data_1ZIK
# 
_entry.id   1ZIK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZIK         
WWPDB D_1000177484 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZIK 
_pdbx_database_status.recvd_initial_deposition_date   1996-10-30 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gonzalez Junior, L.' 1 
'Woolfson, D.N.'      2 
'Alber, T.'           3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Buried polar residues and structural specificity in the GCN4 leucine zipper.'                 Nat.Struct.Biol. 3   1011 
1018 1996 NSBIEW US 1072-8368 2024 ? 8946854 10.1038/nsb1296-1011 
1       'An Engineered Allosteric Switch in Leucine-Zipper Oligomerization'                            Nat.Struct.Biol. 3   510  ? 
1996 NSBIEW US 1072-8368 2024 ? ?       ?                    
2       'Crystal Structure of an Isoleucine-Zipper Trimer'                                             Nature           371 80   ? 
1994 NATUAS UK 0028-0836 0006 ? ?       ?                    
3       'A Switch between Two-, Three-, and Four-Stranded Coiled Coils in GCN4 Leucine Zipper Mutants' Science          262 1401 ? 
1993 SCIEAS US 0036-8075 0038 ? ?       ?                    
4       'X-Ray Structure of the GCN4 Leucine Zipper, a Two-Stranded, Parallel Coiled Coil'             Science          254 539  ? 
1991 SCIEAS US 0036-8075 0038 ? ?       ?                    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gonzalez Jr., L.'    1  
primary 'Woolfson, D.N.'      2  
primary 'Alber, T.'           3  
1       'Gonzalez Junior, L.' 4  
1       'Plecs, J.J.'         5  
1       'Alber, T.'           6  
2       'Harbury, P.B.'       7  
2       'Kim, P.S.'           8  
2       'Alber, T.'           9  
3       'Harbury, P.B.'       10 
3       'Zhang, T.'           11 
3       'Kim, P.S.'           12 
3       'Alber, T.'           13 
4       
;O'Shea, E.K.
;
14 
4       'Klemm, J.D.'         15 
4       'Kim, P.S.'           16 
4       'Alber, T.'           17 
# 
_cell.entry_id           1ZIK 
_cell.length_a           104.310 
_cell.length_b           30.560 
_cell.length_c           22.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.37 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZIK 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'GENERAL CONTROL PROTEIN GCN4' 4020.741 2  ? N16K ? 'THIS STRUCTURE IS IN THE DIMERIC STATE' 
2 water   nat water                          18.015   34 ? ?    ? ?                                        
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GCN4 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       RMKQLEDKVEELLSKKYHLENEVARLKKLVGER 
_entity_poly.pdbx_seq_one_letter_code_can   RMKQLEDKVEELLSKKYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ARG n 
1 2  MET n 
1 3  LYS n 
1 4  GLN n 
1 5  LEU n 
1 6  GLU n 
1 7  ASP n 
1 8  LYS n 
1 9  VAL n 
1 10 GLU n 
1 11 GLU n 
1 12 LEU n 
1 13 LEU n 
1 14 SER n 
1 15 LYS n 
1 16 LYS n 
1 17 TYR n 
1 18 HIS n 
1 19 LEU n 
1 20 GLU n 
1 21 ASN n 
1 22 GLU n 
1 23 VAL n 
1 24 ALA n 
1 25 ARG n 
1 26 LEU n 
1 27 LYS n 
1 28 LYS n 
1 29 LEU n 
1 30 VAL n 
1 31 GLY n 
1 32 GLU n 
1 33 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDA
KTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTT
SFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR
RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZIK A 1 ? 33 ? P03069 249 ? 281 ? 1 33 
2 1 1ZIK B 1 ? 33 ? P03069 249 ? 281 ? 1 33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ZIK LYS A 16 ? UNP P03069 ASN 264 ENGINEERED 16 1 
2 1ZIK LYS B 16 ? UNP P03069 ASN 264 ENGINEERED 16 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ZIK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.18 
_exptl_crystal.density_percent_sol   44. 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   1994-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'SEALED TUBE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ZIK 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   5706 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         88. 
_reflns.pdbx_Rmerge_I_obs            0.0530000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.8 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1ZIK 
_refine.ls_number_reflns_obs                     5706 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6. 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1860000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        512 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             34 
_refine_hist.number_atoms_total               546 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        6. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.1   ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1ZIK 
_struct.title                     'GCN4-LEUCINE ZIPPER CORE MUTANT ASN16LYS IN THE DIMERIC STATE' 
_struct.pdbx_descriptor           'GENERAL CONTROL PROTEIN GCN4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZIK 
_struct_keywords.pdbx_keywords   'LEUCINE ZIPPER' 
_struct_keywords.text            
'LEUCINE ZIPPER, AMINO-ACID BIOSYNTHESIS, TRANSCRIPTION REGULATION, ACTIVATOR, DNA-BINDING, NUCLEAR PROTEIN, COILED COIL' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 1 ? VAL A 30 ? ARG A 1 VAL A 30 1 ? 30 
HELX_P HELX_P2 2 ARG B 1 ? VAL B 30 ? ARG B 1 VAL B 30 1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1ZIK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZIK 
_atom_sites.fract_transf_matrix[1][1]   0.009587 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001240 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.032723 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.045156 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ARG A 1 1  ? 39.645 15.539 14.173  1.00 56.87  ? 1  ARG A N   1 
ATOM   2   C CA  . ARG A 1 1  ? 38.422 14.946 14.705  1.00 62.98  ? 1  ARG A CA  1 
ATOM   3   C C   . ARG A 1 1  ? 37.464 15.998 15.203  1.00 52.36  ? 1  ARG A C   1 
ATOM   4   O O   . ARG A 1 1  ? 36.237 15.825 15.168  1.00 46.26  ? 1  ARG A O   1 
ATOM   5   C CB  . ARG A 1 1  ? 38.561 13.774 15.690  1.00 56.60  ? 1  ARG A CB  1 
ATOM   6   C CG  . ARG A 1 1  ? 37.318 13.690 16.586  1.00 53.36  ? 1  ARG A CG  1 
ATOM   7   C CD  . ARG A 1 1  ? 36.802 12.295 16.930  1.00 100.00 ? 1  ARG A CD  1 
ATOM   8   N NE  . ARG A 1 1  ? 36.455 12.240 18.356  1.00 83.09  ? 1  ARG A NE  1 
ATOM   9   C CZ  . ARG A 1 1  ? 35.255 11.991 18.875  1.00 93.31  ? 1  ARG A CZ  1 
ATOM   10  N NH1 . ARG A 1 1  ? 34.177 11.713 18.133  1.00 72.78  ? 1  ARG A NH1 1 
ATOM   11  N NH2 . ARG A 1 1  ? 35.148 11.986 20.199  1.00 80.69  ? 1  ARG A NH2 1 
ATOM   12  N N   . MET A 1 2  ? 38.006 17.100 15.696  1.00 27.39  ? 2  MET A N   1 
ATOM   13  C CA  . MET A 1 2  ? 37.071 18.088 16.101  1.00 33.48  ? 2  MET A CA  1 
ATOM   14  C C   . MET A 1 2  ? 36.619 18.742 14.745  1.00 45.15  ? 2  MET A C   1 
ATOM   15  O O   . MET A 1 2  ? 35.422 19.040 14.476  1.00 34.80  ? 2  MET A O   1 
