HOH 41  477 41  HOH HOH A . 
C 3 HOH 42  478 42  HOH HOH A . 
C 3 HOH 43  479 43  HOH HOH A . 
C 3 HOH 44  480 44  HOH HOH A . 
C 3 HOH 45  481 45  HOH HOH A . 
C 3 HOH 46  482 46  HOH HOH A . 
C 3 HOH 47  483 47  HOH HOH A . 
C 3 HOH 48  484 48  HOH HOH A . 
C 3 HOH 49  485 49  HOH HOH A . 
C 3 HOH 50  486 50  HOH HOH A . 
C 3 HOH 51  487 51  HOH HOH A . 
C 3 HOH 52  488 52  HOH HOH A . 
C 3 HOH 53  489 53  HOH HOH A . 
C 3 HOH 54  490 54  HOH HOH A . 
C 3 HOH 55  491 55  HOH HOH A . 
C 3 HOH 56  492 56  HOH HOH A . 
C 3 HOH 57  493 57  HOH HOH A . 
C 3 HOH 58  494 58  HOH HOH A . 
C 3 HOH 59  495 59  HOH HOH A . 
C 3 HOH 60  496 60  HOH HOH A . 
C 3 HOH 61  497 61  HOH HOH A . 
C 3 HOH 62  498 62  HOH HOH A . 
C 3 HOH 63  499 63  HOH HOH A . 
C 3 HOH 64  500 64  HOH HOH A . 
C 3 HOH 65  501 65  HOH HOH A . 
C 3 HOH 66  502 66  HOH HOH A . 
C 3 HOH 67  503 67  HOH HOH A . 
C 3 HOH 68  504 68  HOH HOH A . 
C 3 HOH 69  505 69  HOH HOH A . 
C 3 HOH 70  506 70  HOH HOH A . 
C 3 HOH 71  507 71  HOH HOH A . 
C 3 HOH 72  508 72  HOH HOH A . 
C 3 HOH 73  509 73  HOH HOH A . 
C 3 HOH 74  510 74  HOH HOH A . 
C 3 HOH 75  511 75  HOH HOH A . 
C 3 HOH 76  512 76  HOH HOH A . 
C 3 HOH 77  513 77  HOH HOH A . 
C 3 HOH 78  514 78  HOH HOH A . 
C 3 HOH 79  515 79  HOH HOH A . 
C 3 HOH 80  516 80  HOH HOH A . 
C 3 HOH 81  517 81  HOH HOH A . 
C 3 HOH 82  518 82  HOH HOH A . 
C 3 HOH 83  519 83  HOH HOH A . 
C 3 HOH 84  520 84  HOH HOH A . 
C 3 HOH 85  521 85  HOH HOH A . 
C 3 HOH 86  522 86  HOH HOH A . 
C 3 HOH 87  523 87  HOH HOH A . 
C 3 HOH 88  524 88  HOH HOH A . 
C 3 HOH 89  525 89  HOH HOH A . 
C 3 HOH 90  526 90  HOH HOH A . 
C 3 HOH 91  527 91  HOH HOH A . 
C 3 HOH 92  528 92  HOH HOH A . 
C 3 HOH 93  529 93  HOH HOH A . 
C 3 HOH 94  530 94  HOH HOH A . 
C 3 HOH 95  531 95  HOH HOH A . 
C 3 HOH 96  532 96  HOH HOH A . 
C 3 HOH 97  533 97  HOH HOH A . 
C 3 HOH 98  534 98  HOH HOH A . 
C 3 HOH 99  535 99  HOH HOH A . 
C 3 HOH 100 536 100 HOH HOH A . 
C 3 HOH 101 537 101 HOH HOH A . 
C 3 HOH 102 538 102 HOH HOH A . 
C 3 HOH 103 539 103 HOH HOH A . 
C 3 HOH 104 540 104 HOH HOH A . 
C 3 HOH 105 541 105 HOH HOH A . 
C 3 HOH 106 542 106 HOH HOH A . 
C 3 HOH 107 543 107 HOH HOH A . 
C 3 HOH 108 544 108 HOH HOH A . 
C 3 HOH 109 545 109 HOH HOH A . 
