data_1ZGB
# 
_entry.id   1ZGB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZGB         
RCSB  RCSB032686   
WWPDB D_1000032686 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      1ZGC   'Crystal structure of the same protein in complex with an (RS)-Tacrine(10)hupyridone inhibitor' unspecified 
TargetDB W00568 .                                                                                               unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZGB 
_pdbx_database_status.recvd_initial_deposition_date   2005-04-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Haviv, H.'                                  1 
'Wong, D.M.'                                 2 
'Greenblatt, H.M.'                           3 
'Carlier, P.R.'                              4 
'Pang, Y.P.'                                 5 
'Silman, I.'                                 6 
'Sussman, J.L.'                              7 
'Israel Structural Proteomics Center (ISPC)' 8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal Packing Mediates Enantioselective Ligand Recognition at the Peripheral Site of Acetylcholinesterase' 
J.Am.Chem.Soc.        127 11029 11036 2005 JACSAT US 0002-7863 0004 ? 16076210 10.1021/ja051765f               
1       'Potent, easily synthesized huperzine A-tacrine hybrid acetylcholinesterase inhibitors' BIOORG.MED.CHEM.LETT. 9   2335  
2338  1999 BMCLE8 UK 0960-894X 1127 ? 10476864 '10.1016/S0960-894X(99)00396-0' 
2       
;Acetylcholinesterase Complexed with Bivalent Ligands Related to Huperzine A: Experimental Evidence for Species-Dependent Protein-Ligand Complementarity
;
J.Am.Chem.Soc.        125 363   373   2003 JACSAT US 0002-7863 0004 ? 12517147 10.1021/ja021111w               
3       'Structure of acetylcholinesterase complexed with the nootropic alkaloid, (-)-huperzine A' NAT.STRUCT.BIOL.      4   57    
63    1997 NSBIEW US 1072-8368 2024 ? 8989325  10.1038/nsb0197-57              
4       'Atomic structure of acetylcholinesterase from Torpedo californica: a prototypic acetylcholine-binding protein' Science 
253 872   879   1991 SCIEAS US 0036-8075 0038 ? 1678899  ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Haviv, H.'        1  ? 
primary 'Wong, D.M.'       2  ? 
primary 'Greenblatt, H.M.' 3  ? 
primary 'Carlier, P.R.'    4  ? 
primary 'Pang, Y.P.'       5  ? 
primary 'Silman, I.'       6  ? 
primary 'Sussman, J.L.'    7  ? 
1       'Carlier, P.R.'    8  ? 
1       'Du, D.-M.'        9  ? 
1       'Han, Y.-F.'       10 ? 
1       'Liu, J.'          11 ? 
1       'Pang, Y.-P.'      12 ? 
2       'Wong, D.M.'       13 ? 
2       'Greenblatt, H.M.' 14 ? 
2       'Dvir, H.'         15 ? 
2       'Carlier, P.R.'    16 ? 
2       'Han, Y.-F.'       17 ? 
2       'Pang, Y.-P.'      18 ? 
2       'Silman, I.'       19 ? 
2       'Sussman, J.L.'    20 ? 
3       'Raves, M.L.'      21 ? 
3       'Harel, M.'        22 ? 
3       'Pang, Y.-P.'      23 ? 
3       'Silman, I.'       24 ? 
3       'Kozikowski, A.P.' 25 ? 
3       'Sussman, J.L.'    26 ? 
4       'Sussman, J.L.'    27 ? 
4       'Harel, M.'        28 ? 
4       'Frolow, F.'       29 ? 
4       'Oefner, C.'       30 ? 
4       'Goldman, A.'      31 ? 
4       'Toker, L.'        32 ? 
4       'Silman, I.'       33 ? 
# 
_cell.entry_id           1ZGB 
_cell.length_a           111.449 
_cell.length_b           111.449 
_cell.length_c           137.095 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZGB 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Acetylcholinesterase                                                                                 61325.090 1 
3.1.1.7 ? ? ? 
2 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose                                                             221.208   2 
?       ? ? ? 
3 non-polymer syn '(5R)-5-{[10-(1,2,3,4-TETRAHYDROACRIDIN-9-YLAMINO)DECYL]AMINO}-5,6,7,8-TETRAHYDROQUINOLIN-2(1H)-ONE' 500.718   1 
?       ? ? ? 
4 water       nat water                                                                                                18.015    
178 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         W00568 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ZGB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A1E non-polymer                  . 
'(5R)-5-{[10-(1,2,3,4-TETRAHYDROACRIDIN-9-YLAMINO)DECYL]AMINO}-5,6,7,8-TETRAHYDROQUINOLIN-2(1H)-ONE' 
;(R)-N-9 -(1 ,2 ,3 ,4 -TETRAHYDROACRIDINYL)-N'-5 -[5 ,6 ,7 ,8 -TETRAHYDRO-2'(1'H)-QUINOLINONYL]-1,10-DIAMINODECANE; (R)-TACRINE(10)-HUPYRIDONE
;
'C32 H44 N4 O'   500.718 
ALA 'L-peptide linking'          y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ZGB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.07 
_exptl_crystal.density_percent_sol   69.7 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
;PEG 200, pH 5.8, temperature 277K, VAPOR DIFFUSION, HANGING DROP. PROTEIN WAS CRYSTALLISED FROM 28% V/V PEG 200 0.5 M MES PH 5.8 AT 277K, SEEDING WITH TRIGONAL MICROCRYSTALS; THEN SOAKED IN MOTHER LIQUOR (40% V/V PEG 200 IN 0.1 M MES BUFFER, PH 5.8) CONTAINING 2 MM (RS)-(+/-)- TACRINE(10)-HUPYRIDONE ((5RS)-(+/-)-5-{[10-(1,2,3,4-TETRAHYDROACRIDIN-9-YLAMINO) DECYL] AMINO}-5,6,7,8-TETRAHYDRO-QUINOLIN-2(1H)-ONE) BIS-OXALATE FOR 17 HOURS.
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2000-09-07 
_diffrn_detector.details                'OSMIC BLUE CONFOCAL MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ZGB 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   44250 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.9000 
_reflns.B_iso_Wilson_estimate        28.80 
_reflns.pdbx_redundancy              1.590 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.367 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.160 
_reflns_shell.pdbx_redundancy        10.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1ZGB 
_refine.ls_number_reflns_obs                     43555 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               1962219.640 
_refine.pdbx_data_cutoff_low_absF                0.0000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.19 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    98.4 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.188 
_refine.ls_R_factor_R_free                       0.23 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2190 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               39.30 
_refine.aniso_B[1][1]                            7.66000 
_refine.aniso_B[2][2]                            7.66000 
_refine.aniso_B[3][3]                            -15.32000 
_refine.aniso_B[1][2]                            5.56000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35 
_refine.solvent_model_param_bsol                 35.49 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ZGB 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4175 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         65 
_refine_hist.number_atoms_solvent             178 
_refine_hist.number_atoms_total               4418 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        29.19 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.116 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.90  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.10 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.38  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.267 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.959 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.169 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.028 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.38 
_refine_ls_shell.number_reflns_R_work             6902 
_refine_ls_shell.R_factor_R_work                  0.218 
_refine_ls_shell.percent_reflns_obs               98.80 
_refine_ls_shell.R_factor_R_free                  0.255 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            4.40 
_refine_ls_shell.number_reflns_R_free             315 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 ARE.PAR            ARE.TOP          'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
4 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
5 CIS_PEPTIDE.PARAM  ?                'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ZGB 
_struct.title                     
'Crystal Structure of Torpedo Californica Acetylcholinesterase in Complex With an (R)-Tacrine(10)-Hupyridone Inhibitor.' 
_struct.pdbx_descriptor           'Acetylcholinesterase precursor (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZGB 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SERINE-HYDROLASE, PROTEIN-INHIBITOR COMPLEX, ENANTIOMERIC SELECTIVITY, Israel Structural Proteomics Center, ISPC, Structural Genomics, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 10 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? GLY A 415 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? ASN A 457 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P23 23 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 24 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 25 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.067 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.044 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 59  A NAG 591  1_555 ? ? ? ? ? ? ? 1.477 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 416 A NAG 4161 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
B 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
B 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
B 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
B 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
B 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
B 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
B 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
B 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
C 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
C 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
A 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
B 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
B 2  3  N PHE A 30  ? N PHE A 30  O ILE A 99  ? O ILE A 99  
B 3  4  N ASN A 98  ? N ASN A 98  O SER A 145 ? O SER A 145 
B 4  5  O VAL A 144 ? O VAL A 144 N MET A 112 ? N MET A 112 
B 5  6  N THR A 109 ? N THR A 109 O ASP A 190 ? O ASP A 190 
B 6  7  N GLY A 198 ? N GLY A 198 O GLN A 225 ? O GLN A 225 
B 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
B 8  9  N VAL A 323 ? N VAL A 323 O PHE A 423 ? O PHE A 423 
B 9  10 N PHE A 422 ? N PHE A 422 O LEU A 505 ? O LEU A 505 
B 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
C 1  2  N VAL A 236 ? N VAL A 236 O ILE A 296 ? O ILE A 296 
# 
_database_PDB_matrix.entry_id          1ZGB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZGB 
_atom_sites.fract_transf_matrix[1][1]   0.008973 
_atom_sites.fract_transf_matrix[1][2]   0.005180 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010361 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007294 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.305 87.499 34.546 1.00 56.94 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.654 87.872 35.860 1.00 57.28 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.504 86.935 36.298 1.00 55.63 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.574 85.718 36.135 1.00 55.14 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.692 87.901 37.000 1.00 57.64 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.051 88.054 38.275 1.00 59.09 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.471 87.531 36.886 1.00 53.88 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.326  86.808 37.370 1.00 52.79 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.680  85.819 38.508 1.00 50.89 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.975  84.849 38.711 1.00 49.88 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.270  87.800 37.849 1.00 54.82 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.960  87.127 38.193 1.00 58.75 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.824  88.091 38.429 1.00 60.50 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.965  89.006 39.249 1.00 61.88 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.761  87.925 37.803 1.00 65.24 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.778 86.051 39.224 1.00 47.96 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -11.154 85.177 40.320 1.00 45.73 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -12.145 84.097 39.949 1.00 44.40 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.536 83.272 40.790 1.00 43.97 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.709 85.999 41.496 1.00 43.95 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.670 86.894 42.176 1.00 44.17 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.352 87.846 43.207 1.00 41.44 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.635  85.994 42.893 1.00 43.32 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.535 84.070 38.690 1.00 43.79 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.499 83.070 38.258 1.00 43.99 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.775 82.054 37.392 1.00 42.67 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.077 82.420 36.446 1.00 42.38 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.649 83.734 37.476 1.00 46.10 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.794 82.821 37.022 1.00 49.63 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.453 82.175 38.284 1.00 49.95 ? 7    LEU A CD1 1 
ATOM   31   N N   . VAL A 1 8   ? -12.896 80.776 37.741 1.00 40.57 ? 8    VAL A N   1 
ATOM   32   C CA  . VAL A 1 8   ? -12.237 79.767 36.947 1.00 39.32 ? 8    VAL A CA  1 
ATOM   33   C C   . VAL A 1 8   ? -13.194 78.634 36.652 1.00 39.44 ? 8    VAL A C   1 
ATOM   34   O O   . VAL A 1 8   ? -13.934 78.156 37.500 1.00 39.23 ? 8    VAL A O   1 
ATOM   35   C CB  . VAL A 1 8   ? -10.942 79.226 37.647 1.00 40.67 ? 8    VAL A CB  1 
ATOM   36   C CG1 . VAL A 1 8   ? -10.354 78.033 36.866 1.00 38.28 ? 8    VAL A CG1 1 
ATOM   37   C CG2 . VAL A 1 8   ? -9.909  80.326 37.747 1.00 36.22 ? 8    VAL A CG2 1 
ATOM   38   N N   . ASN A 1 9   ? -13.173 78.220 35.411 1.00 41.02 ? 9    ASN A N   1 
ATOM   39   C CA  . ASN A 1 9   ? -14.018 77.144 34.959 1.00 43.48 ? 9    ASN A CA  1 
ATOM   40   C C   . ASN A 1 9   ? -13.284 75.809 34.914 1.00 42.03 ? 9    ASN A C   1 
ATOM   41   O O   . ASN A 1 9   ? -12.430 75.614 34.070 1.00 42.14 ? 9    ASN A O   1 
ATOM   42   C CB  . ASN A 1 9   ? -14.528 77.458 33.587 1.00 46.73 ? 9    ASN A CB  1 
ATOM   43   C CG  . ASN A 1 9   ? -15.983 77.195 33.487 1.00 55.93 ? 9    ASN A CG  1 
ATOM   44   O OD1 . ASN A 1 9   ? -16.469 76.058 33.784 1.00 57.62 ? 9    ASN A OD1 1 
ATOM   45   N ND2 . ASN A 1 9   ? -16.735 78.244 33.102 1.00 58.33 ? 9    ASN A ND2 1 
ATOM   46   N N   . THR A 1 10  ? -13.635 74.884 35.798 1.00 40.44 ? 10   THR A N   1 
ATOM   47   C CA  . THR A 1 10  ? -12.946 73.604 35.814 1.00 39.70 ? 10   THR A CA  1 
ATOM   48   C C   . THR A 1 10  ? -13.883 72.550 35.248 1.00 40.32 ? 10   THR A C   1 
ATOM   49   O O   . THR A 1 10  ? -15.069 72.819 35.034 1.00 39.58 ? 10   THR A O   1 
ATOM   50   C CB  . THR A 1 10  ? -12.588 73.160 37.264 1.00 38.31 ? 10   THR A CB  1 
ATOM   51   O OG1 . THR A 1 10  ? -13.772 72.631 37.879 1.00 36.08 ? 10   THR A OG1 1 
ATOM   52   C CG2 . THR A 1 10  ? -12.042 74.343 38.120 1.00 34.61 ? 10   THR A CG2 1 
ATOM   53   N N   . LYS A 1 11  ? -13.348 71.340 35.067 1.00 40.07 ? 11   LYS A N   1 
ATOM   54   C CA  . LYS A 1 11  ? -14.106 70.195 34.568 1.00 39.16 ? 11   LYS A CA  1 
ATOM   55   C C   . LYS A 1 11  ? -15.167 69.788 35.594 1.00 39.95 ? 11   LYS A C   1 
ATOM   56   O O   . LYS A 1 11  ? -16.083 69.033 35.273 1.00 39.37 ? 11   LYS A O   1 
ATOM   57   C CB  . LYS A 1 11  ? -13.154 69.011 34.292 1.00 38.63 ? 11   LYS A CB  1 
ATOM   58   C CG  . LYS A 1 11  ? -12.102 69.317 33.201 1.00 37.96 ? 11   LYS A CG  1 
ATOM   59   C CD  . LYS A 1 11  ? -10.982 68.275 33.097 1.00 35.37 ? 11   LYS A CD  1 
ATOM   60   C CE  . LYS A 1 11  ? -10.197 68.561 31.828 1.00 32.94 ? 11   LYS A CE  1 
ATOM   61   N NZ  . LYS A 1 11  ? -8.904  67.854 31.740 1.00 35.39 ? 11   LYS A NZ  1 
ATOM   62   N N   . SER A 1 12  ? -15.046 70.275 36.825 1.00 39.92 ? 12   SER A N   1 
ATOM   63   C CA  . SER A 1 12  ? -16.021 69.944 37.862 1.00 42.58 ? 12   SER A CA  1 
ATOM   64   C C   . SER A 1 12  ? -17.091 71.046 38.028 1.00 43.19 ? 12   SER A C   1 
ATOM   65   O O   . SER A 1 12  ? -18.138 70.827 38.657 1.00 41.58 ? 12   SER A O   1 
ATOM   66   C CB  . SER A 1 12  ? -15.314 69.725 39.214 1.00 44.37 ? 12   SER A CB  1 
ATOM   67   O OG  . SER A 1 12  ? -14.497 68.552 39.186 1.00 48.77 ? 12   SER A OG  1 
ATOM   68   N N   . GLY A 1 13  ? -16.817 72.221 37.451 1.00 43.57 ? 13   GLY A N   1 
ATOM   69   C CA  . GLY A 1 13  ? -17.733 73.342 37.566 1.00 42.79 ? 13   GLY A CA  1 
ATOM   70   C C   . GLY A 1 13  ? -16.936 74.615 37.744 1.00 42.77 ? 13   GLY A C   1 
ATOM   71   O O   . GLY A 1 13  ? -15.697 74.552 37.761 1.00 43.02 ? 13   GLY A O   1 
ATOM   72   N N   . LYS A 1 14  ? -17.625 75.756 37.875 1.00 42.02 ? 14   LYS A N   1 
ATOM   73   C CA  . LYS A 1 14  ? -16.962 77.068 38.044 1.00 40.75 ? 14   LYS A CA  1 
ATOM   74   C C   . LYS A 1 14  ? -16.685 77.275 39.514 1.00 39.59 ? 14   LYS A C   1 
ATOM   75   O O   . LYS A 1 14  ? -17.435 76.847 40.383 1.00 39.59 ? 14   LYS A O   1 
ATOM   76   C CB  . LYS A 1 14  ? -17.821 78.243 37.546 1.00 42.05 ? 14   LYS A CB  1 
ATOM   77   C CG  . LYS A 1 14  ? -18.496 78.040 36.174 1.00 47.68 ? 14   LYS A CG  1 
ATOM   78   C CD  . LYS A 1 14  ? -18.852 79.413 35.514 1.00 51.81 ? 14   LYS A CD  1 
ATOM   79   C CE  . LYS A 1 14  ? -19.744 79.293 34.243 1.00 52.81 ? 14   LYS A CE  1 
ATOM   80   N NZ  . LYS A 1 14  ? -19.971 80.661 33.609 1.00 55.87 ? 14   LYS A NZ  1 
ATOM   81   N N   . VAL A 1 15  ? -15.607 77.964 39.790 1.00 38.49 ? 15   VAL A N   1 
ATOM   82   C CA  . VAL A 1 15  ? -15.212 78.182 41.152 1.00 39.58 ? 15   VAL A CA  1 
ATOM   83   C C   . VAL A 1 15  ? -14.827 79.660 41.179 1.00 38.68 ? 15   VAL A C   1 
ATOM   84   O O   . VAL A 1 15  ? -14.292 80.181 40.201 1.00 36.45 ? 15   VAL A O   1 
ATOM   85   C CB  . VAL A 1 15  ? -14.003 77.191 41.486 1.00 39.82 ? 15   VAL A CB  1 
ATOM   86   C CG1 . VAL A 1 15  ? -12.769 77.609 40.742 1.00 42.00 ? 15   VAL A CG1 1 
ATOM   87   C CG2 . VAL A 1 15  ? -13.695 77.191 42.898 1.00 42.86 ? 15   VAL A CG2 1 
ATOM   88   N N   . MET A 1 16  ? -15.138 80.330 42.283 1.00 40.60 ? 16   MET A N   1 
ATOM   89   C CA  . MET A 1 16  ? -14.836 81.760 42.457 1.00 41.55 ? 16   MET A CA  1 
ATOM   90   C C   . MET A 1 16  ? -13.916 81.941 43.644 1.00 40.70 ? 16   MET A C   1 
ATOM   91   O O   . MET A 1 16  ? -14.256 81.590 44.805 1.00 39.65 ? 16   MET A O   1 
ATOM   92   C CB  . MET A 1 16  ? -16.136 82.556 42.700 1.00 45.74 ? 16   MET A CB  1 
ATOM   93   C CG  . MET A 1 16  ? -15.993 84.066 42.944 1.00 49.95 ? 16   MET A CG  1 
ATOM   94   S SD  . MET A 1 16  ? -15.590 84.970 41.412 1.00 56.73 ? 16   MET A SD  1 
ATOM   95   C CE  . MET A 1 16  ? -15.087 86.634 42.231 1.00 59.19 ? 16   MET A CE  1 
ATOM   96   N N   . GLY A 1 17  ? -12.762 82.517 43.346 1.00 39.70 ? 17   GLY A N   1 
ATOM   97   C CA  . GLY A 1 17  ? -11.786 82.744 44.377 1.00 41.99 ? 17   GLY A CA  1 
ATOM   98   C C   . GLY A 1 17  ? -11.946 84.068 45.093 1.00 43.89 ? 17   GLY A C   1 
ATOM   99   O O   . GLY A 1 17  ? -12.999 84.711 45.031 1.00 43.20 ? 17   GLY A O   1 
ATOM   100  N N   . THR A 1 18  ? -10.877 84.455 45.781 1.00 45.67 ? 18   THR A N   1 
ATOM   101  C CA  . THR A 1 18  ? -10.818 85.691 46.543 1.00 47.66 ? 18   THR A CA  1 
ATOM   102  C C   . THR A 1 18  ? -9.439  86.248 46.411 1.00 47.60 ? 18   THR A C   1 
ATOM   103  O O   . THR A 1 18  ? -8.491  85.500 46.287 1.00 47.99 ? 18   THR A O   1 
ATOM   104  C CB  . THR A 1 18  ? -11.104 85.477 48.037 1.00 48.57 ? 18   THR A CB  1 
ATOM   105  O OG1 . THR A 1 18  ? -10.922 86.724 48.711 1.00 50.46 ? 18   THR A OG1 1 
ATOM   106  C CG2 . THR A 1 18  ? -10.144 84.437 48.665 1.00 49.65 ? 18   THR A CG2 1 
ATOM   107  N N   . ARG A 1 19  ? -9.328  87.568 46.411 1.00 49.00 ? 19   ARG A N   1 
ATOM   108  C CA  . ARG A 1 19  ? -8.043  88.244 46.267 1.00 49.44 ? 19   ARG A CA  1 
ATOM   109  C C   . ARG A 1 19  ? -7.409  88.396 47.665 1.00 48.66 ? 19   ARG A C   1 
ATOM   110  O O   . ARG A 1 19  ? -8.087  88.782 48.602 1.00 49.33 ? 19   ARG A O   1 
ATOM   111  C CB  . ARG A 1 19  ? -8.276  89.589 45.571 1.00 52.14 ? 19   ARG A CB  1 
ATOM   112  C CG  . ARG A 1 19  ? -7.106  90.524 45.629 1.00 57.66 ? 19   ARG A CG  1 
ATOM   113  C CD  . ARG A 1 19  ? -7.151  91.586 44.548 1.00 62.21 ? 19   ARG A CD  1 
ATOM   114  N NE  . ARG A 1 19  ? -5.984  91.442 43.668 1.00 67.76 ? 19   ARG A NE  1 
ATOM   115  C CZ  . ARG A 1 19  ? -5.181  92.434 43.283 1.00 68.89 ? 19   ARG A CZ  1 
ATOM   116  N NH1 . ARG A 1 19  ? -5.419  93.690 43.700 1.00 68.79 ? 19   ARG A NH1 1 
ATOM   117  N NH2 . ARG A 1 19  ? -4.125  92.149 42.506 1.00 68.21 ? 19   ARG A NH2 1 
ATOM   118  N N   . VAL A 1 20  ? -6.135  88.031 47.821 1.00 47.20 ? 20   VAL A N   1 
ATOM   119  C CA  . VAL A 1 20  ? -5.485  88.123 49.130 1.00 46.54 ? 20   VAL A CA  1 
ATOM   120  C C   . VAL A 1 20  ? -4.208  88.938 49.054 1.00 44.35 ? 20   VAL A C   1 
ATOM   121  O O   . VAL A 1 20  ? -3.494  88.880 48.068 1.00 44.25 ? 20   VAL A O   1 
ATOM   122  C CB  . VAL A 1 20  ? -5.123  86.707 49.753 1.00 47.88 ? 20   VAL A CB  1 
ATOM   123  C CG1 . VAL A 1 20  ? -6.354  85.860 49.881 1.00 47.70 ? 20   VAL A CG1 1 
ATOM   124  C CG2 . VAL A 1 20  ? -4.095  85.991 48.901 1.00 48.50 ? 20   VAL A CG2 1 
ATOM   125  N N   . PRO A 1 21  ? -3.927  89.727 50.097 1.00 44.02 ? 21   PRO A N   1 
ATOM   126  C CA  . PRO A 1 21  ? -2.718  90.559 50.127 1.00 44.89 ? 21   PRO A CA  1 
ATOM   127  C C   . PRO A 1 21  ? -1.526  89.709 50.590 1.00 45.36 ? 21   PRO A C   1 
ATOM   128  O O   . PRO A 1 21  ? -1.693  88.786 51.414 1.00 45.59 ? 21   PRO A O   1 
ATOM   129  C CB  . PRO A 1 21  ? -3.105  91.694 51.101 1.00 43.77 ? 21   PRO A CB  1 
ATOM   130  C CG  . PRO A 1 21  ? -3.962  90.967 52.124 1.00 42.94 ? 21   PRO A CG  1 
ATOM   131  C CD  . PRO A 1 21  ? -4.796  89.990 51.270 1.00 43.88 ? 21   PRO A CD  1 
ATOM   132  N N   . VAL A 1 22  ? -0.348  90.021 50.042 1.00 44.88 ? 22   VAL A N   1 
ATOM   133  C CA  . VAL A 1 22  ? 0.898   89.316 50.330 1.00 44.79 ? 22   VAL A CA  1 
ATOM   134  C C   . VAL A 1 22  ? 2.040   90.282 50.161 1.00 44.39 ? 22   VAL A C   1 
ATOM   135  O O   . VAL A 1 22  ? 2.242   90.758 49.050 1.00 42.06 ? 22   VAL A O   1 
ATOM   136  C CB  . VAL A 1 22  ? 1.296   88.261 49.241 1.00 45.51 ? 22   VAL A CB  1 
ATOM   137  C CG1 . VAL A 1 22  ? 2.121   87.157 49.854 1.00 43.39 ? 22   VAL A CG1 1 
ATOM   138  C CG2 . VAL A 1 22  ? 0.115   87.837 48.459 1.00 45.25 ? 22   VAL A CG2 1 
ATOM   139  N N   . LEU A 1 23  ? 2.825   90.509 51.210 1.00 46.24 ? 23   LEU A N   1 
ATOM   140  C CA  . LEU A 1 23  ? 4.006   91.375 51.112 1.00 48.14 ? 23   LEU A CA  1 
ATOM   141  C C   . LEU A 1 23  ? 3.771   92.666 50.269 1.00 49.42 ? 23   LEU A C   1 
ATOM   142  O O   . LEU A 1 23  ? 4.500   92.949 49.300 1.00 49.01 ? 23   LEU A O   1 
ATOM   143  C CB  . LEU A 1 23  ? 5.153   90.535 50.516 1.00 46.70 ? 23   LEU A CB  1 
ATOM   144  C CG  . LEU A 1 23  ? 5.454   89.257 51.315 1.00 45.96 ? 23   LEU A CG  1 
ATOM   145  C CD1 . LEU A 1 23  ? 6.533   88.458 50.622 1.00 44.62 ? 23   LEU A CD1 1 
ATOM   146  C CD2 . LEU A 1 23  ? 5.876   89.638 52.748 1.00 45.71 ? 23   LEU A CD2 1 
ATOM   147  N N   . SER A 1 24  ? 2.718   93.395 50.644 1.00 50.89 ? 24   SER A N   1 
ATOM   148  C CA  . SER A 1 24  ? 2.287   94.646 50.000 1.00 52.71 ? 24   SER A CA  1 
ATOM   149  C C   . SER A 1 24  ? 1.828   94.531 48.519 1.00 52.36 ? 24   SER A C   1 
ATOM   150  O O   . SER A 1 24  ? 1.780   95.536 47.785 1.00 52.81 ? 24   SER A O   1 
ATOM   151  C CB  . SER A 1 24  ? 3.376   95.716 50.143 1.00 52.98 ? 24   SER A CB  1 
ATOM   152  O OG  . SER A 1 24  ? 4.249   95.646 49.024 1.00 56.28 ? 24   SER A OG  1 
ATOM   153  N N   . SER A 1 25  ? 1.491   93.311 48.089 1.00 50.94 ? 25   SER A N   1 
ATOM   154  C CA  . SER A 1 25  ? 0.964   93.056 46.749 1.00 48.60 ? 25   SER A CA  1 
ATOM   155  C C   . SER A 1 25  ? -0.250  92.146 46.928 1.00 47.40 ? 25   SER A C   1 
ATOM   156  O O   . SER A 1 25  ? -0.840  92.110 48.021 1.00 46.02 ? 25   SER A O   1 
ATOM   157  C CB  . SER A 1 25  ? 2.026   92.428 45.831 1.00 50.11 ? 25   SER A CB  1 
ATOM   158  O OG  . SER A 1 25  ? 1.520   92.232 44.510 1.00 50.54 ? 25   SER A OG  1 
ATOM   159  N N   . HIS A 1 26  ? -0.644  91.403 45.894 1.00 47.79 ? 26   HIS A N   1 
ATOM   160  C CA  . HIS A 1 26  ? -1.845  90.538 45.998 1.00 48.12 ? 26   HIS A CA  1 
ATOM   161  C C   . HIS A 1 26  ? -1.798  89.332 45.045 1.00 47.83 ? 26   HIS A C   1 
ATOM   162  O O   . HIS A 1 26  ? -1.099  89.361 44.015 1.00 45.81 ? 26   HIS A O   1 
ATOM   163  C CB  . HIS A 1 26  ? -3.139  91.313 45.641 1.00 52.56 ? 26   HIS A CB  1 
ATOM   164  C CG  . HIS A 1 26  ? -3.395  92.557 46.457 1.00 58.25 ? 26   HIS A CG  1 
ATOM   165  N ND1 . HIS A 1 26  ? -2.814  93.783 46.169 1.00 60.05 ? 26   HIS A ND1 1 
ATOM   166  C CD2 . HIS A 1 26  ? -4.213  92.773 47.525 1.00 59.91 ? 26   HIS A CD2 1 
ATOM   167  C CE1 . HIS A 1 26  ? -3.264  94.694 47.024 1.00 61.43 ? 26   HIS A CE1 1 
ATOM   168  N NE2 . HIS A 1 26  ? -4.114  94.108 47.857 1.00 61.19 ? 26   HIS A NE2 1 
ATOM   169  N N   . ILE A 1 27  ? -2.559  88.284 45.387 1.00 45.90 ? 27   ILE A N   1 
ATOM   170  C CA  . ILE A 1 27  ? -2.675  87.097 44.553 1.00 44.75 ? 27   ILE A CA  1 
ATOM   171  C C   . ILE A 1 27  ? -4.076  86.575 44.718 1.00 43.96 ? 27   ILE A C   1 
ATOM   172  O O   . ILE A 1 27  ? -4.825  87.067 45.555 1.00 44.66 ? 27   ILE A O   1 
ATOM   173  C CB  . ILE A 1 27  ? -1.655  85.975 44.899 1.00 44.14 ? 27   ILE A CB  1 
ATOM   174  C CG1 . ILE A 1 27  ? -1.758  85.562 46.358 1.00 44.49 ? 27   ILE A CG1 1 
ATOM   175  C CG2 . ILE A 1 27  ? -0.277  86.467 44.623 1.00 46.38 ? 27   ILE A CG2 1 
ATOM   176  N N   . SER A 1 28  ? -4.441  85.590 43.920 1.00 41.59 ? 28   SER A N   1 
ATOM   177  C CA  . SER A 1 28  ? -5.778  85.049 44.010 1.00 40.86 ? 28   SER A CA  1 
ATOM   178  C C   . SER A 1 28  ? -5.667  83.761 44.819 1.00 41.46 ? 28   SER A C   1 
ATOM   179  O O   . SER A 1 28  ? -4.647  83.056 44.746 1.00 41.16 ? 28   SER A O   1 
ATOM   180  C CB  . SER A 1 28  ? -6.334  84.671 42.628 1.00 40.42 ? 28   SER A CB  1 
ATOM   181  O OG  . SER A 1 28  ? -6.003  85.573 41.588 1.00 40.71 ? 28   SER A OG  1 
ATOM   182  N N   . ALA A 1 29  ? -6.709  83.438 45.571 1.00 39.48 ? 29   ALA A N   1 
ATOM   183  C CA  . ALA A 1 29  ? -6.696  82.202 46.320 1.00 39.98 ? 29   ALA A CA  1 
ATOM   184  C C   . ALA A 1 29  ? -8.024  81.539 46.081 1.00 40.15 ? 29   ALA A C   1 
ATOM   185  O O   . ALA A 1 29  ? -9.063  82.194 46.062 1.00 41.99 ? 29   ALA A O   1 
ATOM   186  C CB  . ALA A 1 29  ? -6.472  82.447 47.826 1.00 38.27 ? 29   ALA A CB  1 
ATOM   187  N N   . PHE A 1 30  ? -7.989  80.242 45.844 1.00 39.01 ? 30   PHE A N   1 
ATOM   188  C CA  . PHE A 1 30  ? -9.203  79.493 45.641 1.00 38.52 ? 30   PHE A CA  1 
ATOM   189  C C   . PHE A 1 30  ? -9.142  78.481 46.768 1.00 39.21 ? 30   PHE A C   1 
ATOM   190  O O   . PHE A 1 30  ? -8.458  77.461 46.690 1.00 41.25 ? 30   PHE A O   1 
ATOM   191  C CB  . PHE A 1 30  ? -9.177  78.819 44.274 1.00 37.79 ? 30   PHE A CB  1 
ATOM   192  C CG  . PHE A 1 30  ? -9.111  79.795 43.118 1.00 36.45 ? 30   PHE A CG  1 
ATOM   193  C CD1 . PHE A 1 30  ? -7.886  80.336 42.721 1.00 35.81 ? 30   PHE A CD1 1 
ATOM   194  C CD2 . PHE A 1 30  ? -10.293 80.185 42.445 1.00 36.72 ? 30   PHE A CD2 1 
ATOM   195  C CE1 . PHE A 1 30  ? -7.802  81.262 41.668 1.00 37.98 ? 30   PHE A CE1 1 
ATOM   196  C CE2 . PHE A 1 30  ? -10.256 81.116 41.375 1.00 36.48 ? 30   PHE A CE2 1 
ATOM   197  C CZ  . PHE A 1 30  ? -9.000  81.664 40.979 1.00 38.68 ? 30   PHE A CZ  1 
ATOM   198  N N   . LEU A 1 31  ? -9.824  78.794 47.840 1.00 38.81 ? 31   LEU A N   1 
ATOM   199  C CA  . LEU A 1 31  ? -9.811  77.963 49.014 1.00 39.79 ? 31   LEU A CA  1 
ATOM   200  C C   . LEU A 1 31  ? -11.019 77.055 49.061 1.00 39.65 ? 31   LEU A C   1 
ATOM   201  O O   . LEU A 1 31  ? -12.110 77.445 48.661 1.00 41.59 ? 31   LEU A O   1 
ATOM   202  C CB  . LEU A 1 31  ? -9.783  78.868 50.254 1.00 37.88 ? 31   LEU A CB  1 
ATOM   203  C CG  . LEU A 1 31  ? -8.732  79.968 50.116 1.00 40.25 ? 31   LEU A CG  1 
ATOM   204  C CD1 . LEU A 1 31  ? -8.661  80.821 51.390 1.00 37.89 ? 31   LEU A CD1 1 
ATOM   205  C CD2 . LEU A 1 31  ? -7.359  79.318 49.845 1.00 39.41 ? 31   LEU A CD2 1 
ATOM   206  N N   . GLY A 1 32  ? -10.825 75.845 49.563 1.00 38.94 ? 32   GLY A N   1 
ATOM   207  C CA  . GLY A 1 32  ? -11.939 74.913 49.708 1.00 38.22 ? 32   GLY A CA  1 
ATOM   208  C C   . GLY A 1 32  ? -12.590 74.302 48.471 1.00 37.65 ? 32   GLY A C   1 
ATOM   209  O O   . GLY A 1 32  ? -13.789 74.122 48.468 1.00 38.38 ? 32   GLY A O   1 
ATOM   210  N N   . ILE A 1 33  ? -11.830 73.973 47.433 1.00 36.42 ? 33   ILE A N   1 
ATOM   211  C CA  . ILE A 1 33  ? -12.406 73.362 46.245 1.00 36.55 ? 33   ILE A CA  1 
ATOM   212  C C   . ILE A 1 33  ? -12.551 71.863 46.594 1.00 37.35 ? 33   ILE A C   1 
ATOM   213  O O   . ILE A 1 33  ? -11.583 71.237 47.011 1.00 35.97 ? 33   ILE A O   1 
ATOM   214  C CB  . ILE A 1 33  ? -11.448 73.541 45.024 1.00 36.86 ? 33   ILE A CB  1 
ATOM   215  C CG1 . ILE A 1 33  ? -11.275 75.022 44.694 1.00 35.12 ? 33   ILE A CG1 1 
ATOM   216  C CG2 . ILE A 1 33  ? -11.956 72.732 43.838 1.00 35.97 ? 33   ILE A CG2 1 
ATOM   217  C CD1 . ILE A 1 33  ? -10.220 75.305 43.634 1.00 32.90 ? 33   ILE A CD1 1 
ATOM   218  N N   . PRO A 1 34  ? -13.755 71.278 46.427 1.00 37.73 ? 34   PRO A N   1 
ATOM   219  C CA  . PRO A 1 34  ? -13.965 69.859 46.750 1.00 37.66 ? 34   PRO A CA  1 
ATOM   220  C C   . PRO A 1 34  ? -13.404 68.950 45.650 1.00 37.09 ? 34   PRO A C   1 
ATOM   221  O O   . PRO A 1 34  ? -13.523 69.290 44.465 1.00 38.23 ? 34   PRO A O   1 
ATOM   222  C CB  . PRO A 1 34  ? -15.501 69.765 46.876 1.00 38.20 ? 34   PRO A CB  1 
ATOM   223  C CG  . PRO A 1 34  ? -15.944 70.700 45.729 1.00 39.18 ? 34   PRO A CG  1 
ATOM   224  C CD  . PRO A 1 34  ? -15.013 71.904 45.947 1.00 38.86 ? 34   PRO A CD  1 
ATOM   225  N N   . PHE A 1 35  ? -12.784 67.816 46.001 1.00 34.48 ? 35   PHE A N   1 
ATOM   226  C CA  . PHE A 1 35  ? -12.244 66.961 44.932 1.00 34.58 ? 35   PHE A CA  1 
ATOM   227  C C   . PHE A 1 35  ? -12.773 65.560 45.059 1.00 35.19 ? 35   PHE A C   1 
ATOM   228  O O   . PHE A 1 35  ? -12.502 64.705 44.227 1.00 37.26 ? 35   PHE A O   1 
ATOM   229  C CB  . PHE A 1 35  ? -10.689 66.952 44.906 1.00 32.58 ? 35   PHE A CB  1 
ATOM   230  C CG  . PHE A 1 35  ? -10.048 66.465 46.200 1.00 33.11 ? 35   PHE A CG  1 
ATOM   231  C CD1 . PHE A 1 35  ? -10.026 65.100 46.514 1.00 32.70 ? 35   PHE A CD1 1 
ATOM   232  C CD2 . PHE A 1 35  ? -9.527  67.389 47.134 1.00 30.86 ? 35   PHE A CD2 1 
ATOM   233  C CE1 . PHE A 1 35  ? -9.497  64.645 47.741 1.00 32.40 ? 35   PHE A CE1 1 
ATOM   234  C CE2 . PHE A 1 35  ? -8.987  66.961 48.380 1.00 31.84 ? 35   PHE A CE2 1 
ATOM   235  C CZ  . PHE A 1 35  ? -8.971  65.590 48.687 1.00 32.04 ? 35   PHE A CZ  1 
ATOM   236  N N   . ALA A 1 36  ? -13.576 65.347 46.085 1.00 35.60 ? 36   ALA A N   1 
ATOM   237  C CA  . ALA A 1 36  ? -14.137 64.042 46.337 1.00 36.65 ? 36   ALA A CA  1 
ATOM   238  C C   . ALA A 1 36  ? -15.498 64.232 46.991 1.00 38.88 ? 36   ALA A C   1 
ATOM   239  O O   . ALA A 1 36  ? -15.790 65.295 47.562 1.00 39.47 ? 36   ALA A O   1 
ATOM   240  C CB  . ALA A 1 36  ? -13.229 63.270 47.299 1.00 35.11 ? 36   ALA A CB  1 
ATOM   241  N N   . GLU A 1 37  ? -16.339 63.206 46.901 1.00 39.66 ? 37   GLU A N   1 
ATOM   242  C CA  . GLU A 1 37  ? -17.612 63.254 47.574 1.00 39.76 ? 37   GLU A CA  1 
ATOM   243  C C   . GLU A 1 37  ? -17.278 63.109 49.063 1.00 39.81 ? 37   GLU A C   1 
ATOM   244  O O   . GLU A 1 37  ? -16.344 62.389 49.422 1.00 38.67 ? 37   GLU A O   1 
ATOM   245  C CB  . GLU A 1 37  ? -18.480 62.084 47.117 1.00 39.39 ? 37   GLU A CB  1 
ATOM   246  C CG  . GLU A 1 37  ? -19.064 62.278 45.693 1.00 43.40 ? 37   GLU A CG  1 
ATOM   247  C CD  . GLU A 1 37  ? -20.049 63.467 45.636 1.00 43.21 ? 37   GLU A CD  1 
ATOM   248  O OE1 . GLU A 1 37  ? -21.004 63.452 46.426 1.00 45.62 ? 37   GLU A OE1 1 
ATOM   249  O OE2 . GLU A 1 37  ? -19.870 64.407 44.831 1.00 45.48 ? 37   GLU A OE2 1 
ATOM   250  N N   . PRO A 1 38  ? -18.016 63.815 49.939 1.00 40.47 ? 38   PRO A N   1 
ATOM   251  C CA  . PRO A 1 38  ? -17.814 63.748 51.398 1.00 40.12 ? 38   PRO A CA  1 
ATOM   252  C C   . PRO A 1 38  ? -17.835 62.253 51.810 1.00 41.71 ? 38   PRO A C   1 
ATOM   253  O O   . PRO A 1 38  ? -18.771 61.511 51.478 1.00 40.56 ? 38   PRO A O   1 
ATOM   254  C CB  . PRO A 1 38  ? -19.020 64.521 51.944 1.00 39.42 ? 38   PRO A CB  1 
ATOM   255  C CG  . PRO A 1 38  ? -19.228 65.602 50.866 1.00 40.13 ? 38   PRO A CG  1 
ATOM   256  C CD  . PRO A 1 38  ? -19.109 64.757 49.591 1.00 39.83 ? 38   PRO A CD  1 
ATOM   257  N N   . PRO A 1 39  ? -16.800 61.788 52.535 1.00 41.95 ? 39   PRO A N   1 
ATOM   258  C CA  . PRO A 1 39  ? -16.776 60.378 52.929 1.00 41.61 ? 39   PRO A CA  1 
ATOM   259  C C   . PRO A 1 39  ? -17.464 60.150 54.267 1.00 44.31 ? 39   PRO A C   1 
ATOM   260  O O   . PRO A 1 39  ? -16.833 59.785 55.263 1.00 42.77 ? 39   PRO A O   1 
ATOM   261  C CB  . PRO A 1 39  ? -15.289 60.081 52.962 1.00 42.60 ? 39   PRO A CB  1 
ATOM   262  C CG  . PRO A 1 39  ? -14.719 61.332 53.552 1.00 43.24 ? 39   PRO A CG  1 
ATOM   263  C CD  . PRO A 1 39  ? -15.530 62.458 52.854 1.00 41.59 ? 39   PRO A CD  1 
ATOM   264  N N   . VAL A 1 40  ? -18.780 60.375 54.256 1.00 45.53 ? 40   VAL A N   1 
ATOM   265  C CA  . VAL A 1 40  ? -19.636 60.278 55.427 1.00 45.37 ? 40   VAL A CA  1 
ATOM   266  C C   . VAL A 1 40  ? -20.651 59.115 55.359 1.00 46.73 ? 40   VAL A C   1 
ATOM   267  O O   . VAL A 1 40  ? -20.863 58.495 54.304 1.00 46.84 ? 40   VAL A O   1 
ATOM   268  C CB  . VAL A 1 40  ? -20.379 61.617 55.607 1.00 45.30 ? 40   VAL A CB  1 
ATOM   269  C CG1 . VAL A 1 40  ? -19.358 62.749 55.622 1.00 44.89 ? 40   VAL A CG1 1 
ATOM   270  C CG2 . VAL A 1 40  ? -21.355 61.864 54.407 1.00 43.97 ? 40   VAL A CG2 1 
ATOM   271  N N   . GLY A 1 41  ? -21.259 58.824 56.504 1.00 46.66 ? 41   GLY A N   1 
ATOM   272  C CA  . GLY A 1 41  ? -22.227 57.749 56.598 1.00 47.03 ? 41   GLY A CA  1 
ATOM   273  C C   . GLY A 1 41  ? -21.589 56.451 56.172 1.00 48.98 ? 41   GLY A C   1 
ATOM   274  O O   . GLY A 1 41  ? -20.500 56.063 56.640 1.00 49.15 ? 41   GLY A O   1 
ATOM   275  N N   . ASN A 1 42  ? -22.261 55.762 55.265 1.00 49.13 ? 42   ASN A N   1 
ATOM   276  C CA  . ASN A 1 42  ? -21.740 54.507 54.781 1.00 48.71 ? 42   ASN A CA  1 
ATOM   277  C C   . ASN A 1 42  ? -20.463 54.615 53.962 1.00 46.05 ? 42   ASN A C   1 
ATOM   278  O O   . ASN A 1 42  ? -19.866 53.621 53.630 1.00 45.18 ? 42   ASN A O   1 
ATOM   279  C CB  . ASN A 1 42  ? -22.847 53.775 54.026 1.00 54.92 ? 42   ASN A CB  1 
ATOM   280  C CG  . ASN A 1 42  ? -23.671 52.891 54.969 1.00 61.24 ? 42   ASN A CG  1 
ATOM   281  O OD1 . ASN A 1 42  ? -23.608 53.054 56.225 1.00 64.83 ? 42   ASN A OD1 1 
ATOM   282  N ND2 . ASN A 1 42  ? -24.433 51.946 54.393 1.00 62.67 ? 42   ASN A ND2 1 
ATOM   283  N N   A MET A 1 43  ? -20.045 55.825 53.616 0.65 44.96 ? 43   MET A N   1 
ATOM   284  N N   B MET A 1 43  ? -20.050 55.838 53.656 0.35 43.52 ? 43   MET A N   1 
ATOM   285  C CA  A MET A 1 43  ? -18.801 55.952 52.870 0.65 44.58 ? 43   MET A CA  1 
ATOM   286  C CA  B MET A 1 43  ? -18.827 56.040 52.896 0.35 41.87 ? 43   MET A CA  1 
ATOM   287  C C   A MET A 1 43  ? -17.586 56.042 53.820 0.65 42.88 ? 43   MET A C   1 
ATOM   288  C C   B MET A 1 43  ? -17.600 56.130 53.815 0.35 41.17 ? 43   MET A C   1 
ATOM   289  O O   A MET A 1 43  ? -16.438 55.984 53.369 0.65 42.40 ? 43   MET A O   1 
ATOM   290  O O   B MET A 1 43  ? -16.463 56.155 53.339 0.35 41.02 ? 43   MET A O   1 
ATOM   291  C CB  A MET A 1 43  ? -18.845 57.162 51.918 0.65 47.11 ? 43   MET A CB  1 
ATOM   292  C CB  B MET A 1 43  ? -18.948 57.299 52.028 0.35 40.80 ? 43   MET A CB  1 
ATOM   293  C CG  A MET A 1 43  ? -19.748 56.963 50.676 0.65 48.95 ? 43   MET A CG  1 
ATOM   294  C CG  B MET A 1 43  ? -20.040 57.189 50.959 0.35 38.96 ? 43   MET A CG  1 
ATOM   295  S SD  A MET A 1 43  ? -19.529 58.278 49.429 0.65 53.98 ? 43   MET A SD  1 
ATOM   296  S SD  B MET A 1 43  ? -19.818 55.708 49.953 0.35 35.18 ? 43   MET A SD  1 
ATOM   297  N N   . ARG A 1 44  ? -17.827 56.164 55.127 1.00 41.24 ? 44   ARG A N   1 
ATOM   298  C CA  . ARG A 1 44  ? -16.702 56.233 56.092 1.00 40.05 ? 44   ARG A CA  1 
ATOM   299  C C   . ARG A 1 44  ? -15.890 54.937 55.930 1.00 39.28 ? 44   ARG A C   1 
ATOM   300  O O   . ARG A 1 44  ? -16.459 53.847 55.825 1.00 39.76 ? 44   ARG A O   1 
ATOM   301  C CB  . ARG A 1 44  ? -17.196 56.396 57.559 1.00 38.73 ? 44   ARG A CB  1 
ATOM   302  C CG  . ARG A 1 44  ? -16.056 56.274 58.591 1.00 39.76 ? 44   ARG A CG  1 
ATOM   303  C CD  . ARG A 1 44  ? -16.544 56.218 60.022 1.00 37.28 ? 44   ARG A CD  1 
ATOM   304  N NE  . ARG A 1 44  ? -17.200 57.438 60.490 1.00 35.62 ? 44   ARG A NE  1 
ATOM   305  C CZ  . ARG A 1 44  ? -17.869 57.488 61.634 1.00 35.40 ? 44   ARG A CZ  1 
ATOM   306  N NH1 . ARG A 1 44  ? -17.965 56.366 62.367 1.00 34.80 ? 44   ARG A NH1 1 
ATOM   307  N NH2 . ARG A 1 44  ? -18.350 58.650 62.099 1.00 32.72 ? 44   ARG A NH2 1 
ATOM   308  N N   . PHE A 1 45  ? -14.577 55.078 55.854 1.00 37.43 ? 45   PHE A N   1 
ATOM   309  C CA  . PHE A 1 45  ? -13.629 53.975 55.670 1.00 38.00 ? 45   PHE A CA  1 
ATOM   310  C C   . PHE A 1 45  ? -13.499 53.535 54.227 1.00 39.36 ? 45   PHE A C   1 
ATOM   311  O O   . PHE A 1 45  ? -12.540 52.825 53.875 1.00 39.39 ? 45   PHE A O   1 
ATOM   312  C CB  . PHE A 1 45  ? -13.936 52.747 56.538 1.00 38.29 ? 45   PHE A CB  1 
ATOM   313  C CG  . PHE A 1 45  ? -14.097 53.055 58.016 1.00 38.84 ? 45   PHE A CG  1 
ATOM   314  C CD1 . PHE A 1 45  ? -13.145 53.811 58.697 1.00 37.16 ? 45   PHE A CD1 1 
ATOM   315  C CD2 . PHE A 1 45  ? -15.204 52.564 58.724 1.00 37.60 ? 45   PHE A CD2 1 
ATOM   316  C CE1 . PHE A 1 45  ? -13.293 54.079 60.088 1.00 38.55 ? 45   PHE A CE1 1 
ATOM   317  C CE2 . PHE A 1 45  ? -15.376 52.820 60.105 1.00 38.53 ? 45   PHE A CE2 1 
ATOM   318  C CZ  . PHE A 1 45  ? -14.425 53.576 60.795 1.00 37.86 ? 45   PHE A CZ  1 
ATOM   319  N N   . ARG A 1 46  ? -14.423 53.975 53.369 1.00 40.83 ? 46   ARG A N   1 
ATOM   320  C CA  . ARG A 1 46  ? -14.347 53.607 51.956 1.00 42.64 ? 46   ARG A CA  1 
ATOM   321  C C   . ARG A 1 46  ? -13.400 54.442 51.089 1.00 41.62 ? 46   ARG A C   1 
ATOM   322  O O   . ARG A 1 46  ? -13.035 55.577 51.438 1.00 37.41 ? 46   ARG A O   1 
ATOM   323  C CB  . ARG A 1 46  ? -15.730 53.671 51.279 1.00 47.49 ? 46   ARG A CB  1 
ATOM   324  C CG  . ARG A 1 46  ? -16.611 52.469 51.457 1.00 54.29 ? 46   ARG A CG  1 
ATOM   325  C CD  . ARG A 1 46  ? -17.860 52.626 50.566 1.00 60.93 ? 46   ARG A CD  1 
ATOM   326  N NE  . ARG A 1 46  ? -18.932 51.755 51.047 1.00 68.20 ? 46   ARG A NE  1 
ATOM   327  C CZ  . ARG A 1 46  ? -20.222 51.864 50.713 1.00 71.55 ? 46   ARG A CZ  1 
ATOM   328  N NH1 . ARG A 1 46  ? -21.104 51.004 51.233 1.00 71.75 ? 46   ARG A NH1 1 
ATOM   329  N NH2 . ARG A 1 46  ? -20.634 52.820 49.861 1.00 72.84 ? 46   ARG A NH2 1 
ATOM   330  N N   . ARG A 1 47  ? -13.011 53.848 49.955 1.00 40.76 ? 47   ARG A N   1 
ATOM   331  C CA  . ARG A 1 47  ? -12.201 54.545 48.981 1.00 42.16 ? 47   ARG A CA  1 
ATOM   332  C C   . ARG A 1 47  ? -12.948 55.852 48.614 1.00 40.87 ? 47   ARG A C   1 
ATOM   333  O O   . ARG A 1 47  ? -14.184 55.912 48.629 1.00 38.64 ? 47   ARG A O   1 
ATOM   334  C CB  . ARG A 1 47  ? -12.040 53.700 47.710 1.00 44.21 ? 47   ARG A CB  1 
ATOM   335  C CG  . ARG A 1 47  ? -11.067 52.572 47.890 1.00 51.15 ? 47   ARG A CG  1 
ATOM   336  C CD  . ARG A 1 47  ? -11.098 51.556 46.740 1.00 56.67 ? 47   ARG A CD  1 
ATOM   337  N NE  . ARG A 1 47  ? -10.447 50.293 47.145 1.00 62.40 ? 47   ARG A NE  1 
ATOM   338  C CZ  . ARG A 1 47  ? -9.200  49.935 46.809 1.00 64.47 ? 47   ARG A CZ  1 
ATOM   339  N NH1 . ARG A 1 47  ? -8.438  50.746 46.051 1.00 65.40 ? 47   ARG A NH1 1 
ATOM   340  N NH2 . ARG A 1 47  ? -8.718  48.751 47.196 1.00 64.19 ? 47   ARG A NH2 1 
ATOM   341  N N   . PRO A 1 48  ? -12.198 56.909 48.298 1.00 39.00 ? 48   PRO A N   1 
ATOM   342  C CA  . PRO A 1 48  ? -12.890 58.136 47.937 1.00 38.60 ? 48   PRO A CA  1 
ATOM   343  C C   . PRO A 1 48  ? -13.538 57.983 46.541 1.00 39.47 ? 48   PRO A C   1 
ATOM   344  O O   . PRO A 1 48  ? -13.076 57.203 45.714 1.00 37.24 ? 48   PRO A O   1 
ATOM   345  C CB  . PRO A 1 48  ? -11.771 59.166 47.916 1.00 37.61 ? 48   PRO A CB  1 
ATOM   346  C CG  . PRO A 1 48  ? -10.584 58.326 47.326 1.00 37.36 ? 48   PRO A CG  1 
ATOM   347  C CD  . PRO A 1 48  ? -10.730 57.049 48.178 1.00 39.07 ? 48   PRO A CD  1 
ATOM   348  N N   . GLU A 1 49  ? -14.635 58.708 46.332 1.00 40.69 ? 49   GLU A N   1 
ATOM   349  C CA  . GLU A 1 49  ? -15.338 58.773 45.044 1.00 42.23 ? 49   GLU A CA  1 
ATOM   350  C C   . GLU A 1 49  ? -15.125 60.256 44.555 1.00 39.85 ? 49   GLU A C   1 
ATOM   351  O O   . GLU A 1 49  ? -15.135 61.195 45.363 1.00 37.76 ? 49   GLU A O   1 
ATOM   352  C CB  . GLU A 1 49  ? -16.859 58.499 45.208 1.00 44.91 ? 49   GLU A CB  1 
ATOM   353  C CG  . GLU A 1 49  ? -17.316 57.071 45.671 1.00 52.01 ? 49   GLU A CG  1 
ATOM   354  C CD  . GLU A 1 49  ? -16.692 55.870 44.870 1.00 57.35 ? 49   GLU A CD  1 
ATOM   355  O OE1 . GLU A 1 49  ? -16.537 55.952 43.612 1.00 59.60 ? 49   GLU A OE1 1 
ATOM   356  O OE2 . GLU A 1 49  ? -16.365 54.822 45.512 1.00 59.69 ? 49   GLU A OE2 1 
ATOM   357  N N   . PRO A 1 50  ? -14.935 60.466 43.245 1.00 37.84 ? 50   PRO A N   1 
ATOM   358  C CA  . PRO A 1 50  ? -14.727 61.802 42.663 1.00 38.74 ? 50   PRO A CA  1 
ATOM   359  C C   . PRO A 1 50  ? -15.912 62.731 42.909 1.00 39.42 ? 50   PRO A C   1 
ATOM   360  O O   . PRO A 1 50  ? -17.052 62.271 42.969 1.00 39.23 ? 50   PRO A O   1 
ATOM   361  C CB  . PRO A 1 50  ? -14.485 61.516 41.171 1.00 39.36 ? 50   PRO A CB  1 
ATOM   362  C CG  . PRO A 1 50  ? -15.150 60.204 40.935 1.00 40.23 ? 50   PRO A CG  1 
ATOM   363  C CD  . PRO A 1 50  ? -14.982 59.412 42.211 1.00 38.73 ? 50   PRO A CD  1 
ATOM   364  N N   . LYS A 1 51  ? -15.660 64.024 43.108 1.00 39.15 ? 51   LYS A N   1 
ATOM   365  C CA  . LYS A 1 51  ? -16.766 64.948 43.392 1.00 40.74 ? 51   LYS A CA  1 
ATOM   366  C C   . LYS A 1 51  ? -17.709 65.074 42.164 1.00 42.43 ? 51   LYS A C   1 
ATOM   367  O O   . LYS A 1 51  ? -17.242 65.226 41.029 1.00 40.61 ? 51   LYS A O   1 
ATOM   368  C CB  . LYS A 1 51  ? -16.192 66.307 43.769 1.00 40.16 ? 51   LYS A CB  1 
ATOM   369  C CG  . LYS A 1 51  ? -17.205 67.449 43.907 1.00 41.83 ? 51   LYS A CG  1 
ATOM   370  C CD  . LYS A 1 51  ? -18.123 67.296 45.115 1.00 40.43 ? 51   LYS A CD  1 
ATOM   371  C CE  . LYS A 1 51  ? -18.916 68.576 45.398 1.00 40.88 ? 51   LYS A CE  1 
ATOM   372  N NZ  . LYS A 1 51  ? -19.825 68.350 46.553 1.00 42.13 ? 51   LYS A NZ  1 
ATOM   373  N N   . LYS A 1 52  ? -19.027 64.972 42.382 1.00 43.90 ? 52   LYS A N   1 
ATOM   374  C CA  . LYS A 1 52  ? -19.964 65.110 41.256 1.00 43.74 ? 52   LYS A CA  1 
ATOM   375  C C   . LYS A 1 52  ? -19.915 66.555 40.800 1.00 43.06 ? 52   LYS A C   1 
ATOM   376  O O   . LYS A 1 52  ? -19.959 67.494 41.624 1.00 43.13 ? 52   LYS A O   1 
ATOM   377  C CB  . LYS A 1 52  ? -21.400 64.769 41.673 1.00 45.70 ? 52   LYS A CB  1 
ATOM   378  C CG  . LYS A 1 52  ? -21.634 63.305 42.071 1.00 47.67 ? 52   LYS A CG  1 
ATOM   379  N N   . PRO A 1 53  ? -19.794 66.769 39.486 1.00 43.42 ? 53   PRO A N   1 
ATOM   380  C CA  . PRO A 1 53  ? -19.755 68.160 38.997 1.00 44.02 ? 53   PRO A CA  1 
ATOM   381  C C   . PRO A 1 53  ? -20.984 68.927 39.524 1.00 43.76 ? 53   PRO A C   1 
ATOM   382  O O   . PRO A 1 53  ? -22.058 68.334 39.752 1.00 41.12 ? 53   PRO A O   1 
ATOM   383  C CB  . PRO A 1 53  ? -19.794 67.998 37.473 1.00 43.89 ? 53   PRO A CB  1 
ATOM   384  C CG  . PRO A 1 53  ? -19.071 66.689 37.274 1.00 44.72 ? 53   PRO A CG  1 
ATOM   385  C CD  . PRO A 1 53  ? -19.652 65.811 38.377 1.00 43.00 ? 53   PRO A CD  1 
ATOM   386  N N   . TRP A 1 54  ? -20.806 70.223 39.740 1.00 43.35 ? 54   TRP A N   1 
ATOM   387  C CA  . TRP A 1 54  ? -21.905 71.061 40.222 1.00 45.49 ? 54   TRP A CA  1 
ATOM   388  C C   . TRP A 1 54  ? -22.189 72.147 39.191 1.00 46.97 ? 54   TRP A C   1 
ATOM   389  O O   . TRP A 1 54  ? -21.299 72.532 38.421 1.00 46.39 ? 54   TRP A O   1 
ATOM   390  C CB  . TRP A 1 54  ? -21.542 71.744 41.549 1.00 43.37 ? 54   TRP A CB  1 
ATOM   391  C CG  . TRP A 1 54  ? -20.331 72.576 41.424 1.00 40.56 ? 54   TRP A CG  1 
ATOM   392  C CD1 . TRP A 1 54  ? -20.252 73.852 40.951 1.00 40.54 ? 54   TRP A CD1 1 
ATOM   393  C CD2 . TRP A 1 54  ? -18.989 72.146 41.656 1.00 40.70 ? 54   TRP A CD2 1 
ATOM   394  N NE1 . TRP A 1 54  ? -18.929 74.250 40.861 1.00 40.22 ? 54   TRP A NE1 1 
ATOM   395  C CE2 . TRP A 1 54  ? -18.134 73.219 41.292 1.00 41.01 ? 54   TRP A CE2 1 
ATOM   396  C CE3 . TRP A 1 54  ? -18.417 70.953 42.135 1.00 39.24 ? 54   TRP A CE3 1 
ATOM   397  C CZ2 . TRP A 1 54  ? -16.738 73.129 41.394 1.00 38.93 ? 54   TRP A CZ2 1 
ATOM   398  C CZ3 . TRP A 1 54  ? -17.037 70.871 42.230 1.00 37.46 ? 54   TRP A CZ3 1 
ATOM   399  C CH2 . TRP A 1 54  ? -16.218 71.953 41.862 1.00 38.59 ? 54   TRP A CH2 1 
ATOM   400  N N   . SER A 1 55  ? -23.436 72.613 39.142 1.00 48.58 ? 55   SER A N   1 
ATOM   401  C CA  . SER A 1 55  ? -23.737 73.718 38.231 1.00 50.83 ? 55   SER A CA  1 
ATOM   402  C C   . SER A 1 55  ? -23.636 74.964 39.132 1.00 50.25 ? 55   SER A C   1 
ATOM   403  O O   . SER A 1 55  ? -23.539 74.847 40.365 1.00 50.33 ? 55   SER A O   1 
ATOM   404  C CB  . SER A 1 55  ? -25.130 73.569 37.601 1.00 51.75 ? 55   SER A CB  1 
ATOM   405  O OG  . SER A 1 55  ? -26.122 73.444 38.602 1.00 55.73 ? 55   SER A OG  1 
ATOM   406  N N   . GLY A 1 56  ? -23.626 76.150 38.543 1.00 50.51 ? 56   GLY A N   1 
ATOM   407  C CA  . GLY A 1 56  ? -23.489 77.333 39.378 1.00 48.56 ? 56   GLY A CA  1 
ATOM   408  C C   . GLY A 1 56  ? -22.022 77.605 39.703 1.00 48.51 ? 56   GLY A C   1 
ATOM   409  O O   . GLY A 1 56  ? -21.104 76.985 39.118 1.00 46.11 ? 56   GLY A O   1 
ATOM   410  N N   . VAL A 1 57  ? -21.801 78.498 40.667 1.00 46.61 ? 57   VAL A N   1 
ATOM   411  C CA  . VAL A 1 57  ? -20.452 78.906 41.039 1.00 45.82 ? 57   VAL A CA  1 
ATOM   412  C C   . VAL A 1 57  ? -20.070 78.480 42.460 1.00 45.89 ? 57   VAL A C   1 
ATOM   413  O O   . VAL A 1 57  ? -20.811 78.759 43.411 1.00 44.07 ? 57   VAL A O   1 
ATOM   414  C CB  . VAL A 1 57  ? -20.310 80.437 40.871 1.00 46.26 ? 57   VAL A CB  1 
ATOM   415  C CG1 . VAL A 1 57  ? -18.954 80.891 41.308 1.00 45.62 ? 57   VAL A CG1 1 
ATOM   416  C CG2 . VAL A 1 57  ? -20.559 80.803 39.406 1.00 45.04 ? 57   VAL A CG2 1 
ATOM   417  N N   . TRP A 1 58  ? -18.929 77.773 42.597 1.00 43.80 ? 58   TRP A N   1 
ATOM   418  C CA  . TRP A 1 58  ? -18.506 77.314 43.916 1.00 42.70 ? 58   TRP A CA  1 
ATOM   419  C C   . TRP A 1 58  ? -17.740 78.459 44.557 1.00 41.73 ? 58   TRP A C   1 
ATOM   420  O O   . TRP A 1 58  ? -16.837 79.033 43.946 1.00 41.00 ? 58   TRP A O   1 
ATOM   421  C CB  . TRP A 1 58  ? -17.645 76.019 43.818 1.00 41.95 ? 58   TRP A CB  1 
ATOM   422  C CG  . TRP A 1 58  ? -17.344 75.424 45.182 1.00 40.15 ? 58   TRP A CG  1 
ATOM   423  C CD1 . TRP A 1 58  ? -16.507 75.949 46.136 1.00 39.80 ? 58   TRP A CD1 1 
ATOM   424  C CD2 . TRP A 1 58  ? -17.999 74.303 45.805 1.00 39.08 ? 58   TRP A CD2 1 
ATOM   425  N NE1 . TRP A 1 58  ? -16.616 75.249 47.305 1.00 39.54 ? 58   TRP A NE1 1 
ATOM   426  C CE2 . TRP A 1 58  ? -17.522 74.231 47.137 1.00 39.16 ? 58   TRP A CE2 1 
ATOM   427  C CE3 . TRP A 1 58  ? -18.944 73.356 45.366 1.00 38.59 ? 58   TRP A CE3 1 
ATOM   428  C CZ2 . TRP A 1 58  ? -17.959 73.253 48.040 1.00 38.08 ? 58   TRP A CZ2 1 
ATOM   429  C CZ3 . TRP A 1 58  ? -19.386 72.380 46.264 1.00 39.17 ? 58   TRP A CZ3 1 
ATOM   430  C CH2 . TRP A 1 58  ? -18.891 72.339 47.587 1.00 39.41 ? 58   TRP A CH2 1 
ATOM   431  N N   . ASN A 1 59  ? -18.157 78.815 45.767 1.00 42.54 ? 59   ASN A N   1 
ATOM   432  C CA  . ASN A 1 59  ? -17.552 79.902 46.533 1.00 44.50 ? 59   ASN A CA  1 
ATOM   433  C C   . ASN A 1 59  ? -16.286 79.276 47.164 1.00 43.43 ? 59   ASN A C   1 
ATOM   434  O O   . ASN A 1 59  ? -16.405 78.432 48.048 1.00 42.38 ? 59   ASN A O   1 
ATOM   435  C CB  . ASN A 1 59  ? -18.545 80.385 47.634 1.00 49.06 ? 59   ASN A CB  1 
ATOM   436  C CG  . ASN A 1 59  ? -18.043 81.619 48.435 1.00 55.13 ? 59   ASN A CG  1 
ATOM   437  O OD1 . ASN A 1 59  ? -16.876 81.979 48.329 1.00 55.53 ? 59   ASN A OD1 1 
ATOM   438  N ND2 . ASN A 1 59  ? -18.935 82.237 49.243 1.00 62.41 ? 59   ASN A ND2 1 
ATOM   439  N N   . ALA A 1 60  ? -15.110 79.675 46.672 1.00 41.44 ? 60   ALA A N   1 
ATOM   440  C CA  . ALA A 1 60  ? -13.802 79.214 47.161 1.00 40.88 ? 60   ALA A CA  1 
ATOM   441  C C   . ALA A 1 60  ? -13.115 80.413 47.789 1.00 41.15 ? 60   ALA A C   1 
ATOM   442  O O   . ALA A 1 60  ? -11.953 80.713 47.478 1.00 40.86 ? 60   ALA A O   1 
ATOM   443  C CB  . ALA A 1 60  ? -12.942 78.724 46.008 1.00 39.45 ? 60   ALA A CB  1 
ATOM   444  N N   . SER A 1 61  ? -13.819 81.129 48.653 1.00 40.05 ? 61   SER A N   1 
ATOM   445  C CA  . SER A 1 61  ? -13.199 82.308 49.247 1.00 40.54 ? 61   SER A CA  1 
ATOM   446  C C   . SER A 1 61  ? -12.744 82.039 50.683 1.00 39.81 ? 61   SER A C   1 
ATOM   447  O O   . SER A 1 61  ? -12.004 82.832 51.247 1.00 41.01 ? 61   SER A O   1 
ATOM   448  C CB  . SER A 1 61  ? -14.188 83.484 49.200 1.00 39.37 ? 61   SER A CB  1 
ATOM   449  O OG  . SER A 1 61  ? -15.308 83.157 50.023 1.00 42.42 ? 61   SER A OG  1 
ATOM   450  N N   . THR A 1 62  ? -13.174 80.923 51.272 1.00 39.53 ? 62   THR A N   1 
ATOM   451  C CA  . THR A 1 62  ? -12.761 80.603 52.651 1.00 40.63 ? 62   THR A CA  1 
ATOM   452  C C   . THR A 1 62  ? -12.217 79.174 52.852 1.00 39.15 ? 62   THR A C   1 
ATOM   453  O O   . THR A 1 62  ? -12.618 78.234 52.156 1.00 38.93 ? 62   THR A O   1 
ATOM   454  C CB  . THR A 1 62  ? -13.932 80.768 53.601 1.00 40.43 ? 62   THR A CB  1 
ATOM   455  O OG1 . THR A 1 62  ? -14.938 79.829 53.225 1.00 43.50 ? 62   THR A OG1 1 
ATOM   456  C CG2 . THR A 1 62  ? -14.534 82.180 53.479 1.00 45.78 ? 62   THR A CG2 1 
ATOM   457  N N   . TYR A 1 63  ? -11.325 79.001 53.823 1.00 37.86 ? 63   TYR A N   1 
ATOM   458  C CA  . TYR A 1 63  ? -10.795 77.655 54.105 1.00 36.23 ? 63   TYR A CA  1 
ATOM   459  C C   . TYR A 1 63  ? -11.881 76.628 54.425 1.00 35.47 ? 63   TYR A C   1 
ATOM   460  O O   . TYR A 1 63  ? -12.899 76.943 54.995 1.00 35.11 ? 63   TYR A O   1 
ATOM   461  C CB  . TYR A 1 63  ? -9.832  77.675 55.286 1.00 33.55 ? 63   TYR A CB  1 
ATOM   462  C CG  . TYR A 1 63  ? -8.447  78.135 54.944 1.00 34.99 ? 63   TYR A CG  1 
