data_1ZIL
# 
_entry.id   1ZIL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZIL         
WWPDB D_1000177485 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZIL 
_pdbx_database_status.recvd_initial_deposition_date   1996-10-30 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gonzalez Junior, L.' 1 
'Woolfson, D.N.'      2 
'Alber, T.'           3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Buried polar residues and structural specificity in the GCN4 leucine zipper.'                 Nat.Struct.Biol. 3   1011 
1018 1996 NSBIEW US 1072-8368 2024 ? 8946854 10.1038/nsb1296-1011 
1       'An Engineered Allosteric Switch in Leucine-Zipper Oligomerization'                            Nat.Struct.Biol. 3   510  ? 
1996 NSBIEW US 1072-8368 2024 ? ?       ?                    
2       'Crystal Structure of an Isoleucine-Zipper Trimer'                                             Nature           371 80   ? 
1994 NATUAS UK 0028-0836 0006 ? ?       ?                    
3       'A Switch between Two-, Three-, and Four-Stranded Coiled Coils in GCN4 Leucine Zipper Mutants' Science          262 1401 ? 
1993 SCIEAS US 0036-8075 0038 ? ?       ?                    
4       'X-Ray Structure of the GCN4 Leucine Zipper, a Two-Stranded, Parallel Coiled Coil'             Science          254 539  ? 
1991 SCIEAS US 0036-8075 0038 ? ?       ?                    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gonzalez Jr., L.'    1  
primary 'Woolfson, D.N.'      2  
primary 'Alber, T.'           3  
1       'Gonzalez Junior, L.' 4  
1       'Plecs, J.J.'         5  
1       'Alber, T.'           6  
2       'Harbury, P.B.'       7  
2       'Kim, P.S.'           8  
2       'Alber, T.'           9  
3       'Harbury, P.B.'       10 
3       'Zhang, T.'           11 
3       'Kim, P.S.'           12 
3       'Alber, T.'           13 
4       
;O'Shea, E.K.
;
14 
4       'Klemm, J.D.'         15 
4       'Kim, P.S.'           16 
4       'Alber, T.'           17 
# 
_cell.entry_id           1ZIL 
_cell.length_a           104.250 
_cell.length_b           30.790 
_cell.length_c           22.020 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.57 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZIL 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'GENERAL CONTROL PROTEIN GCN4' 4019.690 2  ? N16Q ? 'THIS STRUCTURE IS IN THE DIMERIC STATE' 
2 water   nat water                          18.015   32 ? ?    ? ?                                        
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GCN4 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       RMKQLEDKVEELLSKQYHLENEVARLKKLVGER 
_entity_poly.pdbx_seq_one_letter_code_can   RMKQLEDKVEELLSKQYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ARG n 
1 2  MET n 
1 3  LYS n 
1 4  GLN n 
1 5  LEU n 
1 6  GLU n 
1 7  ASP n 
1 8  LYS n 
1 9  VAL n 
1 10 GLU n 
1 11 GLU n 
1 12 LEU n 
1 13 LEU n 
1 14 SER n 
1 15 LYS n 
1 16 GLN n 
1 17 TYR n 
1 18 HIS n 
1 19 LEU n 
1 20 GLU n 
1 21 ASN n 
1 22 GLU n 
1 23 VAL n 
1 24 ALA n 
1 25 ARG n 
1 26 LEU n 
1 27 LYS n 
1 28 LYS n 
1 29 LEU n 
1 30 VAL n 
1 31 GLY n 
1 32 GLU n 
1 33 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDA
KTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTT
SFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR
RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZIL A 1 ? 33 ? P03069 249 ? 281 ? 1 33 
2 1 1ZIL B 1 ? 33 ? P03069 249 ? 281 ? 1 33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ZIL GLN A 16 ? UNP P03069 ASN 264 ENGINEERED 16 1 
2 1ZIL GLN B 16 ? UNP P03069 ASN 264 ENGINEERED 16 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ZIL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   44. 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1994-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'SEALED TUBE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ZIL 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   2627 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         65. 