C 3 HOH 110 546 110 HOH HOH A . 
C 3 HOH 111 547 111 HOH HOH A . 
C 3 HOH 112 548 112 HOH HOH A . 
C 3 HOH 113 549 113 HOH HOH A . 
C 3 HOH 114 550 114 HOH HOH A . 
C 3 HOH 115 551 115 HOH HOH A . 
C 3 HOH 116 552 116 HOH HOH A . 
C 3 HOH 117 553 117 HOH HOH A . 
C 3 HOH 118 554 118 HOH HOH A . 
C 3 HOH 119 555 119 HOH HOH A . 
C 3 HOH 120 556 120 HOH HOH A . 
C 3 HOH 121 557 121 HOH HOH A . 
C 3 HOH 122 558 122 HOH HOH A . 
C 3 HOH 123 559 123 HOH HOH A . 
C 3 HOH 124 560 124 HOH HOH A . 
C 3 HOH 125 561 125 HOH HOH A . 
C 3 HOH 126 562 126 HOH HOH A . 
C 3 HOH 127 563 127 HOH HOH A . 
C 3 HOH 128 564 128 HOH HOH A . 
C 3 HOH 129 565 129 HOH HOH A . 
C 3 HOH 130 566 130 HOH HOH A . 
C 3 HOH 131 567 131 HOH HOH A . 
C 3 HOH 132 568 132 HOH HOH A . 
C 3 HOH 133 569 133 HOH HOH A . 
C 3 HOH 134 570 134 HOH HOH A . 
C 3 HOH 135 571 135 HOH HOH A . 
C 3 HOH 136 572 136 HOH HOH A . 
C 3 HOH 137 573 137 HOH HOH A . 
C 3 HOH 138 574 138 HOH HOH A . 
C 3 HOH 139 575 139 HOH HOH A . 
C 3 HOH 140 576 140 HOH HOH A . 
C 3 HOH 141 577 141 HOH HOH A . 
C 3 HOH 142 578 142 HOH HOH A . 
C 3 HOH 143 579 143 HOH HOH A . 
C 3 HOH 144 580 144 HOH HOH A . 
C 3 HOH 145 581 145 HOH HOH A . 
C 3 HOH 146 582 146 HOH HOH A . 
C 3 HOH 147 583 147 HOH HOH A . 
C 3 HOH 148 584 148 HOH HOH A . 
C 3 HOH 149 585 149 HOH HOH A . 
C 3 HOH 150 586 150 HOH HOH A . 
C 3 HOH 151 587 151 HOH HOH A . 
C 3 HOH 152 588 152 HOH HOH A . 
C 3 HOH 153 589 153 HOH HOH A . 
C 3 HOH 154 590 154 HOH HOH A . 
C 3 HOH 155 591 155 HOH HOH A . 
C 3 HOH 156 592 156 HOH HOH A . 
C 3 HOH 157 593 157 HOH HOH A . 
C 3 HOH 158 594 158 HOH HOH A . 
C 3 HOH 159 595 159 HOH HOH A . 
C 3 HOH 160 596 160 HOH HOH A . 
C 3 HOH 161 597 161 HOH HOH A . 
C 3 HOH 162 598 162 HOH HOH A . 
C 3 HOH 163 599 163 HOH HOH A . 
C 3 HOH 164 600 164 HOH HOH A . 
C 3 HOH 165 601 165 HOH HOH A . 
C 3 HOH 166 602 166 HOH HOH A . 
C 3 HOH 167 603 167 HOH HOH A . 
C 3 HOH 168 604 168 HOH HOH A . 
C 3 HOH 169 605 169 HOH HOH A . 
C 3 HOH 170 606 170 HOH HOH A . 
C 3 HOH 171 607 171 HOH HOH A . 
C 3 HOH 172 608 172 HOH HOH A . 
C 3 HOH 173 609 173 HOH HOH A . 
C 3 HOH 174 610 174 HOH HOH A . 
C 3 HOH 175 611 175 HOH HOH A . 
C 3 HOH 176 612 176 HOH HOH A . 
C 3 HOH 177 613 177 HOH HOH A . 
C 3 HOH 178 614 178 HOH HOH A . 
C 3 HOH 179 615 179 HOH HOH A . 