ATOM   463  C CD1 . TYR A 1 63  ? -7.766  77.606 53.834 1.00 35.66 ? 63   TYR A CD1 1 
ATOM   464  C CD2 . TYR A 1 63  ? -7.754  79.018 55.798 1.00 35.66 ? 63   TYR A CD2 1 
ATOM   465  C CE1 . TYR A 1 63  ? -6.445  77.928 53.592 1.00 34.00 ? 63   TYR A CE1 1 
ATOM   466  C CE2 . TYR A 1 63  ? -6.419  79.348 55.572 1.00 33.90 ? 63   TYR A CE2 1 
ATOM   467  C CZ  . TYR A 1 63  ? -5.778  78.801 54.476 1.00 35.37 ? 63   TYR A CZ  1 
ATOM   468  O OH  . TYR A 1 63  ? -4.474  79.122 54.263 1.00 36.38 ? 63   TYR A OH  1 
ATOM   469  N N   . PRO A 1 64  ? -11.660 75.370 54.044 1.00 34.49 ? 64   PRO A N   1 
ATOM   470  C CA  . PRO A 1 64  ? -12.601 74.292 54.300 1.00 33.34 ? 64   PRO A CA  1 
ATOM   471  C C   . PRO A 1 64  ? -12.417 73.768 55.753 1.00 34.17 ? 64   PRO A C   1 
ATOM   472  O O   . PRO A 1 64  ? -11.527 74.213 56.477 1.00 31.55 ? 64   PRO A O   1 
ATOM   473  C CB  . PRO A 1 64  ? -12.150 73.246 53.289 1.00 34.54 ? 64   PRO A CB  1 
ATOM   474  C CG  . PRO A 1 64  ? -10.633 73.377 53.363 1.00 31.43 ? 64   PRO A CG  1 
ATOM   475  C CD  . PRO A 1 64  ? -10.519 74.886 53.236 1.00 35.41 ? 64   PRO A CD  1 
ATOM   476  N N   . ASN A 1 65  ? -13.286 72.850 56.156 1.00 33.47 ? 65   ASN A N   1 
ATOM   477  C CA  . ASN A 1 65  ? -13.165 72.186 57.425 1.00 36.10 ? 65   ASN A CA  1 
ATOM   478  C C   . ASN A 1 65  ? -11.860 71.334 57.398 1.00 36.30 ? 65   ASN A C   1 
ATOM   479  O O   . ASN A 1 65  ? -11.322 71.000 56.333 1.00 35.60 ? 65   ASN A O   1 
ATOM   480  C CB  . ASN A 1 65  ? -14.327 71.206 57.612 1.00 39.08 ? 65   ASN A CB  1 
ATOM   481  C CG  . ASN A 1 65  ? -15.697 71.907 57.693 1.00 43.02 ? 65   ASN A CG  1 
ATOM   482  O OD1 . ASN A 1 65  ? -15.873 72.867 58.441 1.00 41.27 ? 65   ASN A OD1 1 
ATOM   483  N ND2 . ASN A 1 65  ? -16.665 71.410 56.915 1.00 45.41 ? 65   ASN A ND2 1 
ATOM   484  N N   . ASN A 1 66  ? -11.373 70.975 58.577 1.00 36.54 ? 66   ASN A N   1 
ATOM   485  C CA  . ASN A 1 66  ? -10.197 70.105 58.699 1.00 35.45 ? 66   ASN A CA  1 
ATOM   486  C C   . ASN A 1 66  ? -10.795 68.714 59.027 1.00 35.65 ? 66   ASN A C   1 
ATOM   487  O O   . ASN A 1 66  ? -11.888 68.629 59.625 1.00 35.07 ? 66   ASN A O   1 
ATOM   488  C CB  . ASN A 1 66  ? -9.322  70.544 59.871 1.00 33.74 ? 66   ASN A CB  1 
ATOM   489  C CG  . ASN A 1 66  ? -8.780  71.993 59.731 1.00 36.55 ? 66   ASN A CG  1 
ATOM   490  O OD1 . ASN A 1 66  ? -8.645  72.695 60.734 1.00 36.36 ? 66   ASN A OD1 1 
ATOM   491  N ND2 . ASN A 1 66  ? -8.452  72.419 58.507 1.00 35.27 ? 66   ASN A ND2 1 
ATOM   492  N N   . CYS A 1 67  ? -10.093 67.639 58.675 1.00 34.20 ? 67   CYS A N   1 
ATOM   493  C CA  . CYS A 1 67  ? -10.593 66.297 58.970 1.00 34.87 ? 67   CYS A CA  1 
ATOM   494  C C   . CYS A 1 67  ? -10.594 66.028 60.450 1.00 35.39 ? 67   CYS A C   1 
ATOM   495  O O   . CYS A 1 67  ? -9.864  66.665 61.207 1.00 35.79 ? 67   CYS A O   1 
ATOM   496  C CB  . CYS A 1 67  ? -9.748  65.238 58.250 1.00 34.45 ? 67   CYS A CB  1 
ATOM   497  S SG  . CYS A 1 67  ? -9.784  65.385 56.427 1.00 38.10 ? 67   CYS A SG  1 
ATOM   498  N N   . GLN A 1 68  ? -11.416 65.072 60.867 1.00 36.57 ? 68   GLN A N   1 
ATOM   499  C CA  . GLN A 1 68  ? -11.548 64.710 62.281 1.00 35.99 ? 68   GLN A CA  1 
ATOM   500  C C   . GLN A 1 68  ? -10.223 64.134 62.761 1.00 36.42 ? 68   GLN A C   1 
ATOM   501  O O   . GLN A 1 68  ? -9.677  63.230 62.119 1.00 36.65 ? 68   GLN A O   1 
ATOM   502  C CB  . GLN A 1 68  ? -12.668 63.678 62.468 1.00 35.75 ? 68   GLN A CB  1 
ATOM   503  C CG  . GLN A 1 68  ? -14.082 64.224 62.232 1.00 36.18 ? 68   GLN A CG  1 
ATOM   504  C CD  . GLN A 1 68  ? -14.635 65.021 63.435 1.00 39.17 ? 68   GLN A CD  1 
ATOM   505  O OE1 . GLN A 1 68  ? -15.752 65.534 63.394 1.00 40.99 ? 68   GLN A OE1 1 
ATOM   506  N NE2 . GLN A 1 68  ? -13.858 65.116 64.495 1.00 36.60 ? 68   GLN A NE2 1 
ATOM   507  N N   . GLN A 1 69  ? -9.712  64.660 63.873 1.00 34.07 ? 69   GLN A N   1 
ATOM   508  C CA  . GLN A 1 69  ? -8.427  64.207 64.405 1.00 35.37 ? 69   GLN A CA  1 
ATOM   509  C C   . GLN A 1 69  ? -8.263  64.448 65.915 1.00 34.68 ? 69   GLN A C   1 
ATOM   510  O O   . GLN A 1 69  ? -8.997  65.270 66.522 1.00 32.71 ? 69   GLN A O   1 
ATOM   511  C CB  . GLN A 1 69  ? -7.296  64.936 63.660 1.00 34.48 ? 69   GLN A CB  1 
ATOM   512  C CG  . GLN A 1 69  ? -7.424  66.493 63.690 1.00 32.55 ? 69   GLN A CG  1 
ATOM   513  C CD  . GLN A 1 69  ? -6.444  67.173 62.714 1.00 34.84 ? 69   GLN A CD  1 
ATOM   514  O OE1 . GLN A 1 69  ? -5.277  67.483 63.065 1.00 33.39 ? 69   GLN A OE1 1 
ATOM   515  N NE2 . GLN A 1 69  ? -6.905  67.373 61.459 1.00 33.98 ? 69   GLN A NE2 1 
ATOM   516  N N   . TYR A 1 70  ? -7.305  63.731 66.502 1.00 33.93 ? 70   TYR A N   1 
ATOM   517  C CA  . TYR A 1 70  ? -6.964  63.926 67.901 1.00 35.55 ? 70   TYR A CA  1 
ATOM   518  C C   . TYR A 1 70  ? -6.409  65.371 68.002 1.00 37.20 ? 70   TYR A C   1 
ATOM   519  O O   . TYR A 1 70  ? -5.690  65.836 67.113 1.00 36.55 ? 70   TYR A O   1 
ATOM   520  C CB  . TYR A 1 70  ? -5.892  62.926 68.337 1.00 38.42 ? 70   TYR A CB  1 
ATOM   521  C CG  . TYR A 1 70  ? -5.321  63.179 69.737 1.00 40.46 ? 70   TYR A CG  1 
ATOM   522  C CD1 . TYR A 1 70  ? -5.877  62.602 70.912 1.00 40.65 ? 70   TYR A CD1 1 
ATOM   523  C CD2 . TYR A 1 70  ? -4.227  64.009 69.878 1.00 41.75 ? 70   TYR A CD2 1 
ATOM   524  C CE1 . TYR A 1 70  ? -5.296  62.889 72.216 1.00 42.03 ? 70   TYR A CE1 1 
ATOM   525  C CE2 . TYR A 1 70  ? -3.660  64.294 71.131 1.00 44.25 ? 70   TYR A CE2 1 
ATOM   526  C CZ  . TYR A 1 70  ? -4.181  63.752 72.288 1.00 44.74 ? 70   TYR A CZ  1 
ATOM   527  O OH  . TYR A 1 70  ? -3.545  64.177 73.481 1.00 50.41 ? 70   TYR A OH  1 
ATOM   528  N N   . VAL A 1 71  ? -6.767  66.096 69.060 1.00 36.92 ? 71   VAL A N   1 
ATOM   529  C CA  . VAL A 1 71  ? -6.306  67.474 69.214 1.00 38.47 ? 71   VAL A CA  1 
ATOM   530  C C   . VAL A 1 71  ? -5.325  67.594 70.386 1.00 40.44 ? 71   VAL A C   1 
ATOM   531  O O   . VAL A 1 71  ? -5.574  67.088 71.488 1.00 41.43 ? 71   VAL A O   1 
ATOM   532  C CB  . VAL A 1 71  ? -7.525  68.448 69.398 1.00 37.49 ? 71   VAL A CB  1 
ATOM   533  C CG1 . VAL A 1 71  ? -7.074  69.852 69.793 1.00 38.92 ? 71   VAL A CG1 1 
ATOM   534  C CG2 . VAL A 1 71  ? -8.277  68.538 68.076 1.00 38.89 ? 71   VAL A CG2 1 
ATOM   535  N N   . ASP A 1 72  ? -4.198  68.248 70.139 1.00 41.52 ? 72   ASP A N   1 
ATOM   536  C CA  . ASP A 1 72  ? -3.169  68.441 71.162 1.00 40.92 ? 72   ASP A CA  1 
ATOM   537  C C   . ASP A 1 72  ? -3.623  69.464 72.200 1.00 41.10 ? 72   ASP A C   1 
ATOM   538  O O   . ASP A 1 72  ? -3.897  70.609 71.869 1.00 41.74 ? 72   ASP A O   1 
ATOM   539  C CB  . ASP A 1 72  ? -1.877  68.972 70.520 1.00 41.81 ? 72   ASP A CB  1 
ATOM   540  C CG  . ASP A 1 72  ? -0.734  69.081 71.508 1.00 42.44 ? 72   ASP A CG  1 
ATOM   541  O OD1 . ASP A 1 72  ? -0.876  68.678 72.670 1.00 42.21 ? 72   ASP A OD1 1 
ATOM   542  O OD2 . ASP A 1 72  ? 0.331   69.554 71.112 1.00 45.71 ? 72   ASP A OD2 1 
ATOM   543  N N   . GLU A 1 73  ? -3.681  69.035 73.456 1.00 42.58 ? 73   GLU A N   1 
ATOM   544  C CA  . GLU A 1 73  ? -4.035  69.894 74.579 1.00 43.50 ? 73   GLU A CA  1 
ATOM   545  C C   . GLU A 1 73  ? -2.926  69.926 75.657 1.00 42.86 ? 73   GLU A C   1 
ATOM   546  O O   . GLU A 1 73  ? -3.155  70.402 76.757 1.00 43.66 ? 73   GLU A O   1 
ATOM   547  C CB  . GLU A 1 73  ? -5.365  69.421 75.193 1.00 45.44 ? 73   GLU A CB  1 
ATOM   548  C CG  . GLU A 1 73  ? -6.563  69.769 74.346 1.00 47.30 ? 73   GLU A CG  1 
ATOM   549  C CD  . GLU A 1 73  ? -7.888  69.277 74.925 1.00 51.44 ? 73   GLU A CD  1 
ATOM   550  O OE1 . GLU A 1 73  ? -8.121  69.355 76.169 1.00 50.58 ? 73   GLU A OE1 1 
ATOM   551  O OE2 . GLU A 1 73  ? -8.720  68.829 74.104 1.00 53.31 ? 73   GLU A OE2 1 
ATOM   552  N N   . GLN A 1 74  ? -1.740  69.413 75.354 1.00 43.34 ? 74   GLN A N   1 
ATOM   553  C CA  . GLN A 1 74  ? -0.644  69.427 76.324 1.00 45.45 ? 74   GLN A CA  1 
ATOM   554  C C   . GLN A 1 74  ? -0.247  70.821 76.845 1.00 43.72 ? 74   GLN A C   1 
ATOM   555  O O   . GLN A 1 74  ? 0.034   70.975 78.018 1.00 44.27 ? 74   GLN A O   1 
ATOM   556  C CB  . GLN A 1 74  ? 0.603   68.751 75.753 1.00 46.95 ? 74   GLN A CB  1 
ATOM   557  C CG  . GLN A 1 74  ? 0.807   67.328 76.259 1.00 53.78 ? 74   GLN A CG  1 
ATOM   558  C CD  . GLN A 1 74  ? 1.565   67.251 77.586 1.00 56.75 ? 74   GLN A CD  1 
ATOM   559  O OE1 . GLN A 1 74  ? 2.573   66.522 77.693 1.00 60.55 ? 74   GLN A OE1 1 
ATOM   560  N NE2 . GLN A 1 74  ? 1.093   67.993 78.607 1.00 57.11 ? 74   GLN A NE2 1 
ATOM   561  N N   . PHE A 1 75  ? -0.267  71.826 75.980 1.00 41.33 ? 75   PHE A N   1 
ATOM   562  C CA  . PHE A 1 75  ? 0.112   73.205 76.338 1.00 40.64 ? 75   PHE A CA  1 
ATOM   563  C C   . PHE A 1 75  ? -0.945  74.205 75.845 1.00 40.27 ? 75   PHE A C   1 
ATOM   564  O O   . PHE A 1 75  ? -0.677  74.998 74.944 1.00 38.67 ? 75   PHE A O   1 
ATOM   565  C CB  . PHE A 1 75  ? 1.477   73.523 75.691 1.00 37.31 ? 75   PHE A CB  1 
ATOM   566  C CG  . PHE A 1 75  ? 2.540   72.520 76.050 1.00 36.74 ? 75   PHE A CG  1 
ATOM   567  C CD1 . PHE A 1 75  ? 2.992   72.403 77.396 1.00 35.12 ? 75   PHE A CD1 1 
ATOM   568  C CD2 . PHE A 1 75  ? 3.068   71.664 75.087 1.00 34.98 ? 75   PHE A CD2 1 
ATOM   569  C CE1 . PHE A 1 75  ? 3.932   71.461 77.746 1.00 33.91 ? 75   PHE A CE1 1 
ATOM   570  C CE2 . PHE A 1 75  ? 4.037   70.696 75.428 1.00 33.46 ? 75   PHE A CE2 1 
ATOM   571  C CZ  . PHE A 1 75  ? 4.470   70.592 76.758 1.00 33.95 ? 75   PHE A CZ  1 
ATOM   572  N N   . PRO A 1 76  ? -2.140  74.197 76.463 1.00 41.53 ? 76   PRO A N   1 
ATOM   573  C CA  . PRO A 1 76  ? -3.238  75.083 76.073 1.00 42.07 ? 76   PRO A CA  1 
ATOM   574  C C   . PRO A 1 76  ? -2.752  76.485 75.802 1.00 43.36 ? 76   PRO A C   1 
ATOM   575  O O   . PRO A 1 76  ? -2.101  77.104 76.651 1.00 43.41 ? 76   PRO A O   1 
ATOM   576  C CB  . PRO A 1 76  ? -4.193  74.990 77.262 1.00 41.18 ? 76   PRO A CB  1 
ATOM   577  C CG  . PRO A 1 76  ? -3.955  73.622 77.793 1.00 40.35 ? 76   PRO A CG  1 
ATOM   578  C CD  . PRO A 1 76  ? -2.438  73.574 77.767 1.00 41.91 ? 76   PRO A CD  1 
ATOM   579  N N   . GLY A 1 77  ? -3.042  76.983 74.602 1.00 43.59 ? 77   GLY A N   1 
ATOM   580  C CA  . GLY A 1 77  ? -2.604  78.328 74.259 1.00 44.08 ? 77   GLY A CA  1 
ATOM   581  C C   . GLY A 1 77  ? -1.130  78.560 73.907 1.00 43.82 ? 77   GLY A C   1 
ATOM   582  O O   . GLY A 1 77  ? -0.755  79.644 73.454 1.00 46.48 ? 77   GLY A O   1 
ATOM   583  N N   . PHE A 1 78  ? -0.271  77.580 74.116 1.00 42.08 ? 78   PHE A N   1 
ATOM   584  C CA  . PHE A 1 78  ? 1.143   77.758 73.771 1.00 39.69 ? 78   PHE A CA  1 
ATOM   585  C C   . PHE A 1 78  ? 1.180   77.788 72.240 1.00 39.74 ? 78   PHE A C   1 
ATOM   586  O O   . PHE A 1 78  ? 0.691   76.886 71.591 1.00 38.66 ? 78   PHE A O   1 
ATOM   587  C CB  . PHE A 1 78  ? 1.946   76.579 74.343 1.00 38.06 ? 78   PHE A CB  1 
ATOM   588  C CG  . PHE A 1 78  ? 3.412   76.654 74.082 1.00 38.00 ? 78   PHE A CG  1 
ATOM   589  C CD1 . PHE A 1 78  ? 4.162   77.764 74.528 1.00 38.64 ? 78   PHE A CD1 1 
ATOM   590  C CD2 . PHE A 1 78  ? 4.055   75.620 73.395 1.00 36.68 ? 78   PHE A CD2 1 
ATOM   591  C CE1 . PHE A 1 78  ? 5.524   77.850 74.296 1.00 37.49 ? 78   PHE A CE1 1 
ATOM   592  C CE2 . PHE A 1 78  ? 5.412   75.675 73.152 1.00 39.11 ? 78   PHE A CE2 1 
ATOM   593  C CZ  . PHE A 1 78  ? 6.159   76.805 73.606 1.00 40.09 ? 78   PHE A CZ  1 
ATOM   594  N N   . SER A 1 79  ? 1.742   78.830 71.645 1.00 41.03 ? 79   SER A N   1 
ATOM   595  C CA  . SER A 1 79  ? 1.751   78.900 70.179 1.00 41.42 ? 79   SER A CA  1 
ATOM   596  C C   . SER A 1 79  ? 2.594   77.771 69.548 1.00 42.10 ? 79   SER A C   1 
ATOM   597  O O   . SER A 1 79  ? 2.300   77.316 68.424 1.00 43.22 ? 79   SER A O   1 
ATOM   598  C CB  . SER A 1 79  ? 2.286   80.244 69.707 1.00 38.26 ? 79   SER A CB  1 
ATOM   599  O OG  . SER A 1 79  ? 3.597   80.398 70.223 1.00 41.65 ? 79   SER A OG  1 
ATOM   600  N N   . GLY A 1 80  ? 3.622   77.319 70.270 1.00 40.97 ? 80   GLY A N   1 
ATOM   601  C CA  . GLY A 1 80  ? 4.489   76.271 69.747 1.00 40.25 ? 80   GLY A CA  1 
ATOM   602  C C   . GLY A 1 80  ? 3.736   75.001 69.356 1.00 39.45 ? 80   GLY A C   1 
ATOM   603  O O   . GLY A 1 80  ? 4.046   74.378 68.348 1.00 37.89 ? 80   GLY A O   1 
ATOM   604  N N   . SER A 1 81  ? 2.747   74.629 70.163 1.00 38.57 ? 81   SER A N   1 
ATOM   605  C CA  . SER A 1 81  ? 1.969   73.441 69.898 1.00 39.56 ? 81   SER A CA  1 
ATOM   606  C C   . SER A 1 81  ? 0.654   73.717 69.178 1.00 39.48 ? 81   SER A C   1 
ATOM   607  O O   . SER A 1 81  ? 0.219   72.897 68.367 1.00 37.69 ? 81   SER A O   1 
ATOM   608  C CB  . SER A 1 81  ? 1.663   72.699 71.200 1.00 40.49 ? 81   SER A CB  1 
ATOM   609  O OG  . SER A 1 81  ? 1.000   73.552 72.101 1.00 43.41 ? 81   SER A OG  1 
ATOM   610  N N   . GLU A 1 82  ? 0.017   74.851 69.459 1.00 39.19 ? 82   GLU A N   1 
ATOM   611  C CA  . GLU A 1 82  ? -1.262  75.104 68.818 1.00 40.72 ? 82   GLU A CA  1 
ATOM   612  C C   . GLU A 1 82  ? -1.194  75.433 67.354 1.00 39.43 ? 82   GLU A C   1 
ATOM   613  O O   . GLU A 1 82  ? -2.193  75.276 66.665 1.00 38.39 ? 82   GLU A O   1 
ATOM   614  C CB  . GLU A 1 82  ? -2.093  76.152 69.578 1.00 45.12 ? 82   GLU A CB  1 
ATOM   615  C CG  . GLU A 1 82  ? -3.377  75.467 70.166 1.00 50.41 ? 82   GLU A CG  1 
ATOM   616  C CD  . GLU A 1 82  ? -3.474  75.683 71.619 1.00 53.88 ? 82   GLU A CD  1 
ATOM   617  O OE1 . GLU A 1 82  ? -3.288  76.847 71.992 1.00 58.73 ? 82   GLU A OE1 1 
ATOM   618  O OE2 . GLU A 1 82  ? -3.722  74.733 72.400 1.00 58.22 ? 82   GLU A OE2 1 
ATOM   619  N N   . MET A 1 83  ? -0.017  75.865 66.878 1.00 36.75 ? 83   MET A N   1 
ATOM   620  C CA  . MET A 1 83  ? 0.157   76.140 65.463 1.00 34.67 ? 83   MET A CA  1 
ATOM   621  C C   . MET A 1 83  ? 0.009   74.851 64.605 1.00 34.74 ? 83   MET A C   1 
ATOM   622  O O   . MET A 1 83  ? -0.041  74.959 63.386 1.00 33.12 ? 83   MET A O   1 
ATOM   623  C CB  . MET A 1 83  ? 1.539   76.727 65.203 1.00 35.12 ? 83   MET A CB  1 
ATOM   624  C CG  . MET A 1 83  ? 2.661   75.695 65.356 1.00 35.91 ? 83   MET A CG  1 
ATOM   625  S SD  . MET A 1 83  ? 4.306   76.451 65.161 1.00 38.48 ? 83   MET A SD  1 
ATOM   626  C CE  . MET A 1 83  ? 4.530   76.277 63.367 1.00 37.30 ? 83   MET A CE  1 
ATOM   627  N N   . TRP A 1 84  ? -0.043  73.659 65.245 1.00 33.40 ? 84   TRP A N   1 
ATOM   628  C CA  . TRP A 1 84  ? -0.192  72.378 64.549 1.00 32.79 ? 84   TRP A CA  1 
ATOM   629  C C   . TRP A 1 84  ? -1.624  71.813 64.601 1.00 33.67 ? 84   TRP A C   1 
ATOM   630  O O   . TRP A 1 84  ? -1.978  70.932 63.821 1.00 34.23 ? 84   TRP A O   1 
ATOM   631  C CB  . TRP A 1 84  ? 0.779   71.317 65.115 1.00 31.51 ? 84   TRP A CB  1 
ATOM   632  C CG  . TRP A 1 84  ? 2.224   71.749 65.063 1.00 31.16 ? 84   TRP A CG  1 
ATOM   633  C CD1 . TRP A 1 84  ? 2.990   72.208 66.107 1.00 30.15 ? 84   TRP A CD1 1 
ATOM   634  C CD2 . TRP A 1 84  ? 3.030   71.901 63.882 1.00 31.42 ? 84   TRP A CD2 1 
ATOM   635  N NE1 . TRP A 1 84  ? 4.227   72.642 65.640 1.00 32.10 ? 84   TRP A NE1 1 
ATOM   636  C CE2 . TRP A 1 84  ? 4.269   72.466 64.281 1.00 31.96 ? 84   TRP A CE2 1 
ATOM   637  C CE3 . TRP A 1 84  ? 2.821   71.624 62.520 1.00 32.74 ? 84   TRP A CE3 1 
ATOM   638  C CZ2 . TRP A 1 84  ? 5.300   72.761 63.357 1.00 34.23 ? 84   TRP A CZ2 1 
ATOM   639  C CZ3 . TRP A 1 84  ? 3.851   71.916 61.603 1.00 33.63 ? 84   TRP A CZ3 1 
ATOM   640  C CH2 . TRP A 1 84  ? 5.072   72.480 62.034 1.00 33.66 ? 84   TRP A CH2 1 
ATOM   641  N N   . ASN A 1 85  ? -2.425  72.328 65.522 1.00 33.75 ? 85   ASN A N   1 
ATOM   642  C CA  . ASN A 1 85  ? -3.801  71.892 65.727 1.00 34.70 ? 85   ASN A CA  1 
ATOM   643  C C   . ASN A 1 85  ? -4.723  72.452 64.655 1.00 33.84 ? 85   ASN A C   1 
ATOM   644  O O   . ASN A 1 85  ? -4.420  73.442 64.021 1.00 33.61 ? 85   ASN A O   1 
ATOM   645  C CB  . ASN A 1 85  ? -4.334  72.400 67.087 1.00 36.15 ? 85   ASN A CB  1 
ATOM   646  C CG  . ASN A 1 85  ? -3.993  71.472 68.267 1.00 37.61 ? 85   ASN A CG  1 
ATOM   647  O OD1 . ASN A 1 85  ? -3.833  70.239 68.119 1.00 37.18 ? 85   ASN A OD1 1 
ATOM   648  N ND2 . ASN A 1 85  ? -3.917  72.068 69.460 1.00 36.85 ? 85   ASN A ND2 1 
ATOM   649  N N   . PRO A 1 86  ? -5.848  71.793 64.429 1.00 33.04 ? 86   PRO A N   1 
ATOM   650  C CA  . PRO A 1 86  ? -6.837  72.234 63.434 1.00 33.87 ? 86   PRO A CA  1 
ATOM   651  C C   . PRO A 1 86  ? -7.215  73.702 63.797 1.00 35.52 ? 86   PRO A C   1 
ATOM   652  O O   . PRO A 1 86  ? -7.425  74.000 64.983 1.00 32.64 ? 86   PRO A O   1 
ATOM   653  C CB  . PRO A 1 86  ? -8.039  71.327 63.688 1.00 33.21 ? 86   PRO A CB  1 
ATOM   654  C CG  . PRO A 1 86  ? -7.466  70.127 64.423 1.00 33.37 ? 86   PRO A CG  1 
ATOM   655  C CD  . PRO A 1 86  ? -6.322  70.658 65.236 1.00 32.11 ? 86   PRO A CD  1 
ATOM   656  N N   . ASN A 1 87  ? -7.283  74.595 62.806 1.00 34.24 ? 87   ASN A N   1 
ATOM   657  C CA  . ASN A 1 87  ? -7.654  75.974 63.097 1.00 37.13 ? 87   ASN A CA  1 
ATOM   658  C C   . ASN A 1 87  ? -9.003  76.247 62.430 1.00 38.97 ? 87   ASN A C   1 
ATOM   659  O O   . ASN A 1 87  ? -9.380  77.401 62.242 1.00 39.75 ? 87   ASN A O   1 
ATOM   660  C CB  . ASN A 1 87  ? -6.606  76.960 62.587 1.00 34.26 ? 87   ASN A CB  1 
ATOM   661  C CG  . ASN A 1 87  ? -6.354  76.810 61.105 1.00 37.60 ? 87   ASN A CG  1 
ATOM   662  O OD1 . ASN A 1 87  ? -6.747  75.795 60.473 1.00 37.81 ? 87   ASN A OD1 1 
ATOM   663  N ND2 . ASN A 1 87  ? -5.690  77.796 60.528 1.00 36.51 ? 87   ASN A ND2 1 
ATOM   664  N N   . ARG A 1 88  ? -9.702  75.182 62.054 1.00 38.11 ? 88   ARG A N   1 
ATOM   665  C CA  . ARG A 1 88  ? -11.050 75.308 61.477 1.00 40.08 ? 88   ARG A CA  1 
ATOM   666  C C   . ARG A 1 88  ? -11.842 74.263 62.210 1.00 39.52 ? 88   ARG A C   1 
ATOM   667  O O   . ARG A 1 88  ? -11.274 73.455 62.897 1.00 38.36 ? 88   ARG A O   1 
ATOM   668  C CB  . ARG A 1 88  ? -11.069 74.911 60.000 1.00 40.74 ? 88   ARG A CB  1 
ATOM   669  C CG  . ARG A 1 88  ? -10.240 75.812 59.168 1.00 45.25 ? 88   ARG A CG  1 
ATOM   670  C CD  . ARG A 1 88  ? -11.214 76.831 58.731 1.00 48.22 ? 88   ARG A CD  1 
ATOM   671  N NE  . ARG A 1 88  ? -10.797 78.144 59.130 1.00 51.14 ? 88   ARG A NE  1 
ATOM   672  C CZ  . ARG A 1 88  ? -11.430 79.230 58.729 1.00 52.72 ? 88   ARG A CZ  1 
ATOM   673  N NH1 . ARG A 1 88  ? -12.517 79.114 57.947 1.00 52.35 ? 88   ARG A NH1 1 
ATOM   674  N NH2 . ARG A 1 88  ? -10.905 80.410 59.011 1.00 51.95 ? 88   ARG A NH2 1 
ATOM   675  N N   . GLU A 1 89  ? -13.146 74.250 62.021 1.00 40.87 ? 89   GLU A N   1 
ATOM   676  C CA  . GLU A 1 89  ? -13.983 73.257 62.646 1.00 42.60 ? 89   GLU A CA  1 
ATOM   677  C C   . GLU A 1 89  ? -13.619 71.903 62.012 1.00 40.50 ? 89   GLU A C   1 
ATOM   678  O O   . GLU A 1 89  ? -13.245 71.824 60.843 1.00 39.84 ? 89   GLU A O   1 
ATOM   679  C CB  . GLU A 1 89  ? -15.443 73.604 62.368 1.00 47.40 ? 89   GLU A CB  1 
ATOM   680  C CG  . GLU A 1 89  ? -16.454 72.630 62.968 1.00 57.44 ? 89   GLU A CG  1 
ATOM   681  C CD  . GLU A 1 89  ? -17.907 72.849 62.435 1.00 63.08 ? 89   GLU A CD  1 
ATOM   682  O OE1 . GLU A 1 89  ? -18.698 71.853 62.418 1.00 64.02 ? 89   GLU A OE1 1 
ATOM   683  O OE2 . GLU A 1 89  ? -18.244 74.014 62.038 1.00 65.58 ? 89   GLU A OE2 1 
ATOM   684  N N   . MET A 1 90  ? -13.712 70.834 62.774 1.00 38.45 ? 90   MET A N   1 
ATOM   685  C CA  . MET A 1 90  ? -13.426 69.533 62.200 1.00 38.92 ? 90   MET A CA  1 
ATOM   686  C C   . MET A 1 90  ? -14.708 68.935 61.651 1.00 38.98 ? 90   MET A C   1 
ATOM   687  O O   . MET A 1 90  ? -15.801 69.185 62.154 1.00 39.96 ? 90   MET A O   1 
ATOM   688  C CB  . MET A 1 90  ? -12.843 68.581 63.264 1.00 38.24 ? 90   MET A CB  1 
ATOM   689  C CG  . MET A 1 90  ? -11.435 68.985 63.733 1.00 39.70 ? 90   MET A CG  1 
ATOM   690  S SD  . MET A 1 90  ? -10.678 67.775 64.859 1.00 38.96 ? 90   MET A SD  1 
ATOM   691  C CE  . MET A 1 90  ? -11.528 68.232 66.435 1.00 38.38 ? 90   MET A CE  1 
ATOM   692  N N   . SER A 1 91  ? -14.571 68.114 60.631 1.00 39.48 ? 91   SER A N   1 
ATOM   693  C CA  . SER A 1 91  ? -15.728 67.438 60.056 1.00 37.47 ? 91   SER A CA  1 
ATOM   694  C C   . SER A 1 91  ? -15.297 66.251 59.213 1.00 36.40 ? 91   SER A C   1 
ATOM   695  O O   . SER A 1 91  ? -14.235 66.308 58.566 1.00 36.45 ? 91   SER A O   1 
ATOM   696  C CB  . SER A 1 91  ? -16.503 68.403 59.152 1.00 37.45 ? 91   SER A CB  1 
ATOM   697  O OG  . SER A 1 91  ? -17.558 67.713 58.511 1.00 36.62 ? 91   SER A OG  1 
ATOM   698  N N   . GLU A 1 92  ? -16.088 65.180 59.174 1.00 35.02 ? 92   GLU A N   1 
ATOM   699  C CA  . GLU A 1 92  ? -15.695 64.102 58.249 1.00 35.71 ? 92   GLU A CA  1 
ATOM   700  C C   . GLU A 1 92  ? -15.789 64.629 56.803 1.00 36.61 ? 92   GLU A C   1 
ATOM   701  O O   . GLU A 1 92  ? -15.171 64.065 55.869 1.00 35.92 ? 92   GLU A O   1 
ATOM   702  C CB  . GLU A 1 92  ? -16.589 62.884 58.402 1.00 37.72 ? 92   GLU A CB  1 
ATOM   703  C CG  . GLU A 1 92  ? -16.192 62.012 59.567 1.00 36.71 ? 92   GLU A CG  1 
ATOM   704  C CD  . GLU A 1 92  ? -17.011 60.741 59.639 1.00 37.98 ? 92   GLU A CD  1 
ATOM   705  O OE1 . GLU A 1 92  ? -18.120 60.801 60.188 1.00 39.36 ? 92   GLU A OE1 1 
ATOM   706  O OE2 . GLU A 1 92  ? -16.550 59.689 59.138 1.00 38.15 ? 92   GLU A OE2 1 
ATOM   707  N N   . ASP A 1 93  ? -16.558 65.714 56.618 1.00 35.47 ? 93   ASP A N   1 
ATOM   708  C CA  . ASP A 1 93  ? -16.701 66.328 55.292 1.00 37.54 ? 93   ASP A CA  1 
ATOM   709  C C   . ASP A 1 93  ? -15.503 67.253 55.196 1.00 36.47 ? 93   ASP A C   1 
ATOM   710  O O   . ASP A 1 93  ? -15.601 68.446 55.503 1.00 36.17 ? 93   ASP A O   1 
ATOM   711  C CB  . ASP A 1 93  ? -18.031 67.128 55.177 1.00 37.76 ? 93   ASP A CB  1 
ATOM   712  C CG  . ASP A 1 93  ? -18.198 67.803 53.795 1.00 40.52 ? 93   ASP A CG  1 
ATOM   713  O OD1 . ASP A 1 93  ? -17.283 67.694 52.934 1.00 38.58 ? 93   ASP A OD1 1 
ATOM   714  O OD2 . ASP A 1 93  ? -19.248 68.454 53.568 1.00 42.77 ? 93   ASP A OD2 1 
ATOM   715  N N   . CYS A 1 94  ? -14.381 66.707 54.724 1.00 37.35 ? 94   CYS A N   1 
ATOM   716  C CA  . CYS A 1 94  ? -13.139 67.479 54.707 1.00 36.44 ? 94   CYS A CA  1 
ATOM   717  C C   . CYS A 1 94  ? -12.277 67.288 53.492 1.00 37.42 ? 94   CYS A C   1 
ATOM   718  O O   . CYS A 1 94  ? -11.102 67.724 53.491 1.00 36.26 ? 94   CYS A O   1 
ATOM   719  C CB  . CYS A 1 94  ? -12.296 67.105 55.948 1.00 35.66 ? 94   CYS A CB  1 
ATOM   720  S SG  . CYS A 1 94  ? -11.800 65.330 55.975 1.00 33.94 ? 94   CYS A SG  1 
ATOM   721  N N   . LEU A 1 95  ? -12.805 66.642 52.458 1.00 35.63 ? 95   LEU A N   1 
ATOM   722  C CA  . LEU A 1 95  ? -11.945 66.456 51.321 1.00 34.66 ? 95   LEU A CA  1 
ATOM   723  C C   . LEU A 1 95  ? -11.904 67.617 50.329 1.00 34.38 ? 95   LEU A C   1 
ATOM   724  O O   . LEU A 1 95  ? -12.566 67.602 49.290 1.00 35.59 ? 95   LEU A O   1 
ATOM   725  C CB  . LEU A 1 95  ? -12.258 65.128 50.637 1.00 33.95 ? 95   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 95  ? -11.932 63.942 51.549 1.00 34.51 ? 95   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 95  ? -12.105 62.617 50.744 1.00 34.85 ? 95   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 95  ? -10.473 64.055 52.071 1.00 34.61 ? 95   LEU A CD2 1 
ATOM   729  N N   . TYR A 1 96  ? -11.083 68.601 50.652 1.00 33.90 ? 96   TYR A N   1 
ATOM   730  C CA  . TYR A 1 96  ? -10.912 69.794 49.832 1.00 35.65 ? 96   TYR A CA  1 
ATOM   731  C C   . TYR A 1 96  ? -9.442  70.144 49.558 1.00 36.42 ? 96   TYR A C   1 
ATOM   732  O O   . TYR A 1 96  ? -8.522  69.631 50.231 1.00 36.87 ? 96   TYR A O   1 
ATOM   733  C CB  . TYR A 1 96  ? -11.584 71.006 50.508 1.00 37.28 ? 96   TYR A CB  1 
ATOM   734  C CG  . TYR A 1 96  ? -13.047 70.776 50.807 1.00 38.23 ? 96   TYR A CG  1 
ATOM   735  C CD1 . TYR A 1 96  ? -13.425 70.029 51.940 1.00 36.83 ? 96   TYR A CD1 1 
ATOM   736  C CD2 . TYR A 1 96  ? -14.050 71.209 49.906 1.00 35.34 ? 96   TYR A CD2 1 
ATOM   737  C CE1 . TYR A 1 96  ? -14.737 69.706 52.176 1.00 36.97 ? 96   TYR A CE1 1 
ATOM   738  C CE2 . TYR A 1 96  ? -15.391 70.892 50.130 1.00 35.54 ? 96   TYR A CE2 1 
ATOM   739  C CZ  . TYR A 1 96  ? -15.732 70.139 51.267 1.00 38.24 ? 96   TYR A CZ  1 
ATOM   740  O OH  . TYR A 1 96  ? -17.046 69.829 51.546 1.00 36.26 ? 96   TYR A OH  1 
ATOM   741  N N   . LEU A 1 97  ? -9.229  70.971 48.537 1.00 34.74 ? 97   LEU A N   1 
ATOM   742  C CA  . LEU A 1 97  ? -7.905  71.439 48.209 1.00 35.17 ? 97   LEU A CA  1 
ATOM   743  C C   . LEU A 1 97  ? -7.912  72.965 48.096 1.00 34.56 ? 97   LEU A C   1 
ATOM   744  O O   . LEU A 1 97  ? -8.953  73.581 47.885 1.00 35.09 ? 97   LEU A O   1 
ATOM   745  C CB  . LEU A 1 97  ? -7.357  70.757 46.947 1.00 34.30 ? 97   LEU A CB  1 
ATOM   746  C CG  . LEU A 1 97  ? -8.057  70.741 45.583 1.00 35.31 ? 97   LEU A CG  1 
ATOM   747  C CD1 . LEU A 1 97  ? -7.897  72.092 44.904 1.00 34.54 ? 97   LEU A CD1 1 
ATOM   748  C CD2 . LEU A 1 97  ? -7.435  69.675 44.700 1.00 36.35 ? 97   LEU A CD2 1 
ATOM   749  N N   . ASN A 1 98  ? -6.738  73.559 48.255 1.00 34.10 ? 98   ASN A N   1 
ATOM   750  C CA  . ASN A 1 98  ? -6.545  74.991 48.209 1.00 34.67 ? 98   ASN A CA  1 
ATOM   751  C C   . ASN A 1 98  ? -5.518  75.352 47.133 1.00 35.64 ? 98   ASN A C   1 
ATOM   752  O O   . ASN A 1 98  ? -4.501  74.671 47.002 1.00 37.56 ? 98   ASN A O   1 
ATOM   753  C CB  . ASN A 1 98  ? -6.039  75.497 49.580 1.00 34.70 ? 98   ASN A CB  1 
ATOM   754  C CG  . ASN A 1 98  ? -6.899  74.995 50.742 1.00 36.28 ? 98   ASN A CG  1 
ATOM   755  O OD1 . ASN A 1 98  ? -8.102  75.244 50.774 1.00 34.71 ? 98   ASN A OD1 1 
ATOM   756  N ND2 . ASN A 1 98  ? -6.277  74.283 51.703 1.00 32.89 ? 98   ASN A ND2 1 
ATOM   757  N N   . ILE A 1 99  ? -5.785  76.424 46.372 1.00 35.16 ? 99   ILE A N   1 
ATOM   758  C CA  . ILE A 1 99  ? -4.883  76.886 45.330 1.00 34.59 ? 99   ILE A CA  1 
ATOM   759  C C   . ILE A 1 99  ? -4.483  78.378 45.416 1.00 35.65 ? 99   ILE A C   1 
ATOM   760  O O   . ILE A 1 99  ? -5.333  79.226 45.504 1.00 37.55 ? 99   ILE A O   1 
ATOM   761  C CB  . ILE A 1 99  ? -5.469  76.671 43.897 1.00 32.91 ? 99   ILE A CB  1 
ATOM   762  C CG1 . ILE A 1 99  ? -6.168  75.300 43.775 1.00 33.17 ? 99   ILE A CG1 1 
ATOM   763  C CG2 . ILE A 1 99  ? -4.297  76.767 42.894 1.00 31.11 ? 99   ILE A CG2 1 
ATOM   764  C CD1 . ILE A 1 99  ? -6.620  74.951 42.301 1.00 33.49 ? 99   ILE A CD1 1 
ATOM   765  N N   . TRP A 1 100 ? -3.201  78.697 45.386 1.00 35.71 ? 100  TRP A N   1 
ATOM   766  C CA  . TRP A 1 100 ? -2.784  80.092 45.404 1.00 37.01 ? 100  TRP A CA  1 
ATOM   767  C C   . TRP A 1 100 ? -2.204  80.304 44.017 1.00 38.07 ? 100  TRP A C   1 
ATOM   768  O O   . TRP A 1 100 ? -1.288  79.581 43.596 1.00 36.61 ? 100  TRP A O   1 
ATOM   769  C CB  . TRP A 1 100 ? -1.713  80.360 46.461 1.00 36.71 ? 100  TRP A CB  1 
ATOM   770  C CG  . TRP A 1 100 ? -2.280  80.486 47.830 1.00 37.64 ? 100  TRP A CG  1 
ATOM   771  C CD1 . TRP A 1 100 ? -2.666  81.636 48.465 1.00 39.42 ? 100  TRP A CD1 1 
ATOM   772  C CD2 . TRP A 1 100 ? -2.469  79.436 48.764 1.00 37.78 ? 100  TRP A CD2 1 
ATOM   773  N NE1 . TRP A 1 100 ? -3.068  81.360 49.745 1.00 38.97 ? 100  TRP A NE1 1 
ATOM   774  C CE2 . TRP A 1 100 ? -2.954  80.017 49.960 1.00 38.22 ? 100  TRP A CE2 1 
ATOM   775  C CE3 . TRP A 1 100 ? -2.265  78.050 48.719 1.00 38.58 ? 100  TRP A CE3 1 
ATOM   776  C CZ2 . TRP A 1 100 ? -3.235  79.266 51.098 1.00 40.01 ? 100  TRP A CZ2 1 
ATOM   777  C CZ3 . TRP A 1 100 ? -2.544  77.292 49.867 1.00 38.13 ? 100  TRP A CZ3 1 
ATOM   778  C CH2 . TRP A 1 100 ? -3.022  77.905 51.037 1.00 37.68 ? 100  TRP A CH2 1 
ATOM   779  N N   . VAL A 1 101 ? -2.737  81.301 43.317 1.00 38.00 ? 101  VAL A N   1 
ATOM   780  C CA  . VAL A 1 101 ? -2.344  81.577 41.945 1.00 37.70 ? 101  VAL A CA  1 
ATOM   781  C C   . VAL A 1 101 ? -1.762  82.990 41.770 1.00 38.70 ? 101  VAL A C   1 
ATOM   782  O O   . VAL A 1 101 ? -2.389  83.979 42.163 1.00 36.90 ? 101  VAL A O   1 
ATOM   783  C CB  . VAL A 1 101 ? -3.610  81.413 41.021 1.00 37.02 ? 101  VAL A CB  1 
ATOM   784  C CG1 . VAL A 1 101 ? -3.311  81.803 39.566 1.00 34.84 ? 101  VAL A CG1 1 
ATOM   785  C CG2 . VAL A 1 101 ? -4.153  80.008 41.122 1.00 35.55 ? 101  VAL A CG2 1 
ATOM   786  N N   . PRO A 1 102 ? -0.543  83.093 41.201 1.00 39.76 ? 102  PRO A N   1 
ATOM   787  C CA  . PRO A 1 102 ? 0.053   84.429 40.983 1.00 40.56 ? 102  PRO A CA  1 
ATOM   788  C C   . PRO A 1 102 ? -0.950  85.365 40.243 1.00 42.40 ? 102  PRO A C   1 
ATOM   789  O O   . PRO A 1 102 ? -1.896  84.909 39.554 1.00 42.64 ? 102  PRO A O   1 
ATOM   790  C CB  . PRO A 1 102 ? 1.270   84.149 40.112 1.00 38.08 ? 102  PRO A CB  1 
ATOM   791  C CG  . PRO A 1 102 ? 1.712   82.749 40.593 1.00 38.60 ? 102  PRO A CG  1 
ATOM   792  C CD  . PRO A 1 102 ? 0.404   82.006 40.872 1.00 38.84 ? 102  PRO A CD  1 
ATOM   793  N N   . SER A 1 103 ? -0.752  86.671 40.415 1.00 43.20 ? 103  SER A N   1 
ATOM   794  C CA  . SER A 1 103 ? -1.584  87.658 39.752 1.00 43.88 ? 103  SER A CA  1 
ATOM   795  C C   . SER A 1 103 ? -0.666  88.631 39.028 1.00 42.72 ? 103  SER A C   1 
ATOM   796  O O   . SER A 1 103 ? 0.223   89.234 39.632 1.00 40.65 ? 103  SER A O   1 
ATOM   797  C CB  . SER A 1 103 ? -2.459  88.404 40.765 1.00 44.94 ? 103  SER A CB  1 
ATOM   798  O OG  . SER A 1 103 ? -3.323  89.298 40.057 1.00 48.66 ? 103  SER A OG  1 
ATOM   799  N N   . PRO A 1 104 ? -0.858  88.794 37.709 1.00 43.63 ? 104  PRO A N   1 
ATOM   800  C CA  . PRO A 1 104 ? -1.871  88.156 36.841 1.00 43.03 ? 104  PRO A CA  1 
ATOM   801  C C   . PRO A 1 104 ? -1.738  86.610 36.672 1.00 42.60 ? 104  PRO A C   1 
ATOM   802  O O   . PRO A 1 104 ? -0.623  86.068 36.748 1.00 41.96 ? 104  PRO A O   1 
ATOM   803  C CB  . PRO A 1 104 ? -1.684  88.894 35.504 1.00 43.68 ? 104  PRO A CB  1 
ATOM   804  C CG  . PRO A 1 104 ? -0.160  89.177 35.481 1.00 44.71 ? 104  PRO A CG  1 
ATOM   805  C CD  . PRO A 1 104 ? 0.119   89.600 36.929 1.00 42.28 ? 104  PRO A CD  1 
ATOM   806  N N   . ARG A 1 105 ? -2.871  85.938 36.406 1.00 40.57 ? 105  ARG A N   1 
ATOM   807  C CA  . ARG A 1 105 ? -2.940  84.479 36.216 1.00 41.11 ? 105  ARG A CA  1 
ATOM   808  C C   . ARG A 1 105 ? -1.888  83.996 35.237 1.00 41.79 ? 105  ARG A C   1 
ATOM   809  O O   . ARG A 1 105 ? -1.845  84.477 34.121 1.00 43.19 ? 105  ARG A O   1 
ATOM   810  C CB  . ARG A 1 105 ? -4.318  84.035 35.689 1.00 39.36 ? 105  ARG A CB  1 
ATOM   811  C CG  . ARG A 1 105 ? -4.505  82.506 35.774 1.00 38.77 ? 105  ARG A CG  1 
ATOM   812  C CD  . ARG A 1 105 ? -5.791  82.043 35.198 1.00 36.17 ? 105  ARG A CD  1 
ATOM   813  N NE  . ARG A 1 105 ? -6.934  82.634 35.901 1.00 39.87 ? 105  ARG A NE  1 
ATOM   814  C CZ  . ARG A 1 105 ? -8.164  82.598 35.403 1.00 40.41 ? 105  ARG A CZ  1 
ATOM   815  N NH1 . ARG A 1 105 ? -8.345  82.000 34.237 1.00 40.42 ? 105  ARG A NH1 1 
ATOM   816  N NH2 . ARG A 1 105 ? -9.192  83.183 36.008 1.00 39.35 ? 105  ARG A NH2 1 
ATOM   817  N N   . PRO A 1 106 ? -1.014  83.052 35.644 1.00 42.00 ? 106  PRO A N   1 
ATOM   818  C CA  . PRO A 1 106 ? 0.019   82.560 34.712 1.00 40.95 ? 106  PRO A CA  1 
ATOM   819  C C   . PRO A 1 106 ? -0.688  81.814 33.597 1.00 40.73 ? 106  PRO A C   1 
ATOM   820  O O   . PRO A 1 106 ? -1.878  81.499 33.706 1.00 41.38 ? 106  PRO A O   1 
ATOM   821  C CB  . PRO A 1 106 ? 0.837   81.577 35.557 1.00 39.87 ? 106  PRO A CB  1 
ATOM   822  C CG  . PRO A 1 106 ? 0.581   82.002 36.935 1.00 41.03 ? 106  PRO A CG  1 
ATOM   823  C CD  . PRO A 1 106 ? -0.883  82.382 36.947 1.00 41.34 ? 106  PRO A CD  1 
ATOM   824  N N   . LYS A 1 107 ? 0.046   81.522 32.537 1.00 40.96 ? 107  LYS A N   1 
ATOM   825  C CA  . LYS A 1 107 ? -0.498  80.777 31.418 1.00 41.78 ? 107  LYS A CA  1 
ATOM   826  C C   . LYS A 1 107 ? -0.220  79.275 31.630 1.00 42.67 ? 107  LYS A C   1 
ATOM   827  O O   . LYS A 1 107 ? -1.101  78.432 31.464 1.00 41.80 ? 107  LYS A O   1 
ATOM   828  C CB  . LYS A 1 107 ? 0.171   81.222 30.102 1.00 42.79 ? 107  LYS A CB  1 
ATOM   829  C CG  . LYS A 1 107 ? 0.075   82.727 29.834 1.00 44.21 ? 107  LYS A CG  1 
ATOM   830  C CD  . LYS A 1 107 ? -1.410  83.110 30.000 1.00 47.55 ? 107  LYS A CD  1 
ATOM   831  C CE  . LYS A 1 107 ? -1.661  84.611 29.869 1.00 48.40 ? 107  LYS A CE  1 
ATOM   832  N NZ  . LYS A 1 107 ? -3.124  84.889 29.868 1.00 49.57 ? 107  LYS A NZ  1 
ATOM   833  N N   . SER A 1 108 ? 1.012   78.942 31.989 1.00 42.24 ? 108  SER A N   1 
ATOM   834  C CA  . SER A 1 108 ? 1.363   77.535 32.137 1.00 44.06 ? 108  SER A CA  1 
ATOM   835  C C   . SER A 1 108 ? 2.624   77.444 32.948 1.00 42.85 ? 108  SER A C   1 
ATOM   836  O O   . SER A 1 108 ? 3.694   77.199 32.388 1.00 43.96 ? 108  SER A O   1 
ATOM   837  C CB  . SER A 1 108 ? 1.630   76.923 30.770 1.00 44.15 ? 108  SER A CB  1 
ATOM   838  O OG  . SER A 1 108 ? 1.743   75.517 30.864 1.00 46.39 ? 108  SER A OG  1 
ATOM   839  N N   . THR A 1 109 ? 2.494   77.625 34.253 1.00 39.12 ? 109  THR A N   1 
ATOM   840  C CA  . THR A 1 109 ? 3.654   77.611 35.104 1.00 37.94 ? 109  THR A CA  1 
ATOM   841  C C   . THR A 1 109 ? 3.806   76.409 36.079 1.00 38.04 ? 109  THR A C   1 
ATOM   842  O O   . THR A 1 109 ? 2.868   75.613 36.285 1.00 38.27 ? 109  THR A O   1 
ATOM   843  C CB  . THR A 1 109 ? 3.718   78.901 35.924 1.00 35.71 ? 109  THR A CB  1 
ATOM   844  O OG1 . THR A 1 109 ? 5.020   78.992 36.498 1.00 38.41 ? 109  THR A OG1 1 
ATOM   845  C CG2 . THR A 1 109 ? 2.695   78.888 37.041 1.00 33.57 ? 109  THR A CG2 1 
ATOM   846  N N   . THR A 1 110 ? 4.992   76.319 36.680 1.00 37.12 ? 110  THR A N   1 
ATOM   847  C CA  . THR A 1 110 ? 5.330   75.282 37.646 1.00 36.48 ? 110  THR A CA  1 
ATOM   848  C C   . THR A 1 110 ? 4.295   75.160 38.773 1.00 35.79 ? 110  THR A C   1 
ATOM   849  O O   . THR A 1 110 ? 3.893   76.148 39.391 1.00 36.15 ? 110  THR A O   1 
ATOM   850  C CB  . THR A 1 110 ? 6.691   75.560 38.284 1.00 38.15 ? 110  THR A CB  1 
ATOM   851  O OG1 . THR A 1 110 ? 7.698   75.637 37.266 1.00 40.08 ? 110  THR A OG1 1 
ATOM   852  C CG2 . THR A 1 110 ? 7.046   74.442 39.278 1.00 36.03 ? 110  THR A CG2 1 
ATOM   853  N N   . VAL A 1 111 ? 3.871   73.936 39.037 1.00 36.05 ? 111  VAL A N   1 
ATOM   854  C CA  . VAL A 1 111 ? 2.906   73.659 40.093 1.00 33.92 ? 111  VAL A CA  1 
ATOM   855  C C   . VAL A 1 111 ? 3.592   72.882 41.262 1.00 34.51 ? 111  VAL A C   1 
ATOM   856  O O   . VAL A 1 111 ? 4.404   71.983 41.014 1.00 35.23 ? 111  VAL A O   1 
ATOM   857  C CB  . VAL A 1 111 ? 1.763   72.786 39.523 1.00 34.33 ? 111  VAL A CB  1 
ATOM   858  C CG1 . VAL A 1 111 ? 0.763   72.449 40.662 1.00 31.15 ? 111  VAL A CG1 1 
ATOM   859  C CG2 . VAL A 1 111 ? 1.074   73.498 38.297 1.00 29.33 ? 111  VAL A CG2 1 
ATOM   860  N N   . MET A 1 112 ? 3.239   73.218 42.509 1.00 35.13 ? 112  MET A N   1 
ATOM   861  C CA  . MET A 1 112 ? 3.745   72.568 43.738 1.00 33.72 ? 112  MET A CA  1 
ATOM   862  C C   . MET A 1 112 ? 2.530   72.168 44.581 1.00 34.24 ? 112  MET A C   1 
ATOM   863  O O   . MET A 1 112 ? 1.638   72.988 44.853 1.00 37.31 ? 112  MET A O   1 
ATOM   864  C CB  . MET A 1 112 ? 4.680   73.508 44.538 1.00 33.47 ? 112  MET A CB  1 
ATOM   865  C CG  . MET A 1 112 ? 5.967   73.809 43.783 1.00 33.96 ? 112  MET A CG  1 
ATOM   866  S SD  . MET A 1 112 ? 7.249   74.771 44.625 1.00 36.27 ? 112  MET A SD  1 
ATOM   867  C CE  . MET A 1 112 ? 7.641   73.874 46.011 1.00 37.29 ? 112  MET A CE  1 
ATOM   868  N N   . VAL A 1 113 ? 2.475   70.892 44.964 1.00 32.98 ? 113  VAL A N   1 
ATOM   869  C CA  . VAL A 1 113 ? 1.372   70.360 45.734 1.00 30.97 ? 113  VAL A CA  1 
ATOM   870  C C   . VAL A 1 113 ? 1.903   69.883 47.074 1.00 32.12 ? 113  VAL A C   1 
ATOM   871  O O   . VAL A 1 113 ? 2.719   68.975 47.155 1.00 33.18 ? 113  VAL A O   1 
ATOM   872  C CB  . VAL A 1 113 ? 0.702   69.165 45.000 1.00 31.17 ? 113  VAL A CB  1 
ATOM   873  C CG1 . VAL A 1 113 ? -0.558  68.654 45.850 1.00 26.32 ? 113  VAL A CG1 1 
ATOM   874  C CG2 . VAL A 1 113 ? 0.328   69.584 43.578 1.00 25.63 ? 113  VAL A CG2 1 
ATOM   875  N N   . TRP A 1 114 ? 1.403   70.508 48.115 1.00 31.92 ? 114  TRP A N   1 
ATOM   876  C CA  . TRP A 1 114 ? 1.806   70.244 49.473 1.00 30.86 ? 114  TRP A CA  1 
ATOM   877  C C   . TRP A 1 114 ? 0.925   69.184 50.120 1.00 30.62 ? 114  TRP A C   1 
ATOM   878  O O   . TRP A 1 114 ? -0.321  69.227 50.029 1.00 30.12 ? 114  TRP A O   1 
ATOM   879  C CB  . TRP A 1 114 ? 1.751   71.556 50.293 1.00 29.50 ? 114  TRP A CB  1 
ATOM   880  C CG  . TRP A 1 114 ? 2.010   71.356 51.774 1.00 30.24 ? 114  TRP A CG  1 
ATOM   881  C CD1 . TRP A 1 114 ? 1.097   71.448 52.813 1.00 31.62 ? 114  TRP A CD1 1 
ATOM   882  C CD2 . TRP A 1 114 ? 3.268   71.080 52.380 1.00 29.34 ? 114  TRP A CD2 1 
ATOM   883  N NE1 . TRP A 1 114 ? 1.723   71.254 54.023 1.00 31.26 ? 114  TRP A NE1 1 
ATOM   884  C CE2 . TRP A 1 114 ? 3.057   71.029 53.788 1.00 30.90 ? 114  TRP A CE2 1 
ATOM   885  C CE3 . TRP A 1 114 ? 4.565   70.875 51.874 1.00 28.73 ? 114  TRP A CE3 1 
ATOM   886  C CZ2 . TRP A 1 114 ? 4.095   70.785 54.686 1.00 29.44 ? 114  TRP A CZ2 1 
ATOM   887  C CZ3 . TRP A 1 114 ? 5.592   70.632 52.770 1.00 28.39 ? 114  TRP A CZ3 1 
ATOM   888  C CH2 . TRP A 1 114 ? 5.357   70.592 54.156 1.00 28.37 ? 114  TRP A CH2 1 
ATOM   889  N N   . ILE A 1 115 ? 1.590   68.236 50.778 1.00 29.89 ? 115  ILE A N   1 
ATOM   890  C CA  . ILE A 1 115 ? 0.912   67.157 51.488 1.00 29.33 ? 115  ILE A CA  1 
ATOM   891  C C   . ILE A 1 115 ? 1.310   67.264 52.950 1.00 29.78 ? 115  ILE A C   1 
ATOM   892  O O   . ILE A 1 115 ? 2.474   66.999 53.313 1.00 29.55 ? 115  ILE A O   1 
ATOM   893  C CB  . ILE A 1 115 ? 1.314   65.786 50.934 1.00 28.88 ? 115  ILE A CB  1 
ATOM   894  C CG1 . ILE A 1 115 ? 0.987   65.738 49.440 1.00 30.25 ? 115  ILE A CG1 1 
ATOM   895  C CG2 . ILE A 1 115 ? 0.563   64.669 51.713 1.00 28.16 ? 115  ILE A CG2 1 
ATOM   896  C CD1 . ILE A 1 115 ? 1.197   64.330 48.780 1.00 32.01 ? 115  ILE A CD1 1 
ATOM   897  N N   . TYR A 1 116 ? 0.365   67.662 53.803 1.00 29.89 ? 116  TYR A N   1 
ATOM   898  C CA  . TYR A 1 116 ? 0.714   67.814 55.216 1.00 30.10 ? 116  TYR A CA  1 
ATOM   899  C C   . TYR A 1 116 ? 1.091   66.518 55.947 1.00 30.29 ? 116  TYR A C   1 
ATOM   900  O O   . TYR A 1 116 ? 0.680   65.415 55.563 1.00 29.23 ? 116  TYR A O   1 
ATOM   901  C CB  . TYR A 1 116 ? -0.405  68.541 56.005 1.00 29.83 ? 116  TYR A CB  1 
ATOM   902  C CG  . TYR A 1 116 ? -1.782  67.879 56.030 1.00 29.47 ? 116  TYR A CG  1 
ATOM   903  C CD1 . TYR A 1 116 ? -2.021  66.673 56.728 1.00 29.11 ? 116  TYR A CD1 1 
ATOM   904  C CD2 . TYR A 1 116 ? -2.856  68.478 55.381 1.00 29.92 ? 116  TYR A CD2 1 
ATOM   905  C CE1 . TYR A 1 116 ? -3.308  66.088 56.767 1.00 27.10 ? 116  TYR A CE1 1 
ATOM   906  C CE2 . TYR A 1 116 ? -4.149  67.911 55.404 1.00 26.54 ? 116  TYR A CE2 1 
ATOM   907  C CZ  . TYR A 1 116 ? -4.373  66.723 56.081 1.00 29.76 ? 116  TYR A CZ  1 
ATOM   908  O OH  . TYR A 1 116 ? -5.643  66.144 55.982 1.00 29.50 ? 116  TYR A OH  1 
ATOM   909  N N   . GLY A 1 117 ? 1.914   66.682 56.986 1.00 31.18 ? 117  GLY A N   1 
ATOM   910  C CA  . GLY A 1 117 ? 2.277   65.571 57.858 1.00 30.97 ? 117  GLY A CA  1 
ATOM   911  C C   . GLY A 1 117 ? 1.381   65.574 59.094 1.00 33.03 ? 117  GLY A C   1 
ATOM   912  O O   . GLY A 1 117 ? 0.320   66.250 59.134 1.00 34.68 ? 117  GLY A O   1 
ATOM   913  N N   . GLY A 1 118 ? 1.814   64.862 60.131 1.00 32.87 ? 118  GLY A N   1 
ATOM   914  C CA  . GLY A 1 118 ? 1.026   64.738 61.345 1.00 29.98 ? 118  GLY A CA  1 
ATOM   915  C C   . GLY A 1 118 ? 0.874   63.242 61.708 1.00 30.83 ? 118  GLY A C   1 
ATOM   916  O O   . GLY A 1 118 ? -0.158  62.846 62.216 1.00 30.73 ? 118  GLY A O   1 
ATOM   917  N N   . GLY A 1 119 ? 1.908   62.426 61.449 1.00 29.64 ? 119  GLY A N   1 
ATOM   918  C CA  . GLY A 1 119 ? 1.873   61.003 61.779 1.00 30.58 ? 119  GLY A CA  1 
ATOM   919  C C   . GLY A 1 119 ? 0.695   60.166 61.256 1.00 30.87 ? 119  GLY A C   1 
ATOM   920  O O   . GLY A 1 119 ? 0.441   59.078 61.751 1.00 31.20 ? 119  GLY A O   1 
ATOM   921  N N   . PHE A 1 120 ? 0.022   60.655 60.220 1.00 31.14 ? 120  PHE A N   1 
ATOM   922  C CA  . PHE A 1 120 ? -1.166  60.007 59.634 1.00 31.16 ? 120  PHE A CA  1 
ATOM   923  C C   . PHE A 1 120 ? -2.381  59.999 60.584 1.00 31.10 ? 120  PHE A C   1 
ATOM   924  O O   . PHE A 1 120 ? -3.405  59.379 60.265 1.00 32.41 ? 120  PHE A O   1 
ATOM   925  C CB  . PHE A 1 120 ? -0.900  58.562 59.142 1.00 27.53 ? 120  PHE A CB  1 
ATOM   926  C CG  . PHE A 1 120 ? 0.094   58.472 58.015 1.00 26.25 ? 120  PHE A CG  1 
ATOM   927  C CD1 . PHE A 1 120 ? -0.231  58.874 56.745 1.00 25.04 ? 120  PHE A CD1 1 
ATOM   928  C CD2 . PHE A 1 120 ? 1.370   57.949 58.245 1.00 26.29 ? 120  PHE A CD2 1 
ATOM   929  C CE1 . PHE A 1 120 ? 0.683   58.761 55.701 1.00 26.23 ? 120  PHE A CE1 1 
ATOM   930  C CE2 . PHE A 1 120 ? 2.301   57.824 57.223 1.00 26.05 ? 120  PHE A CE2 1 
ATOM   931  C CZ  . PHE A 1 120 ? 1.955   58.233 55.929 1.00 27.36 ? 120  PHE A CZ  1 
ATOM   932  N N   . TYR A 1 121 ? -2.297  60.666 61.736 1.00 29.95 ? 121  TYR A N   1 
ATOM   933  C CA  . TYR A 1 121 ? -3.469  60.706 62.627 1.00 29.66 ? 121  TYR A CA  1 
ATOM   934  C C   . TYR A 1 121 ? -3.995  62.144 62.802 1.00 31.25 ? 121  TYR A C   1 
ATOM   935  O O   . TYR A 1 121 ? -5.001  62.371 63.504 1.00 29.98 ? 121  TYR A O   1 
ATOM   936  C CB  . TYR A 1 121 ? -3.156  60.138 64.036 1.00 30.25 ? 121  TYR A CB  1 
ATOM   937  C CG  . TYR A 1 121 ? -2.336  61.063 64.916 1.00 29.95 ? 121  TYR A CG  1 
ATOM   938  C CD1 . TYR A 1 121 ? -2.953  62.047 65.693 1.00 29.98 ? 121  TYR A CD1 1 
ATOM   939  C CD2 . TYR A 1 121 ? -0.931  61.046 64.869 1.00 29.76 ? 121  TYR A CD2 1 
ATOM   940  C CE1 . TYR A 1 121 ? -2.199  63.014 66.397 1.00 29.88 ? 121  TYR A CE1 1 
ATOM   941  C CE2 . TYR A 1 121 ? -0.172  61.996 65.577 1.00 31.23 ? 121  TYR A CE2 1 
ATOM   942  C CZ  . TYR A 1 121 ? -0.816  62.974 66.336 1.00 31.19 ? 121  TYR A CZ  1 
ATOM   943  O OH  . TYR A 1 121 ? -0.076  63.896 67.060 1.00 35.92 ? 121  TYR A OH  1 
ATOM   944  N N   . SER A 1 122 ? -3.292  63.112 62.216 1.00 30.61 ? 122  SER A N   1 
ATOM   945  C CA  . SER A 1 122 ? -3.673  64.505 62.353 1.00 31.11 ? 122  SER A CA  1 
ATOM   946  C C   . SER A 1 122 ? -3.092  65.270 61.172 1.00 31.75 ? 122  SER A C   1 
ATOM   947  O O   . SER A 1 122 ? -2.476  64.647 60.290 1.00 30.10 ? 122  SER A O   1 
ATOM   948  C CB  . SER A 1 122 ? -3.140  65.071 63.682 1.00 31.85 ? 122  SER A CB  1 
ATOM   949  O OG  . SER A 1 122 ? -1.738  65.023 63.695 1.00 33.10 ? 122  SER A OG  1 
ATOM   950  N N   . GLY A 1 123 ? -3.277  66.603 61.183 1.00 30.83 ? 123  GLY A N   1 
ATOM   951  C CA  . GLY A 1 123 ? -2.827  67.443 60.084 1.00 30.93 ? 123  GLY A CA  1 
ATOM   952  C C   . GLY A 1 123 ? -3.998  68.189 59.416 1.00 31.91 ? 123  GLY A C   1 
ATOM   953  O O   . GLY A 1 123 ? -5.127  67.718 59.389 1.00 30.41 ? 123  GLY A O   1 
ATOM   954  N N   . SER A 1 124 ? -3.702  69.366 58.897 1.00 31.15 ? 124  SER A N   1 
ATOM   955  C CA  . SER A 1 124 ? -4.674  70.243 58.264 1.00 33.46 ? 124  SER A CA  1 
ATOM   956  C C   . SER A 1 124 ? -3.956  71.001 57.175 1.00 33.89 ? 124  SER A C   1 
ATOM   957  O O   . SER A 1 124 ? -2.798  71.361 57.327 1.00 34.00 ? 124  SER A O   1 
ATOM   958  C CB  . SER A 1 124 ? -5.223  71.294 59.257 1.00 32.59 ? 124  SER A CB  1 
ATOM   959  O OG  . SER A 1 124 ? -5.809  70.673 60.381 1.00 35.98 ? 124  SER A OG  1 
ATOM   960  N N   . SER A 1 125 ? -4.650  71.266 56.083 1.00 34.69 ? 125  SER A N   1 
ATOM   961  C CA  . SER A 1 125 ? -4.048  72.000 54.987 1.00 36.12 ? 125  SER A CA  1 
ATOM   962  C C   . SER A 1 125 ? -4.161  73.514 55.185 1.00 36.56 ? 125  SER A C   1 
ATOM   963  O O   . SER A 1 125 ? -3.563  74.269 54.429 1.00 38.99 ? 125  SER A O   1 
ATOM   964  C CB  . SER A 1 125 ? -4.778  71.667 53.697 1.00 35.46 ? 125  SER A CB  1 
ATOM   965  O OG  . SER A 1 125 ? -6.106  72.146 53.791 1.00 38.09 ? 125  SER A OG  1 
ATOM   966  N N   . THR A 1 126 ? -4.871  73.923 56.230 1.00 36.55 ? 126  THR A N   1 
ATOM   967  C CA  . THR A 1 126 ? -5.214  75.322 56.502 1.00 36.72 ? 126  THR A CA  1 
ATOM   968  C C   . THR A 1 126 ? -4.404  76.043 57.541 1.00 37.09 ? 126  THR A C   1 
ATOM   969  O O   . THR A 1 126 ? -4.676  77.184 57.852 1.00 37.55 ? 126  THR A O   1 
ATOM   970  C CB  . THR A 1 126 ? -6.673  75.378 56.946 1.00 36.11 ? 126  THR A CB  1 
ATOM   971  O OG1 . THR A 1 126 ? -6.791  74.686 58.188 1.00 33.87 ? 126  THR A OG1 1 
ATOM   972  C CG2 . THR A 1 126 ? -7.583  74.657 55.934 1.00 35.90 ? 126  THR A CG2 1 
ATOM   973  N N   . LEU A 1 127 ? -3.420  75.370 58.107 1.00 37.59 ? 127  LEU A N   1 
ATOM   974  C CA  . LEU A 1 127 ? -2.579  75.996 59.114 1.00 37.57 ? 127  LEU A CA  1 
ATOM   975  C C   . LEU A 1 127 ? -1.824  77.221 58.615 1.00 37.82 ? 127  LEU A C   1 
ATOM   976  O O   . LEU A 1 127 ? -1.368  77.257 57.464 1.00 36.65 ? 127  LEU A O   1 
ATOM   977  C CB  . LEU A 1 127 ? -1.542  75.000 59.627 1.00 35.10 ? 127  LEU A CB  1 
ATOM   978  C CG  . LEU A 1 127 ? -2.051  73.631 60.103 1.00 34.25 ? 127  LEU A CG  1 
ATOM   979  C CD1 . LEU A 1 127 ? -0.835  72.754 60.538 1.00 27.49 ? 127  LEU A CD1 1 
ATOM   980  C CD2 . LEU A 1 127 ? -3.059  73.829 61.209 1.00 31.66 ? 127  LEU A CD2 1 
ATOM   981  N N   . ASP A 1 128 ? -1.622  78.195 59.498 1.00 38.29 ? 128  ASP A N   1 
ATOM   982  C CA  . ASP A 1 128 ? -0.857  79.385 59.099 1.00 38.20 ? 128  ASP A CA  1 
ATOM   983  C C   . ASP A 1 128 ? 0.557   79.031 58.554 1.00 37.80 ? 128  ASP A C   1 
ATOM   984  O O   . ASP A 1 128 ? 1.013   79.682 57.603 1.00 36.37 ? 128  ASP A O   1 
ATOM   985  C CB  . ASP A 1 128 ? -0.754  80.411 60.264 1.00 39.63 ? 128  ASP A CB  1 
ATOM   986  C CG  . ASP A 1 128 ? -2.147  80.894 60.781 1.00 43.89 ? 128  ASP A CG  1 
ATOM   987  O OD1 . ASP A 1 128 ? -3.156  80.919 60.017 1.00 43.96 ? 128  ASP A OD1 1 
ATOM   988  O OD2 . ASP A 1 128 ? -2.227  81.234 61.990 1.00 48.74 ? 128  ASP A OD2 1 
ATOM   989  N N   . VAL A 1 129 ? 1.269   78.034 59.121 1.00 37.35 ? 129  VAL A N   1 
ATOM   990  C CA  . VAL A 1 129 ? 2.604   77.735 58.560 1.00 37.10 ? 129  VAL A CA  1 
ATOM   991  C C   . VAL A 1 129 ? 2.501   77.153 57.145 1.00 37.83 ? 129  VAL A C   1 
ATOM   992  O O   . VAL A 1 129 ? 3.528   77.058 56.462 1.00 37.64 ? 129  VAL A O   1 
ATOM   993  C CB  . VAL A 1 129 ? 3.485   76.658 59.328 1.00 37.19 ? 129  VAL A CB  1 
ATOM   994  C CG1 . VAL A 1 129 ? 4.448   77.303 60.245 1.00 36.15 ? 129  VAL A CG1 1 
ATOM   995  C CG2 . VAL A 1 129 ? 2.638   75.643 59.947 1.00 33.17 ? 129  VAL A CG2 1 
ATOM   996  N N   . TYR A 1 130 ? 1.306   76.705 56.728 1.00 37.40 ? 130  TYR A N   1 
ATOM   997  C CA  . TYR A 1 130 ? 1.151   76.163 55.373 1.00 37.97 ? 130  TYR A CA  1 
ATOM   998  C C   . TYR A 1 130 ? 0.532   77.182 54.397 1.00 39.15 ? 130  TYR A C   1 
ATOM   999  O O   . TYR A 1 130 ? 0.164   76.811 53.286 1.00 38.41 ? 130  TYR A O   1 
ATOM   1000 C CB  . TYR A 1 130 ? 0.275   74.904 55.351 1.00 34.88 ? 130  TYR A CB  1 
ATOM   1001 C CG  . TYR A 1 130 ? 0.767   73.750 56.196 1.00 33.85 ? 130  TYR A CG  1 
ATOM   1002 C CD1 . TYR A 1 130 ? 2.126   73.599 56.508 1.00 32.30 ? 130  TYR A CD1 1 
ATOM   1003 C CD2 . TYR A 1 130 ? -0.146  72.822 56.729 1.00 32.57 ? 130  TYR A CD2 1 
ATOM   1004 C CE1 . TYR A 1 130 ? 2.562   72.561 57.345 1.00 32.24 ? 130  TYR A CE1 1 
ATOM   1005 C CE2 . TYR A 1 130 ? 0.272   71.789 57.557 1.00 30.81 ? 130  TYR A CE2 1 
ATOM   1006 C CZ  . TYR A 1 130 ? 1.614   71.663 57.866 1.00 31.72 ? 130  TYR A CZ  1 
ATOM   1007 O OH  . TYR A 1 130 ? 2.008   70.645 58.677 1.00 29.77 ? 130  TYR A OH  1 
ATOM   1008 N N   . ASN A 1 131 ? 0.391   78.446 54.812 1.00 40.22 ? 131  ASN A N   1 
ATOM   1009 C CA  . ASN A 1 131 ? -0.197  79.477 53.924 1.00 39.64 ? 131  ASN A CA  1 
ATOM   1010 C C   . ASN A 1 131 ? 0.655   79.582 52.653 1.00 37.76 ? 131  ASN A C   1 
ATOM   1011 O O   . ASN A 1 131 ? 1.803   80.041 52.708 1.00 36.36 ? 131  ASN A O   1 
ATOM   1012 C CB  . ASN A 1 131 ? -0.225  80.829 54.639 1.00 40.58 ? 131  ASN A CB  1 
ATOM   1013 C CG  . ASN A 1 131 ? -1.147  81.839 53.945 1.00 43.28 ? 131  ASN A CG  1 
ATOM   1014 O OD1 . ASN A 1 131 ? -1.204  81.915 52.709 1.00 42.03 ? 131  ASN A OD1 1 
ATOM   1015 N ND2 . ASN A 1 131 ? -1.864  82.634 54.753 1.00 45.00 ? 131  ASN A ND2 1 
ATOM   1016 N N   . GLY A 1 132 ? 0.096   79.177 51.507 1.00 38.30 ? 132  GLY A N   1 
ATOM   1017 C CA  . GLY A 1 132 ? 0.907   79.178 50.285 1.00 37.39 ? 132  GLY A CA  1 
ATOM   1018 C C   . GLY A 1 132 ? 1.109   80.473 49.498 1.00 38.08 ? 132  GLY A C   1 
ATOM   1019 O O   . GLY A 1 132 ? 1.796   80.484 48.453 1.00 37.53 ? 132  GLY A O   1 
ATOM   1020 N N   . LYS A 1 133 ? 0.572   81.579 50.014 1.00 38.58 ? 133  LYS A N   1 
ATOM   1021 C CA  . LYS A 1 133 ? 0.639   82.843 49.289 1.00 37.58 ? 133  LYS A CA  1 
ATOM   1022 C C   . LYS A 1 133 ? 2.061   83.368 49.147 1.00 38.22 ? 133  LYS A C   1 
ATOM   1023 O O   . LYS A 1 133 ? 2.407   83.874 48.063 1.00 36.71 ? 133  LYS A O   1 
ATOM   1024 C CB  . LYS A 1 133 ? -0.302  83.878 49.941 1.00 38.49 ? 133  LYS A CB  1 
ATOM   1025 C CG  . LYS A 1 133 ? 0.285   84.612 51.169 1.00 38.89 ? 133  LYS A CG  1 
ATOM   1026 C CD  . LYS A 1 133 ? -0.814  85.293 51.969 1.00 39.06 ? 133  LYS A CD  1 
ATOM   1027 C CE  . LYS A 1 133 ? -0.219  86.335 52.936 1.00 40.06 ? 133  LYS A CE  1 
ATOM   1028 N NZ  . LYS A 1 133 ? -1.358  86.974 53.656 1.00 43.56 ? 133  LYS A NZ  1 
ATOM   1029 N N   . TYR A 1 134 ? 2.902   83.197 50.178 1.00 37.39 ? 134  TYR A N   1 
ATOM   1030 C CA  . TYR A 1 134 ? 4.270   83.715 50.099 1.00 38.07 ? 134  TYR A CA  1 
ATOM   1031 C C   . TYR A 1 134 ? 5.075   82.994 49.032 1.00 39.11 ? 134  TYR A C   1 
ATOM   1032 O O   . TYR A 1 134 ? 5.761   83.617 48.234 1.00 40.31 ? 134  TYR A O   1 
ATOM   1033 C CB  . TYR A 1 134 ? 5.003   83.625 51.457 1.00 38.48 ? 134  TYR A CB  1 
ATOM   1034 C CG  . TYR A 1 134 ? 4.244   84.258 52.587 1.00 39.90 ? 134  TYR A CG  1 
ATOM   1035 C CD1 . TYR A 1 134 ? 3.624   83.468 53.547 1.00 39.06 ? 134  TYR A CD1 1 
ATOM   1036 C CD2 . TYR A 1 134 ? 4.057   85.657 52.653 1.00 40.80 ? 134  TYR A CD2 1 
ATOM   1037 C CE1 . TYR A 1 134 ? 2.830   84.018 54.549 1.00 38.11 ? 134  TYR A CE1 1 
ATOM   1038 C CE2 . TYR A 1 134 ? 3.252   86.235 53.673 1.00 38.07 ? 134  TYR A CE2 1 
ATOM   1039 C CZ  . TYR A 1 134 ? 2.645   85.395 54.615 1.00 40.92 ? 134  TYR A CZ  1 
ATOM   1040 O OH  . TYR A 1 134 ? 1.858   85.897 55.644 1.00 42.63 ? 134  TYR A OH  1 
ATOM   1041 N N   . LEU A 1 135 ? 4.975   81.678 48.989 1.00 38.74 ? 135  LEU A N   1 
ATOM   1042 C CA  . LEU A 1 135 ? 5.730   80.915 47.999 1.00 39.03 ? 135  LEU A CA  1 
ATOM   1043 C C   . LEU A 1 135 ? 5.146   81.161 46.601 1.00 40.58 ? 135  LEU A C   1 
ATOM   1044 O O   . LEU A 1 135 ? 5.896   81.409 45.651 1.00 41.78 ? 135  LEU A O   1 
ATOM   1045 C CB  . LEU A 1 135 ? 5.681   79.420 48.375 1.00 38.42 ? 135  LEU A CB  1 
ATOM   1046 C CG  . LEU A 1 135 ? 6.446   78.334 47.656 1.00 38.31 ? 135  LEU A CG  1 
ATOM   1047 C CD1 . LEU A 1 135 ? 7.917   78.727 47.467 1.00 36.42 ? 135  LEU A CD1 1 
ATOM   1048 C CD2 . LEU A 1 135 ? 6.309   77.046 48.526 1.00 36.59 ? 135  LEU A CD2 1 
ATOM   1049 N N   . ALA A 1 136 ? 3.818   81.097 46.453 1.00 41.39 ? 136  ALA A N   1 