ATOM   16  C CB  . MET A 1 2  ? 37.704 19.033 17.134  1.00 40.02  ? 2  MET A CB  1 
ATOM   17  C CG  . MET A 1 2  ? 36.823 20.211 17.508  1.00 58.13  ? 2  MET A CG  1 
ATOM   18  S SD  . MET A 1 2  ? 35.694 19.869 18.882  1.00 78.65  ? 2  MET A SD  1 
ATOM   19  C CE  . MET A 1 2  ? 36.695 18.699 19.835  1.00 79.96  ? 2  MET A CE  1 
ATOM   20  N N   . LYS A 1 3  ? 37.623 18.908 13.853  1.00 29.33  ? 3  LYS A N   1 
ATOM   21  C CA  . LYS A 1 3  ? 37.400 19.470 12.532  1.00 40.95  ? 3  LYS A CA  1 
ATOM   22  C C   . LYS A 1 3  ? 36.453 18.596 11.713  1.00 38.13  ? 3  LYS A C   1 
ATOM   23  O O   . LYS A 1 3  ? 35.593 19.083 10.995  1.00 42.35  ? 3  LYS A O   1 
ATOM   24  C CB  . LYS A 1 3  ? 38.700 19.740 11.786  1.00 50.30  ? 3  LYS A CB  1 
ATOM   25  C CG  . LYS A 1 3  ? 38.509 19.885 10.274  1.00 72.25  ? 3  LYS A CG  1 
ATOM   26  C CD  . LYS A 1 3  ? 37.722 21.125 9.875   1.00 92.33  ? 3  LYS A CD  1 
ATOM   27  C CE  . LYS A 1 3  ? 37.984 21.561 8.442   1.00 94.36  ? 3  LYS A CE  1 
ATOM   28  N NZ  . LYS A 1 3  ? 38.292 22.995 8.344   1.00 90.16  ? 3  LYS A NZ  1 
ATOM   29  N N   . GLN A 1 4  ? 36.631 17.282 11.834  1.00 30.21  ? 4  GLN A N   1 
ATOM   30  C CA  . GLN A 1 4  ? 35.796 16.321 11.127  1.00 30.99  ? 4  GLN A CA  1 
ATOM   31  C C   . GLN A 1 4  ? 34.375 16.383 11.608  1.00 36.84  ? 4  GLN A C   1 
ATOM   32  O O   . GLN A 1 4  ? 33.460 16.153 10.842  1.00 34.53  ? 4  GLN A O   1 
ATOM   33  C CB  . GLN A 1 4  ? 36.285 14.883 11.234  1.00 29.21  ? 4  GLN A CB  1 
ATOM   34  C CG  . GLN A 1 4  ? 37.670 14.679 10.636  1.00 62.58  ? 4  GLN A CG  1 
ATOM   35  C CD  . GLN A 1 4  ? 38.082 13.252 10.905  1.00 100.00 ? 4  GLN A CD  1 
ATOM   36  O OE1 . GLN A 1 4  ? 37.266 12.333 10.698  1.00 100.00 ? 4  GLN A OE1 1 
ATOM   37  N NE2 . GLN A 1 4  ? 39.291 13.064 11.453  1.00 100.00 ? 4  GLN A NE2 1 
ATOM   38  N N   . LEU A 1 5  ? 34.180 16.706 12.892  1.00 27.98  ? 5  LEU A N   1 
ATOM   39  C CA  . LEU A 1 5  ? 32.838 16.787 13.363  1.00 31.52  ? 5  LEU A CA  1 
ATOM   40  C C   . LEU A 1 5  ? 32.228 18.088 12.860  1.00 32.25  ? 5  LEU A C   1 
ATOM   41  O O   . LEU A 1 5  ? 31.026 18.133 12.511  1.00 27.56  ? 5  LEU A O   1 
ATOM   42  C CB  . LEU A 1 5  ? 32.719 16.705 14.891  1.00 35.66  ? 5  LEU A CB  1 
ATOM   43  C CG  . LEU A 1 5  ? 32.840 15.288 15.448  1.00 38.36  ? 5  LEU A CG  1 
ATOM   44  C CD1 . LEU A 1 5  ? 33.060 15.422 16.940  1.00 31.95  ? 5  LEU A CD1 1 
ATOM   45  C CD2 . LEU A 1 5  ? 31.530 14.552 15.249  1.00 26.31  ? 5  LEU A CD2 1 
ATOM   46  N N   . GLU A 1 6  ? 33.074 19.144 12.864  1.00 25.90  ? 6  GLU A N   1 
ATOM   47  C CA  . GLU A 1 6  ? 32.639 20.460 12.395  1.00 34.67  ? 6  GLU A CA  1 
ATOM   48  C C   . GLU A 1 6  ? 32.179 20.416 10.910  1.00 23.30  ? 6  GLU A C   1 
ATOM   49  O O   . GLU A 1 6  ? 31.055 20.810 10.566  1.00 26.66  ? 6  GLU A O   1 
ATOM   50  C CB  . GLU A 1 6  ? 33.687 21.520 12.714  1.00 31.40  ? 6  GLU A CB  1 
ATOM   51  C CG  . GLU A 1 6  ? 33.529 22.121 14.165  1.00 26.98  ? 6  GLU A CG  1 
ATOM   52  C CD  . GLU A 1 6  ? 34.775 22.866 14.650  1.00 48.13  ? 6  GLU A CD  1 
ATOM   53  O OE1 . GLU A 1 6  ? 35.790 23.004 13.976  1.00 30.14  ? 6  GLU A OE1 1 
ATOM   54  O OE2 . GLU A 1 6  ? 34.646 23.373 15.858  1.00 46.61  ? 6  GLU A OE2 1 
ATOM   55  N N   . ASP A 1 7  ? 33.061 19.909 10.067  1.00 20.89  ? 7  ASP A N   1 
ATOM   56  C CA  . ASP A 1 7  ? 32.772 19.742 8.654   1.00 30.75  ? 7  ASP A CA  1 
ATOM   57  C C   . ASP A 1 7  ? 31.485 18.946 8.439   1.00 30.23  ? 7  ASP A C   1 
ATOM   58  O O   . ASP A 1 7  ? 30.720 19.174 7.509   1.00 25.10  ? 7  ASP A O   1 
ATOM   59  C CB  . ASP A 1 7  ? 33.911 18.972 7.999   1.00 28.02  ? 7  ASP A CB  1 
ATOM   60  C CG  . ASP A 1 7  ? 35.087 19.839 7.840   1.00 23.92  ? 7  ASP A CG  1 
ATOM   61  O OD1 . ASP A 1 7  ? 35.052 21.018 8.083   1.00 37.25  ? 7  ASP A OD1 1 
ATOM   62  O OD2 . ASP A 1 7  ? 36.141 19.184 7.477   1.00 46.38  ? 7  ASP A OD2 1 
ATOM   63  N N   . LYS A 1 8  ? 31.276 17.984 9.312   1.00 28.19  ? 8  LYS A N   1 
ATOM   64  C CA  . LYS A 1 8  ? 30.128 17.133 9.270   1.00 21.87  ? 8  LYS A CA  1 
ATOM   65  C C   . LYS A 1 8  ? 28.848 17.875 9.576   1.00 43.42  ? 8  LYS A C   1 
ATOM   66  O O   . LYS A 1 8  ? 27.811 17.678 8.912   1.00 33.68  ? 8  LYS A O   1 
ATOM   67  C CB  . LYS A 1 8  ? 30.320 15.872 10.086  1.00 24.86  ? 8  LYS A CB  1 
ATOM   68  C CG  . LYS A 1 8  ? 29.102 14.994 10.050  1.00 31.01  ? 8  LYS A CG  1 
ATOM   69  C CD  . LYS A 1 8  ? 29.304 13.789 9.150   1.00 47.47  ? 8  LYS A CD  1 
ATOM   70  C CE  . LYS A 1 8  ? 27.992 13.192 8.680   1.00 54.19  ? 8  LYS A CE  1 
ATOM   71  N NZ  . LYS A 1 8  ? 27.857 13.200 7.210   1.00 92.18  ? 8  LYS A NZ  1 
ATOM   72  N N   . VAL A 1 9  ? 28.909 18.765 10.569  1.00 27.19  ? 9  VAL A N   1 
ATOM   73  C CA  . VAL A 1 9  ? 27.709 19.535 10.892  1.00 25.83  ? 9  VAL A CA  1 
ATOM   74  C C   . VAL A 1 9  ? 27.381 20.443 9.645   1.00 21.40  ? 9  VAL A C   1 
ATOM   75  O O   . VAL A 1 9  ? 26.218 20.615 9.212   1.00 28.01  ? 9  VAL A O   1 
ATOM   76  C CB  . VAL A 1 9  ? 27.941 20.380 12.212  1.00 23.49  ? 9  VAL A CB  1 
ATOM   77  C CG1 . VAL A 1 9  ? 26.837 21.420 12.445  1.00 24.32  ? 9  VAL A CG1 1 
ATOM   78  C CG2 . VAL A 1 9  ? 28.040 19.493 13.445  1.00 22.69  ? 9  VAL A CG2 1 
ATOM   79  N N   . GLU A 1 10 ? 28.440 21.026 9.082   1.00 18.36  ? 10 GLU A N   1 
ATOM   80  C CA  . GLU A 1 10 ? 28.334 21.914 7.921   1.00 31.01  ? 10 GLU A CA  1 
ATOM   81  C C   . GLU A 1 10 ? 27.607 21.218 6.743   1.00 29.86  ? 10 GLU A C   1 
ATOM   82  O O   . GLU A 1 10 ? 26.574 21.687 6.199   1.00 30.53  ? 10 GLU A O   1 
ATOM   83  C CB  . GLU A 1 10 ? 29.726 22.465 7.598   1.00 23.42  ? 10 GLU A CB  1 
ATOM   84  C CG  . GLU A 1 10 ? 29.920 23.670 8.544   1.00 27.54  ? 10 GLU A CG  1 
ATOM   85  C CD  . GLU A 1 10 ? 31.324 24.031 8.910   1.00 52.32  ? 10 GLU A CD  1 
ATOM   86  O OE1 . GLU A 1 10 ? 32.300 23.691 8.283   1.00 69.79  ? 10 GLU A OE1 1 
ATOM   87  O OE2 . GLU A 1 10 ? 31.368 24.784 9.973   1.00 69.69  ? 10 GLU A OE2 1 
ATOM   88  N N   . GLU A 1 11 ? 28.130 20.040 6.418   1.00 26.99  ? 11 GLU A N   1 
ATOM   89  C CA  . GLU A 1 11 ? 27.566 19.189 5.351   1.00 22.08  ? 11 GLU A CA  1 
ATOM   90  C C   . GLU A 1 11 ? 26.077 18.934 5.541   1.00 35.37  ? 11 GLU A C   1 
ATOM   91  O O   . GLU A 1 11 ? 25.246 19.125 4.633   1.00 30.54  ? 11 GLU A O   1 
ATOM   92  C CB  . GLU A 1 11 ? 28.324 17.875 5.248   1.00 20.07  ? 11 GLU A CB  1 
ATOM   93  C CG  . GLU A 1 11 ? 27.589 16.740 4.487   1.00 33.40  ? 11 GLU A CG  1 
ATOM   94  C CD  . GLU A 1 11 ? 28.465 15.511 4.372   1.00 63.03  ? 11 GLU A CD  1 
ATOM   95  O OE1 . GLU A 1 11 ? 29.145 15.087 5.285   1.00 43.68  ? 11 GLU A OE1 1 
ATOM   96  O OE2 . GLU A 1 11 ? 28.486 14.992 3.178   1.00 48.67  ? 11 GLU A OE2 1 
ATOM   97  N N   . LEU A 1 12 ? 25.739 18.503 6.750   1.00 31.47  ? 12 LEU A N   1 
ATOM   98  C CA  . LEU A 1 12 ? 24.366 18.194 7.037   1.00 23.48  ? 12 LEU A CA  1 