C 3 HOH 180 616 180 HOH HOH A . 
C 3 HOH 181 617 181 HOH HOH A . 
C 3 HOH 182 618 182 HOH HOH A . 
C 3 HOH 183 619 183 HOH HOH A . 
C 3 HOH 184 620 184 HOH HOH A . 
C 3 HOH 185 621 185 HOH HOH A . 
C 3 HOH 186 622 186 HOH HOH A . 
C 3 HOH 187 623 187 HOH HOH A . 
C 3 HOH 188 624 188 HOH HOH A . 
C 3 HOH 189 625 189 HOH HOH A . 
C 3 HOH 190 626 190 HOH HOH A . 
C 3 HOH 191 627 191 HOH HOH A . 
C 3 HOH 192 628 192 HOH HOH A . 
C 3 HOH 193 629 193 HOH HOH A . 
C 3 HOH 194 630 194 HOH HOH A . 
C 3 HOH 195 631 195 HOH HOH A . 
C 3 HOH 196 632 196 HOH HOH A . 
C 3 HOH 197 633 197 HOH HOH A . 
C 3 HOH 198 634 198 HOH HOH A . 
C 3 HOH 199 635 199 HOH HOH A . 
C 3 HOH 200 636 200 HOH HOH A . 
C 3 HOH 201 637 201 HOH HOH A . 
C 3 HOH 202 638 202 HOH HOH A . 
C 3 HOH 203 639 203 HOH HOH A . 
C 3 HOH 204 640 204 HOH HOH A . 
C 3 HOH 205 641 205 HOH HOH A . 
C 3 HOH 206 642 206 HOH HOH A . 
C 3 HOH 207 643 207 HOH HOH A . 
C 3 HOH 208 644 208 HOH HOH A . 
C 3 HOH 209 645 209 HOH HOH A . 
C 3 HOH 210 646 210 HOH HOH A . 
C 3 HOH 211 647 211 HOH HOH A . 
C 3 HOH 212 648 212 HOH HOH A . 
C 3 HOH 213 649 213 HOH HOH A . 
C 3 HOH 214 650 214 HOH HOH A . 
C 3 HOH 215 651 215 HOH HOH A . 
C 3 HOH 216 652 216 HOH HOH A . 
C 3 HOH 217 653 217 HOH HOH A . 
C 3 HOH 218 654 218 HOH HOH A . 
C 3 HOH 219 655 219 HOH HOH A . 
C 3 HOH 220 656 220 HOH HOH A . 
C 3 HOH 221 657 221 HOH HOH A . 
C 3 HOH 222 658 222 HOH HOH A . 
C 3 HOH 223 659 223 HOH HOH A . 
C 3 HOH 224 660 224 HOH HOH A . 
C 3 HOH 225 661 225 HOH HOH A . 
C 3 HOH 226 662 226 HOH HOH A . 
C 3 HOH 227 663 227 HOH HOH A . 
C 3 HOH 228 664 228 HOH HOH A . 
C 3 HOH 229 665 229 HOH HOH A . 
C 3 HOH 230 666 230 HOH HOH A . 
C 3 HOH 231 667 231 HOH HOH A . 
C 3 HOH 232 668 232 HOH HOH A . 
C 3 HOH 233 669 233 HOH HOH A . 
C 3 HOH 234 670 234 HOH HOH A . 
C 3 HOH 235 671 235 HOH HOH A . 
C 3 HOH 236 672 236 HOH HOH A . 
C 3 HOH 237 673 237 HOH HOH A . 
C 3 HOH 238 674 238 HOH HOH A . 
C 3 HOH 239 675 239 HOH HOH A . 
C 3 HOH 240 676 240 HOH HOH A . 
C 3 HOH 241 677 241 HOH HOH A . 
C 3 HOH 242 678 242 HOH HOH A . 
C 3 HOH 243 679 243 HOH HOH A . 
C 3 HOH 244 680 244 HOH HOH A . 
C 3 HOH 245 681 245 HOH HOH A . 
C 3 HOH 246 682 246 HOH HOH A . 
C 3 HOH 247 683 247 HOH HOH A . 
C 3 HOH 248 684 248 HOH HOH A . 