ATOM   1050 C CA  . ALA A 1 136 ? 3.220   81.319 45.126 1.00 42.16 ? 136  ALA A CA  1 
ATOM   1051 C C   . ALA A 1 136 ? 3.674   82.682 44.579 1.00 43.02 ? 136  ALA A C   1 
ATOM   1052 O O   . ALA A 1 136 ? 4.124   82.821 43.419 1.00 43.54 ? 136  ALA A O   1 
ATOM   1053 C CB  . ALA A 1 136 ? 1.668   81.263 45.212 1.00 39.45 ? 136  ALA A CB  1 
ATOM   1054 N N   . TYR A 1 137 ? 3.573   83.688 45.440 1.00 43.17 ? 137  TYR A N   1 
ATOM   1055 C CA  . TYR A 1 137 ? 3.938   85.026 45.063 1.00 43.01 ? 137  TYR A CA  1 
ATOM   1056 C C   . TYR A 1 137 ? 5.411   85.205 44.787 1.00 42.47 ? 137  TYR A C   1 
ATOM   1057 O O   . TYR A 1 137 ? 5.787   85.631 43.696 1.00 41.53 ? 137  TYR A O   1 
ATOM   1058 C CB  . TYR A 1 137 ? 3.482   86.009 46.133 1.00 43.33 ? 137  TYR A CB  1 
ATOM   1059 C CG  . TYR A 1 137 ? 3.975   87.397 45.904 1.00 45.43 ? 137  TYR A CG  1 
ATOM   1060 C CD1 . TYR A 1 137 ? 4.977   87.945 46.707 1.00 47.78 ? 137  TYR A CD1 1 
ATOM   1061 C CD2 . TYR A 1 137 ? 3.441   88.179 44.890 1.00 47.89 ? 137  TYR A CD2 1 
ATOM   1062 C CE1 . TYR A 1 137 ? 5.438   89.252 46.505 1.00 48.40 ? 137  TYR A CE1 1 
ATOM   1063 C CE2 . TYR A 1 137 ? 3.888   89.483 44.673 1.00 49.22 ? 137  TYR A CE2 1 
ATOM   1064 C CZ  . TYR A 1 137 ? 4.887   90.010 45.487 1.00 49.37 ? 137  TYR A CZ  1 
ATOM   1065 O OH  . TYR A 1 137 ? 5.323   91.284 45.261 1.00 50.39 ? 137  TYR A OH  1 
ATOM   1066 N N   . THR A 1 138 ? 6.254   84.861 45.747 1.00 42.30 ? 138  THR A N   1 
ATOM   1067 C CA  . THR A 1 138 ? 7.697   85.080 45.558 1.00 42.42 ? 138  THR A CA  1 
ATOM   1068 C C   . THR A 1 138 ? 8.307   84.288 44.431 1.00 41.88 ? 138  THR A C   1 
ATOM   1069 O O   . THR A 1 138 ? 9.184   84.792 43.750 1.00 42.46 ? 138  THR A O   1 
ATOM   1070 C CB  . THR A 1 138 ? 8.539   84.784 46.840 1.00 41.27 ? 138  THR A CB  1 
ATOM   1071 O OG1 . THR A 1 138 ? 7.965   85.453 47.957 1.00 39.22 ? 138  THR A OG1 1 
ATOM   1072 C CG2 . THR A 1 138 ? 9.933   85.299 46.667 1.00 40.62 ? 138  THR A CG2 1 
ATOM   1073 N N   . GLU A 1 139 ? 7.843   83.060 44.208 1.00 40.37 ? 139  GLU A N   1 
ATOM   1074 C CA  . GLU A 1 139 ? 8.453   82.252 43.147 1.00 40.35 ? 139  GLU A CA  1 
ATOM   1075 C C   . GLU A 1 139 ? 7.634   82.080 41.861 1.00 40.35 ? 139  GLU A C   1 
ATOM   1076 O O   . GLU A 1 139 ? 8.106   81.437 40.923 1.00 39.02 ? 139  GLU A O   1 
ATOM   1077 C CB  . GLU A 1 139 ? 8.858   80.874 43.698 1.00 39.74 ? 139  GLU A CB  1 
ATOM   1078 C CG  . GLU A 1 139 ? 9.935   80.912 44.795 1.00 38.01 ? 139  GLU A CG  1 
ATOM   1079 C CD  . GLU A 1 139 ? 11.272  81.382 44.313 1.00 38.18 ? 139  GLU A CD  1 
ATOM   1080 O OE1 . GLU A 1 139 ? 11.690  81.014 43.189 1.00 37.28 ? 139  GLU A OE1 1 
ATOM   1081 O OE2 . GLU A 1 139 ? 11.945  82.096 45.084 1.00 39.12 ? 139  GLU A OE2 1 
ATOM   1082 N N   . GLU A 1 140 ? 6.427   82.648 41.831 1.00 41.79 ? 140  GLU A N   1 
ATOM   1083 C CA  . GLU A 1 140 ? 5.547   82.582 40.658 1.00 44.82 ? 140  GLU A CA  1 
ATOM   1084 C C   . GLU A 1 140 ? 5.170   81.150 40.335 1.00 42.25 ? 140  GLU A C   1 
ATOM   1085 O O   . GLU A 1 140 ? 5.249   80.712 39.172 1.00 41.48 ? 140  GLU A O   1 
ATOM   1086 C CB  . GLU A 1 140 ? 6.224   83.210 39.419 1.00 50.44 ? 140  GLU A CB  1 
ATOM   1087 C CG  . GLU A 1 140 ? 5.556   84.470 38.815 1.00 58.80 ? 140  GLU A CG  1 
ATOM   1088 C CD  . GLU A 1 140 ? 6.530   85.696 38.781 1.00 64.33 ? 140  GLU A CD  1 
ATOM   1089 O OE1 . GLU A 1 140 ? 7.749   85.534 38.441 1.00 64.54 ? 140  GLU A OE1 1 
ATOM   1090 O OE2 . GLU A 1 140 ? 6.066   86.830 39.094 1.00 67.55 ? 140  GLU A OE2 1 
ATOM   1091 N N   . VAL A 1 141 ? 4.779   80.407 41.365 1.00 40.25 ? 141  VAL A N   1 
ATOM   1092 C CA  . VAL A 1 141 ? 4.357   79.053 41.130 1.00 38.48 ? 141  VAL A CA  1 
ATOM   1093 C C   . VAL A 1 141 ? 2.905   79.008 41.545 1.00 37.85 ? 141  VAL A C   1 
ATOM   1094 O O   . VAL A 1 141 ? 2.476   79.872 42.302 1.00 35.09 ? 141  VAL A O   1 
ATOM   1095 C CB  . VAL A 1 141 ? 5.196   78.018 41.973 1.00 39.76 ? 141  VAL A CB  1 
ATOM   1096 C CG1 . VAL A 1 141 ? 6.729   78.154 41.637 1.00 39.33 ? 141  VAL A CG1 1 
ATOM   1097 C CG2 . VAL A 1 141 ? 4.956   78.218 43.448 1.00 38.69 ? 141  VAL A CG2 1 
ATOM   1098 N N   . VAL A 1 142 ? 2.149   78.043 40.992 1.00 37.20 ? 142  VAL A N   1 
ATOM   1099 C CA  . VAL A 1 142 ? 0.772   77.809 41.400 1.00 36.37 ? 142  VAL A CA  1 
ATOM   1100 C C   . VAL A 1 142 ? 0.958   76.778 42.539 1.00 37.36 ? 142  VAL A C   1 
ATOM   1101 O O   . VAL A 1 142 ? 1.466   75.660 42.325 1.00 36.58 ? 142  VAL A O   1 
ATOM   1102 C CB  . VAL A 1 142 ? -0.098  77.212 40.259 1.00 37.11 ? 142  VAL A CB  1 
ATOM   1103 C CG1 . VAL A 1 142 ? -1.391  76.640 40.814 1.00 33.91 ? 142  VAL A CG1 1 
ATOM   1104 C CG2 . VAL A 1 142 ? -0.411  78.307 39.225 1.00 35.39 ? 142  VAL A CG2 1 
ATOM   1105 N N   . LEU A 1 143 ? 0.590   77.190 43.754 1.00 36.66 ? 143  LEU A N   1 
ATOM   1106 C CA  . LEU A 1 143 ? 0.744   76.361 44.928 1.00 36.06 ? 143  LEU A CA  1 
ATOM   1107 C C   . LEU A 1 143 ? -0.539  75.696 45.378 1.00 35.28 ? 143  LEU A C   1 
ATOM   1108 O O   . LEU A 1 143 ? -1.532  76.365 45.695 1.00 36.23 ? 143  LEU A O   1 
ATOM   1109 C CB  . LEU A 1 143 ? 1.305   77.172 46.096 1.00 37.88 ? 143  LEU A CB  1 
ATOM   1110 C CG  . LEU A 1 143 ? 1.664   76.130 47.156 1.00 41.21 ? 143  LEU A CG  1 
ATOM   1111 C CD1 . LEU A 1 143 ? 3.165   75.872 47.143 1.00 41.20 ? 143  LEU A CD1 1 
ATOM   1112 C CD2 . LEU A 1 143 ? 1.210   76.556 48.478 1.00 41.43 ? 143  LEU A CD2 1 
ATOM   1113 N N   . VAL A 1 144 ? -0.518  74.371 45.426 1.00 33.17 ? 144  VAL A N   1 
ATOM   1114 C CA  . VAL A 1 144 ? -1.699  73.639 45.853 1.00 31.95 ? 144  VAL A CA  1 
ATOM   1115 C C   . VAL A 1 144 ? -1.442  72.916 47.185 1.00 31.08 ? 144  VAL A C   1 
ATOM   1116 O O   . VAL A 1 144 ? -0.345  72.337 47.382 1.00 30.24 ? 144  VAL A O   1 
ATOM   1117 C CB  . VAL A 1 144 ? -2.103  72.505 44.820 1.00 30.73 ? 144  VAL A CB  1 
ATOM   1118 C CG1 . VAL A 1 144 ? -3.338  71.754 45.334 1.00 30.26 ? 144  VAL A CG1 1 
ATOM   1119 C CG2 . VAL A 1 144 ? -2.395  73.077 43.433 1.00 30.57 ? 144  VAL A CG2 1 
ATOM   1120 N N   . SER A 1 145 ? -2.418  72.962 48.086 1.00 30.53 ? 145  SER A N   1 
ATOM   1121 C CA  . SER A 1 145 ? -2.337  72.133 49.297 1.00 31.51 ? 145  SER A CA  1 
ATOM   1122 C C   . SER A 1 145 ? -3.590  71.273 49.300 1.00 32.15 ? 145  SER A C   1 
ATOM   1123 O O   . SER A 1 145 ? -4.723  71.772 49.174 1.00 31.02 ? 145  SER A O   1 
ATOM   1124 C CB  . SER A 1 145 ? -2.256  72.931 50.608 1.00 32.45 ? 145  SER A CB  1 
ATOM   1125 O OG  . SER A 1 145 ? -3.271  73.919 50.713 1.00 35.28 ? 145  SER A OG  1 
ATOM   1126 N N   . LEU A 1 146 ? -3.405  69.962 49.412 1.00 32.38 ? 146  LEU A N   1 
ATOM   1127 C CA  . LEU A 1 146 ? -4.552  69.068 49.468 1.00 31.32 ? 146  LEU A CA  1 
ATOM   1128 C C   . LEU A 1 146 ? -4.823  68.613 50.930 1.00 32.33 ? 146  LEU A C   1 
ATOM   1129 O O   . LEU A 1 146 ? -4.125  68.992 51.853 1.00 33.59 ? 146  LEU A O   1 
ATOM   1130 C CB  . LEU A 1 146 ? -4.288  67.858 48.565 1.00 30.90 ? 146  LEU A CB  1 
ATOM   1131 C CG  . LEU A 1 146 ? -2.963  67.108 48.804 1.00 29.82 ? 146  LEU A CG  1 
ATOM   1132 C CD1 . LEU A 1 146 ? -3.084  66.317 50.112 1.00 28.71 ? 146  LEU A CD1 1 
ATOM   1133 C CD2 . LEU A 1 146 ? -2.636  66.191 47.640 1.00 27.85 ? 146  LEU A CD2 1 
ATOM   1134 N N   . SER A 1 147 ? -5.842  67.796 51.130 1.00 31.82 ? 147  SER A N   1 
ATOM   1135 C CA  . SER A 1 147 ? -6.126  67.245 52.448 1.00 33.52 ? 147  SER A CA  1 
ATOM   1136 C C   . SER A 1 147 ? -6.417  65.785 52.204 1.00 33.02 ? 147  SER A C   1 
ATOM   1137 O O   . SER A 1 147 ? -6.562  65.338 51.046 1.00 34.74 ? 147  SER A O   1 
ATOM   1138 C CB  . SER A 1 147 ? -7.338  67.896 53.090 1.00 32.67 ? 147  SER A CB  1 
ATOM   1139 O OG  . SER A 1 147 ? -8.447  67.775 52.210 1.00 37.97 ? 147  SER A OG  1 
ATOM   1140 N N   . TYR A 1 148 ? -6.492  65.033 53.284 1.00 32.11 ? 148  TYR A N   1 
ATOM   1141 C CA  . TYR A 1 148 ? -6.779  63.613 53.219 1.00 30.12 ? 148  TYR A CA  1 
ATOM   1142 C C   . TYR A 1 148 ? -7.185  63.169 54.624 1.00 31.89 ? 148  TYR A C   1 
ATOM   1143 O O   . TYR A 1 148 ? -6.762  63.788 55.655 1.00 31.37 ? 148  TYR A O   1 
ATOM   1144 C CB  . TYR A 1 148 ? -5.560  62.806 52.723 1.00 28.92 ? 148  TYR A CB  1 
ATOM   1145 C CG  . TYR A 1 148 ? -4.275  62.930 53.554 1.00 28.66 ? 148  TYR A CG  1 
ATOM   1146 C CD1 . TYR A 1 148 ? -3.433  64.035 53.415 1.00 27.04 ? 148  TYR A CD1 1 
ATOM   1147 C CD2 . TYR A 1 148 ? -3.932  61.945 54.503 1.00 27.82 ? 148  TYR A CD2 1 
ATOM   1148 C CE1 . TYR A 1 148 ? -2.276  64.184 54.205 1.00 27.62 ? 148  TYR A CE1 1 
ATOM   1149 C CE2 . TYR A 1 148 ? -2.769  62.071 55.316 1.00 27.25 ? 148  TYR A CE2 1 
ATOM   1150 C CZ  . TYR A 1 148 ? -1.953  63.196 55.170 1.00 29.23 ? 148  TYR A CZ  1 
ATOM   1151 O OH  . TYR A 1 148 ? -0.861  63.368 56.026 1.00 28.88 ? 148  TYR A OH  1 
ATOM   1152 N N   . ARG A 1 149 ? -8.011  62.123 54.659 1.00 30.64 ? 149  ARG A N   1 
ATOM   1153 C CA  . ARG A 1 149 ? -8.489  61.565 55.916 1.00 31.71 ? 149  ARG A CA  1 
ATOM   1154 C C   . ARG A 1 149 ? -7.314  60.979 56.702 1.00 31.07 ? 149  ARG A C   1 
ATOM   1155 O O   . ARG A 1 149 ? -6.428  60.354 56.118 1.00 31.94 ? 149  ARG A O   1 
ATOM   1156 C CB  . ARG A 1 149 ? -9.528  60.467 55.650 1.00 30.92 ? 149  ARG A CB  1 
ATOM   1157 C CG  . ARG A 1 149 ? -10.944 61.003 55.268 1.00 29.39 ? 149  ARG A CG  1 
ATOM   1158 C CD  . ARG A 1 149 ? -11.836 59.828 54.822 1.00 31.42 ? 149  ARG A CD  1 
ATOM   1159 N NE  . ARG A 1 149 ? -11.486 59.395 53.458 1.00 30.71 ? 149  ARG A NE  1 
ATOM   1160 C CZ  . ARG A 1 149 ? -12.033 58.346 52.849 1.00 32.32 ? 149  ARG A CZ  1 
ATOM   1161 N NH1 . ARG A 1 149 ? -12.946 57.606 53.500 1.00 31.50 ? 149  ARG A NH1 1 
ATOM   1162 N NH2 . ARG A 1 149 ? -11.719 58.062 51.577 1.00 29.55 ? 149  ARG A NH2 1 
ATOM   1163 N N   . VAL A 1 150 ? -7.311  61.207 58.011 1.00 29.21 ? 150  VAL A N   1 
ATOM   1164 C CA  . VAL A 1 150 ? -6.279  60.679 58.885 1.00 27.95 ? 150  VAL A CA  1 
ATOM   1165 C C   . VAL A 1 150 ? -6.954  59.819 59.965 1.00 30.31 ? 150  VAL A C   1 
ATOM   1166 O O   . VAL A 1 150 ? -8.197  59.674 59.989 1.00 30.07 ? 150  VAL A O   1 
ATOM   1167 C CB  . VAL A 1 150 ? -5.468  61.868 59.542 1.00 27.69 ? 150  VAL A CB  1 
ATOM   1168 C CG1 . VAL A 1 150 ? -4.680  62.653 58.421 1.00 24.74 ? 150  VAL A CG1 1 
ATOM   1169 C CG2 . VAL A 1 150 ? -6.418  62.809 60.290 1.00 23.72 ? 150  VAL A CG2 1 
ATOM   1170 N N   . GLY A 1 151 ? -6.144  59.252 60.875 1.00 31.85 ? 151  GLY A N   1 
ATOM   1171 C CA  . GLY A 1 151 ? -6.670  58.394 61.929 1.00 31.05 ? 151  GLY A CA  1 
ATOM   1172 C C   . GLY A 1 151 ? -7.425  57.171 61.398 1.00 33.65 ? 151  GLY A C   1 
ATOM   1173 O O   . GLY A 1 151 ? -7.220  56.714 60.255 1.00 32.58 ? 151  GLY A O   1 
ATOM   1174 N N   . ALA A 1 152 ? -8.330  56.629 62.209 1.00 34.69 ? 152  ALA A N   1 
ATOM   1175 C CA  . ALA A 1 152 ? -9.102  55.457 61.753 1.00 35.18 ? 152  ALA A CA  1 
ATOM   1176 C C   . ALA A 1 152 ? -9.848  55.805 60.422 1.00 34.45 ? 152  ALA A C   1 
ATOM   1177 O O   . ALA A 1 152 ? -9.903  54.989 59.477 1.00 34.01 ? 152  ALA A O   1 
ATOM   1178 C CB  . ALA A 1 152 ? -10.126 54.997 62.890 1.00 33.56 ? 152  ALA A CB  1 
ATOM   1179 N N   . PHE A 1 153 ? -10.345 57.041 60.328 1.00 33.53 ? 153  PHE A N   1 
ATOM   1180 C CA  . PHE A 1 153 ? -11.079 57.483 59.133 1.00 32.87 ? 153  PHE A CA  1 
ATOM   1181 C C   . PHE A 1 153 ? -10.313 57.307 57.848 1.00 31.39 ? 153  PHE A C   1 
ATOM   1182 O O   . PHE A 1 153 ? -10.911 56.991 56.811 1.00 29.94 ? 153  PHE A O   1 
ATOM   1183 C CB  . PHE A 1 153 ? -11.504 58.944 59.288 1.00 32.31 ? 153  PHE A CB  1 
ATOM   1184 C CG  . PHE A 1 153 ? -12.145 59.225 60.608 1.00 35.92 ? 153  PHE A CG  1 
ATOM   1185 C CD1 . PHE A 1 153 ? -13.540 59.073 60.779 1.00 37.10 ? 153  PHE A CD1 1 
ATOM   1186 C CD2 . PHE A 1 153 ? -11.373 59.629 61.703 1.00 33.88 ? 153  PHE A CD2 1 
ATOM   1187 C CE1 . PHE A 1 153 ? -14.139 59.325 62.023 1.00 36.46 ? 153  PHE A CE1 1 
ATOM   1188 C CE2 . PHE A 1 153 ? -11.964 59.888 62.960 1.00 33.39 ? 153  PHE A CE2 1 
ATOM   1189 C CZ  . PHE A 1 153 ? -13.320 59.740 63.128 1.00 35.89 ? 153  PHE A CZ  1 
ATOM   1190 N N   . GLY A 1 154 ? -8.991  57.523 57.900 1.00 31.74 ? 154  GLY A N   1 
ATOM   1191 C CA  . GLY A 1 154 ? -8.196  57.350 56.702 1.00 30.14 ? 154  GLY A CA  1 
ATOM   1192 C C   . GLY A 1 154 ? -7.440  56.042 56.571 1.00 31.16 ? 154  GLY A C   1 
ATOM   1193 O O   . GLY A 1 154 ? -7.054  55.646 55.460 1.00 32.75 ? 154  GLY A O   1 
ATOM   1194 N N   . PHE A 1 155 ? -7.233  55.331 57.676 1.00 31.02 ? 155  PHE A N   1 
ATOM   1195 C CA  . PHE A 1 155 ? -6.399  54.167 57.576 1.00 30.28 ? 155  PHE A CA  1 
ATOM   1196 C C   . PHE A 1 155 ? -6.829  52.889 58.253 1.00 31.68 ? 155  PHE A C   1 
ATOM   1197 O O   . PHE A 1 155 ? -6.070  51.941 58.316 1.00 30.99 ? 155  PHE A O   1 
ATOM   1198 C CB  . PHE A 1 155 ? -4.980  54.595 57.984 1.00 28.80 ? 155  PHE A CB  1 
ATOM   1199 C CG  . PHE A 1 155 ? -4.399  55.676 57.064 1.00 27.39 ? 155  PHE A CG  1 
ATOM   1200 C CD1 . PHE A 1 155 ? -3.825  55.343 55.839 1.00 27.43 ? 155  PHE A CD1 1 
ATOM   1201 C CD2 . PHE A 1 155 ? -4.528  57.015 57.376 1.00 28.26 ? 155  PHE A CD2 1 
ATOM   1202 C CE1 . PHE A 1 155 ? -3.388  56.317 54.945 1.00 28.59 ? 155  PHE A CE1 1 
ATOM   1203 C CE2 . PHE A 1 155 ? -4.090  58.015 56.479 1.00 26.98 ? 155  PHE A CE2 1 
ATOM   1204 C CZ  . PHE A 1 155 ? -3.516  57.659 55.264 1.00 27.51 ? 155  PHE A CZ  1 
ATOM   1205 N N   . LEU A 1 156 ? -8.059  52.840 58.735 1.00 34.60 ? 156  LEU A N   1 
ATOM   1206 C CA  . LEU A 1 156 ? -8.551  51.603 59.358 1.00 36.32 ? 156  LEU A CA  1 
ATOM   1207 C C   . LEU A 1 156 ? -8.416  50.583 58.221 1.00 35.91 ? 156  LEU A C   1 
ATOM   1208 O O   . LEU A 1 156 ? -8.874  50.825 57.120 1.00 36.71 ? 156  LEU A O   1 
ATOM   1209 C CB  . LEU A 1 156 ? -10.010 51.759 59.783 1.00 37.49 ? 156  LEU A CB  1 
ATOM   1210 C CG  . LEU A 1 156 ? -10.483 50.540 60.578 1.00 41.00 ? 156  LEU A CG  1 
ATOM   1211 C CD1 . LEU A 1 156 ? -10.528 50.818 62.089 1.00 39.48 ? 156  LEU A CD1 1 
ATOM   1212 C CD2 . LEU A 1 156 ? -11.855 50.205 60.084 1.00 40.25 ? 156  LEU A CD2 1 
ATOM   1213 N N   . ALA A 1 157 ? -7.778  49.458 58.489 1.00 35.66 ? 157  ALA A N   1 
ATOM   1214 C CA  . ALA A 1 157 ? -7.532  48.474 57.452 1.00 37.33 ? 157  ALA A CA  1 
ATOM   1215 C C   . ALA A 1 157 ? -7.973  47.016 57.765 1.00 39.52 ? 157  ALA A C   1 
ATOM   1216 O O   . ALA A 1 157 ? -7.418  46.344 58.647 1.00 39.81 ? 157  ALA A O   1 
ATOM   1217 C CB  . ALA A 1 157 ? -6.023  48.495 57.078 1.00 31.91 ? 157  ALA A CB  1 
ATOM   1218 N N   . LEU A 1 158 ? -8.971  46.541 57.039 1.00 39.99 ? 158  LEU A N   1 
ATOM   1219 C CA  . LEU A 1 158 ? -9.436  45.161 57.194 1.00 42.34 ? 158  LEU A CA  1 
ATOM   1220 C C   . LEU A 1 158 ? -9.208  44.570 55.808 1.00 41.59 ? 158  LEU A C   1 
ATOM   1221 O O   . LEU A 1 158 ? -10.105 44.492 54.997 1.00 42.48 ? 158  LEU A O   1 
ATOM   1222 C CB  . LEU A 1 158 ? -10.925 45.150 57.610 1.00 41.38 ? 158  LEU A CB  1 
ATOM   1223 C CG  . LEU A 1 158 ? -11.056 45.478 59.123 1.00 42.68 ? 158  LEU A CG  1 
ATOM   1224 C CD1 . LEU A 1 158 ? -12.494 45.877 59.476 1.00 39.03 ? 158  LEU A CD1 1 
ATOM   1225 C CD2 . LEU A 1 158 ? -10.519 44.264 59.956 1.00 40.31 ? 158  LEU A CD2 1 
ATOM   1226 N N   . HIS A 1 159 ? -7.977  44.184 55.525 1.00 44.86 ? 159  HIS A N   1 
ATOM   1227 C CA  . HIS A 1 159 ? -7.628  43.665 54.187 1.00 46.33 ? 159  HIS A CA  1 
ATOM   1228 C C   . HIS A 1 159 ? -8.563  42.538 53.796 1.00 48.67 ? 159  HIS A C   1 
ATOM   1229 O O   . HIS A 1 159 ? -8.804  41.632 54.608 1.00 48.76 ? 159  HIS A O   1 
ATOM   1230 C CB  . HIS A 1 159 ? -6.211  43.157 54.166 1.00 44.35 ? 159  HIS A CB  1 
ATOM   1231 C CG  . HIS A 1 159 ? -5.742  42.750 52.809 1.00 44.85 ? 159  HIS A CG  1 
ATOM   1232 N ND1 . HIS A 1 159 ? -5.641  43.639 51.756 1.00 45.15 ? 159  HIS A ND1 1 
ATOM   1233 C CD2 . HIS A 1 159 ? -5.307  41.554 52.340 1.00 43.97 ? 159  HIS A CD2 1 
ATOM   1234 C CE1 . HIS A 1 159 ? -5.165  43.004 50.698 1.00 45.19 ? 159  HIS A CE1 1 
ATOM   1235 N NE2 . HIS A 1 159 ? -4.955  41.738 51.026 1.00 44.17 ? 159  HIS A NE2 1 
ATOM   1236 N N   . GLY A 1 160 ? -9.079  42.594 52.562 1.00 49.38 ? 160  GLY A N   1 
ATOM   1237 C CA  . GLY A 1 160 ? -10.019 41.578 52.102 1.00 49.44 ? 160  GLY A CA  1 
ATOM   1238 C C   . GLY A 1 160 ? -11.412 42.178 51.966 1.00 49.78 ? 160  GLY A C   1 
ATOM   1239 O O   . GLY A 1 160 ? -12.197 41.778 51.115 1.00 50.09 ? 160  GLY A O   1 
ATOM   1240 N N   . SER A 1 161 ? -11.721 43.156 52.813 1.00 50.47 ? 161  SER A N   1 
ATOM   1241 C CA  . SER A 1 161 ? -13.012 43.828 52.775 1.00 50.31 ? 161  SER A CA  1 
ATOM   1242 C C   . SER A 1 161 ? -12.921 44.986 51.797 1.00 51.03 ? 161  SER A C   1 
ATOM   1243 O O   . SER A 1 161 ? -11.857 45.584 51.641 1.00 51.96 ? 161  SER A O   1 
ATOM   1244 C CB  . SER A 1 161 ? -13.348 44.375 54.151 1.00 51.16 ? 161  SER A CB  1 
ATOM   1245 O OG  . SER A 1 161 ? -14.557 45.134 54.101 1.00 57.21 ? 161  SER A OG  1 
ATOM   1246 N N   . GLN A 1 162 ? -14.015 45.316 51.130 1.00 50.33 ? 162  GLN A N   1 
ATOM   1247 C CA  . GLN A 1 162 ? -13.970 46.427 50.207 1.00 51.70 ? 162  GLN A CA  1 
ATOM   1248 C C   . GLN A 1 162 ? -14.561 47.619 50.937 1.00 50.78 ? 162  GLN A C   1 
ATOM   1249 O O   . GLN A 1 162 ? -14.497 48.736 50.461 1.00 49.71 ? 162  GLN A O   1 
ATOM   1250 C CB  . GLN A 1 162 ? -14.767 46.136 48.921 1.00 55.81 ? 162  GLN A CB  1 
ATOM   1251 C CG  . GLN A 1 162 ? -14.158 45.076 47.967 1.00 60.11 ? 162  GLN A CG  1 
ATOM   1252 C CD  . GLN A 1 162 ? -12.704 45.378 47.576 1.00 64.32 ? 162  GLN A CD  1 
ATOM   1253 O OE1 . GLN A 1 162 ? -12.310 46.555 47.414 1.00 65.97 ? 162  GLN A OE1 1 
ATOM   1254 N NE2 . GLN A 1 162 ? -11.900 44.312 47.405 1.00 63.97 ? 162  GLN A NE2 1 
ATOM   1255 N N   . GLU A 1 163 ? -15.139 47.376 52.106 1.00 50.27 ? 163  GLU A N   1 
ATOM   1256 C CA  . GLU A 1 163 ? -15.726 48.466 52.871 1.00 49.79 ? 163  GLU A CA  1 
ATOM   1257 C C   . GLU A 1 163 ? -14.710 49.327 53.672 1.00 48.00 ? 163  GLU A C   1 
ATOM   1258 O O   . GLU A 1 163 ? -14.936 50.516 53.873 1.00 46.16 ? 163  GLU A O   1 
ATOM   1259 C CB  . GLU A 1 163 ? -16.828 47.912 53.787 1.00 53.58 ? 163  GLU A CB  1 
ATOM   1260 C CG  . GLU A 1 163 ? -18.055 47.355 52.999 1.00 56.68 ? 163  GLU A CG  1 
ATOM   1261 C CD  . GLU A 1 163 ? -18.636 48.385 52.017 1.00 59.92 ? 163  GLU A CD  1 
ATOM   1262 O OE1 . GLU A 1 163 ? -18.972 47.989 50.867 1.00 60.40 ? 163  GLU A OE1 1 
ATOM   1263 O OE2 . GLU A 1 163 ? -18.755 49.588 52.390 1.00 59.74 ? 163  GLU A OE2 1 
ATOM   1264 N N   . ALA A 1 164 ? -13.600 48.722 54.110 1.00 45.34 ? 164  ALA A N   1 
ATOM   1265 C CA  . ALA A 1 164 ? -12.543 49.426 54.861 1.00 43.13 ? 164  ALA A CA  1 
ATOM   1266 C C   . ALA A 1 164 ? -11.267 48.661 54.474 1.00 41.59 ? 164  ALA A C   1 
ATOM   1267 O O   . ALA A 1 164 ? -10.690 47.924 55.295 1.00 42.06 ? 164  ALA A O   1 
ATOM   1268 C CB  . ALA A 1 164 ? -12.805 49.339 56.393 1.00 41.20 ? 164  ALA A CB  1 
ATOM   1269 N N   . PRO A 1 165 ? -10.821 48.827 53.206 1.00 39.37 ? 165  PRO A N   1 
ATOM   1270 C CA  . PRO A 1 165 ? -9.636  48.162 52.649 1.00 37.84 ? 165  PRO A CA  1 
ATOM   1271 C C   . PRO A 1 165 ? -8.317  48.685 53.159 1.00 39.11 ? 165  PRO A C   1 
ATOM   1272 O O   . PRO A 1 165 ? -7.297  48.011 53.002 1.00 38.30 ? 165  PRO A O   1 
ATOM   1273 C CB  . PRO A 1 165 ? -9.776  48.388 51.145 1.00 36.62 ? 165  PRO A CB  1 
ATOM   1274 C CG  . PRO A 1 165 ? -10.389 49.793 51.085 1.00 37.53 ? 165  PRO A CG  1 
ATOM   1275 C CD  . PRO A 1 165 ? -11.353 49.855 52.282 1.00 37.53 ? 165  PRO A CD  1 
ATOM   1276 N N   . GLY A 1 166 ? -8.352  49.867 53.784 1.00 36.77 ? 166  GLY A N   1 
ATOM   1277 C CA  . GLY A 1 166 ? -7.115  50.481 54.240 1.00 37.02 ? 166  GLY A CA  1 
ATOM   1278 C C   . GLY A 1 166 ? -6.566  51.387 53.120 1.00 36.25 ? 166  GLY A C   1 
ATOM   1279 O O   . GLY A 1 166 ? -7.042  51.332 51.985 1.00 35.45 ? 166  GLY A O   1 
ATOM   1280 N N   . ASN A 1 167 ? -5.600  52.230 53.477 1.00 35.64 ? 167  ASN A N   1 
ATOM   1281 C CA  . ASN A 1 167 ? -4.951  53.168 52.603 1.00 34.65 ? 167  ASN A CA  1 
ATOM   1282 C C   . ASN A 1 167 ? -5.891  54.207 51.985 1.00 34.48 ? 167  ASN A C   1 
ATOM   1283 O O   . ASN A 1 167 ? -5.505  54.905 51.051 1.00 34.63 ? 167  ASN A O   1 
ATOM   1284 C CB  . ASN A 1 167 ? -4.212  52.402 51.484 1.00 35.05 ? 167  ASN A CB  1 
ATOM   1285 C CG  . ASN A 1 167 ? -3.037  51.608 52.022 1.00 36.58 ? 167  ASN A CG  1 
ATOM   1286 O OD1 . ASN A 1 167 ? -2.482  51.953 53.065 1.00 36.63 ? 167  ASN A OD1 1 
ATOM   1287 N ND2 . ASN A 1 167 ? -2.644  50.548 51.322 1.00 35.41 ? 167  ASN A ND2 1 
ATOM   1288 N N   . VAL A 1 168 ? -7.109  54.349 52.485 1.00 34.00 ? 168  VAL A N   1 
ATOM   1289 C CA  . VAL A 1 168 ? -7.970  55.283 51.784 1.00 33.36 ? 168  VAL A CA  1 
ATOM   1290 C C   . VAL A 1 168 ? -7.491  56.737 51.832 1.00 33.56 ? 168  VAL A C   1 
ATOM   1291 O O   . VAL A 1 168 ? -7.693  57.505 50.860 1.00 34.28 ? 168  VAL A O   1 
ATOM   1292 C CB  . VAL A 1 168 ? -9.489  55.078 52.186 1.00 32.82 ? 168  VAL A CB  1 
ATOM   1293 C CG1 . VAL A 1 168 ? -9.834  53.553 52.031 1.00 32.13 ? 168  VAL A CG1 1 
ATOM   1294 C CG2 . VAL A 1 168 ? -9.791  55.597 53.580 1.00 32.63 ? 168  VAL A CG2 1 
ATOM   1295 N N   . GLY A 1 169 ? -6.810  57.093 52.930 1.00 33.12 ? 169  GLY A N   1 
ATOM   1296 C CA  . GLY A 1 169 ? -6.241  58.420 53.062 1.00 31.18 ? 169  GLY A CA  1 
ATOM   1297 C C   . GLY A 1 169 ? -5.191  58.632 51.964 1.00 30.24 ? 169  GLY A C   1 
ATOM   1298 O O   . GLY A 1 169 ? -5.007  59.751 51.463 1.00 29.95 ? 169  GLY A O   1 
ATOM   1299 N N   . LEU A 1 170 ? -4.494  57.581 51.569 1.00 28.72 ? 170  LEU A N   1 
ATOM   1300 C CA  . LEU A 1 170 ? -3.514  57.784 50.491 1.00 30.64 ? 170  LEU A CA  1 
ATOM   1301 C C   . LEU A 1 170 ? -4.325  57.919 49.181 1.00 31.21 ? 170  LEU A C   1 
ATOM   1302 O O   . LEU A 1 170 ? -3.917  58.672 48.275 1.00 31.11 ? 170  LEU A O   1 
ATOM   1303 C CB  . LEU A 1 170 ? -2.508  56.629 50.363 1.00 27.77 ? 170  LEU A CB  1 
ATOM   1304 C CG  . LEU A 1 170 ? -1.434  56.522 51.473 1.00 28.45 ? 170  LEU A CG  1 
ATOM   1305 C CD1 . LEU A 1 170 ? -0.807  55.110 51.430 1.00 24.15 ? 170  LEU A CD1 1 
ATOM   1306 C CD2 . LEU A 1 170 ? -0.314  57.566 51.257 1.00 24.61 ? 170  LEU A CD2 1 
ATOM   1307 N N   . LEU A 1 171 ? -5.442  57.186 49.078 1.00 31.11 ? 171  LEU A N   1 
ATOM   1308 C CA  . LEU A 1 171 ? -6.289  57.292 47.879 1.00 32.57 ? 171  LEU A CA  1 
ATOM   1309 C C   . LEU A 1 171 ? -6.885  58.721 47.856 1.00 31.78 ? 171  LEU A C   1 
ATOM   1310 O O   . LEU A 1 171 ? -6.990  59.285 46.786 1.00 27.28 ? 171  LEU A O   1 
ATOM   1311 C CB  . LEU A 1 171 ? -7.379  56.202 47.850 1.00 33.58 ? 171  LEU A CB  1 
ATOM   1312 C CG  . LEU A 1 171 ? -6.822  54.777 47.595 1.00 36.16 ? 171  LEU A CG  1 
ATOM   1313 C CD1 . LEU A 1 171 ? -7.995  53.783 47.623 1.00 34.78 ? 171  LEU A CD1 1 
ATOM   1314 C CD2 . LEU A 1 171 ? -6.080  54.704 46.259 1.00 32.29 ? 171  LEU A CD2 1 
ATOM   1315 N N   . ASP A 1 172 ? -7.223  59.320 49.024 1.00 31.99 ? 172  ASP A N   1 
ATOM   1316 C CA  . ASP A 1 172 ? -7.679  60.727 48.996 1.00 31.65 ? 172  ASP A CA  1 
ATOM   1317 C C   . ASP A 1 172 ? -6.558  61.599 48.325 1.00 32.19 ? 172  ASP A C   1 
ATOM   1318 O O   . ASP A 1 172 ? -6.823  62.447 47.451 1.00 32.35 ? 172  ASP A O   1 
ATOM   1319 C CB  . ASP A 1 172 ? -7.940  61.287 50.423 1.00 31.70 ? 172  ASP A CB  1 
ATOM   1320 C CG  . ASP A 1 172 ? -9.057  60.538 51.185 1.00 33.90 ? 172  ASP A CG  1 
ATOM   1321 O OD1 . ASP A 1 172 ? -9.901  59.893 50.526 1.00 30.88 ? 172  ASP A OD1 1 
ATOM   1322 O OD2 . ASP A 1 172 ? -9.109  60.624 52.449 1.00 35.63 ? 172  ASP A OD2 1 
ATOM   1323 N N   . GLN A 1 173 ? -5.296  61.381 48.723 1.00 30.83 ? 173  GLN A N   1 
ATOM   1324 C CA  . GLN A 1 173 ? -4.205  62.188 48.196 1.00 30.42 ? 173  GLN A CA  1 
ATOM   1325 C C   . GLN A 1 173 ? -4.128  61.995 46.707 1.00 30.73 ? 173  GLN A C   1 
ATOM   1326 O O   . GLN A 1 173 ? -3.995  62.964 45.945 1.00 32.11 ? 173  GLN A O   1 
ATOM   1327 C CB  . GLN A 1 173 ? -2.861  61.818 48.855 1.00 29.73 ? 173  GLN A CB  1 
ATOM   1328 C CG  . GLN A 1 173 ? -2.774  62.087 50.363 1.00 28.08 ? 173  GLN A CG  1 
ATOM   1329 C CD  . GLN A 1 173 ? -1.461  61.565 50.962 1.00 31.08 ? 173  GLN A CD  1 
ATOM   1330 O OE1 . GLN A 1 173 ? -0.523  61.231 50.199 1.00 28.02 ? 173  GLN A OE1 1 
ATOM   1331 N NE2 . GLN A 1 173 ? -1.374  61.499 52.333 1.00 28.35 ? 173  GLN A NE2 1 
ATOM   1332 N N   . ARG A 1 174 ? -4.233  60.744 46.289 1.00 30.53 ? 174  ARG A N   1 
ATOM   1333 C CA  . ARG A 1 174 ? -4.149  60.434 44.877 1.00 32.48 ? 174  ARG A CA  1 
ATOM   1334 C C   . ARG A 1 174 ? -5.274  61.123 44.064 1.00 33.28 ? 174  ARG A C   1 
ATOM   1335 O O   . ARG A 1 174 ? -5.022  61.623 42.953 1.00 29.86 ? 174  ARG A O   1 
ATOM   1336 C CB  . ARG A 1 174 ? -4.212  58.911 44.627 1.00 32.08 ? 174  ARG A CB  1 
ATOM   1337 C CG  . ARG A 1 174 ? -4.120  58.574 43.100 1.00 33.12 ? 174  ARG A CG  1 
ATOM   1338 C CD  . ARG A 1 174 ? -4.201  57.072 42.768 1.00 34.91 ? 174  ARG A CD  1 
ATOM   1339 N NE  . ARG A 1 174 ? -3.079  56.298 43.296 1.00 32.76 ? 174  ARG A NE  1 
ATOM   1340 C CZ  . ARG A 1 174 ? -3.111  54.966 43.406 1.00 35.93 ? 174  ARG A CZ  1 
ATOM   1341 N NH1 . ARG A 1 174 ? -4.198  54.293 43.033 1.00 34.44 ? 174  ARG A NH1 1 
ATOM   1342 N NH2 . ARG A 1 174 ? -2.049  54.282 43.817 1.00 33.74 ? 174  ARG A NH2 1 
ATOM   1343 N N   . MET A 1 175 ? -6.499  61.108 44.621 1.00 33.48 ? 175  MET A N   1 
ATOM   1344 C CA  . MET A 1 175 ? -7.624  61.742 43.949 1.00 36.01 ? 175  MET A CA  1 
ATOM   1345 C C   . MET A 1 175 ? -7.388  63.255 43.786 1.00 34.70 ? 175  MET A C   1 
ATOM   1346 O O   . MET A 1 175 ? -7.632  63.799 42.732 1.00 34.46 ? 175  MET A O   1 
ATOM   1347 C CB  . MET A 1 175 ? -8.923  61.494 44.683 1.00 36.39 ? 175  MET A CB  1 
ATOM   1348 C CG  . MET A 1 175 ? -10.105 61.850 43.754 1.00 40.74 ? 175  MET A CG  1 
ATOM   1349 S SD  . MET A 1 175 ? -11.494 60.807 44.055 1.00 45.59 ? 175  MET A SD  1 
ATOM   1350 C CE  . MET A 1 175 ? -12.034 61.577 45.200 1.00 37.17 ? 175  MET A CE  1 
ATOM   1351 N N   . ALA A 1 176 ? -6.898  63.928 44.820 1.00 34.33 ? 176  ALA A N   1 
ATOM   1352 C CA  . ALA A 1 176 ? -6.591  65.372 44.694 1.00 31.76 ? 176  ALA A CA  1 
ATOM   1353 C C   . ALA A 1 176 ? -5.506  65.560 43.582 1.00 31.74 ? 176  ALA A C   1 
ATOM   1354 O O   . ALA A 1 176 ? -5.537  66.526 42.795 1.00 29.91 ? 176  ALA A O   1 
ATOM   1355 C CB  . ALA A 1 176 ? -6.087  65.920 46.058 1.00 29.12 ? 176  ALA A CB  1 
ATOM   1356 N N   . LEU A 1 177 ? -4.558  64.621 43.489 1.00 30.98 ? 177  LEU A N   1 
ATOM   1357 C CA  . LEU A 1 177 ? -3.516  64.758 42.465 1.00 31.69 ? 177  LEU A CA  1 
ATOM   1358 C C   . LEU A 1 177 ? -4.142  64.531 41.078 1.00 31.71 ? 177  LEU A C   1 
ATOM   1359 O O   . LEU A 1 177 ? -3.717  65.124 40.076 1.00 29.54 ? 177  LEU A O   1 
ATOM   1360 C CB  . LEU A 1 177 ? -2.350  63.756 42.672 1.00 29.46 ? 177  LEU A CB  1 
ATOM   1361 C CG  . LEU A 1 177 ? -1.498  63.957 43.916 1.00 32.25 ? 177  LEU A CG  1 
ATOM   1362 C CD1 . LEU A 1 177 ? -0.494  62.830 43.943 1.00 32.00 ? 177  LEU A CD1 1 
ATOM   1363 C CD2 . LEU A 1 177 ? -0.755  65.378 43.945 1.00 29.65 ? 177  LEU A CD2 1 
ATOM   1364 N N   . GLN A 1 178 ? -5.150  63.667 41.032 1.00 32.56 ? 178  GLN A N   1 
ATOM   1365 C CA  . GLN A 1 178 ? -5.836  63.377 39.766 1.00 32.00 ? 178  GLN A CA  1 
ATOM   1366 C C   . GLN A 1 178 ? -6.542  64.671 39.408 1.00 31.16 ? 178  GLN A C   1 
ATOM   1367 O O   . GLN A 1 178 ? -6.505  65.106 38.267 1.00 31.84 ? 178  GLN A O   1 
ATOM   1368 C CB  . GLN A 1 178 ? -6.866  62.211 39.906 1.00 33.16 ? 178  GLN A CB  1 
ATOM   1369 C CG  . GLN A 1 178 ? -7.587  61.810 38.548 1.00 37.45 ? 178  GLN A CG  1 
ATOM   1370 C CD  . GLN A 1 178 ? -6.574  61.275 37.539 1.00 38.03 ? 178  GLN A CD  1 
ATOM   1371 O OE1 . GLN A 1 178 ? -5.889  60.322 37.821 1.00 41.80 ? 178  GLN A OE1 1 
ATOM   1372 N NE2 . GLN A 1 178 ? -6.458  61.904 36.396 1.00 41.53 ? 178  GLN A NE2 1 
ATOM   1373 N N   . TRP A 1 179 ? -7.144  65.309 40.393 1.00 29.69 ? 179  TRP A N   1 
ATOM   1374 C CA  . TRP A 1 179 ? -7.846  66.566 40.115 1.00 31.98 ? 179  TRP A CA  1 
ATOM   1375 C C   . TRP A 1 179 ? -6.872  67.647 39.633 1.00 32.85 ? 179  TRP A C   1 
ATOM   1376 O O   . TRP A 1 179 ? -7.194  68.365 38.670 1.00 34.24 ? 179  TRP A O   1 
ATOM   1377 C CB  . TRP A 1 179 ? -8.594  67.065 41.343 1.00 30.53 ? 179  TRP A CB  1 
ATOM   1378 C CG  . TRP A 1 179 ? -9.653  68.033 41.043 1.00 32.46 ? 179  TRP A CG  1 
ATOM   1379 C CD1 . TRP A 1 179 ? -10.978 67.756 40.791 1.00 31.74 ? 179  TRP A CD1 1 
ATOM   1380 C CD2 . TRP A 1 179 ? -9.511  69.463 40.962 1.00 30.98 ? 179  TRP A CD2 1 
ATOM   1381 N NE1 . TRP A 1 179 ? -11.647 68.927 40.558 1.00 33.09 ? 179  TRP A NE1 1 
ATOM   1382 C CE2 . TRP A 1 179 ? -10.775 69.986 40.661 1.00 31.37 ? 179  TRP A CE2 1 
ATOM   1383 C CE3 . TRP A 1 179 ? -8.433  70.344 41.124 1.00 29.67 ? 179  TRP A CE3 1 
ATOM   1384 C CZ2 . TRP A 1 179 ? -11.003 71.363 40.517 1.00 30.08 ? 179  TRP A CZ2 1 
ATOM   1385 C CZ3 . TRP A 1 179 ? -8.661  71.713 40.983 1.00 31.47 ? 179  TRP A CZ3 1 
ATOM   1386 C CH2 . TRP A 1 179 ? -9.939  72.205 40.681 1.00 30.99 ? 179  TRP A CH2 1 
ATOM   1387 N N   . VAL A 1 180 ? -5.699  67.763 40.264 1.00 32.70 ? 180  VAL A N   1 
ATOM   1388 C CA  . VAL A 1 180 ? -4.694  68.772 39.838 1.00 33.70 ? 180  VAL A CA  1 
ATOM   1389 C C   . VAL A 1 180 ? -4.242  68.469 38.379 1.00 34.13 ? 180  VAL A C   1 
ATOM   1390 O O   . VAL A 1 180 ? -4.211  69.345 37.499 1.00 34.04 ? 180  VAL A O   1 
ATOM   1391 C CB  . VAL A 1 180 ? -3.480  68.745 40.825 1.00 34.35 ? 180  VAL A CB  1 
ATOM   1392 C CG1 . VAL A 1 180 ? -2.219  69.419 40.242 1.00 34.14 ? 180  VAL A CG1 1 
ATOM   1393 C CG2 . VAL A 1 180 ? -3.894  69.418 42.091 1.00 32.48 ? 180  VAL A CG2 1 
ATOM   1394 N N   . HIS A 1 181 ? -3.915  67.218 38.126 1.00 33.49 ? 181  HIS A N   1 
ATOM   1395 C CA  . HIS A 1 181 ? -3.519  66.814 36.784 1.00 34.55 ? 181  HIS A CA  1 
ATOM   1396 C C   . HIS A 1 181 ? -4.578  67.272 35.758 1.00 35.47 ? 181  HIS A C   1 
ATOM   1397 O O   . HIS A 1 181 ? -4.239  67.839 34.734 1.00 35.05 ? 181  HIS A O   1 
ATOM   1398 C CB  . HIS A 1 181 ? -3.407  65.284 36.726 1.00 33.87 ? 181  HIS A CB  1 
ATOM   1399 C CG  . HIS A 1 181 ? -3.110  64.735 35.362 1.00 36.67 ? 181  HIS A CG  1 
ATOM   1400 N ND1 . HIS A 1 181 ? -4.090  64.200 34.543 1.00 36.57 ? 181  HIS A ND1 1 
ATOM   1401 C CD2 . HIS A 1 181 ? -1.951  64.649 34.670 1.00 35.01 ? 181  HIS A CD2 1 
ATOM   1402 C CE1 . HIS A 1 181 ? -3.543  63.813 33.407 1.00 37.01 ? 181  HIS A CE1 1 
ATOM   1403 N NE2 . HIS A 1 181 ? -2.249  64.070 33.458 1.00 35.85 ? 181  HIS A NE2 1 
ATOM   1404 N N   . ASP A 1 182 ? -5.847  67.013 36.067 1.00 34.18 ? 182  ASP A N   1 
ATOM   1405 C CA  . ASP A 1 182 ? -6.948  67.307 35.189 1.00 34.55 ? 182  ASP A CA  1 
ATOM   1406 C C   . ASP A 1 182 ? -7.423  68.765 35.082 1.00 35.90 ? 182  ASP A C   1 
ATOM   1407 O O   . ASP A 1 182 ? -7.913  69.159 34.034 1.00 36.53 ? 182  ASP A O   1 
ATOM   1408 C CB  . ASP A 1 182 ? -8.157  66.446 35.563 1.00 34.58 ? 182  ASP A CB  1 
ATOM   1409 C CG  . ASP A 1 182 ? -7.949  64.968 35.263 1.00 36.14 ? 182  ASP A CG  1 
ATOM   1410 O OD1 . ASP A 1 182 ? -7.174  64.601 34.335 1.00 40.05 ? 182  ASP A OD1 1 
ATOM   1411 O OD2 . ASP A 1 182 ? -8.580  64.159 35.942 1.00 35.27 ? 182  ASP A OD2 1 
ATOM   1412 N N   . ASN A 1 183 ? -7.216  69.556 36.120 1.00 34.31 ? 183  ASN A N   1 
ATOM   1413 C CA  . ASN A 1 183 ? -7.733  70.900 36.141 1.00 36.29 ? 183  ASN A CA  1 
ATOM   1414 C C   . ASN A 1 183 ? -6.801  72.052 36.377 1.00 36.39 ? 183  ASN A C   1 
ATOM   1415 O O   . ASN A 1 183 ? -7.207  73.202 36.192 1.00 37.50 ? 183  ASN A O   1 
ATOM   1416 C CB  . ASN A 1 183 ? -8.823  70.987 37.222 1.00 34.65 ? 183  ASN A CB  1 
ATOM   1417 C CG  . ASN A 1 183 ? -10.015 70.154 36.888 1.00 36.18 ? 183  ASN A CG  1 
ATOM   1418 O OD1 . ASN A 1 183 ? -10.874 70.594 36.111 1.00 34.97 ? 183  ASN A OD1 1 
ATOM   1419 N ND2 . ASN A 1 183 ? -10.088 68.917 37.459 1.00 33.83 ? 183  ASN A ND2 1 
ATOM   1420 N N   . ILE A 1 184 ? -5.576  71.787 36.825 1.00 36.92 ? 184  ILE A N   1 
ATOM   1421 C CA  . ILE A 1 184 ? -4.689  72.900 37.138 1.00 35.14 ? 184  ILE A CA  1 
ATOM   1422 C C   . ILE A 1 184 ? -4.389  73.819 35.916 1.00 36.52 ? 184  ILE A C   1 
ATOM   1423 O O   . ILE A 1 184 ? -4.052  74.997 36.103 1.00 35.47 ? 184  ILE A O   1 
ATOM   1424 C CB  . ILE A 1 184 ? -3.398  72.378 37.837 1.00 34.57 ? 184  ILE A CB  1 
ATOM   1425 C CG1 . ILE A 1 184 ? -2.841  73.467 38.768 1.00 32.73 ? 184  ILE A CG1 1 
ATOM   1426 C CG2 . ILE A 1 184 ? -2.387  71.854 36.812 1.00 32.16 ? 184  ILE A CG2 1 
ATOM   1427 C CD1 . ILE A 1 184 ? -3.815  73.779 39.994 1.00 31.69 ? 184  ILE A CD1 1 
ATOM   1428 N N   . GLN A 1 185 ? -4.521  73.296 34.679 1.00 35.32 ? 185  GLN A N   1 
ATOM   1429 C CA  . GLN A 1 185 ? -4.263  74.131 33.494 1.00 35.16 ? 185  GLN A CA  1 
ATOM   1430 C C   . GLN A 1 185 ? -5.174  75.375 33.517 1.00 35.14 ? 185  GLN A C   1 
ATOM   1431 O O   . GLN A 1 185 ? -4.741  76.447 33.114 1.00 34.06 ? 185  GLN A O   1 
ATOM   1432 C CB  . GLN A 1 185 ? -4.495  73.368 32.170 1.00 34.02 ? 185  GLN A CB  1 
ATOM   1433 C CG  . GLN A 1 185 ? -5.941  72.995 31.931 1.00 35.36 ? 185  GLN A CG  1 
ATOM   1434 C CD  . GLN A 1 185 ? -6.135  71.838 30.899 1.00 38.09 ? 185  GLN A CD  1 
ATOM   1435 O OE1 . GLN A 1 185 ? -6.130  70.640 31.265 1.00 37.68 ? 185  GLN A OE1 1 
ATOM   1436 N NE2 . GLN A 1 185 ? -6.305  72.196 29.621 1.00 33.99 ? 185  GLN A NE2 1 
ATOM   1437 N N   . PHE A 1 186 ? -6.396  75.245 34.030 1.00 34.51 ? 186  PHE A N   1 
ATOM   1438 C CA  . PHE A 1 186 ? -7.325  76.398 34.034 1.00 36.16 ? 186  PHE A CA  1 
ATOM   1439 C C   . PHE A 1 186 ? -6.913  77.504 35.001 1.00 37.99 ? 186  PHE A C   1 
ATOM   1440 O O   . PHE A 1 186 ? -7.334  78.660 34.862 1.00 38.08 ? 186  PHE A O   1 
ATOM   1441 C CB  . PHE A 1 186 ? -8.750  75.892 34.319 1.00 33.83 ? 186  PHE A CB  1 
ATOM   1442 C CG  . PHE A 1 186 ? -9.175  74.794 33.358 1.00 35.35 ? 186  PHE A CG  1 
ATOM   1443 C CD1 . PHE A 1 186 ? -9.231  75.047 31.979 1.00 33.98 ? 186  PHE A CD1 1 
ATOM   1444 C CD2 . PHE A 1 186 ? -9.398  73.493 33.805 1.00 32.70 ? 186  PHE A CD2 1 
ATOM   1445 C CE1 . PHE A 1 186 ? -9.504  74.000 31.042 1.00 36.90 ? 186  PHE A CE1 1 
ATOM   1446 C CE2 . PHE A 1 186 ? -9.662  72.442 32.914 1.00 36.26 ? 186  PHE A CE2 1 
ATOM   1447 C CZ  . PHE A 1 186 ? -9.720  72.679 31.505 1.00 35.33 ? 186  PHE A CZ  1 
ATOM   1448 N N   . PHE A 1 187 ? -6.033  77.159 35.945 1.00 37.21 ? 187  PHE A N   1 
ATOM   1449 C CA  . PHE A 1 187 ? -5.577  78.110 36.938 1.00 35.68 ? 187  PHE A CA  1 
ATOM   1450 C C   . PHE A 1 187 ? -4.243  78.632 36.520 1.00 35.94 ? 187  PHE A C   1 
ATOM   1451 O O   . PHE A 1 187 ? -3.593  79.359 37.268 1.00 36.02 ? 187  PHE A O   1 
ATOM   1452 C CB  . PHE A 1 187 ? -5.461  77.441 38.304 1.00 33.74 ? 187  PHE A CB  1 
ATOM   1453 C CG  . PHE A 1 187 ? -6.773  76.990 38.869 1.00 33.23 ? 187  PHE A CG  1 
ATOM   1454 C CD1 . PHE A 1 187 ? -7.293  75.731 38.550 1.00 31.24 ? 187  PHE A CD1 1 
ATOM   1455 C CD2 . PHE A 1 187 ? -7.502  77.832 39.742 1.00 31.36 ? 187  PHE A CD2 1 
ATOM   1456 C CE1 . PHE A 1 187 ? -8.504  75.313 39.089 1.00 27.66 ? 187  PHE A CE1 1 
ATOM   1457 C CE2 . PHE A 1 187 ? -8.707  77.421 40.277 1.00 29.85 ? 187  PHE A CE2 1 
ATOM   1458 C CZ  . PHE A 1 187 ? -9.220  76.148 39.948 1.00 28.49 ? 187  PHE A CZ  1 
ATOM   1459 N N   . GLY A 1 188 ? -3.837  78.266 35.311 1.00 35.98 ? 188  GLY A N   1 
ATOM   1460 C CA  . GLY A 1 188 ? -2.534  78.700 34.835 1.00 36.75 ? 188  GLY A CA  1 
ATOM   1461 C C   . GLY A 1 188 ? -1.370  77.766 35.183 1.00 37.21 ? 188  GLY A C   1 
ATOM   1462 O O   . GLY A 1 188 ? -0.191  78.109 34.937 1.00 37.90 ? 188  GLY A O   1 
ATOM   1463 N N   . GLY A 1 189 ? -1.683  76.588 35.740 1.00 36.14 ? 189  GLY A N   1 
ATOM   1464 C CA  . GLY A 1 189 ? -0.653  75.627 36.118 1.00 35.33 ? 189  GLY A CA  1 
ATOM   1465 C C   . GLY A 1 189 ? -0.298  74.675 34.980 1.00 36.64 ? 189  GLY A C   1 
ATOM   1466 O O   . GLY A 1 189 ? -1.120  74.401 34.119 1.00 36.72 ? 189  GLY A O   1 
ATOM   1467 N N   . ASP A 1 190 ? 0.940   74.206 34.942 1.00 35.44 ? 190  ASP A N   1 
ATOM   1468 C CA  . ASP A 1 190 ? 1.348   73.266 33.916 1.00 36.68 ? 190  ASP A CA  1 
ATOM   1469 C C   . ASP A 1 190 ? 1.211   71.805 34.466 1.00 35.52 ? 190  ASP A C   1 
ATOM   1470 O O   . ASP A 1 190 ? 2.015   71.362 35.258 1.00 37.13 ? 190  ASP A O   1 
ATOM   1471 C CB  . ASP A 1 190 ? 2.782   73.596 33.467 1.00 36.35 ? 190  ASP A CB  1 
ATOM   1472 C CG  . ASP A 1 190 ? 3.335   72.599 32.461 1.00 38.13 ? 190  ASP A CG  1 
ATOM   1473 O OD1 . ASP A 1 190 ? 2.544   71.828 31.892 1.00 38.90 ? 190  ASP A OD1 1 
ATOM   1474 O OD2 . ASP A 1 190 ? 4.566   72.595 32.230 1.00 37.42 ? 190  ASP A OD2 1 
ATOM   1475 N N   . PRO A 1 191 ? 0.195   71.055 34.023 1.00 34.18 ? 191  PRO A N   1 
ATOM   1476 C CA  . PRO A 1 191 ? 0.043   69.686 34.524 1.00 34.66 ? 191  PRO A CA  1 
ATOM   1477 C C   . PRO A 1 191 ? 1.240   68.773 34.238 1.00 35.87 ? 191  PRO A C   1 
ATOM   1478 O O   . PRO A 1 191 ? 1.377   67.711 34.845 1.00 36.36 ? 191  PRO A O   1 
ATOM   1479 C CB  . PRO A 1 191 ? -1.271  69.202 33.871 1.00 34.29 ? 191  PRO A CB  1 
ATOM   1480 C CG  . PRO A 1 191 ? -1.309  69.987 32.527 1.00 34.24 ? 191  PRO A CG  1 
ATOM   1481 C CD  . PRO A 1 191 ? -0.793  71.376 32.968 1.00 33.93 ? 191  PRO A CD  1 
ATOM   1482 N N   . LYS A 1 192 ? 2.139   69.176 33.350 1.00 36.39 ? 192  LYS A N   1 
ATOM   1483 C CA  . LYS A 1 192 ? 3.280   68.299 33.083 1.00 36.90 ? 192  LYS A CA  1 
ATOM   1484 C C   . LYS A 1 192 ? 4.478   68.662 33.964 1.00 36.16 ? 192  LYS A C   1 
ATOM   1485 O O   . LYS A 1 192 ? 5.539   68.012 33.933 1.00 35.15 ? 192  LYS A O   1 
ATOM   1486 C CB  . LYS A 1 192 ? 3.631   68.283 31.574 1.00 37.54 ? 192  LYS A CB  1 
ATOM   1487 C CG  . LYS A 1 192 ? 4.323   69.477 31.004 1.00 42.46 ? 192  LYS A CG  1 
ATOM   1488 C CD  . LYS A 1 192 ? 4.119   69.474 29.420 1.00 45.08 ? 192  LYS A CD  1 
ATOM   1489 C CE  . LYS A 1 192 ? 4.488   70.805 28.775 1.00 45.59 ? 192  LYS A CE  1 
ATOM   1490 N N   . THR A 1 193 ? 4.285   69.673 34.800 1.00 35.06 ? 193  THR A N   1 
ATOM   1491 C CA  . THR A 1 193 ? 5.364   70.075 35.682 1.00 35.28 ? 193  THR A CA  1 
ATOM   1492 C C   . THR A 1 193 ? 4.914   70.203 37.141 1.00 34.04 ? 193  THR A C   1 
ATOM   1493 O O   . THR A 1 193 ? 5.115   71.271 37.775 1.00 33.79 ? 193  THR A O   1 
ATOM   1494 C CB  . THR A 1 193 ? 6.007   71.413 35.185 1.00 36.08 ? 193  THR A CB  1 
ATOM   1495 O OG1 . THR A 1 193 ? 6.261   71.286 33.781 1.00 36.46 ? 193  THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 193 ? 7.343   71.697 35.884 1.00 32.00 ? 193  THR A CG2 1 
ATOM   1497 N N   . VAL A 1 194 ? 4.287   69.150 37.672 1.00 31.91 ? 194  VAL A N   1 
ATOM   1498 C CA  . VAL A 1 194 ? 3.916   69.246 39.066 1.00 32.49 ? 194  VAL A CA  1 
ATOM   1499 C C   . VAL A 1 194 ? 4.834   68.506 40.020 1.00 33.69 ? 194  VAL A C   1 
ATOM   1500 O O   . VAL A 1 194 ? 5.218   67.353 39.795 1.00 34.88 ? 194  VAL A O   1 
ATOM   1501 C CB  . VAL A 1 194 ? 2.368   68.941 39.356 1.00 33.84 ? 194  VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 194 ? 1.608   68.675 38.100 1.00 31.97 ? 194  VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 194 ? 2.168   67.935 40.418 1.00 32.24 ? 194  VAL A CG2 1 
ATOM   1504 N N   . THR A 1 195 ? 5.249   69.234 41.057 1.00 34.04 ? 195  THR A N   1 
ATOM   1505 C CA  . THR A 1 195 ? 6.091   68.683 42.102 1.00 33.50 ? 195  THR A CA  1 
ATOM   1506 C C   . THR A 1 195 ? 5.243   68.458 43.323 1.00 32.32 ? 195  THR A C   1 
ATOM   1507 O O   . THR A 1 195 ? 4.577   69.402 43.776 1.00 32.93 ? 195  THR A O   1 
ATOM   1508 C CB  . THR A 1 195 ? 7.246   69.636 42.523 1.00 32.04 ? 195  THR A CB  1 
ATOM   1509 O OG1 . THR A 1 195 ? 8.142   69.801 41.427 1.00 35.48 ? 195  THR A OG1 1 
ATOM   1510 C CG2 . THR A 1 195 ? 8.075   69.007 43.687 1.00 32.34 ? 195  THR A CG2 1 
ATOM   1511 N N   . ILE A 1 196 ? 5.206   67.222 43.839 1.00 31.52 ? 196  ILE A N   1 
ATOM   1512 C CA  . ILE A 1 196 ? 4.501   66.986 45.116 1.00 29.70 ? 196  ILE A CA  1 
ATOM   1513 C C   . ILE A 1 196 ? 5.583   67.128 46.219 1.00 29.77 ? 196  ILE A C   1 
ATOM   1514 O O   . ILE A 1 196 ? 6.742   66.725 46.042 1.00 28.97 ? 196  ILE A O   1 
ATOM   1515 C CB  . ILE A 1 196 ? 3.839   65.579 45.201 1.00 31.27 ? 196  ILE A CB  1 
ATOM   1516 C CG1 . ILE A 1 196 ? 4.870   64.462 45.016 1.00 28.22 ? 196  ILE A CG1 1 
ATOM   1517 C CG2 . ILE A 1 196 ? 2.722   65.462 44.128 1.00 30.69 ? 196  ILE A CG2 1 
ATOM   1518 C CD1 . ILE A 1 196 ? 4.228   63.063 45.157 1.00 31.13 ? 196  ILE A CD1 1 
ATOM   1519 N N   . PHE A 1 197 ? 5.245   67.774 47.326 1.00 31.48 ? 197  PHE A N   1 
ATOM   1520 C CA  . PHE A 1 197 ? 6.207   67.934 48.411 1.00 30.07 ? 197  PHE A CA  1 
ATOM   1521 C C   . PHE A 1 197 ? 5.499   67.845 49.729 1.00 30.98 ? 197  PHE A C   1 
ATOM   1522 O O   . PHE A 1 197 ? 4.333   68.195 49.823 1.00 32.24 ? 197  PHE A O   1 
ATOM   1523 C CB  . PHE A 1 197 ? 7.052   69.210 48.255 1.00 29.40 ? 197  PHE A CB  1 
ATOM   1524 C CG  . PHE A 1 197 ? 6.357   70.531 48.575 1.00 30.83 ? 197  PHE A CG  1 
ATOM   1525 C CD1 . PHE A 1 197 ? 5.176   70.920 47.947 1.00 31.33 ? 197  PHE A CD1 1 
ATOM   1526 C CD2 . PHE A 1 197 ? 7.000   71.465 49.410 1.00 30.79 ? 197  PHE A CD2 1 
ATOM   1527 C CE1 . PHE A 1 197 ? 4.652   72.222 48.145 1.00 31.52 ? 197  PHE A CE1 1 
ATOM   1528 C CE2 . PHE A 1 197 ? 6.494   72.774 49.623 1.00 30.05 ? 197  PHE A CE2 1 
ATOM   1529 C CZ  . PHE A 1 197 ? 5.330   73.159 49.000 1.00 29.67 ? 197  PHE A CZ  1 
ATOM   1530 N N   . GLY A 1 198 ? 6.158   67.306 50.743 1.00 30.97 ? 198  GLY A N   1 
ATOM   1531 C CA  . GLY A 1 198 ? 5.484   67.142 52.030 1.00 30.52 ? 198  GLY A CA  1 
ATOM   1532 C C   . GLY A 1 198 ? 6.466   66.891 53.160 1.00 29.35 ? 198  GLY A C   1 
ATOM   1533 O O   . GLY A 1 198 ? 7.622   66.603 52.902 1.00 28.82 ? 198  GLY A O   1 
ATOM   1534 N N   . GLU A 1 199 ? 6.012   67.068 54.402 1.00 29.29 ? 199  GLU A N   1 
ATOM   1535 C CA  . GLU A 1 199 ? 6.885   66.907 55.556 1.00 28.89 ? 199  GLU A CA  1 
ATOM   1536 C C   . GLU A 1 199 ? 6.383   65.847 56.512 1.00 28.57 ? 199  GLU A C   1 
ATOM   1537 O O   . GLU A 1 199 ? 5.176   65.752 56.752 1.00 27.49 ? 199  GLU A O   1 
ATOM   1538 C CB  . GLU A 1 199 ? 7.058   68.244 56.318 1.00 28.06 ? 199  GLU A CB  1 
ATOM   1539 C CG  . GLU A 1 199 ? 8.079   68.178 57.469 1.00 26.02 ? 199  GLU A CG  1 
ATOM   1540 C CD  . GLU A 1 199 ? 7.439   67.833 58.808 1.00 30.63 ? 199  GLU A CD  1 
ATOM   1541 O OE1 . GLU A 1 199 ? 6.191   67.765 58.846 1.00 29.63 ? 199  GLU A OE1 1 
ATOM   1542 O OE2 . GLU A 1 199 ? 8.180   67.635 59.829 1.00 31.03 ? 199  GLU A OE2 1 
ATOM   1543 N N   . SER A 1 200 ? 7.324   65.078 57.063 1.00 27.07 ? 200  SER A N   1 
ATOM   1544 C CA  . SER A 1 200 ? 7.032   64.017 58.016 1.00 28.16 ? 200  SER A CA  1 
ATOM   1545 C C   . SER A 1 200 ? 6.079   62.990 57.354 1.00 27.16 ? 200  SER A C   1 
ATOM   1546 O O   . SER A 1 200 ? 6.426   62.461 56.313 1.00 27.95 ? 200  SER A O   1 
ATOM   1547 C CB  . SER A 1 200 ? 6.440   64.623 59.270 1.00 28.81 ? 200  SER A CB  1 
ATOM   1548 O OG  . SER A 1 200 ? 6.457   63.677 60.327 1.00 33.94 ? 200  SER A OG  1 
ATOM   1549 N N   . ALA A 1 201 ? 4.919   62.677 57.924 1.00 25.21 ? 201  ALA A N   1 
ATOM   1550 C CA  . ALA A 1 201 ? 4.001   61.735 57.228 1.00 26.25 ? 201  ALA A CA  1 
ATOM   1551 C C   . ALA A 1 201 ? 3.696   62.215 55.770 1.00 26.84 ? 201  ALA A C   1 
ATOM   1552 O O   . ALA A 1 201 ? 3.374   61.407 54.887 1.00 25.64 ? 201  ALA A O   1 
ATOM   1553 C CB  . ALA A 1 201 ? 2.652   61.545 58.031 1.00 23.75 ? 201  ALA A CB  1 
ATOM   1554 N N   . GLY A 1 202 ? 3.777   63.530 55.540 1.00 26.93 ? 202  GLY A N   1 
ATOM   1555 C CA  . GLY A 1 202 ? 3.595   64.071 54.192 1.00 27.98 ? 202  GLY A CA  1 
ATOM   1556 C C   . GLY A 1 202 ? 4.767   63.715 53.275 1.00 29.55 ? 202  GLY A C   1 
ATOM   1557 O O   . GLY A 1 202 ? 4.580   63.495 52.057 1.00 30.33 ? 202  GLY A O   1 
ATOM   1558 N N   . GLY A 1 203 ? 5.977   63.656 53.852 1.00 28.62 ? 203  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 203 ? 7.173   63.297 53.106 1.00 27.32 ? 203  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 203 ? 7.142   61.781 52.877 1.00 28.37 ? 203  GLY A C   1 
ATOM   1561 O O   . GLY A 1 203 ? 7.517   61.284 51.813 1.00 30.41 ? 203  GLY A O   1 
ATOM   1562 N N   . ALA A 1 204 ? 6.684   61.027 53.865 1.00 28.98 ? 204  ALA A N   1 
ATOM   1563 C CA  . ALA A 1 204 ? 6.545   59.575 53.693 1.00 30.83 ? 204  ALA A CA  1 
ATOM   1564 C C   . ALA A 1 204 ? 5.489   59.338 52.552 1.00 31.20 ? 204  ALA A C   1 
ATOM   1565 O O   . ALA A 1 204 ? 5.693   58.470 51.661 1.00 31.54 ? 204  ALA A O   1 
ATOM   1566 C CB  . ALA A 1 204 ? 6.058   58.908 55.024 1.00 29.06 ? 204  ALA A CB  1 
ATOM   1567 N N   . SER A 1 205 ? 4.372   60.085 52.609 1.00 29.29 ? 205  SER A N   1 
ATOM   1568 C CA  . SER A 1 205 ? 3.321   59.983 51.574 1.00 30.14 ? 205  SER A CA  1 
ATOM   1569 C C   . SER A 1 205 ? 3.938   60.255 50.154 1.00 30.17 ? 205  SER A C   1 
ATOM   1570 O O   . SER A 1 205 ? 3.692   59.486 49.192 1.00 29.94 ? 205  SER A O   1 
ATOM   1571 C CB  . SER A 1 205 ? 2.185   61.008 51.820 1.00 30.49 ? 205  SER A CB  1 
ATOM   1572 O OG  . SER A 1 205 ? 1.417   60.744 52.970 1.00 29.43 ? 205  SER A OG  1 
ATOM   1573 N N   . VAL A 1 206 ? 4.720   61.343 50.024 1.00 27.97 ? 206  VAL A N   1 
ATOM   1574 C CA  . VAL A 1 206 ? 5.334   61.668 48.732 1.00 27.22 ? 206  VAL A CA  1 
ATOM   1575 C C   . VAL A 1 206 ? 6.105   60.424 48.276 1.00 28.37 ? 206  VAL A C   1 
ATOM   1576 O O   . VAL A 1 206 ? 5.932   59.956 47.143 1.00 30.31 ? 206  VAL A O   1 
ATOM   1577 C CB  . VAL A 1 206 ? 6.270   62.889 48.842 1.00 28.90 ? 206  VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 206 ? 7.207   62.990 47.585 1.00 28.15 ? 206  VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 206 ? 5.427   64.158 49.034 1.00 27.46 ? 206  VAL A CG2 1 
ATOM   1580 N N   . GLY A 1 207 ? 6.931   59.865 49.157 1.00 26.45 ? 207  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 207 ? 7.643   58.652 48.804 1.00 26.53 ? 207  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 207 ? 6.751   57.464 48.454 1.00 28.29 ? 207  GLY A C   1 
ATOM   1583 O O   . GLY A 1 207 ? 7.119   56.600 47.623 1.00 27.80 ? 207  GLY A O   1 
ATOM   1584 N N   . MET A 1 208 ? 5.572   57.413 49.071 1.00 29.29 ? 208  MET A N   1 
ATOM   1585 C CA  . MET A 1 208 ? 4.637   56.323 48.771 1.00 30.86 ? 208  MET A CA  1 
ATOM   1586 C C   . MET A 1 208 ? 4.032   56.477 47.341 1.00 31.89 ? 208  MET A C   1 
ATOM   1587 O O   . MET A 1 208 ? 3.783   55.475 46.666 1.00 32.71 ? 208  MET A O   1 
ATOM   1588 C CB  . MET A 1 208 ? 3.543   56.256 49.851 1.00 28.11 ? 208  MET A CB  1 
ATOM   1589 C CG  . MET A 1 208 ? 4.043   55.599 51.138 1.00 29.77 ? 208  MET A CG  1 
ATOM   1590 S SD  . MET A 1 208 ? 2.993   55.826 52.602 1.00 30.38 ? 208  MET A SD  1 
ATOM   1591 C CE  . MET A 1 208 ? 3.868   54.808 53.820 1.00 29.49 ? 208  MET A CE  1 
ATOM   1592 N N   . HIS A 1 209 ? 3.813   57.703 46.874 1.00 30.37 ? 209  HIS A N   1 
ATOM   1593 C CA  . HIS A 1 209 ? 3.263   57.898 45.533 1.00 30.63 ? 209  HIS A CA  1 
ATOM   1594 C C   . HIS A 1 209 ? 4.344   57.666 44.491 1.00 30.49 ? 209  HIS A C   1 
ATOM   1595 O O   . HIS A 1 209 ? 4.056   57.374 43.337 1.00 29.23 ? 209  HIS A O   1 
ATOM   1596 C CB  . HIS A 1 209 ? 2.704   59.307 45.371 1.00 30.23 ? 209  HIS A CB  1 
ATOM   1597 C CG  . HIS A 1 209 ? 1.517   59.559 46.236 1.00 31.90 ? 209  HIS A CG  1 
ATOM   1598 N ND1 . HIS A 1 209 ? 0.318   58.895 46.062 1.00 31.30 ? 209  HIS A ND1 1 
ATOM   1599 C CD2 . HIS A 1 209 ? 1.340   60.406 47.280 1.00 29.93 ? 209  HIS A CD2 1 
ATOM   1600 C CE1 . HIS A 1 209 ? -0.554  59.334 46.950 1.00 31.49 ? 209  HIS A CE1 1 
ATOM   1601 N NE2 . HIS A 1 209 ? 0.045   60.250 47.703 1.00 33.13 ? 209  HIS A NE2 1 
ATOM   1602 N N   . ILE A 1 210 ? 5.593   57.834 44.908 1.00 31.17 ? 210  ILE A N   1 
ATOM   1603 C CA  . ILE A 1 210 ? 6.710   57.565 44.016 1.00 30.64 ? 210  ILE A CA  1 
ATOM   1604 C C   . ILE A 1 210 ? 6.769   56.010 43.845 1.00 31.74 ? 210  ILE A C   1 
ATOM   1605 O O   . ILE A 1 210 ? 7.086   55.531 42.773 1.00 31.42 ? 210  ILE A O   1 
ATOM   1606 C CB  . ILE A 1 210 ? 8.007   58.032 44.654 1.00 31.43 ? 210  ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 210 ? 8.200   59.525 44.445 1.00 30.53 ? 210  ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 210 ? 9.192   57.214 44.091 1.00 31.95 ? 210  ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 210 ? 9.341   60.029 45.278 1.00 28.94 ? 210  ILE A CD1 1 
ATOM   1610 N N   . LEU A 1 211 ? 6.456   55.249 44.902 1.00 29.75 ? 211  LEU A N   1 
ATOM   1611 C CA  . LEU A 1 211 ? 6.493   53.786 44.811 1.00 32.31 ? 211  LEU A CA  1 
ATOM   1612 C C   . LEU A 1 211 ? 5.247   53.176 44.143 1.00 32.30 ? 211  LEU A C   1 
ATOM   1613 O O   . LEU A 1 211 ? 5.344   52.308 43.277 1.00 33.31 ? 211  LEU A O   1 
ATOM   1614 C CB  . LEU A 1 211 ? 6.660   53.148 46.196 1.00 31.06 ? 211  LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 211 ? 8.029   53.361 46.875 1.00 35.74 ? 211  LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 211 ? 7.880   53.203 48.392 1.00 36.19 ? 211  LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 211 ? 9.008   52.356 46.389 1.00 37.98 ? 211  LEU A CD2 1 
ATOM   1618 N N   . SER A 1 212 ? 4.089   53.656 44.524 1.00 31.77 ? 212  SER A N   1 
ATOM   1619 C CA  . SER A 1 212 ? 2.832   53.122 44.017 1.00 33.83 ? 212  SER A CA  1 
ATOM   1620 C C   . SER A 1 212 ? 2.609   53.325 42.525 1.00 33.67 ? 212  SER A C   1 
ATOM   1621 O O   . SER A 1 212 ? 2.485   54.471 42.069 1.00 34.22 ? 212  SER A O   1 
ATOM   1622 C CB  . SER A 1 212 ? 1.664   53.737 44.772 1.00 33.26 ? 212  SER A CB  1 
ATOM   1623 O OG  . SER A 1 212 ? 0.476   53.056 44.449 1.00 36.46 ? 212  SER A OG  1 
ATOM   1624 N N   . PRO A 1 213 ? 2.554   52.217 41.754 1.00 33.51 ? 213  PRO A N   1 
ATOM   1625 C CA  . PRO A 1 213 ? 2.339   52.228 40.293 1.00 34.37 ? 213  PRO A CA  1 
ATOM   1626 C C   . PRO A 1 213 ? 1.140   53.123 39.953 1.00 33.25 ? 213  PRO A C   1 
ATOM   1627 O O   . PRO A 1 213 ? 1.193   53.912 39.035 1.00 32.99 ? 213  PRO A O   1 
ATOM   1628 C CB  . PRO A 1 213 ? 2.044   50.759 39.951 1.00 33.83 ? 213  PRO A CB  1 
ATOM   1629 C CG  . PRO A 1 213 ? 2.853   50.025 41.033 1.00 37.13 ? 213  PRO A CG  1 
ATOM   1630 C CD  . PRO A 1 213 ? 2.623   50.845 42.282 1.00 33.55 ? 213  PRO A CD  1 
ATOM   1631 N N   . GLY A 1 214 ? 0.083   53.021 40.746 1.00 33.98 ? 214  GLY A N   1 
ATOM   1632 C CA  . GLY A 1 214 ? -1.117  53.813 40.474 1.00 33.74 ? 214  GLY A CA  1 
ATOM   1633 C C   . GLY A 1 214 ? -1.008  55.314 40.677 1.00 35.12 ? 214  GLY A C   1 
ATOM   1634 O O   . GLY A 1 214 ? -1.911  56.029 40.285 1.00 35.43 ? 214  GLY A O   1 