_reflns.pdbx_Rmerge_I_obs            0.0860000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.8 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1ZIL 
_refine.ls_number_reflns_obs                     2627 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6. 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1740000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        512 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             32 
_refine_hist.number_atoms_total               544 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        6. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        1.7   ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1ZIL 
_struct.title                     'GCN4-LEUCINE ZIPPER CORE MUTANT ASN16GLN IN THE DIMERIC STATE' 
_struct.pdbx_descriptor           'GENERAL CONTROL PROTEIN GCN4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZIL 
_struct_keywords.pdbx_keywords   'LEUCINE ZIPPER' 
_struct_keywords.text            
'LEUCINE ZIPPER, AMINO-ACID BIOSYNTHESIS, TRANSCRIPTION REGULATION, ACTIVATOR, DNA-BINDING, NUCLEAR PROTEIN, COILED COIL' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 1 ? VAL A 30 ? ARG A 1 VAL A 30 1 ? 30 
HELX_P HELX_P2 2 ARG B 1 ? VAL B 30 ? ARG B 1 VAL B 30 1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1ZIL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZIL 
_atom_sites.fract_transf_matrix[1][1]   0.009592 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000935 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.032478 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.045629 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ARG A 1 1  ? 40.332 15.568 14.615 1.00 25.69  ? 1  ARG A N   1 
ATOM   2   C CA  . ARG A 1 1  ? 38.986 15.017 14.745 1.00 29.22  ? 1  ARG A CA  1 
ATOM   3   C C   . ARG A 1 1  ? 37.879 16.054 14.914 1.00 42.70  ? 1  ARG A C   1 
ATOM   4   O O   . ARG A 1 1  ? 36.757 15.835 14.454 1.00 41.92  ? 1  ARG A O   1 
ATOM   5   C CB  . ARG A 1 1  ? 38.881 13.965 15.839 1.00 34.81  ? 1  ARG A CB  1 
ATOM   6   C CG  . ARG A 1 1  ? 37.442 13.481 16.029 1.00 37.25  ? 1  ARG A CG  1 
ATOM   7   C CD  . ARG A 1 1  ? 36.641 14.323 17.008 1.00 50.81  ? 1  ARG A CD  1 
ATOM   8   N NE  . ARG A 1 1  ? 35.654 13.528 17.723 1.00 72.52  ? 1  ARG A NE  1 
ATOM   9   C CZ  . ARG A 1 1  ? 35.983 12.675 18.692 1.00 73.04  ? 1  ARG A CZ  1 
ATOM   10  N NH1 . ARG A 1 1  ? 37.255 12.506 19.071 1.00 41.20  ? 1  ARG A NH1 1 
ATOM   11  N NH2 . ARG A 1 1  ? 35.023 11.982 19.302 1.00 68.87  ? 1  ARG A NH2 1 
ATOM   12  N N   . MET A 1 2  ? 38.197 17.153 15.622 1.00 41.01  ? 2  MET A N   1 
ATOM   13  C CA  . MET A 1 2  ? 37.287 18.260 15.897 1.00 38.01  ? 2  MET A CA  1 
ATOM   14  C C   . MET A 1 2  ? 36.856 18.877 14.567 1.00 33.85  ? 2  MET A C   1 
ATOM   15  O O   . MET A 1 2  ? 35.653 19.055 14.280 1.00 28.94  ? 2  MET A O   1 
ATOM   16  C CB  . MET A 1 2  ? 38.062 19.301 16.733 1.00 44.46  ? 2  MET A CB  1 