ATOM   99  C C   . LEU A 1 12 ? 23.529 19.402 7.030   1.00 28.38  ? 12 LEU A C   1 
ATOM   100 O O   . LEU A 1 12 ? 22.339 19.255 6.781   1.00 21.19  ? 12 LEU A O   1 
ATOM   101 C CB  . LEU A 1 12 ? 24.099 17.377 8.349   1.00 25.58  ? 12 LEU A CB  1 
ATOM   102 C CG  . LEU A 1 12 ? 24.606 15.945 8.296   1.00 31.85  ? 12 LEU A CG  1 
ATOM   103 C CD1 . LEU A 1 12 ? 24.832 15.425 9.734   1.00 25.03  ? 12 LEU A CD1 1 
ATOM   104 C CD2 . LEU A 1 12 ? 23.506 15.103 7.652   1.00 34.20  ? 12 LEU A CD2 1 
ATOM   105 N N   . LEU A 1 13 ? 24.133 20.563 7.349   1.00 22.54  ? 13 LEU A N   1 
ATOM   106 C CA  . LEU A 1 13 ? 23.329 21.787 7.338   1.00 35.15  ? 13 LEU A CA  1 
ATOM   107 C C   . LEU A 1 13 ? 22.884 22.065 5.863   1.00 32.29  ? 13 LEU A C   1 
ATOM   108 O O   . LEU A 1 13 ? 21.698 22.326 5.526   1.00 28.18  ? 13 LEU A O   1 
ATOM   109 C CB  . LEU A 1 13 ? 24.117 22.984 7.918   1.00 25.82  ? 13 LEU A CB  1 
ATOM   110 C CG  . LEU A 1 13 ? 23.304 24.253 7.962   1.00 19.45  ? 13 LEU A CG  1 
ATOM   111 C CD1 . LEU A 1 13 ? 22.036 24.057 8.767   1.00 19.86  ? 13 LEU A CD1 1 
ATOM   112 C CD2 . LEU A 1 13 ? 24.146 25.309 8.638   1.00 52.18  ? 13 LEU A CD2 1 
ATOM   113 N N   . SER A 1 14 ? 23.893 21.978 4.998   1.00 22.02  ? 14 SER A N   1 
ATOM   114 C CA  . SER A 1 14 ? 23.732 22.148 3.572   1.00 33.72  ? 14 SER A CA  1 
ATOM   115 C C   . SER A 1 14 ? 22.617 21.187 3.062   1.00 38.59  ? 14 SER A C   1 
ATOM   116 O O   . SER A 1 14 ? 21.563 21.564 2.527   1.00 31.02  ? 14 SER A O   1 
ATOM   117 C CB  . SER A 1 14 ? 25.054 21.749 2.945   1.00 25.82  ? 14 SER A CB  1 
ATOM   118 O OG  . SER A 1 14 ? 25.039 22.123 1.597   1.00 67.81  ? 14 SER A OG  1 
ATOM   119 N N   . LYS A 1 15 ? 22.850 19.899 3.227   1.00 24.62  ? 15 LYS A N   1 
ATOM   120 C CA  . LYS A 1 15 ? 21.831 18.972 2.791   1.00 25.13  ? 15 LYS A CA  1 
ATOM   121 C C   . LYS A 1 15 ? 20.490 19.346 3.387   1.00 31.38  ? 15 LYS A C   1 
ATOM   122 O O   . LYS A 1 15 ? 19.398 19.302 2.801   1.00 27.40  ? 15 LYS A O   1 
ATOM   123 C CB  . LYS A 1 15 ? 22.173 17.532 3.148   1.00 22.22  ? 15 LYS A CB  1 
ATOM   124 C CG  . LYS A 1 15 ? 23.583 17.105 2.741   1.00 50.41  ? 15 LYS A CG  1 
ATOM   125 C CD  . LYS A 1 15 ? 23.602 15.716 2.095   1.00 64.74  ? 15 LYS A CD  1 
ATOM   126 C CE  . LYS A 1 15 ? 24.793 14.855 2.483   1.00 53.83  ? 15 LYS A CE  1 
ATOM   127 N NZ  . LYS A 1 15 ? 24.851 13.601 1.700   1.00 56.82  ? 15 LYS A NZ  1 
ATOM   128 N N   . LYS A 1 16 ? 20.514 19.734 4.617   1.00 24.55  ? 16 LYS A N   1 
ATOM   129 C CA  . LYS A 1 16 ? 19.240 20.066 5.156   1.00 16.11  ? 16 LYS A CA  1 
ATOM   130 C C   . LYS A 1 16 ? 18.618 21.250 4.420   1.00 28.51  ? 16 LYS A C   1 
ATOM   131 O O   . LYS A 1 16 ? 17.407 21.306 4.216   1.00 28.77  ? 16 LYS A O   1 
ATOM   132 C CB  . LYS A 1 16 ? 19.318 20.447 6.630   1.00 46.62  ? 16 LYS A CB  1 
ATOM   133 C CG  . LYS A 1 16 ? 17.934 20.749 7.184   1.00 33.37  ? 16 LYS A CG  1 
ATOM   134 C CD  . LYS A 1 16 ? 17.962 21.073 8.655   1.00 45.50  ? 16 LYS A CD  1 
ATOM   135 C CE  . LYS A 1 16 ? 18.275 22.532 8.866   1.00 38.64  ? 16 LYS A CE  1 
ATOM   136 N NZ  . LYS A 1 16 ? 17.154 23.266 9.490   1.00 55.05  ? 16 LYS A NZ  1 
ATOM   137 N N   . TYR A 1 17 ? 19.440 22.232 4.072   1.00 23.06  ? 17 TYR A N   1 
ATOM   138 C CA  . TYR A 1 17 ? 18.855 23.425 3.437   1.00 27.07  ? 17 TYR A CA  1 
ATOM   139 C C   . TYR A 1 17 ? 18.194 23.121 2.090   1.00 34.76  ? 17 TYR A C   1 
ATOM   140 O O   . TYR A 1 17 ? 17.131 23.673 1.690   1.00 34.83  ? 17 TYR A O   1 
ATOM   141 C CB  . TYR A 1 17 ? 19.858 24.584 3.442   1.00 25.92  ? 17 TYR A CB  1 
ATOM   142 C CG  . TYR A 1 17 ? 19.910 25.373 4.757   1.00 15.40  ? 17 TYR A CG  1 
ATOM   143 C CD1 . TYR A 1 17 ? 18.780 25.542 5.559   1.00 16.51  ? 17 TYR A CD1 1 
ATOM   144 C CD2 . TYR A 1 17 ? 21.094 26.009 5.137   1.00 27.31  ? 17 TYR A CD2 1 
ATOM   145 C CE1 . TYR A 1 17 ? 18.832 26.280 6.736   1.00 24.80  ? 17 TYR A CE1 1 
ATOM   146 C CE2 . TYR A 1 17 ? 21.169 26.750 6.312   1.00 34.94  ? 17 TYR A CE2 1 
ATOM   147 C CZ  . TYR A 1 17 ? 20.037 26.882 7.109   1.00 25.60  ? 17 TYR A CZ  1 
ATOM   148 O OH  . TYR A 1 17 ? 20.120 27.615 8.260   1.00 48.28  ? 17 TYR A OH  1 
ATOM   149 N N   . HIS A 1 18 ? 18.862 22.195 1.400   1.00 34.42  ? 18 HIS A N   1 
ATOM   150 C CA  . HIS A 1 18 ? 18.442 21.708 0.088   1.00 37.17  ? 18 HIS A CA  1 
ATOM   151 C C   . HIS A 1 18 ? 17.066 21.070 0.196   1.00 41.37  ? 18 HIS A C   1 
ATOM   152 O O   . HIS A 1 18 ? 16.145 21.370 -0.550  1.00 39.40  ? 18 HIS A O   1 
ATOM   153 C CB  . HIS A 1 18 ? 19.465 20.704 -0.479  1.00 41.97  ? 18 HIS A CB  1 
ATOM   154 C CG  . HIS A 1 18 ? 18.987 20.186 -1.801  1.00 65.52  ? 18 HIS A CG  1 
ATOM   155 N ND1 . HIS A 1 18 ? 17.978 19.229 -1.890  1.00 75.15  ? 18 HIS A ND1 1 
ATOM   156 C CD2 . HIS A 1 18 ? 19.368 20.522 -3.068  1.00 79.00  ? 18 HIS A CD2 1 
ATOM   157 C CE1 . HIS A 1 18 ? 17.783 18.996 -3.181  1.00 79.22  ? 18 HIS A CE1 1 
ATOM   158 N NE2 . HIS A 1 18 ? 18.603 19.755 -3.913  1.00 81.41  ? 18 HIS A NE2 1 
ATOM   159 N N   . LEU A 1 19 ? 16.940 20.185 1.176   1.00 24.62  ? 19 LEU A N   1 
ATOM   160 C CA  . LEU A 1 19 ? 15.732 19.489 1.448   1.00 26.02  ? 19 LEU A CA  1 
ATOM   161 C C   . LEU A 1 19 ? 14.615 20.422 1.783   1.00 32.44  ? 19 LEU A C   1 
ATOM   162 O O   . LEU A 1 19 ? 13.492 20.190 1.396   1.00 30.06  ? 19 LEU A O   1 
ATOM   163 C CB  . LEU A 1 19 ? 15.907 18.378 2.510   1.00 34.10  ? 19 LEU A CB  1 
ATOM   164 C CG  . LEU A 1 19 ? 16.676 17.170 1.940   1.00 37.98  ? 19 LEU A CG  1 
ATOM   165 C CD1 . LEU A 1 19 ? 17.238 16.231 3.040   1.00 25.37  ? 19 LEU A CD1 1 
ATOM   166 C CD2 . LEU A 1 19 ? 15.684 16.408 1.090   1.00 34.67  ? 19 LEU A CD2 1 
ATOM   167 N N   . GLU A 1 20 ? 14.890 21.482 2.504   1.00 22.80  ? 20 GLU A N   1 
ATOM   168 C CA  . GLU A 1 20 ? 13.806 22.402 2.824   1.00 32.18  ? 20 GLU A CA  1 
ATOM   169 C C   . GLU A 1 20 ? 13.400 23.260 1.581   1.00 26.25  ? 20 GLU A C   1 
ATOM   170 O O   . GLU A 1 20 ? 12.234 23.588 1.406   1.00 34.52  ? 20 GLU A O   1 
ATOM   171 C CB  . GLU A 1 20 ? 14.096 23.288 4.059   1.00 34.35  ? 20 GLU A CB  1 
ATOM   172 C CG  . GLU A 1 20 ? 14.349 22.506 5.352   1.00 39.81  ? 20 GLU A CG  1 
ATOM   173 C CD  . GLU A 1 20 ? 14.622 23.361 6.567   1.00 41.99  ? 20 GLU A CD  1 
ATOM   174 O OE1 . GLU A 1 20 ? 15.318 24.367 6.525   1.00 36.75  ? 20 GLU A OE1 1 
ATOM   175 O OE2 . GLU A 1 20 ? 14.093 22.845 7.673   1.00 47.98  ? 20 GLU A OE2 1 
ATOM   176 N N   . ASN A 1 21 ? 14.372 23.611 0.736   1.00 22.61  ? 21 ASN A N   1 
ATOM   177 C CA  . ASN A 1 21 ? 14.060 24.363 -0.464  1.00 26.96  ? 21 ASN A CA  1 
ATOM   178 C C   . ASN A 1 21 ? 13.082 23.497 -1.325  1.00 42.86  ? 21 ASN A C   1 
ATOM   179 O O   . ASN A 1 21 ? 12.011 23.921 -1.768  1.00 45.97  ? 21 ASN A O   1 
ATOM   180 C CB  . ASN A 1 21 ? 15.386 24.635 -1.190  1.00 21.30  ? 21 ASN A CB  1 
ATOM   181 C CG  . ASN A 1 21 ? 16.184 25.665 -0.392  1.00 29.85  ? 21 ASN A CG  1 