ATOM   1635 N N   . SER A 1 215 ? 0.064   55.822 41.282 1.00 34.28 ? 215  SER A N   1 
ATOM   1636 C CA  . SER A 1 215 ? 0.158   57.271 41.501 1.00 33.85 ? 215  SER A CA  1 
ATOM   1637 C C   . SER A 1 215 ? 1.227   57.917 40.648 1.00 34.49 ? 215  SER A C   1 
ATOM   1638 O O   . SER A 1 215 ? 1.162   59.116 40.387 1.00 34.70 ? 215  SER A O   1 
ATOM   1639 C CB  . SER A 1 215 ? 0.510   57.609 42.977 1.00 33.17 ? 215  SER A CB  1 
ATOM   1640 O OG  . SER A 1 215 ? -0.532  57.294 43.859 1.00 33.10 ? 215  SER A OG  1 
ATOM   1641 N N   . ARG A 1 216 ? 2.200   57.117 40.216 1.00 35.24 ? 216  ARG A N   1 
ATOM   1642 C CA  . ARG A 1 216 ? 3.345   57.618 39.481 1.00 37.08 ? 216  ARG A CA  1 
ATOM   1643 C C   . ARG A 1 216 ? 3.143   58.562 38.325 1.00 37.67 ? 216  ARG A C   1 
ATOM   1644 O O   . ARG A 1 216 ? 3.971   59.468 38.114 1.00 39.18 ? 216  ARG A O   1 
ATOM   1645 C CB  . ARG A 1 216 ? 4.200   56.472 38.930 1.00 38.59 ? 216  ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 216 ? 4.668   55.475 39.937 1.00 39.99 ? 216  ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 216 ? 5.582   54.450 39.285 1.00 38.10 ? 216  ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 216 ? 5.807   53.363 40.227 1.00 36.16 ? 216  ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 216 ? 6.321   52.187 39.899 1.00 37.07 ? 216  ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 216 ? 6.464   51.251 40.840 1.00 34.23 ? 216  ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 216 ? 6.719   51.960 38.637 1.00 35.77 ? 216  ARG A NH2 1 
ATOM   1652 N N   . ASP A 1 217 ? 2.096   58.348 37.546 1.00 35.96 ? 217  ASP A N   1 
ATOM   1653 C CA  . ASP A 1 217 ? 1.943   59.180 36.365 1.00 36.53 ? 217  ASP A CA  1 
ATOM   1654 C C   . ASP A 1 217 ? 1.302   60.522 36.653 1.00 36.31 ? 217  ASP A C   1 
ATOM   1655 O O   . ASP A 1 217 ? 1.286   61.357 35.790 1.00 36.33 ? 217  ASP A O   1 
ATOM   1656 C CB  . ASP A 1 217 ? 1.161   58.426 35.267 1.00 36.27 ? 217  ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 217 ? 1.796   57.047 34.907 1.00 38.97 ? 217  ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 217 ? 2.931   56.731 35.319 1.00 38.41 ? 217  ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 217 ? 1.155   56.262 34.188 1.00 43.05 ? 217  ASP A OD2 1 
ATOM   1660 N N   . LEU A 1 218 ? 0.808   60.730 37.876 1.00 36.11 ? 218  LEU A N   1 
ATOM   1661 C CA  . LEU A 1 218 ? 0.135   61.968 38.220 1.00 35.08 ? 218  LEU A CA  1 
ATOM   1662 C C   . LEU A 1 218 ? 1.021   63.131 38.655 1.00 36.32 ? 218  LEU A C   1 
ATOM   1663 O O   . LEU A 1 218 ? 0.486   64.167 39.032 1.00 38.18 ? 218  LEU A O   1 
ATOM   1664 C CB  . LEU A 1 218 ? -0.905  61.726 39.312 1.00 34.02 ? 218  LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 218 ? -1.921  60.662 38.936 1.00 36.00 ? 218  LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 218 ? -2.803  60.386 40.126 1.00 37.17 ? 218  LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 218 ? -2.722  61.106 37.746 1.00 35.58 ? 218  LEU A CD2 1 
ATOM   1668 N N   . PHE A 1 219 ? 2.351   62.986 38.642 1.00 35.05 ? 219  PHE A N   1 
ATOM   1669 C CA  . PHE A 1 219 ? 3.202   64.115 39.032 1.00 32.30 ? 219  PHE A CA  1 
ATOM   1670 C C   . PHE A 1 219 ? 4.580   63.993 38.373 1.00 33.09 ? 219  PHE A C   1 
ATOM   1671 O O   . PHE A 1 219 ? 4.971   62.914 37.885 1.00 32.01 ? 219  PHE A O   1 
ATOM   1672 C CB  . PHE A 1 219 ? 3.326   64.236 40.582 1.00 31.09 ? 219  PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 219 ? 4.001   63.073 41.235 1.00 28.07 ? 219  PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 219 ? 3.284   61.882 41.496 1.00 27.76 ? 219  PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 219 ? 5.390   63.114 41.494 1.00 26.34 ? 219  PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 219 ? 3.963   60.697 42.023 1.00 28.25 ? 219  PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 219 ? 6.074   61.974 42.009 1.00 29.33 ? 219  PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 219 ? 5.350   60.746 42.279 1.00 26.02 ? 219  PHE A CZ  1 
ATOM   1679 N N   . ARG A 1 220 ? 5.338   65.082 38.384 1.00 31.76 ? 220  ARG A N   1 
ATOM   1680 C CA  . ARG A 1 220 ? 6.624   65.051 37.727 1.00 33.97 ? 220  ARG A CA  1 
ATOM   1681 C C   . ARG A 1 220 ? 7.849   64.728 38.604 1.00 34.49 ? 220  ARG A C   1 
ATOM   1682 O O   . ARG A 1 220 ? 8.633   63.862 38.267 1.00 34.72 ? 220  ARG A O   1 
ATOM   1683 C CB  . ARG A 1 220 ? 6.838   66.420 37.042 1.00 34.95 ? 220  ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 220 ? 8.173   66.603 36.326 1.00 34.64 ? 220  ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 220 ? 8.319   65.602 35.164 1.00 36.48 ? 220  ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 220 ? 9.417   66.017 34.271 1.00 39.97 ? 220  ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 220 ? 9.303   66.966 33.322 1.00 39.58 ? 220  ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 220 ? 8.130   67.615 33.125 1.00 36.65 ? 220  ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 220 ? 10.342  67.238 32.544 1.00 36.29 ? 220  ARG A NH2 1 
ATOM   1690 N N   . ARG A 1 221 ? 7.981   65.458 39.710 1.00 32.80 ? 221  ARG A N   1 
ATOM   1691 C CA  . ARG A 1 221 ? 9.105   65.412 40.640 1.00 32.05 ? 221  ARG A CA  1 
ATOM   1692 C C   . ARG A 1 221 ? 8.585   65.456 42.063 1.00 31.04 ? 221  ARG A C   1 
ATOM   1693 O O   . ARG A 1 221 ? 7.405   65.796 42.313 1.00 27.20 ? 221  ARG A O   1 
ATOM   1694 C CB  . ARG A 1 221 ? 9.994   66.640 40.437 1.00 35.00 ? 221  ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 221 ? 10.812  66.533 39.227 1.00 42.30 ? 221  ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 221 ? 11.862  67.630 39.116 1.00 42.03 ? 221  ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 221 ? 11.310  68.720 38.410 1.00 43.01 ? 221  ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 221 ? 11.305  68.852 37.091 1.00 41.99 ? 221  ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 221 ? 11.862  67.948 36.285 1.00 37.96 ? 221  ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 221 ? 10.644  69.888 36.593 1.00 39.61 ? 221  ARG A NH2 1 
ATOM   1701 N N   . ALA A 1 222 ? 9.508   65.213 42.992 1.00 30.42 ? 222  ALA A N   1 
ATOM   1702 C CA  . ALA A 1 222 ? 9.154   65.089 44.410 1.00 31.25 ? 222  ALA A CA  1 
ATOM   1703 C C   . ALA A 1 222 ? 10.167  65.663 45.369 1.00 31.12 ? 222  ALA A C   1 
ATOM   1704 O O   . ALA A 1 222 ? 11.371  65.619 45.090 1.00 33.46 ? 222  ALA A O   1 
ATOM   1705 C CB  . ALA A 1 222 ? 8.926   63.577 44.739 1.00 28.19 ? 222  ALA A CB  1 
ATOM   1706 N N   . ILE A 1 223 ? 9.657   66.206 46.482 1.00 30.80 ? 223  ILE A N   1 
ATOM   1707 C CA  . ILE A 1 223 ? 10.451  66.763 47.561 1.00 30.40 ? 223  ILE A CA  1 
ATOM   1708 C C   . ILE A 1 223 ? 9.964   66.095 48.865 1.00 30.32 ? 223  ILE A C   1 
ATOM   1709 O O   . ILE A 1 223 ? 8.783   66.112 49.157 1.00 29.83 ? 223  ILE A O   1 
ATOM   1710 C CB  . ILE A 1 223 ? 10.251  68.266 47.688 1.00 31.08 ? 223  ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 223 ? 10.773  68.976 46.438 1.00 31.27 ? 223  ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 223 ? 11.003  68.809 48.967 1.00 31.36 ? 223  ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 223 ? 10.480  70.546 46.499 1.00 28.28 ? 223  ILE A CD1 1 
ATOM   1714 N N   . LEU A 1 224 ? 10.879  65.505 49.627 1.00 28.12 ? 224  LEU A N   1 
ATOM   1715 C CA  . LEU A 1 224 ? 10.558  64.814 50.870 1.00 28.38 ? 224  LEU A CA  1 
ATOM   1716 C C   . LEU A 1 224 ? 11.290  65.489 52.031 1.00 29.14 ? 224  LEU A C   1 
ATOM   1717 O O   . LEU A 1 224 ? 12.536  65.555 52.045 1.00 30.79 ? 224  LEU A O   1 
ATOM   1718 C CB  . LEU A 1 224 ? 10.993  63.345 50.804 1.00 26.44 ? 224  LEU A CB  1 
ATOM   1719 C CG  . LEU A 1 224 ? 10.286  62.456 49.778 1.00 27.46 ? 224  LEU A CG  1 
ATOM   1720 C CD1 . LEU A 1 224 ? 10.863  62.704 48.382 1.00 24.12 ? 224  LEU A CD1 1 
ATOM   1721 C CD2 . LEU A 1 224 ? 10.387  61.005 50.205 1.00 22.90 ? 224  LEU A CD2 1 
ATOM   1722 N N   . GLN A 1 225 ? 10.536  65.992 52.999 1.00 29.81 ? 225  GLN A N   1 
ATOM   1723 C CA  . GLN A 1 225 ? 11.132  66.704 54.160 1.00 29.65 ? 225  GLN A CA  1 
ATOM   1724 C C   . GLN A 1 225 ? 10.905  65.892 55.441 1.00 29.30 ? 225  GLN A C   1 
ATOM   1725 O O   . GLN A 1 225 ? 9.756   65.680 55.877 1.00 27.71 ? 225  GLN A O   1 
ATOM   1726 C CB  . GLN A 1 225 ? 10.493  68.105 54.326 1.00 28.49 ? 225  GLN A CB  1 
ATOM   1727 C CG  . GLN A 1 225 ? 10.706  69.007 53.117 1.00 29.03 ? 225  GLN A CG  1 
ATOM   1728 C CD  . GLN A 1 225 ? 9.837   70.283 53.077 1.00 29.66 ? 225  GLN A CD  1 
ATOM   1729 O OE1 . GLN A 1 225 ? 9.484   70.725 52.006 1.00 33.31 ? 225  GLN A OE1 1 
ATOM   1730 N NE2 . GLN A 1 225 ? 9.512   70.862 54.219 1.00 28.21 ? 225  GLN A NE2 1 
ATOM   1731 N N   . SER A 1 226 ? 12.013  65.396 55.987 1.00 29.55 ? 226  SER A N   1 
ATOM   1732 C CA  . SER A 1 226 ? 12.016  64.646 57.232 1.00 29.30 ? 226  SER A CA  1 
ATOM   1733 C C   . SER A 1 226 ? 11.037  63.507 57.230 1.00 28.60 ? 226  SER A C   1 
ATOM   1734 O O   . SER A 1 226 ? 10.287  63.318 58.188 1.00 29.43 ? 226  SER A O   1 
ATOM   1735 C CB  . SER A 1 226 ? 11.682  65.588 58.422 1.00 30.82 ? 226  SER A CB  1 
ATOM   1736 O OG  . SER A 1 226 ? 12.562  66.720 58.517 1.00 30.21 ? 226  SER A OG  1 
ATOM   1737 N N   . GLY A 1 227 ? 10.996  62.761 56.155 1.00 28.19 ? 227  GLY A N   1 
ATOM   1738 C CA  . GLY A 1 227 ? 10.103  61.612 56.131 1.00 26.72 ? 227  GLY A CA  1 
ATOM   1739 C C   . GLY A 1 227 ? 10.379  60.841 54.865 1.00 29.19 ? 227  GLY A C   1 
ATOM   1740 O O   . GLY A 1 227 ? 10.810  61.420 53.849 1.00 28.75 ? 227  GLY A O   1 
ATOM   1741 N N   . SER A 1 228 ? 10.171  59.534 54.937 1.00 29.04 ? 228  SER A N   1 
ATOM   1742 C CA  . SER A 1 228 ? 10.378  58.692 53.814 1.00 29.85 ? 228  SER A CA  1 
ATOM   1743 C C   . SER A 1 228 ? 9.421   57.504 53.964 1.00 30.59 ? 228  SER A C   1 
ATOM   1744 O O   . SER A 1 228 ? 8.956   57.186 55.065 1.00 30.02 ? 228  SER A O   1 
ATOM   1745 C CB  . SER A 1 228 ? 11.858  58.308 53.608 1.00 28.37 ? 228  SER A CB  1 
ATOM   1746 O OG  . SER A 1 228 ? 12.376  57.613 54.687 1.00 32.21 ? 228  SER A OG  1 
ATOM   1747 N N   . PRO A 1 229 ? 9.086   56.867 52.823 1.00 29.28 ? 229  PRO A N   1 
ATOM   1748 C CA  . PRO A 1 229 ? 8.145   55.739 52.816 1.00 29.91 ? 229  PRO A CA  1 
ATOM   1749 C C   . PRO A 1 229 ? 8.429   54.541 53.722 1.00 29.98 ? 229  PRO A C   1 
ATOM   1750 O O   . PRO A 1 229 ? 7.502   53.957 54.280 1.00 29.52 ? 229  PRO A O   1 
ATOM   1751 C CB  . PRO A 1 229 ? 8.015   55.395 51.297 1.00 30.22 ? 229  PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 229 ? 9.444   55.764 50.742 1.00 29.59 ? 229  PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 229 ? 9.853   56.995 51.566 1.00 26.69 ? 229  PRO A CD  1 
ATOM   1754 N N   . ASN A 1 230 ? 9.710   54.215 53.883 1.00 28.86 ? 230  ASN A N   1 
ATOM   1755 C CA  . ASN A 1 230 ? 10.142  53.103 54.676 1.00 29.51 ? 230  ASN A CA  1 
ATOM   1756 C C   . ASN A 1 230 ? 10.284  53.423 56.166 1.00 30.73 ? 230  ASN A C   1 
ATOM   1757 O O   . ASN A 1 230 ? 10.808  52.581 56.892 1.00 31.82 ? 230  ASN A O   1 
ATOM   1758 C CB  . ASN A 1 230 ? 11.485  52.622 54.145 1.00 29.51 ? 230  ASN A CB  1 
ATOM   1759 C CG  . ASN A 1 230 ? 12.522  53.770 54.118 1.00 33.53 ? 230  ASN A CG  1 
ATOM   1760 O OD1 . ASN A 1 230 ? 12.208  54.898 53.671 1.00 30.17 ? 230  ASN A OD1 1 
ATOM   1761 N ND2 . ASN A 1 230 ? 13.733  53.502 54.600 1.00 29.41 ? 230  ASN A ND2 1 
ATOM   1762 N N   . CYS A 1 231 ? 9.838   54.594 56.631 1.00 28.43 ? 231  CYS A N   1 
ATOM   1763 C CA  . CYS A 1 231 ? 9.960   54.891 58.059 1.00 29.61 ? 231  CYS A CA  1 
ATOM   1764 C C   . CYS A 1 231 ? 9.254   53.792 58.872 1.00 30.30 ? 231  CYS A C   1 
ATOM   1765 O O   . CYS A 1 231 ? 8.199   53.274 58.461 1.00 30.05 ? 231  CYS A O   1 
ATOM   1766 C CB  . CYS A 1 231 ? 9.380   56.271 58.412 1.00 29.57 ? 231  CYS A CB  1 
ATOM   1767 S SG  . CYS A 1 231 ? 10.432  57.626 57.874 1.00 28.93 ? 231  CYS A SG  1 
ATOM   1768 N N   . PRO A 1 232 ? 9.826   53.432 60.032 1.00 29.46 ? 232  PRO A N   1 
ATOM   1769 C CA  . PRO A 1 232 ? 9.243   52.368 60.860 1.00 28.86 ? 232  PRO A CA  1 
ATOM   1770 C C   . PRO A 1 232 ? 7.829   52.588 61.366 1.00 30.31 ? 232  PRO A C   1 
ATOM   1771 O O   . PRO A 1 232 ? 7.103   51.622 61.634 1.00 28.37 ? 232  PRO A O   1 
ATOM   1772 C CB  . PRO A 1 232 ? 10.300  52.166 61.981 1.00 27.70 ? 232  PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 232 ? 10.912  53.523 62.162 1.00 28.92 ? 232  PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 232 ? 11.013  54.040 60.677 1.00 28.94 ? 232  PRO A CD  1 
ATOM   1775 N N   . TRP A 1 233 ? 7.433   53.859 61.476 1.00 29.35 ? 233  TRP A N   1 
ATOM   1776 C CA  . TRP A 1 233 ? 6.093   54.241 61.935 1.00 29.52 ? 233  TRP A CA  1 
ATOM   1777 C C   . TRP A 1 233 ? 5.089   54.511 60.785 1.00 31.43 ? 233  TRP A C   1 
ATOM   1778 O O   . TRP A 1 233 ? 3.907   54.778 61.060 1.00 33.66 ? 233  TRP A O   1 
ATOM   1779 C CB  . TRP A 1 233 ? 6.171   55.559 62.730 1.00 27.65 ? 233  TRP A CB  1 
ATOM   1780 C CG  . TRP A 1 233 ? 6.987   56.628 62.004 1.00 27.19 ? 233  TRP A CG  1 
ATOM   1781 C CD1 . TRP A 1 233 ? 8.341   56.879 62.144 1.00 27.49 ? 233  TRP A CD1 1 
ATOM   1782 C CD2 . TRP A 1 233 ? 6.522   57.548 60.992 1.00 27.74 ? 233  TRP A CD2 1 
ATOM   1783 N NE1 . TRP A 1 233 ? 8.732   57.888 61.283 1.00 27.69 ? 233  TRP A NE1 1 
ATOM   1784 C CE2 . TRP A 1 233 ? 7.644   58.321 60.571 1.00 28.35 ? 233  TRP A CE2 1 
ATOM   1785 C CE3 . TRP A 1 233 ? 5.271   57.802 60.407 1.00 28.70 ? 233  TRP A CE3 1 
ATOM   1786 C CZ2 . TRP A 1 233 ? 7.545   59.336 59.593 1.00 27.24 ? 233  TRP A CZ2 1 
ATOM   1787 C CZ3 . TRP A 1 233 ? 5.176   58.823 59.428 1.00 27.55 ? 233  TRP A CZ3 1 
ATOM   1788 C CH2 . TRP A 1 233 ? 6.308   59.572 59.042 1.00 26.95 ? 233  TRP A CH2 1 
ATOM   1789 N N   . ALA A 1 234 ? 5.548   54.468 59.533 1.00 28.85 ? 234  ALA A N   1 
ATOM   1790 C CA  . ALA A 1 234 ? 4.716   54.853 58.396 1.00 28.35 ? 234  ALA A CA  1 
ATOM   1791 C C   . ALA A 1 234 ? 3.870   53.784 57.762 1.00 29.62 ? 234  ALA A C   1 
ATOM   1792 O O   . ALA A 1 234 ? 3.092   54.097 56.895 1.00 28.12 ? 234  ALA A O   1 
ATOM   1793 C CB  . ALA A 1 234 ? 5.598   55.511 57.289 1.00 25.98 ? 234  ALA A CB  1 
ATOM   1794 N N   . SER A 1 235 ? 4.071   52.520 58.130 1.00 31.63 ? 235  SER A N   1 
ATOM   1795 C CA  . SER A 1 235 ? 3.245   51.470 57.563 1.00 32.10 ? 235  SER A CA  1 
ATOM   1796 C C   . SER A 1 235 ? 3.228   50.252 58.472 1.00 34.25 ? 235  SER A C   1 
ATOM   1797 O O   . SER A 1 235 ? 3.999   50.183 59.428 1.00 34.31 ? 235  SER A O   1 
ATOM   1798 C CB  . SER A 1 235 ? 3.725   51.113 56.164 1.00 31.13 ? 235  SER A CB  1 
ATOM   1799 O OG  . SER A 1 235 ? 4.938   50.399 56.150 1.00 29.49 ? 235  SER A OG  1 
ATOM   1800 N N   . VAL A 1 236 ? 2.304   49.333 58.210 1.00 35.31 ? 236  VAL A N   1 
ATOM   1801 C CA  . VAL A 1 236 ? 2.195   48.090 58.973 1.00 36.08 ? 236  VAL A CA  1 
ATOM   1802 C C   . VAL A 1 236 ? 1.731   46.998 57.996 1.00 36.95 ? 236  VAL A C   1 
ATOM   1803 O O   . VAL A 1 236 ? 1.259   47.300 56.878 1.00 36.53 ? 236  VAL A O   1 
ATOM   1804 C CB  . VAL A 1 236 ? 1.144   48.196 60.103 1.00 35.25 ? 236  VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 236 ? 1.592   49.207 61.155 1.00 34.34 ? 236  VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 236 ? -0.213  48.577 59.525 1.00 35.35 ? 236  VAL A CG2 1 
ATOM   1807 N N   . SER A 1 237 ? 1.861   45.745 58.405 1.00 35.56 ? 237  SER A N   1 
ATOM   1808 C CA  . SER A 1 237 ? 1.411   44.636 57.563 1.00 36.90 ? 237  SER A CA  1 
ATOM   1809 C C   . SER A 1 237 ? -0.136  44.579 57.639 1.00 36.52 ? 237  SER A C   1 
ATOM   1810 O O   . SER A 1 237 ? -0.764  45.232 58.521 1.00 34.29 ? 237  SER A O   1 
ATOM   1811 C CB  . SER A 1 237 ? 1.978   43.306 58.078 1.00 36.58 ? 237  SER A CB  1 
ATOM   1812 O OG  . SER A 1 237 ? 1.404   43.055 59.357 1.00 38.49 ? 237  SER A OG  1 
ATOM   1813 N N   . VAL A 1 238 ? -0.743  43.796 56.737 1.00 35.71 ? 238  VAL A N   1 
ATOM   1814 C CA  . VAL A 1 238 ? -2.196  43.723 56.747 1.00 36.24 ? 238  VAL A CA  1 
ATOM   1815 C C   . VAL A 1 238 ? -2.666  43.008 57.981 1.00 35.62 ? 238  VAL A C   1 
ATOM   1816 O O   . VAL A 1 238 ? -3.755  43.305 58.496 1.00 35.34 ? 238  VAL A O   1 
ATOM   1817 C CB  . VAL A 1 238 ? -2.789  43.034 55.485 1.00 38.21 ? 238  VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 238 ? -2.373  43.763 54.276 1.00 37.29 ? 238  VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 238 ? -2.374  41.570 55.418 1.00 37.16 ? 238  VAL A CG2 1 
ATOM   1820 N N   . ALA A 1 239 ? -1.846  42.083 58.481 1.00 35.21 ? 239  ALA A N   1 
ATOM   1821 C CA  . ALA A 1 239 ? -2.216  41.383 59.727 1.00 36.28 ? 239  ALA A CA  1 
ATOM   1822 C C   . ALA A 1 239 ? -2.217  42.370 60.912 1.00 35.69 ? 239  ALA A C   1 
ATOM   1823 O O   . ALA A 1 239 ? -3.148  42.397 61.707 1.00 36.60 ? 239  ALA A O   1 
ATOM   1824 C CB  . ALA A 1 239 ? -1.239  40.198 60.018 1.00 33.19 ? 239  ALA A CB  1 
ATOM   1825 N N   . GLU A 1 240 ? -1.182  43.195 61.019 1.00 35.94 ? 240  GLU A N   1 
ATOM   1826 C CA  . GLU A 1 240 ? -1.137  44.153 62.133 1.00 34.70 ? 240  GLU A CA  1 
ATOM   1827 C C   . GLU A 1 240 ? -2.277  45.174 61.973 1.00 33.59 ? 240  GLU A C   1 
ATOM   1828 O O   . GLU A 1 240 ? -2.959  45.534 62.947 1.00 32.25 ? 240  GLU A O   1 
ATOM   1829 C CB  . GLU A 1 240 ? 0.249   44.821 62.191 1.00 35.30 ? 240  GLU A CB  1 
ATOM   1830 C CG  . GLU A 1 240 ? 0.388   45.946 63.273 1.00 37.07 ? 240  GLU A CG  1 
ATOM   1831 C CD  . GLU A 1 240 ? 0.073   45.471 64.710 1.00 36.19 ? 240  GLU A CD  1 
ATOM   1832 O OE1 . GLU A 1 240 ? -0.012  44.253 64.939 1.00 37.75 ? 240  GLU A OE1 1 
ATOM   1833 O OE2 . GLU A 1 240 ? -0.090  46.316 65.611 1.00 36.50 ? 240  GLU A OE2 1 
ATOM   1834 N N   . GLY A 1 241 ? -2.516  45.622 60.735 1.00 34.70 ? 241  GLY A N   1 
ATOM   1835 C CA  . GLY A 1 241 ? -3.615  46.560 60.515 1.00 34.14 ? 241  GLY A CA  1 
ATOM   1836 C C   . GLY A 1 241 ? -4.949  45.955 60.961 1.00 35.50 ? 241  GLY A C   1 
ATOM   1837 O O   . GLY A 1 241 ? -5.802  46.626 61.564 1.00 35.22 ? 241  GLY A O   1 
ATOM   1838 N N   . ARG A 1 242 ? -5.122  44.665 60.685 1.00 36.69 ? 242  ARG A N   1 
ATOM   1839 C CA  . ARG A 1 242 ? -6.356  43.965 61.052 1.00 38.66 ? 242  ARG A CA  1 
ATOM   1840 C C   . ARG A 1 242 ? -6.508  43.896 62.579 1.00 38.28 ? 242  ARG A C   1 
ATOM   1841 O O   . ARG A 1 242 ? -7.554  44.241 63.150 1.00 36.97 ? 242  ARG A O   1 
ATOM   1842 C CB  . ARG A 1 242 ? -6.327  42.553 60.391 1.00 39.52 ? 242  ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 242 ? -7.378  41.533 60.855 1.00 41.47 ? 242  ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 242 ? -7.554  40.336 59.820 1.00 42.41 ? 242  ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 242 ? -8.226  40.800 58.595 1.00 41.28 ? 242  ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 242 ? -9.528  41.054 58.520 1.00 41.73 ? 242  ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 242 ? -10.061 41.506 57.390 1.00 42.48 ? 242  ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 242 ? -10.315 40.818 59.569 1.00 41.36 ? 242  ARG A NH2 1 
ATOM   1849 N N   . ARG A 1 243 ? -5.437  43.457 63.235 1.00 38.78 ? 243  ARG A N   1 
ATOM   1850 C CA  . ARG A 1 243 ? -5.394  43.327 64.695 1.00 38.83 ? 243  ARG A CA  1 
ATOM   1851 C C   . ARG A 1 243 ? -5.775  44.688 65.362 1.00 38.74 ? 243  ARG A C   1 
ATOM   1852 O O   . ARG A 1 243 ? -6.557  44.740 66.335 1.00 36.61 ? 243  ARG A O   1 
ATOM   1853 C CB  . ARG A 1 243 ? -3.985  42.843 65.061 1.00 41.06 ? 243  ARG A CB  1 
ATOM   1854 C CG  . ARG A 1 243 ? -3.669  42.565 66.521 1.00 46.80 ? 243  ARG A CG  1 
ATOM   1855 C CD  . ARG A 1 243 ? -2.332  43.294 66.978 1.00 50.37 ? 243  ARG A CD  1 
ATOM   1856 N NE  . ARG A 1 243 ? -2.641  43.926 68.249 1.00 55.43 ? 243  ARG A NE  1 
ATOM   1857 C CZ  . ARG A 1 243 ? -2.455  45.196 68.584 1.00 55.87 ? 243  ARG A CZ  1 
ATOM   1858 N NH1 . ARG A 1 243 ? -1.907  46.081 67.755 1.00 55.43 ? 243  ARG A NH1 1 
ATOM   1859 N NH2 . ARG A 1 243 ? -2.908  45.584 69.773 1.00 58.84 ? 243  ARG A NH2 1 
ATOM   1860 N N   . ARG A 1 244 ? -5.287  45.802 64.805 1.00 38.06 ? 244  ARG A N   1 
ATOM   1861 C CA  . ARG A 1 244 ? -5.620  47.112 65.399 1.00 37.76 ? 244  ARG A CA  1 
ATOM   1862 C C   . ARG A 1 244 ? -7.067  47.503 65.162 1.00 36.89 ? 244  ARG A C   1 
ATOM   1863 O O   . ARG A 1 244 ? -7.692  48.077 66.076 1.00 38.31 ? 244  ARG A O   1 
ATOM   1864 C CB  . ARG A 1 244 ? -4.672  48.244 64.923 1.00 35.28 ? 244  ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 244 ? -3.242  48.036 65.346 1.00 33.86 ? 244  ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 244 ? -2.315  49.092 64.778 1.00 34.59 ? 244  ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 244 ? -0.908  48.747 64.962 1.00 34.93 ? 244  ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 244 ? 0.117   49.577 64.777 1.00 34.49 ? 244  ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 244 ? -0.079  50.841 64.402 1.00 33.42 ? 244  ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 244 ? 1.350   49.130 64.943 1.00 32.44 ? 244  ARG A NH2 1 
ATOM   1871 N N   . ALA A 1 245 ? -7.599  47.205 63.974 1.00 35.43 ? 245  ALA A N   1 
ATOM   1872 C CA  . ALA A 1 245 ? -9.004  47.513 63.672 1.00 37.99 ? 245  ALA A CA  1 
ATOM   1873 C C   . ALA A 1 245 ? -9.917  46.728 64.634 1.00 39.50 ? 245  ALA A C   1 
ATOM   1874 O O   . ALA A 1 245 ? -10.897 47.285 65.178 1.00 39.11 ? 245  ALA A O   1 
ATOM   1875 C CB  . ALA A 1 245 ? -9.350  47.135 62.208 1.00 38.96 ? 245  ALA A CB  1 
ATOM   1876 N N   . VAL A 1 246 ? -9.577  45.444 64.843 1.00 39.00 ? 246  VAL A N   1 
ATOM   1877 C CA  . VAL A 1 246 ? -10.338 44.582 65.750 1.00 40.04 ? 246  VAL A CA  1 
ATOM   1878 C C   . VAL A 1 246 ? -10.222 45.134 67.180 1.00 40.73 ? 246  VAL A C   1 
ATOM   1879 O O   . VAL A 1 246 ? -11.214 45.214 67.914 1.00 42.27 ? 246  VAL A O   1 
ATOM   1880 C CB  . VAL A 1 246 ? -9.827  43.082 65.735 1.00 40.28 ? 246  VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 246 ? -10.590 42.280 66.760 1.00 39.50 ? 246  VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 246 ? -9.989  42.432 64.314 1.00 36.45 ? 246  VAL A CG2 1 
ATOM   1883 N N   . GLU A 1 247 ? -9.025  45.530 67.580 1.00 39.81 ? 247  GLU A N   1 
ATOM   1884 C CA  . GLU A 1 247 ? -8.867  46.072 68.916 1.00 39.15 ? 247  GLU A CA  1 
ATOM   1885 C C   . GLU A 1 247 ? -9.626  47.405 69.062 1.00 37.98 ? 247  GLU A C   1 
ATOM   1886 O O   . GLU A 1 247 ? -10.188 47.689 70.132 1.00 38.54 ? 247  GLU A O   1 
ATOM   1887 C CB  . GLU A 1 247 ? -7.377  46.218 69.242 1.00 41.72 ? 247  GLU A CB  1 
ATOM   1888 C CG  . GLU A 1 247 ? -7.112  46.424 70.724 1.00 47.91 ? 247  GLU A CG  1 
ATOM   1889 C CD  . GLU A 1 247 ? -7.578  45.232 71.597 1.00 49.57 ? 247  GLU A CD  1 
ATOM   1890 O OE1 . GLU A 1 247 ? -7.553  45.399 72.847 1.00 52.36 ? 247  GLU A OE1 1 
ATOM   1891 O OE2 . GLU A 1 247 ? -7.950  44.158 71.044 1.00 48.38 ? 247  GLU A OE2 1 
ATOM   1892 N N   . LEU A 1 248 ? -9.705  48.202 67.992 1.00 36.25 ? 248  LEU A N   1 
ATOM   1893 C CA  . LEU A 1 248 ? -10.467 49.460 68.063 1.00 37.10 ? 248  LEU A CA  1 
ATOM   1894 C C   . LEU A 1 248 ? -11.932 49.086 68.331 1.00 38.53 ? 248  LEU A C   1 
ATOM   1895 O O   . LEU A 1 248 ? -12.595 49.665 69.217 1.00 37.26 ? 248  LEU A O   1 
ATOM   1896 C CB  . LEU A 1 248 ? -10.398 50.246 66.750 1.00 36.59 ? 248  LEU A CB  1 
ATOM   1897 C CG  . LEU A 1 248 ? -11.094 51.617 66.805 1.00 37.66 ? 248  LEU A CG  1 
ATOM   1898 C CD1 . LEU A 1 248 ? -10.260 52.511 67.757 1.00 39.61 ? 248  LEU A CD1 1 
ATOM   1899 C CD2 . LEU A 1 248 ? -11.205 52.272 65.435 1.00 33.98 ? 248  LEU A CD2 1 
ATOM   1900 N N   . GLY A 1 249 ? -12.433 48.116 67.560 1.00 38.25 ? 249  GLY A N   1 
ATOM   1901 C CA  . GLY A 1 249 ? -13.800 47.654 67.755 1.00 39.51 ? 249  GLY A CA  1 
ATOM   1902 C C   . GLY A 1 249 ? -14.008 47.117 69.165 1.00 39.97 ? 249  GLY A C   1 
ATOM   1903 O O   . GLY A 1 249 ? -15.010 47.443 69.813 1.00 40.08 ? 249  GLY A O   1 
ATOM   1904 N N   . ARG A 1 250 ? -13.056 46.331 69.662 1.00 39.61 ? 250  ARG A N   1 
ATOM   1905 C CA  . ARG A 1 250 ? -13.175 45.795 71.014 1.00 40.67 ? 250  ARG A CA  1 
ATOM   1906 C C   . ARG A 1 250 ? -13.290 46.915 72.083 1.00 41.58 ? 250  ARG A C   1 
ATOM   1907 O O   . ARG A 1 250 ? -13.993 46.751 73.079 1.00 42.10 ? 250  ARG A O   1 
ATOM   1908 C CB  . ARG A 1 250 ? -11.988 44.866 71.278 1.00 40.99 ? 250  ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 250 ? -12.037 44.041 72.548 1.00 43.64 ? 250  ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 250 ? -10.807 43.116 72.631 1.00 43.41 ? 250  ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 250 ? -10.812 42.099 71.552 1.00 46.95 ? 250  ARG A NE  1 
ATOM   1912 N N   . ASN A 1 251 ? -12.621 48.057 71.863 1.00 42.90 ? 251  ASN A N   1 
ATOM   1913 C CA  . ASN A 1 251 ? -12.643 49.226 72.784 1.00 41.66 ? 251  ASN A CA  1 
ATOM   1914 C C   . ASN A 1 251 ? -13.986 49.966 72.784 1.00 42.05 ? 251  ASN A C   1 
ATOM   1915 O O   . ASN A 1 251 ? -14.295 50.715 73.735 1.00 40.72 ? 251  ASN A O   1 
ATOM   1916 C CB  . ASN A 1 251 ? -11.571 50.270 72.383 1.00 40.67 ? 251  ASN A CB  1 
ATOM   1917 C CG  . ASN A 1 251 ? -10.225 50.072 73.089 1.00 39.05 ? 251  ASN A CG  1 
ATOM   1918 O OD1 . ASN A 1 251 ? -9.959  50.685 74.120 1.00 39.09 ? 251  ASN A OD1 1 
ATOM   1919 N ND2 . ASN A 1 251 ? -9.380  49.236 72.528 1.00 34.39 ? 251  ASN A ND2 1 
ATOM   1920 N N   . LEU A 1 252 ? -14.754 49.786 71.704 1.00 42.52 ? 252  LEU A N   1 
ATOM   1921 C CA  . LEU A 1 252 ? -16.066 50.444 71.570 1.00 45.31 ? 252  LEU A CA  1 
ATOM   1922 C C   . LEU A 1 252 ? -17.241 49.448 71.685 1.00 46.87 ? 252  LEU A C   1 
ATOM   1923 O O   . LEU A 1 252 ? -18.364 49.750 71.290 1.00 47.20 ? 252  LEU A O   1 
ATOM   1924 C CB  . LEU A 1 252 ? -16.143 51.243 70.259 1.00 41.41 ? 252  LEU A CB  1 
ATOM   1925 C CG  . LEU A 1 252 ? -15.103 52.389 70.231 1.00 42.16 ? 252  LEU A CG  1 
ATOM   1926 C CD1 . LEU A 1 252 ? -14.848 52.859 68.808 1.00 40.19 ? 252  LEU A CD1 1 
ATOM   1927 C CD2 . LEU A 1 252 ? -15.581 53.551 71.049 1.00 40.41 ? 252  LEU A CD2 1 
ATOM   1928 N N   . ASN A 1 253 ? -16.951 48.272 72.237 1.00 49.61 ? 253  ASN A N   1 
ATOM   1929 C CA  . ASN A 1 253 ? -17.949 47.218 72.464 1.00 52.89 ? 253  ASN A CA  1 
ATOM   1930 C C   . ASN A 1 253 ? -18.631 46.836 71.158 1.00 52.51 ? 253  ASN A C   1 
ATOM   1931 O O   . ASN A 1 253 ? -19.856 46.821 71.062 1.00 51.39 ? 253  ASN A O   1 
ATOM   1932 C CB  . ASN A 1 253 ? -18.990 47.719 73.465 1.00 55.03 ? 253  ASN A CB  1 
ATOM   1933 C CG  . ASN A 1 253 ? -18.365 48.586 74.559 1.00 59.88 ? 253  ASN A CG  1 
ATOM   1934 O OD1 . ASN A 1 253 ? -17.528 48.108 75.346 1.00 60.40 ? 253  ASN A OD1 1 
ATOM   1935 N ND2 . ASN A 1 253 ? -18.756 49.881 74.601 1.00 60.38 ? 253  ASN A ND2 1 
ATOM   1936 N N   . CYS A 1 254 ? -17.835 46.557 70.141 1.00 51.14 ? 254  CYS A N   1 
ATOM   1937 C CA  . CYS A 1 254 ? -18.418 46.189 68.879 1.00 50.39 ? 254  CYS A CA  1 
ATOM   1938 C C   . CYS A 1 254 ? -18.547 44.699 68.796 1.00 50.64 ? 254  CYS A C   1 
ATOM   1939 O O   . CYS A 1 254 ? -17.813 43.943 69.429 1.00 49.45 ? 254  CYS A O   1 
ATOM   1940 C CB  . CYS A 1 254 ? -17.542 46.644 67.714 1.00 49.70 ? 254  CYS A CB  1 
ATOM   1941 S SG  . CYS A 1 254 ? -17.619 48.410 67.285 1.00 50.40 ? 254  CYS A SG  1 
ATOM   1942 N N   . ASN A 1 255 ? -19.498 44.282 67.981 1.00 51.85 ? 255  ASN A N   1 
ATOM   1943 C CA  . ASN A 1 255 ? -19.695 42.877 67.704 1.00 51.03 ? 255  ASN A CA  1 
ATOM   1944 C C   . ASN A 1 255 ? -18.462 42.580 66.831 1.00 50.03 ? 255  ASN A C   1 
ATOM   1945 O O   . ASN A 1 255 ? -18.253 43.276 65.824 1.00 50.11 ? 255  ASN A O   1 
ATOM   1946 C CB  . ASN A 1 255 ? -20.964 42.729 66.868 1.00 52.95 ? 255  ASN A CB  1 
ATOM   1947 C CG  . ASN A 1 255 ? -21.231 41.291 66.470 1.00 54.13 ? 255  ASN A CG  1 
ATOM   1948 O OD1 . ASN A 1 255 ? -20.353 40.587 65.933 1.00 53.32 ? 255  ASN A OD1 1 
ATOM   1949 N ND2 . ASN A 1 255 ? -22.449 40.842 66.731 1.00 54.19 ? 255  ASN A ND2 1 
ATOM   1950 N N   . LEU A 1 256 ? -17.661 41.574 67.176 1.00 48.71 ? 256  LEU A N   1 
ATOM   1951 C CA  . LEU A 1 256 ? -16.477 41.275 66.376 1.00 49.51 ? 256  LEU A CA  1 
ATOM   1952 C C   . LEU A 1 256 ? -16.532 39.979 65.578 1.00 51.61 ? 256  LEU A C   1 
ATOM   1953 O O   . LEU A 1 256 ? -15.485 39.448 65.225 1.00 51.71 ? 256  LEU A O   1 
ATOM   1954 C CB  . LEU A 1 256 ? -15.231 41.219 67.261 1.00 48.79 ? 256  LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 256 ? -15.130 42.341 68.292 1.00 49.05 ? 256  LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 256 ? -13.944 42.092 69.186 1.00 46.97 ? 256  LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 256 ? -15.041 43.721 67.557 1.00 49.65 ? 256  LEU A CD2 1 
ATOM   1958 N N   . ASN A 1 257 ? -17.725 39.489 65.250 1.00 52.61 ? 257  ASN A N   1 
ATOM   1959 C CA  . ASN A 1 257 ? -17.851 38.214 64.529 1.00 54.30 ? 257  ASN A CA  1 
ATOM   1960 C C   . ASN A 1 257 ? -17.509 38.153 63.037 1.00 53.58 ? 257  ASN A C   1 
ATOM   1961 O O   . ASN A 1 257 ? -17.205 37.077 62.509 1.00 51.32 ? 257  ASN A O   1 
ATOM   1962 C CB  . ASN A 1 257 ? -19.264 37.662 64.744 1.00 57.01 ? 257  ASN A CB  1 
ATOM   1963 C CG  . ASN A 1 257 ? -19.443 37.044 66.138 1.00 59.95 ? 257  ASN A CG  1 
ATOM   1964 O OD1 . ASN A 1 257 ? -20.581 36.890 66.619 1.00 62.27 ? 257  ASN A OD1 1 
ATOM   1965 N ND2 . ASN A 1 257 ? -18.318 36.679 66.787 1.00 59.02 ? 257  ASN A ND2 1 
ATOM   1966 N N   . SER A 1 258 ? -17.600 39.298 62.364 1.00 52.12 ? 258  SER A N   1 
ATOM   1967 C CA  . SER A 1 258 ? -17.298 39.401 60.946 1.00 51.17 ? 258  SER A CA  1 
ATOM   1968 C C   . SER A 1 258 ? -16.874 40.837 60.638 1.00 50.89 ? 258  SER A C   1 
ATOM   1969 O O   . SER A 1 258 ? -17.236 41.785 61.379 1.00 49.44 ? 258  SER A O   1 
ATOM   1970 C CB  . SER A 1 258 ? -18.537 39.097 60.106 1.00 50.87 ? 258  SER A CB  1 
ATOM   1971 O OG  . SER A 1 258 ? -19.545 40.087 60.344 1.00 51.74 ? 258  SER A OG  1 
ATOM   1972 N N   . ASP A 1 259 ? -16.129 40.996 59.541 1.00 50.30 ? 259  ASP A N   1 
ATOM   1973 C CA  . ASP A 1 259 ? -15.712 42.326 59.117 1.00 50.06 ? 259  ASP A CA  1 
ATOM   1974 C C   . ASP A 1 259 ? -16.938 43.228 59.007 1.00 50.33 ? 259  ASP A C   1 
ATOM   1975 O O   . ASP A 1 259 ? -16.948 44.353 59.525 1.00 50.89 ? 259  ASP A O   1 
ATOM   1976 C CB  . ASP A 1 259 ? -14.970 42.257 57.777 1.00 49.42 ? 259  ASP A CB  1 
ATOM   1977 C CG  . ASP A 1 259 ? -13.560 41.696 57.935 1.00 50.35 ? 259  ASP A CG  1 
ATOM   1978 O OD1 . ASP A 1 259 ? -13.132 41.536 59.099 1.00 52.09 ? 259  ASP A OD1 1 
ATOM   1979 O OD2 . ASP A 1 259 ? -12.864 41.421 56.922 1.00 50.82 ? 259  ASP A OD2 1 
ATOM   1980 N N   . GLU A 1 260 ? -17.993 42.708 58.383 1.00 51.02 ? 260  GLU A N   1 
ATOM   1981 C CA  . GLU A 1 260 ? -19.219 43.476 58.177 1.00 51.18 ? 260  GLU A CA  1 
ATOM   1982 C C   . GLU A 1 260 ? -19.806 43.955 59.490 1.00 49.16 ? 260  GLU A C   1 
ATOM   1983 O O   . GLU A 1 260 ? -20.262 45.105 59.599 1.00 47.45 ? 260  GLU A O   1 
ATOM   1984 C CB  . GLU A 1 260 ? -20.276 42.646 57.412 1.00 54.08 ? 260  GLU A CB  1 
ATOM   1985 C CG  . GLU A 1 260 ? -19.757 41.848 56.189 1.00 57.33 ? 260  GLU A CG  1 
ATOM   1986 C CD  . GLU A 1 260 ? -19.034 40.521 56.563 1.00 60.50 ? 260  GLU A CD  1 
ATOM   1987 O OE1 . GLU A 1 260 ? -17.787 40.479 56.782 1.00 60.34 ? 260  GLU A OE1 1 
ATOM   1988 N N   . GLU A 1 261 ? -19.824 43.072 60.483 1.00 48.97 ? 261  GLU A N   1 
ATOM   1989 C CA  . GLU A 1 261 ? -20.361 43.457 61.799 1.00 48.73 ? 261  GLU A CA  1 
ATOM   1990 C C   . GLU A 1 261 ? -19.492 44.593 62.401 1.00 46.40 ? 261  GLU A C   1 
ATOM   1991 O O   . GLU A 1 261 ? -20.033 45.629 62.811 1.00 43.81 ? 261  GLU A O   1 
ATOM   1992 C CB  . GLU A 1 261 ? -20.403 42.250 62.771 1.00 51.66 ? 261  GLU A CB  1 
ATOM   1993 C CG  . GLU A 1 261 ? -21.493 41.207 62.497 1.00 55.96 ? 261  GLU A CG  1 
ATOM   1994 C CD  . GLU A 1 261 ? -22.887 41.781 62.689 1.00 59.11 ? 261  GLU A CD  1 
ATOM   1995 O OE2 . GLU A 1 261 ? -23.693 41.138 63.401 1.00 62.05 ? 261  GLU A OE2 1 
ATOM   1996 N N   . LEU A 1 262 ? -18.160 44.393 62.406 1.00 45.17 ? 262  LEU A N   1 
ATOM   1997 C CA  . LEU A 1 262 ? -17.187 45.368 62.945 1.00 43.72 ? 262  LEU A CA  1 
ATOM   1998 C C   . LEU A 1 262 ? -17.301 46.734 62.236 1.00 43.21 ? 262  LEU A C   1 
ATOM   1999 O O   . LEU A 1 262 ? -17.481 47.768 62.870 1.00 40.79 ? 262  LEU A O   1 
ATOM   2000 C CB  . LEU A 1 262 ? -15.757 44.830 62.811 1.00 42.23 ? 262  LEU A CB  1 
ATOM   2001 C CG  . LEU A 1 262 ? -14.614 45.791 63.198 1.00 41.40 ? 262  LEU A CG  1 
ATOM   2002 C CD1 . LEU A 1 262 ? -14.854 46.369 64.580 1.00 38.55 ? 262  LEU A CD1 1 
ATOM   2003 C CD2 . LEU A 1 262 ? -13.264 45.030 63.147 1.00 39.21 ? 262  LEU A CD2 1 
ATOM   2004 N N   . ILE A 1 263 ? -17.263 46.711 60.917 1.00 43.76 ? 263  ILE A N   1 
ATOM   2005 C CA  . ILE A 1 263 ? -17.351 47.945 60.165 1.00 45.38 ? 263  ILE A CA  1 
ATOM   2006 C C   . ILE A 1 263 ? -18.667 48.661 60.399 1.00 46.41 ? 263  ILE A C   1 
ATOM   2007 O O   . ILE A 1 263 ? -18.676 49.879 60.557 1.00 46.68 ? 263  ILE A O   1 
ATOM   2008 C CB  . ILE A 1 263 ? -17.165 47.698 58.657 1.00 45.13 ? 263  ILE A CB  1 
ATOM   2009 C CG1 . ILE A 1 263 ? -15.747 47.196 58.369 1.00 44.42 ? 263  ILE A CG1 1 
ATOM   2010 C CG2 . ILE A 1 263 ? -17.475 48.958 57.898 1.00 46.39 ? 263  ILE A CG2 1 
ATOM   2011 C CD1 . ILE A 1 263 ? -15.534 46.752 56.904 1.00 44.99 ? 263  ILE A CD1 1 
ATOM   2012 N N   . HIS A 1 264 ? -19.776 47.914 60.449 1.00 48.30 ? 264  HIS A N   1 
ATOM   2013 C CA  . HIS A 1 264 ? -21.082 48.535 60.655 1.00 49.16 ? 264  HIS A CA  1 
ATOM   2014 C C   . HIS A 1 264 ? -21.098 49.248 62.001 1.00 48.23 ? 264  HIS A C   1 
ATOM   2015 O O   . HIS A 1 264 ? -21.537 50.418 62.097 1.00 48.68 ? 264  HIS A O   1 
ATOM   2016 C CB  . HIS A 1 264 ? -22.245 47.507 60.569 1.00 53.60 ? 264  HIS A CB  1 
ATOM   2017 C CG  . HIS A 1 264 ? -23.595 48.102 60.893 1.00 58.39 ? 264  HIS A CG  1 
ATOM   2018 N ND1 . HIS A 1 264 ? -24.147 48.071 62.163 1.00 60.97 ? 264  HIS A ND1 1 
ATOM   2019 C CD2 . HIS A 1 264 ? -24.435 48.862 60.143 1.00 60.78 ? 264  HIS A CD2 1 
ATOM   2020 C CE1 . HIS A 1 264 ? -25.258 48.790 62.183 1.00 62.21 ? 264  HIS A CE1 1 
ATOM   2021 N NE2 . HIS A 1 264 ? -25.455 49.282 60.970 1.00 63.30 ? 264  HIS A NE2 1 
ATOM   2022 N N   . CYS A 1 265 ? -20.625 48.552 63.037 1.00 45.89 ? 265  CYS A N   1 
ATOM   2023 C CA  . CYS A 1 265 ? -20.542 49.136 64.379 1.00 45.78 ? 265  CYS A CA  1 
ATOM   2024 C C   . CYS A 1 265 ? -19.670 50.419 64.368 1.00 44.19 ? 265  CYS A C   1 
ATOM   2025 O O   . CYS A 1 265 ? -20.096 51.466 64.869 1.00 41.95 ? 265  CYS A O   1 
ATOM   2026 C CB  . CYS A 1 265 ? -19.942 48.124 65.366 1.00 46.74 ? 265  CYS A CB  1 
ATOM   2027 S SG  . CYS A 1 265 ? -19.609 48.754 67.067 1.00 52.22 ? 265  CYS A SG  1 
ATOM   2028 N N   . LEU A 1 266 ? -18.474 50.328 63.772 1.00 43.81 ? 266  LEU A N   1 
ATOM   2029 C CA  . LEU A 1 266 ? -17.545 51.486 63.720 1.00 44.34 ? 266  LEU A CA  1 
ATOM   2030 C C   . LEU A 1 266 ? -18.178 52.660 62.960 1.00 45.61 ? 266  LEU A C   1 
ATOM   2031 O O   . LEU A 1 266 ? -17.916 53.813 63.262 1.00 46.43 ? 266  LEU A O   1 
ATOM   2032 C CB  . LEU A 1 266 ? -16.180 51.084 63.099 1.00 41.26 ? 266  LEU A CB  1 
ATOM   2033 C CG  . LEU A 1 266 ? -15.359 50.072 63.925 1.00 40.42 ? 266  LEU A CG  1 
ATOM   2034 C CD1 . LEU A 1 266 ? -14.097 49.683 63.173 1.00 40.66 ? 266  LEU A CD1 1 
ATOM   2035 C CD2 . LEU A 1 266 ? -15.005 50.647 65.306 1.00 39.72 ? 266  LEU A CD2 1 
ATOM   2036 N N   . ARG A 1 267 ? -19.057 52.367 62.011 1.00 46.73 ? 267  ARG A N   1 
ATOM   2037 C CA  . ARG A 1 267 ? -19.696 53.426 61.266 1.00 48.23 ? 267  ARG A CA  1 
ATOM   2038 C C   . ARG A 1 267 ? -20.807 54.127 61.995 1.00 49.42 ? 267  ARG A C   1 
ATOM   2039 O O   . ARG A 1 267 ? -21.189 55.224 61.606 1.00 48.65 ? 267  ARG A O   1 
ATOM   2040 C CB  . ARG A 1 267 ? -20.232 52.898 59.951 1.00 47.32 ? 267  ARG A CB  1 
ATOM   2041 C CG  . ARG A 1 267 ? -19.148 52.644 58.956 1.00 48.15 ? 267  ARG A CG  1 
ATOM   2042 C CD  . ARG A 1 267 ? -19.743 52.382 57.623 1.00 47.90 ? 267  ARG A CD  1 
ATOM   2043 N NE  . ARG A 1 267 ? -18.705 52.182 56.646 1.00 48.44 ? 267  ARG A NE  1 
ATOM   2044 C CZ  . ARG A 1 267 ? -18.842 51.410 55.584 1.00 49.29 ? 267  ARG A CZ  1 
ATOM   2045 N NH1 . ARG A 1 267 ? -19.997 50.766 55.388 1.00 47.82 ? 267  ARG A NH1 1 
ATOM   2046 N NH2 . ARG A 1 267 ? -17.826 51.298 54.724 1.00 49.16 ? 267  ARG A NH2 1 
ATOM   2047 N N   . GLU A 1 268 ? -21.333 53.506 63.047 1.00 51.20 ? 268  GLU A N   1 
ATOM   2048 C CA  . GLU A 1 268 ? -22.425 54.133 63.808 1.00 52.90 ? 268  GLU A CA  1 
ATOM   2049 C C   . GLU A 1 268 ? -21.880 55.050 64.883 1.00 52.37 ? 268  GLU A C   1 
ATOM   2050 O O   . GLU A 1 268 ? -22.646 55.810 65.486 1.00 52.15 ? 268  GLU A O   1 
ATOM   2051 C CB  . GLU A 1 268 ? -23.323 53.079 64.496 1.00 55.38 ? 268  GLU A CB  1 
ATOM   2052 C CG  . GLU A 1 268 ? -24.253 52.302 63.545 1.00 60.81 ? 268  GLU A CG  1 
ATOM   2053 C CD  . GLU A 1 268 ? -24.956 53.238 62.538 1.00 64.02 ? 268  GLU A CD  1 
ATOM   2054 O OE1 . GLU A 1 268 ? -24.700 53.107 61.304 1.00 64.55 ? 268  GLU A OE1 1 
ATOM   2055 O OE2 . GLU A 1 268 ? -25.742 54.113 62.994 1.00 64.92 ? 268  GLU A OE2 1 
ATOM   2056 N N   . LYS A 1 269 ? -20.573 54.965 65.137 1.00 49.52 ? 269  LYS A N   1 
ATOM   2057 C CA  . LYS A 1 269 ? -19.963 55.782 66.185 1.00 48.07 ? 269  LYS A CA  1 
ATOM   2058 C C   . LYS A 1 269 ? -19.725 57.217 65.742 1.00 47.35 ? 269  LYS A C   1 
ATOM   2059 O O   . LYS A 1 269 ? -19.424 57.476 64.576 1.00 46.93 ? 269  LYS A O   1 
ATOM   2060 C CB  . LYS A 1 269 ? -18.636 55.164 66.621 1.00 47.67 ? 269  LYS A CB  1 
ATOM   2061 C CG  . LYS A 1 269 ? -18.741 53.765 67.162 1.00 48.63 ? 269  LYS A CG  1 
ATOM   2062 C CD  . LYS A 1 269 ? -19.589 53.718 68.460 1.00 48.34 ? 269  LYS A CD  1 
ATOM   2063 C CE  . LYS A 1 269 ? -19.800 52.264 68.886 1.00 49.17 ? 269  LYS A CE  1 
ATOM   2064 N NZ  . LYS A 1 269 ? -20.506 52.214 70.197 1.00 51.37 ? 269  LYS A NZ  1 
ATOM   2065 N N   . LYS A 1 270 ? -19.878 58.154 66.670 1.00 47.45 ? 270  LYS A N   1 
ATOM   2066 C CA  . LYS A 1 270 ? -19.637 59.555 66.344 1.00 47.46 ? 270  LYS A CA  1 
ATOM   2067 C C   . LYS A 1 270 ? -18.100 59.663 66.183 1.00 45.74 ? 270  LYS A C   1 
ATOM   2068 O O   . LYS A 1 270 ? -17.353 58.891 66.802 1.00 45.57 ? 270  LYS A O   1 
ATOM   2069 C CB  . LYS A 1 270 ? -20.152 60.472 67.464 1.00 49.12 ? 270  LYS A CB  1 
ATOM   2070 C CG  . LYS A 1 270 ? -21.682 60.444 67.631 1.00 52.85 ? 270  LYS A CG  1 
ATOM   2071 C CD  . LYS A 1 270 ? -22.229 61.520 68.625 1.00 54.67 ? 270  LYS A CD  1 
ATOM   2072 C CE  . LYS A 1 270 ? -22.094 61.161 70.124 1.00 56.10 ? 270  LYS A CE  1 
ATOM   2073 N N   . PRO A 1 271 ? -17.619 60.590 65.338 1.00 43.12 ? 271  PRO A N   1 
ATOM   2074 C CA  . PRO A 1 271 ? -16.173 60.751 65.132 1.00 42.12 ? 271  PRO A CA  1 
ATOM   2075 C C   . PRO A 1 271 ? -15.341 60.757 66.451 1.00 41.68 ? 271  PRO A C   1 
ATOM   2076 O O   . PRO A 1 271 ? -14.397 59.958 66.594 1.00 39.89 ? 271  PRO A O   1 
ATOM   2077 C CB  . PRO A 1 271 ? -16.061 62.088 64.357 1.00 41.88 ? 271  PRO A CB  1 
ATOM   2078 C CG  . PRO A 1 271 ? -17.349 62.163 63.621 1.00 42.33 ? 271  PRO A CG  1 
ATOM   2079 C CD  . PRO A 1 271 ? -18.388 61.612 64.600 1.00 41.62 ? 271  PRO A CD  1 
ATOM   2080 N N   . GLN A 1 272 ? -15.701 61.613 67.404 1.00 40.76 ? 272  GLN A N   1 
ATOM   2081 C CA  . GLN A 1 272 ? -14.951 61.693 68.659 1.00 43.05 ? 272  GLN A CA  1 
ATOM   2082 C C   . GLN A 1 272 ? -14.857 60.377 69.486 1.00 43.48 ? 272  GLN A C   1 
ATOM   2083 O O   . GLN A 1 272 ? -13.935 60.207 70.295 1.00 41.16 ? 272  GLN A O   1 
ATOM   2084 C CB  . GLN A 1 272 ? -15.482 62.836 69.546 1.00 42.49 ? 272  GLN A CB  1 
ATOM   2085 C CG  . GLN A 1 272 ? -14.506 63.217 70.694 1.00 44.00 ? 272  GLN A CG  1 
ATOM   2086 C CD  . GLN A 1 272 ? -13.071 63.514 70.178 1.00 45.35 ? 272  GLN A CD  1 
ATOM   2087 O OE1 . GLN A 1 272 ? -12.904 64.171 69.135 1.00 43.33 ? 272  GLN A OE1 1 
ATOM   2088 N NE2 . GLN A 1 272 ? -12.038 63.021 70.911 1.00 42.92 ? 272  GLN A NE2 1 
ATOM   2089 N N   . GLU A 1 273 ? -15.789 59.443 69.279 1.00 43.31 ? 273  GLU A N   1 
ATOM   2090 C CA  . GLU A 1 273 ? -15.715 58.163 70.000 1.00 43.53 ? 273  GLU A CA  1 
ATOM   2091 C C   . GLU A 1 273 ? -14.558 57.344 69.460 1.00 41.18 ? 273  GLU A C   1 
ATOM   2092 O O   . GLU A 1 273 ? -13.939 56.608 70.196 1.00 41.10 ? 273  GLU A O   1 
ATOM   2093 C CB  . GLU A 1 273 ? -17.003 57.342 69.841 1.00 45.95 ? 273  GLU A CB  1 
ATOM   2094 C CG  . GLU A 1 273 ? -18.216 58.052 70.398 1.00 50.39 ? 273  GLU A CG  1 
ATOM   2095 C CD  . GLU A 1 273 ? -19.449 57.193 70.253 1.00 53.79 ? 273  GLU A CD  1 
ATOM   2096 O OE1 . GLU A 1 273 ? -19.564 56.236 71.042 1.00 55.36 ? 273  GLU A OE1 1 
ATOM   2097 O OE2 . GLU A 1 273 ? -20.270 57.456 69.344 1.00 53.21 ? 273  GLU A OE2 1 
ATOM   2098 N N   . LEU A 1 274 ? -14.315 57.425 68.157 1.00 40.01 ? 274  LEU A N   1 
ATOM   2099 C CA  . LEU A 1 274 ? -13.190 56.715 67.557 1.00 40.33 ? 274  LEU A CA  1 
ATOM   2100 C C   . LEU A 1 274 ? -11.890 57.404 68.038 1.00 38.17 ? 274  LEU A C   1 
ATOM   2101 O O   . LEU A 1 274 ? -10.979 56.752 68.502 1.00 36.73 ? 274  LEU A O   1 
ATOM   2102 C CB  . LEU A 1 274 ? -13.276 56.744 66.015 1.00 42.54 ? 274  LEU A CB  1 
ATOM   2103 C CG  . LEU A 1 274 ? -13.992 55.582 65.266 1.00 45.03 ? 274  LEU A CG  1 
ATOM   2104 C CD1 . LEU A 1 274 ? -15.290 55.254 65.920 1.00 44.09 ? 274  LEU A CD1 1 
ATOM   2105 C CD2 . LEU A 1 274 ? -14.229 55.940 63.789 1.00 44.57 ? 274  LEU A CD2 1 
ATOM   2106 N N   . ILE A 1 275 ? -11.820 58.721 67.956 1.00 37.20 ? 275  ILE A N   1 
ATOM   2107 C CA  . ILE A 1 275 ? -10.627 59.434 68.390 1.00 36.17 ? 275  ILE A CA  1 
ATOM   2108 C C   . ILE A 1 275 ? -10.345 59.222 69.913 1.00 37.07 ? 275  ILE A C   1 
ATOM   2109 O O   . ILE A 1 275 ? -9.201  59.148 70.338 1.00 36.88 ? 275  ILE A O   1 
ATOM   2110 C CB  . ILE A 1 275 ? -10.793 60.919 68.044 1.00 35.79 ? 275  ILE A CB  1 
ATOM   2111 C CG1 . ILE A 1 275 ? -10.789 61.066 66.529 1.00 36.21 ? 275  ILE A CG1 1 
ATOM   2112 C CG2 . ILE A 1 275 ? -9.719  61.796 68.703 1.00 33.99 ? 275  ILE A CG2 1 
ATOM   2113 C CD1 . ILE A 1 275 ? -11.385 62.384 66.058 1.00 35.25 ? 275  ILE A CD1 1 
ATOM   2114 N N   . ASP A 1 276 ? -11.381 59.106 70.728 1.00 35.51 ? 276  ASP A N   1 
ATOM   2115 C CA  . ASP A 1 276 ? -11.181 58.891 72.149 1.00 36.27 ? 276  ASP A CA  1 
ATOM   2116 C C   . ASP A 1 276 ? -10.396 57.621 72.534 1.00 36.06 ? 276  ASP A C   1 
ATOM   2117 O O   . ASP A 1 276 ? -9.761  57.614 73.583 1.00 35.85 ? 276  ASP A O   1 
ATOM   2118 C CB  . ASP A 1 276 ? -12.562 58.855 72.887 1.00 38.00 ? 276  ASP A CB  1 
ATOM   2119 C CG  . ASP A 1 276 ? -13.069 60.253 73.253 1.00 38.83 ? 276  ASP A CG  1 
ATOM   2120 O OD1 . ASP A 1 276 ? -12.315 61.264 73.156 1.00 40.89 ? 276  ASP A OD1 1 
ATOM   2121 O OD2 . ASP A 1 276 ? -14.220 60.343 73.647 1.00 41.69 ? 276  ASP A OD2 1 
ATOM   2122 N N   . VAL A 1 277 ? -10.462 56.553 71.724 1.00 35.27 ? 277  VAL A N   1 
ATOM   2123 C CA  . VAL A 1 277 ? -9.777  55.275 72.057 1.00 33.89 ? 277  VAL A CA  1 
ATOM   2124 C C   . VAL A 1 277 ? -8.654  54.893 71.077 1.00 34.87 ? 277  VAL A C   1 
ATOM   2125 O O   . VAL A 1 277 ? -7.963  53.858 71.251 1.00 36.47 ? 277  VAL A O   1 
ATOM   2126 C CB  . VAL A 1 277 ? -10.805 54.069 72.104 1.00 33.44 ? 277  VAL A CB  1 
ATOM   2127 C CG1 . VAL A 1 277 ? -11.816 54.239 73.257 1.00 29.39 ? 277  VAL A CG1 1 
ATOM   2128 C CG2 . VAL A 1 277 ? -11.581 53.976 70.783 1.00 31.73 ? 277  VAL A CG2 1 
ATOM   2129 N N   . GLU A 1 278 ? -8.467  55.734 70.060 1.00 33.24 ? 278  GLU A N   1 
ATOM   2130 C CA  . GLU A 1 278 ? -7.466  55.505 69.004 1.00 32.33 ? 278  GLU A CA  1 
ATOM   2131 C C   . GLU A 1 278 ? -6.092  55.060 69.520 1.00 33.06 ? 278  GLU A C   1 
ATOM   2132 O O   . GLU A 1 278 ? -5.452  54.127 68.995 1.00 33.19 ? 278  GLU A O   1 
ATOM   2133 C CB  . GLU A 1 278 ? -7.305  56.806 68.215 1.00 34.19 ? 278  GLU A CB  1 
ATOM   2134 C CG  . GLU A 1 278 ? -6.234  56.788 67.109 1.00 37.04 ? 278  GLU A CG  1 
ATOM   2135 C CD  . GLU A 1 278 ? -6.103  58.138 66.339 1.00 37.03 ? 278  GLU A CD  1 
ATOM   2136 O OE1 . GLU A 1 278 ? -7.082  58.941 66.248 1.00 35.91 ? 278  GLU A OE1 1 
ATOM   2137 O OE2 . GLU A 1 278 ? -5.011  58.363 65.795 1.00 35.91 ? 278  GLU A OE2 1 
ATOM   2138 N N   . TRP A 1 279 ? -5.603  55.752 70.540 1.00 32.99 ? 279  TRP A N   1 
ATOM   2139 C CA  . TRP A 1 279 ? -4.288  55.433 71.068 1.00 32.75 ? 279  TRP A CA  1 
ATOM   2140 C C   . TRP A 1 279 ? -4.243  54.124 71.838 1.00 32.78 ? 279  TRP A C   1 
ATOM   2141 O O   . TRP A 1 279 ? -3.173  53.618 72.036 1.00 35.68 ? 279  TRP A O   1 
ATOM   2142 C CB  . TRP A 1 279 ? -3.750  56.598 71.909 1.00 34.26 ? 279  TRP A CB  1 
ATOM   2143 C CG  . TRP A 1 279 ? -3.615  57.855 71.143 1.00 35.33 ? 279  TRP A CG  1 
ATOM   2144 C CD1 . TRP A 1 279 ? -4.519  58.915 71.092 1.00 37.31 ? 279  TRP A CD1 1 
ATOM   2145 C CD2 . TRP A 1 279 ? -2.524  58.222 70.299 1.00 37.10 ? 279  TRP A CD2 1 
ATOM   2146 N NE1 . TRP A 1 279 ? -4.039  59.904 70.265 1.00 36.41 ? 279  TRP A NE1 1 
ATOM   2147 C CE2 . TRP A 1 279 ? -2.820  59.511 69.766 1.00 38.82 ? 279  TRP A CE2 1 
ATOM   2148 C CE3 . TRP A 1 279 ? -1.319  57.596 69.942 1.00 38.04 ? 279  TRP A CE3 1 
ATOM   2149 C CZ2 . TRP A 1 279 ? -1.947  60.175 68.894 1.00 39.75 ? 279  TRP A CZ2 1 
ATOM   2150 C CZ3 . TRP A 1 279 ? -0.451  58.247 69.075 1.00 38.87 ? 279  TRP A CZ3 1 
ATOM   2151 C CH2 . TRP A 1 279 ? -0.767  59.531 68.556 1.00 39.62 ? 279  TRP A CH2 1 
ATOM   2152 N N   . ASN A 1 280 ? -5.379  53.533 72.222 1.00 33.57 ? 280  ASN A N   1 
ATOM   2153 C CA  . ASN A 1 280 ? -5.362  52.235 72.947 1.00 34.56 ? 280  ASN A CA  1 
ATOM   2154 C C   . ASN A 1 280 ? -4.998  50.984 72.122 1.00 34.22 ? 280  ASN A C   1 
ATOM   2155 O O   . ASN A 1 280 ? -4.791  49.893 72.681 1.00 34.77 ? 280  ASN A O   1 
ATOM   2156 C CB  . ASN A 1 280 ? -6.728  51.991 73.619 1.00 35.35 ? 280  ASN A CB  1 
ATOM   2157 C CG  . ASN A 1 280 ? -7.155  53.165 74.541 1.00 36.87 ? 280  ASN A CG  1 
ATOM   2158 O OD1 . ASN A 1 280 ? -6.311  53.970 74.947 1.00 38.89 ? 280  ASN A OD1 1 
ATOM   2159 N ND2 . ASN A 1 280 ? -8.449  53.243 74.889 1.00 35.21 ? 280  ASN A ND2 1 
ATOM   2160 N N   . VAL A 1 281 ? -4.881  51.109 70.804 1.00 34.48 ? 281  VAL A N   1 
ATOM   2161 C CA  . VAL A 1 281 ? -4.595  49.914 70.013 1.00 34.42 ? 281  VAL A CA  1 
ATOM   2162 C C   . VAL A 1 281 ? -3.140  49.676 69.640 1.00 35.75 ? 281  VAL A C   1 
ATOM   2163 O O   . VAL A 1 281 ? -2.836  48.692 68.951 1.00 34.42 ? 281  VAL A O   1 
ATOM   2164 C CB  . VAL A 1 281 ? -5.457  49.860 68.686 1.00 36.65 ? 281  VAL A CB  1 
ATOM   2165 C CG1 . VAL A 1 281 ? -6.951  50.083 69.031 1.00 33.19 ? 281  VAL A CG1 1 
ATOM   2166 C CG2 . VAL A 1 281 ? -4.953  50.897 67.651 1.00 35.39 ? 281  VAL A CG2 1 
ATOM   2167 N N   . LEU A 1 282 ? -2.249  50.562 70.081 1.00 35.19 ? 282  LEU A N   1 
ATOM   2168 C CA  . LEU A 1 282 ? -0.831  50.391 69.776 1.00 35.96 ? 282  LEU A CA  1 
ATOM   2169 C C   . LEU A 1 282 ? -0.405  49.077 70.423 1.00 37.72 ? 282  LEU A C   1 
ATOM   2170 O O   . LEU A 1 282 ? -0.766  48.796 71.563 1.00 38.01 ? 282  LEU A O   1 
ATOM   2171 C CB  . LEU A 1 282 ? -0.007  51.568 70.337 1.00 33.95 ? 282  LEU A CB  1 
ATOM   2172 C CG  . LEU A 1 282 ? -0.204  52.852 69.469 1.00 32.93 ? 282  LEU A CG  1 
ATOM   2173 C CD1 . LEU A 1 282 ? 0.473   54.034 70.129 1.00 36.10 ? 282  LEU A CD1 1 
ATOM   2174 C CD2 . LEU A 1 282 ? 0.359   52.673 68.095 1.00 29.54 ? 282  LEU A CD2 1 
ATOM   2175 N N   . PRO A 1 283 ? 0.383   48.262 69.718 1.00 37.53 ? 283  PRO A N   1 
ATOM   2176 C CA  . PRO A 1 283 ? 0.776   46.993 70.353 1.00 39.08 ? 283  PRO A CA  1 
ATOM   2177 C C   . PRO A 1 283 ? 1.791   47.134 71.477 1.00 39.36 ? 283  PRO A C   1 
ATOM   2178 O O   . PRO A 1 283 ? 1.791   46.330 72.392 1.00 40.42 ? 283  PRO A O   1 
ATOM   2179 C CB  . PRO A 1 283 ? 1.337   46.158 69.169 1.00 38.44 ? 283  PRO A CB  1 
ATOM   2180 C CG  . PRO A 1 283 ? 1.984   47.265 68.317 1.00 37.77 ? 283  PRO A CG  1 
ATOM   2181 C CD  . PRO A 1 283 ? 0.929   48.385 68.355 1.00 36.77 ? 283  PRO A CD  1 
ATOM   2182 N N   . PHE A 1 284 ? 2.656   48.141 71.405 1.00 39.72 ? 284  PHE A N   1 
ATOM   2183 C CA  . PHE A 1 284 ? 3.693   48.339 72.422 1.00 38.47 ? 284  PHE A CA  1 
ATOM   2184 C C   . PHE A 1 284 ? 3.680   49.722 73.095 1.00 37.26 ? 284  PHE A C   1 
ATOM   2185 O O   . PHE A 1 284 ? 3.144   50.684 72.554 1.00 36.48 ? 284  PHE A O   1 
ATOM   2186 C CB  . PHE A 1 284 ? 5.079   48.172 71.795 1.00 41.23 ? 284  PHE A CB  1 
ATOM   2187 C CG  . PHE A 1 284 ? 5.191   46.996 70.870 1.00 45.03 ? 284  PHE A CG  1 
ATOM   2188 C CD1 . PHE A 1 284 ? 5.147   45.686 71.378 1.00 46.32 ? 284  PHE A CD1 1 
ATOM   2189 C CD2 . PHE A 1 284 ? 5.291   47.200 69.477 1.00 45.23 ? 284  PHE A CD2 1 
ATOM   2190 C CE1 . PHE A 1 284 ? 5.196   44.560 70.496 1.00 48.81 ? 284  PHE A CE1 1 
ATOM   2191 C CE2 . PHE A 1 284 ? 5.341   46.120 68.584 1.00 47.32 ? 284  PHE A CE2 1 
ATOM   2192 C CZ  . PHE A 1 284 ? 5.292   44.778 69.093 1.00 48.13 ? 284  PHE A CZ  1 
ATOM   2193 N N   . ASP A 1 285 ? 4.299   49.798 74.273 1.00 34.66 ? 285  ASP A N   1 
ATOM   2194 C CA  . ASP A 1 285 ? 4.460   51.046 75.001 1.00 33.53 ? 285  ASP A CA  1 
ATOM   2195 C C   . ASP A 1 285 ? 5.468   51.686 74.061 1.00 32.96 ? 285  ASP A C   1 
ATOM   2196 O O   . ASP A 1 285 ? 6.559   51.177 73.858 1.00 33.41 ? 285  ASP A O   1 
ATOM   2197 C CB  . ASP A 1 285 ? 5.122   50.774 76.333 1.00 33.71 ? 285  ASP A CB  1 
ATOM   2198 C CG  . ASP A 1 285 ? 5.107   51.974 77.233 1.00 35.14 ? 285  ASP A CG  1 
ATOM   2199 O OD1 . ASP A 1 285 ? 4.639   53.047 76.775 1.00 33.21 ? 285  ASP A OD1 1 
ATOM   2200 O OD2 . ASP A 1 285 ? 5.578   51.823 78.394 1.00 35.32 ? 285  ASP A OD2 1 
ATOM   2201 N N   . SER A 1 286 ? 5.161   52.816 73.499 1.00 31.95 ? 286  SER A N   1 
ATOM   2202 C CA  . SER A 1 286 ? 6.116   53.262 72.525 1.00 33.94 ? 286  SER A CA  1 
ATOM   2203 C C   . SER A 1 286 ? 6.045   54.722 72.300 1.00 34.05 ? 286  SER A C   1 
ATOM   2204 O O   . SER A 1 286 ? 5.095   55.377 72.721 1.00 36.92 ? 286  SER A O   1 
ATOM   2205 C CB  . SER A 1 286 ? 5.813   52.553 71.185 1.00 35.82 ? 286  SER A CB  1 
ATOM   2206 O OG  . SER A 1 286 ? 4.526   52.971 70.734 1.00 37.57 ? 286  SER A OG  1 
ATOM   2207 N N   . ILE A 1 287 ? 7.043   55.216 71.585 1.00 34.37 ? 287  ILE A N   1 
ATOM   2208 C CA  . ILE A 1 287 ? 7.112   56.615 71.215 1.00 32.78 ? 287  ILE A CA  1 
ATOM   2209 C C   . ILE A 1 287 ? 7.276   56.678 69.681 1.00 33.05 ? 287  ILE A C   1 
ATOM   2210 O O   . ILE A 1 287 ? 7.839   55.762 69.065 1.00 31.82 ? 287  ILE A O   1 
ATOM   2211 C CB  . ILE A 1 287 ? 8.257   57.254 72.076 1.00 35.76 ? 287  ILE A CB  1 
ATOM   2212 C CG1 . ILE A 1 287 ? 7.683   58.483 72.700 1.00 37.26 ? 287  ILE A CG1 1 