ATOM   17  C CG  . MET A 1 2  ? 37.227 20.419 17.343 1.00 54.95  ? 2  MET A CG  1 
ATOM   18  S SD  . MET A 1 2  ? 36.801 20.131 19.079 1.00 66.94  ? 2  MET A SD  1 
ATOM   19  C CE  . MET A 1 2  ? 35.560 18.815 18.925 1.00 60.13  ? 2  MET A CE  1 
ATOM   20  N N   . LYS A 1 3  ? 37.892 19.181 13.748 1.00 27.24  ? 3  LYS A N   1 
ATOM   21  C CA  . LYS A 1 3  ? 37.747 19.760 12.410 1.00 20.96  ? 3  LYS A CA  1 
ATOM   22  C C   . LYS A 1 3  ? 36.969 18.810 11.506 1.00 18.52  ? 3  LYS A C   1 
ATOM   23  O O   . LYS A 1 3  ? 36.455 19.150 10.467 1.00 22.05  ? 3  LYS A O   1 
ATOM   24  C CB  . LYS A 1 3  ? 39.116 20.048 11.829 1.00 19.26  ? 3  LYS A CB  1 
ATOM   25  C CG  . LYS A 1 3  ? 39.131 20.235 10.320 1.00 18.50  ? 3  LYS A CG  1 
ATOM   26  C CD  . LYS A 1 3  ? 38.482 21.522 9.832  1.00 56.22  ? 3  LYS A CD  1 
ATOM   27  C CE  . LYS A 1 3  ? 38.971 21.932 8.447  1.00 49.23  ? 3  LYS A CE  1 
ATOM   28  N NZ  . LYS A 1 3  ? 39.112 20.789 7.527  1.00 40.64  ? 3  LYS A NZ  1 
ATOM   29  N N   . GLN A 1 4  ? 36.903 17.577 11.918 1.00 24.74  ? 4  GLN A N   1 
ATOM   30  C CA  . GLN A 1 4  ? 36.184 16.597 11.159 1.00 28.41  ? 4  GLN A CA  1 
ATOM   31  C C   . GLN A 1 4  ? 34.744 16.738 11.552 1.00 20.31  ? 4  GLN A C   1 
ATOM   32  O O   . GLN A 1 4  ? 33.858 16.674 10.720 1.00 26.87  ? 4  GLN A O   1 
ATOM   33  C CB  . GLN A 1 4  ? 36.673 15.144 11.435 1.00 34.54  ? 4  GLN A CB  1 
ATOM   34  C CG  . GLN A 1 4  ? 38.189 15.030 11.714 1.00 74.34  ? 4  GLN A CG  1 
ATOM   35  C CD  . GLN A 1 4  ? 38.634 13.625 12.107 1.00 100.00 ? 4  GLN A CD  1 
ATOM   36  O OE1 . GLN A 1 4  ? 37.867 12.655 11.993 1.00 100.00 ? 4  GLN A OE1 1 
ATOM   37  N NE2 . GLN A 1 4  ? 39.879 13.508 12.573 1.00 85.87  ? 4  GLN A NE2 1 
ATOM   38  N N   . LEU A 1 5  ? 34.540 16.940 12.855 1.00 9.84   ? 5  LEU A N   1 
ATOM   39  C CA  . LEU A 1 5  ? 33.213 17.082 13.403 1.00 19.60  ? 5  LEU A CA  1 
ATOM   40  C C   . LEU A 1 5  ? 32.631 18.379 12.948 1.00 23.08  ? 5  LEU A C   1 
ATOM   41  O O   . LEU A 1 5  ? 31.439 18.473 12.643 1.00 24.20  ? 5  LEU A O   1 
ATOM   42  C CB  . LEU A 1 5  ? 33.155 16.916 14.945 1.00 22.88  ? 5  LEU A CB  1 
ATOM   43  C CG  . LEU A 1 5  ? 33.020 15.452 15.397 1.00 14.70  ? 5  LEU A CG  1 
ATOM   44  C CD1 . LEU A 1 5  ? 33.150 15.339 16.910 1.00 16.32  ? 5  LEU A CD1 1 
ATOM   45  C CD2 . LEU A 1 5  ? 31.670 14.892 14.951 1.00 4.96   ? 5  LEU A CD2 1 
ATOM   46  N N   . GLU A 1 6  ? 33.511 19.368 12.887 1.00 17.57  ? 6  GLU A N   1 
ATOM   47  C CA  . GLU A 1 6  ? 33.131 20.686 12.447 1.00 17.96  ? 6  GLU A CA  1 
ATOM   48  C C   . GLU A 1 6  ? 32.658 20.640 11.004 1.00 10.57  ? 6  GLU A C   1 
ATOM   49  O O   . GLU A 1 6  ? 31.608 21.156 10.674 1.00 18.77  ? 6  GLU A O   1 
ATOM   50  C CB  . GLU A 1 6  ? 34.274 21.729 12.724 1.00 17.06  ? 6  GLU A CB  1 
ATOM   51  C CG  . GLU A 1 6  ? 34.172 22.332 14.152 1.00 7.21   ? 6  GLU A CG  1 
ATOM   52  C CD  . GLU A 1 6  ? 35.459 22.789 14.747 1.00 11.53  ? 6  GLU A CD  1 