ATOM   182 O OD1 . ASN A 1 21 ? 15.666 26.213 0.559   1.00 28.65  ? 21 ASN A OD1 1 
ATOM   183 N ND2 . ASN A 1 21 ? 17.422 25.947 -0.755  1.00 19.26  ? 21 ASN A ND2 1 
ATOM   184 N N   . GLU A 1 22 ? 13.445 22.243 -1.543  1.00 32.42  ? 22 GLU A N   1 
ATOM   185 C CA  . GLU A 1 22 ? 12.646 21.309 -2.321  1.00 32.51  ? 22 GLU A CA  1 
ATOM   186 C C   . GLU A 1 22 ? 11.245 21.181 -1.795  1.00 34.02  ? 22 GLU A C   1 
ATOM   187 O O   . GLU A 1 22 ? 10.282 21.135 -2.537  1.00 41.27  ? 22 GLU A O   1 
ATOM   188 C CB  . GLU A 1 22 ? 13.263 19.895 -2.381  1.00 33.94  ? 22 GLU A CB  1 
ATOM   189 C CG  . GLU A 1 22 ? 14.318 19.635 -3.471  1.00 68.98  ? 22 GLU A CG  1 
ATOM   190 C CD  . GLU A 1 22 ? 13.740 19.298 -4.826  1.00 100.00 ? 22 GLU A CD  1 
ATOM   191 O OE1 . GLU A 1 22 ? 13.072 18.300 -5.053  1.00 70.94  ? 22 GLU A OE1 1 
ATOM   192 O OE2 . GLU A 1 22 ? 14.073 20.174 -5.746  1.00 100.00 ? 22 GLU A OE2 1 
ATOM   193 N N   . VAL A 1 23 ? 11.117 21.104 -0.496  1.00 36.78  ? 23 VAL A N   1 
ATOM   194 C CA  . VAL A 1 23 ? 9.803  20.947 0.083   1.00 39.90  ? 23 VAL A CA  1 
ATOM   195 C C   . VAL A 1 23 ? 8.962  22.170 -0.192  1.00 54.86  ? 23 VAL A C   1 
ATOM   196 O O   . VAL A 1 23 ? 7.753  22.053 -0.373  1.00 56.67  ? 23 VAL A O   1 
ATOM   197 C CB  . VAL A 1 23 ? 9.815  20.601 1.592   1.00 43.20  ? 23 VAL A CB  1 
ATOM   198 C CG1 . VAL A 1 23 ? 8.396  20.430 2.137   1.00 34.12  ? 23 VAL A CG1 1 
ATOM   199 C CG2 . VAL A 1 23 ? 10.581 19.303 1.838   1.00 46.24  ? 23 VAL A CG2 1 
ATOM   200 N N   . ALA A 1 24 ? 9.619  23.343 -0.223  1.00 49.33  ? 24 ALA A N   1 
ATOM   201 C CA  . ALA A 1 24 ? 8.933  24.611 -0.462  1.00 41.80  ? 24 ALA A CA  1 
ATOM   202 C C   . ALA A 1 24 ? 8.262  24.594 -1.816  1.00 53.51  ? 24 ALA A C   1 
ATOM   203 O O   . ALA A 1 24 ? 7.085  24.893 -2.018  1.00 45.93  ? 24 ALA A O   1 
ATOM   204 C CB  . ALA A 1 24 ? 9.937  25.732 -0.408  1.00 34.25  ? 24 ALA A CB  1 
ATOM   205 N N   . ARG A 1 25 ? 9.102  24.188 -2.721  1.00 47.27  ? 25 ARG A N   1 
ATOM   206 C CA  . ARG A 1 25 ? 8.801  24.050 -4.098  1.00 51.66  ? 25 ARG A CA  1 
ATOM   207 C C   . ARG A 1 25 ? 7.647  23.107 -4.361  1.00 63.21  ? 25 ARG A C   1 
ATOM   208 O O   . ARG A 1 25 ? 6.806  23.440 -5.204  1.00 62.96  ? 25 ARG A O   1 
ATOM   209 C CB  . ARG A 1 25 ? 10.053 23.571 -4.814  1.00 39.52  ? 25 ARG A CB  1 
ATOM   210 C CG  . ARG A 1 25 ? 9.833  23.375 -6.296  1.00 36.97  ? 25 ARG A CG  1 
ATOM   211 C CD  . ARG A 1 25 ? 10.982 22.631 -6.932  1.00 37.61  ? 25 ARG A CD  1 
ATOM   212 N NE  . ARG A 1 25 ? 10.978 21.216 -6.598  1.00 57.09  ? 25 ARG A NE  1 
ATOM   213 C CZ  . ARG A 1 25 ? 10.278 20.314 -7.265  1.00 68.27  ? 25 ARG A CZ  1 
ATOM   214 N NH1 . ARG A 1 25 ? 9.508  20.663 -8.295  1.00 57.67  ? 25 ARG A NH1 1 
ATOM   215 N NH2 . ARG A 1 25 ? 10.348 19.034 -6.889  1.00 62.47  ? 25 ARG A NH2 1 
ATOM   216 N N   . LEU A 1 26 ? 7.643  21.936 -3.659  1.00 46.37  ? 26 LEU A N   1 
ATOM   217 C CA  . LEU A 1 26 ? 6.606  20.916 -3.830  1.00 36.19  ? 26 LEU A CA  1 
ATOM   218 C C   . LEU A 1 26 ? 5.341  21.377 -3.161  1.00 45.07  ? 26 LEU A C   1 
ATOM   219 O O   . LEU A 1 26 ? 4.215  21.074 -3.592  1.00 48.17  ? 26 LEU A O   1 
ATOM   220 C CB  . LEU A 1 26 ? 7.009  19.496 -3.357  1.00 34.47  ? 26 LEU A CB  1 
ATOM   221 C CG  . LEU A 1 26 ? 8.138  18.832 -4.136  1.00 46.28  ? 26 LEU A CG  1 
ATOM   222 C CD1 . LEU A 1 26 ? 8.592  17.578 -3.397  1.00 60.32  ? 26 LEU A CD1 1 
ATOM   223 C CD2 . LEU A 1 26 ? 7.692  18.421 -5.522  1.00 34.26  ? 26 LEU A CD2 1 
ATOM   224 N N   . LYS A 1 27 ? 5.556  22.149 -2.099  1.00 55.59  ? 27 LYS A N   1 
ATOM   225 C CA  . LYS A 1 27 ? 4.457  22.699 -1.328  1.00 66.35  ? 27 LYS A CA  1 
ATOM   226 C C   . LYS A 1 27 ? 3.761  23.786 -2.134  1.00 92.53  ? 27 LYS A C   1 
ATOM   227 O O   . LYS A 1 27 ? 2.669  24.254 -1.798  1.00 100.00 ? 27 LYS A O   1 
ATOM   228 C CB  . LYS A 1 27 ? 4.853  23.169 0.077   1.00 64.22  ? 27 LYS A CB  1 
ATOM   229 C CG  . LYS A 1 27 ? 4.146  22.407 1.193   1.00 46.16  ? 27 LYS A CG  1 
ATOM   230 C CD  . LYS A 1 27 ? 4.819  22.545 2.561   1.00 54.57  ? 27 LYS A CD  1 
ATOM   231 C CE  . LYS A 1 27 ? 5.202  21.204 3.207   1.00 100.00 ? 27 LYS A CE  1 
ATOM   232 N NZ  . LYS A 1 27 ? 4.532  20.870 4.490   1.00 49.77  ? 27 LYS A NZ  1 
ATOM   233 N N   . LYS A 1 28 ? 4.408  24.184 -3.226  1.00 82.98  ? 28 LYS A N   1 
ATOM   234 C CA  . LYS A 1 28 ? 3.835  25.199 -4.062  1.00 73.43  ? 28 LYS A CA  1 
ATOM   235 C C   . LYS A 1 28 ? 3.133  24.644 -5.298  1.00 77.08  ? 28 LYS A C   1 
ATOM   236 O O   . LYS A 1 28 ? 2.441  25.368 -5.999  1.00 81.51  ? 28 LYS A O   1 
ATOM   237 C CB  . LYS A 1 28 ? 4.708  26.428 -4.221  1.00 75.68  ? 28 LYS A CB  1 
ATOM   238 C CG  . LYS A 1 28 ? 5.055  27.039 -2.854  1.00 100.00 ? 28 LYS A CG  1 
ATOM   239 C CD  . LYS A 1 28 ? 5.912  28.305 -2.898  1.00 100.00 ? 28 LYS A CD  1 
ATOM   240 C CE  . LYS A 1 28 ? 7.125  28.261 -1.966  1.00 83.46  ? 28 LYS A CE  1 
ATOM   241 N NZ  . LYS A 1 28 ? 8.401  28.599 -2.636  1.00 79.77  ? 28 LYS A NZ  1 
ATOM   242 N N   . LEU A 1 29 ? 3.296  23.331 -5.519  1.00 61.52  ? 29 LEU A N   1 
ATOM   243 C CA  . LEU A 1 29 ? 2.690  22.589 -6.608  1.00 54.83  ? 29 LEU A CA  1 
ATOM   244 C C   . LEU A 1 29 ? 1.519  21.817 -6.084  1.00 64.69  ? 29 LEU A C   1 
ATOM   245 O O   . LEU A 1 29 ? 0.984  20.987 -6.795  1.00 73.80  ? 29 LEU A O   1 
ATOM   246 C CB  . LEU A 1 29 ? 3.590  21.423 -7.040  1.00 52.17  ? 29 LEU A CB  1 
ATOM   247 C CG  . LEU A 1 29 ? 4.890  21.808 -7.696  1.00 58.81  ? 29 LEU A CG  1 
ATOM   248 C CD1 . LEU A 1 29 ? 5.489  20.579 -8.391  1.00 48.47  ? 29 LEU A CD1 1 
ATOM   249 C CD2 . LEU A 1 29 ? 4.650  22.961 -8.654  1.00 62.95  ? 29 LEU A CD2 1 
ATOM   250 N N   . VAL A 1 30 ? 1.171  22.036 -4.827  1.00 62.60  ? 30 VAL A N   1 
ATOM   251 C CA  . VAL A 1 30 ? 0.097  21.302 -4.166  1.00 77.09  ? 30 VAL A CA  1 
ATOM   252 C C   . VAL A 1 30 ? -1.318 21.803 -4.455  1.00 100.00 ? 30 VAL A C   1 
ATOM   253 O O   . VAL A 1 30 ? -2.216 21.013 -4.825  1.00 87.18  ? 30 VAL A O   1 
ATOM   254 C CB  . VAL A 1 30 ? 0.398  21.041 -2.679  1.00 77.53  ? 30 VAL A CB  1 
ATOM   255 C CG1 . VAL A 1 30 ? -0.875 20.719 -1.899  1.00 78.44  ? 30 VAL A CG1 1 
ATOM   256 C CG2 . VAL A 1 30 ? 1.420  19.910 -2.531  1.00 70.59  ? 30 VAL A CG2 1 
ATOM   257 N N   . ARG B 1 1  ? 31.812 21.548 22.497  1.00 70.45  ? 1  ARG B N   1 
ATOM   258 C CA  . ARG B 1 1  ? 32.863 20.565 22.665  1.00 60.60  ? 1  ARG B CA  1 
ATOM   259 C C   . ARG B 1 1  ? 32.583 19.262 21.884  1.00 45.81  ? 1  ARG B C   1 
ATOM   260 O O   . ARG B 1 1  ? 31.535 19.152 21.237  1.00 49.92  ? 1  ARG B O   1 
ATOM   261 C CB  . ARG B 1 1  ? 33.268 20.423 24.138  1.00 61.68  ? 1  ARG B CB  1 
ATOM   262 C CG  . ARG B 1 1  ? 32.444 19.442 24.968  1.00 39.90  ? 1  ARG B CG  1 
ATOM   263 C CD  . ARG B 1 1  ? 30.979 19.397 24.626  1.00 30.11  ? 1  ARG B CD  1 
ATOM   264 N NE  . ARG B 1 1  ? 30.284 18.512 25.552  1.00 78.54  ? 1  ARG B NE  1 