ATOM   2213 C CG2 . ILE A 1 287 ? 9.564   57.472 71.384 1.00 30.32 ? 287  ILE A CG2 1 
ATOM   2214 C CD1 . ILE A 1 287 ? 6.782   58.099 73.712 1.00 40.34 ? 287  ILE A CD1 1 
ATOM   2215 N N   . PHE A 1 288 ? 6.741   57.712 69.052 1.00 31.18 ? 288  PHE A N   1 
ATOM   2216 C CA  . PHE A 1 288 ? 6.837   57.852 67.596 1.00 30.97 ? 288  PHE A CA  1 
ATOM   2217 C C   . PHE A 1 288 ? 6.157   56.683 66.846 1.00 32.23 ? 288  PHE A C   1 
ATOM   2218 O O   . PHE A 1 288 ? 6.725   56.142 65.881 1.00 33.64 ? 288  PHE A O   1 
ATOM   2219 C CB  . PHE A 1 288 ? 8.302   57.948 67.132 1.00 29.67 ? 288  PHE A CB  1 
ATOM   2220 C CG  . PHE A 1 288 ? 8.532   58.941 65.985 1.00 29.68 ? 288  PHE A CG  1 
ATOM   2221 C CD1 . PHE A 1 288 ? 7.701   58.938 64.837 1.00 28.54 ? 288  PHE A CD1 1 
ATOM   2222 C CD2 . PHE A 1 288 ? 9.583   59.864 66.041 1.00 28.27 ? 288  PHE A CD2 1 
ATOM   2223 C CE1 . PHE A 1 288 ? 7.914   59.825 63.767 1.00 29.10 ? 288  PHE A CE1 1 
ATOM   2224 C CE2 . PHE A 1 288 ? 9.814   60.771 64.977 1.00 29.19 ? 288  PHE A CE2 1 
ATOM   2225 C CZ  . PHE A 1 288 ? 8.972   60.752 63.827 1.00 29.55 ? 288  PHE A CZ  1 
ATOM   2226 N N   . ARG A 1 289 ? 4.977   56.273 67.310 1.00 31.25 ? 289  ARG A N   1 
ATOM   2227 C CA  . ARG A 1 289 ? 4.220   55.183 66.677 1.00 32.49 ? 289  ARG A CA  1 
ATOM   2228 C C   . ARG A 1 289 ? 2.771   55.688 66.679 1.00 33.20 ? 289  ARG A C   1 
ATOM   2229 O O   . ARG A 1 289 ? 2.314   56.298 67.647 1.00 32.53 ? 289  ARG A O   1 
ATOM   2230 C CB  . ARG A 1 289 ? 4.331   53.844 67.454 1.00 31.28 ? 289  ARG A CB  1 
ATOM   2231 C CG  . ARG A 1 289 ? 5.662   53.153 67.337 1.00 30.61 ? 289  ARG A CG  1 
ATOM   2232 C CD  . ARG A 1 289 ? 6.099   52.935 65.891 1.00 31.49 ? 289  ARG A CD  1 
ATOM   2233 N NE  . ARG A 1 289 ? 7.368   52.204 65.839 1.00 31.04 ? 289  ARG A NE  1 
ATOM   2234 C CZ  . ARG A 1 289 ? 8.576   52.762 65.721 1.00 30.53 ? 289  ARG A CZ  1 
ATOM   2235 N NH1 . ARG A 1 289 ? 8.705   54.073 65.642 1.00 28.98 ? 289  ARG A NH1 1 
ATOM   2236 N NH2 . ARG A 1 289 ? 9.658   51.998 65.668 1.00 30.28 ? 289  ARG A NH2 1 
ATOM   2237 N N   . PHE A 1 290 ? 2.080   55.459 65.569 1.00 32.83 ? 290  PHE A N   1 
ATOM   2238 C CA  . PHE A 1 290 ? 0.728   55.954 65.420 1.00 32.56 ? 290  PHE A CA  1 
ATOM   2239 C C   . PHE A 1 290 ? -0.161  54.768 65.092 1.00 32.01 ? 290  PHE A C   1 
ATOM   2240 O O   . PHE A 1 290 ? 0.256   53.836 64.451 1.00 31.65 ? 290  PHE A O   1 
ATOM   2241 C CB  . PHE A 1 290 ? 0.751   57.034 64.323 1.00 33.31 ? 290  PHE A CB  1 
ATOM   2242 C CG  . PHE A 1 290 ? 1.892   58.039 64.493 1.00 31.17 ? 290  PHE A CG  1 
ATOM   2243 C CD1 . PHE A 1 290 ? 1.894   58.933 65.544 1.00 31.29 ? 290  PHE A CD1 1 
ATOM   2244 C CD2 . PHE A 1 290 ? 2.978   58.050 63.611 1.00 31.99 ? 290  PHE A CD2 1 
ATOM   2245 C CE1 . PHE A 1 290 ? 2.961   59.841 65.727 1.00 32.04 ? 290  PHE A CE1 1 
ATOM   2246 C CE2 . PHE A 1 290 ? 4.047   58.940 63.769 1.00 29.74 ? 290  PHE A CE2 1 
ATOM   2247 C CZ  . PHE A 1 290 ? 4.048   59.841 64.824 1.00 29.72 ? 290  PHE A CZ  1 
ATOM   2248 N N   . SER A 1 291 ? -1.394  54.808 65.543 1.00 32.74 ? 291  SER A N   1 
ATOM   2249 C CA  . SER A 1 291 ? -2.305  53.684 65.346 1.00 34.31 ? 291  SER A CA  1 
ATOM   2250 C C   . SER A 1 291 ? -2.709  53.224 63.931 1.00 34.18 ? 291  SER A C   1 
ATOM   2251 O O   . SER A 1 291 ? -2.540  52.051 63.575 1.00 34.21 ? 291  SER A O   1 
ATOM   2252 C CB  . SER A 1 291 ? -3.554  53.964 66.154 1.00 33.90 ? 291  SER A CB  1 
ATOM   2253 O OG  . SER A 1 291 ? -3.177  53.891 67.504 1.00 35.89 ? 291  SER A OG  1 
ATOM   2254 N N   . PHE A 1 292 ? -3.221  54.161 63.138 1.00 32.87 ? 292  PHE A N   1 
ATOM   2255 C CA  . PHE A 1 292 ? -3.693  53.857 61.785 1.00 31.44 ? 292  PHE A CA  1 
ATOM   2256 C C   . PHE A 1 292 ? -2.855  54.526 60.732 1.00 29.88 ? 292  PHE A C   1 
ATOM   2257 O O   . PHE A 1 292 ? -2.922  55.738 60.525 1.00 28.88 ? 292  PHE A O   1 
ATOM   2258 C CB  . PHE A 1 292 ? -5.134  54.303 61.679 1.00 30.62 ? 292  PHE A CB  1 
ATOM   2259 C CG  . PHE A 1 292 ? -5.988  53.648 62.696 1.00 32.39 ? 292  PHE A CG  1 
ATOM   2260 C CD1 . PHE A 1 292 ? -6.345  52.290 62.544 1.00 33.34 ? 292  PHE A CD1 1 
ATOM   2261 C CD2 . PHE A 1 292 ? -6.357  54.325 63.856 1.00 31.01 ? 292  PHE A CD2 1 
ATOM   2262 C CE1 . PHE A 1 292 ? -7.068  51.610 63.559 1.00 33.15 ? 292  PHE A CE1 1 
ATOM   2263 C CE2 . PHE A 1 292 ? -7.065  53.665 64.869 1.00 31.23 ? 292  PHE A CE2 1 
ATOM   2264 C CZ  . PHE A 1 292 ? -7.416  52.297 64.712 1.00 32.15 ? 292  PHE A CZ  1 
ATOM   2265 N N   . VAL A 1 293 ? -2.085  53.706 60.060 1.00 27.60 ? 293  VAL A N   1 
ATOM   2266 C CA  . VAL A 1 293 ? -1.195  54.171 59.061 1.00 28.71 ? 293  VAL A CA  1 
ATOM   2267 C C   . VAL A 1 293 ? -1.371  53.266 57.830 1.00 30.35 ? 293  VAL A C   1 
ATOM   2268 O O   . VAL A 1 293 ? -2.107  52.284 57.877 1.00 29.52 ? 293  VAL A O   1 
ATOM   2269 C CB  . VAL A 1 293 ? 0.273   54.030 59.606 1.00 28.49 ? 293  VAL A CB  1 
ATOM   2270 C CG1 . VAL A 1 293 ? 0.526   54.975 60.810 1.00 24.35 ? 293  VAL A CG1 1 
ATOM   2271 C CG2 . VAL A 1 293 ? 0.520   52.570 60.011 1.00 26.78 ? 293  VAL A CG2 1 
ATOM   2272 N N   . PRO A 1 294 ? -0.706  53.614 56.716 1.00 31.06 ? 294  PRO A N   1 
ATOM   2273 C CA  . PRO A 1 294 ? -0.761  52.830 55.477 1.00 32.25 ? 294  PRO A CA  1 
ATOM   2274 C C   . PRO A 1 294 ? -0.452  51.319 55.735 1.00 33.74 ? 294  PRO A C   1 
ATOM   2275 O O   . PRO A 1 294 ? 0.297   50.973 56.653 1.00 34.81 ? 294  PRO A O   1 
ATOM   2276 C CB  . PRO A 1 294 ? 0.318   53.507 54.613 1.00 28.16 ? 294  PRO A CB  1 
ATOM   2277 C CG  . PRO A 1 294 ? 0.098   54.983 54.954 1.00 30.71 ? 294  PRO A CG  1 
ATOM   2278 C CD  . PRO A 1 294 ? -0.150  54.972 56.471 1.00 29.50 ? 294  PRO A CD  1 
ATOM   2279 N N   . VAL A 1 295 ? -1.017  50.443 54.916 1.00 34.10 ? 295  VAL A N   1 
ATOM   2280 C CA  . VAL A 1 295 ? -0.797  48.992 54.994 1.00 34.47 ? 295  VAL A CA  1 
ATOM   2281 C C   . VAL A 1 295 ? -0.194  48.515 53.709 1.00 33.84 ? 295  VAL A C   1 
ATOM   2282 O O   . VAL A 1 295 ? -0.560  48.981 52.622 1.00 32.74 ? 295  VAL A O   1 
ATOM   2283 C CB  . VAL A 1 295 ? -2.096  48.142 55.163 1.00 35.91 ? 295  VAL A CB  1 
ATOM   2284 C CG1 . VAL A 1 295 ? -2.626  48.313 56.520 1.00 39.28 ? 295  VAL A CG1 1 
ATOM   2285 C CG2 . VAL A 1 295 ? -3.168  48.550 54.142 1.00 37.51 ? 295  VAL A CG2 1 
ATOM   2286 N N   . ILE A 1 296 ? 0.745   47.590 53.853 1.00 34.50 ? 296  ILE A N   1 
ATOM   2287 C CA  . ILE A 1 296 ? 1.428   46.980 52.729 1.00 35.51 ? 296  ILE A CA  1 
ATOM   2288 C C   . ILE A 1 296 ? 0.352   45.951 52.303 1.00 38.25 ? 296  ILE A C   1 
ATOM   2289 O O   . ILE A 1 296 ? 0.244   44.838 52.839 1.00 38.09 ? 296  ILE A O   1 
ATOM   2290 C CB  . ILE A 1 296 ? 2.747   46.351 53.224 1.00 34.85 ? 296  ILE A CB  1 
ATOM   2291 C CG1 . ILE A 1 296 ? 3.591   47.427 53.935 1.00 33.93 ? 296  ILE A CG1 1 
ATOM   2292 C CG2 . ILE A 1 296 ? 3.511   45.730 52.027 1.00 35.31 ? 296  ILE A CG2 1 
ATOM   2293 C CD1 . ILE A 1 296 ? 3.839   48.741 53.053 1.00 31.16 ? 296  ILE A CD1 1 
ATOM   2294 N N   . ASP A 1 297 ? -0.493  46.374 51.368 1.00 38.32 ? 297  ASP A N   1 
ATOM   2295 C CA  . ASP A 1 297 ? -1.636  45.562 50.958 1.00 40.29 ? 297  ASP A CA  1 
ATOM   2296 C C   . ASP A 1 297 ? -1.541  44.769 49.656 1.00 40.85 ? 297  ASP A C   1 
ATOM   2297 O O   . ASP A 1 297 ? -2.485  44.090 49.323 1.00 42.60 ? 297  ASP A O   1 
ATOM   2298 C CB  . ASP A 1 297 ? -2.855  46.476 50.835 1.00 38.52 ? 297  ASP A CB  1 
ATOM   2299 C CG  . ASP A 1 297 ? -2.672  47.523 49.721 1.00 40.72 ? 297  ASP A CG  1 
ATOM   2300 O OD1 . ASP A 1 297 ? -1.520  47.660 49.217 1.00 38.01 ? 297  ASP A OD1 1 
ATOM   2301 O OD2 . ASP A 1 297 ? -3.668  48.198 49.356 1.00 42.20 ? 297  ASP A OD2 1 
ATOM   2302 N N   . GLY A 1 298 ? -0.459  44.865 48.900 1.00 42.06 ? 298  GLY A N   1 
ATOM   2303 C CA  . GLY A 1 298 ? -0.439  44.138 47.637 1.00 42.85 ? 298  GLY A CA  1 
ATOM   2304 C C   . GLY A 1 298 ? -1.131  44.876 46.467 1.00 44.70 ? 298  GLY A C   1 
ATOM   2305 O O   . GLY A 1 298 ? -1.068  44.380 45.336 1.00 46.22 ? 298  GLY A O   1 
ATOM   2306 N N   . GLU A 1 299 ? -1.801  46.016 46.716 1.00 43.64 ? 299  GLU A N   1 
ATOM   2307 C CA  . GLU A 1 299 ? -2.483  46.815 45.677 1.00 42.96 ? 299  GLU A CA  1 
ATOM   2308 C C   . GLU A 1 299 ? -1.817  48.200 45.525 1.00 40.12 ? 299  GLU A C   1 
ATOM   2309 O O   . GLU A 1 299 ? -1.135  48.448 44.534 1.00 40.23 ? 299  GLU A O   1 
ATOM   2310 C CB  . GLU A 1 299 ? -3.975  46.972 46.011 1.00 47.24 ? 299  GLU A CB  1 
ATOM   2311 C CG  . GLU A 1 299 ? -4.709  45.627 45.929 1.00 57.88 ? 299  GLU A CG  1 
ATOM   2312 C CD  . GLU A 1 299 ? -6.123  45.632 46.530 1.00 62.74 ? 299  GLU A CD  1 
ATOM   2313 O OE1 . GLU A 1 299 ? -6.478  44.606 47.191 1.00 64.06 ? 299  GLU A OE1 1 
ATOM   2314 O OE2 . GLU A 1 299 ? -6.868  46.644 46.331 1.00 65.81 ? 299  GLU A OE2 1 
ATOM   2315 N N   . PHE A 1 300 ? -2.028  49.100 46.486 1.00 37.01 ? 300  PHE A N   1 
ATOM   2316 C CA  . PHE A 1 300 ? -1.375  50.409 46.458 1.00 36.25 ? 300  PHE A CA  1 
ATOM   2317 C C   . PHE A 1 300 ? 0.170   50.138 46.434 1.00 37.50 ? 300  PHE A C   1 
ATOM   2318 O O   . PHE A 1 300 ? 0.906   50.724 45.649 1.00 37.76 ? 300  PHE A O   1 
ATOM   2319 C CB  . PHE A 1 300 ? -1.801  51.227 47.687 1.00 34.42 ? 300  PHE A CB  1 
ATOM   2320 C CG  . PHE A 1 300 ? -1.421  52.695 47.604 1.00 37.19 ? 300  PHE A CG  1 
ATOM   2321 C CD1 . PHE A 1 300 ? -0.083  53.115 47.830 1.00 36.14 ? 300  PHE A CD1 1 
ATOM   2322 C CD2 . PHE A 1 300 ? -2.375  53.662 47.237 1.00 34.70 ? 300  PHE A CD2 1 
ATOM   2323 C CE1 . PHE A 1 300 ? 0.283   54.482 47.679 1.00 34.98 ? 300  PHE A CE1 1 
ATOM   2324 C CE2 . PHE A 1 300 ? -2.016  55.011 47.086 1.00 34.29 ? 300  PHE A CE2 1 
ATOM   2325 C CZ  . PHE A 1 300 ? -0.684  55.414 47.307 1.00 34.01 ? 300  PHE A CZ  1 
ATOM   2326 N N   . PHE A 1 301 ? 0.637   49.204 47.263 1.00 36.80 ? 301  PHE A N   1 
ATOM   2327 C CA  . PHE A 1 301 ? 2.058   48.819 47.312 1.00 36.49 ? 301  PHE A CA  1 
ATOM   2328 C C   . PHE A 1 301 ? 2.011   47.358 46.789 1.00 38.04 ? 301  PHE A C   1 
ATOM   2329 O O   . PHE A 1 301 ? 1.498   46.466 47.482 1.00 37.35 ? 301  PHE A O   1 
ATOM   2330 C CB  . PHE A 1 301 ? 2.546   48.876 48.761 1.00 32.43 ? 301  PHE A CB  1 
ATOM   2331 C CG  . PHE A 1 301 ? 2.427   50.242 49.386 1.00 31.97 ? 301  PHE A CG  1 
ATOM   2332 C CD1 . PHE A 1 301 ? 3.265   51.287 48.975 1.00 30.62 ? 301  PHE A CD1 1 
ATOM   2333 C CD2 . PHE A 1 301 ? 1.499   50.486 50.400 1.00 31.83 ? 301  PHE A CD2 1 
ATOM   2334 C CE1 . PHE A 1 301 ? 3.192   52.562 49.568 1.00 30.89 ? 301  PHE A CE1 1 
ATOM   2335 C CE2 . PHE A 1 301 ? 1.411   51.785 51.024 1.00 31.35 ? 301  PHE A CE2 1 
ATOM   2336 C CZ  . PHE A 1 301 ? 2.266   52.815 50.598 1.00 30.26 ? 301  PHE A CZ  1 
ATOM   2337 N N   . PRO A 1 302 ? 2.534   47.097 45.571 1.00 38.65 ? 302  PRO A N   1 
ATOM   2338 C CA  . PRO A 1 302 ? 2.453   45.699 45.090 1.00 40.09 ? 302  PRO A CA  1 
ATOM   2339 C C   . PRO A 1 302 ? 3.195   44.625 45.885 1.00 39.81 ? 302  PRO A C   1 
ATOM   2340 O O   . PRO A 1 302 ? 2.717   43.506 45.975 1.00 40.01 ? 302  PRO A O   1 
ATOM   2341 C CB  . PRO A 1 302 ? 2.890   45.796 43.614 1.00 39.47 ? 302  PRO A CB  1 
ATOM   2342 C CG  . PRO A 1 302 ? 3.727   47.065 43.591 1.00 41.40 ? 302  PRO A CG  1 
ATOM   2343 C CD  . PRO A 1 302 ? 3.044   48.006 44.526 1.00 36.90 ? 302  PRO A CD  1 
ATOM   2344 N N   . THR A 1 303 ? 4.354   44.961 46.440 1.00 38.92 ? 303  THR A N   1 
ATOM   2345 C CA  . THR A 1 303 ? 5.105   44.041 47.277 1.00 39.83 ? 303  THR A CA  1 
ATOM   2346 C C   . THR A 1 303 ? 5.693   44.869 48.430 1.00 39.77 ? 303  THR A C   1 
ATOM   2347 O O   . THR A 1 303 ? 5.402   46.072 48.567 1.00 39.55 ? 303  THR A O   1 
ATOM   2348 C CB  . THR A 1 303 ? 6.259   43.345 46.512 1.00 41.26 ? 303  THR A CB  1 
ATOM   2349 O OG1 . THR A 1 303 ? 7.244   44.306 46.136 1.00 41.70 ? 303  THR A OG1 1 
ATOM   2350 C CG2 . THR A 1 303 ? 5.751   42.720 45.233 1.00 42.84 ? 303  THR A CG2 1 
ATOM   2351 N N   . SER A 1 304 ? 6.528   44.245 49.243 1.00 37.51 ? 304  SER A N   1 
ATOM   2352 C CA  . SER A 1 304 ? 7.108   44.964 50.360 1.00 37.19 ? 304  SER A CA  1 
ATOM   2353 C C   . SER A 1 304 ? 7.917   46.195 49.886 1.00 35.81 ? 304  SER A C   1 
ATOM   2354 O O   . SER A 1 304 ? 8.528   46.194 48.796 1.00 34.72 ? 304  SER A O   1 
ATOM   2355 C CB  . SER A 1 304 ? 8.005   44.034 51.189 1.00 37.66 ? 304  SER A CB  1 
ATOM   2356 O OG  . SER A 1 304 ? 9.197   43.775 50.482 1.00 38.99 ? 304  SER A OG  1 
ATOM   2357 N N   . LEU A 1 305 ? 7.921   47.237 50.715 1.00 34.56 ? 305  LEU A N   1 
ATOM   2358 C CA  . LEU A 1 305 ? 8.603   48.451 50.342 1.00 35.62 ? 305  LEU A CA  1 
ATOM   2359 C C   . LEU A 1 305 ? 10.084  48.194 50.013 1.00 36.58 ? 305  LEU A C   1 
ATOM   2360 O O   . LEU A 1 305 ? 10.611  48.720 49.006 1.00 35.88 ? 305  LEU A O   1 
ATOM   2361 C CB  . LEU A 1 305 ? 8.450   49.467 51.443 1.00 33.94 ? 305  LEU A CB  1 
ATOM   2362 C CG  . LEU A 1 305 ? 7.024   49.859 51.847 1.00 34.16 ? 305  LEU A CG  1 
ATOM   2363 C CD1 . LEU A 1 305 ? 7.133   50.991 52.895 1.00 32.39 ? 305  LEU A CD1 1 
ATOM   2364 C CD2 . LEU A 1 305 ? 6.190   50.316 50.647 1.00 35.47 ? 305  LEU A CD2 1 
ATOM   2365 N N   . GLU A 1 306 ? 10.740  47.356 50.828 1.00 36.40 ? 306  GLU A N   1 
ATOM   2366 C CA  . GLU A 1 306 ? 12.144  47.030 50.611 1.00 36.86 ? 306  GLU A CA  1 
ATOM   2367 C C   . GLU A 1 306 ? 12.395  46.296 49.284 1.00 36.83 ? 306  GLU A C   1 
ATOM   2368 O O   . GLU A 1 306 ? 13.366  46.588 48.598 1.00 36.16 ? 306  GLU A O   1 
ATOM   2369 C CB  . GLU A 1 306 ? 12.698  46.188 51.793 1.00 39.33 ? 306  GLU A CB  1 
ATOM   2370 C CG  . GLU A 1 306 ? 14.178  45.819 51.667 1.00 41.62 ? 306  GLU A CG  1 
ATOM   2371 C CD  . GLU A 1 306 ? 15.120  47.050 51.646 1.00 46.12 ? 306  GLU A CD  1 
ATOM   2372 O OE1 . GLU A 1 306 ? 14.662  48.178 51.959 1.00 48.06 ? 306  GLU A OE1 1 
ATOM   2373 O OE2 . GLU A 1 306 ? 16.323  46.890 51.339 1.00 46.46 ? 306  GLU A OE2 1 
ATOM   2374 N N   . SER A 1 307 ? 11.545  45.345 48.892 1.00 36.23 ? 307  SER A N   1 
ATOM   2375 C CA  . SER A 1 307 ? 11.854  44.687 47.613 1.00 37.32 ? 307  SER A CA  1 
ATOM   2376 C C   . SER A 1 307 ? 11.588  45.645 46.442 1.00 36.06 ? 307  SER A C   1 
ATOM   2377 O O   . SER A 1 307 ? 12.268  45.586 45.423 1.00 35.15 ? 307  SER A O   1 
ATOM   2378 C CB  . SER A 1 307 ? 11.080  43.373 47.442 1.00 36.11 ? 307  SER A CB  1 
ATOM   2379 O OG  . SER A 1 307 ? 9.700   43.598 47.511 1.00 42.06 ? 307  SER A OG  1 
ATOM   2380 N N   . MET A 1 308 ? 10.609  46.530 46.606 1.00 34.92 ? 308  MET A N   1 
ATOM   2381 C CA  . MET A 1 308 ? 10.340  47.528 45.581 1.00 34.59 ? 308  MET A CA  1 
ATOM   2382 C C   . MET A 1 308 ? 11.566  48.434 45.471 1.00 34.04 ? 308  MET A C   1 
ATOM   2383 O O   . MET A 1 308 ? 11.998  48.766 44.389 1.00 32.58 ? 308  MET A O   1 
ATOM   2384 C CB  . MET A 1 308 ? 9.106   48.360 45.951 1.00 34.61 ? 308  MET A CB  1 
ATOM   2385 C CG  . MET A 1 308 ? 7.797   47.635 45.793 1.00 31.94 ? 308  MET A CG  1 
ATOM   2386 S SD  . MET A 1 308 ? 6.331   48.688 46.056 1.00 36.28 ? 308  MET A SD  1 
ATOM   2387 C CE  . MET A 1 308 ? 6.533   49.787 44.539 1.00 34.50 ? 308  MET A CE  1 
ATOM   2388 N N   . LEU A 1 309 ? 12.136  48.842 46.599 1.00 35.95 ? 309  LEU A N   1 
ATOM   2389 C CA  . LEU A 1 309 ? 13.316  49.696 46.525 1.00 38.22 ? 309  LEU A CA  1 
ATOM   2390 C C   . LEU A 1 309 ? 14.493  48.969 45.891 1.00 40.69 ? 309  LEU A C   1 
ATOM   2391 O O   . LEU A 1 309 ? 15.223  49.546 45.072 1.00 41.56 ? 309  LEU A O   1 
ATOM   2392 C CB  . LEU A 1 309 ? 13.701  50.198 47.910 1.00 37.47 ? 309  LEU A CB  1 
ATOM   2393 C CG  . LEU A 1 309 ? 12.712  51.273 48.396 1.00 37.60 ? 309  LEU A CG  1 
ATOM   2394 C CD1 . LEU A 1 309 ? 12.940  51.474 49.868 1.00 37.17 ? 309  LEU A CD1 1 
ATOM   2395 C CD2 . LEU A 1 309 ? 12.889  52.601 47.596 1.00 34.63 ? 309  LEU A CD2 1 
ATOM   2396 N N   . ASN A 1 310 ? 14.668  47.698 46.262 1.00 41.70 ? 310  ASN A N   1 
ATOM   2397 C CA  . ASN A 1 310 ? 15.753  46.897 45.743 1.00 42.52 ? 310  ASN A CA  1 
ATOM   2398 C C   . ASN A 1 310 ? 15.707  46.660 44.260 1.00 41.73 ? 310  ASN A C   1 
ATOM   2399 O O   . ASN A 1 310 ? 16.759  46.717 43.601 1.00 38.94 ? 310  ASN A O   1 
ATOM   2400 C CB  . ASN A 1 310 ? 15.833  45.532 46.440 1.00 45.22 ? 310  ASN A CB  1 
ATOM   2401 C CG  . ASN A 1 310 ? 16.629  45.595 47.713 1.00 48.24 ? 310  ASN A CG  1 
ATOM   2402 O OD1 . ASN A 1 310 ? 17.586  46.385 47.821 1.00 48.86 ? 310  ASN A OD1 1 
ATOM   2403 N ND2 . ASN A 1 310 ? 16.268  44.747 48.687 1.00 49.15 ? 310  ASN A ND2 1 
ATOM   2404 N N   . SER A 1 311 ? 14.498  46.408 43.740 1.00 40.99 ? 311  SER A N   1 
ATOM   2405 C CA  . SER A 1 311 ? 14.338  46.129 42.320 1.00 40.90 ? 311  SER A CA  1 
ATOM   2406 C C   . SER A 1 311 ? 14.093  47.352 41.437 1.00 40.62 ? 311  SER A C   1 
ATOM   2407 O O   . SER A 1 311 ? 13.853  47.207 40.224 1.00 41.65 ? 311  SER A O   1 
ATOM   2408 C CB  . SER A 1 311 ? 13.195  45.123 42.092 1.00 40.90 ? 311  SER A CB  1 
ATOM   2409 O OG  . SER A 1 311 ? 11.909  45.718 42.312 1.00 44.49 ? 311  SER A OG  1 
ATOM   2410 N N   . GLY A 1 312 ? 14.147  48.552 42.010 1.00 39.62 ? 312  GLY A N   1 
ATOM   2411 C CA  . GLY A 1 312 ? 13.895  49.740 41.199 1.00 36.12 ? 312  GLY A CA  1 
ATOM   2412 C C   . GLY A 1 312 ? 12.438  49.877 40.747 1.00 35.43 ? 312  GLY A C   1 
ATOM   2413 O O   . GLY A 1 312 ? 12.111  50.583 39.780 1.00 34.03 ? 312  GLY A O   1 
ATOM   2414 N N   . ASN A 1 313 ? 11.548  49.200 41.447 1.00 34.21 ? 313  ASN A N   1 
ATOM   2415 C CA  . ASN A 1 313 ? 10.145  49.270 41.115 1.00 34.91 ? 313  ASN A CA  1 
ATOM   2416 C C   . ASN A 1 313 ? 9.541   50.580 41.695 1.00 34.77 ? 313  ASN A C   1 
ATOM   2417 O O   . ASN A 1 313 ? 8.869   50.584 42.750 1.00 33.33 ? 313  ASN A O   1 
ATOM   2418 C CB  . ASN A 1 313 ? 9.432   48.054 41.686 1.00 35.92 ? 313  ASN A CB  1 
ATOM   2419 C CG  . ASN A 1 313 ? 8.006   47.957 41.217 1.00 38.64 ? 313  ASN A CG  1 
ATOM   2420 O OD1 . ASN A 1 313 ? 7.563   48.777 40.408 1.00 38.65 ? 313  ASN A OD1 1 
ATOM   2421 N ND2 . ASN A 1 313 ? 7.274   46.959 41.717 1.00 37.89 ? 313  ASN A ND2 1 
ATOM   2422 N N   . PHE A 1 314 ? 9.804   51.686 41.003 1.00 33.79 ? 314  PHE A N   1 
ATOM   2423 C CA  . PHE A 1 314 ? 9.311   52.998 41.439 1.00 33.78 ? 314  PHE A CA  1 
ATOM   2424 C C   . PHE A 1 314 ? 9.525   54.091 40.386 1.00 34.22 ? 314  PHE A C   1 
ATOM   2425 O O   . PHE A 1 314 ? 10.308  53.929 39.438 1.00 33.00 ? 314  PHE A O   1 
ATOM   2426 C CB  . PHE A 1 314 ? 9.947   53.418 42.805 1.00 31.87 ? 314  PHE A CB  1 
ATOM   2427 C CG  . PHE A 1 314 ? 11.460  53.347 42.849 1.00 30.73 ? 314  PHE A CG  1 
ATOM   2428 C CD1 . PHE A 1 314 ? 12.243  54.325 42.238 1.00 33.09 ? 314  PHE A CD1 1 
ATOM   2429 C CD2 . PHE A 1 314 ? 12.101  52.302 43.516 1.00 33.39 ? 314  PHE A CD2 1 
ATOM   2430 C CE1 . PHE A 1 314 ? 13.632  54.271 42.280 1.00 31.80 ? 314  PHE A CE1 1 
ATOM   2431 C CE2 . PHE A 1 314 ? 13.519  52.231 43.579 1.00 31.11 ? 314  PHE A CE2 1 
ATOM   2432 C CZ  . PHE A 1 314 ? 14.277  53.218 42.957 1.00 32.20 ? 314  PHE A CZ  1 
ATOM   2433 N N   . LYS A 1 315 ? 8.806   55.195 40.541 1.00 33.67 ? 315  LYS A N   1 
ATOM   2434 C CA  . LYS A 1 315 ? 8.949   56.262 39.594 1.00 33.22 ? 315  LYS A CA  1 
ATOM   2435 C C   . LYS A 1 315 ? 10.391  56.770 39.574 1.00 34.32 ? 315  LYS A C   1 
ATOM   2436 O O   . LYS A 1 315 ? 10.997  57.039 40.637 1.00 32.77 ? 315  LYS A O   1 
ATOM   2437 C CB  . LYS A 1 315 ? 7.998   57.404 39.937 1.00 32.66 ? 315  LYS A CB  1 
ATOM   2438 C CG  . LYS A 1 315 ? 7.975   58.518 38.864 1.00 31.70 ? 315  LYS A CG  1 
ATOM   2439 C CD  . LYS A 1 315 ? 7.122   59.725 39.370 1.00 31.65 ? 315  LYS A CD  1 
ATOM   2440 C CE  . LYS A 1 315 ? 7.023   60.831 38.330 1.00 29.95 ? 315  LYS A CE  1 
ATOM   2441 N NZ  . LYS A 1 315 ? 6.282   60.322 37.123 1.00 26.66 ? 315  LYS A NZ  1 
ATOM   2442 N N   . LYS A 1 316 ? 10.952  56.865 38.370 1.00 33.87 ? 316  LYS A N   1 
ATOM   2443 C CA  . LYS A 1 316 ? 12.295  57.388 38.228 1.00 36.47 ? 316  LYS A CA  1 
ATOM   2444 C C   . LYS A 1 316 ? 12.234  58.863 37.763 1.00 36.89 ? 316  LYS A C   1 
ATOM   2445 O O   . LYS A 1 316 ? 11.776  59.162 36.669 1.00 38.48 ? 316  LYS A O   1 
ATOM   2446 C CB  . LYS A 1 316 ? 13.083  56.567 37.218 1.00 40.21 ? 316  LYS A CB  1 
ATOM   2447 C CG  . LYS A 1 316 ? 13.622  55.279 37.766 1.00 44.06 ? 316  LYS A CG  1 
ATOM   2448 C CD  . LYS A 1 316 ? 12.774  54.159 37.374 1.00 48.39 ? 316  LYS A CD  1 
ATOM   2449 C CE  . LYS A 1 316 ? 13.325  52.851 37.919 1.00 49.59 ? 316  LYS A CE  1 
ATOM   2450 N NZ  . LYS A 1 316 ? 12.351  51.825 37.430 1.00 53.63 ? 316  LYS A NZ  1 
ATOM   2451 N N   . THR A 1 317 ? 12.694  59.788 38.601 1.00 35.61 ? 317  THR A N   1 
ATOM   2452 C CA  . THR A 1 317 ? 12.653  61.192 38.267 1.00 33.62 ? 317  THR A CA  1 
ATOM   2453 C C   . THR A 1 317 ? 13.681  61.781 39.231 1.00 34.41 ? 317  THR A C   1 
ATOM   2454 O O   . THR A 1 317 ? 14.514  61.020 39.754 1.00 35.45 ? 317  THR A O   1 
ATOM   2455 C CB  . THR A 1 317 ? 11.186  61.724 38.513 1.00 31.87 ? 317  THR A CB  1 
ATOM   2456 O OG1 . THR A 1 317 ? 11.105  63.097 38.140 1.00 32.03 ? 317  THR A OG1 1 
ATOM   2457 C CG2 . THR A 1 317 ? 10.771  61.534 39.999 1.00 33.13 ? 317  THR A CG2 1 
ATOM   2458 N N   . GLN A 1 318 ? 13.639  63.092 39.460 1.00 32.40 ? 318  GLN A N   1 
ATOM   2459 C CA  . GLN A 1 318 ? 14.549  63.764 40.394 1.00 33.57 ? 318  GLN A CA  1 
ATOM   2460 C C   . GLN A 1 318 ? 13.829  63.955 41.756 1.00 33.84 ? 318  GLN A C   1 
ATOM   2461 O O   . GLN A 1 318 ? 12.597  64.076 41.828 1.00 33.95 ? 318  GLN A O   1 
ATOM   2462 C CB  . GLN A 1 318 ? 14.983  65.175 39.879 1.00 33.01 ? 318  GLN A CB  1 
ATOM   2463 C CG  . GLN A 1 318 ? 15.531  65.230 38.435 1.00 36.02 ? 318  GLN A CG  1 
ATOM   2464 C CD  . GLN A 1 318 ? 14.407  65.172 37.349 1.00 38.14 ? 318  GLN A CD  1 
ATOM   2465 O OE1 . GLN A 1 318 ? 13.301  65.655 37.569 1.00 35.58 ? 318  GLN A OE1 1 
ATOM   2466 N NE2 . GLN A 1 318 ? 14.710  64.572 36.187 1.00 37.36 ? 318  GLN A NE2 1 
ATOM   2467 N N   . ILE A 1 319 ? 14.599  63.976 42.834 1.00 32.69 ? 319  ILE A N   1 
ATOM   2468 C CA  . ILE A 1 319 ? 14.024  64.189 44.148 1.00 31.80 ? 319  ILE A CA  1 
ATOM   2469 C C   . ILE A 1 319 ? 14.991  65.078 44.904 1.00 31.63 ? 319  ILE A C   1 
ATOM   2470 O O   . ILE A 1 319 ? 16.196  65.078 44.628 1.00 31.04 ? 319  ILE A O   1 
ATOM   2471 C CB  . ILE A 1 319 ? 13.817  62.846 44.956 1.00 31.02 ? 319  ILE A CB  1 
ATOM   2472 C CG1 . ILE A 1 319 ? 15.154  62.121 45.147 1.00 28.96 ? 319  ILE A CG1 1 
ATOM   2473 C CG2 . ILE A 1 319 ? 12.778  61.951 44.247 1.00 30.62 ? 319  ILE A CG2 1 
ATOM   2474 C CD1 . ILE A 1 319 ? 15.122  60.944 46.105 1.00 26.85 ? 319  ILE A CD1 1 
ATOM   2475 N N   . LEU A 1 320 ? 14.432  65.867 45.808 1.00 30.19 ? 320  LEU A N   1 
ATOM   2476 C CA  . LEU A 1 320 ? 15.166  66.743 46.682 1.00 30.69 ? 320  LEU A CA  1 
ATOM   2477 C C   . LEU A 1 320 ? 14.551  66.431 48.060 1.00 30.83 ? 320  LEU A C   1 
ATOM   2478 O O   . LEU A 1 320 ? 13.320  66.443 48.221 1.00 32.93 ? 320  LEU A O   1 
ATOM   2479 C CB  . LEU A 1 320 ? 14.968  68.187 46.262 1.00 31.12 ? 320  LEU A CB  1 
ATOM   2480 C CG  . LEU A 1 320 ? 15.670  69.233 47.124 1.00 31.65 ? 320  LEU A CG  1 
ATOM   2481 C CD1 . LEU A 1 320 ? 15.916  70.542 46.258 1.00 32.51 ? 320  LEU A CD1 1 
ATOM   2482 C CD2 . LEU A 1 320 ? 14.818  69.533 48.335 1.00 31.68 ? 320  LEU A CD2 1 
ATOM   2483 N N   . LEU A 1 321 ? 15.399  66.111 49.031 1.00 29.97 ? 321  LEU A N   1 
ATOM   2484 C CA  . LEU A 1 321 ? 14.941  65.720 50.350 1.00 29.30 ? 321  LEU A CA  1 
ATOM   2485 C C   . LEU A 1 321 ? 16.027  65.988 51.394 1.00 29.45 ? 321  LEU A C   1 
ATOM   2486 O O   . LEU A 1 321 ? 17.191  66.265 51.066 1.00 30.65 ? 321  LEU A O   1 
ATOM   2487 C CB  . LEU A 1 321 ? 14.564  64.225 50.343 1.00 28.44 ? 321  LEU A CB  1 
ATOM   2488 C CG  . LEU A 1 321 ? 15.704  63.164 50.262 1.00 29.96 ? 321  LEU A CG  1 
ATOM   2489 C CD1 . LEU A 1 321 ? 15.077  61.736 50.215 1.00 25.57 ? 321  LEU A CD1 1 
ATOM   2490 C CD2 . LEU A 1 321 ? 16.590  63.358 48.985 1.00 26.88 ? 321  LEU A CD2 1 
ATOM   2491 N N   . GLY A 1 322 ? 15.637  65.907 52.659 1.00 28.98 ? 322  GLY A N   1 
ATOM   2492 C CA  . GLY A 1 322 ? 16.564  66.170 53.727 1.00 28.16 ? 322  GLY A CA  1 
ATOM   2493 C C   . GLY A 1 322 ? 15.937  65.992 55.083 1.00 29.88 ? 322  GLY A C   1 
ATOM   2494 O O   . GLY A 1 322 ? 14.746  65.616 55.188 1.00 29.38 ? 322  GLY A O   1 
ATOM   2495 N N   . VAL A 1 323 ? 16.737  66.286 56.119 1.00 29.82 ? 323  VAL A N   1 
ATOM   2496 C CA  . VAL A 1 323 ? 16.322  66.123 57.488 1.00 30.52 ? 323  VAL A CA  1 
ATOM   2497 C C   . VAL A 1 323 ? 16.761  67.298 58.367 1.00 32.48 ? 323  VAL A C   1 
ATOM   2498 O O   . VAL A 1 323 ? 17.566  68.116 57.960 1.00 33.18 ? 323  VAL A O   1 
ATOM   2499 C CB  . VAL A 1 323 ? 16.906  64.790 58.056 1.00 30.11 ? 323  VAL A CB  1 
ATOM   2500 C CG1 . VAL A 1 323 ? 16.519  63.592 57.148 1.00 31.20 ? 323  VAL A CG1 1 
ATOM   2501 C CG2 . VAL A 1 323 ? 18.392  64.846 58.135 1.00 30.31 ? 323  VAL A CG2 1 
ATOM   2502 N N   . ASN A 1 324 ? 16.198  67.392 59.560 1.00 32.50 ? 324  ASN A N   1 
ATOM   2503 C CA  . ASN A 1 324 ? 16.592  68.420 60.526 1.00 33.59 ? 324  ASN A CA  1 
ATOM   2504 C C   . ASN A 1 324 ? 17.513  67.766 61.590 1.00 33.22 ? 324  ASN A C   1 
ATOM   2505 O O   . ASN A 1 324 ? 17.490  66.532 61.815 1.00 32.70 ? 324  ASN A O   1 
ATOM   2506 C CB  . ASN A 1 324 ? 15.364  69.020 61.208 1.00 32.01 ? 324  ASN A CB  1 
ATOM   2507 C CG  . ASN A 1 324 ? 14.419  69.732 60.225 1.00 31.84 ? 324  ASN A CG  1 
ATOM   2508 O OD1 . ASN A 1 324 ? 14.690  69.848 59.020 1.00 29.79 ? 324  ASN A OD1 1 
ATOM   2509 N ND2 . ASN A 1 324 ? 13.299  70.211 60.752 1.00 30.01 ? 324  ASN A ND2 1 
ATOM   2510 N N   . LYS A 1 325 ? 18.296  68.593 62.266 1.00 33.75 ? 325  LYS A N   1 
ATOM   2511 C CA  . LYS A 1 325 ? 19.255  68.100 63.263 1.00 33.33 ? 325  LYS A CA  1 
ATOM   2512 C C   . LYS A 1 325 ? 18.668  67.349 64.444 1.00 32.06 ? 325  LYS A C   1 
ATOM   2513 O O   . LYS A 1 325 ? 19.279  66.371 64.890 1.00 30.57 ? 325  LYS A O   1 
ATOM   2514 C CB  . LYS A 1 325 ? 20.146  69.251 63.786 1.00 35.59 ? 325  LYS A CB  1 
ATOM   2515 C CG  . LYS A 1 325 ? 21.191  68.854 64.885 1.00 39.13 ? 325  LYS A CG  1 
ATOM   2516 C CD  . LYS A 1 325 ? 22.182  70.010 65.267 1.00 39.79 ? 325  LYS A CD  1 
ATOM   2517 C CE  . LYS A 1 325 ? 22.596  69.966 66.769 1.00 44.35 ? 325  LYS A CE  1 
ATOM   2518 N NZ  . LYS A 1 325 ? 21.541  70.661 67.766 1.00 42.64 ? 325  LYS A NZ  1 
ATOM   2519 N N   . ASP A 1 326 ? 17.503  67.774 64.948 1.00 29.87 ? 326  ASP A N   1 
ATOM   2520 C CA  . ASP A 1 326 ? 16.938  67.099 66.131 1.00 29.66 ? 326  ASP A CA  1 
ATOM   2521 C C   . ASP A 1 326 ? 15.502  66.600 65.912 1.00 31.37 ? 326  ASP A C   1 
ATOM   2522 O O   . ASP A 1 326 ? 14.537  66.989 66.647 1.00 32.51 ? 326  ASP A O   1 
ATOM   2523 C CB  . ASP A 1 326 ? 17.036  68.061 67.337 1.00 28.14 ? 326  ASP A CB  1 
ATOM   2524 C CG  . ASP A 1 326 ? 18.487  68.584 67.546 1.00 30.98 ? 326  ASP A CG  1 
ATOM   2525 O OD1 . ASP A 1 326 ? 19.377  67.794 67.958 1.00 29.19 ? 326  ASP A OD1 1 
ATOM   2526 O OD2 . ASP A 1 326 ? 18.749  69.771 67.247 1.00 30.06 ? 326  ASP A OD2 1 
ATOM   2527 N N   . GLU A 1 327 ? 15.357  65.761 64.890 1.00 29.71 ? 327  GLU A N   1 
ATOM   2528 C CA  . GLU A 1 327 ? 14.065  65.225 64.543 1.00 30.59 ? 327  GLU A CA  1 
ATOM   2529 C C   . GLU A 1 327 ? 13.352  64.635 65.765 1.00 30.59 ? 327  GLU A C   1 
ATOM   2530 O O   . GLU A 1 327 ? 12.148  64.845 65.913 1.00 31.50 ? 327  GLU A O   1 
ATOM   2531 C CB  . GLU A 1 327 ? 14.205  64.149 63.447 1.00 29.47 ? 327  GLU A CB  1 
ATOM   2532 C CG  . GLU A 1 327 ? 14.872  64.638 62.156 1.00 29.25 ? 327  GLU A CG  1 
ATOM   2533 C CD  . GLU A 1 327 ? 13.953  65.499 61.303 1.00 30.92 ? 327  GLU A CD  1 
ATOM   2534 O OE1 . GLU A 1 327 ? 12.911  65.972 61.826 1.00 33.23 ? 327  GLU A OE1 1 
ATOM   2535 O OE2 . GLU A 1 327 ? 14.260  65.724 60.111 1.00 31.50 ? 327  GLU A OE2 1 
ATOM   2536 N N   . GLY A 1 328 ? 14.076  63.958 66.664 1.00 29.14 ? 328  GLY A N   1 
ATOM   2537 C CA  . GLY A 1 328 ? 13.389  63.305 67.755 1.00 28.50 ? 328  GLY A CA  1 
ATOM   2538 C C   . GLY A 1 328 ? 12.928  64.091 68.974 1.00 29.74 ? 328  GLY A C   1 
ATOM   2539 O O   . GLY A 1 328 ? 12.086  63.616 69.741 1.00 29.15 ? 328  GLY A O   1 
ATOM   2540 N N   . SER A 1 329 ? 13.416  65.304 69.164 1.00 30.48 ? 329  SER A N   1 
ATOM   2541 C CA  . SER A 1 329 ? 13.101  65.954 70.425 1.00 30.75 ? 329  SER A CA  1 
ATOM   2542 C C   . SER A 1 329 ? 11.640  66.096 70.825 1.00 31.49 ? 329  SER A C   1 
ATOM   2543 O O   . SER A 1 329 ? 11.288  65.848 72.002 1.00 30.64 ? 329  SER A O   1 
ATOM   2544 C CB  . SER A 1 329 ? 13.806  67.314 70.514 1.00 30.21 ? 329  SER A CB  1 
ATOM   2545 O OG  . SER A 1 329 ? 13.251  68.260 69.629 1.00 28.76 ? 329  SER A OG  1 
ATOM   2546 N N   . PHE A 1 330 ? 10.750  66.450 69.898 1.00 32.44 ? 330  PHE A N   1 
ATOM   2547 C CA  . PHE A 1 330 ? 9.411   66.647 70.414 1.00 33.78 ? 330  PHE A CA  1 
ATOM   2548 C C   . PHE A 1 330 ? 8.693   65.351 70.802 1.00 33.03 ? 330  PHE A C   1 
ATOM   2549 O O   . PHE A 1 330 ? 7.845   65.345 71.721 1.00 33.36 ? 330  PHE A O   1 
ATOM   2550 C CB  . PHE A 1 330 ? 8.616   67.602 69.502 1.00 36.45 ? 330  PHE A CB  1 
ATOM   2551 C CG  . PHE A 1 330 ? 7.777   66.951 68.493 1.00 37.84 ? 330  PHE A CG  1 
ATOM   2552 C CD1 . PHE A 1 330 ? 6.755   66.078 68.861 1.00 40.34 ? 330  PHE A CD1 1 
ATOM   2553 C CD2 . PHE A 1 330 ? 7.984   67.216 67.164 1.00 38.74 ? 330  PHE A CD2 1 
ATOM   2554 C CE1 . PHE A 1 330 ? 5.944   65.464 67.904 1.00 39.77 ? 330  PHE A CE1 1 
ATOM   2555 C CE2 . PHE A 1 330 ? 7.179   66.624 66.207 1.00 42.35 ? 330  PHE A CE2 1 
ATOM   2556 C CZ  . PHE A 1 330 ? 6.136   65.727 66.592 1.00 40.94 ? 330  PHE A CZ  1 
ATOM   2557 N N   . PHE A 1 331 ? 9.097   64.238 70.188 1.00 32.10 ? 331  PHE A N   1 
ATOM   2558 C CA  . PHE A 1 331 ? 8.484   62.980 70.559 1.00 32.10 ? 331  PHE A CA  1 
ATOM   2559 C C   . PHE A 1 331 ? 8.902   62.570 71.958 1.00 31.36 ? 331  PHE A C   1 
ATOM   2560 O O   . PHE A 1 331 ? 8.151   61.888 72.632 1.00 30.54 ? 331  PHE A O   1 
ATOM   2561 C CB  . PHE A 1 331 ? 8.795   61.878 69.538 1.00 33.28 ? 331  PHE A CB  1 
ATOM   2562 C CG  . PHE A 1 331 ? 8.312   62.206 68.158 1.00 35.36 ? 331  PHE A CG  1 
ATOM   2563 C CD1 . PHE A 1 331 ? 9.066   63.066 67.323 1.00 35.10 ? 331  PHE A CD1 1 
ATOM   2564 C CD2 . PHE A 1 331 ? 7.071   61.733 67.710 1.00 34.06 ? 331  PHE A CD2 1 
ATOM   2565 C CE1 . PHE A 1 331 ? 8.588   63.456 66.037 1.00 35.30 ? 331  PHE A CE1 1 
ATOM   2566 C CE2 . PHE A 1 331 ? 6.591   62.117 66.432 1.00 35.59 ? 331  PHE A CE2 1 
ATOM   2567 C CZ  . PHE A 1 331 ? 7.346   62.972 65.593 1.00 33.19 ? 331  PHE A CZ  1 
ATOM   2568 N N   . LEU A 1 332 ? 10.083  62.993 72.415 1.00 30.15 ? 332  LEU A N   1 
ATOM   2569 C CA  . LEU A 1 332 ? 10.517  62.649 73.775 1.00 30.19 ? 332  LEU A CA  1 
ATOM   2570 C C   . LEU A 1 332 ? 9.796   63.580 74.767 1.00 31.55 ? 332  LEU A C   1 
ATOM   2571 O O   . LEU A 1 332 ? 9.372   63.150 75.832 1.00 32.08 ? 332  LEU A O   1 
ATOM   2572 C CB  . LEU A 1 332 ? 12.043  62.809 73.917 1.00 30.75 ? 332  LEU A CB  1 
ATOM   2573 C CG  . LEU A 1 332 ? 12.922  61.773 73.192 1.00 31.35 ? 332  LEU A CG  1 
ATOM   2574 C CD1 . LEU A 1 332 ? 14.327  62.388 72.947 1.00 27.88 ? 332  LEU A CD1 1 
ATOM   2575 C CD2 . LEU A 1 332 ? 12.981  60.508 74.029 1.00 27.77 ? 332  LEU A CD2 1 
ATOM   2576 N N   . LEU A 1 333 ? 9.667   64.860 74.415 1.00 32.11 ? 333  LEU A N   1 
ATOM   2577 C CA  . LEU A 1 333 ? 8.957   65.835 75.257 1.00 33.32 ? 333  LEU A CA  1 
ATOM   2578 C C   . LEU A 1 333 ? 7.569   65.306 75.577 1.00 34.34 ? 333  LEU A C   1 
ATOM   2579 O O   . LEU A 1 333 ? 7.135   65.261 76.733 1.00 33.86 ? 333  LEU A O   1 
ATOM   2580 C CB  . LEU A 1 333 ? 8.760   67.166 74.506 1.00 30.56 ? 333  LEU A CB  1 
ATOM   2581 C CG  . LEU A 1 333 ? 7.806   68.143 75.207 1.00 33.45 ? 333  LEU A CG  1 
ATOM   2582 C CD1 . LEU A 1 333 ? 8.348   68.374 76.685 1.00 31.34 ? 333  LEU A CD1 1 
ATOM   2583 C CD2 . LEU A 1 333 ? 7.713   69.520 74.396 1.00 30.82 ? 333  LEU A CD2 1 
ATOM   2584 N N   . TYR A 1 334 ? 6.872   64.920 74.515 1.00 36.21 ? 334  TYR A N   1 
ATOM   2585 C CA  . TYR A 1 334 ? 5.514   64.435 74.643 1.00 38.11 ? 334  TYR A CA  1 
ATOM   2586 C C   . TYR A 1 334 ? 5.385   63.005 75.175 1.00 40.44 ? 334  TYR A C   1 
ATOM   2587 O O   . TYR A 1 334 ? 4.366   62.670 75.769 1.00 45.61 ? 334  TYR A O   1 
ATOM   2588 C CB  . TYR A 1 334 ? 4.764   64.522 73.298 1.00 36.97 ? 334  TYR A CB  1 
ATOM   2589 C CG  . TYR A 1 334 ? 4.248   65.895 72.949 1.00 35.66 ? 334  TYR A CG  1 
ATOM   2590 C CD1 . TYR A 1 334 ? 5.119   66.904 72.561 1.00 35.03 ? 334  TYR A CD1 1 
ATOM   2591 C CD2 . TYR A 1 334 ? 2.870   66.185 72.981 1.00 34.11 ? 334  TYR A CD2 1 
ATOM   2592 C CE1 . TYR A 1 334 ? 4.638   68.173 72.202 1.00 34.86 ? 334  TYR A CE1 1 
ATOM   2593 C CE2 . TYR A 1 334 ? 2.377   67.473 72.621 1.00 33.02 ? 334  TYR A CE2 1 
ATOM   2594 C CZ  . TYR A 1 334 ? 3.265   68.448 72.235 1.00 33.58 ? 334  TYR A CZ  1 
ATOM   2595 O OH  . TYR A 1 334 ? 2.832   69.710 71.890 1.00 30.43 ? 334  TYR A OH  1 
ATOM   2596 N N   . GLY A 1 335 ? 6.377   62.154 75.027 1.00 38.74 ? 335  GLY A N   1 
ATOM   2597 C CA  . GLY A 1 335 ? 6.117   60.828 75.525 1.00 39.93 ? 335  GLY A CA  1 
ATOM   2598 C C   . GLY A 1 335 ? 7.115   60.074 76.384 1.00 40.07 ? 335  GLY A C   1 
ATOM   2599 O O   . GLY A 1 335 ? 6.823   58.939 76.713 1.00 41.92 ? 335  GLY A O   1 
ATOM   2600 N N   . ALA A 1 336 ? 8.259   60.643 76.742 1.00 37.26 ? 336  ALA A N   1 
ATOM   2601 C CA  . ALA A 1 336 ? 9.216   59.893 77.537 1.00 36.59 ? 336  ALA A CA  1 
ATOM   2602 C C   . ALA A 1 336 ? 9.433   60.499 78.923 1.00 37.89 ? 336  ALA A C   1 
ATOM   2603 O O   . ALA A 1 336 ? 9.518   61.713 79.077 1.00 38.74 ? 336  ALA A O   1 
ATOM   2604 C CB  . ALA A 1 336 ? 10.539  59.770 76.791 1.00 32.44 ? 336  ALA A CB  1 
ATOM   2605 N N   . PRO A 1 337 ? 9.555   59.653 79.956 1.00 38.71 ? 337  PRO A N   1 
ATOM   2606 C CA  . PRO A 1 337 ? 9.753   60.165 81.315 1.00 38.54 ? 337  PRO A CA  1 
ATOM   2607 C C   . PRO A 1 337 ? 11.034  60.957 81.475 1.00 38.93 ? 337  PRO A C   1 
ATOM   2608 O O   . PRO A 1 337 ? 12.094  60.582 80.933 1.00 40.02 ? 337  PRO A O   1 
ATOM   2609 C CB  . PRO A 1 337 ? 9.758   58.895 82.170 1.00 39.37 ? 337  PRO A CB  1 
ATOM   2610 C CG  . PRO A 1 337 ? 10.528  57.935 81.234 1.00 41.53 ? 337  PRO A CG  1 
ATOM   2611 C CD  . PRO A 1 337 ? 9.818   58.206 79.887 1.00 39.74 ? 337  PRO A CD  1 
ATOM   2612 N N   . GLY A 1 338 ? 10.919  62.064 82.217 1.00 37.78 ? 338  GLY A N   1 
ATOM   2613 C CA  . GLY A 1 338 ? 12.058  62.921 82.504 1.00 35.99 ? 338  GLY A CA  1 
ATOM   2614 C C   . GLY A 1 338 ? 12.202  64.141 81.618 1.00 35.57 ? 338  GLY A C   1 
ATOM   2615 O O   . GLY A 1 338 ? 13.057  65.016 81.841 1.00 36.97 ? 338  GLY A O   1 
ATOM   2616 N N   . PHE A 1 339 ? 11.395  64.197 80.585 1.00 33.57 ? 339  PHE A N   1 
ATOM   2617 C CA  . PHE A 1 339 ? 11.467  65.319 79.651 1.00 34.22 ? 339  PHE A CA  1 
ATOM   2618 C C   . PHE A 1 339 ? 10.331  66.272 79.905 1.00 35.08 ? 339  PHE A C   1 
ATOM   2619 O O   . PHE A 1 339 ? 9.191   65.819 80.091 1.00 36.50 ? 339  PHE A O   1 
ATOM   2620 C CB  . PHE A 1 339 ? 11.340  64.816 78.206 1.00 31.77 ? 339  PHE A CB  1 
ATOM   2621 C CG  . PHE A 1 339 ? 12.569  64.134 77.694 1.00 31.95 ? 339  PHE A CG  1 
ATOM   2622 C CD1 . PHE A 1 339 ? 13.543  64.874 77.037 1.00 30.49 ? 339  PHE A CD1 1 
ATOM   2623 C CD2 . PHE A 1 339 ? 12.735  62.739 77.848 1.00 30.51 ? 339  PHE A CD2 1 
ATOM   2624 C CE1 . PHE A 1 339 ? 14.698  64.247 76.513 1.00 29.31 ? 339  PHE A CE1 1 
ATOM   2625 C CE2 . PHE A 1 339 ? 13.858  62.105 77.333 1.00 32.60 ? 339  PHE A CE2 1 
ATOM   2626 C CZ  . PHE A 1 339 ? 14.853  62.884 76.651 1.00 30.49 ? 339  PHE A CZ  1 
ATOM   2627 N N   . SER A 1 340 ? 10.602  67.571 79.901 1.00 34.59 ? 340  SER A N   1 
ATOM   2628 C CA  . SER A 1 340 ? 9.494   68.496 80.098 1.00 35.78 ? 340  SER A CA  1 
ATOM   2629 C C   . SER A 1 340 ? 9.788   69.819 79.400 1.00 36.58 ? 340  SER A C   1 
ATOM   2630 O O   . SER A 1 340 ? 10.950  70.145 79.107 1.00 35.20 ? 340  SER A O   1 
ATOM   2631 C CB  . SER A 1 340 ? 9.156   68.657 81.590 1.00 36.33 ? 340  SER A CB  1 
ATOM   2632 O OG  . SER A 1 340 ? 10.258  69.113 82.332 1.00 40.42 ? 340  SER A OG  1 
ATOM   2633 N N   . LYS A 1 341 ? 8.721   70.552 79.086 1.00 35.47 ? 341  LYS A N   1 
ATOM   2634 C CA  . LYS A 1 341 ? 8.885   71.752 78.334 1.00 36.23 ? 341  LYS A CA  1 
ATOM   2635 C C   . LYS A 1 341 ? 9.686   72.857 78.988 1.00 36.26 ? 341  LYS A C   1 
ATOM   2636 O O   . LYS A 1 341 ? 10.480  73.536 78.327 1.00 34.29 ? 341  LYS A O   1 
ATOM   2637 C CB  . LYS A 1 341 ? 7.520   72.303 77.905 1.00 36.47 ? 341  LYS A CB  1 
ATOM   2638 C CG  . LYS A 1 341 ? 7.685   73.551 76.988 1.00 37.10 ? 341  LYS A CG  1 
ATOM   2639 C CD  . LYS A 1 341 ? 6.380   74.010 76.274 1.00 37.37 ? 341  LYS A CD  1 
ATOM   2640 C CE  . LYS A 1 341 ? 5.610   74.972 77.139 1.00 37.03 ? 341  LYS A CE  1 
ATOM   2641 N NZ  . LYS A 1 341 ? 6.505   76.051 77.788 1.00 38.86 ? 341  LYS A NZ  1 
ATOM   2642 N N   . ASP A 1 342 ? 9.483   73.023 80.284 1.00 35.93 ? 342  ASP A N   1 
ATOM   2643 C CA  . ASP A 1 342 ? 10.137  74.101 81.001 1.00 37.68 ? 342  ASP A CA  1 
ATOM   2644 C C   . ASP A 1 342 ? 11.409  73.771 81.785 1.00 37.39 ? 342  ASP A C   1 
ATOM   2645 O O   . ASP A 1 342 ? 11.793  74.515 82.688 1.00 34.81 ? 342  ASP A O   1 
ATOM   2646 C CB  . ASP A 1 342 ? 9.132   74.791 81.925 1.00 37.84 ? 342  ASP A CB  1 
ATOM   2647 C CG  . ASP A 1 342 ? 7.859   75.245 81.196 1.00 39.78 ? 342  ASP A CG  1 
ATOM   2648 O OD1 . ASP A 1 342 ? 7.855   75.448 79.952 1.00 37.96 ? 342  ASP A OD1 1 
ATOM   2649 O OD2 . ASP A 1 342 ? 6.842   75.400 81.911 1.00 41.33 ? 342  ASP A OD2 1 
ATOM   2650 N N   . SER A 1 343 ? 12.052  72.648 81.493 1.00 37.61 ? 343  SER A N   1 
ATOM   2651 C CA  . SER A 1 343 ? 13.311  72.401 82.183 1.00 39.02 ? 343  SER A CA  1 
ATOM   2652 C C   . SER A 1 343 ? 14.274  71.970 81.095 1.00 40.10 ? 343  SER A C   1 
ATOM   2653 O O   . SER A 1 343 ? 13.838  71.675 79.967 1.00 37.85 ? 343  SER A O   1 
ATOM   2654 C CB  . SER A 1 343 ? 13.195  71.335 83.263 1.00 39.15 ? 343  SER A CB  1 
ATOM   2655 O OG  . SER A 1 343 ? 13.284  70.062 82.716 1.00 44.13 ? 343  SER A OG  1 
ATOM   2656 N N   . GLU A 1 344 ? 15.562  71.973 81.425 1.00 39.54 ? 344  GLU A N   1 
ATOM   2657 C CA  . GLU A 1 344 ? 16.584  71.604 80.481 1.00 41.00 ? 344  GLU A CA  1 
ATOM   2658 C C   . GLU A 1 344 ? 16.517  70.094 80.185 1.00 40.75 ? 344  GLU A C   1 
ATOM   2659 O O   . GLU A 1 344 ? 17.220  69.601 79.306 1.00 39.85 ? 344  GLU A O   1 
ATOM   2660 C CB  . GLU A 1 344 ? 17.970  71.980 81.027 1.00 42.62 ? 344  GLU A CB  1 
ATOM   2661 C CG  . GLU A 1 344 ? 18.356  73.469 80.818 1.00 47.84 ? 344  GLU A CG  1 
ATOM   2662 C CD  . GLU A 1 344 ? 19.856  73.724 81.035 1.00 49.52 ? 344  GLU A CD  1 
ATOM   2663 O OE1 . GLU A 1 344 ? 20.399  73.126 82.001 1.00 53.87 ? 344  GLU A OE1 1 
ATOM   2664 N N   . SER A 1 345 ? 15.697  69.375 80.954 1.00 38.87 ? 345  SER A N   1 
ATOM   2665 C CA  . SER A 1 345 ? 15.495  67.949 80.751 1.00 39.58 ? 345  SER A CA  1 
ATOM   2666 C C   . SER A 1 345 ? 16.751  67.061 80.767 1.00 40.52 ? 345  SER A C   1 
ATOM   2667 O O   . SER A 1 345 ? 16.954  66.243 79.852 1.00 40.48 ? 345  SER A O   1 
ATOM   2668 C CB  . SER A 1 345 ? 14.768  67.697 79.419 1.00 38.18 ? 345  SER A CB  1 
ATOM   2669 O OG  . SER A 1 345 ? 13.483  68.272 79.365 1.00 39.83 ? 345  SER A OG  1 
ATOM   2670 N N   . LYS A 1 346 ? 17.553  67.183 81.813 1.00 41.80 ? 346  LYS A N   1 
ATOM   2671 C CA  . LYS A 1 346 ? 18.746  66.372 81.959 1.00 42.82 ? 346  LYS A CA  1 
ATOM   2672 C C   . LYS A 1 346 ? 18.193  65.027 82.396 1.00 42.94 ? 346  LYS A C   1 
ATOM   2673 O O   . LYS A 1 346 ? 17.392  64.925 83.314 1.00 43.17 ? 346  LYS A O   1 
ATOM   2674 C CB  . LYS A 1 346 ? 19.666  66.989 82.984 1.00 44.29 ? 346  LYS A CB  1 
ATOM   2675 C CG  . LYS A 1 346 ? 20.284  68.329 82.516 1.00 46.69 ? 346  LYS A CG  1 
ATOM   2676 C CD  . LYS A 1 346 ? 21.147  68.889 83.668 1.00 50.88 ? 346  LYS A CD  1 
ATOM   2677 C CE  . LYS A 1 346 ? 21.609  70.352 83.494 1.00 54.13 ? 346  LYS A CE  1 
ATOM   2678 N NZ  . LYS A 1 346 ? 22.312  70.774 84.778 1.00 55.10 ? 346  LYS A NZ  1 
ATOM   2679 N N   . ILE A 1 347 ? 18.626  63.994 81.706 1.00 41.69 ? 347  ILE A N   1 
ATOM   2680 C CA  . ILE A 1 347 ? 18.101  62.654 81.887 1.00 42.94 ? 347  ILE A CA  1 
ATOM   2681 C C   . ILE A 1 347 ? 19.013  61.744 82.727 1.00 41.72 ? 347  ILE A C   1 
ATOM   2682 O O   . ILE A 1 347 ? 20.201  61.674 82.473 1.00 41.11 ? 347  ILE A O   1 
ATOM   2683 C CB  . ILE A 1 347 ? 17.867  62.051 80.417 1.00 43.63 ? 347  ILE A CB  1 
ATOM   2684 C CG1 . ILE A 1 347 ? 16.766  62.855 79.713 1.00 44.59 ? 347  ILE A CG1 1 
ATOM   2685 C CG2 . ILE A 1 347 ? 17.501  60.572 80.424 1.00 43.66 ? 347  ILE A CG2 1 
ATOM   2686 C CD1 . ILE A 1 347 ? 15.499  62.965 80.536 1.00 43.99 ? 347  ILE A CD1 1 
ATOM   2687 N N   . SER A 1 348 ? 18.441  61.044 83.698 1.00 41.24 ? 348  SER A N   1 
ATOM   2688 C CA  . SER A 1 348 ? 19.209  60.097 84.518 1.00 44.87 ? 348  SER A CA  1 
ATOM   2689 C C   . SER A 1 348 ? 19.496  58.853 83.658 1.00 45.48 ? 348  SER A C   1 
ATOM   2690 O O   . SER A 1 348 ? 18.944  58.708 82.581 1.00 46.96 ? 348  SER A O   1 
ATOM   2691 C CB  . SER A 1 348 ? 18.402  59.688 85.757 1.00 44.06 ? 348  SER A CB  1 
ATOM   2692 O OG  . SER A 1 348 ? 17.236  58.970 85.407 1.00 44.03 ? 348  SER A OG  1 
ATOM   2693 N N   . ARG A 1 349 ? 20.384  57.983 84.093 1.00 46.49 ? 349  ARG A N   1 
ATOM   2694 C CA  . ARG A 1 349 ? 20.647  56.796 83.324 1.00 48.50 ? 349  ARG A CA  1 
ATOM   2695 C C   . ARG A 1 349 ? 19.396  55.942 83.352 1.00 49.35 ? 349  ARG A C   1 
ATOM   2696 O O   . ARG A 1 349 ? 19.161  55.186 82.415 1.00 50.33 ? 349  ARG A O   1 
ATOM   2697 C CB  . ARG A 1 349 ? 21.777  55.970 83.926 1.00 50.05 ? 349  ARG A CB  1 
ATOM   2698 C CG  . ARG A 1 349 ? 23.161  56.478 83.621 1.00 54.02 ? 349  ARG A CG  1 
ATOM   2699 C CD  . ARG A 1 349 ? 23.428  56.673 82.122 1.00 53.81 ? 349  ARG A CD  1 
ATOM   2700 N NE  . ARG A 1 349 ? 23.528  55.430 81.385 1.00 49.92 ? 349  ARG A NE  1 
ATOM   2701 C CZ  . ARG A 1 349 ? 23.568  55.360 80.058 1.00 49.73 ? 349  ARG A CZ  1 
ATOM   2702 N NH1 . ARG A 1 349 ? 23.539  56.472 79.320 1.00 48.39 ? 349  ARG A NH1 1 
ATOM   2703 N NH2 . ARG A 1 349 ? 23.568  54.167 79.464 1.00 48.73 ? 349  ARG A NH2 1 
ATOM   2704 N N   . GLU A 1 350 ? 18.602  56.032 84.424 1.00 49.13 ? 350  GLU A N   1 
ATOM   2705 C CA  . GLU A 1 350 ? 17.399  55.218 84.479 1.00 49.50 ? 350  GLU A CA  1 
ATOM   2706 C C   . GLU A 1 350 ? 16.424  55.688 83.415 1.00 49.04 ? 350  GLU A C   1 
ATOM   2707 O O   . GLU A 1 350 ? 15.851  54.854 82.698 1.00 47.88 ? 350  GLU A O   1 
ATOM   2708 C CB  . GLU A 1 350 ? 16.702  55.251 85.853 1.00 50.03 ? 350  GLU A CB  1 
ATOM   2709 C CG  . GLU A 1 350 ? 17.547  54.714 87.028 1.00 55.67 ? 350  GLU A CG  1 
ATOM   2710 N N   . ASP A 1 351 ? 16.221  57.008 83.309 1.00 48.37 ? 351  ASP A N   1 
ATOM   2711 C CA  . ASP A 1 351 ? 15.284  57.525 82.312 1.00 47.24 ? 351  ASP A CA  1 
ATOM   2712 C C   . ASP A 1 351 ? 15.805  57.325 80.877 1.00 45.81 ? 351  ASP A C   1 
ATOM   2713 O O   . ASP A 1 351 ? 15.039  57.161 79.936 1.00 45.09 ? 351  ASP A O   1 
ATOM   2714 C CB  . ASP A 1 351 ? 14.934  58.990 82.599 1.00 48.72 ? 351  ASP A CB  1 
ATOM   2715 C CG  . ASP A 1 351 ? 13.901  59.129 83.729 1.00 50.13 ? 351  ASP A CG  1 
ATOM   2716 O OD1 . ASP A 1 351 ? 13.194  58.140 84.034 1.00 50.38 ? 351  ASP A OD1 1 
ATOM   2717 O OD2 . ASP A 1 351 ? 13.780  60.234 84.296 1.00 50.83 ? 351  ASP A OD2 1 
ATOM   2718 N N   . PHE A 1 352 ? 17.113  57.300 80.717 1.00 43.77 ? 352  PHE A N   1 
ATOM   2719 C CA  . PHE A 1 352 ? 17.681  57.054 79.400 1.00 42.63 ? 352  PHE A CA  1 
ATOM   2720 C C   . PHE A 1 352 ? 17.263  55.657 78.974 1.00 43.53 ? 352  PHE A C   1 
ATOM   2721 O O   . PHE A 1 352 ? 16.797  55.425 77.839 1.00 42.00 ? 352  PHE A O   1 
ATOM   2722 C CB  . PHE A 1 352 ? 19.195  57.098 79.469 1.00 39.48 ? 352  PHE A CB  1 
ATOM   2723 C CG  . PHE A 1 352 ? 19.863  56.799 78.185 1.00 37.54 ? 352  PHE A CG  1 
ATOM   2724 C CD1 . PHE A 1 352 ? 20.031  57.796 77.225 1.00 34.69 ? 352  PHE A CD1 1 
ATOM   2725 C CD2 . PHE A 1 352 ? 20.328  55.510 77.925 1.00 35.01 ? 352  PHE A CD2 1 
ATOM   2726 C CE1 . PHE A 1 352 ? 20.656  57.513 76.019 1.00 32.89 ? 352  PHE A CE1 1 
ATOM   2727 C CE2 . PHE A 1 352 ? 20.947  55.213 76.741 1.00 36.03 ? 352  PHE A CE2 1 
ATOM   2728 C CZ  . PHE A 1 352 ? 21.121  56.214 75.772 1.00 34.74 ? 352  PHE A CZ  1 
ATOM   2729 N N   . MET A 1 353 ? 17.424  54.715 79.889 1.00 44.60 ? 353  MET A N   1 
ATOM   2730 C CA  . MET A 1 353 ? 17.111  53.345 79.536 1.00 46.80 ? 353  MET A CA  1 
ATOM   2731 C C   . MET A 1 353 ? 15.645  53.077 79.320 1.00 45.77 ? 353  MET A C   1 
ATOM   2732 O O   . MET A 1 353 ? 15.292  52.329 78.394 1.00 43.97 ? 353  MET A O   1 
ATOM   2733 C CB  . MET A 1 353 ? 17.729  52.380 80.538 1.00 50.09 ? 353  MET A CB  1 
ATOM   2734 C CG  . MET A 1 353 ? 19.237  52.277 80.300 1.00 54.08 ? 353  MET A CG  1 
ATOM   2735 S SD  . MET A 1 353 ? 19.934  50.873 81.152 1.00 63.00 ? 353  MET A SD  1 
ATOM   2736 C CE  . MET A 1 353 ? 19.673  51.431 82.892 1.00 54.12 ? 353  MET A CE  1 
ATOM   2737 N N   . SER A 1 354 ? 14.779  53.680 80.128 1.00 43.88 ? 354  SER A N   1 
ATOM   2738 C CA  . SER A 1 354 ? 13.380  53.439 79.854 1.00 44.62 ? 354  SER A CA  1 
ATOM   2739 C C   . SER A 1 354 ? 13.020  54.180 78.489 1.00 43.83 ? 354  SER A C   1 
ATOM   2740 O O   . SER A 1 354 ? 12.163  53.704 77.708 1.00 43.41 ? 354  SER A O   1 
ATOM   2741 C CB  . SER A 1 354 ? 12.518  53.835 81.067 1.00 44.50 ? 354  SER A CB  1 
ATOM   2742 O OG  . SER A 1 354 ? 12.658  55.181 81.379 1.00 49.90 ? 354  SER A OG  1 
ATOM   2743 N N   . GLY A 1 355 ? 13.755  55.266 78.182 1.00 41.61 ? 355  GLY A N   1 
ATOM   2744 C CA  . GLY A 1 355 ? 13.628  55.997 76.919 1.00 38.40 ? 355  GLY A CA  1 
ATOM   2745 C C   . GLY A 1 355 ? 14.032  55.126 75.708 1.00 37.36 ? 355  GLY A C   1 
ATOM   2746 O O   . GLY A 1 355 ? 13.344  55.137 74.669 1.00 35.31 ? 355  GLY A O   1 
ATOM   2747 N N   . VAL A 1 356 ? 15.117  54.348 75.812 1.00 36.55 ? 356  VAL A N   1 
ATOM   2748 C CA  . VAL A 1 356 ? 15.448  53.531 74.662 1.00 37.53 ? 356  VAL A CA  1 
ATOM   2749 C C   . VAL A 1 356 ? 14.439  52.420 74.431 1.00 37.29 ? 356  VAL A C   1 
ATOM   2750 O O   . VAL A 1 356 ? 14.154  52.094 73.281 1.00 37.12 ? 356  VAL A O   1 
ATOM   2751 C CB  . VAL A 1 356 ? 16.956  52.948 74.620 1.00 37.48 ? 356  VAL A CB  1 
ATOM   2752 C CG1 . VAL A 1 356 ? 17.874  53.691 75.540 1.00 34.09 ? 356  VAL A CG1 1 
ATOM   2753 C CG2 . VAL A 1 356 ? 16.970  51.492 74.762 1.00 36.25 ? 356  VAL A CG2 1 
ATOM   2754 N N   . LYS A 1 357 ? 13.888  51.871 75.509 1.00 38.21 ? 357  LYS A N   1 
ATOM   2755 C CA  . LYS A 1 357 ? 12.853  50.811 75.438 1.00 39.66 ? 357  LYS A CA  1 
ATOM   2756 C C   . LYS A 1 357 ? 11.595  51.353 74.662 1.00 38.86 ? 357  LYS A C   1 
ATOM   2757 O O   . LYS A 1 357 ? 11.058  50.719 73.741 1.00 38.78 ? 357  LYS A O   1 
ATOM   2758 C CB  . LYS A 1 357 ? 12.474  50.398 76.869 1.00 40.46 ? 357  LYS A CB  1 
ATOM   2759 C CG  . LYS A 1 357 ? 11.397  49.331 76.953 1.00 44.93 ? 357  LYS A CG  1 
ATOM   2760 C CD  . LYS A 1 357 ? 11.719  48.164 76.009 1.00 47.53 ? 357  LYS A CD  1 
ATOM   2761 C CE  . LYS A 1 357 ? 10.925  46.911 76.332 1.00 50.29 ? 357  LYS A CE  1 
ATOM   2762 N NZ  . LYS A 1 357 ? 9.516   47.250 76.678 1.00 53.70 ? 357  LYS A NZ  1 
ATOM   2763 N N   . LEU A 1 358 ? 11.185  52.555 75.028 1.00 37.04 ? 358  LEU A N   1 
ATOM   2764 C CA  . LEU A 1 358 ? 10.093  53.243 74.406 1.00 37.52 ? 358  LEU A CA  1 
ATOM   2765 C C   . LEU A 1 358 ? 10.387  53.556 72.917 1.00 38.62 ? 358  LEU A C   1 
ATOM   2766 O O   . LEU A 1 358 ? 9.460   53.517 72.075 1.00 38.85 ? 358  LEU A O   1 
ATOM   2767 C CB  . LEU A 1 358 ? 9.877   54.532 75.167 1.00 36.89 ? 358  LEU A CB  1 
ATOM   2768 C CG  . LEU A 1 358 ? 8.611   54.872 75.939 1.00 39.92 ? 358  LEU A CG  1 
ATOM   2769 C CD1 . LEU A 1 358 ? 7.815   53.641 76.462 1.00 37.81 ? 358  LEU A CD1 1 
ATOM   2770 C CD2 . LEU A 1 358 ? 9.063   55.835 77.049 1.00 36.81 ? 358  LEU A CD2 1 
ATOM   2771 N N   . SER A 1 359 ? 11.662  53.843 72.581 1.00 36.31 ? 359  SER A N   1 
ATOM   2772 C CA  . SER A 1 359 ? 12.029  54.227 71.219 1.00 33.57 ? 359  SER A CA  1 
ATOM   2773 C C   . SER A 1 359 ? 12.195  53.103 70.224 1.00 34.50 ? 359  SER A C   1 
ATOM   2774 O O   . SER A 1 359 ? 12.055  53.314 69.033 1.00 32.45 ? 359  SER A O   1 
ATOM   2775 C CB  . SER A 1 359 ? 13.304  55.053 71.227 1.00 34.54 ? 359  SER A CB  1 
ATOM   2776 O OG  . SER A 1 359 ? 13.236  56.125 72.149 1.00 35.03 ? 359  SER A OG  1 
ATOM   2777 N N   . VAL A 1 360 ? 12.473  51.898 70.690 1.00 34.72 ? 360  VAL A N   1 
ATOM   2778 C CA  . VAL A 1 360 ? 12.669  50.806 69.730 1.00 38.32 ? 360  VAL A CA  1 
ATOM   2779 C C   . VAL A 1 360 ? 11.823  49.722 70.328 1.00 40.00 ? 360  VAL A C   1 
ATOM   2780 O O   . VAL A 1 360 ? 12.340  48.679 70.764 1.00 37.85 ? 360  VAL A O   1 
ATOM   2781 C CB  . VAL A 1 360 ? 14.155  50.376 69.712 1.00 38.56 ? 360  VAL A CB  1 
ATOM   2782 C CG1 . VAL A 1 360 ? 14.401  49.397 68.578 1.00 38.07 ? 360  VAL A CG1 1 
ATOM   2783 C CG2 . VAL A 1 360 ? 15.052  51.629 69.591 1.00 37.79 ? 360  VAL A CG2 1 
ATOM   2784 N N   . PRO A 1 361 ? 10.492  49.952 70.333 1.00 41.76 ? 361  PRO A N   1 
ATOM   2785 C CA  . PRO A 1 361 ? 9.468   49.062 70.897 1.00 43.75 ? 361  PRO A CA  1 
ATOM   2786 C C   . PRO A 1 361 ? 9.503   47.601 70.495 1.00 46.53 ? 361  PRO A C   1 
ATOM   2787 O O   . PRO A 1 361 ? 9.240   46.712 71.307 1.00 46.13 ? 361  PRO A O   1 
ATOM   2788 C CB  . PRO A 1 361 ? 8.172   49.778 70.537 1.00 43.30 ? 361  PRO A CB  1 
ATOM   2789 C CG  . PRO A 1 361 ? 8.491   50.463 69.247 1.00 40.83 ? 361  PRO A CG  1 
ATOM   2790 C CD  . PRO A 1 361 ? 9.883   50.962 69.440 1.00 40.84 ? 361  PRO A CD  1 
ATOM   2791 N N   . HIS A 1 362 ? 9.876   47.369 69.245 1.00 50.10 ? 362  HIS A N   1 
ATOM   2792 C CA  . HIS A 1 362 ? 9.964   46.027 68.681 1.00 54.16 ? 362  HIS A CA  1 
ATOM   2793 C C   . HIS A 1 362 ? 11.266  45.231 69.025 1.00 53.51 ? 362  HIS A C   1 
ATOM   2794 O O   . HIS A 1 362 ? 11.434  44.102 68.552 1.00 53.03 ? 362  HIS A O   1 
ATOM   2795 C CB  . HIS A 1 362 ? 9.815   46.133 67.141 1.00 57.90 ? 362  HIS A CB  1 
ATOM   2796 C CG  . HIS A 1 362 ? 10.808  47.070 66.493 1.00 62.20 ? 362  HIS A CG  1 
ATOM   2797 N ND1 . HIS A 1 362 ? 10.691  48.450 66.552 1.00 62.38 ? 362  HIS A ND1 1 
ATOM   2798 C CD2 . HIS A 1 362 ? 11.923  46.820 65.755 1.00 62.38 ? 362  HIS A CD2 1 
ATOM   2799 C CE1 . HIS A 1 362 ? 11.686  49.003 65.876 1.00 62.66 ? 362  HIS A CE1 1 