C 3 HOH 249 685 249 HOH HOH A . 
C 3 HOH 250 686 250 HOH HOH A . 
C 3 HOH 251 687 251 HOH HOH A . 
C 3 HOH 252 688 252 HOH HOH A . 
C 3 HOH 253 689 253 HOH HOH A . 
C 3 HOH 254 690 254 HOH HOH A . 
C 3 HOH 255 691 255 HOH HOH A . 
C 3 HOH 256 692 256 HOH HOH A . 
C 3 HOH 257 693 257 HOH HOH A . 
C 3 HOH 258 694 258 HOH HOH A . 
C 3 HOH 259 695 259 HOH HOH A . 
C 3 HOH 260 696 260 HOH HOH A . 
C 3 HOH 261 697 261 HOH HOH A . 
C 3 HOH 262 698 262 HOH HOH A . 
C 3 HOH 263 699 263 HOH HOH A . 
C 3 HOH 264 700 264 HOH HOH A . 
C 3 HOH 265 701 265 HOH HOH A . 
C 3 HOH 266 702 266 HOH HOH A . 
C 3 HOH 267 703 267 HOH HOH A . 
C 3 HOH 268 704 268 HOH HOH A . 
C 3 HOH 269 705 269 HOH HOH A . 
C 3 HOH 270 706 270 HOH HOH A . 
C 3 HOH 271 707 271 HOH HOH A . 
C 3 HOH 272 708 272 HOH HOH A . 
C 3 HOH 273 709 273 HOH HOH A . 
C 3 HOH 274 710 274 HOH HOH A . 
C 3 HOH 275 711 275 HOH HOH A . 
C 3 HOH 276 712 276 HOH HOH A . 
C 3 HOH 277 713 277 HOH HOH A . 
C 3 HOH 278 714 278 HOH HOH A . 
C 3 HOH 279 715 279 HOH HOH A . 
C 3 HOH 280 716 280 HOH HOH A . 
C 3 HOH 281 717 281 HOH HOH A . 
C 3 HOH 282 718 282 HOH HOH A . 
C 3 HOH 283 719 283 HOH HOH A . 
C 3 HOH 284 720 284 HOH HOH A . 
C 3 HOH 285 721 285 HOH HOH A . 
C 3 HOH 286 722 286 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-12-06 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         43.5730 
_pdbx_refine_tls.origin_y         44.1410 
_pdbx_refine_tls.origin_z         9.9030 
_pdbx_refine_tls.T[1][1]          -0.0380 
_pdbx_refine_tls.T[2][2]          -0.0060 
_pdbx_refine_tls.T[3][3]          -0.0684 
_pdbx_refine_tls.T[1][2]          0.0358 
_pdbx_refine_tls.T[1][3]          0.0293 
_pdbx_refine_tls.T[2][3]          0.0324 
_pdbx_refine_tls.L[1][1]          1.6473 
_pdbx_refine_tls.L[2][2]          0.9277 
_pdbx_refine_tls.L[3][3]          0.7164 
_pdbx_refine_tls.L[1][2]          -0.4070 
_pdbx_refine_tls.L[1][3]          0.6076 
_pdbx_refine_tls.L[2][3]          0.0880 
_pdbx_refine_tls.S[1][1]          0.0735 
_pdbx_refine_tls.S[1][2]          -0.0305 
_pdbx_refine_tls.S[1][3]          -0.1040 
_pdbx_refine_tls.S[2][1]          -0.0585 
_pdbx_refine_tls.S[2][2]          0.0212 
_pdbx_refine_tls.S[2][3]          0.0500 
_pdbx_refine_tls.S[3][1]          -0.0836 
_pdbx_refine_tls.S[3][2]          -0.1299 