ATOM   265 C CZ  . ARG B 1 1  ? 29.551 18.874 26.609  1.00 90.82  ? 1  ARG B CZ  1 
ATOM   266 N NH1 . ARG B 1 1  ? 29.339 20.149 26.978  1.00 51.58  ? 1  ARG B NH1 1 
ATOM   267 N NH2 . ARG B 1 1  ? 29.000 17.907 27.336  1.00 97.65  ? 1  ARG B NH2 1 
ATOM   268 N N   . MET B 1 2  ? 33.516 18.282 21.911  1.00 34.91  ? 2  MET B N   1 
ATOM   269 C CA  . MET B 1 2  ? 33.335 17.016 21.181  1.00 36.96  ? 2  MET B CA  1 
ATOM   270 C C   . MET B 1 2  ? 31.909 16.453 21.231  1.00 48.85  ? 2  MET B C   1 
ATOM   271 O O   . MET B 1 2  ? 31.266 16.160 20.206  1.00 38.07  ? 2  MET B O   1 
ATOM   272 C CB  . MET B 1 2  ? 34.349 15.958 21.583  1.00 34.78  ? 2  MET B CB  1 
ATOM   273 C CG  . MET B 1 2  ? 34.729 15.068 20.441  1.00 50.94  ? 2  MET B CG  1 
ATOM   274 S SD  . MET B 1 2  ? 36.239 15.640 19.663  1.00 74.01  ? 2  MET B SD  1 
ATOM   275 C CE  . MET B 1 2  ? 35.570 16.453 18.197  1.00 77.37  ? 2  MET B CE  1 
ATOM   276 N N   . LYS B 1 3  ? 31.424 16.312 22.457  1.00 30.93  ? 3  LYS B N   1 
ATOM   277 C CA  . LYS B 1 3  ? 30.118 15.795 22.713  1.00 26.69  ? 3  LYS B CA  1 
ATOM   278 C C   . LYS B 1 3  ? 28.958 16.666 22.182  1.00 36.04  ? 3  LYS B C   1 
ATOM   279 O O   . LYS B 1 3  ? 27.926 16.133 21.730  1.00 32.73  ? 3  LYS B O   1 
ATOM   280 C CB  . LYS B 1 3  ? 29.943 15.279 24.145  1.00 27.91  ? 3  LYS B CB  1 
ATOM   281 C CG  . LYS B 1 3  ? 28.626 14.535 24.314  1.00 59.15  ? 3  LYS B CG  1 
ATOM   282 C CD  . LYS B 1 3  ? 28.356 14.234 25.774  1.00 100.00 ? 3  LYS B CD  1 
ATOM   283 C CE  . LYS B 1 3  ? 27.503 12.999 26.024  1.00 100.00 ? 3  LYS B CE  1 
ATOM   284 N NZ  . LYS B 1 3  ? 27.363 12.689 27.465  1.00 100.00 ? 3  LYS B NZ  1 
ATOM   285 N N   . GLN B 1 4  ? 29.097 18.003 22.237  1.00 29.70  ? 4  GLN B N   1 
ATOM   286 C CA  . GLN B 1 4  ? 28.025 18.882 21.716  1.00 42.44  ? 4  GLN B CA  1 
ATOM   287 C C   . GLN B 1 4  ? 27.865 18.673 20.187  1.00 28.96  ? 4  GLN B C   1 
ATOM   288 O O   . GLN B 1 4  ? 26.757 18.541 19.650  1.00 32.99  ? 4  GLN B O   1 
ATOM   289 C CB  . GLN B 1 4  ? 28.343 20.392 21.895  1.00 38.71  ? 4  GLN B CB  1 
ATOM   290 C CG  . GLN B 1 4  ? 28.012 21.017 23.254  1.00 92.15  ? 4  GLN B CG  1 
ATOM   291 C CD  . GLN B 1 4  ? 28.984 22.163 23.527  1.00 100.00 ? 4  GLN B CD  1 
ATOM   292 O OE1 . GLN B 1 4  ? 29.239 22.520 24.696  1.00 100.00 ? 4  GLN B OE1 1 
ATOM   293 N NE2 . GLN B 1 4  ? 29.570 22.725 22.448  1.00 76.68  ? 4  GLN B NE2 1 
ATOM   294 N N   . LEU B 1 5  ? 29.045 18.703 19.535  1.00 26.37  ? 5  LEU B N   1 
ATOM   295 C CA  . LEU B 1 5  ? 29.184 18.538 18.124  1.00 22.39  ? 5  LEU B CA  1 
ATOM   296 C C   . LEU B 1 5  ? 28.546 17.212 17.774  1.00 39.92  ? 5  LEU B C   1 
ATOM   297 O O   . LEU B 1 5  ? 27.768 17.192 16.828  1.00 39.59  ? 5  LEU B O   1 
ATOM   298 C CB  . LEU B 1 5  ? 30.656 18.662 17.666  1.00 25.48  ? 5  LEU B CB  1 
ATOM   299 C CG  . LEU B 1 5  ? 31.254 20.117 17.645  1.00 27.16  ? 5  LEU B CG  1 
ATOM   300 C CD1 . LEU B 1 5  ? 32.730 20.073 17.251  1.00 20.94  ? 5  LEU B CD1 1 
ATOM   301 C CD2 . LEU B 1 5  ? 30.579 20.981 16.587  1.00 33.85  ? 5  LEU B CD2 1 
ATOM   302 N N   . GLU B 1 6  ? 28.824 16.127 18.573  1.00 22.57  ? 6  GLU B N   1 
ATOM   303 C CA  . GLU B 1 6  ? 28.246 14.830 18.298  1.00 16.22  ? 6  GLU B CA  1 
ATOM   304 C C   . GLU B 1 6  ? 26.790 14.888 18.399  1.00 22.11  ? 6  GLU B C   1 
ATOM   305 O O   . GLU B 1 6  ? 26.057 14.269 17.644  1.00 24.59  ? 6  GLU B O   1 
ATOM   306 C CB  . GLU B 1 6  ? 28.800 13.670 19.135  1.00 14.00  ? 6  GLU B CB  1 
ATOM   307 C CG  . GLU B 1 6  ? 30.292 13.422 18.828  1.00 16.11  ? 6  GLU B CG  1 
ATOM   308 C CD  . GLU B 1 6  ? 30.870 12.595 19.949  1.00 52.41  ? 6  GLU B CD  1 
ATOM   309 O OE1 . GLU B 1 6  ? 30.207 12.224 20.891  1.00 23.38  ? 6  GLU B OE1 1 
ATOM   310 O OE2 . GLU B 1 6  ? 32.115 12.293 19.803  1.00 35.80  ? 6  GLU B OE2 1 
ATOM   311 N N   . ASP B 1 7  ? 26.343 15.679 19.327  1.00 19.59  ? 7  ASP B N   1 
ATOM   312 C CA  . ASP B 1 7  ? 24.887 15.813 19.510  1.00 25.54  ? 7  ASP B CA  1 
ATOM   313 C C   . ASP B 1 7  ? 24.205 16.596 18.349  1.00 33.11  ? 7  ASP B C   1 
ATOM   314 O O   . ASP B 1 7  ? 23.047 16.313 17.972  1.00 25.97  ? 7  ASP B O   1 
ATOM   315 C CB  . ASP B 1 7  ? 24.545 16.511 20.857  1.00 38.83  ? 7  ASP B CB  1 
ATOM   316 C CG  . ASP B 1 7  ? 24.727 15.615 22.053  1.00 47.65  ? 7  ASP B CG  1 
ATOM   317 O OD1 . ASP B 1 7  ? 25.121 14.475 21.965  1.00 41.82  ? 7  ASP B OD1 1 
ATOM   318 O OD2 . ASP B 1 7  ? 24.417 16.177 23.179  1.00 55.62  ? 7  ASP B OD2 1 
ATOM   319 N N   . LYS B 1 8  ? 24.926 17.606 17.821  1.00 20.60  ? 8  LYS B N   1 
ATOM   320 C CA  . LYS B 1 8  ? 24.442 18.459 16.694  1.00 20.67  ? 8  LYS B CA  1 
ATOM   321 C C   . LYS B 1 8  ? 24.287 17.522 15.445  1.00 24.36  ? 8  LYS B C   1 
ATOM   322 O O   . LYS B 1 8  ? 23.232 17.401 14.876  1.00 27.60  ? 8  LYS B O   1 
ATOM   323 C CB  . LYS B 1 8  ? 25.405 19.564 16.429  1.00 18.31  ? 8  LYS B CB  1 
ATOM   324 C CG  . LYS B 1 8  ? 24.851 20.580 15.446  1.00 31.95  ? 8  LYS B CG  1 
ATOM   325 C CD  . LYS B 1 8  ? 23.556 21.193 15.925  1.00 36.57  ? 8  LYS B CD  1 
ATOM   326 C CE  . LYS B 1 8  ? 23.223 22.525 15.264  1.00 47.30  ? 8  LYS B CE  1 
ATOM   327 N NZ  . LYS B 1 8  ? 21.778 22.664 15.042  1.00 62.34  ? 8  LYS B NZ  1 
ATOM   328 N N   . VAL B 1 9  ? 25.335 16.797 15.097  1.00 23.44  ? 9  VAL B N   1 
ATOM   329 C CA  . VAL B 1 9  ? 25.259 15.821 14.012  1.00 26.02  ? 9  VAL B CA  1 
ATOM   330 C C   . VAL B 1 9  ? 24.012 14.900 14.160  1.00 30.45  ? 9  VAL B C   1 
ATOM   331 O O   . VAL B 1 9  ? 23.241 14.763 13.237  1.00 28.22  ? 9  VAL B O   1 
ATOM   332 C CB  . VAL B 1 9  ? 26.533 14.963 13.876  1.00 21.36  ? 9  VAL B CB  1 
ATOM   333 C CG1 . VAL B 1 9  ? 26.331 13.832 12.871  1.00 25.28  ? 9  VAL B CG1 1 
ATOM   334 C CG2 . VAL B 1 9  ? 27.776 15.749 13.525  1.00 18.21  ? 9  VAL B CG2 1 
ATOM   335 N N   . GLU B 1 10 ? 23.761 14.273 15.319  1.00 22.00  ? 10 GLU B N   1 
ATOM   336 C CA  . GLU B 1 10 ? 22.627 13.392 15.455  1.00 22.51  ? 10 GLU B CA  1 
ATOM   337 C C   . GLU B 1 10 ? 21.309 14.068 15.259  1.00 29.83  ? 10 GLU B C   1 
ATOM   338 O O   . GLU B 1 10 ? 20.345 13.504 14.752  1.00 33.70  ? 10 GLU B O   1 
ATOM   339 C CB  . GLU B 1 10 ? 22.636 12.576 16.791  1.00 18.64  ? 10 GLU B CB  1 
ATOM   340 C CG  . GLU B 1 10 ? 23.936 11.753 16.837  1.00 28.51  ? 10 GLU B CG  1 
ATOM   341 C CD  . GLU B 1 10 ? 24.339 11.394 18.253  1.00 100.00 ? 10 GLU B CD  1 
ATOM   342 O OE1 . GLU B 1 10 ? 23.707 11.729 19.233  1.00 35.77  ? 10 GLU B OE1 1 
ATOM   343 O OE2 . GLU B 1 10 ? 25.440 10.682 18.328  1.00 100.00 ? 10 GLU B OE2 1 
ATOM   344 N N   . GLU B 1 11 ? 21.248 15.277 15.710  1.00 28.62  ? 11 GLU B N   1 
ATOM   345 C CA  . GLU B 1 11 ? 19.998 16.024 15.611  1.00 33.77  ? 11 GLU B CA  1 
ATOM   346 C C   . GLU B 1 11 ? 19.706 16.452 14.176  1.00 25.82  ? 11 GLU B C   1 
ATOM   347 O O   . GLU B 1 11 ? 18.546 16.435 13.724  1.00 27.26  ? 11 GLU B O   1 