ATOM   2800 N NE2 . HIS A 1 362 ? 12.447  48.038 65.380 1.00 63.00 ? 362  HIS A NE2 1 
ATOM   2801 N N   . ALA A 1 363 ? 12.158  45.790 69.851 1.00 51.09 ? 363  ALA A N   1 
ATOM   2802 C CA  . ALA A 1 363 ? 13.421  45.107 70.148 1.00 48.95 ? 363  ALA A CA  1 
ATOM   2803 C C   . ALA A 1 363 ? 13.488  44.195 71.377 1.00 47.81 ? 363  ALA A C   1 
ATOM   2804 O O   . ALA A 1 363 ? 12.883  44.484 72.390 1.00 47.69 ? 363  ALA A O   1 
ATOM   2805 C CB  . ALA A 1 363 ? 14.556  46.159 70.252 1.00 46.20 ? 363  ALA A CB  1 
ATOM   2806 N N   . ASN A 1 364 ? 14.241  43.095 71.278 1.00 47.36 ? 364  ASN A N   1 
ATOM   2807 C CA  . ASN A 1 364 ? 14.467  42.221 72.444 1.00 46.10 ? 364  ASN A CA  1 
ATOM   2808 C C   . ASN A 1 364 ? 15.554  42.880 73.316 1.00 46.23 ? 364  ASN A C   1 
ATOM   2809 O O   . ASN A 1 364 ? 16.077  43.968 72.974 1.00 45.92 ? 364  ASN A O   1 
ATOM   2810 C CB  . ASN A 1 364 ? 14.943  40.812 72.058 1.00 45.70 ? 364  ASN A CB  1 
ATOM   2811 C CG  . ASN A 1 364 ? 16.128  40.811 71.098 1.00 46.57 ? 364  ASN A CG  1 
ATOM   2812 O OD1 . ASN A 1 364 ? 16.952  41.744 71.067 1.00 45.50 ? 364  ASN A OD1 1 
ATOM   2813 N ND2 . ASN A 1 364 ? 16.218  39.755 70.304 1.00 44.40 ? 364  ASN A ND2 1 
ATOM   2814 N N   . ASP A 1 365 ? 15.884  42.233 74.434 1.00 44.78 ? 365  ASP A N   1 
ATOM   2815 C CA  . ASP A 1 365 ? 16.864  42.749 75.360 1.00 45.30 ? 365  ASP A CA  1 
ATOM   2816 C C   . ASP A 1 365 ? 18.250  42.965 74.754 1.00 44.54 ? 365  ASP A C   1 
ATOM   2817 O O   . ASP A 1 365 ? 18.924  43.958 75.083 1.00 43.85 ? 365  ASP A O   1 
ATOM   2818 C CB  . ASP A 1 365 ? 16.981  41.839 76.569 1.00 50.52 ? 365  ASP A CB  1 
ATOM   2819 C CG  . ASP A 1 365 ? 15.824  42.021 77.558 1.00 57.17 ? 365  ASP A CG  1 
ATOM   2820 O OD1 . ASP A 1 365 ? 14.772  42.650 77.193 1.00 58.81 ? 365  ASP A OD1 1 
ATOM   2821 O OD2 . ASP A 1 365 ? 15.970  41.517 78.714 1.00 60.68 ? 365  ASP A OD2 1 
ATOM   2822 N N   . LEU A 1 366 ? 18.677  42.039 73.898 1.00 40.94 ? 366  LEU A N   1 
ATOM   2823 C CA  . LEU A 1 366 ? 19.962  42.135 73.246 1.00 39.99 ? 366  LEU A CA  1 
ATOM   2824 C C   . LEU A 1 366 ? 19.971  43.405 72.341 1.00 39.39 ? 366  LEU A C   1 
ATOM   2825 O O   . LEU A 1 366 ? 20.961  44.135 72.291 1.00 38.25 ? 366  LEU A O   1 
ATOM   2826 C CB  . LEU A 1 366 ? 20.215  40.889 72.405 1.00 39.05 ? 366  LEU A CB  1 
ATOM   2827 C CG  . LEU A 1 366 ? 21.576  40.961 71.733 1.00 41.65 ? 366  LEU A CG  1 
ATOM   2828 C CD1 . LEU A 1 366 ? 22.688  40.842 72.782 1.00 38.62 ? 366  LEU A CD1 1 
ATOM   2829 C CD2 . LEU A 1 366 ? 21.678  39.860 70.713 1.00 41.53 ? 366  LEU A CD2 1 
ATOM   2830 N N   . GLY A 1 367 ? 18.865  43.636 71.630 1.00 37.87 ? 367  GLY A N   1 
ATOM   2831 C CA  . GLY A 1 367 ? 18.721  44.804 70.777 1.00 36.27 ? 367  GLY A CA  1 
ATOM   2832 C C   . GLY A 1 367 ? 18.750  46.094 71.603 1.00 35.74 ? 367  GLY A C   1 
ATOM   2833 O O   . GLY A 1 367 ? 19.416  47.063 71.221 1.00 35.76 ? 367  GLY A O   1 
ATOM   2834 N N   . LEU A 1 368 ? 18.052  46.110 72.734 1.00 34.46 ? 368  LEU A N   1 
ATOM   2835 C CA  . LEU A 1 368 ? 18.077  47.282 73.593 1.00 35.96 ? 368  LEU A CA  1 
ATOM   2836 C C   . LEU A 1 368 ? 19.493  47.544 74.092 1.00 37.40 ? 368  LEU A C   1 
ATOM   2837 O O   . LEU A 1 368 ? 19.896  48.733 74.196 1.00 38.95 ? 368  LEU A O   1 
ATOM   2838 C CB  . LEU A 1 368 ? 17.111  47.142 74.781 1.00 35.04 ? 368  LEU A CB  1 
ATOM   2839 C CG  . LEU A 1 368 ? 15.648  46.952 74.346 1.00 36.40 ? 368  LEU A CG  1 
ATOM   2840 C CD1 . LEU A 1 368 ? 14.787  46.826 75.603 1.00 35.24 ? 368  LEU A CD1 1 
ATOM   2841 C CD2 . LEU A 1 368 ? 15.172  48.130 73.457 1.00 35.84 ? 368  LEU A CD2 1 
ATOM   2842 N N   . ASP A 1 369 ? 20.259  46.470 74.379 1.00 37.07 ? 369  ASP A N   1 
ATOM   2843 C CA  . ASP A 1 369 ? 21.651  46.625 74.819 1.00 37.82 ? 369  ASP A CA  1 
ATOM   2844 C C   . ASP A 1 369 ? 22.513  47.192 73.649 1.00 36.90 ? 369  ASP A C   1 
ATOM   2845 O O   . ASP A 1 369 ? 23.397  48.041 73.863 1.00 36.09 ? 369  ASP A O   1 
ATOM   2846 C CB  . ASP A 1 369 ? 22.292  45.295 75.267 1.00 41.71 ? 369  ASP A CB  1 
ATOM   2847 C CG  . ASP A 1 369 ? 21.802  44.822 76.608 1.00 44.89 ? 369  ASP A CG  1 
ATOM   2848 O OD1 . ASP A 1 369 ? 21.238  45.643 77.375 1.00 46.52 ? 369  ASP A OD1 1 
ATOM   2849 O OD2 . ASP A 1 369 ? 21.992  43.616 76.893 1.00 46.43 ? 369  ASP A OD2 1 
ATOM   2850 N N   . ALA A 1 370 ? 22.262  46.732 72.425 1.00 35.27 ? 370  ALA A N   1 
ATOM   2851 C CA  . ALA A 1 370 ? 23.044  47.238 71.289 1.00 34.48 ? 370  ALA A CA  1 
ATOM   2852 C C   . ALA A 1 370 ? 22.759  48.735 71.090 1.00 33.39 ? 370  ALA A C   1 
ATOM   2853 O O   . ALA A 1 370 ? 23.673  49.474 70.842 1.00 34.26 ? 370  ALA A O   1 
ATOM   2854 C CB  . ALA A 1 370 ? 22.742  46.451 70.018 1.00 30.14 ? 370  ALA A CB  1 
ATOM   2855 N N   . VAL A 1 371 ? 21.516  49.189 71.235 1.00 32.81 ? 371  VAL A N   1 
ATOM   2856 C CA  . VAL A 1 371 ? 21.247  50.622 71.042 1.00 31.60 ? 371  VAL A CA  1 
ATOM   2857 C C   . VAL A 1 371 ? 21.918  51.419 72.164 1.00 32.32 ? 371  VAL A C   1 
ATOM   2858 O O   . VAL A 1 371 ? 22.612  52.402 71.900 1.00 32.81 ? 371  VAL A O   1 
ATOM   2859 C CB  . VAL A 1 371 ? 19.685  50.957 71.050 1.00 31.29 ? 371  VAL A CB  1 
ATOM   2860 C CG1 . VAL A 1 371 ? 19.461  52.468 71.104 1.00 27.59 ? 371  VAL A CG1 1 
ATOM   2861 C CG2 . VAL A 1 371 ? 18.982  50.324 69.821 1.00 29.92 ? 371  VAL A CG2 1 
ATOM   2862 N N   . THR A 1 372 ? 21.679  51.000 73.408 1.00 33.51 ? 372  THR A N   1 
ATOM   2863 C CA  . THR A 1 372 ? 22.234  51.639 74.590 1.00 34.87 ? 372  THR A CA  1 
ATOM   2864 C C   . THR A 1 372 ? 23.768  51.794 74.509 1.00 36.68 ? 372  THR A C   1 
ATOM   2865 O O   . THR A 1 372 ? 24.295  52.883 74.703 1.00 36.31 ? 372  THR A O   1 
ATOM   2866 C CB  . THR A 1 372 ? 21.855  50.846 75.864 1.00 37.20 ? 372  THR A CB  1 
ATOM   2867 O OG1 . THR A 1 372 ? 20.421  50.870 76.011 1.00 38.43 ? 372  THR A OG1 1 
ATOM   2868 C CG2 . THR A 1 372 ? 22.552  51.436 77.125 1.00 29.58 ? 372  THR A CG2 1 
ATOM   2869 N N   . LEU A 1 373 ? 24.467  50.723 74.173 1.00 36.33 ? 373  LEU A N   1 
ATOM   2870 C CA  . LEU A 1 373 ? 25.904  50.798 74.031 1.00 37.73 ? 373  LEU A CA  1 
ATOM   2871 C C   . LEU A 1 373 ? 26.331  51.800 72.951 1.00 39.31 ? 373  LEU A C   1 
ATOM   2872 O O   . LEU A 1 373 ? 27.278  52.569 73.155 1.00 38.26 ? 373  LEU A O   1 
ATOM   2873 C CB  . LEU A 1 373 ? 26.461  49.431 73.665 1.00 39.29 ? 373  LEU A CB  1 
ATOM   2874 C CG  . LEU A 1 373 ? 27.901  49.493 73.199 1.00 42.56 ? 373  LEU A CG  1 
ATOM   2875 C CD1 . LEU A 1 373 ? 28.762  48.582 74.024 1.00 45.09 ? 373  LEU A CD1 1 
ATOM   2876 C CD2 . LEU A 1 373 ? 27.949  49.077 71.739 1.00 47.13 ? 373  LEU A CD2 1 
ATOM   2877 N N   . GLN A 1 374 ? 25.627  51.781 71.811 1.00 37.52 ? 374  GLN A N   1 
ATOM   2878 C CA  . GLN A 1 374 ? 25.932  52.656 70.675 1.00 38.36 ? 374  GLN A CA  1 
ATOM   2879 C C   . GLN A 1 374 ? 25.809  54.163 70.961 1.00 36.68 ? 374  GLN A C   1 
ATOM   2880 O O   . GLN A 1 374 ? 26.478  54.977 70.341 1.00 36.57 ? 374  GLN A O   1 
ATOM   2881 C CB  . GLN A 1 374 ? 25.000  52.302 69.505 1.00 39.62 ? 374  GLN A CB  1 
ATOM   2882 C CG  . GLN A 1 374 ? 25.382  52.905 68.188 1.00 42.99 ? 374  GLN A CG  1 
ATOM   2883 C CD  . GLN A 1 374 ? 26.543  52.174 67.500 1.00 45.90 ? 374  GLN A CD  1 
ATOM   2884 O OE1 . GLN A 1 374 ? 26.973  52.594 66.424 1.00 47.45 ? 374  GLN A OE1 1 
ATOM   2885 N NE2 . GLN A 1 374 ? 27.055  51.084 68.117 1.00 46.37 ? 374  GLN A NE2 1 
ATOM   2886 N N   . TYR A 1 375 ? 24.957  54.512 71.909 1.00 35.42 ? 375  TYR A N   1 
ATOM   2887 C CA  . TYR A 1 375 ? 24.684  55.900 72.234 1.00 36.58 ? 375  TYR A CA  1 
ATOM   2888 C C   . TYR A 1 375 ? 25.166  56.385 73.614 1.00 37.95 ? 375  TYR A C   1 
ATOM   2889 O O   . TYR A 1 375 ? 24.913  57.525 74.014 1.00 39.27 ? 375  TYR A O   1 
ATOM   2890 C CB  . TYR A 1 375 ? 23.155  56.139 72.056 1.00 33.17 ? 375  TYR A CB  1 
ATOM   2891 C CG  . TYR A 1 375 ? 22.790  56.258 70.577 1.00 31.81 ? 375  TYR A CG  1 
ATOM   2892 C CD1 . TYR A 1 375 ? 22.829  57.491 69.932 1.00 30.05 ? 375  TYR A CD1 1 
ATOM   2893 C CD2 . TYR A 1 375 ? 22.441  55.130 69.819 1.00 29.62 ? 375  TYR A CD2 1 
ATOM   2894 C CE1 . TYR A 1 375 ? 22.518  57.610 68.564 1.00 29.49 ? 375  TYR A CE1 1 
ATOM   2895 C CE2 . TYR A 1 375 ? 22.144  55.229 68.461 1.00 28.04 ? 375  TYR A CE2 1 
ATOM   2896 C CZ  . TYR A 1 375 ? 22.175  56.471 67.848 1.00 30.26 ? 375  TYR A CZ  1 
ATOM   2897 O OH  . TYR A 1 375 ? 21.819  56.594 66.539 1.00 30.27 ? 375  TYR A OH  1 
ATOM   2898 N N   . THR A 1 376 ? 25.878  55.542 74.338 1.00 37.18 ? 376  THR A N   1 
ATOM   2899 C CA  . THR A 1 376 ? 26.344  55.953 75.645 1.00 36.82 ? 376  THR A CA  1 
ATOM   2900 C C   . THR A 1 376 ? 27.833  56.259 75.616 1.00 37.44 ? 376  THR A C   1 
ATOM   2901 O O   . THR A 1 376 ? 28.633  55.503 75.067 1.00 35.75 ? 376  THR A O   1 
ATOM   2902 C CB  . THR A 1 376 ? 26.131  54.817 76.690 1.00 37.44 ? 376  THR A CB  1 
ATOM   2903 O OG1 . THR A 1 376 ? 24.741  54.514 76.814 1.00 35.67 ? 376  THR A OG1 1 
ATOM   2904 C CG2 . THR A 1 376 ? 26.666  55.211 78.044 1.00 37.32 ? 376  THR A CG2 1 
ATOM   2905 N N   . ASP A 1 377 ? 28.209  57.373 76.217 1.00 38.61 ? 377  ASP A N   1 
ATOM   2906 C CA  . ASP A 1 377 ? 29.626  57.713 76.365 1.00 39.20 ? 377  ASP A CA  1 
ATOM   2907 C C   . ASP A 1 377 ? 29.952  57.075 77.760 1.00 40.93 ? 377  ASP A C   1 
ATOM   2908 O O   . ASP A 1 377 ? 29.544  57.636 78.807 1.00 39.87 ? 377  ASP A O   1 
ATOM   2909 C CB  . ASP A 1 377 ? 29.789  59.223 76.466 1.00 40.69 ? 377  ASP A CB  1 
ATOM   2910 C CG  . ASP A 1 377 ? 31.201  59.623 76.830 1.00 44.07 ? 377  ASP A CG  1 
ATOM   2911 O OD1 . ASP A 1 377 ? 31.986  58.723 77.232 1.00 42.89 ? 377  ASP A OD1 1 
ATOM   2912 O OD2 . ASP A 1 377 ? 31.526  60.833 76.719 1.00 44.85 ? 377  ASP A OD2 1 
ATOM   2913 N N   . TRP A 1 378 ? 30.649  55.929 77.779 1.00 40.25 ? 378  TRP A N   1 
ATOM   2914 C CA  . TRP A 1 378 ? 30.965  55.237 79.030 1.00 42.77 ? 378  TRP A CA  1 
ATOM   2915 C C   . TRP A 1 378 ? 32.017  55.864 79.929 1.00 42.68 ? 378  TRP A C   1 
ATOM   2916 O O   . TRP A 1 378 ? 32.318  55.331 80.992 1.00 43.94 ? 378  TRP A O   1 
ATOM   2917 C CB  . TRP A 1 378 ? 31.299  53.731 78.814 1.00 41.49 ? 378  TRP A CB  1 
ATOM   2918 C CG  . TRP A 1 378 ? 30.157  52.950 78.283 1.00 44.02 ? 378  TRP A CG  1 
ATOM   2919 C CD1 . TRP A 1 378 ? 30.013  52.518 77.007 1.00 45.40 ? 378  TRP A CD1 1 
ATOM   2920 C CD2 . TRP A 1 378 ? 28.932  52.599 78.963 1.00 44.28 ? 378  TRP A CD2 1 
ATOM   2921 N NE1 . TRP A 1 378 ? 28.789  51.932 76.839 1.00 47.26 ? 378  TRP A NE1 1 
ATOM   2922 C CE2 . TRP A 1 378 ? 28.100  51.975 78.020 1.00 45.39 ? 378  TRP A CE2 1 
ATOM   2923 C CE3 . TRP A 1 378 ? 28.465  52.765 80.267 1.00 46.55 ? 378  TRP A CE3 1 
ATOM   2924 C CZ2 . TRP A 1 378 ? 26.802  51.513 78.330 1.00 48.13 ? 378  TRP A CZ2 1 
ATOM   2925 C CZ3 . TRP A 1 378 ? 27.180  52.308 80.586 1.00 46.71 ? 378  TRP A CZ3 1 
ATOM   2926 C CH2 . TRP A 1 378 ? 26.365  51.694 79.621 1.00 47.61 ? 378  TRP A CH2 1 
ATOM   2927 N N   A MET A 1 379 ? 32.592  56.978 79.517 0.75 42.44 ? 379  MET A N   1 
ATOM   2928 N N   B MET A 1 379 ? 32.574  56.989 79.499 0.25 42.44 ? 379  MET A N   1 
ATOM   2929 C CA  A MET A 1 379 ? 33.548  57.650 80.389 0.75 43.81 ? 379  MET A CA  1 
ATOM   2930 C CA  B MET A 1 379 ? 33.555  57.690 80.313 0.25 43.00 ? 379  MET A CA  1 
ATOM   2931 C C   A MET A 1 379 ? 32.753  58.684 81.182 0.75 44.19 ? 379  MET A C   1 
ATOM   2932 C C   B MET A 1 379 ? 32.802  58.828 80.995 0.25 43.43 ? 379  MET A C   1 
ATOM   2933 O O   A MET A 1 379 ? 33.281  59.325 82.095 0.75 44.12 ? 379  MET A O   1 
ATOM   2934 O O   B MET A 1 379 ? 33.414  59.693 81.630 0.25 43.33 ? 379  MET A O   1 
ATOM   2935 C CB  A MET A 1 379 ? 34.611  58.418 79.591 0.75 45.53 ? 379  MET A CB  1 
ATOM   2936 C CB  B MET A 1 379 ? 34.684  58.265 79.447 0.25 43.22 ? 379  MET A CB  1 
ATOM   2937 C CG  A MET A 1 379 ? 35.462  57.600 78.632 0.75 48.44 ? 379  MET A CG  1 
ATOM   2938 C CG  B MET A 1 379 ? 35.929  58.712 80.219 0.25 43.74 ? 379  MET A CG  1 
ATOM   2939 S SD  A MET A 1 379 ? 36.627  58.701 77.799 0.75 54.56 ? 379  MET A SD  1 
ATOM   2940 S SD  B MET A 1 379 ? 37.170  57.419 80.433 0.25 44.38 ? 379  MET A SD  1 
ATOM   2941 C CE  A MET A 1 379 ? 37.764  59.062 79.279 0.75 51.82 ? 379  MET A CE  1 
ATOM   2942 C CE  B MET A 1 379 ? 38.083  57.533 78.916 0.25 43.49 ? 379  MET A CE  1 
ATOM   2943 N N   . ASP A 1 380 ? 31.472  58.836 80.858 1.00 44.63 ? 380  ASP A N   1 
ATOM   2944 C CA  . ASP A 1 380 ? 30.663  59.892 81.485 1.00 45.05 ? 380  ASP A CA  1 
ATOM   2945 C C   . ASP A 1 380 ? 29.181  59.538 81.414 1.00 46.66 ? 380  ASP A C   1 
ATOM   2946 O O   . ASP A 1 380 ? 28.345  60.329 80.977 1.00 44.83 ? 380  ASP A O   1 
ATOM   2947 C CB  . ASP A 1 380 ? 30.993  61.185 80.713 1.00 43.27 ? 380  ASP A CB  1 
ATOM   2948 C CG  . ASP A 1 380 ? 30.540  62.445 81.411 1.00 44.55 ? 380  ASP A CG  1 
ATOM   2949 O OD1 . ASP A 1 380 ? 30.250  62.413 82.634 1.00 46.29 ? 380  ASP A OD1 1 
ATOM   2950 O OD2 . ASP A 1 380 ? 30.486  63.476 80.710 1.00 43.51 ? 380  ASP A OD2 1 
ATOM   2951 N N   . ASP A 1 381 ? 28.864  58.336 81.878 1.00 48.70 ? 381  ASP A N   1 
ATOM   2952 C CA  . ASP A 1 381 ? 27.510  57.821 81.780 1.00 49.52 ? 381  ASP A CA  1 
ATOM   2953 C C   . ASP A 1 381 ? 26.421  58.511 82.564 1.00 50.26 ? 381  ASP A C   1 
ATOM   2954 O O   . ASP A 1 381 ? 25.239  58.336 82.248 1.00 49.60 ? 381  ASP A O   1 
ATOM   2955 C CB  . ASP A 1 381 ? 27.501  56.324 82.089 1.00 50.54 ? 381  ASP A CB  1 
ATOM   2956 C CG  . ASP A 1 381 ? 28.201  56.000 83.396 1.00 53.28 ? 381  ASP A CG  1 
ATOM   2957 O OD1 . ASP A 1 381 ? 29.399  56.374 83.589 1.00 53.08 ? 381  ASP A OD1 1 
ATOM   2958 O OD2 . ASP A 1 381 ? 27.537  55.360 84.227 1.00 54.76 ? 381  ASP A OD2 1 
ATOM   2959 N N   . ASN A 1 382 ? 26.781  59.277 83.588 1.00 49.87 ? 382  ASN A N   1 
ATOM   2960 C CA  . ASN A 1 382 ? 25.744  59.976 84.352 1.00 49.43 ? 382  ASN A CA  1 
ATOM   2961 C C   . ASN A 1 382 ? 25.648  61.441 83.936 1.00 47.29 ? 382  ASN A C   1 
ATOM   2962 O O   . ASN A 1 382 ? 25.071  62.268 84.631 1.00 48.18 ? 382  ASN A O   1 
ATOM   2963 C CB  . ASN A 1 382 ? 25.994  59.847 85.868 1.00 51.25 ? 382  ASN A CB  1 
ATOM   2964 C CG  . ASN A 1 382 ? 25.839  58.420 86.350 1.00 53.07 ? 382  ASN A CG  1 
ATOM   2965 O OD1 . ASN A 1 382 ? 24.825  57.777 86.101 1.00 52.34 ? 382  ASN A OD1 1 
ATOM   2966 N ND2 . ASN A 1 382 ? 26.860  57.910 87.032 1.00 54.76 ? 382  ASN A ND2 1 
ATOM   2967 N N   . ASN A 1 383 ? 26.233  61.780 82.802 1.00 44.30 ? 383  ASN A N   1 
ATOM   2968 C CA  . ASN A 1 383 ? 26.119  63.148 82.341 1.00 42.14 ? 383  ASN A CA  1 
ATOM   2969 C C   . ASN A 1 383 ? 24.650  63.309 81.817 1.00 41.17 ? 383  ASN A C   1 
ATOM   2970 O O   . ASN A 1 383 ? 24.255  62.701 80.814 1.00 37.96 ? 383  ASN A O   1 
ATOM   2971 C CB  . ASN A 1 383 ? 27.163  63.367 81.262 1.00 41.49 ? 383  ASN A CB  1 
ATOM   2972 C CG  . ASN A 1 383 ? 27.120  64.741 80.698 1.00 42.89 ? 383  ASN A CG  1 
ATOM   2973 O OD1 . ASN A 1 383 ? 28.153  65.266 80.265 1.00 44.80 ? 383  ASN A OD1 1 
ATOM   2974 N ND2 . ASN A 1 383 ? 25.929  65.345 80.665 1.00 40.44 ? 383  ASN A ND2 1 
ATOM   2975 N N   . GLY A 1 384 ? 23.843  64.085 82.555 1.00 40.20 ? 384  GLY A N   1 
ATOM   2976 C CA  . GLY A 1 384 ? 22.449  64.305 82.209 1.00 36.51 ? 384  GLY A CA  1 
ATOM   2977 C C   . GLY A 1 384 ? 22.235  64.898 80.822 1.00 36.32 ? 384  GLY A C   1 
ATOM   2978 O O   . GLY A 1 384 ? 21.292  64.514 80.130 1.00 34.91 ? 384  GLY A O   1 
ATOM   2979 N N   . ILE A 1 385 ? 23.101  65.808 80.405 1.00 36.31 ? 385  ILE A N   1 
ATOM   2980 C CA  . ILE A 1 385 ? 22.986  66.462 79.097 1.00 36.28 ? 385  ILE A CA  1 
ATOM   2981 C C   . ILE A 1 385 ? 23.252  65.445 77.975 1.00 38.04 ? 385  ILE A C   1 
ATOM   2982 O O   . ILE A 1 385 ? 22.587  65.454 76.930 1.00 38.68 ? 385  ILE A O   1 
ATOM   2983 C CB  . ILE A 1 385 ? 24.028  67.596 78.952 1.00 38.93 ? 385  ILE A CB  1 
ATOM   2984 C CG1 . ILE A 1 385 ? 23.796  68.676 80.016 1.00 41.33 ? 385  ILE A CG1 1 
ATOM   2985 C CG2 . ILE A 1 385 ? 24.015  68.198 77.562 1.00 35.14 ? 385  ILE A CG2 1 
ATOM   2986 C CD1 . ILE A 1 385 ? 22.447  69.219 79.996 1.00 45.76 ? 385  ILE A CD1 1 
ATOM   2987 N N   . LYS A 1 386 ? 24.226  64.572 78.204 1.00 37.92 ? 386  LYS A N   1 
ATOM   2988 C CA  . LYS A 1 386 ? 24.614  63.567 77.221 1.00 38.99 ? 386  LYS A CA  1 
ATOM   2989 C C   . LYS A 1 386 ? 23.556  62.490 77.112 1.00 38.28 ? 386  LYS A C   1 
ATOM   2990 O O   . LYS A 1 386 ? 23.306  61.980 76.016 1.00 37.87 ? 386  LYS A O   1 
ATOM   2991 C CB  . LYS A 1 386 ? 25.977  62.943 77.575 1.00 38.09 ? 386  LYS A CB  1 
ATOM   2992 C CG  . LYS A 1 386 ? 27.169  63.801 77.156 1.00 41.20 ? 386  LYS A CG  1 
ATOM   2993 C CD  . LYS A 1 386 ? 28.462  63.175 77.672 1.00 43.16 ? 386  LYS A CD  1 
ATOM   2994 C CE  . LYS A 1 386 ? 29.738  63.790 77.028 1.00 42.16 ? 386  LYS A CE  1 
ATOM   2995 N NZ  . LYS A 1 386 ? 30.954  63.367 77.830 1.00 42.84 ? 386  LYS A NZ  1 
ATOM   2996 N N   . ASN A 1 387 ? 22.938  62.145 78.240 1.00 37.31 ? 387  ASN A N   1 
ATOM   2997 C CA  . ASN A 1 387 ? 21.897  61.158 78.197 1.00 37.02 ? 387  ASN A CA  1 
ATOM   2998 C C   . ASN A 1 387 ? 20.708  61.743 77.392 1.00 36.06 ? 387  ASN A C   1 
ATOM   2999 O O   . ASN A 1 387 ? 20.145  61.059 76.534 1.00 35.00 ? 387  ASN A O   1 
ATOM   3000 C CB  . ASN A 1 387 ? 21.471  60.756 79.608 1.00 37.51 ? 387  ASN A CB  1 
ATOM   3001 C CG  . ASN A 1 387 ? 22.566  59.952 80.348 1.00 42.67 ? 387  ASN A CG  1 
ATOM   3002 O OD1 . ASN A 1 387 ? 23.417  59.314 79.708 1.00 43.19 ? 387  ASN A OD1 1 
ATOM   3003 N ND2 . ASN A 1 387 ? 22.546  59.983 81.697 1.00 39.92 ? 387  ASN A ND2 1 
ATOM   3004 N N   . ARG A 1 388 ? 20.356  63.004 77.659 1.00 34.61 ? 388  ARG A N   1 
ATOM   3005 C CA  . ARG A 1 388 ? 19.233  63.665 76.985 1.00 34.99 ? 388  ARG A CA  1 
ATOM   3006 C C   . ARG A 1 388 ? 19.499  63.759 75.470 1.00 35.64 ? 388  ARG A C   1 
ATOM   3007 O O   . ARG A 1 388 ? 18.640  63.365 74.647 1.00 36.32 ? 388  ARG A O   1 
ATOM   3008 C CB  . ARG A 1 388 ? 18.981  65.071 77.578 1.00 33.50 ? 388  ARG A CB  1 
ATOM   3009 C CG  . ARG A 1 388 ? 17.903  65.918 76.858 1.00 33.85 ? 388  ARG A CG  1 
ATOM   3010 C CD  . ARG A 1 388 ? 18.095  67.415 77.071 1.00 32.97 ? 388  ARG A CD  1 
ATOM   3011 N NE  . ARG A 1 388 ? 19.281  67.917 76.361 1.00 35.78 ? 388  ARG A NE  1 
ATOM   3012 C CZ  . ARG A 1 388 ? 19.930  69.048 76.673 1.00 33.60 ? 388  ARG A CZ  1 
ATOM   3013 N NH1 . ARG A 1 388 ? 20.981  69.436 75.980 1.00 34.17 ? 388  ARG A NH1 1 
ATOM   3014 N NH2 . ARG A 1 388 ? 19.537  69.794 77.689 1.00 34.70 ? 388  ARG A NH2 1 
ATOM   3015 N N   . ASP A 1 389 ? 20.691  64.237 75.103 1.00 33.90 ? 389  ASP A N   1 
ATOM   3016 C CA  . ASP A 1 389 ? 21.039  64.352 73.699 1.00 34.66 ? 389  ASP A CA  1 
ATOM   3017 C C   . ASP A 1 389 ? 21.163  63.001 72.968 1.00 34.14 ? 389  ASP A C   1 
ATOM   3018 O O   . ASP A 1 389 ? 20.820  62.907 71.769 1.00 32.88 ? 389  ASP A O   1 
ATOM   3019 C CB  . ASP A 1 389 ? 22.317  65.177 73.518 1.00 31.91 ? 389  ASP A CB  1 
ATOM   3020 C CG  . ASP A 1 389 ? 22.106  66.660 73.877 1.00 33.64 ? 389  ASP A CG  1 
ATOM   3021 O OD1 . ASP A 1 389 ? 20.923  67.107 73.959 1.00 30.81 ? 389  ASP A OD1 1 
ATOM   3022 O OD2 . ASP A 1 389 ? 23.126  67.348 74.069 1.00 33.62 ? 389  ASP A OD2 1 
ATOM   3023 N N   . GLY A 1 390 ? 21.653  61.987 73.686 1.00 33.33 ? 390  GLY A N   1 
ATOM   3024 C CA  . GLY A 1 390 ? 21.793  60.660 73.112 1.00 32.52 ? 390  GLY A CA  1 
ATOM   3025 C C   . GLY A 1 390 ? 20.427  60.070 72.770 1.00 32.83 ? 390  GLY A C   1 
ATOM   3026 O O   . GLY A 1 390 ? 20.250  59.476 71.716 1.00 31.95 ? 390  GLY A O   1 
ATOM   3027 N N   . LEU A 1 391 ? 19.462  60.251 73.668 1.00 32.06 ? 391  LEU A N   1 
ATOM   3028 C CA  . LEU A 1 391 ? 18.103  59.771 73.478 1.00 33.15 ? 391  LEU A CA  1 
ATOM   3029 C C   . LEU A 1 391 ? 17.453  60.518 72.269 1.00 33.67 ? 391  LEU A C   1 
ATOM   3030 O O   . LEU A 1 391 ? 16.802  59.928 71.408 1.00 34.15 ? 391  LEU A O   1 
ATOM   3031 C CB  . LEU A 1 391 ? 17.345  60.042 74.789 1.00 34.20 ? 391  LEU A CB  1 
ATOM   3032 C CG  . LEU A 1 391 ? 16.108  59.244 75.161 1.00 38.84 ? 391  LEU A CG  1 
ATOM   3033 C CD1 . LEU A 1 391 ? 16.236  57.775 74.603 1.00 39.66 ? 391  LEU A CD1 1 
ATOM   3034 C CD2 . LEU A 1 391 ? 15.928  59.256 76.722 1.00 37.69 ? 391  LEU A CD2 1 
ATOM   3035 N N   . ASP A 1 392 ? 17.646  61.827 72.227 1.00 33.45 ? 392  ASP A N   1 
ATOM   3036 C CA  . ASP A 1 392 ? 17.143  62.664 71.150 1.00 34.71 ? 392  ASP A CA  1 
ATOM   3037 C C   . ASP A 1 392 ? 17.684  62.069 69.831 1.00 34.11 ? 392  ASP A C   1 
ATOM   3038 O O   . ASP A 1 392 ? 16.907  61.772 68.918 1.00 35.03 ? 392  ASP A O   1 
ATOM   3039 C CB  . ASP A 1 392 ? 17.619  64.114 71.391 1.00 35.86 ? 392  ASP A CB  1 
ATOM   3040 C CG  . ASP A 1 392 ? 16.867  65.160 70.558 1.00 40.69 ? 392  ASP A CG  1 
ATOM   3041 O OD1 . ASP A 1 392 ? 16.094  64.847 69.613 1.00 42.37 ? 392  ASP A OD1 1 
ATOM   3042 O OD2 . ASP A 1 392 ? 17.077  66.353 70.848 1.00 44.19 ? 392  ASP A OD2 1 
ATOM   3043 N N   . ASP A 1 393 ? 18.995  61.861 69.724 1.00 32.60 ? 393  ASP A N   1 
ATOM   3044 C CA  . ASP A 1 393 ? 19.552  61.279 68.497 1.00 30.67 ? 393  ASP A CA  1 
ATOM   3045 C C   . ASP A 1 393 ? 18.997  59.876 68.176 1.00 30.74 ? 393  ASP A C   1 
ATOM   3046 O O   . ASP A 1 393 ? 18.772  59.532 67.002 1.00 30.01 ? 393  ASP A O   1 
ATOM   3047 C CB  . ASP A 1 393 ? 21.056  61.189 68.596 1.00 33.02 ? 393  ASP A CB  1 
ATOM   3048 C CG  . ASP A 1 393 ? 21.718  62.541 68.532 1.00 37.08 ? 393  ASP A CG  1 
ATOM   3049 O OD1 . ASP A 1 393 ? 21.149  63.453 67.890 1.00 39.98 ? 393  ASP A OD1 1 
ATOM   3050 O OD2 . ASP A 1 393 ? 22.825  62.684 69.092 1.00 39.79 ? 393  ASP A OD2 1 
ATOM   3051 N N   . ILE A 1 394 ? 18.794  59.055 69.200 1.00 28.13 ? 394  ILE A N   1 
ATOM   3052 C CA  . ILE A 1 394 ? 18.226  57.726 68.953 1.00 28.55 ? 394  ILE A CA  1 
ATOM   3053 C C   . ILE A 1 394 ? 16.858  57.859 68.300 1.00 27.93 ? 394  ILE A C   1 
ATOM   3054 O O   . ILE A 1 394 ? 16.598  57.241 67.292 1.00 29.17 ? 394  ILE A O   1 
ATOM   3055 C CB  . ILE A 1 394 ? 18.072  56.921 70.259 1.00 29.06 ? 394  ILE A CB  1 
ATOM   3056 C CG1 . ILE A 1 394 ? 19.463  56.402 70.705 1.00 27.32 ? 394  ILE A CG1 1 
ATOM   3057 C CG2 . ILE A 1 394 ? 17.036  55.761 70.094 1.00 26.69 ? 394  ILE A CG2 1 
ATOM   3058 C CD1 . ILE A 1 394 ? 19.452  55.977 72.175 1.00 28.98 ? 394  ILE A CD1 1 
ATOM   3059 N N   . VAL A 1 395 ? 15.997  58.700 68.844 1.00 28.72 ? 395  VAL A N   1 
ATOM   3060 C CA  . VAL A 1 395 ? 14.687  58.822 68.265 1.00 28.54 ? 395  VAL A CA  1 
ATOM   3061 C C   . VAL A 1 395 ? 14.760  59.333 66.831 1.00 28.58 ? 395  VAL A C   1 
ATOM   3062 O O   . VAL A 1 395 ? 14.169  58.728 65.931 1.00 29.08 ? 395  VAL A O   1 
ATOM   3063 C CB  . VAL A 1 395 ? 13.782  59.714 69.154 1.00 28.89 ? 395  VAL A CB  1 
ATOM   3064 C CG1 . VAL A 1 395 ? 12.395  59.851 68.541 1.00 26.93 ? 395  VAL A CG1 1 
ATOM   3065 C CG2 . VAL A 1 395 ? 13.661  59.072 70.536 1.00 27.97 ? 395  VAL A CG2 1 
ATOM   3066 N N   . GLY A 1 396 ? 15.527  60.409 66.620 1.00 28.28 ? 396  GLY A N   1 
ATOM   3067 C CA  . GLY A 1 396 ? 15.675  60.972 65.296 1.00 26.43 ? 396  GLY A CA  1 
ATOM   3068 C C   . GLY A 1 396 ? 16.368  60.049 64.294 1.00 28.58 ? 396  GLY A C   1 
ATOM   3069 O O   . GLY A 1 396 ? 15.930  59.935 63.130 1.00 28.81 ? 396  GLY A O   1 
ATOM   3070 N N   . ASP A 1 397 ? 17.438  59.369 64.706 1.00 27.60 ? 397  ASP A N   1 
ATOM   3071 C CA  . ASP A 1 397 ? 18.125  58.499 63.763 1.00 26.88 ? 397  ASP A CA  1 
ATOM   3072 C C   . ASP A 1 397 ? 17.246  57.310 63.346 1.00 27.15 ? 397  ASP A C   1 
ATOM   3073 O O   . ASP A 1 397 ? 17.151  56.986 62.173 1.00 26.97 ? 397  ASP A O   1 
ATOM   3074 C CB  . ASP A 1 397 ? 19.429  57.927 64.345 1.00 27.82 ? 397  ASP A CB  1 
ATOM   3075 C CG  . ASP A 1 397 ? 20.509  59.000 64.583 1.00 28.74 ? 397  ASP A CG  1 
ATOM   3076 O OD1 . ASP A 1 397 ? 20.431  60.102 64.020 1.00 25.63 ? 397  ASP A OD1 1 
ATOM   3077 O OD2 . ASP A 1 397 ? 21.457  58.699 65.329 1.00 28.57 ? 397  ASP A OD2 1 
ATOM   3078 N N   . HIS A 1 398 ? 16.638  56.655 64.322 1.00 26.62 ? 398  HIS A N   1 
ATOM   3079 C CA  . HIS A 1 398 ? 15.812  55.497 64.042 1.00 28.11 ? 398  HIS A CA  1 
ATOM   3080 C C   . HIS A 1 398 ? 14.522  55.809 63.257 1.00 27.91 ? 398  HIS A C   1 
ATOM   3081 O O   . HIS A 1 398 ? 14.175  55.079 62.339 1.00 28.13 ? 398  HIS A O   1 
ATOM   3082 C CB  . HIS A 1 398 ? 15.462  54.757 65.372 1.00 27.25 ? 398  HIS A CB  1 
ATOM   3083 C CG  . HIS A 1 398 ? 14.408  53.707 65.224 1.00 28.14 ? 398  HIS A CG  1 
ATOM   3084 N ND1 . HIS A 1 398 ? 14.561  52.589 64.408 1.00 28.97 ? 398  HIS A ND1 1 
ATOM   3085 C CD2 . HIS A 1 398 ? 13.182  53.597 65.794 1.00 28.06 ? 398  HIS A CD2 1 
ATOM   3086 C CE1 . HIS A 1 398 ? 13.473  51.845 64.486 1.00 27.55 ? 398  HIS A CE1 1 
ATOM   3087 N NE2 . HIS A 1 398 ? 12.621  52.433 65.322 1.00 29.31 ? 398  HIS A NE2 1 
ATOM   3088 N N   . ASN A 1 399 ? 13.867  56.918 63.585 1.00 27.37 ? 399  ASN A N   1 
ATOM   3089 C CA  . ASN A 1 399 ? 12.603  57.229 62.989 1.00 26.70 ? 399  ASN A CA  1 
ATOM   3090 C C   . ASN A 1 399 ? 12.597  58.059 61.737 1.00 27.94 ? 399  ASN A C   1 
ATOM   3091 O O   . ASN A 1 399 ? 11.702  57.923 60.910 1.00 27.75 ? 399  ASN A O   1 
ATOM   3092 C CB  . ASN A 1 399 ? 11.746  57.880 64.045 1.00 26.28 ? 399  ASN A CB  1 
ATOM   3093 C CG  . ASN A 1 399 ? 11.265  56.878 65.104 1.00 27.41 ? 399  ASN A CG  1 
ATOM   3094 O OD1 . ASN A 1 399 ? 10.482  55.957 64.811 1.00 24.78 ? 399  ASN A OD1 1 
ATOM   3095 N ND2 . ASN A 1 399 ? 11.709  57.071 66.342 1.00 25.92 ? 399  ASN A ND2 1 
ATOM   3096 N N   . VAL A 1 400 ? 13.636  58.870 61.546 1.00 27.93 ? 400  VAL A N   1 
ATOM   3097 C CA  . VAL A 1 400 ? 13.640  59.771 60.410 1.00 26.14 ? 400  VAL A CA  1 
ATOM   3098 C C   . VAL A 1 400 ? 14.897  59.740 59.590 1.00 26.89 ? 400  VAL A C   1 
ATOM   3099 O O   . VAL A 1 400 ? 14.869  59.416 58.396 1.00 28.02 ? 400  VAL A O   1 
ATOM   3100 C CB  . VAL A 1 400 ? 13.412  61.218 60.895 1.00 25.97 ? 400  VAL A CB  1 
ATOM   3101 C CG1 . VAL A 1 400 ? 13.501  62.211 59.731 1.00 24.13 ? 400  VAL A CG1 1 
ATOM   3102 C CG2 . VAL A 1 400 ? 12.039  61.307 61.562 1.00 25.89 ? 400  VAL A CG2 1 
ATOM   3103 N N   . ILE A 1 401 ? 16.025  60.046 60.221 1.00 27.37 ? 401  ILE A N   1 
ATOM   3104 C CA  . ILE A 1 401 ? 17.268  60.104 59.467 1.00 26.25 ? 401  ILE A CA  1 
ATOM   3105 C C   . ILE A 1 401 ? 17.733  58.839 58.780 1.00 27.93 ? 401  ILE A C   1 
ATOM   3106 O O   . ILE A 1 401 ? 17.895  58.824 57.554 1.00 28.78 ? 401  ILE A O   1 
ATOM   3107 C CB  . ILE A 1 401 ? 18.399  60.673 60.314 1.00 24.67 ? 401  ILE A CB  1 
ATOM   3108 C CG1 . ILE A 1 401 ? 17.943  62.061 60.823 1.00 25.32 ? 401  ILE A CG1 1 
ATOM   3109 C CG2 . ILE A 1 401 ? 19.722  60.709 59.470 1.00 21.54 ? 401  ILE A CG2 1 
ATOM   3110 C CD1 . ILE A 1 401 ? 19.010  62.941 61.379 1.00 28.55 ? 401  ILE A CD1 1 
ATOM   3111 N N   . CYS A 1 402 ? 17.959  57.774 59.537 1.00 28.86 ? 402  CYS A N   1 
ATOM   3112 C CA  . CYS A 1 402 ? 18.449  56.553 58.905 1.00 28.18 ? 402  CYS A CA  1 
ATOM   3113 C C   . CYS A 1 402 ? 17.460  55.961 57.882 1.00 28.17 ? 402  CYS A C   1 
ATOM   3114 O O   . CYS A 1 402 ? 17.893  55.431 56.891 1.00 26.94 ? 402  CYS A O   1 
ATOM   3115 C CB  . CYS A 1 402 ? 18.880  55.573 59.992 1.00 28.19 ? 402  CYS A CB  1 
ATOM   3116 S SG  . CYS A 1 402 ? 20.325  56.296 60.869 1.00 32.24 ? 402  CYS A SG  1 
ATOM   3117 N N   . PRO A 1 403 ? 16.123  56.005 58.144 1.00 29.50 ? 403  PRO A N   1 
ATOM   3118 C CA  . PRO A 1 403 ? 15.178  55.475 57.139 1.00 29.65 ? 403  PRO A CA  1 
ATOM   3119 C C   . PRO A 1 403 ? 15.355  56.344 55.865 1.00 30.36 ? 403  PRO A C   1 
ATOM   3120 O O   . PRO A 1 403 ? 15.397  55.814 54.752 1.00 31.97 ? 403  PRO A O   1 
ATOM   3121 C CB  . PRO A 1 403 ? 13.780  55.735 57.763 1.00 27.81 ? 403  PRO A CB  1 
ATOM   3122 C CG  . PRO A 1 403 ? 14.057  55.545 59.229 1.00 30.16 ? 403  PRO A CG  1 
ATOM   3123 C CD  . PRO A 1 403 ? 15.446  56.204 59.450 1.00 29.73 ? 403  PRO A CD  1 
ATOM   3124 N N   . LEU A 1 404 ? 15.464  57.676 56.028 1.00 29.96 ? 404  LEU A N   1 
ATOM   3125 C CA  . LEU A 1 404 ? 15.625  58.529 54.858 1.00 30.68 ? 404  LEU A CA  1 
ATOM   3126 C C   . LEU A 1 404 ? 16.952  58.226 54.099 1.00 32.24 ? 404  LEU A C   1 
ATOM   3127 O O   . LEU A 1 404 ? 16.984  58.181 52.847 1.00 31.81 ? 404  LEU A O   1 
ATOM   3128 C CB  . LEU A 1 404 ? 15.564  60.015 55.242 1.00 30.63 ? 404  LEU A CB  1 
ATOM   3129 C CG  . LEU A 1 404 ? 15.583  60.996 54.045 1.00 32.01 ? 404  LEU A CG  1 
ATOM   3130 C CD1 . LEU A 1 404 ? 14.614  62.184 54.217 1.00 31.14 ? 404  LEU A CD1 1 
ATOM   3131 C CD2 . LEU A 1 404 ? 17.014  61.481 53.879 1.00 29.07 ? 404  LEU A CD2 1 
ATOM   3132 N N   . MET A 1 405 ? 18.035  58.009 54.841 1.00 31.15 ? 405  MET A N   1 
ATOM   3133 C CA  . MET A 1 405 ? 19.312  57.725 54.187 1.00 32.45 ? 405  MET A CA  1 
ATOM   3134 C C   . MET A 1 405 ? 19.235  56.401 53.429 1.00 32.20 ? 405  MET A C   1 
ATOM   3135 O O   . MET A 1 405 ? 19.762  56.278 52.333 1.00 32.35 ? 405  MET A O   1 
ATOM   3136 C CB  . MET A 1 405 ? 20.483  57.745 55.193 1.00 29.50 ? 405  MET A CB  1 
ATOM   3137 C CG  . MET A 1 405 ? 20.703  59.160 55.722 1.00 28.33 ? 405  MET A CG  1 
ATOM   3138 S SD  . MET A 1 405 ? 20.854  60.415 54.419 1.00 29.71 ? 405  MET A SD  1 
ATOM   3139 C CE  . MET A 1 405 ? 22.294  59.619 53.474 1.00 26.81 ? 405  MET A CE  1 
ATOM   3140 N N   . HIS A 1 406 ? 18.519  55.436 53.982 1.00 32.33 ? 406  HIS A N   1 
ATOM   3141 C CA  . HIS A 1 406 ? 18.370  54.159 53.292 1.00 32.78 ? 406  HIS A CA  1 
ATOM   3142 C C   . HIS A 1 406 ? 17.534  54.394 52.005 1.00 33.52 ? 406  HIS A C   1 
ATOM   3143 O O   . HIS A 1 406 ? 17.894  53.884 50.925 1.00 34.50 ? 406  HIS A O   1 
ATOM   3144 C CB  . HIS A 1 406 ? 17.673  53.144 54.206 1.00 31.74 ? 406  HIS A CB  1 
ATOM   3145 C CG  . HIS A 1 406 ? 17.435  51.814 53.569 1.00 33.92 ? 406  HIS A CG  1 
ATOM   3146 N ND1 . HIS A 1 406 ? 18.455  50.923 53.300 1.00 34.39 ? 406  HIS A ND1 1 
ATOM   3147 C CD2 . HIS A 1 406 ? 16.285  51.214 53.158 1.00 33.34 ? 406  HIS A CD2 1 
ATOM   3148 C CE1 . HIS A 1 406 ? 17.946  49.835 52.749 1.00 33.53 ? 406  HIS A CE1 1 
ATOM   3149 N NE2 . HIS A 1 406 ? 16.633  49.984 52.655 1.00 34.12 ? 406  HIS A NE2 1 
ATOM   3150 N N   . PHE A 1 407 ? 16.431  55.147 52.113 1.00 31.49 ? 407  PHE A N   1 
ATOM   3151 C CA  . PHE A 1 407 ? 15.630  55.418 50.924 1.00 31.78 ? 407  PHE A CA  1 
ATOM   3152 C C   . PHE A 1 407 ? 16.473  56.157 49.885 1.00 32.47 ? 407  PHE A C   1 
ATOM   3153 O O   . PHE A 1 407 ? 16.438  55.785 48.695 1.00 31.56 ? 407  PHE A O   1 
ATOM   3154 C CB  . PHE A 1 407 ? 14.389  56.266 51.248 1.00 31.18 ? 407  PHE A CB  1 
ATOM   3155 C CG  . PHE A 1 407 ? 13.650  56.773 50.035 1.00 30.27 ? 407  PHE A CG  1 
ATOM   3156 C CD1 . PHE A 1 407 ? 12.781  55.945 49.324 1.00 30.79 ? 407  PHE A CD1 1 
ATOM   3157 C CD2 . PHE A 1 407 ? 13.798  58.091 49.620 1.00 30.08 ? 407  PHE A CD2 1 
ATOM   3158 C CE1 . PHE A 1 407 ? 12.051  56.420 48.205 1.00 30.34 ? 407  PHE A CE1 1 
ATOM   3159 C CE2 . PHE A 1 407 ? 13.079  58.574 48.502 1.00 30.14 ? 407  PHE A CE2 1 
ATOM   3160 C CZ  . PHE A 1 407 ? 12.205  57.733 47.804 1.00 30.06 ? 407  PHE A CZ  1 
ATOM   3161 N N   . VAL A 1 408 ? 17.268  57.155 50.312 1.00 32.05 ? 408  VAL A N   1 
ATOM   3162 C CA  . VAL A 1 408 ? 18.001  57.911 49.311 1.00 33.61 ? 408  VAL A CA  1 
ATOM   3163 C C   . VAL A 1 408 ? 19.107  57.124 48.606 1.00 34.28 ? 408  VAL A C   1 
ATOM   3164 O O   . VAL A 1 408 ? 19.353  57.307 47.407 1.00 33.86 ? 408  VAL A O   1 
ATOM   3165 C CB  . VAL A 1 408 ? 18.553  59.274 49.859 1.00 34.05 ? 408  VAL A CB  1 
ATOM   3166 C CG1 . VAL A 1 408 ? 19.675  59.054 50.792 1.00 33.41 ? 408  VAL A CG1 1 
ATOM   3167 C CG2 . VAL A 1 408 ? 19.013  60.168 48.679 1.00 36.22 ? 408  VAL A CG2 1 
ATOM   3168 N N   . ASN A 1 409 ? 19.765  56.246 49.335 1.00 34.81 ? 409  ASN A N   1 
ATOM   3169 C CA  . ASN A 1 409 ? 20.799  55.450 48.702 1.00 35.27 ? 409  ASN A CA  1 
ATOM   3170 C C   . ASN A 1 409 ? 20.129  54.417 47.788 1.00 35.21 ? 409  ASN A C   1 
ATOM   3171 O O   . ASN A 1 409 ? 20.652  54.092 46.732 1.00 37.03 ? 409  ASN A O   1 
ATOM   3172 C CB  . ASN A 1 409 ? 21.703  54.815 49.784 1.00 34.47 ? 409  ASN A CB  1 
ATOM   3173 C CG  . ASN A 1 409 ? 22.830  55.766 50.189 1.00 37.12 ? 409  ASN A CG  1 
ATOM   3174 O OD1 . ASN A 1 409 ? 23.712  56.048 49.361 1.00 40.53 ? 409  ASN A OD1 1 
ATOM   3175 N ND2 . ASN A 1 409 ? 22.807  56.283 51.429 1.00 33.72 ? 409  ASN A ND2 1 
ATOM   3176 N N   . LYS A 1 410 ? 18.972  53.900 48.155 1.00 33.89 ? 410  LYS A N   1 
ATOM   3177 C CA  . LYS A 1 410 ? 18.338  52.952 47.253 1.00 35.81 ? 410  LYS A CA  1 
ATOM   3178 C C   . LYS A 1 410 ? 17.776  53.684 46.020 1.00 36.51 ? 410  LYS A C   1 
ATOM   3179 O O   . LYS A 1 410 ? 17.883  53.200 44.885 1.00 35.49 ? 410  LYS A O   1 
ATOM   3180 C CB  . LYS A 1 410 ? 17.205  52.227 47.957 1.00 37.04 ? 410  LYS A CB  1 
ATOM   3181 C CG  . LYS A 1 410 ? 17.677  51.249 49.008 1.00 39.59 ? 410  LYS A CG  1 
ATOM   3182 C CD  . LYS A 1 410 ? 18.218  49.995 48.370 1.00 40.37 ? 410  LYS A CD  1 
ATOM   3183 C CE  . LYS A 1 410 ? 18.787  49.059 49.408 1.00 43.27 ? 410  LYS A CE  1 
ATOM   3184 N NZ  . LYS A 1 410 ? 19.470  47.911 48.711 1.00 43.85 ? 410  LYS A NZ  1 
ATOM   3185 N N   . TYR A 1 411 ? 17.220  54.873 46.237 1.00 35.00 ? 411  TYR A N   1 
ATOM   3186 C CA  . TYR A 1 411 ? 16.610  55.594 45.142 1.00 35.12 ? 411  TYR A CA  1 
ATOM   3187 C C   . TYR A 1 411 ? 17.602  56.051 44.101 1.00 35.23 ? 411  TYR A C   1 
ATOM   3188 O O   . TYR A 1 411 ? 17.377  55.897 42.900 1.00 35.04 ? 411  TYR A O   1 
ATOM   3189 C CB  . TYR A 1 411 ? 15.816  56.837 45.640 1.00 33.56 ? 411  TYR A CB  1 
ATOM   3190 C CG  . TYR A 1 411 ? 15.008  57.461 44.535 1.00 30.62 ? 411  TYR A CG  1 
ATOM   3191 C CD1 . TYR A 1 411 ? 13.726  57.017 44.278 1.00 30.89 ? 411  TYR A CD1 1 
ATOM   3192 C CD2 . TYR A 1 411 ? 15.558  58.459 43.699 1.00 29.97 ? 411  TYR A CD2 1 
ATOM   3193 C CE1 . TYR A 1 411 ? 12.978  57.514 43.222 1.00 32.33 ? 411  TYR A CE1 1 
ATOM   3194 C CE2 . TYR A 1 411 ? 14.836  58.981 42.627 1.00 28.40 ? 411  TYR A CE2 1 
ATOM   3195 C CZ  . TYR A 1 411 ? 13.532  58.497 42.379 1.00 31.97 ? 411  TYR A CZ  1 
ATOM   3196 O OH  . TYR A 1 411 ? 12.798  58.885 41.272 1.00 30.14 ? 411  TYR A OH  1 
ATOM   3197 N N   . THR A 1 412 ? 18.687  56.636 44.577 1.00 36.20 ? 412  THR A N   1 
ATOM   3198 C CA  . THR A 1 412 ? 19.705  57.190 43.716 1.00 36.55 ? 412  THR A CA  1 
ATOM   3199 C C   . THR A 1 412 ? 20.291  56.196 42.712 1.00 37.96 ? 412  THR A C   1 
ATOM   3200 O O   . THR A 1 412 ? 20.691  56.573 41.622 1.00 38.91 ? 412  THR A O   1 
ATOM   3201 C CB  . THR A 1 412 ? 20.793  57.846 44.600 1.00 35.11 ? 412  THR A CB  1 
ATOM   3202 O OG1 . THR A 1 412 ? 20.192  58.921 45.341 1.00 36.76 ? 412  THR A OG1 1 
ATOM   3203 C CG2 . THR A 1 412 ? 21.936  58.382 43.778 1.00 34.36 ? 412  THR A CG2 1 
ATOM   3204 N N   . LYS A 1 413 ? 20.319  54.933 43.069 1.00 39.06 ? 413  LYS A N   1 
ATOM   3205 C CA  . LYS A 1 413 ? 20.824  53.945 42.154 1.00 41.83 ? 413  LYS A CA  1 
ATOM   3206 C C   . LYS A 1 413 ? 19.991  53.916 40.841 1.00 42.90 ? 413  LYS A C   1 
ATOM   3207 O O   . LYS A 1 413 ? 20.540  53.657 39.768 1.00 43.78 ? 413  LYS A O   1 
ATOM   3208 C CB  . LYS A 1 413 ? 20.810  52.568 42.830 1.00 42.99 ? 413  LYS A CB  1 
ATOM   3209 C CG  . LYS A 1 413 ? 21.117  51.411 41.860 1.00 46.45 ? 413  LYS A CG  1 
ATOM   3210 N N   . PHE A 1 414 ? 18.680  54.174 40.910 1.00 41.62 ? 414  PHE A N   1 
ATOM   3211 C CA  . PHE A 1 414 ? 17.846  54.155 39.709 1.00 40.33 ? 414  PHE A CA  1 
ATOM   3212 C C   . PHE A 1 414 ? 17.258  55.486 39.265 1.00 39.95 ? 414  PHE A C   1 
ATOM   3213 O O   . PHE A 1 414 ? 16.715  55.581 38.160 1.00 37.56 ? 414  PHE A O   1 
ATOM   3214 C CB  . PHE A 1 414 ? 16.670  53.235 39.915 1.00 40.54 ? 414  PHE A CB  1 
ATOM   3215 C CG  . PHE A 1 414 ? 17.040  51.822 40.081 1.00 42.61 ? 414  PHE A CG  1 
ATOM   3216 C CD1 . PHE A 1 414 ? 17.217  50.999 38.962 1.00 43.23 ? 414  PHE A CD1 1 
ATOM   3217 C CD2 . PHE A 1 414 ? 17.154  51.278 41.350 1.00 41.11 ? 414  PHE A CD2 1 
ATOM   3218 C CE1 . PHE A 1 414 ? 17.493  49.642 39.125 1.00 43.42 ? 414  PHE A CE1 1 
ATOM   3219 C CE2 . PHE A 1 414 ? 17.430  49.935 41.529 1.00 43.53 ? 414  PHE A CE2 1 
ATOM   3220 C CZ  . PHE A 1 414 ? 17.600  49.108 40.414 1.00 43.88 ? 414  PHE A CZ  1 
ATOM   3221 N N   . GLY A 1 415 ? 17.327  56.497 40.134 1.00 39.76 ? 415  GLY A N   1 
ATOM   3222 C CA  . GLY A 1 415 ? 16.723  57.784 39.828 1.00 38.47 ? 415  GLY A CA  1 
ATOM   3223 C C   . GLY A 1 415 ? 17.415  58.678 38.822 1.00 38.22 ? 415  GLY A C   1 
ATOM   3224 O O   . GLY A 1 415 ? 18.474  58.380 38.313 1.00 37.81 ? 415  GLY A O   1 
ATOM   3225 N N   . ASN A 1 416 ? 16.828  59.830 38.575 1.00 38.86 ? 416  ASN A N   1 
ATOM   3226 C CA  . ASN A 1 416 ? 17.419  60.699 37.596 1.00 40.04 ? 416  ASN A CA  1 
ATOM   3227 C C   . ASN A 1 416 ? 17.997  61.969 38.204 1.00 38.86 ? 416  ASN A C   1 
ATOM   3228 O O   . ASN A 1 416 ? 18.235  62.941 37.499 1.00 38.82 ? 416  ASN A O   1 
ATOM   3229 C CB  . ASN A 1 416 ? 16.363  61.002 36.495 1.00 43.57 ? 416  ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 416 ? 16.963  61.775 35.300 1.00 49.07 ? 416  ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 416 ? 16.485  62.877 34.961 1.00 46.49 ? 416  ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 416 ? 18.018  61.213 34.687 1.00 49.83 ? 416  ASN A ND2 1 
ATOM   3233 N N   . GLY A 1 417 ? 18.238  61.961 39.518 1.00 37.98 ? 417  GLY A N   1 
ATOM   3234 C CA  . GLY A 1 417 ? 18.817  63.133 40.170 1.00 35.83 ? 417  GLY A CA  1 
ATOM   3235 C C   . GLY A 1 417 ? 18.361  63.323 41.615 1.00 35.91 ? 417  GLY A C   1 
ATOM   3236 O O   . GLY A 1 417 ? 17.152  63.407 41.883 1.00 37.00 ? 417  GLY A O   1 
ATOM   3237 N N   . THR A 1 418 ? 19.315  63.411 42.534 1.00 33.40 ? 418  THR A N   1 
ATOM   3238 C CA  . THR A 1 418 ? 19.015  63.551 43.944 1.00 33.40 ? 418  THR A CA  1 
ATOM   3239 C C   . THR A 1 418 ? 19.778  64.754 44.547 1.00 34.57 ? 418  THR A C   1 
ATOM   3240 O O   . THR A 1 418 ? 20.979  64.936 44.250 1.00 34.14 ? 418  THR A O   1 
ATOM   3241 C CB  . THR A 1 418 ? 19.495  62.281 44.694 1.00 33.44 ? 418  THR A CB  1 
ATOM   3242 O OG1 . THR A 1 418 ? 18.958  61.097 44.068 1.00 33.36 ? 418  THR A OG1 1 
ATOM   3243 C CG2 . THR A 1 418 ? 19.141  62.355 46.183 1.00 30.88 ? 418  THR A CG2 1 
ATOM   3244 N N   . TYR A 1 419 ? 19.083  65.567 45.350 1.00 32.75 ? 419  TYR A N   1 
ATOM   3245 C CA  . TYR A 1 419 ? 19.684  66.677 46.090 1.00 33.90 ? 419  TYR A CA  1 
ATOM   3246 C C   . TYR A 1 419 ? 19.276  66.462 47.557 1.00 34.02 ? 419  TYR A C   1 
ATOM   3247 O O   . TYR A 1 419 ? 18.067  66.361 47.885 1.00 34.76 ? 419  TYR A O   1 
ATOM   3248 C CB  . TYR A 1 419 ? 19.215  68.051 45.577 1.00 34.72 ? 419  TYR A CB  1 
ATOM   3249 C CG  . TYR A 1 419 ? 19.629  68.247 44.137 1.00 35.63 ? 419  TYR A CG  1 
ATOM   3250 C CD1 . TYR A 1 419 ? 18.818  67.783 43.091 1.00 32.83 ? 419  TYR A CD1 1 
ATOM   3251 C CD2 . TYR A 1 419 ? 20.857  68.835 43.824 1.00 34.99 ? 419  TYR A CD2 1 
ATOM   3252 C CE1 . TYR A 1 419 ? 19.192  67.901 41.809 1.00 33.53 ? 419  TYR A CE1 1 
ATOM   3253 C CE2 . TYR A 1 419 ? 21.256  68.955 42.511 1.00 36.07 ? 419  TYR A CE2 1 
ATOM   3254 C CZ  . TYR A 1 419 ? 20.418  68.495 41.503 1.00 38.30 ? 419  TYR A CZ  1 
ATOM   3255 O OH  . TYR A 1 419 ? 20.781  68.656 40.170 1.00 42.03 ? 419  TYR A OH  1 
ATOM   3256 N N   . LEU A 1 420 ? 20.294  66.349 48.411 1.00 33.05 ? 420  LEU A N   1 
ATOM   3257 C CA  . LEU A 1 420 ? 20.132  66.085 49.836 1.00 32.18 ? 420  LEU A CA  1 
ATOM   3258 C C   . LEU A 1 420 ? 20.533  67.253 50.757 1.00 31.72 ? 420  LEU A C   1 
ATOM   3259 O O   . LEU A 1 420 ? 21.516  67.953 50.535 1.00 31.14 ? 420  LEU A O   1 
ATOM   3260 C CB  . LEU A 1 420 ? 20.912  64.820 50.194 1.00 29.59 ? 420  LEU A CB  1 
ATOM   3261 C CG  . LEU A 1 420 ? 20.804  64.325 51.643 1.00 31.22 ? 420  LEU A CG  1 
ATOM   3262 C CD1 . LEU A 1 420 ? 19.391  63.859 51.939 1.00 29.21 ? 420  LEU A CD1 1 
ATOM   3263 C CD2 . LEU A 1 420 ? 21.856  63.181 51.895 1.00 30.06 ? 420  LEU A CD2 1 
ATOM   3264 N N   . TYR A 1 421 ? 19.743  67.487 51.793 1.00 31.69 ? 421  TYR A N   1 
ATOM   3265 C CA  . TYR A 1 421 ? 20.085  68.578 52.696 1.00 32.28 ? 421  TYR A CA  1 
ATOM   3266 C C   . TYR A 1 421 ? 19.999  68.210 54.186 1.00 32.35 ? 421  TYR A C   1 
ATOM   3267 O O   . TYR A 1 421 ? 19.295  67.267 54.565 1.00 31.92 ? 421  TYR A O   1 
ATOM   3268 C CB  . TYR A 1 421 ? 19.168  69.776 52.412 1.00 31.45 ? 421  TYR A CB  1 
ATOM   3269 C CG  . TYR A 1 421 ? 17.737  69.636 52.925 1.00 31.75 ? 421  TYR A CG  1 
ATOM   3270 C CD1 . TYR A 1 421 ? 17.449  69.721 54.303 1.00 30.09 ? 421  TYR A CD1 1 
ATOM   3271 C CD2 . TYR A 1 421 ? 16.674  69.352 52.037 1.00 29.54 ? 421  TYR A CD2 1 
ATOM   3272 C CE1 . TYR A 1 421 ? 16.112  69.510 54.786 1.00 29.95 ? 421  TYR A CE1 1 
ATOM   3273 C CE2 . TYR A 1 421 ? 15.385  69.141 52.502 1.00 28.02 ? 421  TYR A CE2 1 
ATOM   3274 C CZ  . TYR A 1 421 ? 15.102  69.215 53.874 1.00 29.46 ? 421  TYR A CZ  1 
ATOM   3275 O OH  . TYR A 1 421 ? 13.833  68.931 54.317 1.00 30.30 ? 421  TYR A OH  1 
ATOM   3276 N N   . PHE A 1 422 ? 20.699  68.978 55.009 1.00 31.39 ? 422  PHE A N   1 
ATOM   3277 C CA  . PHE A 1 422 ? 20.688  68.817 56.441 1.00 33.48 ? 422  PHE A CA  1 
ATOM   3278 C C   . PHE A 1 422 ? 20.384  70.214 56.988 1.00 35.66 ? 422  PHE A C   1 
ATOM   3279 O O   . PHE A 1 422 ? 21.232  71.119 56.923 1.00 36.59 ? 422  PHE A O   1 
ATOM   3280 C CB  . PHE A 1 422 ? 22.054  68.335 56.916 1.00 35.17 ? 422  PHE A CB  1 
ATOM   3281 C CG  . PHE A 1 422 ? 22.144  68.104 58.411 1.00 35.37 ? 422  PHE A CG  1 
ATOM   3282 C CD1 . PHE A 1 422 ? 21.515  67.011 59.001 1.00 35.63 ? 422  PHE A CD1 1 
ATOM   3283 C CD2 . PHE A 1 422 ? 22.911  68.941 59.205 1.00 34.04 ? 422  PHE A CD2 1 
ATOM   3284 C CE1 . PHE A 1 422 ? 21.658  66.741 60.390 1.00 36.64 ? 422  PHE A CE1 1 
ATOM   3285 C CE2 . PHE A 1 422 ? 23.063  68.699 60.562 1.00 35.50 ? 422  PHE A CE2 1 
ATOM   3286 C CZ  . PHE A 1 422 ? 22.426  67.577 61.164 1.00 36.81 ? 422  PHE A CZ  1 
ATOM   3287 N N   . PHE A 1 423 ? 19.164  70.404 57.493 1.00 36.50 ? 423  PHE A N   1 
ATOM   3288 C CA  . PHE A 1 423 ? 18.725  71.686 58.034 1.00 35.32 ? 423  PHE A CA  1 
ATOM   3289 C C   . PHE A 1 423 ? 19.042  71.774 59.526 1.00 36.09 ? 423  PHE A C   1 
ATOM   3290 O O   . PHE A 1 423 ? 18.465  71.045 60.354 1.00 35.52 ? 423  PHE A O   1 
ATOM   3291 C CB  . PHE A 1 423 ? 17.238  71.860 57.806 1.00 36.05 ? 423  PHE A CB  1 
ATOM   3292 C CG  . PHE A 1 423 ? 16.702  73.178 58.289 1.00 37.47 ? 423  PHE A CG  1 
ATOM   3293 C CD1 . PHE A 1 423 ? 16.678  74.283 57.449 1.00 35.55 ? 423  PHE A CD1 1 
ATOM   3294 C CD2 . PHE A 1 423 ? 16.170  73.297 59.581 1.00 36.75 ? 423  PHE A CD2 1 
ATOM   3295 C CE1 . PHE A 1 423 ? 16.120  75.491 57.877 1.00 37.30 ? 423  PHE A CE1 1 
ATOM   3296 C CE2 . PHE A 1 423 ? 15.605  74.515 60.028 1.00 37.10 ? 423  PHE A CE2 1 
ATOM   3297 C CZ  . PHE A 1 423 ? 15.581  75.612 59.172 1.00 35.19 ? 423  PHE A CZ  1 
ATOM   3298 N N   . ASN A 1 424 ? 19.962  72.678 59.877 1.00 36.84 ? 424  ASN A N   1 
ATOM   3299 C CA  . ASN A 1 424 ? 20.377  72.799 61.267 1.00 38.55 ? 424  ASN A CA  1 
ATOM   3300 C C   . ASN A 1 424 ? 20.375  74.220 61.778 1.00 40.12 ? 424  ASN A C   1 
ATOM   3301 O O   . ASN A 1 424 ? 21.240  74.598 62.604 1.00 39.75 ? 424  ASN A O   1 
ATOM   3302 C CB  . ASN A 1 424 ? 21.761  72.131 61.512 1.00 36.08 ? 424  ASN A CB  1 
ATOM   3303 C CG  . ASN A 1 424 ? 22.878  72.767 60.702 1.00 38.20 ? 424  ASN A CG  1 
ATOM   3304 O OD1 . ASN A 1 424 ? 22.629  73.563 59.801 1.00 38.92 ? 424  ASN A OD1 1 
ATOM   3305 N ND2 . ASN A 1 424 ? 24.120  72.398 60.999 1.00 37.98 ? 424  ASN A ND2 1 
ATOM   3306 N N   . HIS A 1 425 ? 19.410  75.018 61.315 1.00 39.55 ? 425  HIS A N   1 
ATOM   3307 C CA  . HIS A 1 425 ? 19.345  76.366 61.854 1.00 40.42 ? 425  HIS A CA  1 
ATOM   3308 C C   . HIS A 1 425 ? 18.270  76.445 62.936 1.00 40.28 ? 425  HIS A C   1 
ATOM   3309 O O   . HIS A 1 425 ? 17.110  76.138 62.710 1.00 40.77 ? 425  HIS A O   1 
ATOM   3310 C CB  . HIS A 1 425 ? 19.045  77.443 60.784 1.00 39.88 ? 425  HIS A CB  1 
ATOM   3311 C CG  . HIS A 1 425 ? 18.929  78.836 61.365 1.00 41.55 ? 425  HIS A CG  1 
ATOM   3312 N ND1 . HIS A 1 425 ? 20.009  79.522 61.879 1.00 40.86 ? 425  HIS A ND1 1 
ATOM   3313 C CD2 . HIS A 1 425 ? 17.848  79.618 61.613 1.00 43.95 ? 425  HIS A CD2 1 
ATOM   3314 C CE1 . HIS A 1 425 ? 19.603  80.654 62.428 1.00 43.16 ? 425  HIS A CE1 1 
ATOM   3315 N NE2 . HIS A 1 425 ? 18.293  80.739 62.281 1.00 45.29 ? 425  HIS A NE2 1 
ATOM   3316 N N   . ARG A 1 426 ? 18.661  76.876 64.115 1.00 41.67 ? 426  ARG A N   1 
ATOM   3317 C CA  . ARG A 1 426 ? 17.718  77.059 65.212 1.00 43.18 ? 426  ARG A CA  1 
ATOM   3318 C C   . ARG A 1 426 ? 17.221  78.528 65.101 1.00 43.23 ? 426  ARG A C   1 
ATOM   3319 O O   . ARG A 1 426 ? 18.002  79.457 65.241 1.00 44.38 ? 426  ARG A O   1 
ATOM   3320 C CB  . ARG A 1 426 ? 18.439  76.785 66.542 1.00 43.30 ? 426  ARG A CB  1 
ATOM   3321 C CG  . ARG A 1 426 ? 17.817  77.426 67.776 1.00 46.85 ? 426  ARG A CG  1 
ATOM   3322 C CD  . ARG A 1 426 ? 16.891  76.514 68.502 1.00 45.59 ? 426  ARG A CD  1 
ATOM   3323 N NE  . ARG A 1 426 ? 16.320  77.141 69.689 1.00 45.58 ? 426  ARG A NE  1 
ATOM   3324 C CZ  . ARG A 1 426 ? 15.549  76.486 70.561 1.00 47.29 ? 426  ARG A CZ  1 
ATOM   3325 N NH1 . ARG A 1 426 ? 15.033  77.124 71.621 1.00 43.05 ? 426  ARG A NH1 1 
ATOM   3326 N NH2 . ARG A 1 426 ? 15.312  75.168 70.375 1.00 46.37 ? 426  ARG A NH2 1 
ATOM   3327 N N   . ALA A 1 427 ? 15.935  78.716 64.823 1.00 42.53 ? 427  ALA A N   1 
ATOM   3328 C CA  . ALA A 1 427 ? 15.336  80.042 64.663 1.00 43.64 ? 427  ALA A CA  1 
ATOM   3329 C C   . ALA A 1 427 ? 15.430  80.924 65.917 1.00 44.43 ? 427  ALA A C   1 
ATOM   3330 O O   . ALA A 1 427 ? 15.172  80.484 67.056 1.00 43.93 ? 427  ALA A O   1 
ATOM   3331 C CB  . ALA A 1 427 ? 13.858  79.927 64.209 1.00 41.17 ? 427  ALA A CB  1 
ATOM   3332 N N   . SER A 1 428 ? 15.779  82.187 65.673 1.00 45.62 ? 428  SER A N   1 
ATOM   3333 C CA  . SER A 1 428 ? 15.978  83.192 66.722 1.00 46.61 ? 428  SER A CA  1 
ATOM   3334 C C   . SER A 1 428 ? 14.744  83.402 67.567 1.00 46.88 ? 428  SER A C   1 
ATOM   3335 O O   . SER A 1 428 ? 14.868  83.626 68.752 1.00 47.78 ? 428  SER A O   1 
ATOM   3336 C CB  . SER A 1 428 ? 16.428  84.521 66.102 1.00 46.90 ? 428  SER A CB  1 
ATOM   3337 O OG  . SER A 1 428 ? 15.439  84.997 65.187 1.00 49.77 ? 428  SER A OG  1 
ATOM   3338 N N   . ASN A 1 429 ? 13.558  83.277 66.968 1.00 47.26 ? 429  ASN A N   1 
ATOM   3339 C CA  . ASN A 1 429 ? 12.294  83.467 67.691 1.00 46.00 ? 429  ASN A CA  1 
ATOM   3340 C C   . ASN A 1 429 ? 11.628  82.168 68.173 1.00 45.55 ? 429  ASN A C   1 
ATOM   3341 O O   . ASN A 1 429 ? 10.397  82.164 68.439 1.00 45.67 ? 429  ASN A O   1 
ATOM   3342 C CB  . ASN A 1 429 ? 11.290  84.206 66.774 1.00 45.70 ? 429  ASN A CB  1 
ATOM   3343 C CG  . ASN A 1 429 ? 11.082  83.488 65.406 1.00 47.36 ? 429  ASN A CG  1 
ATOM   3344 O OD1 . ASN A 1 429 ? 11.542  82.351 65.208 1.00 45.13 ? 429  ASN A OD1 1 
ATOM   3345 N ND2 . ASN A 1 429 ? 10.381  84.157 64.469 1.00 45.04 ? 429  ASN A ND2 1 
ATOM   3346 N N   . LEU A 1 430 ? 12.375  81.070 68.264 1.00 43.62 ? 430  LEU A N   1 
ATOM   3347 C CA  . LEU A 1 430 ? 11.746  79.800 68.683 1.00 42.96 ? 430  LEU A CA  1 
ATOM   3348 C C   . LEU A 1 430 ? 11.157  79.856 70.092 1.00 42.63 ? 430  LEU A C   1 
ATOM   3349 O O   . LEU A 1 430 ? 11.838  80.283 71.040 1.00 41.08 ? 430  LEU A O   1 
ATOM   3350 C CB  . LEU A 1 430 ? 12.748  78.644 68.652 1.00 44.26 ? 430  LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 430 ? 12.513  77.428 67.736 1.00 47.04 ? 430  LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 430 ? 12.882  76.234 68.567 1.00 48.96 ? 430  LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 430 ? 11.079  77.245 67.253 1.00 48.66 ? 430  LEU A CD2 1 
ATOM   3354 N N   . VAL A 1 431 ? 9.918   79.392 70.255 1.00 39.92 ? 431  VAL A N   1 
ATOM   3355 C CA  . VAL A 1 431 ? 9.325   79.437 71.577 1.00 39.08 ? 431  VAL A CA  1 
ATOM   3356 C C   . VAL A 1 431 ? 9.593   78.174 72.384 1.00 40.62 ? 431  VAL A C   1 
ATOM   3357 O O   . VAL A 1 431 ? 9.334   78.136 73.594 1.00 41.68 ? 431  VAL A O   1 
ATOM   3358 C CB  . VAL A 1 431 ? 7.804   79.687 71.489 1.00 40.40 ? 431  VAL A CB  1 
ATOM   3359 C CG1 . VAL A 1 431 ? 7.559   81.003 70.726 1.00 38.30 ? 431  VAL A CG1 1 
ATOM   3360 C CG2 . VAL A 1 431 ? 7.098   78.507 70.756 1.00 37.58 ? 431  VAL A CG2 1 
ATOM   3361 N N   . TRP A 1 432 ? 10.114  77.132 71.737 1.00 39.31 ? 432  TRP A N   1 
ATOM   3362 C CA  . TRP A 1 432 ? 10.415  75.866 72.450 1.00 36.16 ? 432  TRP A CA  1 
ATOM   3363 C C   . TRP A 1 432 ? 11.767  75.958 73.174 1.00 35.16 ? 432  TRP A C   1 
ATOM   3364 O O   . TRP A 1 432 ? 12.671  76.669 72.725 1.00 36.35 ? 432  TRP A O   1 
ATOM   3365 C CB  . TRP A 1 432 ? 10.434  74.666 71.453 1.00 33.49 ? 432  TRP A CB  1 
ATOM   3366 C CG  . TRP A 1 432 ? 9.060   74.343 70.842 1.00 30.67 ? 432  TRP A CG  1 
ATOM   3367 C CD1 . TRP A 1 432 ? 8.620   74.660 69.580 1.00 31.09 ? 432  TRP A CD1 1 
ATOM   3368 C CD2 . TRP A 1 432 ? 7.995   73.635 71.463 1.00 27.71 ? 432  TRP A CD2 1 
ATOM   3369 N NE1 . TRP A 1 432 ? 7.351   74.185 69.383 1.00 27.96 ? 432  TRP A NE1 1 
ATOM   3370 C CE2 . TRP A 1 432 ? 6.941   73.546 70.517 1.00 28.40 ? 432  TRP A CE2 1 
ATOM   3371 C CE3 . TRP A 1 432 ? 7.822   73.067 72.723 1.00 28.41 ? 432  TRP A CE3 1 
ATOM   3372 C CZ2 . TRP A 1 432 ? 5.723   72.894 70.788 1.00 27.49 ? 432  TRP A CZ2 1 
ATOM   3373 C CZ3 . TRP A 1 432 ? 6.607   72.415 73.008 1.00 31.30 ? 432  TRP A CZ3 1 
ATOM   3374 C CH2 . TRP A 1 432 ? 5.570   72.334 72.024 1.00 30.71 ? 432  TRP A CH2 1 
ATOM   3375 N N   . PRO A 1 433 ? 11.938  75.220 74.278 1.00 35.06 ? 433  PRO A N   1 
ATOM   3376 C CA  . PRO A 1 433 ? 13.212  75.294 74.984 1.00 35.94 ? 433  PRO A CA  1 
ATOM   3377 C C   . PRO A 1 433 ? 14.391  74.890 74.115 1.00 38.14 ? 433  PRO A C   1 
ATOM   3378 O O   . PRO A 1 433 ? 14.251  74.165 73.126 1.00 38.64 ? 433  PRO A O   1 
ATOM   3379 C CB  . PRO A 1 433 ? 13.016  74.336 76.139 1.00 35.58 ? 433  PRO A CB  1 
ATOM   3380 C CG  . PRO A 1 433 ? 12.128  73.255 75.503 1.00 33.51 ? 433  PRO A CG  1 
ATOM   3381 C CD  . PRO A 1 433 ? 11.103  74.135 74.838 1.00 33.74 ? 433  PRO A CD  1 
ATOM   3382 N N   . GLU A 1 434 ? 15.557  75.335 74.545 1.00 39.87 ? 434  GLU A N   1 
ATOM   3383 C CA  . GLU A 1 434 ? 16.820  75.110 73.877 1.00 40.54 ? 434  GLU A CA  1 
ATOM   3384 C C   . GLU A 1 434 ? 17.192  73.641 73.665 1.00 37.83 ? 434  GLU A C   1 
ATOM   3385 O O   . GLU A 1 434 ? 17.720  73.269 72.613 1.00 35.57 ? 434  GLU A O   1 
ATOM   3386 C CB  . GLU A 1 434 ? 17.927  75.786 74.689 1.00 44.21 ? 434  GLU A CB  1 