ATOM   53  O OE1 . GLU A 1 6  ? 36.510 22.854 14.134 1.00 24.04  ? 6  GLU A OE1 1 
ATOM   54  O OE2 . GLU A 1 6  ? 35.330 23.055 16.024 1.00 11.46  ? 6  GLU A OE2 1 
ATOM   55  N N   . ASP A 1 7  ? 33.426 19.979 10.136 1.00 15.63  ? 7  ASP A N   1 
ATOM   56  C CA  . ASP A 1 7  ? 33.095 19.855 8.695  1.00 20.94  ? 7  ASP A CA  1 
ATOM   57  C C   . ASP A 1 7  ? 31.826 19.064 8.376  1.00 29.20  ? 7  ASP A C   1 
ATOM   58  O O   . ASP A 1 7  ? 31.160 19.272 7.344  1.00 18.41  ? 7  ASP A O   1 
ATOM   59  C CB  . ASP A 1 7  ? 34.279 19.320 7.865  1.00 22.96  ? 7  ASP A CB  1 
ATOM   60  C CG  . ASP A 1 7  ? 35.396 20.308 7.659  1.00 27.65  ? 7  ASP A CG  1 
ATOM   61  O OD1 . ASP A 1 7  ? 35.258 21.515 7.707  1.00 26.65  ? 7  ASP A OD1 1 
ATOM   62  O OD2 . ASP A 1 7  ? 36.546 19.720 7.444  1.00 37.91  ? 7  ASP A OD2 1 
ATOM   63  N N   . LYS A 1 8  ? 31.505 18.142 9.266  1.00 35.49  ? 8  LYS A N   1 
ATOM   64  C CA  . LYS A 1 8  ? 30.333 17.302 9.131  1.00 31.02  ? 8  LYS A CA  1 
ATOM   65  C C   . LYS A 1 8  ? 29.079 18.128 9.378  1.00 35.50  ? 8  LYS A C   1 
ATOM   66  O O   . LYS A 1 8  ? 28.074 17.978 8.668  1.00 35.67  ? 8  LYS A O   1 
ATOM   67  C CB  . LYS A 1 8  ? 30.396 16.145 10.120 1.00 27.48  ? 8  LYS A CB  1 
ATOM   68  C CG  . LYS A 1 8  ? 29.353 15.076 9.870  1.00 33.79  ? 8  LYS A CG  1 
ATOM   69  C CD  . LYS A 1 8  ? 29.721 14.193 8.696  1.00 31.14  ? 8  LYS A CD  1 
ATOM   70  C CE  . LYS A 1 8  ? 28.649 13.175 8.347  1.00 18.71  ? 8  LYS A CE  1 
ATOM   71  N NZ  . LYS A 1 8  ? 28.931 12.514 7.060  1.00 35.67  ? 8  LYS A NZ  1 
ATOM   72  N N   . VAL A 1 9  ? 29.148 19.005 10.404 1.00 21.45  ? 9  VAL A N   1 
ATOM   73  C CA  . VAL A 1 9  ? 28.006 19.844 10.713 1.00 20.05  ? 9  VAL A CA  1 
ATOM   74  C C   . VAL A 1 9  ? 27.736 20.745 9.514  1.00 23.70  ? 9  VAL A C   1 
ATOM   75  O O   . VAL A 1 9  ? 26.609 20.878 9.037  1.00 24.48  ? 9  VAL A O   1 
ATOM   76  C CB  . VAL A 1 9  ? 28.153 20.655 12.009 1.00 15.38  ? 9  VAL A CB  1 
ATOM   77  C CG1 . VAL A 1 9  ? 26.842 21.285 12.398 1.00 11.04  ? 9  VAL A CG1 1 
ATOM   78  C CG2 . VAL A 1 9  ? 28.607 19.787 13.151 1.00 14.03  ? 9  VAL A CG2 1 
ATOM   79  N N   . GLU A 1 10 ? 28.805 21.340 9.013  1.00 23.76  ? 10 GLU A N   1 
ATOM   80  C CA  . GLU A 1 10 ? 28.715 22.225 7.872  1.00 22.89  ? 10 GLU A CA  1 
ATOM   81  C C   . GLU A 1 10 ? 28.225 21.505 6.649  1.00 28.15  ? 10 GLU A C   1 
ATOM   82  O O   . GLU A 1 10 ? 27.445 22.049 5.891  1.00 26.32  ? 10 GLU A O   1 
ATOM   83  C CB  . GLU A 1 10 ? 30.045 22.929 7.580  1.00 22.34  ? 10 GLU A CB  1 
ATOM   84  C CG  . GLU A 1 10 ? 30.604 23.629 8.820  1.00 20.00  ? 10 GLU A CG  1 
ATOM   85  C CD  . GLU A 1 10 ? 32.096 23.661 8.782  1.00 53.37  ? 10 GLU A CD  1 
ATOM   86  O OE1 . GLU A 1 10 ? 32.741 23.701 7.745  1.00 23.34  ? 10 GLU A OE1 1 
ATOM   87  O OE2 . GLU A 1 10 ? 32.631 23.581 9.973  1.00 51.90  ? 10 GLU A OE2 1 
ATOM   88  N N   . GLU A 1 11 ? 28.680 20.275 6.434  1.00 26.97  ? 11 GLU A N   1 