ATOM   348 C CB  . GLU B 1 11 ? 20.118 17.245 16.548  1.00 39.40  ? 11 GLU B CB  1 
ATOM   349 C CG  . GLU B 1 11 ? 19.112 18.372 16.315  1.00 48.83  ? 11 GLU B CG  1 
ATOM   350 C CD  . GLU B 1 11 ? 19.727 19.605 16.879  1.00 84.85  ? 11 GLU B CD  1 
ATOM   351 O OE1 . GLU B 1 11 ? 20.052 19.667 18.049  1.00 100.00 ? 11 GLU B OE1 1 
ATOM   352 O OE2 . GLU B 1 11 ? 20.078 20.483 15.963  1.00 65.04  ? 11 GLU B OE2 1 
ATOM   353 N N   . LEU B 1 12 ? 20.796 16.815 13.491  1.00 18.37  ? 12 LEU B N   1 
ATOM   354 C CA  . LEU B 1 12 ? 20.682 17.250 12.113  1.00 30.97  ? 12 LEU B CA  1 
ATOM   355 C C   . LEU B 1 12 ? 20.317 16.056 11.240  1.00 45.98  ? 12 LEU B C   1 
ATOM   356 O O   . LEU B 1 12 ? 19.473 16.181 10.356  1.00 36.26  ? 12 LEU B O   1 
ATOM   357 C CB  . LEU B 1 12 ? 21.948 17.917 11.604  1.00 22.90  ? 12 LEU B CB  1 
ATOM   358 C CG  . LEU B 1 12 ? 22.014 19.392 11.902  1.00 23.65  ? 12 LEU B CG  1 
ATOM   359 C CD1 . LEU B 1 12 ? 23.301 19.942 11.332  1.00 19.92  ? 12 LEU B CD1 1 
ATOM   360 C CD2 . LEU B 1 12 ? 20.840 20.097 11.281  1.00 22.03  ? 12 LEU B CD2 1 
ATOM   361 N N   . LEU B 1 13 ? 20.937 14.889 11.508  1.00 23.21  ? 13 LEU B N   1 
ATOM   362 C CA  . LEU B 1 13 ? 20.640 13.710 10.729  1.00 22.54  ? 13 LEU B CA  1 
ATOM   363 C C   . LEU B 1 13 ? 19.171 13.291 10.862  1.00 41.90  ? 13 LEU B C   1 
ATOM   364 O O   . LEU B 1 13 ? 18.510 12.814 9.893   1.00 30.68  ? 13 LEU B O   1 
ATOM   365 C CB  . LEU B 1 13 ? 21.624 12.570 10.989  1.00 24.74  ? 13 LEU B CB  1 
ATOM   366 C CG  . LEU B 1 13 ? 21.241 11.281 10.254  1.00 38.63  ? 13 LEU B CG  1 
ATOM   367 C CD1 . LEU B 1 13 ? 21.819 11.269 8.838   1.00 32.32  ? 13 LEU B CD1 1 
ATOM   368 C CD2 . LEU B 1 13 ? 21.672 10.037 11.041  1.00 62.53  ? 13 LEU B CD2 1 
ATOM   369 N N   . SER B 1 14 ? 18.628 13.481 12.069  1.00 33.04  ? 14 SER B N   1 
ATOM   370 C CA  . SER B 1 14 ? 17.227 13.135 12.279  1.00 38.08  ? 14 SER B CA  1 
ATOM   371 C C   . SER B 1 14 ? 16.309 14.040 11.411  1.00 35.01  ? 14 SER B C   1 
ATOM   372 O O   . SER B 1 14 ? 15.300 13.623 10.830  1.00 26.81  ? 14 SER B O   1 
ATOM   373 C CB  . SER B 1 14 ? 16.847 13.185 13.756  1.00 27.52  ? 14 SER B CB  1 
ATOM   374 O OG  . SER B 1 14 ? 15.613 12.513 13.995  1.00 57.71  ? 14 SER B OG  1 
ATOM   375 N N   . LYS B 1 15 ? 16.697 15.310 11.327  1.00 24.58  ? 15 LYS B N   1 
ATOM   376 C CA  . LYS B 1 15 ? 15.952 16.299 10.546  1.00 36.81  ? 15 LYS B CA  1 
ATOM   377 C C   . LYS B 1 15 ? 15.970 15.948 9.073   1.00 31.44  ? 15 LYS B C   1 
ATOM   378 O O   . LYS B 1 15 ? 14.973 15.939 8.361   1.00 30.56  ? 15 LYS B O   1 
ATOM   379 C CB  . LYS B 1 15 ? 16.436 17.709 10.822  1.00 35.65  ? 15 LYS B CB  1 
ATOM   380 C CG  . LYS B 1 15 ? 15.694 18.309 12.015  1.00 75.71  ? 15 LYS B CG  1 
ATOM   381 C CD  . LYS B 1 15 ? 16.330 19.568 12.607  1.00 100.00 ? 15 LYS B CD  1 
ATOM   382 C CE  . LYS B 1 15 ? 17.335 19.291 13.717  1.00 65.28  ? 15 LYS B CE  1 
ATOM   383 N NZ  . LYS B 1 15 ? 16.722 19.037 15.030  1.00 93.30  ? 15 LYS B NZ  1 
ATOM   384 N N   . LYS B 1 16 ? 17.144 15.634 8.637   1.00 24.53  ? 16 LYS B N   1 
ATOM   385 C CA  . LYS B 1 16 ? 17.364 15.232 7.287   1.00 22.99  ? 16 LYS B CA  1 
ATOM   386 C C   . LYS B 1 16 ? 16.411 14.095 6.917   1.00 36.69  ? 16 LYS B C   1 
ATOM   387 O O   . LYS B 1 16 ? 15.727 14.156 5.905   1.00 24.04  ? 16 LYS B O   1 
ATOM   388 C CB  . LYS B 1 16 ? 18.850 14.861 7.069   1.00 28.43  ? 16 LYS B CB  1 
ATOM   389 C CG  . LYS B 1 16 ? 19.157 14.211 5.733   1.00 24.54  ? 16 LYS B CG  1 
ATOM   390 C CD  . LYS B 1 16 ? 20.595 14.257 5.341   1.00 29.42  ? 16 LYS B CD  1 
ATOM   391 C CE  . LYS B 1 16 ? 20.982 13.053 4.532   1.00 57.23  ? 16 LYS B CE  1 
ATOM   392 N NZ  . LYS B 1 16 ? 20.292 11.855 5.003   1.00 69.31  ? 16 LYS B NZ  1 
ATOM   393 N N   . TYR B 1 17 ? 16.356 13.048 7.739   1.00 33.58  ? 17 TYR B N   1 
ATOM   394 C CA  . TYR B 1 17 ? 15.491 11.927 7.427   1.00 31.23  ? 17 TYR B CA  1 
ATOM   395 C C   . TYR B 1 17 ? 14.030 12.309 7.406   1.00 39.91  ? 17 TYR B C   1 
ATOM   396 O O   . TYR B 1 17 ? 13.237 11.758 6.609   1.00 32.48  ? 17 TYR B O   1 
ATOM   397 C CB  . TYR B 1 17 ? 15.709 10.709 8.345   1.00 36.21  ? 17 TYR B CB  1 
ATOM   398 C CG  . TYR B 1 17 ? 17.017 9.996  8.120   1.00 38.33  ? 17 TYR B CG  1 
ATOM   399 C CD1 . TYR B 1 17 ? 17.586 9.902  6.850   1.00 30.24  ? 17 TYR B CD1 1 
ATOM   400 C CD2 . TYR B 1 17 ? 17.697 9.418  9.195   1.00 41.13  ? 17 TYR B CD2 1 
ATOM   401 C CE1 . TYR B 1 17 ? 18.798 9.247  6.647   1.00 28.57  ? 17 TYR B CE1 1 
ATOM   402 C CE2 . TYR B 1 17 ? 18.910 8.758  9.011   1.00 32.02  ? 17 TYR B CE2 1 
ATOM   403 C CZ  . TYR B 1 17 ? 19.459 8.666  7.736   1.00 47.71  ? 17 TYR B CZ  1 
ATOM   404 O OH  . TYR B 1 17 ? 20.658 8.011  7.579   1.00 40.94  ? 17 TYR B OH  1 
ATOM   405 N N   . HIS B 1 18 ? 13.679 13.260 8.305   1.00 28.37  ? 18 HIS B N   1 
ATOM   406 C CA  . HIS B 1 18 ? 12.304 13.724 8.407   1.00 25.84  ? 18 HIS B CA  1 
ATOM   407 C C   . HIS B 1 18 ? 11.902 14.448 7.133   1.00 34.91  ? 18 HIS B C   1 
ATOM   408 O O   . HIS B 1 18 ? 10.784 14.304 6.661   1.00 36.43  ? 18 HIS B O   1 
ATOM   409 C CB  . HIS B 1 18 ? 12.050 14.636 9.629   1.00 38.30  ? 18 HIS B CB  1 
ATOM   410 C CG  . HIS B 1 18 ? 10.677 15.281 9.548   1.00 52.48  ? 18 HIS B CG  1 
ATOM   411 N ND1 . HIS B 1 18 ? 10.496 16.620 9.146   1.00 55.95  ? 18 HIS B ND1 1 
ATOM   412 C CD2 . HIS B 1 18 ? 9.434  14.758 9.803   1.00 56.49  ? 18 HIS B CD2 1 
ATOM   413 C CE1 . HIS B 1 18 ? 9.181  16.868 9.168   1.00 51.05  ? 18 HIS B CE1 1 
ATOM   414 N NE2 . HIS B 1 18 ? 8.516  15.773 9.563   1.00 55.53  ? 18 HIS B NE2 1 
ATOM   415 N N   . LEU B 1 19 ? 12.847 15.225 6.610   1.00 26.27  ? 19 LEU B N   1 
ATOM   416 C CA  . LEU B 1 19 ? 12.694 15.981 5.385   1.00 24.63  ? 19 LEU B CA  1 
ATOM   417 C C   . LEU B 1 19 ? 12.677 15.039 4.154   1.00 40.43  ? 19 LEU B C   1 
ATOM   418 O O   . LEU B 1 19 ? 11.814 15.136 3.281   1.00 46.96  ? 19 LEU B O   1 
ATOM   419 C CB  . LEU B 1 19 ? 13.779 17.023 5.260   1.00 21.66  ? 19 LEU B CB  1 
ATOM   420 C CG  . LEU B 1 19 ? 13.535 18.163 6.231   1.00 28.30  ? 19 LEU B CG  1 
ATOM   421 C CD1 . LEU B 1 19 ? 14.559 19.255 5.975   1.00 38.32  ? 19 LEU B CD1 1 
ATOM   422 C CD2 . LEU B 1 19 ? 12.105 18.720 6.122   1.00 26.28  ? 19 LEU B CD2 1 
ATOM   423 N N   . GLU B 1 20 ? 13.603 14.091 4.069   1.00 24.97  ? 20 GLU B N   1 
ATOM   424 C CA  . GLU B 1 20 ? 13.570 13.164 2.954   1.00 22.70  ? 20 GLU B CA  1 
ATOM   425 C C   . GLU B 1 20 ? 12.229 12.417 2.891   1.00 34.76  ? 20 GLU B C   1 
ATOM   426 O O   . GLU B 1 20 ? 11.636 12.212 1.838   1.00 43.79  ? 20 GLU B O   1 
ATOM   427 C CB  . GLU B 1 20 ? 14.705 12.188 2.964   1.00 24.91  ? 20 GLU B CB  1 
ATOM   428 C CG  . GLU B 1 20 ? 16.047 12.844 2.705   1.00 38.03  ? 20 GLU B CG  1 
ATOM   429 C CD  . GLU B 1 20 ? 17.178 11.871 2.876   1.00 34.83  ? 20 GLU B CD  1 
ATOM   430 O OE1 . GLU B 1 20 ? 17.085 10.788 3.466   1.00 38.81  ? 20 GLU B OE1 1 