ATOM   3387 C CG  . GLU A 1 434 ? 18.781  76.728 73.862 1.00 51.46 ? 434  GLU A CG  1 
ATOM   3388 C CD  . GLU A 1 434 ? 18.001  77.983 73.424 1.00 57.18 ? 434  GLU A CD  1 
ATOM   3389 O OE2 . GLU A 1 434 ? 18.301  78.563 72.335 1.00 60.77 ? 434  GLU A OE2 1 
ATOM   3390 N N   . TRP A 1 435 ? 16.950  72.816 74.675 1.00 36.25 ? 435  TRP A N   1 
ATOM   3391 C CA  . TRP A 1 435 ? 17.314  71.408 74.564 1.00 36.48 ? 435  TRP A CA  1 
ATOM   3392 C C   . TRP A 1 435 ? 16.647  70.711 73.349 1.00 35.37 ? 435  TRP A C   1 
ATOM   3393 O O   . TRP A 1 435 ? 17.149  69.730 72.866 1.00 33.24 ? 435  TRP A O   1 
ATOM   3394 C CB  . TRP A 1 435 ? 16.991  70.652 75.852 1.00 35.96 ? 435  TRP A CB  1 
ATOM   3395 C CG  . TRP A 1 435 ? 15.503  70.373 76.115 1.00 38.07 ? 435  TRP A CG  1 
ATOM   3396 C CD1 . TRP A 1 435 ? 14.695  71.056 76.969 1.00 36.90 ? 435  TRP A CD1 1 
ATOM   3397 C CD2 . TRP A 1 435 ? 14.704  69.264 75.612 1.00 37.36 ? 435  TRP A CD2 1 
ATOM   3398 N NE1 . TRP A 1 435 ? 13.464  70.449 77.050 1.00 38.96 ? 435  TRP A NE1 1 
ATOM   3399 C CE2 . TRP A 1 435 ? 13.433  69.358 76.226 1.00 37.51 ? 435  TRP A CE2 1 
ATOM   3400 C CE3 . TRP A 1 435 ? 14.944  68.215 74.708 1.00 36.72 ? 435  TRP A CE3 1 
ATOM   3401 C CZ2 . TRP A 1 435 ? 12.393  68.449 75.965 1.00 36.41 ? 435  TRP A CZ2 1 
ATOM   3402 C CZ3 . TRP A 1 435 ? 13.916  67.306 74.445 1.00 36.88 ? 435  TRP A CZ3 1 
ATOM   3403 C CH2 . TRP A 1 435 ? 12.652  67.434 75.074 1.00 37.78 ? 435  TRP A CH2 1 
ATOM   3404 N N   . MET A 1 436 ? 15.561  71.268 72.826 1.00 34.51 ? 436  MET A N   1 
ATOM   3405 C CA  . MET A 1 436 ? 14.910  70.633 71.697 1.00 34.24 ? 436  MET A CA  1 
ATOM   3406 C C   . MET A 1 436 ? 15.614  70.850 70.365 1.00 33.98 ? 436  MET A C   1 
ATOM   3407 O O   . MET A 1 436 ? 15.311  70.147 69.394 1.00 33.23 ? 436  MET A O   1 
ATOM   3408 C CB  . MET A 1 436 ? 13.429  71.050 71.630 1.00 32.56 ? 436  MET A CB  1 
ATOM   3409 C CG  . MET A 1 436 ? 12.591  70.378 72.751 1.00 31.05 ? 436  MET A CG  1 
ATOM   3410 S SD  . MET A 1 436 ? 10.889  71.078 72.885 1.00 33.48 ? 436  MET A SD  1 
ATOM   3411 C CE  . MET A 1 436 ? 10.060  70.167 71.538 1.00 31.83 ? 436  MET A CE  1 
ATOM   3412 N N   . GLY A 1 437 ? 16.559  71.794 70.319 1.00 33.74 ? 437  GLY A N   1 
ATOM   3413 C CA  . GLY A 1 437 ? 17.322  72.063 69.086 1.00 32.61 ? 437  GLY A CA  1 
ATOM   3414 C C   . GLY A 1 437 ? 16.545  72.473 67.830 1.00 34.20 ? 437  GLY A C   1 
ATOM   3415 O O   . GLY A 1 437 ? 15.669  73.334 67.881 1.00 35.39 ? 437  GLY A O   1 
ATOM   3416 N N   . VAL A 1 438 ? 16.891  71.864 66.697 1.00 32.25 ? 438  VAL A N   1 
ATOM   3417 C CA  . VAL A 1 438 ? 16.245  72.108 65.426 1.00 31.96 ? 438  VAL A CA  1 
ATOM   3418 C C   . VAL A 1 438 ? 15.184  70.976 65.305 1.00 32.43 ? 438  VAL A C   1 
ATOM   3419 O O   . VAL A 1 438 ? 15.454  69.807 64.873 1.00 30.18 ? 438  VAL A O   1 
ATOM   3420 C CB  . VAL A 1 438 ? 17.294  72.041 64.320 1.00 33.97 ? 438  VAL A CB  1 
ATOM   3421 C CG1 . VAL A 1 438 ? 16.701  72.522 62.996 1.00 32.78 ? 438  VAL A CG1 1 
ATOM   3422 C CG2 . VAL A 1 438 ? 18.509  72.926 64.730 1.00 31.63 ? 438  VAL A CG2 1 
ATOM   3423 N N   . ILE A 1 439 ? 13.984  71.362 65.743 1.00 30.83 ? 439  ILE A N   1 
ATOM   3424 C CA  . ILE A 1 439 ? 12.816  70.521 65.871 1.00 29.49 ? 439  ILE A CA  1 
ATOM   3425 C C   . ILE A 1 439 ? 12.158  70.020 64.586 1.00 29.73 ? 439  ILE A C   1 
ATOM   3426 O O   . ILE A 1 439 ? 12.242  70.660 63.532 1.00 30.12 ? 439  ILE A O   1 
ATOM   3427 C CB  . ILE A 1 439 ? 11.812  71.272 66.729 1.00 29.97 ? 439  ILE A CB  1 
ATOM   3428 C CG1 . ILE A 1 439 ? 12.515  71.678 68.051 1.00 29.41 ? 439  ILE A CG1 1 
ATOM   3429 C CG2 . ILE A 1 439 ? 10.559  70.450 66.982 1.00 26.38 ? 439  ILE A CG2 1 
ATOM   3430 C CD1 . ILE A 1 439 ? 11.740  72.704 68.792 1.00 28.34 ? 439  ILE A CD1 1 
ATOM   3431 N N   . HIS A 1 440 ? 11.555  68.835 64.693 1.00 28.32 ? 440  HIS A N   1 
ATOM   3432 C CA  . HIS A 1 440 ? 10.840  68.200 63.614 1.00 27.67 ? 440  HIS A CA  1 
ATOM   3433 C C   . HIS A 1 440 ? 9.749   69.172 63.231 1.00 29.52 ? 440  HIS A C   1 
ATOM   3434 O O   . HIS A 1 440 ? 8.965   69.577 64.086 1.00 31.06 ? 440  HIS A O   1 
ATOM   3435 C CB  . HIS A 1 440 ? 10.227  66.900 64.124 1.00 26.65 ? 440  HIS A CB  1 
ATOM   3436 C CG  . HIS A 1 440 ? 9.628   66.028 63.063 1.00 26.60 ? 440  HIS A CG  1 
ATOM   3437 N ND1 . HIS A 1 440 ? 10.376  65.475 62.045 1.00 24.29 ? 440  HIS A ND1 1 
ATOM   3438 C CD2 . HIS A 1 440 ? 8.372   65.508 62.940 1.00 27.68 ? 440  HIS A CD2 1 
ATOM   3439 C CE1 . HIS A 1 440 ? 9.614   64.632 61.350 1.00 27.36 ? 440  HIS A CE1 1 
ATOM   3440 N NE2 . HIS A 1 440 ? 8.395   64.631 61.872 1.00 27.17 ? 440  HIS A NE2 1 
ATOM   3441 N N   . GLY A 1 441 ? 9.731   69.561 61.957 1.00 30.44 ? 441  GLY A N   1 
ATOM   3442 C CA  . GLY A 1 441 ? 8.711   70.456 61.437 1.00 31.65 ? 441  GLY A CA  1 
ATOM   3443 C C   . GLY A 1 441 ? 9.112   71.922 61.306 1.00 34.14 ? 441  GLY A C   1 
ATOM   3444 O O   . GLY A 1 441 ? 8.429   72.688 60.627 1.00 33.32 ? 441  GLY A O   1 
ATOM   3445 N N   . TYR A 1 442 ? 10.236  72.307 61.903 1.00 34.88 ? 442  TYR A N   1 
ATOM   3446 C CA  . TYR A 1 442 ? 10.610  73.691 61.894 1.00 35.00 ? 442  TYR A CA  1 
ATOM   3447 C C   . TYR A 1 442 ? 11.370  74.230 60.718 1.00 36.45 ? 442  TYR A C   1 
ATOM   3448 O O   . TYR A 1 442 ? 11.816  75.414 60.738 1.00 35.47 ? 442  TYR A O   1 
ATOM   3449 C CB  . TYR A 1 442 ? 11.279  74.063 63.228 1.00 36.65 ? 442  TYR A CB  1 
ATOM   3450 C CG  . TYR A 1 442 ? 10.198  74.300 64.280 1.00 37.97 ? 442  TYR A CG  1 
ATOM   3451 C CD1 . TYR A 1 442 ? 9.458   73.220 64.792 1.00 37.76 ? 442  TYR A CD1 1 
ATOM   3452 C CD2 . TYR A 1 442 ? 9.791   75.616 64.635 1.00 38.49 ? 442  TYR A CD2 1 
ATOM   3453 C CE1 . TYR A 1 442 ? 8.330   73.420 65.617 1.00 38.00 ? 442  TYR A CE1 1 
ATOM   3454 C CE2 . TYR A 1 442 ? 8.643   75.830 65.464 1.00 36.89 ? 442  TYR A CE2 1 
ATOM   3455 C CZ  . TYR A 1 442 ? 7.915   74.726 65.946 1.00 38.55 ? 442  TYR A CZ  1 
ATOM   3456 O OH  . TYR A 1 442 ? 6.766   74.880 66.718 1.00 36.03 ? 442  TYR A OH  1 
ATOM   3457 N N   . GLU A 1 443 ? 11.547  73.391 59.690 1.00 33.99 ? 443  GLU A N   1 
ATOM   3458 C CA  . GLU A 1 443 ? 12.129  73.920 58.454 1.00 32.98 ? 443  GLU A CA  1 
ATOM   3459 C C   . GLU A 1 443 ? 10.916  74.388 57.581 1.00 32.93 ? 443  GLU A C   1 
ATOM   3460 O O   . GLU A 1 443 ? 11.055  75.222 56.685 1.00 33.05 ? 443  GLU A O   1 
ATOM   3461 C CB  . GLU A 1 443 ? 12.952  72.864 57.690 1.00 32.09 ? 443  GLU A CB  1 
ATOM   3462 C CG  . GLU A 1 443 ? 12.130  71.951 56.766 1.00 29.37 ? 443  GLU A CG  1 
ATOM   3463 C CD  . GLU A 1 443 ? 11.154  71.023 57.505 1.00 31.37 ? 443  GLU A CD  1 
ATOM   3464 O OE1 . GLU A 1 443 ? 11.220  70.899 58.763 1.00 27.69 ? 443  GLU A OE1 1 
ATOM   3465 O OE2 . GLU A 1 443 ? 10.324  70.401 56.808 1.00 31.85 ? 443  GLU A OE2 1 
ATOM   3466 N N   . ILE A 1 444 ? 9.715   73.896 57.878 1.00 31.59 ? 444  ILE A N   1 
ATOM   3467 C CA  . ILE A 1 444 ? 8.548   74.244 57.068 1.00 33.06 ? 444  ILE A CA  1 
ATOM   3468 C C   . ILE A 1 444 ? 8.331   75.782 56.929 1.00 34.76 ? 444  ILE A C   1 
ATOM   3469 O O   . ILE A 1 444 ? 8.102   76.309 55.818 1.00 34.84 ? 444  ILE A O   1 
ATOM   3470 C CB  . ILE A 1 444 ? 7.257   73.594 57.660 1.00 31.64 ? 444  ILE A CB  1 
ATOM   3471 C CG1 . ILE A 1 444 ? 7.418   72.069 57.668 1.00 30.61 ? 444  ILE A CG1 1 
ATOM   3472 C CG2 . ILE A 1 444 ? 5.988   74.146 56.900 1.00 30.60 ? 444  ILE A CG2 1 
ATOM   3473 C CD1 . ILE A 1 444 ? 6.282   71.273 58.315 1.00 26.89 ? 444  ILE A CD1 1 
ATOM   3474 N N   . GLU A 1 445 ? 8.411   76.485 58.054 1.00 34.17 ? 445  GLU A N   1 
ATOM   3475 C CA  . GLU A 1 445 ? 8.217   77.933 58.060 1.00 35.79 ? 445  GLU A CA  1 
ATOM   3476 C C   . GLU A 1 445 ? 9.223   78.639 57.133 1.00 35.97 ? 445  GLU A C   1 
ATOM   3477 O O   . GLU A 1 445 ? 8.932   79.705 56.577 1.00 36.13 ? 445  GLU A O   1 
ATOM   3478 C CB  . GLU A 1 445 ? 8.261   78.494 59.524 1.00 36.67 ? 445  GLU A CB  1 
ATOM   3479 C CG  . GLU A 1 445 ? 9.562   78.210 60.301 1.00 37.00 ? 445  GLU A CG  1 
ATOM   3480 C CD  . GLU A 1 445 ? 9.395   78.351 61.832 1.00 37.63 ? 445  GLU A CD  1 
ATOM   3481 O OE1 . GLU A 1 445 ? 8.458   77.745 62.423 1.00 34.07 ? 445  GLU A OE1 1 
ATOM   3482 O OE2 . GLU A 1 445 ? 10.229  79.056 62.443 1.00 36.67 ? 445  GLU A OE2 1 
ATOM   3483 N N   . PHE A 1 446 ? 10.398  78.054 56.952 1.00 36.00 ? 446  PHE A N   1 
ATOM   3484 C CA  . PHE A 1 446 ? 11.343  78.644 56.037 1.00 35.83 ? 446  PHE A CA  1 
ATOM   3485 C C   . PHE A 1 446 ? 10.947  78.257 54.615 1.00 37.36 ? 446  PHE A C   1 
ATOM   3486 O O   . PHE A 1 446 ? 11.151  79.031 53.666 1.00 38.04 ? 446  PHE A O   1 
ATOM   3487 C CB  . PHE A 1 446 ? 12.765  78.161 56.314 1.00 37.00 ? 446  PHE A CB  1 
ATOM   3488 C CG  . PHE A 1 446 ? 13.413  78.862 57.476 1.00 38.00 ? 446  PHE A CG  1 
ATOM   3489 C CD1 . PHE A 1 446 ? 13.179  78.438 58.792 1.00 36.49 ? 446  PHE A CD1 1 
ATOM   3490 C CD2 . PHE A 1 446 ? 14.170  80.036 57.259 1.00 37.91 ? 446  PHE A CD2 1 
ATOM   3491 C CE1 . PHE A 1 446 ? 13.666  79.165 59.877 1.00 36.75 ? 446  PHE A CE1 1 
ATOM   3492 C CE2 . PHE A 1 446 ? 14.668  80.776 58.343 1.00 36.93 ? 446  PHE A CE2 1 
ATOM   3493 C CZ  . PHE A 1 446 ? 14.414  80.346 59.655 1.00 38.23 ? 446  PHE A CZ  1 
ATOM   3494 N N   . VAL A 1 447 ? 10.385  77.060 54.439 1.00 35.02 ? 447  VAL A N   1 
ATOM   3495 C CA  . VAL A 1 447 ? 9.999   76.658 53.101 1.00 33.96 ? 447  VAL A CA  1 
ATOM   3496 C C   . VAL A 1 447 ? 8.801   77.486 52.629 1.00 35.25 ? 447  VAL A C   1 
ATOM   3497 O O   . VAL A 1 447 ? 8.700   77.806 51.433 1.00 33.71 ? 447  VAL A O   1 
ATOM   3498 C CB  . VAL A 1 447 ? 9.655   75.148 53.052 1.00 34.26 ? 447  VAL A CB  1 
ATOM   3499 C CG1 . VAL A 1 447 ? 8.791   74.829 51.820 1.00 32.99 ? 447  VAL A CG1 1 
ATOM   3500 C CG2 . VAL A 1 447 ? 10.974  74.331 53.041 1.00 32.46 ? 447  VAL A CG2 1 
ATOM   3501 N N   . PHE A 1 448 ? 7.893   77.818 53.565 1.00 34.78 ? 448  PHE A N   1 
ATOM   3502 C CA  . PHE A 1 448 ? 6.732   78.611 53.211 1.00 34.96 ? 448  PHE A CA  1 
ATOM   3503 C C   . PHE A 1 448 ? 6.933   80.131 53.294 1.00 37.24 ? 448  PHE A C   1 
ATOM   3504 O O   . PHE A 1 448 ? 5.990   80.901 53.117 1.00 38.29 ? 448  PHE A O   1 
ATOM   3505 C CB  . PHE A 1 448 ? 5.512   78.177 54.006 1.00 31.42 ? 448  PHE A CB  1 
ATOM   3506 C CG  . PHE A 1 448 ? 4.878   76.962 53.446 1.00 33.96 ? 448  PHE A CG  1 
ATOM   3507 C CD1 . PHE A 1 448 ? 5.462   75.682 53.652 1.00 32.73 ? 448  PHE A CD1 1 
ATOM   3508 C CD2 . PHE A 1 448 ? 3.738   77.063 52.646 1.00 33.84 ? 448  PHE A CD2 1 
ATOM   3509 C CE1 . PHE A 1 448 ? 4.911   74.533 53.065 1.00 33.19 ? 448  PHE A CE1 1 
ATOM   3510 C CE2 . PHE A 1 448 ? 3.183   75.906 52.046 1.00 34.90 ? 448  PHE A CE2 1 
ATOM   3511 C CZ  . PHE A 1 448 ? 3.771   74.644 52.257 1.00 33.85 ? 448  PHE A CZ  1 
ATOM   3512 N N   . GLY A 1 449 ? 8.165   80.547 53.579 1.00 38.19 ? 449  GLY A N   1 
ATOM   3513 C CA  . GLY A 1 449 ? 8.492   81.959 53.603 1.00 39.10 ? 449  GLY A CA  1 
ATOM   3514 C C   . GLY A 1 449 ? 8.021   82.853 54.730 1.00 39.83 ? 449  GLY A C   1 
ATOM   3515 O O   . GLY A 1 449 ? 8.024   84.064 54.532 1.00 39.76 ? 449  GLY A O   1 
ATOM   3516 N N   . LEU A 1 450 ? 7.647   82.295 55.881 1.00 40.04 ? 450  LEU A N   1 
ATOM   3517 C CA  . LEU A 1 450 ? 7.209   83.094 57.028 1.00 42.03 ? 450  LEU A CA  1 
ATOM   3518 C C   . LEU A 1 450 ? 8.237   84.151 57.472 1.00 43.17 ? 450  LEU A C   1 
ATOM   3519 O O   . LEU A 1 450 ? 7.852   85.210 57.958 1.00 44.38 ? 450  LEU A O   1 
ATOM   3520 C CB  . LEU A 1 450 ? 6.839   82.211 58.216 1.00 40.20 ? 450  LEU A CB  1 
ATOM   3521 C CG  . LEU A 1 450 ? 5.572   81.341 58.059 1.00 41.02 ? 450  LEU A CG  1 
ATOM   3522 C CD1 . LEU A 1 450 ? 4.468   81.850 58.898 1.00 42.52 ? 450  LEU A CD1 1 
ATOM   3523 C CD2 . LEU A 1 450 ? 5.127   81.315 56.651 1.00 42.37 ? 450  LEU A CD2 1 
ATOM   3524 N N   . PRO A 1 451 ? 9.543   83.883 57.317 1.00 43.66 ? 451  PRO A N   1 
ATOM   3525 C CA  . PRO A 1 451 ? 10.487  84.919 57.744 1.00 46.02 ? 451  PRO A CA  1 
ATOM   3526 C C   . PRO A 1 451 ? 10.449  86.197 56.887 1.00 47.32 ? 451  PRO A C   1 
ATOM   3527 O O   . PRO A 1 451 ? 11.072  87.172 57.254 1.00 48.06 ? 451  PRO A O   1 
ATOM   3528 C CB  . PRO A 1 451 ? 11.854  84.217 57.676 1.00 42.96 ? 451  PRO A CB  1 
ATOM   3529 C CG  . PRO A 1 451 ? 11.500  82.828 57.988 1.00 44.24 ? 451  PRO A CG  1 
ATOM   3530 C CD  . PRO A 1 451 ? 10.249  82.606 57.138 1.00 45.03 ? 451  PRO A CD  1 
ATOM   3531 N N   . LEU A 1 452 ? 9.773   86.189 55.741 1.00 48.64 ? 452  LEU A N   1 
ATOM   3532 C CA  . LEU A 1 452 ? 9.699   87.411 54.963 1.00 49.40 ? 452  LEU A CA  1 
ATOM   3533 C C   . LEU A 1 452 ? 8.678   88.377 55.590 1.00 50.56 ? 452  LEU A C   1 
ATOM   3534 O O   . LEU A 1 452 ? 8.638   89.536 55.187 1.00 50.77 ? 452  LEU A O   1 
ATOM   3535 C CB  . LEU A 1 452 ? 9.268   87.189 53.513 1.00 49.12 ? 452  LEU A CB  1 
ATOM   3536 C CG  . LEU A 1 452 ? 9.831   86.117 52.604 1.00 52.52 ? 452  LEU A CG  1 
ATOM   3537 C CD1 . LEU A 1 452 ? 9.707   86.629 51.151 1.00 52.46 ? 452  LEU A CD1 1 
ATOM   3538 C CD2 . LEU A 1 452 ? 11.268  85.745 52.978 1.00 51.55 ? 452  LEU A CD2 1 
ATOM   3539 N N   . VAL A 1 453 ? 7.832   87.937 56.525 1.00 51.72 ? 453  VAL A N   1 
ATOM   3540 C CA  . VAL A 1 453 ? 6.893   88.897 57.130 1.00 53.61 ? 453  VAL A CA  1 
ATOM   3541 C C   . VAL A 1 453 ? 7.418   89.450 58.478 1.00 54.83 ? 453  VAL A C   1 
ATOM   3542 O O   . VAL A 1 453 ? 7.508   88.744 59.503 1.00 54.22 ? 453  VAL A O   1 
ATOM   3543 C CB  . VAL A 1 453 ? 5.389   88.354 57.256 1.00 54.17 ? 453  VAL A CB  1 
ATOM   3544 C CG1 . VAL A 1 453 ? 5.199   87.022 56.530 1.00 53.95 ? 453  VAL A CG1 1 
ATOM   3545 C CG2 . VAL A 1 453 ? 4.950   88.295 58.681 1.00 54.05 ? 453  VAL A CG2 1 
ATOM   3546 N N   . LYS A 1 454 ? 7.799   90.730 58.416 1.00 55.67 ? 454  LYS A N   1 
ATOM   3547 C CA  . LYS A 1 454 ? 8.367   91.516 59.517 1.00 56.22 ? 454  LYS A CA  1 
ATOM   3548 C C   . LYS A 1 454 ? 7.755   91.275 60.903 1.00 56.21 ? 454  LYS A C   1 
ATOM   3549 O O   . LYS A 1 454 ? 8.487   91.087 61.876 1.00 54.86 ? 454  LYS A O   1 
ATOM   3550 C CB  . LYS A 1 454 ? 8.290   93.019 59.154 1.00 57.14 ? 454  LYS A CB  1 
ATOM   3551 N N   . GLU A 1 455 ? 6.428   91.280 60.991 1.00 56.03 ? 455  GLU A N   1 
ATOM   3552 C CA  . GLU A 1 455 ? 5.752   91.046 62.264 1.00 58.78 ? 455  GLU A CA  1 
ATOM   3553 C C   . GLU A 1 455 ? 6.130   89.721 62.964 1.00 59.32 ? 455  GLU A C   1 
ATOM   3554 O O   . GLU A 1 455 ? 5.997   89.605 64.181 1.00 59.81 ? 455  GLU A O   1 
ATOM   3555 C CB  . GLU A 1 455 ? 4.229   91.074 62.076 1.00 60.92 ? 455  GLU A CB  1 
ATOM   3556 C CG  . GLU A 1 455 ? 3.697   92.334 61.403 1.00 65.76 ? 455  GLU A CG  1 
ATOM   3557 C CD  . GLU A 1 455 ? 4.166   92.481 59.947 1.00 68.21 ? 455  GLU A CD  1 
ATOM   3558 O OE1 . GLU A 1 455 ? 3.668   91.717 59.084 1.00 69.01 ? 455  GLU A OE1 1 
ATOM   3559 O OE2 . GLU A 1 455 ? 5.033   93.353 59.667 1.00 70.33 ? 455  GLU A OE2 1 
ATOM   3560 N N   . LEU A 1 456 ? 6.596   88.720 62.221 1.00 59.21 ? 456  LEU A N   1 
ATOM   3561 C CA  . LEU A 1 456 ? 6.939   87.450 62.857 1.00 58.49 ? 456  LEU A CA  1 
ATOM   3562 C C   . LEU A 1 456 ? 8.306   87.489 63.542 1.00 59.08 ? 456  LEU A C   1 
ATOM   3563 O O   . LEU A 1 456 ? 8.749   86.527 64.170 1.00 60.41 ? 456  LEU A O   1 
ATOM   3564 C CB  . LEU A 1 456 ? 6.836   86.313 61.840 1.00 56.87 ? 456  LEU A CB  1 
ATOM   3565 C CG  . LEU A 1 456 ? 5.412   86.137 61.281 1.00 56.11 ? 456  LEU A CG  1 
ATOM   3566 C CD1 . LEU A 1 456 ? 5.398   85.003 60.239 1.00 56.32 ? 456  LEU A CD1 1 
ATOM   3567 C CD2 . LEU A 1 456 ? 4.413   85.882 62.414 1.00 52.09 ? 456  LEU A CD2 1 
ATOM   3568 N N   . ASN A 1 457 ? 8.993   88.607 63.408 1.00 58.57 ? 457  ASN A N   1 
ATOM   3569 C CA  . ASN A 1 457 ? 10.243  88.772 64.120 1.00 57.76 ? 457  ASN A CA  1 
ATOM   3570 C C   . ASN A 1 457 ? 11.399  87.843 63.801 1.00 56.34 ? 457  ASN A C   1 
ATOM   3571 O O   . ASN A 1 457 ? 12.024  87.341 64.733 1.00 56.39 ? 457  ASN A O   1 
ATOM   3572 C CB  . ASN A 1 457 ? 9.997   88.657 65.639 1.00 59.66 ? 457  ASN A CB  1 
ATOM   3573 C CG  . ASN A 1 457 ? 8.965   89.666 66.184 1.00 61.70 ? 457  ASN A CG  1 
ATOM   3574 O OD1 . ASN A 1 457 ? 8.403   89.471 67.284 1.00 63.27 ? 457  ASN A OD1 1 
ATOM   3575 N ND2 . ASN A 1 457 ? 8.727   90.742 65.443 1.00 61.88 ? 457  ASN A ND2 1 
ATOM   3576 N N   . TYR A 1 458 ? 11.709  87.590 62.540 1.00 54.02 ? 458  TYR A N   1 
ATOM   3577 C CA  . TYR A 1 458 ? 12.875  86.750 62.267 1.00 51.91 ? 458  TYR A CA  1 
ATOM   3578 C C   . TYR A 1 458 ? 14.017  87.729 62.000 1.00 52.79 ? 458  TYR A C   1 
ATOM   3579 O O   . TYR A 1 458 ? 13.797  88.931 61.852 1.00 53.14 ? 458  TYR A O   1 
ATOM   3580 C CB  . TYR A 1 458 ? 12.679  85.854 61.027 1.00 49.29 ? 458  TYR A CB  1 
ATOM   3581 C CG  . TYR A 1 458 ? 11.736  84.672 61.209 1.00 48.14 ? 458  TYR A CG  1 
ATOM   3582 C CD1 . TYR A 1 458 ? 10.354  84.818 61.037 1.00 46.86 ? 458  TYR A CD1 1 
ATOM   3583 C CD2 . TYR A 1 458 ? 12.227  83.399 61.557 1.00 46.98 ? 458  TYR A CD2 1 
ATOM   3584 C CE1 . TYR A 1 458 ? 9.473   83.735 61.205 1.00 45.33 ? 458  TYR A CE1 1 
ATOM   3585 C CE2 . TYR A 1 458 ? 11.363  82.315 61.729 1.00 46.18 ? 458  TYR A CE2 1 
ATOM   3586 C CZ  . TYR A 1 458 ? 9.976   82.487 61.550 1.00 46.61 ? 458  TYR A CZ  1 
ATOM   3587 O OH  . TYR A 1 458 ? 9.095   81.407 61.697 1.00 45.31 ? 458  TYR A OH  1 
ATOM   3588 N N   . THR A 1 459 ? 15.241  87.230 61.942 1.00 52.55 ? 459  THR A N   1 
ATOM   3589 C CA  . THR A 1 459 ? 16.368  88.097 61.656 1.00 52.03 ? 459  THR A CA  1 
ATOM   3590 C C   . THR A 1 459 ? 16.472  88.259 60.156 1.00 52.63 ? 459  THR A C   1 
ATOM   3591 O O   . THR A 1 459 ? 15.897  87.485 59.398 1.00 52.68 ? 459  THR A O   1 
ATOM   3592 C CB  . THR A 1 459 ? 17.675  87.477 62.105 1.00 52.24 ? 459  THR A CB  1 
ATOM   3593 O OG1 . THR A 1 459 ? 17.902  86.269 61.359 1.00 50.36 ? 459  THR A OG1 1 
ATOM   3594 C CG2 . THR A 1 459 ? 17.631  87.183 63.605 1.00 52.03 ? 459  THR A CG2 1 
ATOM   3595 N N   . ALA A 1 460 ? 17.235  89.254 59.727 1.00 52.16 ? 460  ALA A N   1 
ATOM   3596 C CA  . ALA A 1 460 ? 17.434  89.493 58.310 1.00 51.04 ? 460  ALA A CA  1 
ATOM   3597 C C   . ALA A 1 460 ? 18.127  88.279 57.680 1.00 49.65 ? 460  ALA A C   1 
ATOM   3598 O O   . ALA A 1 460 ? 17.879  87.942 56.524 1.00 50.64 ? 460  ALA A O   1 
ATOM   3599 C CB  . ALA A 1 460 ? 18.293  90.750 58.098 1.00 49.95 ? 460  ALA A CB  1 
ATOM   3600 N N   . GLU A 1 461 ? 19.022  87.631 58.406 1.00 48.63 ? 461  GLU A N   1 
ATOM   3601 C CA  . GLU A 1 461 ? 19.678  86.481 57.812 1.00 49.14 ? 461  GLU A CA  1 
ATOM   3602 C C   . GLU A 1 461 ? 18.674  85.287 57.705 1.00 47.44 ? 461  GLU A C   1 
ATOM   3603 O O   . GLU A 1 461 ? 18.791  84.446 56.818 1.00 46.32 ? 461  GLU A O   1 
ATOM   3604 C CB  . GLU A 1 461 ? 20.987  86.139 58.572 1.00 51.71 ? 461  GLU A CB  1 
ATOM   3605 C CG  . GLU A 1 461 ? 21.066  86.599 60.064 1.00 57.81 ? 461  GLU A CG  1 
ATOM   3606 C CD  . GLU A 1 461 ? 21.252  88.132 60.265 1.00 59.07 ? 461  GLU A CD  1 
ATOM   3607 O OE1 . GLU A 1 461 ? 22.319  88.670 59.878 1.00 60.71 ? 461  GLU A OE1 1 
ATOM   3608 O OE2 . GLU A 1 461 ? 20.329  88.792 60.814 1.00 59.48 ? 461  GLU A OE2 1 
ATOM   3609 N N   . GLU A 1 462 ? 17.665  85.260 58.575 1.00 45.24 ? 462  GLU A N   1 
ATOM   3610 C CA  . GLU A 1 462 ? 16.662  84.216 58.499 1.00 45.38 ? 462  GLU A CA  1 
ATOM   3611 C C   . GLU A 1 462 ? 15.774  84.460 57.287 1.00 45.64 ? 462  GLU A C   1 
ATOM   3612 O O   . GLU A 1 462 ? 15.347  83.494 56.631 1.00 44.86 ? 462  GLU A O   1 
ATOM   3613 C CB  . GLU A 1 462 ? 15.851  84.121 59.804 1.00 42.76 ? 462  GLU A CB  1 
ATOM   3614 C CG  . GLU A 1 462 ? 16.715  83.454 60.862 1.00 42.15 ? 462  GLU A CG  1 
ATOM   3615 C CD  . GLU A 1 462 ? 16.135  83.446 62.253 1.00 43.61 ? 462  GLU A CD  1 
ATOM   3616 O OE1 . GLU A 1 462 ? 15.261  84.281 62.550 1.00 45.87 ? 462  GLU A OE1 1 
ATOM   3617 O OE2 . GLU A 1 462 ? 16.577  82.605 63.065 1.00 44.18 ? 462  GLU A OE2 1 
ATOM   3618 N N   . GLU A 1 463 ? 15.536  85.734 56.959 1.00 44.56 ? 463  GLU A N   1 
ATOM   3619 C CA  . GLU A 1 463 ? 14.733  86.065 55.805 1.00 43.64 ? 463  GLU A CA  1 
ATOM   3620 C C   . GLU A 1 463 ? 15.513  85.663 54.576 1.00 43.74 ? 463  GLU A C   1 
ATOM   3621 O O   . GLU A 1 463 ? 14.955  85.102 53.619 1.00 43.53 ? 463  GLU A O   1 
ATOM   3622 C CB  . GLU A 1 463 ? 14.428  87.561 55.709 1.00 46.89 ? 463  GLU A CB  1 
ATOM   3623 C CG  . GLU A 1 463 ? 13.783  87.892 54.344 1.00 47.93 ? 463  GLU A CG  1 
ATOM   3624 C CD  . GLU A 1 463 ? 13.498  89.364 54.125 1.00 50.52 ? 463  GLU A CD  1 
ATOM   3625 O OE1 . GLU A 1 463 ? 14.012  90.195 54.922 1.00 52.56 ? 463  GLU A OE1 1 
ATOM   3626 O OE2 . GLU A 1 463 ? 12.776  89.683 53.141 1.00 49.29 ? 463  GLU A OE2 1 
ATOM   3627 N N   . ALA A 1 464 ? 16.808  85.947 54.587 1.00 41.84 ? 464  ALA A N   1 
ATOM   3628 C CA  . ALA A 1 464 ? 17.621  85.564 53.445 1.00 41.68 ? 464  ALA A CA  1 
ATOM   3629 C C   . ALA A 1 464 ? 17.676  84.036 53.286 1.00 40.18 ? 464  ALA A C   1 
ATOM   3630 O O   . ALA A 1 464 ? 17.734  83.522 52.168 1.00 39.22 ? 464  ALA A O   1 
ATOM   3631 C CB  . ALA A 1 464 ? 19.082  86.161 53.572 1.00 41.22 ? 464  ALA A CB  1 
ATOM   3632 N N   . LEU A 1 465 ? 17.686  83.310 54.401 1.00 40.84 ? 465  LEU A N   1 
ATOM   3633 C CA  . LEU A 1 465 ? 17.726  81.834 54.328 1.00 39.15 ? 465  LEU A CA  1 
ATOM   3634 C C   . LEU A 1 465 ? 16.395  81.335 53.742 1.00 37.49 ? 465  LEU A C   1 
ATOM   3635 O O   . LEU A 1 465 ? 16.366  80.473 52.866 1.00 36.09 ? 465  LEU A O   1 
ATOM   3636 C CB  . LEU A 1 465 ? 17.943  81.235 55.716 1.00 38.29 ? 465  LEU A CB  1 
ATOM   3637 C CG  . LEU A 1 465 ? 17.816  79.709 55.812 1.00 35.82 ? 465  LEU A CG  1 
ATOM   3638 C CD1 . LEU A 1 465 ? 18.792  78.980 54.836 1.00 34.15 ? 465  LEU A CD1 1 
ATOM   3639 C CD2 . LEU A 1 465 ? 18.076  79.349 57.243 1.00 35.97 ? 465  LEU A CD2 1 
ATOM   3640 N N   . SER A 1 466 ? 15.299  81.920 54.209 1.00 36.70 ? 466  SER A N   1 
ATOM   3641 C CA  . SER A 1 466 ? 14.010  81.534 53.700 1.00 37.34 ? 466  SER A CA  1 
ATOM   3642 C C   . SER A 1 466 ? 13.972  81.765 52.196 1.00 40.29 ? 466  SER A C   1 
ATOM   3643 O O   . SER A 1 466 ? 13.544  80.875 51.429 1.00 41.92 ? 466  SER A O   1 
ATOM   3644 C CB  . SER A 1 466 ? 12.901  82.318 54.389 1.00 37.37 ? 466  SER A CB  1 
ATOM   3645 O OG  . SER A 1 466 ? 11.595  81.899 53.981 1.00 35.56 ? 466  SER A OG  1 
ATOM   3646 N N   . ARG A 1 467 ? 14.452  82.923 51.745 1.00 40.84 ? 467  ARG A N   1 
ATOM   3647 C CA  . ARG A 1 467 ? 14.418  83.195 50.309 1.00 41.61 ? 467  ARG A CA  1 
ATOM   3648 C C   . ARG A 1 467 ? 15.270  82.227 49.508 1.00 41.08 ? 467  ARG A C   1 
ATOM   3649 O O   . ARG A 1 467 ? 14.827  81.796 48.430 1.00 41.30 ? 467  ARG A O   1 
ATOM   3650 C CB  . ARG A 1 467 ? 14.792  84.654 49.976 1.00 42.56 ? 467  ARG A CB  1 
ATOM   3651 C CG  . ARG A 1 467 ? 13.675  85.668 50.319 1.00 44.54 ? 467  ARG A CG  1 
ATOM   3652 C CD  . ARG A 1 467 ? 14.141  87.141 50.062 1.00 45.19 ? 467  ARG A CD  1 
ATOM   3653 N NE  . ARG A 1 467 ? 13.113  88.093 50.487 1.00 46.32 ? 467  ARG A NE  1 
ATOM   3654 C CZ  . ARG A 1 467 ? 12.037  88.399 49.767 1.00 44.80 ? 467  ARG A CZ  1 
ATOM   3655 N NH1 . ARG A 1 467 ? 11.858  87.840 48.582 1.00 42.80 ? 467  ARG A NH1 1 
ATOM   3656 N NH2 . ARG A 1 467 ? 11.122  89.220 50.260 1.00 44.86 ? 467  ARG A NH2 1 
ATOM   3657 N N   . ARG A 1 468 ? 16.470  81.866 49.969 1.00 39.70 ? 468  ARG A N   1 
ATOM   3658 C CA  . ARG A 1 468 ? 17.163  80.880 49.152 1.00 41.68 ? 468  ARG A CA  1 
ATOM   3659 C C   . ARG A 1 468 ? 16.489  79.483 49.198 1.00 40.03 ? 468  ARG A C   1 
ATOM   3660 O O   . ARG A 1 468 ? 16.514  78.771 48.206 1.00 39.48 ? 468  ARG A O   1 
ATOM   3661 C CB  . ARG A 1 468 ? 18.681  80.740 49.463 1.00 43.83 ? 468  ARG A CB  1 
ATOM   3662 C CG  . ARG A 1 468 ? 19.144  81.212 50.783 1.00 47.89 ? 468  ARG A CG  1 
ATOM   3663 C CD  . ARG A 1 468 ? 20.688  81.335 50.775 1.00 49.59 ? 468  ARG A CD  1 
ATOM   3664 N NE  . ARG A 1 468 ? 21.325  80.073 50.471 1.00 50.61 ? 468  ARG A NE  1 
ATOM   3665 C CZ  . ARG A 1 468 ? 21.742  79.230 51.404 1.00 50.99 ? 468  ARG A CZ  1 
ATOM   3666 N NH1 . ARG A 1 468 ? 21.573  79.570 52.661 1.00 50.90 ? 468  ARG A NH1 1 
ATOM   3667 N NH2 . ARG A 1 468 ? 22.314  78.060 51.078 1.00 49.65 ? 468  ARG A NH2 1 
ATOM   3668 N N   . ILE A 1 469 ? 15.886  79.092 50.317 1.00 38.45 ? 469  ILE A N   1 
ATOM   3669 C CA  . ILE A 1 469 ? 15.242  77.780 50.338 1.00 37.43 ? 469  ILE A CA  1 
ATOM   3670 C C   . ILE A 1 469 ? 14.050  77.750 49.368 1.00 37.79 ? 469  ILE A C   1 
ATOM   3671 O O   . ILE A 1 469 ? 13.898  76.820 48.543 1.00 37.58 ? 469  ILE A O   1 
ATOM   3672 C CB  . ILE A 1 469 ? 14.832  77.404 51.807 1.00 35.95 ? 469  ILE A CB  1 
ATOM   3673 C CG1 . ILE A 1 469 ? 16.100  77.012 52.587 1.00 32.98 ? 469  ILE A CG1 1 
ATOM   3674 C CG2 . ILE A 1 469 ? 13.814  76.259 51.828 1.00 34.02 ? 469  ILE A CG2 1 
ATOM   3675 C CD1 . ILE A 1 469 ? 15.898  76.959 54.088 1.00 31.81 ? 469  ILE A CD1 1 
ATOM   3676 N N   . MET A 1 470 ? 13.232  78.794 49.418 1.00 38.92 ? 470  MET A N   1 
ATOM   3677 C CA  . MET A 1 470 ? 12.078  78.866 48.532 1.00 38.61 ? 470  MET A CA  1 
ATOM   3678 C C   . MET A 1 470 ? 12.488  78.836 47.067 1.00 38.44 ? 470  MET A C   1 
ATOM   3679 O O   . MET A 1 470 ? 11.784  78.214 46.218 1.00 37.23 ? 470  MET A O   1 
ATOM   3680 C CB  . MET A 1 470 ? 11.263  80.135 48.765 1.00 38.57 ? 470  MET A CB  1 
ATOM   3681 C CG  . MET A 1 470 ? 10.519  80.139 50.071 1.00 40.54 ? 470  MET A CG  1 
ATOM   3682 S SD  . MET A 1 470 ? 9.235   81.432 50.018 1.00 45.08 ? 470  MET A SD  1 
ATOM   3683 C CE  . MET A 1 470 ? 10.287  82.860 50.468 1.00 38.15 ? 470  MET A CE  1 
ATOM   3684 N N   . HIS A 1 471 ? 13.616  79.497 46.772 1.00 37.73 ? 471  HIS A N   1 
ATOM   3685 C CA  . HIS A 1 471 ? 14.068  79.571 45.395 1.00 36.70 ? 471  HIS A CA  1 
ATOM   3686 C C   . HIS A 1 471 ? 14.690  78.241 45.003 1.00 36.38 ? 471  HIS A C   1 
ATOM   3687 O O   . HIS A 1 471 ? 14.600  77.810 43.842 1.00 36.53 ? 471  HIS A O   1 
ATOM   3688 C CB  . HIS A 1 471 ? 15.031  80.756 45.172 1.00 38.25 ? 471  HIS A CB  1 
ATOM   3689 C CG  . HIS A 1 471 ? 15.312  81.020 43.722 1.00 37.95 ? 471  HIS A CG  1 
ATOM   3690 N ND1 . HIS A 1 471 ? 14.315  81.316 42.813 1.00 39.09 ? 471  HIS A ND1 1 
ATOM   3691 C CD2 . HIS A 1 471 ? 16.467  80.984 43.013 1.00 39.04 ? 471  HIS A CD2 1 
ATOM   3692 C CE1 . HIS A 1 471 ? 14.842  81.453 41.607 1.00 37.88 ? 471  HIS A CE1 1 
ATOM   3693 N NE2 . HIS A 1 471 ? 16.146  81.259 41.702 1.00 40.10 ? 471  HIS A NE2 1 
ATOM   3694 N N   . TYR A 1 472 ? 15.309  77.569 45.963 1.00 35.41 ? 472  TYR A N   1 
ATOM   3695 C CA  . TYR A 1 472 ? 15.848  76.233 45.679 1.00 35.43 ? 472  TYR A CA  1 
ATOM   3696 C C   . TYR A 1 472 ? 14.655  75.282 45.411 1.00 34.47 ? 472  TYR A C   1 
ATOM   3697 O O   . TYR A 1 472 ? 14.675  74.508 44.446 1.00 32.61 ? 472  TYR A O   1 
ATOM   3698 C CB  . TYR A 1 472 ? 16.583  75.619 46.865 1.00 35.94 ? 472  TYR A CB  1 
ATOM   3699 C CG  . TYR A 1 472 ? 17.937  76.158 47.216 1.00 38.13 ? 472  TYR A CG  1 
ATOM   3700 C CD1 . TYR A 1 472 ? 18.851  76.556 46.230 1.00 39.38 ? 472  TYR A CD1 1 
ATOM   3701 C CD2 . TYR A 1 472 ? 18.364  76.136 48.558 1.00 38.86 ? 472  TYR A CD2 1 
ATOM   3702 C CE1 . TYR A 1 472 ? 20.160  76.922 46.576 1.00 39.55 ? 472  TYR A CE1 1 
ATOM   3703 C CE2 . TYR A 1 472 ? 19.647  76.470 48.916 1.00 39.33 ? 472  TYR A CE2 1 
ATOM   3704 C CZ  . TYR A 1 472 ? 20.547  76.868 47.932 1.00 41.43 ? 472  TYR A CZ  1 
ATOM   3705 O OH  . TYR A 1 472 ? 21.823  77.218 48.337 1.00 44.26 ? 472  TYR A OH  1 
ATOM   3706 N N   . TRP A 1 473 ? 13.636  75.331 46.278 1.00 32.88 ? 473  TRP A N   1 
ATOM   3707 C CA  . TRP A 1 473 ? 12.517  74.398 46.104 1.00 32.27 ? 473  TRP A CA  1 
ATOM   3708 C C   . TRP A 1 473 ? 11.781  74.643 44.777 1.00 33.21 ? 473  TRP A C   1 
ATOM   3709 O O   . TRP A 1 473 ? 11.485  73.708 44.042 1.00 33.15 ? 473  TRP A O   1 
ATOM   3710 C CB  . TRP A 1 473 ? 11.521  74.511 47.268 1.00 29.65 ? 473  TRP A CB  1 
ATOM   3711 C CG  . TRP A 1 473 ? 11.648  73.501 48.429 1.00 29.47 ? 473  TRP A CG  1 
ATOM   3712 C CD1 . TRP A 1 473 ? 10.593  72.899 49.091 1.00 26.18 ? 473  TRP A CD1 1 
ATOM   3713 C CD2 . TRP A 1 473 ? 12.837  73.182 49.207 1.00 28.34 ? 473  TRP A CD2 1 
ATOM   3714 N NE1 . TRP A 1 473 ? 11.049  72.262 50.231 1.00 28.47 ? 473  TRP A NE1 1 
ATOM   3715 C CE2 . TRP A 1 473 ? 12.407  72.411 50.329 1.00 27.03 ? 473  TRP A CE2 1 
ATOM   3716 C CE3 . TRP A 1 473 ? 14.221  73.482 49.069 1.00 27.29 ? 473  TRP A CE3 1 
ATOM   3717 C CZ2 . TRP A 1 473 ? 13.304  71.935 51.312 1.00 26.57 ? 473  TRP A CZ2 1 
ATOM   3718 C CZ3 . TRP A 1 473 ? 15.108  73.016 50.035 1.00 27.56 ? 473  TRP A CZ3 1 
ATOM   3719 C CH2 . TRP A 1 473 ? 14.638  72.236 51.165 1.00 26.74 ? 473  TRP A CH2 1 
ATOM   3720 N N   . ALA A 1 474 ? 11.490  75.910 44.474 1.00 33.79 ? 474  ALA A N   1 
ATOM   3721 C CA  . ALA A 1 474 ? 10.773  76.263 43.244 1.00 32.68 ? 474  ALA A CA  1 
ATOM   3722 C C   . ALA A 1 474 ? 11.625  76.046 41.998 1.00 32.14 ? 474  ALA A C   1 
ATOM   3723 O O   . ALA A 1 474 ? 11.122  75.628 40.967 1.00 32.19 ? 474  ALA A O   1 
ATOM   3724 C CB  . ALA A 1 474 ? 10.306  77.716 43.304 1.00 30.68 ? 474  ALA A CB  1 
ATOM   3725 N N   . THR A 1 475 ? 12.906  76.338 42.082 1.00 33.39 ? 475  THR A N   1 
ATOM   3726 C CA  . THR A 1 475 ? 13.784  76.120 40.931 1.00 34.54 ? 475  THR A CA  1 
ATOM   3727 C C   . THR A 1 475 ? 13.891  74.610 40.699 1.00 35.35 ? 475  THR A C   1 
ATOM   3728 O O   . THR A 1 475 ? 13.918  74.149 39.549 1.00 36.11 ? 475  THR A O   1 
ATOM   3729 C CB  . THR A 1 475 ? 15.182  76.671 41.154 1.00 34.47 ? 475  THR A CB  1 
ATOM   3730 O OG1 . THR A 1 475 ? 15.105  78.090 41.410 1.00 33.89 ? 475  THR A OG1 1 
ATOM   3731 C CG2 . THR A 1 475 ? 16.042  76.383 39.910 1.00 31.87 ? 475  THR A CG2 1 
ATOM   3732 N N   . PHE A 1 476 ? 13.984  73.834 41.782 1.00 34.37 ? 476  PHE A N   1 
ATOM   3733 C CA  . PHE A 1 476 ? 14.000  72.382 41.607 1.00 33.54 ? 476  PHE A CA  1 
ATOM   3734 C C   . PHE A 1 476 ? 12.625  71.902 40.996 1.00 32.68 ? 476  PHE A C   1 
ATOM   3735 O O   . PHE A 1 476 ? 12.593  71.031 40.089 1.00 31.98 ? 476  PHE A O   1 
ATOM   3736 C CB  . PHE A 1 476 ? 14.239  71.654 42.956 1.00 32.95 ? 476  PHE A CB  1 
ATOM   3737 C CG  . PHE A 1 476 ? 13.948  70.176 42.891 1.00 34.22 ? 476  PHE A CG  1 
ATOM   3738 C CD1 . PHE A 1 476 ? 14.926  69.274 42.447 1.00 34.00 ? 476  PHE A CD1 1 
ATOM   3739 C CD2 . PHE A 1 476 ? 12.687  69.687 43.225 1.00 33.71 ? 476  PHE A CD2 1 
ATOM   3740 C CE1 . PHE A 1 476 ? 14.667  67.905 42.345 1.00 32.11 ? 476  PHE A CE1 1 
ATOM   3741 C CE2 . PHE A 1 476 ? 12.409  68.300 43.119 1.00 34.45 ? 476  PHE A CE2 1 
ATOM   3742 C CZ  . PHE A 1 476 ? 13.405  67.409 42.685 1.00 32.73 ? 476  PHE A CZ  1 
ATOM   3743 N N   . ALA A 1 477 ? 11.507  72.447 41.488 1.00 30.78 ? 477  ALA A N   1 
ATOM   3744 C CA  . ALA A 1 477 ? 10.194  72.030 40.985 1.00 31.77 ? 477  ALA A CA  1 
ATOM   3745 C C   . ALA A 1 477 ? 10.093  72.336 39.492 1.00 34.94 ? 477  ALA A C   1 
ATOM   3746 O O   . ALA A 1 477 ? 9.518   71.539 38.709 1.00 35.57 ? 477  ALA A O   1 
ATOM   3747 C CB  . ALA A 1 477 ? 9.095   72.736 41.735 1.00 29.94 ? 477  ALA A CB  1 
ATOM   3748 N N   . LYS A 1 478 ? 10.675  73.468 39.080 1.00 35.47 ? 478  LYS A N   1 
ATOM   3749 C CA  . LYS A 1 478 ? 10.602  73.831 37.679 1.00 38.66 ? 478  LYS A CA  1 
ATOM   3750 C C   . LYS A 1 478 ? 11.541  73.092 36.744 1.00 38.09 ? 478  LYS A C   1 
ATOM   3751 O O   . LYS A 1 478 ? 11.154  72.734 35.630 1.00 38.64 ? 478  LYS A O   1 
ATOM   3752 C CB  . LYS A 1 478 ? 10.787  75.351 37.491 1.00 42.81 ? 478  LYS A CB  1 
ATOM   3753 C CG  . LYS A 1 478 ? 10.779  75.782 35.984 1.00 45.75 ? 478  LYS A CG  1 
ATOM   3754 C CD  . LYS A 1 478 ? 10.648  77.296 35.835 1.00 48.92 ? 478  LYS A CD  1 
ATOM   3755 C CE  . LYS A 1 478 ? 11.993  78.046 35.873 1.00 53.05 ? 478  LYS A CE  1 
ATOM   3756 N NZ  . LYS A 1 478 ? 12.013  79.084 34.744 1.00 55.50 ? 478  LYS A NZ  1 
ATOM   3757 N N   . THR A 1 479 ? 12.752  72.810 37.211 1.00 38.81 ? 479  THR A N   1 
ATOM   3758 C CA  . THR A 1 479 ? 13.745  72.157 36.371 1.00 38.80 ? 479  THR A CA  1 
ATOM   3759 C C   . THR A 1 479 ? 14.308  70.804 36.770 1.00 39.11 ? 479  THR A C   1 
ATOM   3760 O O   . THR A 1 479 ? 14.935  70.151 35.955 1.00 38.61 ? 479  THR A O   1 
ATOM   3761 C CB  . THR A 1 479 ? 14.974  73.066 36.203 1.00 39.54 ? 479  THR A CB  1 
ATOM   3762 O OG1 . THR A 1 479 ? 15.686  73.114 37.452 1.00 39.39 ? 479  THR A OG1 1 
ATOM   3763 C CG2 . THR A 1 479 ? 14.536  74.522 35.796 1.00 39.73 ? 479  THR A CG2 1 
ATOM   3764 N N   . GLY A 1 480 ? 14.111  70.379 38.007 1.00 39.11 ? 480  GLY A N   1 
ATOM   3765 C CA  . GLY A 1 480 ? 14.705  69.124 38.442 1.00 37.47 ? 480  GLY A CA  1 
ATOM   3766 C C   . GLY A 1 480 ? 16.100  69.386 39.023 1.00 37.10 ? 480  GLY A C   1 
ATOM   3767 O O   . GLY A 1 480 ? 16.844  68.444 39.260 1.00 35.79 ? 480  GLY A O   1 
ATOM   3768 N N   . ASN A 1 481 ? 16.446  70.666 39.233 1.00 36.86 ? 481  ASN A N   1 
ATOM   3769 C CA  . ASN A 1 481 ? 17.754  71.099 39.760 1.00 37.58 ? 481  ASN A CA  1 
ATOM   3770 C C   . ASN A 1 481 ? 17.526  72.368 40.603 1.00 37.65 ? 481  ASN A C   1 
ATOM   3771 O O   . ASN A 1 481 ? 17.053  73.377 40.090 1.00 37.23 ? 481  ASN A O   1 
ATOM   3772 C CB  . ASN A 1 481 ? 18.684  71.458 38.589 1.00 40.03 ? 481  ASN A CB  1 
ATOM   3773 C CG  . ASN A 1 481 ? 20.138  71.749 39.023 1.00 40.74 ? 481  ASN A CG  1 
ATOM   3774 O OD1 . ASN A 1 481 ? 20.410  72.180 40.144 1.00 41.77 ? 481  ASN A OD1 1 
ATOM   3775 N ND2 . ASN A 1 481 ? 21.072  71.515 38.106 1.00 40.14 ? 481  ASN A ND2 1 
ATOM   3776 N N   . PRO A 1 482 ? 17.851  72.337 41.909 1.00 38.64 ? 482  PRO A N   1 
ATOM   3777 C CA  . PRO A 1 482 ? 17.633  73.542 42.734 1.00 39.74 ? 482  PRO A CA  1 
ATOM   3778 C C   . PRO A 1 482 ? 18.521  74.742 42.371 1.00 41.46 ? 482  PRO A C   1 
ATOM   3779 O O   . PRO A 1 482 ? 18.242  75.871 42.787 1.00 41.43 ? 482  PRO A O   1 
ATOM   3780 C CB  . PRO A 1 482 ? 17.945  73.060 44.133 1.00 38.35 ? 482  PRO A CB  1 
ATOM   3781 C CG  . PRO A 1 482 ? 19.116  72.092 43.865 1.00 37.71 ? 482  PRO A CG  1 
ATOM   3782 C CD  . PRO A 1 482 ? 18.575  71.302 42.671 1.00 38.47 ? 482  PRO A CD  1 
ATOM   3783 N N   . ASN A 1 483 ? 19.580  74.486 41.613 1.00 42.82 ? 483  ASN A N   1 
ATOM   3784 C CA  . ASN A 1 483 ? 20.509  75.532 41.249 1.00 47.21 ? 483  ASN A CA  1 
ATOM   3785 C C   . ASN A 1 483 ? 20.117  76.327 40.035 1.00 50.15 ? 483  ASN A C   1 
ATOM   3786 O O   . ASN A 1 483 ? 19.586  75.796 39.063 1.00 50.44 ? 483  ASN A O   1 
ATOM   3787 C CB  . ASN A 1 483 ? 21.879  74.950 40.996 1.00 43.81 ? 483  ASN A CB  1 
ATOM   3788 C CG  . ASN A 1 483 ? 22.427  74.274 42.204 1.00 43.80 ? 483  ASN A CG  1 
ATOM   3789 O OD1 . ASN A 1 483 ? 22.719  74.937 43.213 1.00 41.50 ? 483  ASN A OD1 1 
ATOM   3790 N ND2 . ASN A 1 483 ? 22.557  72.938 42.137 1.00 38.88 ? 483  ASN A ND2 1 
ATOM   3791 N N   . GLU A 1 484 ? 20.391  77.612 40.126 1.00 55.04 ? 484  GLU A N   1 
ATOM   3792 C CA  . GLU A 1 484 ? 20.161  78.566 39.045 1.00 60.28 ? 484  GLU A CA  1 
ATOM   3793 C C   . GLU A 1 484 ? 21.416  78.398 38.128 1.00 61.97 ? 484  GLU A C   1 
ATOM   3794 O O   . GLU A 1 484 ? 22.550  78.546 38.583 1.00 61.08 ? 484  GLU A O   1 
ATOM   3795 C CB  . GLU A 1 484 ? 20.104  79.960 39.683 1.00 62.67 ? 484  GLU A CB  1 
ATOM   3796 C CG  . GLU A 1 484 ? 19.643  81.077 38.793 1.00 66.00 ? 484  GLU A CG  1 
ATOM   3797 C CD  . GLU A 1 484 ? 18.208  80.921 38.413 1.00 66.65 ? 484  GLU A CD  1 
ATOM   3798 O OE1 . GLU A 1 484 ? 17.338  81.336 39.213 1.00 66.34 ? 484  GLU A OE1 1 
ATOM   3799 O OE2 . GLU A 1 484 ? 17.973  80.364 37.316 1.00 68.51 ? 484  GLU A OE2 1 
ATOM   3800 N N   . PRO A 1 485 ? 21.226  78.043 36.841 1.00 65.13 ? 485  PRO A N   1 
ATOM   3801 C CA  . PRO A 1 485 ? 22.325  77.848 35.863 1.00 66.89 ? 485  PRO A CA  1 
ATOM   3802 C C   . PRO A 1 485 ? 23.693  78.569 36.092 1.00 67.74 ? 485  PRO A C   1 
ATOM   3803 O O   . PRO A 1 485 ? 23.959  79.690 35.610 1.00 67.93 ? 485  PRO A O   1 
ATOM   3804 C CB  . PRO A 1 485 ? 21.674  78.227 34.514 1.00 67.17 ? 485  PRO A CB  1 
ATOM   3805 C CG  . PRO A 1 485 ? 20.162  78.519 34.828 1.00 66.63 ? 485  PRO A CG  1 
ATOM   3806 C CD  . PRO A 1 485 ? 19.911  77.902 36.185 1.00 66.29 ? 485  PRO A CD  1 
ATOM   3807 N N   . SER A 1 490 ? 26.886  79.756 44.326 1.00 52.42 ? 490  SER A N   1 
ATOM   3808 C CA  . SER A 1 490 ? 27.412  78.643 45.172 1.00 54.97 ? 490  SER A CA  1 
ATOM   3809 C C   . SER A 1 490 ? 26.519  77.376 44.981 1.00 52.36 ? 490  SER A C   1 
ATOM   3810 O O   . SER A 1 490 ? 25.340  77.403 45.311 1.00 50.59 ? 490  SER A O   1 
ATOM   3811 C CB  . SER A 1 490 ? 27.455  79.082 46.658 1.00 56.90 ? 490  SER A CB  1 
ATOM   3812 O OG  . SER A 1 490 ? 28.436  78.342 47.393 1.00 60.41 ? 490  SER A OG  1 
ATOM   3813 N N   . LYS A 1 491 ? 27.103  76.294 44.454 1.00 51.38 ? 491  LYS A N   1 
ATOM   3814 C CA  . LYS A 1 491 ? 26.365  75.072 44.093 1.00 52.65 ? 491  LYS A CA  1 
ATOM   3815 C C   . LYS A 1 491 ? 26.023  73.930 45.056 1.00 51.25 ? 491  LYS A C   1 
ATOM   3816 O O   . LYS A 1 491 ? 26.910  73.403 45.756 1.00 51.67 ? 491  LYS A O   1 
ATOM   3817 C CB  . LYS A 1 491 ? 27.022  74.400 42.869 1.00 54.93 ? 491  LYS A CB  1 
ATOM   3818 C CG  . LYS A 1 491 ? 27.064  75.261 41.631 1.00 58.97 ? 491  LYS A CG  1 
ATOM   3819 C CD  . LYS A 1 491 ? 25.821  76.130 41.585 1.00 62.25 ? 491  LYS A CD  1 
ATOM   3820 C CE  . LYS A 1 491 ? 25.990  77.343 40.689 1.00 64.22 ? 491  LYS A CE  1 
ATOM   3821 N NZ  . LYS A 1 491 ? 24.688  78.066 40.673 1.00 66.56 ? 491  LYS A NZ  1 
ATOM   3822 N N   . TRP A 1 492 ? 24.739  73.539 45.037 1.00 46.72 ? 492  TRP A N   1 
ATOM   3823 C CA  . TRP A 1 492 ? 24.227  72.428 45.838 1.00 42.25 ? 492  TRP A CA  1 
ATOM   3824 C C   . TRP A 1 492 ? 24.625  71.299 44.943 1.00 41.81 ? 492  TRP A C   1 
ATOM   3825 O O   . TRP A 1 492 ? 24.084  71.142 43.855 1.00 41.98 ? 492  TRP A O   1 
ATOM   3826 C CB  . TRP A 1 492 ? 22.717  72.474 45.922 1.00 39.85 ? 492  TRP A CB  1 
ATOM   3827 C CG  . TRP A 1 492 ? 22.070  71.472 46.860 1.00 38.27 ? 492  TRP A CG  1 
ATOM   3828 C CD1 . TRP A 1 492 ? 22.550  70.233 47.219 1.00 37.18 ? 492  TRP A CD1 1 
ATOM   3829 C CD2 . TRP A 1 492 ? 20.778  71.584 47.454 1.00 36.39 ? 492  TRP A CD2 1 
ATOM   3830 N NE1 . TRP A 1 492 ? 21.637  69.575 47.985 1.00 37.85 ? 492  TRP A NE1 1 
ATOM   3831 C CE2 . TRP A 1 492 ? 20.534  70.374 48.151 1.00 36.38 ? 492  TRP A CE2 1 
ATOM   3832 C CE3 . TRP A 1 492 ? 19.804  72.584 47.471 1.00 36.17 ? 492  TRP A CE3 1 
ATOM   3833 C CZ2 . TRP A 1 492 ? 19.354  70.141 48.855 1.00 32.77 ? 492  TRP A CZ2 1 
ATOM   3834 C CZ3 . TRP A 1 492 ? 18.631  72.356 48.172 1.00 35.48 ? 492  TRP A CZ3 1 
ATOM   3835 C CH2 . TRP A 1 492 ? 18.415  71.133 48.859 1.00 34.53 ? 492  TRP A CH2 1 
ATOM   3836 N N   . PRO A 1 493 ? 25.586  70.481 45.363 1.00 40.79 ? 493  PRO A N   1 
ATOM   3837 C CA  . PRO A 1 493 ? 25.943  69.403 44.428 1.00 40.27 ? 493  PRO A CA  1 
ATOM   3838 C C   . PRO A 1 493 ? 24.962  68.243 44.430 1.00 40.89 ? 493  PRO A C   1 
ATOM   3839 O O   . PRO A 1 493 ? 24.263  68.008 45.421 1.00 39.32 ? 493  PRO A O   1 
ATOM   3840 C CB  . PRO A 1 493 ? 27.331  68.971 44.911 1.00 39.82 ? 493  PRO A CB  1 
ATOM   3841 C CG  . PRO A 1 493 ? 27.225  69.146 46.360 1.00 39.35 ? 493  PRO A CG  1 
ATOM   3842 C CD  . PRO A 1 493 ? 26.489  70.503 46.516 1.00 39.76 ? 493  PRO A CD  1 
ATOM   3843 N N   . LEU A 1 494 ? 24.916  67.541 43.307 1.00 40.11 ? 494  LEU A N   1 
ATOM   3844 C CA  . LEU A 1 494 ? 24.074  66.380 43.147 1.00 40.70 ? 494  LEU A CA  1 
ATOM   3845 C C   . LEU A 1 494 ? 24.573  65.268 44.124 1.00 41.21 ? 494  LEU A C   1 
ATOM   3846 O O   . LEU A 1 494 ? 25.778  65.131 44.389 1.00 41.61 ? 494  LEU A O   1 
ATOM   3847 C CB  . LEU A 1 494 ? 24.178  65.953 41.688 1.00 42.15 ? 494  LEU A CB  1 
ATOM   3848 C CG  . LEU A 1 494 ? 23.226  65.054 40.894 1.00 44.88 ? 494  LEU A CG  1 
ATOM   3849 C CD1 . LEU A 1 494 ? 21.793  65.588 40.875 1.00 44.44 ? 494  LEU A CD1 1 
ATOM   3850 C CD2 . LEU A 1 494 ? 23.756  65.002 39.464 1.00 45.89 ? 494  LEU A CD2 1 
ATOM   3851 N N   . PHE A 1 495 ? 23.638  64.537 44.729 1.00 40.28 ? 495  PHE A N   1 
ATOM   3852 C CA  . PHE A 1 495 ? 23.967  63.429 45.607 1.00 37.57 ? 495  PHE A CA  1 
ATOM   3853 C C   . PHE A 1 495 ? 24.161  62.272 44.639 1.00 38.65 ? 495  PHE A C   1 
ATOM   3854 O O   . PHE A 1 495 ? 23.301  62.026 43.798 1.00 38.95 ? 495  PHE A O   1 
ATOM   3855 C CB  . PHE A 1 495 ? 22.789  63.140 46.572 1.00 36.20 ? 495  PHE A CB  1 
ATOM   3856 C CG  . PHE A 1 495 ? 22.930  61.838 47.356 1.00 33.87 ? 495  PHE A CG  1 
ATOM   3857 C CD1 . PHE A 1 495 ? 22.593  60.609 46.771 1.00 33.42 ? 495  PHE A CD1 1 
ATOM   3858 C CD2 . PHE A 1 495 ? 23.451  61.842 48.667 1.00 34.24 ? 495  PHE A CD2 1 
ATOM   3859 C CE1 . PHE A 1 495 ? 22.777  59.395 47.484 1.00 34.16 ? 495  PHE A CE1 1 
ATOM   3860 C CE2 . PHE A 1 495 ? 23.634  60.645 49.387 1.00 34.00 ? 495  PHE A CE2 1 
ATOM   3861 C CZ  . PHE A 1 495 ? 23.300  59.427 48.799 1.00 34.62 ? 495  PHE A CZ  1 
ATOM   3862 N N   . THR A 1 496 ? 25.288  61.571 44.712 1.00 39.93 ? 496  THR A N   1 
ATOM   3863 C CA  . THR A 1 496 ? 25.504  60.431 43.810 1.00 41.42 ? 496  THR A CA  1 
ATOM   3864 C C   . THR A 1 496 ? 25.817  59.209 44.650 1.00 42.99 ? 496  THR A C   1 
ATOM   3865 O O   . THR A 1 496 ? 26.181  59.328 45.817 1.00 43.38 ? 496  THR A O   1 
ATOM   3866 C CB  . THR A 1 496 ? 26.690  60.650 42.811 1.00 40.65 ? 496  THR A CB  1 
ATOM   3867 O OG1 . THR A 1 496 ? 27.916  60.812 43.548 1.00 41.15 ? 496  THR A OG1 1 
ATOM   3868 C CG2 . THR A 1 496 ? 26.452  61.879 41.948 1.00 36.16 ? 496  THR A CG2 1 
ATOM   3869 N N   . THR A 1 497 ? 25.661  58.039 44.050 1.00 45.44 ? 497  THR A N   1 
ATOM   3870 C CA  . THR A 1 497 ? 25.918  56.775 44.731 1.00 47.35 ? 497  THR A CA  1 
ATOM   3871 C C   . THR A 1 497 ? 27.333  56.722 45.319 1.00 47.36 ? 497  THR A C   1 
ATOM   3872 O O   . THR A 1 497 ? 27.554  56.281 46.463 1.00 45.42 ? 497  THR A O   1 
ATOM   3873 C CB  . THR A 1 497 ? 25.751  55.624 43.738 1.00 49.25 ? 497  THR A CB  1 
ATOM   3874 O OG1 . THR A 1 497 ? 24.409  55.624 43.232 1.00 51.46 ? 497  THR A OG1 1 
ATOM   3875 C CG2 . THR A 1 497 ? 26.034  54.315 44.413 1.00 49.73 ? 497  THR A CG2 1 
ATOM   3876 N N   . LYS A 1 498 ? 28.282  57.208 44.523 1.00 47.37 ? 498  LYS A N   1 
ATOM   3877 C CA  . LYS A 1 498 ? 29.683  57.212 44.898 1.00 47.90 ? 498  LYS A CA  1 
ATOM   3878 C C   . LYS A 1 498 ? 30.072  58.246 45.927 1.00 47.79 ? 498  LYS A C   1 
ATOM   3879 O O   . LYS A 1 498 ? 30.639  57.908 46.979 1.00 48.02 ? 498  LYS A O   1 
ATOM   3880 C CB  . LYS A 1 498 ? 30.559  57.402 43.648 1.00 48.79 ? 498  LYS A CB  1 
ATOM   3881 C CG  . LYS A 1 498 ? 32.054  57.261 43.924 1.00 50.96 ? 498  LYS A CG  1 
ATOM   3882 N N   . GLU A 1 499 ? 29.772  59.506 45.630 1.00 47.57 ? 499  GLU A N   1 
ATOM   3883 C CA  . GLU A 1 499 ? 30.153  60.613 46.509 1.00 46.30 ? 499  GLU A CA  1 
ATOM   3884 C C   . GLU A 1 499 ? 29.259  60.921 47.726 1.00 43.19 ? 499  GLU A C   1 
ATOM   3885 O O   . GLU A 1 499 ? 29.743  61.419 48.749 1.00 40.62 ? 499  GLU A O   1 
ATOM   3886 C CB  . GLU A 1 499 ? 30.277  61.876 45.663 1.00 51.36 ? 499  GLU A CB  1 
ATOM   3887 C CG  . GLU A 1 499 ? 31.673  62.413 45.455 1.00 57.78 ? 499  GLU A CG  1 
ATOM   3888 C CD  . GLU A 1 499 ? 32.582  61.356 44.943 1.00 60.76 ? 499  GLU A CD  1 
ATOM   3889 O OE1 . GLU A 1 499 ? 32.101  60.597 44.077 1.00 63.03 ? 499  GLU A OE1 1 
ATOM   3890 O OE2 . GLU A 1 499 ? 33.758  61.291 45.400 1.00 63.95 ? 499  GLU A OE2 1 
ATOM   3891 N N   . GLN A 1 500 ? 27.957  60.670 47.587 1.00 40.27 ? 500  GLN A N   1 
ATOM   3892 C CA  . GLN A 1 500 ? 26.974  60.920 48.660 1.00 38.26 ? 500  GLN A CA  1 
ATOM   3893 C C   . GLN A 1 500 ? 27.002  62.318 49.318 1.00 36.56 ? 500  GLN A C   1 
ATOM   3894 O O   . GLN A 1 500 ? 26.807  62.456 50.504 1.00 34.80 ? 500  GLN A O   1 
ATOM   3895 C CB  . GLN A 1 500 ? 27.120  59.812 49.708 1.00 38.34 ? 500  GLN A CB  1 
ATOM   3896 C CG  . GLN A 1 500 ? 26.887  58.454 49.049 1.00 38.27 ? 500  GLN A CG  1 
ATOM   3897 C CD  . GLN A 1 500 ? 27.172  57.282 49.970 1.00 40.24 ? 500  GLN A CD  1 
ATOM   3898 O OE1 . GLN A 1 500 ? 26.829  57.318 51.135 1.00 37.66 ? 500  GLN A OE1 1 
ATOM   3899 N NE2 . GLN A 1 500 ? 27.791  56.234 49.435 1.00 37.82 ? 500  GLN A NE2 1 
ATOM   3900 N N   . LYS A 1 501 ? 27.231  63.352 48.518 1.00 35.42 ? 501  LYS A N   1 
ATOM   3901 C CA  . LYS A 1 501 ? 27.298  64.716 49.009 1.00 36.56 ? 501  LYS A CA  1 
ATOM   3902 C C   . LYS A 1 501 ? 25.932  65.293 49.427 1.00 36.20 ? 501  LYS A C   1 
ATOM   3903 O O   . LYS A 1 501 ? 24.883  64.903 48.897 1.00 36.62 ? 501  LYS A O   1 
ATOM   3904 C CB  . LYS A 1 501 ? 27.891  65.614 47.918 1.00 36.65 ? 501  LYS A CB  1 
ATOM   3905 C CG  . LYS A 1 501 ? 29.304  65.164 47.454 1.00 43.64 ? 501  LYS A CG  1 
ATOM   3906 C CD  . LYS A 1 501 ? 29.885  66.139 46.400 1.00 46.24 ? 501  LYS A CD  1 
ATOM   3907 C CE  . LYS A 1 501 ? 31.375  65.863 46.091 1.00 47.13 ? 501  LYS A CE  1 
ATOM   3908 N NZ  . LYS A 1 501 ? 31.765  66.646 44.858 1.00 50.06 ? 501  LYS A NZ  1 
ATOM   3909 N N   . PHE A 1 502 ? 25.958  66.206 50.373 1.00 33.74 ? 502  PHE A N   1 
ATOM   3910 C CA  . PHE A 1 502 ? 24.743  66.887 50.795 1.00 35.73 ? 502  PHE A CA  1 
ATOM   3911 C C   . PHE A 1 502 ? 25.240  68.243 51.292 1.00 36.57 ? 502  PHE A C   1 
ATOM   3912 O O   . PHE A 1 502 ? 26.448  68.422 51.450 1.00 37.18 ? 502  PHE A O   1 
ATOM   3913 C CB  . PHE A 1 502 ? 24.030  66.123 51.933 1.00 31.84 ? 502  PHE A CB  1 
ATOM   3914 C CG  . PHE A 1 502 ? 24.809  66.060 53.226 1.00 30.65 ? 502  PHE A CG  1 
ATOM   3915 C CD1 . PHE A 1 502 ? 24.575  66.983 54.245 1.00 30.56 ? 502  PHE A CD1 1 
ATOM   3916 C CD2 . PHE A 1 502 ? 25.701  64.996 53.465 1.00 30.65 ? 502  PHE A CD2 1 
ATOM   3917 C CE1 . PHE A 1 502 ? 25.195  66.860 55.516 1.00 29.82 ? 502  PHE A CE1 1 
ATOM   3918 C CE2 . PHE A 1 502 ? 26.338  64.846 54.722 1.00 30.99 ? 502  PHE A CE2 1 
ATOM   3919 C CZ  . PHE A 1 502 ? 26.080  65.784 55.762 1.00 31.31 ? 502  PHE A CZ  1 
ATOM   3920 N N   . ILE A 1 503 ? 24.330  69.182 51.538 1.00 37.46 ? 503  ILE A N   1 
ATOM   3921 C CA  . ILE A 1 503 ? 24.717  70.494 52.045 1.00 36.48 ? 503  ILE A CA  1 
ATOM   3922 C C   . ILE A 1 503 ? 24.010  70.763 53.363 1.00 36.86 ? 503  ILE A C   1 
ATOM   3923 O O   . ILE A 1 503 ? 23.023  70.117 53.691 1.00 34.04 ? 503  ILE A O   1 
ATOM   3924 C CB  . ILE A 1 503 ? 24.304  71.636 51.081 1.00 37.76 ? 503  ILE A CB  1 
ATOM   3925 C CG1 . ILE A 1 503 ? 22.776  71.650 50.922 1.00 37.93 ? 503  ILE A CG1 1 
ATOM   3926 C CG2 . ILE A 1 503 ? 25.012  71.468 49.741 1.00 35.26 ? 503  ILE A CG2 1 
ATOM   3927 C CD1 . ILE A 1 503 ? 22.229  72.875 50.226 1.00 40.08 ? 503  ILE A CD1 1 
ATOM   3928 N N   . ASP A 1 504 ? 24.549  71.690 54.145 1.00 38.30 ? 504  ASP A N   1 
ATOM   3929 C CA  . ASP A 1 504 ? 23.880  72.071 55.373 1.00 40.30 ? 504  ASP A CA  1 
ATOM   3930 C C   . ASP A 1 504 ? 23.027  73.215 54.840 1.00 40.39 ? 504  ASP A C   1 
ATOM   3931 O O   . ASP A 1 504 ? 23.400  73.896 53.862 1.00 40.91 ? 504  ASP A O   1 
ATOM   3932 C CB  . ASP A 1 504 ? 24.834  72.633 56.436 1.00 42.73 ? 504  ASP A CB  1 
ATOM   3933 C CG  . ASP A 1 504 ? 25.895  71.629 56.895 1.00 46.04 ? 504  ASP A CG  1 
ATOM   3934 O OD1 . ASP A 1 504 ? 25.581  70.436 57.090 1.00 47.93 ? 504  ASP A OD1 1 
ATOM   3935 O OD2 . ASP A 1 504 ? 27.060  72.041 57.092 1.00 47.51 ? 504  ASP A OD2 1 
ATOM   3936 N N   . LEU A 1 505 ? 21.902  73.444 55.487 1.00 39.52 ? 505  LEU A N   1 
ATOM   3937 C CA  . LEU A 1 505 ? 20.992  74.496 55.095 1.00 39.46 ? 505  LEU A CA  1 
ATOM   3938 C C   . LEU A 1 505 ? 20.823  75.346 56.350 1.00 40.20 ? 505  LEU A C   1 
ATOM   3939 O O   . LEU A 1 505 ? 20.148  74.953 57.323 1.00 40.42 ? 505  LEU A O   1 
ATOM   3940 C CB  . LEU A 1 505 ? 19.695  73.842 54.656 1.00 38.81 ? 505  LEU A CB  1 
ATOM   3941 C CG  . LEU A 1 505 ? 18.920  74.368 53.476 1.00 40.96 ? 505  LEU A CG  1 
ATOM   3942 C CD1 . LEU A 1 505 ? 19.807  74.838 52.310 1.00 37.29 ? 505  LEU A CD1 1 
ATOM   3943 C CD2 . LEU A 1 505 ? 17.990  73.254 53.079 1.00 38.91 ? 505  LEU A CD2 1 
ATOM   3944 N N   . ASN A 1 506 ? 21.494  76.488 56.367 1.00 41.59 ? 506  ASN A N   1 
ATOM   3945 C CA  . ASN A 1 506 ? 21.439  77.391 57.531 1.00 42.71 ? 506  ASN A CA  1 
ATOM   3946 C C   . ASN A 1 506 ? 21.875  78.807 57.110 1.00 43.64 ? 506  ASN A C   1 
ATOM   3947 O O   . ASN A 1 506 ? 21.892  79.118 55.918 1.00 44.70 ? 506  ASN A O   1 
ATOM   3948 C CB  . ASN A 1 506 ? 22.347  76.840 58.648 1.00 40.91 ? 506  ASN A CB  1 
ATOM   3949 C CG  . ASN A 1 506 ? 23.777  76.673 58.184 1.00 41.54 ? 506  ASN A CG  1 
ATOM   3950 O OD1 . ASN A 1 506 ? 24.289  77.540 57.506 1.00 41.37 ? 506  ASN A OD1 1 
ATOM   3951 N ND2 . ASN A 1 506 ? 24.428  75.569 58.550 1.00 41.44 ? 506  ASN A ND2 1 
ATOM   3952 N N   . THR A 1 507 ? 22.220  79.671 58.056 1.00 44.61 ? 507  THR A N   1 
ATOM   3953 C CA  . THR A 1 507 ? 22.588  81.051 57.700 1.00 45.98 ? 507  THR A CA  1 
ATOM   3954 C C   . THR A 1 507 ? 24.071  81.306 57.367 1.00 47.54 ? 507  THR A C   1 
ATOM   3955 O O   . THR A 1 507 ? 24.441  82.424 56.989 1.00 48.37 ? 507  THR A O   1 
ATOM   3956 C CB  . THR A 1 507 ? 22.175  82.024 58.823 1.00 45.46 ? 507  THR A CB  1 
ATOM   3957 O OG1 . THR A 1 507 ? 22.763  81.572 60.053 1.00 44.31 ? 507  THR A OG1 1 
ATOM   3958 C CG2 . THR A 1 507 ? 20.657  82.069 58.981 1.00 42.69 ? 507  THR A CG2 1 
ATOM   3959 N N   . GLU A 1 508 ? 24.899  80.277 57.526 1.00 47.85 ? 508  GLU A N   1 
ATOM   3960 C CA  . GLU A 1 508 ? 26.335  80.329 57.271 1.00 48.17 ? 508  GLU A CA  1 
ATOM   3961 C C   . GLU A 1 508 ? 26.514  80.035 55.799 1.00 50.06 ? 508  GLU A C   1 
ATOM   3962 O O   . GLU A 1 508 ? 25.560  79.636 55.134 1.00 50.26 ? 508  GLU A O   1 
ATOM   3963 C CB  . GLU A 1 508 ? 27.075  79.244 58.085 1.00 47.29 ? 508  GLU A CB  1 
ATOM   3964 C CG  . GLU A 1 508 ? 27.106  79.447 59.615 1.00 49.49 ? 508  GLU A CG  1 
ATOM   3965 C CD  . GLU A 1 508 ? 25.923  80.283 60.138 1.00 50.19 ? 508  GLU A CD  1 
ATOM   3966 N N   . PRO A 1 509 ? 27.728  80.259 55.261 1.00 52.02 ? 509  PRO A N   1 
ATOM   3967 C CA  . PRO A 1 509 ? 28.032  80.000 53.850 1.00 52.81 ? 509  PRO A CA  1 
ATOM   3968 C C   . PRO A 1 509 ? 27.940  78.496 53.610 1.00 53.22 ? 509  PRO A C   1 
ATOM   3969 O O   . PRO A 1 509 ? 28.473  77.702 54.377 1.00 53.68 ? 509  PRO A O   1 
ATOM   3970 C CB  . PRO A 1 509 ? 29.481  80.482 53.703 1.00 52.61 ? 509  PRO A CB  1 
ATOM   3971 C CG  . PRO A 1 509 ? 29.583  81.574 54.720 1.00 53.30 ? 509  PRO A CG  1 
ATOM   3972 C CD  . PRO A 1 509 ? 28.818  81.031 55.902 1.00 52.68 ? 509  PRO A CD  1 
ATOM   3973 N N   . MET A 1 510 ? 27.287  78.113 52.529 1.00 53.84 ? 510  MET A N   1 