_pdbx_refine_tls.S[3][3]          -0.0947 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     45 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    15 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     304 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    274 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
SOLVE     phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 94  ? ? -112.55 68.84   
2 1 ASP A 125 ? ? -97.69  42.22   
3 1 GLU A 190 ? ? -128.32 -59.99  
4 1 GLN A 220 ? ? 50.68   -122.69 
5 1 ILE A 274 ? ? -133.17 -39.51  
6 1 ILE A 313 ? ? 68.38   108.33  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 47  ? NE  ? A ARG 17  NE  
2  1 Y 1 A ARG 47  ? CZ  ? A ARG 17  CZ  
3  1 Y 1 A ARG 47  ? NH1 ? A ARG 17  NH1 
4  1 Y 1 A ARG 47  ? NH2 ? A ARG 17  NH2 
5  1 Y 1 A GLU 48  ? CD  ? A GLU 18  CD  
6  1 Y 1 A GLU 48  ? OE1 ? A GLU 18  OE1 
7  1 Y 1 A GLU 48  ? OE2 ? A GLU 18  OE2 
8  1 Y 1 A GLN 69  ? CG  ? A GLN 39  CG  
9  1 Y 1 A GLN 69  ? CD  ? A GLN 39  CD  
10 1 Y 1 A GLN 69  ? OE1 ? A GLN 39  OE1 
11 1 Y 1 A GLN 69  ? NE2 ? A GLN 39  NE2 
12 1 Y 1 A GLU 91  ? CD  ? A GLU 61  CD  
13 1 Y 1 A GLU 91  ? OE1 ? A GLU 61  OE1 
14 1 Y 1 A GLU 91  ? OE2 ? A GLU 61  OE2 
15 1 Y 1 A LYS 105 ? CG  ? A LYS 75  CG  
16 1 Y 1 A LYS 105 ? CD  ? A LYS 75  CD  
17 1 Y 1 A LYS 105 ? CE  ? A LYS 75  CE  
18 1 Y 1 A LYS 105 ? NZ  ? A LYS 75  NZ  
19 1 Y 1 A GLN 123 ? CG  ? A GLN 93  CG  
20 1 Y 1 A GLN 123 ? CD  ? A GLN 93  CD  
21 1 Y 1 A GLN 123 ? OE1 ? A GLN 93  OE1 
22 1 Y 1 A GLN 123 ? NE2 ? A GLN 93  NE2 
23 1 Y 1 A GLU 124 ? CD  ? A GLU 94  CD  
24 1 Y 1 A GLU 124 ? OE1 ? A GLU 94  OE1 
25 1 Y 1 A GLU 124 ? OE2 ? A GLU 94  OE2 
26 1 Y 1 A ASP 125 ? CG  ? A ASP 95  CG  
27 1 Y 1 A ASP 125 ? OD1 ? A ASP 95  OD1 
28 1 Y 1 A ASP 125 ? OD2 ? A ASP 95  OD2 
29 1 Y 1 A LEU 176 ? CG  ? A LEU 146 CG  
30 1 Y 1 A LEU 176 ? CD1 ? A LEU 146 CD1 
31 1 Y 1 A LEU 176 ? CD2 ? A LEU 146 CD2 
32 1 Y 1 A ARG 177 ? CG  ? A ARG 147 CG  
33 1 Y 1 A ARG 177 ? CD  ? A ARG 147 CD  
34 1 Y 1 A ARG 177 ? NE  ? A ARG 147 NE  
35 1 Y 1 A ARG 177 ? CZ  ? A ARG 147 CZ  
36 1 Y 1 A ARG 177 ? NH1 ? A ARG 147 NH1 
37 1 Y 1 A ARG 177 ? NH2 ? A ARG 147 NH2 
38 1 Y 1 A CYS 183 ? SG  ? A CYS 153 SG  
39 1 Y 1 A GLU 190 ? CD  ? A GLU 160 CD  
40 1 Y 1 A GLU 190 ? OE1 ? A GLU 160 OE1 
41 1 Y 1 A GLU 190 ? OE2 ? A GLU 160 OE2 
42 1 Y 1 A GLU 191 ? OE1 ? A GLU 161 OE1 