ATOM   431 O OE2 . GLU B 1 20 ? 18.265 12.297 2.283   1.00 39.59  ? 20 GLU B OE2 1 
ATOM   432 N N   . ASN B 1 21 ? 11.714 11.999 4.027   1.00 39.92  ? 21 ASN B N   1 
ATOM   433 C CA  . ASN B 1 21 ? 10.447 11.305 3.987   1.00 41.61  ? 21 ASN B CA  1 
ATOM   434 C C   . ASN B 1 21 ? 9.306  12.255 3.591   1.00 46.26  ? 21 ASN B C   1 
ATOM   435 O O   . ASN B 1 21 ? 8.342  11.906 2.940   1.00 48.86  ? 21 ASN B O   1 
ATOM   436 C CB  . ASN B 1 21 ? 10.124 10.617 5.337   1.00 37.16  ? 21 ASN B CB  1 
ATOM   437 C CG  . ASN B 1 21 ? 11.271 9.803  5.931   1.00 78.82  ? 21 ASN B CG  1 
ATOM   438 O OD1 . ASN B 1 21 ? 11.305 9.526  7.144   1.00 43.31  ? 21 ASN B OD1 1 
ATOM   439 N ND2 . ASN B 1 21 ? 12.206 9.385  5.087   1.00 49.61  ? 21 ASN B ND2 1 
ATOM   440 N N   . GLU B 1 22 ? 9.396  13.486 4.002   1.00 36.49  ? 22 GLU B N   1 
ATOM   441 C CA  . GLU B 1 22 ? 8.332  14.404 3.689   1.00 36.72  ? 22 GLU B CA  1 
ATOM   442 C C   . GLU B 1 22 ? 8.348  14.631 2.224   1.00 41.37  ? 22 GLU B C   1 
ATOM   443 O O   . GLU B 1 22 ? 7.313  14.680 1.573   1.00 42.27  ? 22 GLU B O   1 
ATOM   444 C CB  . GLU B 1 22 ? 8.561  15.731 4.426   1.00 34.75  ? 22 GLU B CB  1 
ATOM   445 C CG  . GLU B 1 22 ? 7.511  16.835 4.208   1.00 54.15  ? 22 GLU B CG  1 
ATOM   446 C CD  . GLU B 1 22 ? 7.786  18.076 5.046   1.00 83.96  ? 22 GLU B CD  1 
ATOM   447 O OE1 . GLU B 1 22 ? 8.701  18.160 5.847   1.00 59.34  ? 22 GLU B OE1 1 
ATOM   448 O OE2 . GLU B 1 22 ? 6.927  19.049 4.847   1.00 91.92  ? 22 GLU B OE2 1 
ATOM   449 N N   . VAL B 1 23 ? 9.563  14.763 1.750   1.00 32.63  ? 23 VAL B N   1 
ATOM   450 C CA  . VAL B 1 23 ? 9.826  15.015 0.371   1.00 37.05  ? 23 VAL B CA  1 
ATOM   451 C C   . VAL B 1 23 ? 9.225  13.929 -0.545  1.00 62.31  ? 23 VAL B C   1 
ATOM   452 O O   . VAL B 1 23 ? 8.583  14.202 -1.569  1.00 47.59  ? 23 VAL B O   1 
ATOM   453 C CB  . VAL B 1 23 ? 11.291 15.318 0.137   1.00 33.02  ? 23 VAL B CB  1 
ATOM   454 C CG1 . VAL B 1 23 ? 11.652 14.943 -1.291  1.00 40.35  ? 23 VAL B CG1 1 
ATOM   455 C CG2 . VAL B 1 23 ? 11.554 16.811 0.367   1.00 25.02  ? 23 VAL B CG2 1 
ATOM   456 N N   . ALA B 1 24 ? 9.422  12.686 -0.130  1.00 59.50  ? 24 ALA B N   1 
ATOM   457 C CA  . ALA B 1 24 ? 8.946  11.520 -0.830  1.00 54.42  ? 24 ALA B CA  1 
ATOM   458 C C   . ALA B 1 24 ? 7.429  11.448 -0.868  1.00 62.52  ? 24 ALA B C   1 
ATOM   459 O O   . ALA B 1 24 ? 6.839  10.898 -1.784  1.00 69.07  ? 24 ALA B O   1 
ATOM   460 C CB  . ALA B 1 24 ? 9.492  10.291 -0.130  1.00 51.69  ? 24 ALA B CB  1 
ATOM   461 N N   . ARG B 1 25 ? 6.814  12.008 0.152   1.00 54.60  ? 25 ARG B N   1 
ATOM   462 C CA  . ARG B 1 25 ? 5.385  12.030 0.282   1.00 52.12  ? 25 ARG B CA  1 
ATOM   463 C C   . ARG B 1 25 ? 4.762  13.043 -0.652  1.00 61.62  ? 25 ARG B C   1 
ATOM   464 O O   . ARG B 1 25 ? 3.765  12.768 -1.328  1.00 63.14  ? 25 ARG B O   1 
ATOM   465 C CB  . ARG B 1 25 ? 4.997  12.397 1.705   1.00 57.64  ? 25 ARG B CB  1 
ATOM   466 C CG  . ARG B 1 25 ? 4.917  11.209 2.654   1.00 61.89  ? 25 ARG B CG  1 
ATOM   467 C CD  . ARG B 1 25 ? 4.311  11.590 4.008   1.00 99.94  ? 25 ARG B CD  1 
ATOM   468 N NE  . ARG B 1 25 ? 5.331  11.872 5.020   1.00 100.00 ? 25 ARG B NE  1 
ATOM   469 C CZ  . ARG B 1 25 ? 5.573  13.066 5.574   1.00 100.00 ? 25 ARG B CZ  1 
ATOM   470 N NH1 . ARG B 1 25 ? 4.882  14.166 5.262   1.00 92.24  ? 25 ARG B NH1 1 
ATOM   471 N NH2 . ARG B 1 25 ? 6.546  13.155 6.482   1.00 74.16  ? 25 ARG B NH2 1 
ATOM   472 N N   . LEU B 1 26 ? 5.350  14.239 -0.669  1.00 57.41  ? 26 LEU B N   1 
ATOM   473 C CA  . LEU B 1 26 ? 4.837  15.314 -1.504  1.00 55.95  ? 26 LEU B CA  1 
ATOM   474 C C   . LEU B 1 26 ? 4.858  14.915 -2.951  1.00 47.06  ? 26 LEU B C   1 
ATOM   475 O O   . LEU B 1 26 ? 3.858  15.006 -3.652  1.00 57.32  ? 26 LEU B O   1 
ATOM   476 C CB  . LEU B 1 26 ? 5.431  16.726 -1.239  1.00 52.26  ? 26 LEU B CB  1 
ATOM   477 C CG  . LEU B 1 26 ? 5.111  17.263 0.154   1.00 51.36  ? 26 LEU B CG  1 
ATOM   478 C CD1 . LEU B 1 26 ? 6.111  18.340 0.538   1.00 57.38  ? 26 LEU B CD1 1 
ATOM   479 C CD2 . LEU B 1 26 ? 3.717  17.844 0.211   1.00 49.27  ? 26 LEU B CD2 1 
ATOM   480 N N   . LYS B 1 27 ? 6.009  14.470 -3.383  1.00 40.56  ? 27 LYS B N   1 
ATOM   481 C CA  . LYS B 1 27 ? 6.158  14.029 -4.760  1.00 49.96  ? 27 LYS B CA  1 
ATOM   482 C C   . LYS B 1 27 ? 5.093  12.978 -5.081  1.00 59.29  ? 27 LYS B C   1 
ATOM   483 O O   . LYS B 1 27 ? 4.479  12.994 -6.127  1.00 58.70  ? 27 LYS B O   1 
ATOM   484 C CB  . LYS B 1 27 ? 7.554  13.513 -5.072  1.00 39.04  ? 27 LYS B CB  1 
ATOM   485 C CG  . LYS B 1 27 ? 8.617  14.610 -5.112  1.00 47.15  ? 27 LYS B CG  1 
ATOM   486 C CD  . LYS B 1 27 ? 10.030 14.037 -5.278  1.00 41.33  ? 27 LYS B CD  1 
ATOM   487 C CE  . LYS B 1 27 ? 11.089 15.112 -5.441  1.00 86.27  ? 27 LYS B CE  1 
ATOM   488 N NZ  . LYS B 1 27 ? 12.132 14.766 -6.424  1.00 100.00 ? 27 LYS B NZ  1 
ATOM   489 N N   . LYS B 1 28 ? 4.843  12.066 -4.165  1.00 54.94  ? 28 LYS B N   1 
ATOM   490 C CA  . LYS B 1 28 ? 3.827  11.091 -4.433  1.00 55.41  ? 28 LYS B CA  1 
ATOM   491 C C   . LYS B 1 28 ? 2.490  11.775 -4.750  1.00 72.46  ? 28 LYS B C   1 
ATOM   492 O O   . LYS B 1 28 ? 1.753  11.352 -5.636  1.00 86.62  ? 28 LYS B O   1 
ATOM   493 C CB  . LYS B 1 28 ? 3.671  10.088 -3.305  1.00 55.74  ? 28 LYS B CB  1 
ATOM   494 C CG  . LYS B 1 28 ? 2.990  8.785  -3.716  1.00 66.65  ? 28 LYS B CG  1 
ATOM   495 C CD  . LYS B 1 28 ? 3.618  7.567  -3.048  1.00 100.00 ? 28 LYS B CD  1 
ATOM   496 C CE  . LYS B 1 28 ? 2.720  6.340  -3.025  1.00 99.26  ? 28 LYS B CE  1 
ATOM   497 N NZ  . LYS B 1 28 ? 1.995  6.173  -1.756  1.00 83.69  ? 28 LYS B NZ  1 
ATOM   498 N N   . LEU B 1 29 ? 2.192  12.850 -4.019  1.00 58.61  ? 29 LEU B N   1 
ATOM   499 C CA  . LEU B 1 29 ? 0.965  13.630 -4.148  1.00 45.98  ? 29 LEU B CA  1 
ATOM   500 C C   . LEU B 1 29 ? 0.909  14.569 -5.373  1.00 61.62  ? 29 LEU B C   1 
ATOM   501 O O   . LEU B 1 29 ? -0.165 15.032 -5.759  1.00 63.67  ? 29 LEU B O   1 
ATOM   502 C CB  . LEU B 1 29 ? 0.740  14.388 -2.818  1.00 43.24  ? 29 LEU B CB  1 
ATOM   503 C CG  . LEU B 1 29 ? -0.586 15.124 -2.645  1.00 47.99  ? 29 LEU B CG  1 
ATOM   504 C CD1 . LEU B 1 29 ? -1.644 14.222 -2.027  1.00 49.18  ? 29 LEU B CD1 1 
ATOM   505 C CD2 . LEU B 1 29 ? -0.396 16.329 -1.735  1.00 49.85  ? 29 LEU B CD2 1 
ATOM   506 N N   . VAL B 1 30 ? 2.049  14.870 -5.994  1.00 60.86  ? 30 VAL B N   1 
ATOM   507 C CA  . VAL B 1 30 ? 2.060  15.763 -7.155  1.00 53.94  ? 30 VAL B CA  1 
ATOM   508 C C   . VAL B 1 30 ? 3.030  15.215 -8.213  1.00 100.00 ? 30 VAL B C   1 
ATOM   509 O O   . VAL B 1 30 ? 2.678  14.542 -9.195  1.00 93.79  ? 30 VAL B O   1 
ATOM   510 C CB  . VAL B 1 30 ? 2.451  17.199 -6.767  1.00 53.75  ? 30 VAL B CB  1 
ATOM   511 C CG1 . VAL B 1 30 ? 1.969  17.493 -5.352  1.00 54.91  ? 30 VAL B CG1 1 
ATOM   512 C CG2 . VAL B 1 30 ? 3.965  17.376 -6.837  1.00 52.64  ? 30 VAL B CG2 1 
HETATM 513 O O   . HOH C 2 .  ? 33.197 15.698 8.178   1.00 49.15  ? 54 HOH A O   1 