ATOM   3974 C CA  . MET A 1 510 ? 27.121  76.720 52.189 1.00 53.54 ? 510  MET A CA  1 
ATOM   3975 C C   . MET A 1 510 ? 28.370  75.886 52.399 1.00 53.13 ? 510  MET A C   1 
ATOM   3976 O O   . MET A 1 510 ? 29.438  76.282 51.966 1.00 53.91 ? 510  MET A O   1 
ATOM   3977 C CB  . MET A 1 510 ? 26.721  76.610 50.722 1.00 54.89 ? 510  MET A CB  1 
ATOM   3978 C CG  . MET A 1 510 ? 26.622  75.166 50.210 1.00 55.40 ? 510  MET A CG  1 
ATOM   3979 S SD  . MET A 1 510 ? 26.070  75.047 48.505 1.00 56.74 ? 510  MET A SD  1 
ATOM   3980 C CE  . MET A 1 510 ? 24.436  75.711 48.686 1.00 55.85 ? 510  MET A CE  1 
ATOM   3981 N N   . LYS A 1 511 ? 28.243  74.752 53.090 1.00 51.58 ? 511  LYS A N   1 
ATOM   3982 C CA  . LYS A 1 511 ? 29.360  73.808 53.256 1.00 49.94 ? 511  LYS A CA  1 
ATOM   3983 C C   . LYS A 1 511 ? 28.796  72.481 52.697 1.00 49.10 ? 511  LYS A C   1 
ATOM   3984 O O   . LYS A 1 511 ? 27.622  72.150 52.903 1.00 50.23 ? 511  LYS A O   1 
ATOM   3985 C CB  . LYS A 1 511 ? 29.750  73.617 54.721 1.00 49.34 ? 511  LYS A CB  1 
ATOM   3986 C CG  . LYS A 1 511 ? 30.233  74.860 55.424 1.00 51.13 ? 511  LYS A CG  1 
ATOM   3987 N N   . VAL A 1 512 ? 29.614  71.743 51.973 1.00 46.55 ? 512  VAL A N   1 
ATOM   3988 C CA  . VAL A 1 512 ? 29.212  70.474 51.389 1.00 44.63 ? 512  VAL A CA  1 
ATOM   3989 C C   . VAL A 1 512 ? 29.862  69.384 52.232 1.00 44.54 ? 512  VAL A C   1 
ATOM   3990 O O   . VAL A 1 512 ? 31.028  69.528 52.634 1.00 43.99 ? 512  VAL A O   1 
ATOM   3991 C CB  . VAL A 1 512 ? 29.737  70.374 49.931 1.00 43.88 ? 512  VAL A CB  1 
ATOM   3992 C CG1 . VAL A 1 512 ? 29.607  68.948 49.382 1.00 42.76 ? 512  VAL A CG1 1 
ATOM   3993 C CG2 . VAL A 1 512 ? 29.004  71.381 49.062 1.00 42.20 ? 512  VAL A CG2 1 
ATOM   3994 N N   . HIS A 1 513 ? 29.121  68.320 52.542 1.00 42.73 ? 513  HIS A N   1 
ATOM   3995 C CA  . HIS A 1 513 ? 29.705  67.205 53.298 1.00 41.07 ? 513  HIS A CA  1 
ATOM   3996 C C   . HIS A 1 513 ? 29.347  65.892 52.622 1.00 41.47 ? 513  HIS A C   1 
ATOM   3997 O O   . HIS A 1 513 ? 28.647  65.847 51.596 1.00 41.60 ? 513  HIS A O   1 
ATOM   3998 C CB  . HIS A 1 513 ? 29.166  67.091 54.702 1.00 41.00 ? 513  HIS A CB  1 
ATOM   3999 C CG  . HIS A 1 513 ? 29.112  68.371 55.453 1.00 42.63 ? 513  HIS A CG  1 
ATOM   4000 N ND1 . HIS A 1 513 ? 30.205  68.890 56.115 1.00 44.37 ? 513  HIS A ND1 1 
ATOM   4001 C CD2 . HIS A 1 513 ? 28.067  69.181 55.749 1.00 44.38 ? 513  HIS A CD2 1 
ATOM   4002 C CE1 . HIS A 1 513 ? 29.832  69.960 56.799 1.00 44.59 ? 513  HIS A CE1 1 
ATOM   4003 N NE2 . HIS A 1 513 ? 28.541  70.159 56.593 1.00 45.83 ? 513  HIS A NE2 1 
ATOM   4004 N N   . GLN A 1 514 ? 29.771  64.800 53.240 1.00 40.97 ? 514  GLN A N   1 
ATOM   4005 C CA  . GLN A 1 514 ? 29.479  63.517 52.669 1.00 40.13 ? 514  GLN A CA  1 
ATOM   4006 C C   . GLN A 1 514 ? 29.007  62.514 53.699 1.00 38.21 ? 514  GLN A C   1 
ATOM   4007 O O   . GLN A 1 514 ? 29.358  62.592 54.859 1.00 36.79 ? 514  GLN A O   1 
ATOM   4008 C CB  . GLN A 1 514 ? 30.743  62.974 51.979 1.00 41.74 ? 514  GLN A CB  1 
ATOM   4009 C CG  . GLN A 1 514 ? 31.216  63.786 50.783 1.00 45.12 ? 514  GLN A CG  1 
ATOM   4010 C CD  . GLN A 1 514 ? 32.508  63.223 50.170 1.00 47.68 ? 514  GLN A CD  1 
ATOM   4011 O OE1 . GLN A 1 514 ? 33.621  63.472 50.669 1.00 49.55 ? 514  GLN A OE1 1 
ATOM   4012 N NE2 . GLN A 1 514 ? 32.359  62.436 49.112 1.00 46.12 ? 514  GLN A NE2 1 
ATOM   4013 N N   . ARG A 1 515 ? 28.219  61.561 53.237 1.00 37.40 ? 515  ARG A N   1 
ATOM   4014 C CA  . ARG A 1 515 ? 27.760  60.460 54.068 1.00 37.77 ? 515  ARG A CA  1 
ATOM   4015 C C   . ARG A 1 515 ? 27.063  60.830 55.378 1.00 36.41 ? 515  ARG A C   1 
ATOM   4016 O O   . ARG A 1 515 ? 27.530  60.473 56.463 1.00 33.76 ? 515  ARG A O   1 
ATOM   4017 C CB  . ARG A 1 515 ? 28.968  59.546 54.338 1.00 39.12 ? 515  ARG A CB  1 
ATOM   4018 C CG  . ARG A 1 515 ? 29.578  58.896 53.041 1.00 42.31 ? 515  ARG A CG  1 
ATOM   4019 C CD  . ARG A 1 515 ? 30.631  57.807 53.346 1.00 43.46 ? 515  ARG A CD  1 
ATOM   4020 N NE  . ARG A 1 515 ? 31.015  57.017 52.168 1.00 48.53 ? 515  ARG A NE  1 
ATOM   4021 C CZ  . ARG A 1 515 ? 31.847  55.964 52.192 1.00 48.07 ? 515  ARG A CZ  1 
ATOM   4022 N N   . LEU A 1 516 ? 25.951  61.550 55.241 1.00 35.68 ? 516  LEU A N   1 
ATOM   4023 C CA  . LEU A 1 516 ? 25.121  62.012 56.358 1.00 35.63 ? 516  LEU A CA  1 
ATOM   4024 C C   . LEU A 1 516 ? 24.842  60.904 57.354 1.00 34.84 ? 516  LEU A C   1 
ATOM   4025 O O   . LEU A 1 516 ? 24.194  59.895 57.028 1.00 33.97 ? 516  LEU A O   1 
ATOM   4026 C CB  . LEU A 1 516 ? 23.795  62.584 55.818 1.00 36.22 ? 516  LEU A CB  1 
ATOM   4027 C CG  . LEU A 1 516 ? 22.656  63.073 56.717 1.00 36.31 ? 516  LEU A CG  1 
ATOM   4028 C CD1 . LEU A 1 516 ? 23.147  63.816 57.914 1.00 39.88 ? 516  LEU A CD1 1 
ATOM   4029 C CD2 . LEU A 1 516 ? 21.839  64.037 55.869 1.00 37.95 ? 516  LEU A CD2 1 
ATOM   4030 N N   . ARG A 1 517 ? 25.320  61.117 58.576 1.00 34.63 ? 517  ARG A N   1 
ATOM   4031 C CA  . ARG A 1 517 ? 25.182  60.145 59.653 1.00 35.13 ? 517  ARG A CA  1 
ATOM   4032 C C   . ARG A 1 517 ? 25.462  58.683 59.262 1.00 34.16 ? 517  ARG A C   1 
ATOM   4033 O O   . ARG A 1 517 ? 24.745  57.777 59.736 1.00 31.23 ? 517  ARG A O   1 
ATOM   4034 C CB  . ARG A 1 517 ? 23.791  60.317 60.368 1.00 36.81 ? 517  ARG A CB  1 
ATOM   4035 C CG  . ARG A 1 517 ? 23.940  61.499 61.425 1.00 44.36 ? 517  ARG A CG  1 
ATOM   4036 C CD  . ARG A 1 517 ? 22.782  61.942 62.307 1.00 43.87 ? 517  ARG A CD  1 
ATOM   4037 N NE  . ARG A 1 517 ? 22.748  61.192 63.551 1.00 47.54 ? 517  ARG A NE  1 
ATOM   4038 C CZ  . ARG A 1 517 ? 23.636  61.297 64.544 1.00 48.19 ? 517  ARG A CZ  1 
ATOM   4039 N NH1 . ARG A 1 517 ? 24.649  62.154 64.438 1.00 48.65 ? 517  ARG A NH1 1 
ATOM   4040 N NH2 . ARG A 1 517 ? 23.539  60.514 65.633 1.00 43.50 ? 517  ARG A NH2 1 
ATOM   4041 N N   . VAL A 1 518 ? 26.511  58.433 58.438 1.00 33.53 ? 518  VAL A N   1 
ATOM   4042 C CA  . VAL A 1 518 ? 26.796  57.037 58.042 1.00 33.99 ? 518  VAL A CA  1 
ATOM   4043 C C   . VAL A 1 518 ? 27.002  56.113 59.244 1.00 33.85 ? 518  VAL A C   1 
ATOM   4044 O O   . VAL A 1 518 ? 26.486  55.020 59.259 1.00 32.82 ? 518  VAL A O   1 
ATOM   4045 C CB  . VAL A 1 518 ? 28.140  56.707 57.352 1.00 34.91 ? 518  VAL A CB  1 
ATOM   4046 C CG1 . VAL A 1 518 ? 27.884  55.986 56.068 1.00 34.03 ? 518  VAL A CG1 1 
ATOM   4047 C CG2 . VAL A 1 518 ? 29.080  57.849 57.372 1.00 33.49 ? 518  VAL A CG2 1 
ATOM   4048 N N   . GLN A 1 519 ? 27.836  56.548 60.190 1.00 33.91 ? 519  GLN A N   1 
ATOM   4049 C CA  . GLN A 1 519 ? 28.173  55.708 61.334 1.00 35.81 ? 519  GLN A CA  1 
ATOM   4050 C C   . GLN A 1 519 ? 26.924  55.166 62.041 1.00 34.27 ? 519  GLN A C   1 
ATOM   4051 O O   . GLN A 1 519 ? 26.750  53.970 62.195 1.00 33.53 ? 519  GLN A O   1 
ATOM   4052 C CB  . GLN A 1 519 ? 29.095  56.492 62.309 1.00 35.19 ? 519  GLN A CB  1 
ATOM   4053 C CG  . GLN A 1 519 ? 29.879  55.581 63.282 1.00 35.97 ? 519  GLN A CG  1 
ATOM   4054 C CD  . GLN A 1 519 ? 30.888  54.682 62.560 1.00 37.24 ? 519  GLN A CD  1 
ATOM   4055 O OE1 . GLN A 1 519 ? 31.523  55.116 61.581 1.00 36.31 ? 519  GLN A OE1 1 
ATOM   4056 N NE2 . GLN A 1 519 ? 31.039  53.423 63.029 1.00 36.31 ? 519  GLN A NE2 1 
ATOM   4057 N N   . MET A 1 520 ? 26.041  56.050 62.449 1.00 34.41 ? 520  MET A N   1 
ATOM   4058 C CA  . MET A 1 520 ? 24.821  55.599 63.114 1.00 34.52 ? 520  MET A CA  1 
ATOM   4059 C C   . MET A 1 520 ? 23.870  54.852 62.180 1.00 34.18 ? 520  MET A C   1 
ATOM   4060 O O   . MET A 1 520 ? 23.235  53.871 62.602 1.00 35.25 ? 520  MET A O   1 
ATOM   4061 C CB  . MET A 1 520 ? 24.094  56.792 63.749 1.00 35.27 ? 520  MET A CB  1 
ATOM   4062 C CG  . MET A 1 520 ? 24.854  57.387 64.928 1.00 39.53 ? 520  MET A CG  1 
ATOM   4063 S SD  . MET A 1 520 ? 25.234  56.099 66.190 1.00 45.88 ? 520  MET A SD  1 
ATOM   4064 C CE  . MET A 1 520 ? 26.942  56.018 65.972 1.00 46.33 ? 520  MET A CE  1 
ATOM   4065 N N   . CYS A 1 521 ? 23.769  55.282 60.918 1.00 30.93 ? 521  CYS A N   1 
ATOM   4066 C CA  . CYS A 1 521 ? 22.867  54.607 60.030 1.00 32.22 ? 521  CYS A CA  1 
ATOM   4067 C C   . CYS A 1 521 ? 23.324  53.215 59.622 1.00 32.15 ? 521  CYS A C   1 
ATOM   4068 O O   . CYS A 1 521 ? 22.486  52.393 59.315 1.00 32.13 ? 521  CYS A O   1 
ATOM   4069 C CB  . CYS A 1 521 ? 22.503  55.509 58.830 1.00 33.92 ? 521  CYS A CB  1 
ATOM   4070 S SG  . CYS A 1 521 ? 21.551  56.989 59.387 1.00 35.52 ? 521  CYS A SG  1 
ATOM   4071 N N   . VAL A 1 522 ? 24.626  52.899 59.670 1.00 32.45 ? 522  VAL A N   1 
ATOM   4072 C CA  . VAL A 1 522 ? 25.017  51.514 59.353 1.00 32.74 ? 522  VAL A CA  1 
ATOM   4073 C C   . VAL A 1 522 ? 24.458  50.665 60.532 1.00 33.86 ? 522  VAL A C   1 
ATOM   4074 O O   . VAL A 1 522 ? 23.974  49.540 60.361 1.00 33.30 ? 522  VAL A O   1 
ATOM   4075 C CB  . VAL A 1 522 ? 26.561  51.348 59.238 1.00 34.57 ? 522  VAL A CB  1 
ATOM   4076 C CG1 . VAL A 1 522 ? 26.946  49.857 59.298 1.00 31.67 ? 522  VAL A CG1 1 
ATOM   4077 C CG2 . VAL A 1 522 ? 27.062  51.996 57.891 1.00 30.16 ? 522  VAL A CG2 1 
ATOM   4078 N N   . PHE A 1 523 ? 24.486  51.228 61.729 1.00 31.78 ? 523  PHE A N   1 
ATOM   4079 C CA  . PHE A 1 523 ? 23.935  50.522 62.867 1.00 31.17 ? 523  PHE A CA  1 
ATOM   4080 C C   . PHE A 1 523 ? 22.429  50.272 62.718 1.00 31.54 ? 523  PHE A C   1 
ATOM   4081 O O   . PHE A 1 523 ? 21.973  49.150 62.878 1.00 30.80 ? 523  PHE A O   1 
ATOM   4082 C CB  . PHE A 1 523 ? 24.167  51.302 64.150 1.00 28.34 ? 523  PHE A CB  1 
ATOM   4083 C CG  . PHE A 1 523 ? 23.444  50.736 65.313 1.00 29.08 ? 523  PHE A CG  1 
ATOM   4084 C CD1 . PHE A 1 523 ? 23.987  49.678 66.029 1.00 31.02 ? 523  PHE A CD1 1 
ATOM   4085 C CD2 . PHE A 1 523 ? 22.216  51.279 65.722 1.00 30.12 ? 523  PHE A CD2 1 
ATOM   4086 C CE1 . PHE A 1 523 ? 23.325  49.159 67.166 1.00 32.73 ? 523  PHE A CE1 1 
ATOM   4087 C CE2 . PHE A 1 523 ? 21.540  50.768 66.848 1.00 31.04 ? 523  PHE A CE2 1 
ATOM   4088 C CZ  . PHE A 1 523 ? 22.109  49.701 67.575 1.00 32.17 ? 523  PHE A CZ  1 
ATOM   4089 N N   . TRP A 1 524 ? 21.659  51.323 62.438 1.00 31.73 ? 524  TRP A N   1 
ATOM   4090 C CA  . TRP A 1 524 ? 20.206  51.173 62.278 1.00 32.10 ? 524  TRP A CA  1 
ATOM   4091 C C   . TRP A 1 524 ? 19.723  50.464 61.011 1.00 33.05 ? 524  TRP A C   1 
ATOM   4092 O O   . TRP A 1 524 ? 18.697  49.803 61.046 1.00 32.10 ? 524  TRP A O   1 
ATOM   4093 C CB  . TRP A 1 524 ? 19.481  52.525 62.341 1.00 28.64 ? 524  TRP A CB  1 
ATOM   4094 C CG  . TRP A 1 524 ? 19.587  53.164 63.705 1.00 28.85 ? 524  TRP A CG  1 
ATOM   4095 C CD1 . TRP A 1 524 ? 20.425  54.178 64.074 1.00 25.63 ? 524  TRP A CD1 1 
ATOM   4096 C CD2 . TRP A 1 524 ? 18.829  52.822 64.869 1.00 26.66 ? 524  TRP A CD2 1 
ATOM   4097 N NE1 . TRP A 1 524 ? 20.228  54.495 65.374 1.00 27.01 ? 524  TRP A NE1 1 
ATOM   4098 C CE2 . TRP A 1 524 ? 19.251  53.680 65.899 1.00 28.44 ? 524  TRP A CE2 1 
ATOM   4099 C CE3 . TRP A 1 524 ? 17.841  51.878 65.138 1.00 25.88 ? 524  TRP A CE3 1 
ATOM   4100 C CZ2 . TRP A 1 524 ? 18.702  53.625 67.206 1.00 26.75 ? 524  TRP A CZ2 1 
ATOM   4101 C CZ3 . TRP A 1 524 ? 17.300  51.822 66.402 1.00 26.66 ? 524  TRP A CZ3 1 
ATOM   4102 C CH2 . TRP A 1 524 ? 17.727  52.690 67.427 1.00 27.33 ? 524  TRP A CH2 1 
ATOM   4103 N N   . ASN A 1 525 ? 20.446  50.586 59.907 1.00 33.62 ? 525  ASN A N   1 
ATOM   4104 C CA  . ASN A 1 525 ? 19.965  49.969 58.683 1.00 35.60 ? 525  ASN A CA  1 
ATOM   4105 C C   . ASN A 1 525 ? 20.559  48.603 58.383 1.00 38.16 ? 525  ASN A C   1 
ATOM   4106 O O   . ASN A 1 525 ? 19.942  47.841 57.667 1.00 36.88 ? 525  ASN A O   1 
ATOM   4107 C CB  . ASN A 1 525 ? 20.186  50.884 57.488 1.00 33.94 ? 525  ASN A CB  1 
ATOM   4108 C CG  . ASN A 1 525 ? 19.410  52.206 57.609 1.00 36.56 ? 525  ASN A CG  1 
ATOM   4109 O OD1 . ASN A 1 525 ? 18.309  52.236 58.155 1.00 36.39 ? 525  ASN A OD1 1 
ATOM   4110 N ND2 . ASN A 1 525 ? 19.976  53.291 57.078 1.00 34.09 ? 525  ASN A ND2 1 
ATOM   4111 N N   . GLN A 1 526 ? 21.749  48.299 58.906 1.00 37.70 ? 526  GLN A N   1 
ATOM   4112 C CA  . GLN A 1 526 ? 22.340  46.994 58.647 1.00 39.06 ? 526  GLN A CA  1 
ATOM   4113 C C   . GLN A 1 526 ? 22.515  46.144 59.896 1.00 38.07 ? 526  GLN A C   1 
ATOM   4114 O O   . GLN A 1 526 ? 21.964  45.066 59.945 1.00 39.07 ? 526  GLN A O   1 
ATOM   4115 C CB  . GLN A 1 526 ? 23.689  47.118 57.960 1.00 41.25 ? 526  GLN A CB  1 
ATOM   4116 C CG  . GLN A 1 526 ? 23.649  47.764 56.595 1.00 49.50 ? 526  GLN A CG  1 
ATOM   4117 C CD  . GLN A 1 526 ? 25.055  47.869 56.018 1.00 54.95 ? 526  GLN A CD  1 
ATOM   4118 O OE1 . GLN A 1 526 ? 25.426  48.907 55.413 1.00 56.04 ? 526  GLN A OE1 1 
ATOM   4119 N NE2 . GLN A 1 526 ? 25.876  46.789 56.218 1.00 57.14 ? 526  GLN A NE2 1 
ATOM   4120 N N   . PHE A 1 527 ? 23.249  46.615 60.915 1.00 35.24 ? 527  PHE A N   1 
ATOM   4121 C CA  . PHE A 1 527 ? 23.442  45.785 62.080 1.00 34.26 ? 527  PHE A CA  1 
ATOM   4122 C C   . PHE A 1 527 ? 22.233  45.425 62.964 1.00 33.93 ? 527  PHE A C   1 
ATOM   4123 O O   . PHE A 1 527 ? 21.986  44.245 63.188 1.00 33.89 ? 527  PHE A O   1 
ATOM   4124 C CB  . PHE A 1 527 ? 24.537  46.345 63.005 1.00 32.22 ? 527  PHE A CB  1 
ATOM   4125 C CG  . PHE A 1 527 ? 24.827  45.435 64.179 1.00 30.22 ? 527  PHE A CG  1 
ATOM   4126 C CD1 . PHE A 1 527 ? 25.477  44.214 63.984 1.00 32.27 ? 527  PHE A CD1 1 
ATOM   4127 C CD2 . PHE A 1 527 ? 24.440  45.782 65.455 1.00 31.80 ? 527  PHE A CD2 1 
ATOM   4128 C CE1 . PHE A 1 527 ? 25.740  43.363 65.045 1.00 30.99 ? 527  PHE A CE1 1 
ATOM   4129 C CE2 . PHE A 1 527 ? 24.688  44.948 66.540 1.00 33.12 ? 527  PHE A CE2 1 
ATOM   4130 C CZ  . PHE A 1 527 ? 25.350  43.720 66.331 1.00 33.40 ? 527  PHE A CZ  1 
ATOM   4131 N N   . LEU A 1 528 ? 21.505  46.405 63.502 1.00 33.73 ? 528  LEU A N   1 
ATOM   4132 C CA  . LEU A 1 528 ? 20.376  46.073 64.380 1.00 34.94 ? 528  LEU A CA  1 
ATOM   4133 C C   . LEU A 1 528 ? 19.349  45.128 63.699 1.00 37.15 ? 528  LEU A C   1 
ATOM   4134 O O   . LEU A 1 528 ? 18.925  44.147 64.290 1.00 38.49 ? 528  LEU A O   1 
ATOM   4135 C CB  . LEU A 1 528 ? 19.679  47.332 64.892 1.00 32.55 ? 528  LEU A CB  1 
ATOM   4136 C CG  . LEU A 1 528 ? 18.660  47.080 66.008 1.00 34.92 ? 528  LEU A CG  1 
ATOM   4137 C CD1 . LEU A 1 528 ? 19.328  46.393 67.228 1.00 33.88 ? 528  LEU A CD1 1 
ATOM   4138 C CD2 . LEU A 1 528 ? 18.030  48.453 66.419 1.00 33.92 ? 528  LEU A CD2 1 
ATOM   4139 N N   . PRO A 1 529 ? 18.925  45.426 62.463 1.00 38.86 ? 529  PRO A N   1 
ATOM   4140 C CA  . PRO A 1 529 ? 17.958  44.500 61.844 1.00 41.47 ? 529  PRO A CA  1 
ATOM   4141 C C   . PRO A 1 529 ? 18.525  43.055 61.777 1.00 43.07 ? 529  PRO A C   1 
ATOM   4142 O O   . PRO A 1 529 ? 17.804  42.087 62.036 1.00 43.79 ? 529  PRO A O   1 
ATOM   4143 C CB  . PRO A 1 529 ? 17.739  45.099 60.445 1.00 39.69 ? 529  PRO A CB  1 
ATOM   4144 C CG  . PRO A 1 529 ? 18.007  46.575 60.672 1.00 39.01 ? 529  PRO A CG  1 
ATOM   4145 C CD  . PRO A 1 529 ? 19.241  46.539 61.553 1.00 37.63 ? 529  PRO A CD  1 
ATOM   4146 N N   . LYS A 1 530 ? 19.805  42.909 61.426 1.00 43.93 ? 530  LYS A N   1 
ATOM   4147 C CA  . LYS A 1 530 ? 20.404  41.577 61.383 1.00 45.00 ? 530  LYS A CA  1 
ATOM   4148 C C   . LYS A 1 530 ? 20.327  40.970 62.799 1.00 44.88 ? 530  LYS A C   1 
ATOM   4149 O O   . LYS A 1 530 ? 19.917  39.822 62.981 1.00 44.83 ? 530  LYS A O   1 
ATOM   4150 C CB  . LYS A 1 530 ? 21.844  41.663 60.894 1.00 46.81 ? 530  LYS A CB  1 
ATOM   4151 C CG  . LYS A 1 530 ? 22.463  40.323 60.528 1.00 51.22 ? 530  LYS A CG  1 
ATOM   4152 C CD  . LYS A 1 530 ? 23.730  40.496 59.649 1.00 54.02 ? 530  LYS A CD  1 
ATOM   4153 C CE  . LYS A 1 530 ? 24.502  39.141 59.494 1.00 55.79 ? 530  LYS A CE  1 
ATOM   4154 N NZ  . LYS A 1 530 ? 25.683  39.193 58.550 1.00 55.76 ? 530  LYS A NZ  1 
ATOM   4155 N N   . LEU A 1 531 ? 20.671  41.770 63.801 1.00 44.20 ? 531  LEU A N   1 
ATOM   4156 C CA  . LEU A 1 531 ? 20.625  41.340 65.177 1.00 44.21 ? 531  LEU A CA  1 
ATOM   4157 C C   . LEU A 1 531 ? 19.231  40.854 65.631 1.00 45.41 ? 531  LEU A C   1 
ATOM   4158 O O   . LEU A 1 531 ? 19.110  39.806 66.262 1.00 43.59 ? 531  LEU A O   1 
ATOM   4159 C CB  . LEU A 1 531 ? 21.105  42.480 66.089 1.00 43.44 ? 531  LEU A CB  1 
ATOM   4160 C CG  . LEU A 1 531 ? 21.119  42.193 67.586 1.00 43.15 ? 531  LEU A CG  1 
ATOM   4161 C CD1 . LEU A 1 531 ? 21.601  40.827 67.687 1.00 46.90 ? 531  LEU A CD1 1 
ATOM   4162 C CD2 . LEU A 1 531 ? 22.065  43.078 68.398 1.00 44.44 ? 531  LEU A CD2 1 
ATOM   4163 N N   . LEU A 1 532 ? 18.189  41.629 65.345 1.00 46.62 ? 532  LEU A N   1 
ATOM   4164 C CA  . LEU A 1 532 ? 16.830  41.251 65.747 1.00 48.06 ? 532  LEU A CA  1 
ATOM   4165 C C   . LEU A 1 532 ? 16.331  40.023 64.971 1.00 49.77 ? 532  LEU A C   1 
ATOM   4166 O O   . LEU A 1 532 ? 15.570  39.252 65.519 1.00 48.73 ? 532  LEU A O   1 
ATOM   4167 C CB  . LEU A 1 532 ? 15.843  42.425 65.574 1.00 46.03 ? 532  LEU A CB  1 
ATOM   4168 C CG  . LEU A 1 532 ? 16.116  43.665 66.419 1.00 45.30 ? 532  LEU A CG  1 
ATOM   4169 C CD1 . LEU A 1 532 ? 15.307  44.866 65.905 1.00 43.96 ? 532  LEU A CD1 1 
ATOM   4170 C CD2 . LEU A 1 532 ? 15.829  43.336 67.850 1.00 43.89 ? 532  LEU A CD2 1 
ATOM   4171 N N   . ASN A 1 533 ? 16.780  39.844 63.727 1.00 53.19 ? 533  ASN A N   1 
ATOM   4172 C CA  . ASN A 1 533 ? 16.396  38.693 62.886 1.00 57.48 ? 533  ASN A CA  1 
ATOM   4173 C C   . ASN A 1 533 ? 17.039  37.363 63.325 1.00 59.72 ? 533  ASN A C   1 
ATOM   4174 O O   . ASN A 1 533 ? 16.473  36.302 63.105 1.00 58.95 ? 533  ASN A O   1 
ATOM   4175 C CB  . ASN A 1 533 ? 16.792  38.898 61.407 1.00 58.99 ? 533  ASN A CB  1 
ATOM   4176 C CG  . ASN A 1 533 ? 16.347  37.719 60.510 1.00 61.80 ? 533  ASN A CG  1 
ATOM   4177 O OD1 . ASN A 1 533 ? 15.150  37.472 60.349 1.00 63.93 ? 533  ASN A OD1 1 
ATOM   4178 N ND2 . ASN A 1 533 ? 17.306  36.985 59.947 1.00 63.43 ? 533  ASN A ND2 1 
ATOM   4179 N N   . ALA A 1 534 ? 18.226  37.421 63.918 1.00 62.38 ? 534  ALA A N   1 
ATOM   4180 C CA  . ALA A 1 534 ? 18.907  36.208 64.324 1.00 65.00 ? 534  ALA A CA  1 
ATOM   4181 C C   . ALA A 1 534 ? 18.501  35.807 65.734 1.00 67.71 ? 534  ALA A C   1 
ATOM   4182 O O   . ALA A 1 534 ? 18.373  34.620 66.025 1.00 69.17 ? 534  ALA A O   1 
ATOM   4183 C CB  . ALA A 1 534 ? 20.407  36.403 64.236 1.00 63.67 ? 534  ALA A CB  1 
ATOM   4184 N N   . THR A 1 535 ? 18.264  36.795 66.595 1.00 69.85 ? 535  THR A N   1 
ATOM   4185 C CA  . THR A 1 535 ? 17.883  36.551 67.991 1.00 71.31 ? 535  THR A CA  1 
ATOM   4186 C C   . THR A 1 535 ? 16.384  36.748 68.250 1.00 73.29 ? 535  THR A C   1 
ATOM   4187 O O   . THR A 1 535 ? 15.654  37.021 67.266 1.00 74.70 ? 535  THR A O   1 
ATOM   4188 C CB  . THR A 1 535 ? 18.637  37.499 68.950 1.00 71.34 ? 535  THR A CB  1 
ATOM   4189 O OG1 . THR A 1 535 ? 18.119  38.825 68.803 1.00 70.22 ? 535  THR A OG1 1 
ATOM   4190 C CG2 . THR A 1 535 ? 20.129  37.516 68.636 1.00 70.80 ? 535  THR A CG2 1 
HETATM 4191 C C1  . NAG B 2 .   ? -18.594 83.402 50.084 1.00 68.00 ? 591  NAG A C1  1 
HETATM 4192 C C2  . NAG B 2 .   ? -19.570 84.560 49.800 1.00 71.27 ? 591  NAG A C2  1 
HETATM 4193 C C3  . NAG B 2 .   ? -19.190 85.804 50.623 1.00 73.74 ? 591  NAG A C3  1 
HETATM 4194 C C4  . NAG B 2 .   ? -19.151 85.449 52.123 1.00 74.58 ? 591  NAG A C4  1 
HETATM 4195 C C5  . NAG B 2 .   ? -18.283 84.185 52.395 1.00 72.87 ? 591  NAG A C5  1 
HETATM 4196 C C6  . NAG B 2 .   ? -18.416 83.712 53.858 1.00 72.16 ? 591  NAG A C6  1 
HETATM 4197 C C7  . NAG B 2 .   ? -20.760 84.613 47.711 1.00 72.32 ? 591  NAG A C7  1 
HETATM 4198 C C8  . NAG B 2 .   ? -20.997 85.422 46.444 1.00 71.33 ? 591  NAG A C8  1 
HETATM 4199 N N2  . NAG B 2 .   ? -19.642 84.880 48.387 1.00 71.15 ? 591  NAG A N2  1 
HETATM 4200 O O3  . NAG B 2 .   ? -20.160 86.837 50.405 1.00 74.81 ? 591  NAG A O3  1 
HETATM 4201 O O4  . NAG B 2 .   ? -18.656 86.569 52.872 1.00 76.83 ? 591  NAG A O4  1 
HETATM 4202 O O5  . NAG B 2 .   ? -18.673 83.076 51.509 1.00 71.47 ? 591  NAG A O5  1 
HETATM 4203 O O6  . NAG B 2 .   ? -19.007 82.417 53.988 1.00 71.43 ? 591  NAG A O6  1 
HETATM 4204 O O7  . NAG B 2 .   ? -21.589 83.749 48.067 1.00 71.64 ? 591  NAG A O7  1 
HETATM 4205 C C1  . NAG C 2 .   ? 18.624  61.876 33.544 1.00 53.75 ? 4161 NAG A C1  1 
HETATM 4206 C C2  . NAG C 2 .   ? 20.143  61.771 33.648 1.00 55.19 ? 4161 NAG A C2  1 
HETATM 4207 C C3  . NAG C 2 .   ? 20.816  62.383 32.407 1.00 57.08 ? 4161 NAG A C3  1 
HETATM 4208 C C4  . NAG C 2 .   ? 20.234  61.731 31.114 1.00 58.16 ? 4161 NAG A C4  1 
HETATM 4209 C C5  . NAG C 2 .   ? 18.705  61.843 31.107 1.00 58.75 ? 4161 NAG A C5  1 
HETATM 4210 C C6  . NAG C 2 .   ? 18.096  61.101 29.896 1.00 59.08 ? 4161 NAG A C6  1 
HETATM 4211 C C7  . NAG C 2 .   ? 20.952  61.739 35.942 1.00 55.08 ? 4161 NAG A C7  1 
HETATM 4212 C C8  . NAG C 2 .   ? 21.423  62.545 37.142 1.00 54.22 ? 4161 NAG A C8  1 
HETATM 4213 N N2  . NAG C 2 .   ? 20.634  62.431 34.844 1.00 54.81 ? 4161 NAG A N2  1 
HETATM 4214 O O3  . NAG C 2 .   ? 22.223  62.156 32.505 1.00 55.07 ? 4161 NAG A O3  1 
HETATM 4215 O O4  . NAG C 2 .   ? 20.769  62.333 29.933 1.00 59.68 ? 4161 NAG A O4  1 
HETATM 4216 O O5  . NAG C 2 .   ? 18.157  61.256 32.323 1.00 56.58 ? 4161 NAG A O5  1 
HETATM 4217 O O6  . NAG C 2 .   ? 17.215  60.033 30.260 1.00 61.30 ? 4161 NAG A O6  1 
HETATM 4218 O O7  . NAG C 2 .   ? 20.860  60.502 36.024 1.00 55.70 ? 4161 NAG A O7  1 
HETATM 4219 C C1  . A1E D 3 .   ? -3.101  59.642 74.646 0.90 50.78 ? 1001 A1E A C1  1 
HETATM 4220 C C2  . A1E D 3 .   ? -2.030  60.648 74.269 0.90 51.66 ? 1001 A1E A C2  1 
HETATM 4221 C C3  . A1E D 3 .   ? -1.072  60.080 73.165 0.90 51.34 ? 1001 A1E A C3  1 
HETATM 4222 C C4  . A1E D 3 .   ? -0.564  58.672 73.543 0.90 50.90 ? 1001 A1E A C4  1 
HETATM 4223 C C5  . A1E D 3 .   ? -1.226  57.929 74.508 0.90 50.75 ? 1001 A1E A C5  1 
HETATM 4224 C C6  . A1E D 3 .   ? -2.444  58.409 75.279 0.90 49.48 ? 1001 A1E A C6  1 
HETATM 4225 C C7  . A1E D 3 .   ? 0.626   58.022 72.883 0.90 49.73 ? 1001 A1E A C7  1 
HETATM 4226 C C8  . A1E D 3 .   ? 1.054   56.748 73.220 0.90 49.72 ? 1001 A1E A C8  1 
HETATM 4227 C C9  . A1E D 3 .   ? 0.285   56.003 74.296 0.90 51.34 ? 1001 A1E A C9  1 
HETATM 4228 N N10 . A1E D 3 .   ? -0.779  56.673 74.827 0.90 52.04 ? 1001 A1E A N10 1 
HETATM 4229 O O11 . A1E D 3 .   ? 0.539   54.906 74.692 0.90 52.90 ? 1001 A1E A O11 1 
HETATM 4230 N N12 . A1E D 3 .   ? 0.040   61.070 73.243 0.90 52.74 ? 1001 A1E A N12 1 
HETATM 4231 C C13 . A1E D 3 .   ? -0.068  62.286 72.383 0.90 54.54 ? 1001 A1E A C13 1 
HETATM 4232 C C14 . A1E D 3 .   ? 0.987   62.015 71.346 0.90 51.98 ? 1001 A1E A C14 1 
HETATM 4233 C C15 . A1E D 3 .   ? 0.638   62.654 70.035 0.90 51.89 ? 1001 A1E A C15 1 
HETATM 4234 C C16 . A1E D 3 .   ? 1.699   62.309 68.991 0.90 53.20 ? 1001 A1E A C16 1 
HETATM 4235 C C17 . A1E D 3 .   ? 3.121   62.474 69.548 0.90 51.52 ? 1001 A1E A C17 1 
HETATM 4236 C C18 . A1E D 3 .   ? 3.679   63.774 69.010 0.90 53.80 ? 1001 A1E A C18 1 
HETATM 4237 C C19 . A1E D 3 .   ? 3.280   65.028 69.812 0.90 53.47 ? 1001 A1E A C19 1 
HETATM 4238 C C20 . A1E D 3 .   ? 2.241   65.863 69.045 0.90 53.22 ? 1001 A1E A C20 1 
HETATM 4239 C C21 . A1E D 3 .   ? 2.718   66.377 67.686 0.90 51.59 ? 1001 A1E A C21 1 
HETATM 4240 C C22 . A1E D 3 .   ? 1.726   67.435 67.200 0.90 48.83 ? 1001 A1E A C22 1 
HETATM 4241 N N23 . A1E D 3 .   ? 2.213   68.411 66.222 0.90 44.05 ? 1001 A1E A N23 1 
HETATM 4242 C C24 . A1E D 3 .   ? 3.521   68.662 65.732 0.90 41.83 ? 1001 A1E A C24 1 
HETATM 4243 C C25 . A1E D 3 .   ? 4.528   69.268 66.626 0.90 41.32 ? 1001 A1E A C25 1 
HETATM 4244 C C26 . A1E D 3 .   ? 5.797   69.577 66.022 0.90 40.52 ? 1001 A1E A C26 1 
HETATM 4245 N N27 . A1E D 3 .   ? 6.070   69.305 64.651 0.90 41.10 ? 1001 A1E A N27 1 
HETATM 4246 C C28 . A1E D 3 .   ? 5.155   68.742 63.863 0.90 39.96 ? 1001 A1E A C28 1 
HETATM 4247 C C29 . A1E D 3 .   ? 3.830   68.386 64.351 0.90 39.28 ? 1001 A1E A C29 1 
HETATM 4248 C C30 . A1E D 3 .   ? 4.425   69.610 68.048 0.90 40.91 ? 1001 A1E A C30 1 
HETATM 4249 C C31 . A1E D 3 .   ? 5.466   70.197 68.772 0.90 39.36 ? 1001 A1E A C31 1 
HETATM 4250 C C32 . A1E D 3 .   ? 6.711   70.499 68.132 0.90 38.98 ? 1001 A1E A C32 1 
HETATM 4251 C C33 . A1E D 3 .   ? 6.866   70.192 66.780 0.90 39.47 ? 1001 A1E A C33 1 
HETATM 4252 C C34 . A1E D 3 .   ? 5.623   68.517 62.401 0.90 39.62 ? 1001 A1E A C34 1 
HETATM 4253 C C35 . A1E D 3 .   ? 4.417   68.291 61.435 0.90 41.38 ? 1001 A1E A C35 1 
HETATM 4254 C C36 . A1E D 3 .   ? 3.463   67.246 62.008 0.90 39.55 ? 1001 A1E A C36 1 
HETATM 4255 C C37 . A1E D 3 .   ? 2.836   67.754 63.356 0.90 39.46 ? 1001 A1E A C37 1 
HETATM 4256 O O   . HOH E 4 .   ? 10.814  68.325 59.490 1.00 30.64 ? 4162 HOH A O   1 
HETATM 4257 O O   . HOH E 4 .   ? -4.053  69.832 62.261 1.00 28.03 ? 4163 HOH A O   1 
HETATM 4258 O O   . HOH E 4 .   ? 3.755   68.687 57.721 1.00 27.46 ? 4164 HOH A O   1 
HETATM 4259 O O   . HOH E 4 .   ? -1.635  69.408 52.639 1.00 27.92 ? 4165 HOH A O   1 
HETATM 4260 O O   . HOH E 4 .   ? -4.704  70.449 33.705 1.00 31.03 ? 4166 HOH A O   1 
HETATM 4261 O O   . HOH E 4 .   ? -14.836 59.575 57.149 1.00 33.34 ? 4167 HOH A O   1 
HETATM 4262 O O   . HOH E 4 .   ? 3.523   66.723 36.367 1.00 28.56 ? 4168 HOH A O   1 
HETATM 4263 O O   . HOH E 4 .   ? -0.606  63.051 58.809 1.00 28.49 ? 4169 HOH A O   1 
HETATM 4264 O O   . HOH E 4 .   ? 7.191   52.179 56.386 1.00 27.43 ? 4170 HOH A O   1 
HETATM 4265 O O   . HOH E 4 .   ? 4.048   63.688 61.074 1.00 36.55 ? 4171 HOH A O   1 
HETATM 4266 O O   . HOH E 4 .   ? 0.198   69.042 59.477 1.00 34.24 ? 4172 HOH A O   1 
HETATM 4267 O O   . HOH E 4 .   ? 31.002  58.114 49.799 1.00 43.69 ? 4173 HOH A O   1 
HETATM 4268 O O   . HOH E 4 .   ? -1.809  57.502 62.349 1.00 28.37 ? 4174 HOH A O   1 
HETATM 4269 O O   . HOH E 4 .   ? 17.765  50.471 44.724 1.00 36.71 ? 4175 HOH A O   1 
HETATM 4270 O O   . HOH E 4 .   ? -4.026  56.955 63.822 1.00 32.06 ? 4176 HOH A O   1 
HETATM 4271 O O   . HOH E 4 .   ? -4.600  85.158 39.438 1.00 39.91 ? 4177 HOH A O   1 
HETATM 4272 O O   . HOH E 4 .   ? -6.748  61.314 65.174 1.00 29.85 ? 4178 HOH A O   1 
HETATM 4273 O O   . HOH E 4 .   ? 0.331   77.130 61.847 1.00 37.46 ? 4179 HOH A O   1 
HETATM 4274 O O   . HOH E 4 .   ? 16.986  63.733 66.945 1.00 40.06 ? 4180 HOH A O   1 
HETATM 4275 O O   . HOH E 4 .   ? 2.863   53.991 63.429 1.00 28.74 ? 4181 HOH A O   1 
HETATM 4276 O O   . HOH E 4 .   ? -0.392  69.182 62.305 1.00 36.25 ? 4182 HOH A O   1 
HETATM 4277 O O   . HOH E 4 .   ? -10.596 65.487 68.640 1.00 38.34 ? 4183 HOH A O   1 
HETATM 4278 O O   . HOH E 4 .   ? 3.985   80.466 51.299 1.00 32.23 ? 4184 HOH A O   1 
HETATM 4279 O O   . HOH E 4 .   ? -8.856  60.808 63.702 1.00 35.78 ? 4185 HOH A O   1 
HETATM 4280 O O   . HOH E 4 .   ? 24.996  58.592 52.207 1.00 33.43 ? 4186 HOH A O   1 
HETATM 4281 O O   . HOH E 4 .   ? 18.256  59.940 41.625 1.00 31.94 ? 4187 HOH A O   1 
HETATM 4282 O O   . HOH E 4 .   ? 12.411  77.319 62.641 1.00 35.69 ? 4188 HOH A O   1 
HETATM 4283 O O   . HOH E 4 .   ? 11.761  67.246 67.266 1.00 30.02 ? 4189 HOH A O   1 
HETATM 4284 O O   . HOH E 4 .   ? -13.535 57.666 56.297 1.00 28.50 ? 4190 HOH A O   1 
HETATM 4285 O O   . HOH E 4 .   ? 13.874  74.306 65.923 1.00 38.28 ? 4191 HOH A O   1 
HETATM 4286 O O   . HOH E 4 .   ? -3.661  50.713 59.449 1.00 32.21 ? 4192 HOH A O   1 
HETATM 4287 O O   . HOH E 4 .   ? 10.505  55.461 68.426 1.00 26.82 ? 4193 HOH A O   1 
HETATM 4288 O O   . HOH E 4 .   ? 7.239   46.688 53.557 1.00 30.43 ? 4194 HOH A O   1 
HETATM 4289 O O   . HOH E 4 .   ? -9.023  58.241 64.528 1.00 34.16 ? 4195 HOH A O   1 
HETATM 4290 O O   . HOH E 4 .   ? 2.786   54.045 36.468 1.00 40.44 ? 4196 HOH A O   1 
HETATM 4291 O O   . HOH E 4 .   ? 4.053   43.443 55.549 1.00 35.62 ? 4197 HOH A O   1 
HETATM 4292 O O   . HOH E 4 .   ? -4.329  51.658 56.180 1.00 33.74 ? 4198 HOH A O   1 
HETATM 4293 O O   . HOH E 4 .   ? -7.350  67.664 57.608 1.00 33.03 ? 4199 HOH A O   1 
HETATM 4294 O O   . HOH E 4 .   ? 17.435  64.293 64.080 1.00 39.97 ? 4200 HOH A O   1 
HETATM 4295 O O   . HOH E 4 .   ? 10.017  79.951 64.901 1.00 41.07 ? 4201 HOH A O   1 
HETATM 4296 O O   . HOH E 4 .   ? 3.421   45.768 61.125 1.00 36.76 ? 4202 HOH A O   1 
HETATM 4297 O O   . HOH E 4 .   ? 7.868   75.485 60.631 1.00 30.30 ? 4203 HOH A O   1 
HETATM 4298 O O   . HOH E 4 .   ? 25.430  66.115 74.362 1.00 34.16 ? 4204 HOH A O   1 
HETATM 4299 O O   . HOH E 4 .   ? 7.284   70.482 39.111 1.00 38.07 ? 4205 HOH A O   1 
HETATM 4300 O O   . HOH E 4 .   ? 13.353  68.694 56.823 1.00 32.66 ? 4206 HOH A O   1 
HETATM 4301 O O   . HOH E 4 .   ? 27.587  63.209 45.662 1.00 38.41 ? 4207 HOH A O   1 
HETATM 4302 O O   . HOH E 4 .   ? 22.356  79.067 61.233 1.00 40.90 ? 4208 HOH A O   1 
HETATM 4303 O O   . HOH E 4 .   ? -15.431 66.225 51.694 1.00 36.40 ? 4209 HOH A O   1 
HETATM 4304 O O   . HOH E 4 .   ? 15.681  52.861 61.410 1.00 38.64 ? 4210 HOH A O   1 
HETATM 4305 O O   . HOH E 4 .   ? -18.026 65.184 61.106 1.00 44.58 ? 4211 HOH A O   1 
HETATM 4306 O O   . HOH E 4 .   ? -13.629 62.134 56.838 1.00 36.85 ? 4212 HOH A O   1 
HETATM 4307 O O   . HOH E 4 .   ? 14.544  76.236 63.746 1.00 43.95 ? 4213 HOH A O   1 
HETATM 4308 O O   . HOH E 4 .   ? 15.499  77.108 76.867 1.00 41.99 ? 4214 HOH A O   1 
HETATM 4309 O O   . HOH E 4 .   ? -0.993  66.171 39.685 1.00 39.69 ? 4215 HOH A O   1 
HETATM 4310 O O   . HOH E 4 .   ? 4.297   64.435 34.951 1.00 36.18 ? 4216 HOH A O   1 
HETATM 4311 O O   . HOH E 4 .   ? -8.118  71.156 52.632 1.00 43.64 ? 4217 HOH A O   1 
HETATM 4312 O O   . HOH E 4 .   ? 18.468  67.090 73.083 1.00 46.22 ? 4218 HOH A O   1 
HETATM 4313 O O   . HOH E 4 .   ? -5.860  44.924 57.306 1.00 36.79 ? 4219 HOH A O   1 
HETATM 4314 O O   . HOH E 4 .   ? 21.350  82.298 53.298 1.00 51.65 ? 4220 HOH A O   1 
HETATM 4315 O O   . HOH E 4 .   ? -15.399 67.304 49.298 1.00 28.07 ? 4221 HOH A O   1 
HETATM 4316 O O   . HOH E 4 .   ? -12.054 66.898 37.132 1.00 33.57 ? 4222 HOH A O   1 
HETATM 4317 O O   . HOH E 4 .   ? 22.991  66.794 47.558 1.00 37.22 ? 4223 HOH A O   1 
HETATM 4318 O O   . HOH E 4 .   ? 20.011  63.690 27.471 1.00 47.37 ? 4224 HOH A O   1 
HETATM 4319 O O   . HOH E 4 .   ? -9.707  69.789 54.584 1.00 39.39 ? 4225 HOH A O   1 
HETATM 4320 O O   . HOH E 4 .   ? -2.404  57.284 66.781 1.00 35.38 ? 4226 HOH A O   1 
HETATM 4321 O O   . HOH E 4 .   ? -12.384 62.981 59.142 1.00 34.02 ? 4227 HOH A O   1 
HETATM 4322 O O   . HOH E 4 .   ? -6.417  49.135 60.953 1.00 35.06 ? 4228 HOH A O   1 
HETATM 4323 O O   . HOH E 4 .   ? -3.210  77.136 31.063 1.00 49.34 ? 4229 HOH A O   1 
HETATM 4324 O O   . HOH E 4 .   ? -10.222 64.965 38.067 1.00 35.82 ? 4230 HOH A O   1 
HETATM 4325 O O   . HOH E 4 .   ? -18.140 68.339 48.889 1.00 36.63 ? 4231 HOH A O   1 
HETATM 4326 O O   . HOH E 4 .   ? -6.518  83.542 38.777 1.00 36.37 ? 4232 HOH A O   1 
HETATM 4327 O O   . HOH E 4 .   ? 24.981  61.357 52.493 1.00 30.72 ? 4233 HOH A O   1 
HETATM 4328 O O   . HOH E 4 .   ? 6.374   48.097 55.743 1.00 31.68 ? 4234 HOH A O   1 
HETATM 4329 O O   . HOH E 4 .   ? 4.327   55.386 78.061 1.00 31.62 ? 4235 HOH A O   1 
HETATM 4330 O O   . HOH E 4 .   ? -1.923  75.249 52.701 1.00 37.23 ? 4236 HOH A O   1 
HETATM 4331 O O   . HOH E 4 .   ? 8.402   76.655 75.972 1.00 37.13 ? 4237 HOH A O   1 
HETATM 4332 O O   . HOH E 4 .   ? -9.737  62.035 59.709 1.00 34.90 ? 4238 HOH A O   1 
HETATM 4333 O O   . HOH E 4 .   ? 1.238   42.936 54.640 1.00 41.76 ? 4239 HOH A O   1 
HETATM 4334 O O   . HOH E 4 .   ? -0.241  66.145 36.373 1.00 35.37 ? 4240 HOH A O   1 
HETATM 4335 O O   . HOH E 4 .   ? -7.550  70.246 56.261 1.00 34.77 ? 4241 HOH A O   1 
HETATM 4336 O O   . HOH E 4 .   ? 20.792  72.152 78.920 1.00 47.87 ? 4242 HOH A O   1 
HETATM 4337 O O   . HOH E 4 .   ? 9.533   55.944 35.913 1.00 35.76 ? 4243 HOH A O   1 
HETATM 4338 O O   . HOH E 4 .   ? 16.097  52.681 58.940 0.60 25.01 ? 4244 HOH A O   1 
HETATM 4339 O O   . HOH E 4 .   ? -10.092 51.750 54.677 1.00 38.75 ? 4245 HOH A O   1 
HETATM 4340 O O   . HOH E 4 .   ? 12.682  83.291 47.150 1.00 42.73 ? 4246 HOH A O   1 
HETATM 4341 O O   . HOH E 4 .   ? 3.486   51.259 64.191 1.00 36.34 ? 4247 HOH A O   1 
HETATM 4342 O O   . HOH E 4 .   ? 19.050  65.144 68.444 1.00 43.98 ? 4248 HOH A O   1 
HETATM 4343 O O   . HOH E 4 .   ? 20.706  59.339 40.643 1.00 42.92 ? 4249 HOH A O   1 
HETATM 4344 O O   . HOH E 4 .   ? -0.304  67.279 64.576 1.00 39.21 ? 4250 HOH A O   1 
HETATM 4345 O O   . HOH E 4 .   ? -3.300  75.986 64.181 1.00 39.92 ? 4251 HOH A O   1 
HETATM 4346 O O   . HOH E 4 .   ? 21.207  51.747 53.730 1.00 43.25 ? 4252 HOH A O   1 
HETATM 4347 O O   . HOH E 4 .   ? 3.421   50.224 69.201 1.00 40.74 ? 4253 HOH A O   1 
HETATM 4348 O O   . HOH E 4 .   ? 6.062   44.162 53.751 1.00 43.96 ? 4254 HOH A O   1 
HETATM 4349 O O   . HOH E 4 .   ? 6.225   62.426 34.909 1.00 37.11 ? 4255 HOH A O   1 
HETATM 4350 O O   . HOH E 4 .   ? 4.754   50.279 61.961 1.00 35.83 ? 4256 HOH A O   1 
HETATM 4351 O O   . HOH E 4 .   ? 21.902  61.656 41.648 1.00 35.36 ? 4257 HOH A O   1 
HETATM 4352 O O   . HOH E 4 .   ? 28.722  59.167 60.869 1.00 37.61 ? 4258 HOH A O   1 
HETATM 4353 O O   . HOH E 4 .   ? -4.783  80.125 62.427 1.00 48.30 ? 4259 HOH A O   1 
HETATM 4354 O O   . HOH E 4 .   ? 16.616  57.402 35.930 1.00 44.38 ? 4260 HOH A O   1 
HETATM 4355 O O   . HOH E 4 .   ? 7.004   65.470 81.717 1.00 42.75 ? 4261 HOH A O   1 
HETATM 4356 O O   . HOH E 4 .   ? 3.483   56.550 70.166 1.00 41.59 ? 4262 HOH A O   1 
HETATM 4357 O O   . HOH E 4 .   ? 9.605   46.433 53.348 0.50 15.57 ? 4263 HOH A O   1 
HETATM 4358 O O   . HOH E 4 .   ? 0.280   40.389 57.144 1.00 38.28 ? 4264 HOH A O   1 
HETATM 4359 O O   . HOH E 4 .   ? -20.562 75.122 37.492 1.00 51.39 ? 4265 HOH A O   1 
HETATM 4360 O O   . HOH E 4 .   ? 23.598  70.008 73.773 1.00 47.28 ? 4266 HOH A O   1 
HETATM 4361 O O   . HOH E 4 .   ? 15.708  62.227 84.438 1.00 43.11 ? 4267 HOH A O   1 
HETATM 4362 O O   . HOH E 4 .   ? 26.678  58.971 62.634 1.00 39.53 ? 4268 HOH A O   1 
HETATM 4363 O O   . HOH E 4 .   ? 7.327   63.535 78.757 1.00 36.35 ? 4269 HOH A O   1 
HETATM 4364 O O   . HOH E 4 .   ? -1.815  68.475 66.549 1.00 43.93 ? 4270 HOH A O   1 
HETATM 4365 O O   . HOH E 4 .   ? -15.583 60.171 48.883 1.00 36.57 ? 4271 HOH A O   1 
HETATM 4366 O O   . HOH E 4 .   ? 34.150  61.671 77.367 1.00 47.72 ? 4272 HOH A O   1 
HETATM 4367 O O   . HOH E 4 .   ? 18.905  85.104 49.972 1.00 48.72 ? 4273 HOH A O   1 
HETATM 4368 O O   . HOH E 4 .   ? 16.598  73.791 77.324 1.00 38.15 ? 4274 HOH A O   1 
HETATM 4369 O O   . HOH E 4 .   ? -2.549  77.762 62.201 1.00 40.76 ? 4275 HOH A O   1 
HETATM 4370 O O   . HOH E 4 .   ? 20.973  83.979 55.796 1.00 44.83 ? 4276 HOH A O   1 
HETATM 4371 O O   . HOH E 4 .   ? -8.865  65.027 70.655 1.00 45.07 ? 4277 HOH A O   1 
HETATM 4372 O O   . HOH E 4 .   ? 23.290  77.143 53.882 1.00 48.48 ? 4278 HOH A O   1 
HETATM 4373 O O   . HOH E 4 .   ? -10.539 81.242 55.468 1.00 49.21 ? 4279 HOH A O   1 
HETATM 4374 O O   . HOH E 4 .   ? -0.177  57.058 37.883 1.00 46.19 ? 4280 HOH A O   1 
HETATM 4375 O O   . HOH E 4 .   ? 9.095   88.209 47.886 1.00 47.82 ? 4281 HOH A O   1 
HETATM 4376 O O   . HOH E 4 .   ? 7.445   49.162 65.861 1.00 46.37 ? 4282 HOH A O   1 
HETATM 4377 O O   . HOH E 4 .   ? -1.032  50.677 42.274 1.00 44.78 ? 4283 HOH A O   1 
HETATM 4378 O O   . HOH E 4 .   ? 16.367  79.724 70.175 1.00 53.20 ? 4284 HOH A O   1 
HETATM 4379 O O   . HOH E 4 .   ? -6.947  48.412 73.906 1.00 46.54 ? 4285 HOH A O   1 
HETATM 4380 O O   . HOH E 4 .   ? -20.229 59.229 59.190 1.00 39.97 ? 4286 HOH A O   1 
HETATM 4381 O O   . HOH E 4 .   ? 4.496   49.673 66.807 1.00 41.45 ? 4287 HOH A O   1 
HETATM 4382 O O   . HOH E 4 .   ? 27.115  63.311 59.206 1.00 43.32 ? 4288 HOH A O   1 
HETATM 4383 O O   . HOH E 4 .   ? 2.191   53.258 73.238 1.00 38.72 ? 4289 HOH A O   1 
HETATM 4384 O O   . HOH E 4 .   ? 4.874   47.510 62.803 1.00 40.34 ? 4290 HOH A O   1 
HETATM 4385 O O   . HOH E 4 .   ? -12.558 64.421 41.653 1.00 41.58 ? 4291 HOH A O   1 
HETATM 4386 O O   . HOH E 4 .   ? 12.610  59.522 56.884 1.00 38.29 ? 4292 HOH A O   1 
HETATM 4387 O O   . HOH E 4 .   ? -1.266  74.749 31.116 1.00 44.38 ? 4293 HOH A O   1 
HETATM 4388 O O   . HOH E 4 .   ? 13.110  58.907 79.039 1.00 46.72 ? 4294 HOH A O   1 
HETATM 4389 O O   . HOH E 4 .   ? 24.980  57.980 54.962 1.00 41.28 ? 4295 HOH A O   1 
HETATM 4390 O O   . HOH E 4 .   ? 22.559  54.010 82.577 1.00 63.83 ? 4296 HOH A O   1 
HETATM 4391 O O   . HOH E 4 .   ? 4.776   46.412 40.206 1.00 48.44 ? 4297 HOH A O   1 
HETATM 4392 O O   . HOH E 4 .   ? 11.068  70.357 33.892 1.00 43.41 ? 4298 HOH A O   1 
HETATM 4393 O O   . HOH E 4 .   ? 3.363   47.268 65.091 1.00 39.70 ? 4299 HOH A O   1 
HETATM 4394 O O   . HOH E 4 .   ? -20.171 56.660 59.531 1.00 40.17 ? 4300 HOH A O   1 
HETATM 4395 O O   . HOH E 4 .   ? -2.971  66.965 74.327 1.00 54.16 ? 4301 HOH A O   1 
HETATM 4396 O O   . HOH E 4 .   ? 0.084   70.266 68.253 1.00 46.40 ? 4302 HOH A O   1 
HETATM 4397 O O   . HOH E 4 .   ? 5.308   53.362 80.414 1.00 44.74 ? 4303 HOH A O   1 
HETATM 4398 O O   . HOH E 4 .   ? 19.137  58.496 34.948 1.00 51.84 ? 4304 HOH A O   1 
HETATM 4399 O O   . HOH E 4 .   ? 16.355  88.496 52.079 1.00 45.29 ? 4305 HOH A O   1 
HETATM 4400 O O   . HOH E 4 .   ? 13.198  86.175 46.917 1.00 48.00 ? 4306 HOH A O   1 
HETATM 4401 O O   . HOH E 4 .   ? 17.490  89.780 54.355 1.00 47.81 ? 4307 HOH A O   1 
HETATM 4402 O O   . HOH E 4 .   ? 1.651   63.827 35.218 1.00 44.10 ? 4308 HOH A O   1 
HETATM 4403 O O   . HOH E 4 .   ? 8.447   79.104 67.460 1.00 43.65 ? 4309 HOH A O   1 
HETATM 4404 O O   . HOH E 4 .   ? -0.343  58.273 32.664 1.00 40.89 ? 4310 HOH A O   1 
HETATM 4405 O O   . HOH E 4 .   ? -21.865 45.998 66.762 1.00 49.14 ? 4311 HOH A O   1 
HETATM 4406 O O   . HOH E 4 .   ? -14.343 65.187 67.042 1.00 39.74 ? 4312 HOH A O   1 
HETATM 4407 O O   . HOH E 4 .   ? 19.801  62.648 65.042 1.00 44.97 ? 4313 HOH A O   1 
HETATM 4408 O O   . HOH E 4 .   ? 18.058  79.589 46.020 1.00 50.68 ? 4314 HOH A O   1 
HETATM 4409 O O   . HOH E 4 .   ? -10.960 82.233 33.435 1.00 44.08 ? 4315 HOH A O   1 
HETATM 4410 O O   . HOH E 4 .   ? 24.961  70.262 63.037 1.00 47.32 ? 4316 HOH A O   1 
HETATM 4411 O O   . HOH E 4 .   ? 19.515  84.444 62.511 1.00 42.16 ? 4317 HOH A O   1 
HETATM 4412 O O   . HOH E 4 .   ? 5.294   65.414 32.764 1.00 48.43 ? 4318 HOH A O   1 
HETATM 4413 O O   . HOH E 4 .   ? 8.159   54.472 80.502 1.00 47.71 ? 4319 HOH A O   1 
HETATM 4414 O O   . HOH E 4 .   ? -15.537 72.318 53.979 1.00 44.57 ? 4320 HOH A O   1 
HETATM 4415 O O   . HOH E 4 .   ? -3.776  49.827 61.724 1.00 42.86 ? 4321 HOH A O   1 
HETATM 4416 O O   . HOH E 4 .   ? -7.020  50.295 49.394 1.00 45.10 ? 4322 HOH A O   1 
HETATM 4417 O O   . HOH E 4 .   ? -6.623  66.139 31.868 1.00 46.70 ? 4323 HOH A O   1 
HETATM 4418 O O   . HOH E 4 .   ? 27.307  74.689 57.725 1.00 48.93 ? 4324 HOH A O   1 
HETATM 4419 O O   . HOH E 4 .   ? 5.847   74.708 32.831 1.00 53.02 ? 4325 HOH A O   1 
HETATM 4420 O O   . HOH E 4 .   ? 1.751   94.576 43.014 1.00 50.89 ? 4326 HOH A O   1 
HETATM 4421 O O   . HOH E 4 .   ? 6.909   78.730 64.173 1.00 43.50 ? 4327 HOH A O   1 
HETATM 4422 O O   . HOH E 4 .   ? -0.014  41.322 64.047 1.00 43.30 ? 4328 HOH A O   1 
HETATM 4423 O O   . HOH E 4 .   ? 14.035  50.937 55.924 1.00 37.41 ? 4329 HOH A O   1 
HETATM 4424 O O   . HOH E 4 .   ? 14.710  64.806 83.886 1.00 50.40 ? 4330 HOH A O   1 
HETATM 4425 O O   . HOH E 4 .   ? 1.879   63.665 76.411 1.00 46.53 ? 4331 HOH A O   1 
HETATM 4426 O O   . HOH E 4 .   ? 3.189   80.897 32.237 1.00 50.01 ? 4332 HOH A O   1 
HETATM 4427 O O   . HOH E 4 .   ? 4.024   86.884 41.684 1.00 52.72 ? 4333 HOH A O   1 
HETATM 4428 O O   . HOH E 4 .   ? 4.199   77.813 78.370 1.00 50.57 ? 4334 HOH A O   1 
HETATM 4429 O O   . HOH E 4 .   ? 1.539   65.215 65.172 1.00 57.27 ? 4335 HOH A O   1 
HETATM 4430 O O   . HOH E 4 .   ? -1.364  65.989 68.130 1.00 57.46 ? 4336 HOH A O   1 
HETATM 4431 O O   . HOH E 4 .   ? 7.470   41.129 49.263 1.00 49.34 ? 4337 HOH A O   1 
HETATM 4432 O O   . HOH E 4 .   ? -14.112 71.235 65.465 1.00 49.48 ? 4338 HOH A O   1 
HETATM 4433 O O   . HOH E 4 .   ? 11.279  64.531 35.423 1.00 53.53 ? 4339 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Israel Structural Proteomics Center' 
_pdbx_SG_project.initial_of_center     ISPC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   591  591  NAG NAG A . 
C 2 NAG 1   4161 4161 NAG NAG A . 
D 3 A1E 1   1001 1001 A1E A1E A . 
E 4 HOH 1   4162 1    HOH HOH A . 
E 4 HOH 2   4163 2    HOH HOH A . 
E 4 HOH 3   4164 3    HOH HOH A . 
E 4 HOH 4   4165 4    HOH HOH A . 
E 4 HOH 5   4166 5    HOH HOH A . 
E 4 HOH 6   4167 6    HOH HOH A . 
E 4 HOH 7   4168 7    HOH HOH A . 
E 4 HOH 8   4169 8    HOH HOH A . 
E 4 HOH 9   4170 9    HOH HOH A . 
E 4 HOH 10  4171 10   HOH HOH A . 
E 4 HOH 11  4172 11   HOH HOH A . 
E 4 HOH 12  4173 12   HOH HOH A . 
E 4 HOH 13  4174 13   HOH HOH A . 
E 4 HOH 14  4175 14   HOH HOH A . 
E 4 HOH 15  4176 15   HOH HOH A . 
E 4 HOH 16  4177 16   HOH HOH A . 
E 4 HOH 17  4178 17   HOH HOH A . 
E 4 HOH 18  4179 18   HOH HOH A . 
E 4 HOH 19  4180 19   HOH HOH A . 
E 4 HOH 20  4181 20   HOH HOH A . 
E 4 HOH 21  4182 21   HOH HOH A . 
E 4 HOH 22  4183 22   HOH HOH A . 
E 4 HOH 23  4184 23   HOH HOH A . 
E 4 HOH 24  4185 24   HOH HOH A . 
E 4 HOH 25  4186 25   HOH HOH A . 
E 4 HOH 26  4187 26   HOH HOH A . 
E 4 HOH 27  4188 27   HOH HOH A . 
E 4 HOH 28  4189 28   HOH HOH A . 
E 4 HOH 29  4190 29   HOH HOH A . 
E 4 HOH 30  4191 30   HOH HOH A . 
E 4 HOH 31  4192 31   HOH HOH A . 
E 4 HOH 32  4193 32   HOH HOH A . 
E 4 HOH 33  4194 33   HOH HOH A . 
E 4 HOH 34  4195 34   HOH HOH A . 
E 4 HOH 35  4196 35   HOH HOH A . 
E 4 HOH 36  4197 36   HOH HOH A . 
E 4 HOH 37  4198 37   HOH HOH A . 
E 4 HOH 38  4199 38   HOH HOH A . 
E 4 HOH 39  4200 39   HOH HOH A . 
E 4 HOH 40  4201 40   HOH HOH A . 
E 4 HOH 41  4202 41   HOH HOH A . 
E 4 HOH 42  4203 42   HOH HOH A . 
E 4 HOH 43  4204 43   HOH HOH A . 
E 4 HOH 44  4205 44   HOH HOH A . 
E 4 HOH 45  4206 45   HOH HOH A . 
E 4 HOH 46  4207 46   HOH HOH A . 
E 4 HOH 47  4208 47   HOH HOH A . 
E 4 HOH 48  4209 48   HOH HOH A . 
E 4 HOH 49  4210 49   HOH HOH A . 
E 4 HOH 50  4211 50   HOH HOH A . 
E 4 HOH 51  4212 51   HOH HOH A . 
E 4 HOH 52  4213 52   HOH HOH A . 
E 4 HOH 53  4214 53   HOH HOH A . 
E 4 HOH 54  4215 54   HOH HOH A . 
E 4 HOH 55  4216 55   HOH HOH A . 
E 4 HOH 56  4217 56   HOH HOH A . 
E 4 HOH 57  4218 57   HOH HOH A . 
E 4 HOH 58  4219 58   HOH HOH A . 
E 4 HOH 59  4220 59   HOH HOH A . 
E 4 HOH 60  4221 60   HOH HOH A . 
E 4 HOH 61  4222 61   HOH HOH A . 
E 4 HOH 62  4223 62   HOH HOH A . 
E 4 HOH 63  4224 63   HOH HOH A . 
E 4 HOH 64  4225 64   HOH HOH A . 
E 4 HOH 65  4226 65   HOH HOH A . 
E 4 HOH 66  4227 66   HOH HOH A . 
E 4 HOH 67  4228 67   HOH HOH A . 
E 4 HOH 68  4229 68   HOH HOH A . 
E 4 HOH 69  4230 69   HOH HOH A . 
E 4 HOH 70  4231 70   HOH HOH A . 
E 4 HOH 71  4232 71   HOH HOH A . 
E 4 HOH 72  4233 72   HOH HOH A . 
E 4 HOH 73  4234 73   HOH HOH A . 
E 4 HOH 74  4235 74   HOH HOH A . 
E 4 HOH 75  4236 75   HOH HOH A . 
E 4 HOH 76  4237 76   HOH HOH A . 
E 4 HOH 77  4238 77   HOH HOH A . 
E 4 HOH 78  4239 78   HOH HOH A . 
E 4 HOH 79  4240 79   HOH HOH A . 
E 4 HOH 80  4241 80   HOH HOH A . 
E 4 HOH 81  4242 81   HOH HOH A . 
E 4 HOH 82  4243 82   HOH HOH A . 
E 4 HOH 83  4244 83   HOH HOH A . 
E 4 HOH 84  4245 84   HOH HOH A . 
E 4 HOH 85  4246 85   HOH HOH A . 
E 4 HOH 86  4247 86   HOH HOH A . 
E 4 HOH 87  4248 87   HOH HOH A . 
E 4 HOH 88  4249 88   HOH HOH A . 
E 4 HOH 89  4250 89   HOH HOH A . 
E 4 HOH 90  4251 90   HOH HOH A . 
E 4 HOH 91  4252 91   HOH HOH A . 
E 4 HOH 92  4253 92   HOH HOH A . 
E 4 HOH 93  4254 93   HOH HOH A . 
E 4 HOH 94  4255 94   HOH HOH A . 
E 4 HOH 95  4256 95   HOH HOH A . 
E 4 HOH 96  4257 96   HOH HOH A . 
E 4 HOH 97  4258 97   HOH HOH A . 
E 4 HOH 98  4259 98   HOH HOH A . 
E 4 HOH 99  4260 99   HOH HOH A . 
E 4 HOH 100 4261 100  HOH HOH A . 
E 4 HOH 101 4262 101  HOH HOH A . 
E 4 HOH 102 4263 102  HOH HOH A . 
E 4 HOH 103 4264 103  HOH HOH A . 
E 4 HOH 104 4265 104  HOH HOH A . 
E 4 HOH 105 4266 105  HOH HOH A . 
E 4 HOH 106 4267 106  HOH HOH A . 
E 4 HOH 107 4268 107  HOH HOH A . 
E 4 HOH 108 4269 108  HOH HOH A . 
E 4 HOH 109 4270 109  HOH HOH A . 
E 4 HOH 110 4271 110  HOH HOH A . 
E 4 HOH 111 4272 111  HOH HOH A . 
E 4 HOH 112 4273 112  HOH HOH A . 
E 4 HOH 113 4274 113  HOH HOH A . 
E 4 HOH 114 4275 114  HOH HOH A . 
E 4 HOH 115 4276 115  HOH HOH A . 
E 4 HOH 116 4277 116  HOH HOH A . 
E 4 HOH 117 4278 117  HOH HOH A . 
E 4 HOH 118 4279 118  HOH HOH A . 
E 4 HOH 119 4280 119  HOH HOH A . 
E 4 HOH 120 4281 120  HOH HOH A . 
E 4 HOH 121 4282 121  HOH HOH A . 
E 4 HOH 122 4283 122  HOH HOH A . 
E 4 HOH 123 4284 123  HOH HOH A . 
E 4 HOH 124 4285 124  HOH HOH A . 
E 4 HOH 125 4286 125  HOH HOH A . 
E 4 HOH 126 4287 126  HOH HOH A . 
E 4 HOH 127 4288 127  HOH HOH A . 
E 4 HOH 128 4289 128  HOH HOH A . 
E 4 HOH 129 4290 129  HOH HOH A . 
E 4 HOH 130 4291 130  HOH HOH A . 
E 4 HOH 131 4292 131  HOH HOH A . 
E 4 HOH 132 4293 132  HOH HOH A . 
E 4 HOH 133 4294 133  HOH HOH A . 
E 4 HOH 134 4295 134  HOH HOH A . 
E 4 HOH 135 4296 135  HOH HOH A . 
E 4 HOH 136 4297 136  HOH HOH A . 
E 4 HOH 137 4298 137  HOH HOH A . 
E 4 HOH 138 4299 138  HOH HOH A . 
E 4 HOH 139 4300 139  HOH HOH A . 
E 4 HOH 140 4301 140  HOH HOH A . 
E 4 HOH 141 4302 141  HOH HOH A . 
E 4 HOH 142 4303 142  HOH HOH A . 
E 4 HOH 143 4304 143  HOH HOH A . 
E 4 HOH 144 4305 144  HOH HOH A . 
E 4 HOH 145 4306 145  HOH HOH A . 
E 4 HOH 146 4307 146  HOH HOH A . 
E 4 HOH 147 4308 147  HOH HOH A . 
E 4 HOH 148 4309 148  HOH HOH A . 
E 4 HOH 149 4310 149  HOH HOH A . 
E 4 HOH 150 4311 150  HOH HOH A . 
E 4 HOH 151 4312 151  HOH HOH A . 
E 4 HOH 152 4313 152  HOH HOH A . 
E 4 HOH 153 4314 153  HOH HOH A . 
E 4 HOH 154 4315 154  HOH HOH A . 
E 4 HOH 155 4316 155  HOH HOH A . 
E 4 HOH 156 4317 156  HOH HOH A . 
E 4 HOH 157 4318 157  HOH HOH A . 
E 4 HOH 158 4319 158  HOH HOH A . 
E 4 HOH 159 4320 159  HOH HOH A . 
E 4 HOH 160 4321 160  HOH HOH A . 
E 4 HOH 161 4322 161  HOH HOH A . 
E 4 HOH 162 4323 162  HOH HOH A . 
E 4 HOH 163 4324 163  HOH HOH A . 
E 4 HOH 164 4325 164  HOH HOH A . 
E 4 HOH 165 4326 165  HOH HOH A . 
E 4 HOH 166 4327 166  HOH HOH A . 
E 4 HOH 167 4328 167  HOH HOH A . 
E 4 HOH 168 4329 168  HOH HOH A . 
E 4 HOH 169 4330 169  HOH HOH A . 
E 4 HOH 170 4331 170  HOH HOH A . 
E 4 HOH 171 4332 171  HOH HOH A . 
E 4 HOH 172 4333 172  HOH HOH A . 
E 4 HOH 173 4334 173  HOH HOH A . 
E 4 HOH 174 4335 174  HOH HOH A . 
E 4 HOH 175 4336 175  HOH HOH A . 
E 4 HOH 176 4337 176  HOH HOH A . 
E 4 HOH 177 4338 177  HOH HOH A . 
E 4 HOH 178 4339 178  HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z+1/3 -0.5000000000 -0.8660254038 0.0000000000 55.7245000000 0.8660254038 
-0.5000000000 0.0000000000 96.5176652264 0.0000000000 0.0000000000 1.0000000000 45.6983333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-08-16 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_entity_nonpoly       
5 4 'Structure model' struct_conn               
6 4 'Structure model' struct_site               
7 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'                     
2 4 'Structure model' '_chem_comp.type'                     
3 4 'Structure model' '_entity.pdbx_description'            
4 4 'Structure model' '_pdbx_entity_nonpoly.name'           
5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6 4 'Structure model' '_struct_conn.pdbx_role'              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement       1.1          ? 1 
STRATEGY 'data reduction' .            ? 2 
CCP4     'data scaling'   '(TRUNCATE)' ? 3 
XTALVIEW refinement       .            ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NE 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    349 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    4296 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.09 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A VAL 22  ? ? CA A VAL 22  ? ? C   A VAL 22  ? ? 99.28  111.40 -12.12 1.90 N 
2 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH2 A ARG 221 ? ? 116.96 120.30 -3.34  0.50 N 
3 1 NE A ARG 243 ? ? CZ A ARG 243 ? ? NH2 A ARG 243 ? ? 117.21 120.30 -3.09  0.50 N 
4 1 CB A VAL 518 ? ? CA A VAL 518 ? ? C   A VAL 518 ? ? 96.01  111.40 -15.39 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? -133.35 -157.62 
2  1 PHE A 45  ? ? 81.25   -13.59  
3  1 CYS A 94  ? ? -140.81 11.48   
4  1 SER A 108 ? ? -162.23 76.77   
5  1 SER A 200 ? ? 58.95   -124.50 
6  1 GLU A 299 ? ? -115.07 -73.54  
7  1 THR A 317 ? ? -160.99 -161.64 
8  1 ASP A 380 ? ? -157.08 52.34   
9  1 ASP A 380 ? ? -169.12 52.34   
10 1 VAL A 400 ? ? -130.48 -59.45  
11 1 ASN A 506 ? ? -160.30 -163.03 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     442 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.063 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 7   ? CD2 ? A LEU 7   CD2 
2  1 Y 1 A ILE 27  ? CD1 ? A ILE 27  CD1 
3  1 Y 1 A MET 43  ? CE  ? A MET 43  CE  
4  1 Y 1 A LYS 52  ? CD  ? A LYS 52  CD  
5  1 Y 1 A LYS 52  ? CE  ? A LYS 52  CE  
6  1 Y 1 A LYS 52  ? NZ  ? A LYS 52  NZ  
7  1 Y 1 A LYS 192 ? NZ  ? A LYS 192 NZ  
8  1 Y 1 A ARG 250 ? CZ  ? A ARG 250 CZ  
9  1 Y 1 A ARG 250 ? NH1 ? A ARG 250 NH1 
10 1 Y 1 A ARG 250 ? NH2 ? A ARG 250 NH2 
11 1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
12 1 Y 1 A GLU 261 ? OE1 ? A GLU 261 OE1 
13 1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
14 1 Y 1 A GLU 344 ? OE2 ? A GLU 344 OE2 
15 1 Y 1 A GLU 350 ? CD  ? A GLU 350 CD  
16 1 Y 1 A GLU 350 ? OE1 ? A GLU 350 OE1 
17 1 Y 1 A GLU 350 ? OE2 ? A GLU 350 OE2 
18 1 Y 1 A LYS 413 ? CD  ? A LYS 413 CD  
19 1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
20 1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
21 1 Y 1 A GLU 434 ? OE1 ? A GLU 434 OE1 
22 1 Y 1 A LYS 454 ? CG  ? A LYS 454 CG  
23 1 Y 1 A LYS 454 ? CD  ? A LYS 454 CD  
24 1 Y 1 A LYS 454 ? CE  ? A LYS 454 CE  
25 1 Y 1 A LYS 454 ? NZ  ? A LYS 454 NZ  
26 1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
27 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
28 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
29 1 Y 1 A GLU 508 ? OE1 ? A GLU 508 OE1 
30 1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
31 1 Y 1 A LYS 511 ? CD  ? A LYS 511 CD  
32 1 Y 1 A LYS 511 ? CE  ? A LYS 511 CE  
33 1 Y 1 A LYS 511 ? NZ  ? A LYS 511 NZ  
34 1 Y 1 A ARG 515 ? NH1 ? A ARG 515 NH1 
35 1 Y 1 A ARG 515 ? NH2 ? A ARG 515 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A HIS 486 ? A HIS 486 
5  1 Y 1 A SER 487 ? A SER 487 
6  1 Y 1 A GLN 488 ? A GLN 488 
7  1 Y 1 A GLU 489 ? A GLU 489 
8  1 Y 1 A ALA 536 ? A ALA 536 
9  1 Y 1 A CYS 537 ? A CYS 537 
10 1 Y 1 A ASP 538 ? A ASP 538 
11 1 Y 1 A GLY 539 ? A GLY 539 
12 1 Y 1 A GLU 540 ? A GLU 540 
13 1 Y 1 A LEU 541 ? A LEU 541 
14 1 Y 1 A SER 542 ? A SER 542 
15 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose                                                             NAG 
3 '(5R)-5-{[10-(1,2,3,4-TETRAHYDROACRIDIN-9-YLAMINO)DECYL]AMINO}-5,6,7,8-TETRAHYDROQUINOLIN-2(1H)-ONE' A1E 
4 water                                                                                                HOH 
#