ATOM   89  C CA  . GLU A 1 11 ? 28.178 19.616 5.251  1.00 28.20  ? 11 GLU A CA  1 
ATOM   90  C C   . GLU A 1 11 ? 26.696 19.308 5.387  1.00 20.60  ? 11 GLU A C   1 
ATOM   91  O O   . GLU A 1 11 ? 25.948 19.383 4.428  1.00 28.71  ? 11 GLU A O   1 
ATOM   92  C CB  . GLU A 1 11 ? 28.969 18.384 4.816  1.00 31.52  ? 11 GLU A CB  1 
ATOM   93  C CG  . GLU A 1 11 ? 28.162 17.535 3.821  1.00 41.79  ? 11 GLU A CG  1 
ATOM   94  C CD  . GLU A 1 11 ? 28.185 16.075 4.183  1.00 60.93  ? 11 GLU A CD  1 
ATOM   95  O OE1 . GLU A 1 11 ? 29.188 15.384 4.112  1.00 29.90  ? 11 GLU A OE1 1 
ATOM   96  O OE2 . GLU A 1 11 ? 27.039 15.649 4.658  1.00 53.09  ? 11 GLU A OE2 1 
ATOM   97  N N   . LEU A 1 12 ? 26.270 18.974 6.601  1.00 20.45  ? 12 LEU A N   1 
ATOM   98  C CA  . LEU A 1 12 ? 24.870 18.650 6.884  1.00 26.22  ? 12 LEU A CA  1 
ATOM   99  C C   . LEU A 1 12 ? 23.879 19.829 6.784  1.00 28.47  ? 12 LEU A C   1 
ATOM   100 O O   . LEU A 1 12 ? 22.658 19.632 6.585  1.00 12.65  ? 12 LEU A O   1 
ATOM   101 C CB  . LEU A 1 12 ? 24.697 17.872 8.200  1.00 27.31  ? 12 LEU A CB  1 
ATOM   102 C CG  . LEU A 1 12 ? 25.248 16.450 8.143  1.00 21.96  ? 12 LEU A CG  1 
ATOM   103 C CD1 . LEU A 1 12 ? 25.439 15.950 9.559  1.00 13.52  ? 12 LEU A CD1 1 
ATOM   104 C CD2 . LEU A 1 12 ? 24.244 15.553 7.446  1.00 8.43   ? 12 LEU A CD2 1 
ATOM   105 N N   . LEU A 1 13 ? 24.384 21.057 6.954  1.00 26.46  ? 13 LEU A N   1 
ATOM   106 C CA  . LEU A 1 13 ? 23.509 22.229 6.866  1.00 27.14  ? 13 LEU A CA  1 
ATOM   107 C C   . LEU A 1 13 ? 23.104 22.460 5.405  1.00 26.55  ? 13 LEU A C   1 
ATOM   108 O O   . LEU A 1 13 ? 21.944 22.780 5.108  1.00 28.64  ? 13 LEU A O   1 
ATOM   109 C CB  . LEU A 1 13 ? 24.157 23.475 7.492  1.00 28.05  ? 13 LEU A CB  1 
ATOM   110 C CG  . LEU A 1 13 ? 23.170 24.504 8.017  1.00 25.31  ? 13 LEU A CG  1 
ATOM   111 C CD1 . LEU A 1 13 ? 22.476 23.966 9.254  1.00 14.20  ? 13 LEU A CD1 1 
ATOM   112 C CD2 . LEU A 1 13 ? 23.912 25.803 8.324  1.00 27.63  ? 13 LEU A CD2 1 
ATOM   113 N N   . SER A 1 14 ? 24.096 22.248 4.511  1.00 19.86  ? 14 SER A N   1 
ATOM   114 C CA  . SER A 1 14 ? 23.951 22.369 3.064  1.00 19.48  ? 14 SER A CA  1 
ATOM   115 C C   . SER A 1 14 ? 22.924 21.363 2.535  1.00 26.92  ? 14 SER A C   1 
ATOM   116 O O   . SER A 1 14 ? 22.143 21.648 1.642  1.00 31.96  ? 14 SER A O   1 
ATOM   117 C CB  . SER A 1 14 ? 25.281 22.166 2.341  1.00 18.94  ? 14 SER A CB  1 
ATOM   118 O OG  . SER A 1 14 ? 26.269 23.043 2.852  1.00 30.31  ? 14 SER A OG  1 
ATOM   119 N N   . LYS A 1 15 ? 22.923 20.161 3.091  1.00 28.73  ? 15 LYS A N   1 
ATOM   120 C CA  . LYS A 1 15 ? 21.961 19.160 2.666  1.00 26.24  ? 15 LYS A CA  1 
ATOM   121 C C   . LYS A 1 15 ? 20.602 19.606 3.114  1.00 19.31  ? 15 LYS A C   1 
ATOM   122 O O   . LYS A 1 15 ? 19.663 19.611 2.357  1.00 19.68  ? 15 LYS A O   1 
ATOM   123 C CB  . LYS A 1 15 ? 22.244 17.774 3.223  1.00 22.96  ? 15 LYS A CB  1 
ATOM   124 C CG  . LYS A 1 15 ? 23.054 16.907 2.281  1.00 44.67  ? 15 LYS A CG  1 