43 1 Y 1 A GLU 191 ? OE2 ? A GLU 161 OE2 
44 1 Y 1 A GLU 192 ? CG  ? A GLU 162 CG  
45 1 Y 1 A GLU 192 ? CD  ? A GLU 162 CD  
46 1 Y 1 A GLU 192 ? OE1 ? A GLU 162 OE1 
47 1 Y 1 A GLU 192 ? OE2 ? A GLU 162 OE2 
48 1 Y 1 A ARG 200 ? NE  ? A ARG 170 NE  
49 1 Y 1 A ARG 200 ? CZ  ? A ARG 170 CZ  
50 1 Y 1 A ARG 200 ? NH1 ? A ARG 170 NH1 
51 1 Y 1 A ARG 200 ? NH2 ? A ARG 170 NH2 
52 1 Y 1 A GLN 202 ? CD  ? A GLN 172 CD  
53 1 Y 1 A GLN 202 ? OE1 ? A GLN 172 OE1 
54 1 Y 1 A GLN 202 ? NE2 ? A GLN 172 NE2 
55 1 Y 1 A LYS 205 ? CE  ? A LYS 175 CE  
56 1 Y 1 A LYS 205 ? NZ  ? A LYS 175 NZ  
57 1 Y 1 A GLU 206 ? CD  ? A GLU 176 CD  
58 1 Y 1 A GLU 206 ? OE1 ? A GLU 176 OE1 
59 1 Y 1 A GLU 206 ? OE2 ? A GLU 176 OE2 
60 1 Y 1 A GLU 241 ? CD  ? A GLU 211 CD  
61 1 Y 1 A GLU 241 ? OE1 ? A GLU 211 OE1 
62 1 Y 1 A GLU 241 ? OE2 ? A GLU 211 OE2 
63 1 Y 1 A GLU 255 ? CD  ? A GLU 225 CD  
64 1 Y 1 A GLU 255 ? OE1 ? A GLU 225 OE1 
65 1 Y 1 A GLU 255 ? OE2 ? A GLU 225 OE2 
66 1 Y 1 A GLU 258 ? CG  ? A GLU 228 CG  
67 1 Y 1 A GLU 258 ? CD  ? A GLU 228 CD  
68 1 Y 1 A GLU 258 ? OE1 ? A GLU 228 OE1 
69 1 Y 1 A GLU 258 ? OE2 ? A GLU 228 OE2 
70 1 Y 1 A THR 259 ? OG1 ? A THR 229 OG1 
71 1 Y 1 A THR 259 ? CG2 ? A THR 229 CG2 
72 1 Y 1 A HIS 262 ? CG  ? A HIS 232 CG  
73 1 Y 1 A HIS 262 ? ND1 ? A HIS 232 ND1 
74 1 Y 1 A HIS 262 ? CD2 ? A HIS 232 CD2 
75 1 Y 1 A HIS 262 ? CE1 ? A HIS 232 CE1 
76 1 Y 1 A HIS 262 ? NE2 ? A HIS 232 NE2 
77 1 Y 1 A GLU 295 ? OE1 ? A GLU 265 OE1 
78 1 Y 1 A GLU 295 ? OE2 ? A GLU 265 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 31  ? A MET 1   
2  1 Y 1 A GLY 32  ? A GLY 2   
3  1 Y 1 A SER 33  ? A SER 3   
4  1 Y 1 A ASP 34  ? A ASP 4   
5  1 Y 1 A LYS 35  ? A LYS 5   
6  1 Y 1 A ILE 36  ? A ILE 6   
7  1 Y 1 A HIS 37  ? A HIS 7   
8  1 Y 1 A HIS 38  ? A HIS 8   
9  1 Y 1 A HIS 39  ? A HIS 9   
10 1 Y 1 A HIS 40  ? A HIS 10  
11 1 Y 1 A HIS 41  ? A HIS 11  
12 1 Y 1 A HIS 42  ? A HIS 12  
13 1 Y 1 A MET 43  ? A MET 13  
14 1 Y 1 A ASN 44  ? A ASN 14  
15 1 Y 1 A GLY 179 ? A GLY 149 
16 1 Y 1 A LYS 180 ? A LYS 150 
17 1 Y 1 A GLU 181 ? A GLU 151 
18 1 Y 1 A LYS 182 ? A LYS 152 
19 1 Y 1 A GLU 335 ? A GLU 305 
20 1 Y 1 A GLU 336 ? A GLU 306 
21 1 Y 1 A PRO 337 ? A PRO 307 
22 1 Y 1 A SER 338 ? A SER 308 
23 1 Y 1 A PRO 339 ? A PRO 309 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
#