HETATM 514 O O   . HOH C 2 .  ? 17.820 24.329 -2.905  1.00 55.43  ? 55 HOH A O   1 
HETATM 515 O O   . HOH C 2 .  ? 20.035 16.032 0.829   1.00 69.64  ? 58 HOH A O   1 
HETATM 516 O O   . HOH C 2 .  ? 7.644  24.943 3.564   1.00 56.27  ? 61 HOH A O   1 
HETATM 517 O O   . HOH C 2 .  ? 25.411 10.853 8.034   1.00 53.37  ? 64 HOH A O   1 
HETATM 518 O O   . HOH C 2 .  ? 15.642 14.861 -2.265  1.00 63.87  ? 65 HOH A O   1 
HETATM 519 O O   . HOH C 2 .  ? 9.852  22.428 -10.107 1.00 80.41  ? 66 HOH A O   1 
HETATM 520 O O   . HOH C 2 .  ? 36.786 16.978 7.529   1.00 72.20  ? 67 HOH A O   1 
HETATM 521 O O   . HOH C 2 .  ? 32.425 12.571 6.261   1.00 62.14  ? 69 HOH A O   1 
HETATM 522 O O   . HOH C 2 .  ? 26.980 24.767 5.498   1.00 50.70  ? 70 HOH A O   1 
HETATM 523 O O   . HOH C 2 .  ? 17.666 27.430 10.226  1.00 28.08  ? 74 HOH A O   1 
HETATM 524 O O   . HOH C 2 .  ? 41.244 17.052 17.098  1.00 92.65  ? 75 HOH A O   1 
HETATM 525 O O   . HOH C 2 .  ? 28.492 9.284  9.619   1.00 56.72  ? 76 HOH A O   1 
HETATM 526 O O   . HOH C 2 .  ? 10.714 23.204 5.600   1.00 65.98  ? 79 HOH A O   1 
HETATM 527 O O   . HOH C 2 .  ? 41.244 18.657 14.684  1.00 64.08  ? 80 HOH A O   1 
HETATM 528 O O   . HOH C 2 .  ? 35.376 23.430 9.910   1.00 56.76  ? 81 HOH A O   1 
HETATM 529 O O   . HOH D 2 .  ? 24.113 18.435 23.487  1.00 53.46  ? 50 HOH B O   1 
HETATM 530 O O   . HOH D 2 .  ? 20.015 10.838 14.790  1.00 36.72  ? 51 HOH B O   1 
HETATM 531 O O   . HOH D 2 .  ? 9.539  10.924 8.713   1.00 84.94  ? 52 HOH B O   1 
HETATM 532 O O   . HOH D 2 .  ? 21.371 19.597 22.304  1.00 57.71  ? 53 HOH B O   1 
HETATM 533 O O   . HOH D 2 .  ? 13.639 15.027 13.831  1.00 74.66  ? 56 HOH B O   1 
HETATM 534 O O   . HOH D 2 .  ? 13.556 11.791 12.224  1.00 61.65  ? 57 HOH B O   1 
HETATM 535 O O   . HOH D 2 .  ? 24.405 20.253 20.174  1.00 52.41  ? 59 HOH B O   1 
HETATM 536 O O   . HOH D 2 .  ? 21.108 14.468 20.141  1.00 45.07  ? 60 HOH B O   1 
HETATM 537 O O   . HOH D 2 .  ? 15.733 15.935 16.291  1.00 68.10  ? 62 HOH B O   1 
HETATM 538 O O   . HOH D 2 .  ? 1.153  9.907  2.633   1.00 65.30  ? 63 HOH B O   1 
HETATM 539 O O   . HOH D 2 .  ? 22.132 8.488  5.447   1.00 41.28  ? 68 HOH B O   1 
HETATM 540 O O   . HOH D 2 .  ? 15.660 8.746  4.047   1.00 43.70  ? 71 HOH B O   1 
HETATM 541 O O   . HOH D 2 .  ? 13.624 11.606 -0.104  1.00 74.39  ? 72 HOH B O   1 
HETATM 542 O O   . HOH D 2 .  ? 7.236  12.637 -9.418  1.00 48.05  ? 73 HOH B O   1 
HETATM 543 O O   . HOH D 2 .  ? 27.424 10.479 20.854  1.00 96.80  ? 77 HOH B O   1 
HETATM 544 O O   . HOH D 2 .  ? 2.033  11.354 7.006   1.00 62.13  ? 78 HOH B O   1 
HETATM 545 O O   . HOH D 2 .  ? 28.915 15.734 28.069  1.00 53.40  ? 82 HOH B O   1 
HETATM 546 O O   . HOH D 2 .  ? 17.867 11.419 16.230  1.00 91.02  ? 83 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ARG 1  1  1  ARG ARG A . n 
A 1 2  MET 2  2  2  MET MET A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  GLN 4  4  4  GLN GLN A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  GLU 6  6  6  GLU GLU A . n 
A 1 7  ASP 7  7  7  ASP ASP A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 GLU 10 10 10 GLU GLU A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 LEU 12 12 12 LEU LEU A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 LYS 16 16 16 LYS LYS A . n 
A 1 17 TYR 17 17 17 TYR TYR A . n 
A 1 18 HIS 18 18 18 HIS HIS A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 GLU 20 20 20 GLU GLU A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 ALA 24 24 24 ALA ALA A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 VAL 30 30 30 VAL VAL A . n 
A 1 31 GLY 31 31 ?  ?   ?   A . n 
A 1 32 GLU 32 32 ?  ?   ?   A . n 
A 1 33 ARG 33 33 ?  ?   ?   A . n 
B 1 1  ARG 1  1  1  ARG ARG B . n 
B 1 2  MET 2  2  2  MET MET B . n 
B 1 3  LYS 3  3  3  LYS LYS B . n 
B 1 4  GLN 4  4  4  GLN GLN B . n 
B 1 5  LEU 5  5  5  LEU LEU B . n 
B 1 6  GLU 6  6  6  GLU GLU B . n 
B 1 7  ASP 7  7  7  ASP ASP B . n 
B 1 8  LYS 8  8  8  LYS LYS B . n 
B 1 9  VAL 9  9  9  VAL VAL B . n 
B 1 10 GLU 10 10 10 GLU GLU B . n 
B 1 11 GLU 11 11 11 GLU GLU B . n 
B 1 12 LEU 12 12 12 LEU LEU B . n 
B 1 13 LEU 13 13 13 LEU LEU B . n 
B 1 14 SER 14 14 14 SER SER B . n 
B 1 15 LYS 15 15 15 LYS LYS B . n 
B 1 16 LYS 16 16 16 LYS LYS B . n 
B 1 17 TYR 17 17 17 TYR TYR B . n 
B 1 18 HIS 18 18 18 HIS HIS B . n 
B 1 19 LEU 19 19 19 LEU LEU B . n 
B 1 20 GLU 20 20 20 GLU GLU B . n 
B 1 21 ASN 21 21 21 ASN ASN B . n 
B 1 22 GLU 22 22 22 GLU GLU B . n 
B 1 23 VAL 23 23 23 VAL VAL B . n 
B 1 24 ALA 24 24 24 ALA ALA B . n 
B 1 25 ARG 25 25 25 ARG ARG B . n 
B 1 26 LEU 26 26 26 LEU LEU B . n 
B 1 27 LYS 27 27 27 LYS LYS B . n 
B 1 28 LYS 28 28 28 LYS LYS B . n 
B 1 29 LEU 29 29 29 LEU LEU B . n 
B 1 30 VAL 30 30 30 VAL VAL B . n 
B 1 31 GLY 31 31 ?  ?   ?   B . n 
B 1 32 GLU 32 32 ?  ?   ?   B . n 
B 1 33 ARG 33 33 ?  ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  54 54 HOH HOH A . 
C 2 HOH 2  55 55 HOH HOH A . 
C 2 HOH 3  58 58 HOH HOH A . 
C 2 HOH 4  61 61 HOH HOH A . 
C 2 HOH 5  64 64 HOH HOH A . 
C 2 HOH 6  65 65 HOH HOH A . 
C 2 HOH 7  66 66 HOH HOH A . 
C 2 HOH 8  67 67 HOH HOH A . 
C 2 HOH 9  69 69 HOH HOH A . 
C 2 HOH 10 70 70 HOH HOH A . 
C 2 HOH 11 74 74 HOH HOH A . 
C 2 HOH 12 75 75 HOH HOH A . 
C 2 HOH 13 76 76 HOH HOH A . 
C 2 HOH 14 79 79 HOH HOH A . 
C 2 HOH 15 80 80 HOH HOH A . 
C 2 HOH 16 81 81 HOH HOH A . 
D 2 HOH 1  50 50 HOH HOH B . 
D 2 HOH 2  51 51 HOH HOH B . 
D 2 HOH 3  52 52 HOH HOH B . 
D 2 HOH 4  53 53 HOH HOH B . 
D 2 HOH 5  56 56 HOH HOH B . 
D 2 HOH 6  57 57 HOH HOH B . 
D 2 HOH 7  59 59 HOH HOH B . 
D 2 HOH 8  60 60 HOH HOH B . 
D 2 HOH 9  62 62 HOH HOH B . 
D 2 HOH 10 63 63 HOH HOH B . 
D 2 HOH 11 68 68 HOH HOH B . 
D 2 HOH 12 71 71 HOH HOH B . 
D 2 HOH 13 72 72 HOH HOH B . 
D 2 HOH 14 73 73 HOH HOH B . 
D 2 HOH 15 77 77 HOH HOH B . 
D 2 HOH 16 78 78 HOH HOH B . 
D 2 HOH 17 82 82 HOH HOH B . 
D 2 HOH 18 83 83 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1740 ? 
1 MORE         -23  ? 
1 'SSA (A^2)'  4650 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-07-07 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT    refinement       . ? 1 
R-AXIS 'data reduction' . ? 2 
R-AXIS 'data scaling'   . ? 3 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             20 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             20 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.330 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.078 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 1 ? ? CZ A ARG 1 ? ? NH1 A ARG 1 ? ? 123.30 120.30 3.00  0.50 N 
2 1 CB A ASP 7 ? ? CG A ASP 7 ? ? OD2 A ASP 7 ? ? 112.57 118.30 -5.73 0.90 N 
3 1 NE B ARG 1 ? ? CZ B ARG 1 ? ? NH1 B ARG 1 ? ? 124.10 120.30 3.80  0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 31 ? A GLY 31 
2 1 Y 1 A GLU 32 ? A GLU 32 
3 1 Y 1 A ARG 33 ? A ARG 33 
4 1 Y 1 B GLY 31 ? B GLY 31 
5 1 Y 1 B GLU 32 ? B GLU 32 
6 1 Y 1 B ARG 33 ? B ARG 33 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#