ATOM   125 C CD  . LYS A 1 15 ? 22.509 15.489 2.199  1.00 56.94  ? 15 LYS A CD  1 
ATOM   126 C CE  . LYS A 1 15 ? 23.588 14.437 1.994  1.00 78.51  ? 15 LYS A CE  1 
ATOM   127 N NZ  . LYS A 1 15 ? 24.421 14.670 0.804  1.00 91.06  ? 15 LYS A NZ  1 
ATOM   128 N N   . GLN A 1 16 ? 20.528 20.004 4.383  1.00 23.01  ? 16 GLN A N   1 
ATOM   129 C CA  . GLN A 1 16 ? 19.294 20.484 4.969  1.00 21.78  ? 16 GLN A CA  1 
ATOM   130 C C   . GLN A 1 16 ? 18.684 21.591 4.140  1.00 24.43  ? 16 GLN A C   1 
ATOM   131 O O   . GLN A 1 16 ? 17.499 21.540 3.801  1.00 29.18  ? 16 GLN A O   1 
ATOM   132 C CB  . GLN A 1 16 ? 19.467 20.925 6.428  1.00 26.54  ? 16 GLN A CB  1 
ATOM   133 C CG  . GLN A 1 16 ? 18.134 21.307 7.113  1.00 27.40  ? 16 GLN A CG  1 
ATOM   134 C CD  . GLN A 1 16 ? 18.329 22.066 8.410  1.00 19.73  ? 16 GLN A CD  1 
ATOM   135 O OE1 . GLN A 1 16 ? 18.997 21.601 9.351  1.00 17.55  ? 16 GLN A OE1 1 
ATOM   136 N NE2 . GLN A 1 16 ? 17.750 23.259 8.463  1.00 22.48  ? 16 GLN A NE2 1 
ATOM   137 N N   . TYR A 1 17 ? 19.487 22.593 3.779  1.00 22.39  ? 17 TYR A N   1 
ATOM   138 C CA  . TYR A 1 17 ? 18.954 23.698 2.958  1.00 23.01  ? 17 TYR A CA  1 
ATOM   139 C C   . TYR A 1 17 ? 18.382 23.260 1.629  1.00 24.75  ? 17 TYR A C   1 
ATOM   140 O O   . TYR A 1 17 ? 17.266 23.654 1.248  1.00 22.81  ? 17 TYR A O   1 
ATOM   141 C CB  . TYR A 1 17 ? 19.882 24.917 2.799  1.00 21.02  ? 17 TYR A CB  1 
ATOM   142 C CG  . TYR A 1 17 ? 20.105 25.667 4.091  1.00 12.76  ? 17 TYR A CG  1 
ATOM   143 C CD1 . TYR A 1 17 ? 19.063 25.957 4.977  1.00 14.10  ? 17 TYR A CD1 1 
ATOM   144 C CD2 . TYR A 1 17 ? 21.390 26.087 4.420  1.00 17.46  ? 17 TYR A CD2 1 
ATOM   145 C CE1 . TYR A 1 17 ? 19.295 26.638 6.174  1.00 14.22  ? 17 TYR A CE1 1 
ATOM   146 C CE2 . TYR A 1 17 ? 21.643 26.784 5.599  1.00 23.95  ? 17 TYR A CE2 1 
ATOM   147 C CZ  . TYR A 1 17 ? 20.595 27.045 6.481  1.00 7.67   ? 17 TYR A CZ  1 
ATOM   148 O OH  . TYR A 1 17 ? 20.850 27.729 7.627  1.00 23.35  ? 17 TYR A OH  1 
ATOM   149 N N   . HIS A 1 18 ? 19.141 22.446 0.913  1.00 22.70  ? 18 HIS A N   1 
ATOM   150 C CA  . HIS A 1 18 ? 18.677 21.957 -0.370 1.00 21.84  ? 18 HIS A CA  1 
ATOM   151 C C   . HIS A 1 18 ? 17.291 21.357 -0.198 1.00 31.57  ? 18 HIS A C   1 
ATOM   152 O O   . HIS A 1 18 ? 16.356 21.638 -0.961 1.00 22.14  ? 18 HIS A O   1 
ATOM   153 C CB  . HIS A 1 18 ? 19.643 20.909 -0.912 1.00 24.44  ? 18 HIS A CB  1 
ATOM   154 C CG  . HIS A 1 18 ? 19.106 20.133 -2.068 1.00 30.24  ? 18 HIS A CG  1 
ATOM   155 N ND1 . HIS A 1 18 ? 18.090 19.210 -1.911 1.00 34.04  ? 18 HIS A ND1 1 
ATOM   156 C CD2 . HIS A 1 18 ? 19.467 20.150 -3.373 1.00 36.95  ? 18 HIS A CD2 1 
ATOM   157 C CE1 . HIS A 1 18 ? 17.852 18.696 -3.110 1.00 37.84  ? 18 HIS A CE1 1 
ATOM   158 N NE2 . HIS A 1 18 ? 18.664 19.238 -4.013 1.00 38.76  ? 18 HIS A NE2 1 
ATOM   159 N N   . LEU A 1 19 ? 17.194 20.529 0.861  1.00 35.99  ? 19 LEU A N   1 
ATOM   160 C CA  . LEU A 1 19 ? 15.994 19.815 1.272  1.00 27.78  ? 19 LEU A CA  1 
ATOM   161 C C   . LEU A 1 19 ? 14.820 20.726 1.550  1.00 25.75  ? 19 LEU A C   1 
ATOM   162 O O   . LEU A 1 19 ? 13.700 20.452 1.148  1.00 34.60  ? 19 LEU A O   1 
ATOM   163 C CB  . LEU A 1 19 ? 16.257 18.947 2.518  1.00 30.41  ? 19 LEU A CB  1 
ATOM   164 C CG  . LEU A 1 19 ? 16.857 17.572 2.222  1.00 39.72  ? 19 LEU A CG  1 
ATOM   165 C CD1 . LEU A 1 19 ? 17.046 16.813 3.537  1.00 34.25  ? 19 LEU A CD1 1 
ATOM   166 C CD2 . LEU A 1 19 ? 15.941 16.774 1.293  1.00 48.24  ? 19 LEU A CD2 1 
ATOM   167 N N   . GLU A 1 20 ? 15.040 21.803 2.265  1.00 23.17  ? 20 GLU A N   1 
ATOM   168 C CA  . GLU A 1 20 ? 13.929 22.685 2.550  1.00 31.20  ? 20 GLU A CA  1 
ATOM   169 C C   . GLU A 1 20 ? 13.489 23.423 1.294  1.00 39.85  ? 20 GLU A C   1 
ATOM   170 O O   . GLU A 1 20 ? 12.314 23.762 1.098  1.00 32.77  ? 20 GLU A O   1 
ATOM   171 C CB  . GLU A 1 20 ? 14.218 23.670 3.685  1.00 35.77  ? 20 GLU A CB  1 
ATOM   172 C CG  . GLU A 1 20 ? 14.305 23.018 5.071  1.00 39.43  ? 20 GLU A CG  1 
ATOM   173 C CD  . GLU A 1 20 ? 15.104 23.877 6.001  1.00 38.76  ? 20 GLU A CD  1 
ATOM   174 O OE1 . GLU A 1 20 ? 14.859 25.148 5.843  1.00 80.02  ? 20 GLU A OE1 1 
ATOM   175 O OE2 . GLU A 1 20 ? 15.907 23.440 6.796  1.00 50.30  ? 20 GLU A OE2 1 
ATOM   176 N N   . ASN A 1 21 ? 14.445 23.685 0.420  1.00 45.12  ? 21 ASN A N   1 
ATOM   177 C CA  . ASN A 1 21 ? 14.087 24.377 -0.801 1.00 44.57  ? 21 ASN A CA  1 
ATOM   178 C C   . ASN A 1 21 ? 13.093 23.527 -1.603 1.00 43.98  ? 21 ASN A C   1 
ATOM   179 O O   . ASN A 1 21 ? 12.044 24.020 -2.018 1.00 44.45  ? 21 ASN A O   1 
ATOM   180 C CB  . ASN A 1 21 ? 15.311 24.816 -1.635 1.00 23.14  ? 21 ASN A CB  1 
ATOM   181 C CG  . ASN A 1 21 ? 16.207 25.844 -0.965 1.00 27.08  ? 21 ASN A CG  1 
ATOM   182 O OD1 . ASN A 1 21 ? 15.848 26.504 0.029  1.00 26.24  ? 21 ASN A OD1 1 
ATOM   183 N ND2 . ASN A 1 21 ? 17.412 25.972 -1.511 1.00 32.64  ? 21 ASN A ND2 1 
ATOM   184 N N   . GLU A 1 22 ? 13.452 22.237 -1.771 1.00 30.70  ? 22 GLU A N   1 
ATOM   185 C CA  . GLU A 1 22 ? 12.692 21.212 -2.480 1.00 34.71  ? 22 GLU A CA  1 
ATOM   186 C C   . GLU A 1 22 ? 11.252 21.046 -1.982 1.00 25.29  ? 22 GLU A C   1 
ATOM   187 O O   . GLU A 1 22 ? 10.282 21.090 -2.749 1.00 28.45  ? 22 GLU A O   1 
ATOM   188 C CB  . GLU A 1 22 ? 13.429 19.883 -2.245 1.00 42.11  ? 22 GLU A CB  1 
ATOM   189 C CG  . GLU A 1 22 ? 12.864 18.693 -3.021 1.00 65.17  ? 22 GLU A CG  1 
ATOM   190 C CD  . GLU A 1 22 ? 13.975 17.810 -3.480 1.00 55.35  ? 22 GLU A CD  1 
ATOM   191 O OE1 . GLU A 1 22 ? 14.878 17.438 -2.759 1.00 60.33  ? 22 GLU A OE1 1 
ATOM   192 O OE2 . GLU A 1 22 ? 13.936 17.587 -4.763 1.00 55.45  ? 22 GLU A OE2 1 
ATOM   193 N N   . VAL A 1 23 ? 11.153 20.876 -0.669 1.00 20.70  ? 23 VAL A N   1 
ATOM   194 C CA  . VAL A 1 23 ? 9.905  20.723 0.047  1.00 26.59  ? 23 VAL A CA  1 
ATOM   195 C C   . VAL A 1 23 ? 8.993  21.922 -0.194 1.00 41.48  ? 23 VAL A C   1 
ATOM   196 O O   . VAL A 1 23 ? 7.765  21.828 -0.132 1.00 39.26  ? 23 VAL A O   1 
ATOM   197 C CB  . VAL A 1 23 ? 10.210 20.565 1.528  1.00 31.28  ? 23 VAL A CB  1 
ATOM   198 C CG1 . VAL A 1 23 ? 8.934  20.611 2.363  1.00 27.76  ? 23 VAL A CG1 1 
ATOM   199 C CG2 . VAL A 1 23 ? 10.978 19.249 1.759  1.00 33.08  ? 23 VAL A CG2 1 
ATOM   200 N N   . ALA A 1 24 ? 9.635  23.065 -0.453 1.00 41.69  ? 24 ALA A N   1 
ATOM   201 C CA  . ALA A 1 24 ? 8.958  24.315 -0.732 1.00 39.48  ? 24 ALA A CA  1 
ATOM   202 C C   . ALA A 1 24 ? 8.432  24.235 -2.145 1.00 40.81  ? 24 ALA A C   1 
ATOM   203 O O   . ALA A 1 24 ? 7.264  24.467 -2.430 1.00 46.69  ? 24 ALA A O   1 
ATOM   204 C CB  . ALA A 1 24 ? 9.938  25.466 -0.605 1.00 38.79  ? 24 ALA A CB  1 
ATOM   205 N N   . ARG A 1 25 ? 9.334  23.859 -3.036 1.00 34.36  ? 25 ARG A N   1 
ATOM   206 C CA  . ARG A 1 25 ? 9.005  23.715 -4.425 1.00 35.56  ? 25 ARG A CA  1 
ATOM   207 C C   . ARG A 1 25 ? 7.809  22.796 -4.508 1.00 48.84  ? 25 ARG A C   1 
ATOM   208 O O   . ARG A 1 25 ? 6.798  23.095 -5.138 1.00 51.16  ? 25 ARG A O   1 
ATOM   209 C CB  . ARG A 1 25 ? 10.139 23.018 -5.166 1.00 33.57  ? 25 ARG A CB  1 
ATOM   210 C CG  . ARG A 1 25 ? 9.903  22.959 -6.670 1.00 38.29  ? 25 ARG A CG  1 
ATOM   211 C CD  . ARG A 1 25 ? 10.213 21.611 -7.309 1.00 44.62  ? 25 ARG A CD  1 
ATOM   212 N NE  . ARG A 1 25 ? 11.141 20.789 -6.537 1.00 52.70  ? 25 ARG A NE  1 
ATOM   213 C CZ  . ARG A 1 25 ? 11.553 19.582 -6.936 1.00 78.70  ? 25 ARG A CZ  1 
ATOM   214 N NH1 . ARG A 1 25 ? 11.148 19.050 -8.086 1.00 76.04  ? 25 ARG A NH1 1 
ATOM   215 N NH2 . ARG A 1 25 ? 12.399 18.889 -6.173 1.00 47.22  ? 25 ARG A NH2 1 
ATOM   216 N N   . LEU A 1 26 ? 7.955  21.654 -3.851 1.00 42.94  ? 26 LEU A N   1 
ATOM   217 C CA  . LEU A 1 26 ? 6.917  20.659 -3.837 1.00 31.26  ? 26 LEU A CA  1 
ATOM   218 C C   . LEU A 1 26 ? 5.634  21.180 -3.246 1.00 32.18  ? 26 LEU A C   1 
ATOM   219 O O   . LEU A 1 26 ? 4.564  20.762 -3.672 1.00 30.90  ? 26 LEU A O   1 
ATOM   220 C CB  . LEU A 1 26 ? 7.383  19.300 -3.260 1.00 24.75  ? 26 LEU A CB  1 
ATOM   221 C CG  . LEU A 1 26 ? 8.426  18.614 -4.152 1.00 16.58  ? 26 LEU A CG  1 
ATOM   222 C CD1 . LEU A 1 26 ? 9.056  17.452 -3.417 1.00 17.40  ? 26 LEU A CD1 1 
ATOM   223 C CD2 . LEU A 1 26 ? 7.780  18.065 -5.406 1.00 19.01  ? 26 LEU A CD2 1 
ATOM   224 N N   . LYS A 1 27 ? 5.731  22.116 -2.283 1.00 34.63  ? 27 LYS A N   1 
ATOM   225 C CA  . LYS A 1 27 ? 4.515  22.655 -1.690 1.00 40.75  ? 27 LYS A CA  1 
ATOM   226 C C   . LYS A 1 27 ? 3.696  23.457 -2.695 1.00 58.16  ? 27 LYS A C   1 
ATOM   227 O O   . LYS A 1 27 ? 2.535  23.136 -2.963 1.00 58.18  ? 27 LYS A O   1 
ATOM   228 C CB  . LYS A 1 27 ? 4.686  23.369 -0.358 1.00 42.66  ? 27 LYS A CB  1 
ATOM   229 C CG  . LYS A 1 27 ? 4.888  22.418 0.805  1.00 23.88  ? 27 LYS A CG  1 
ATOM   230 C CD  . LYS A 1 27 ? 4.409  22.985 2.133  1.00 25.73  ? 27 LYS A CD  1 
ATOM   231 C CE  . LYS A 1 27 ? 5.164  22.445 3.346  1.00 31.84  ? 27 LYS A CE  1 
ATOM   232 N NZ  . LYS A 1 27 ? 5.288  20.977 3.360  1.00 41.63  ? 27 LYS A NZ  1 
ATOM   233 N N   . LYS A 1 28 ? 4.299  24.495 -3.271 1.00 58.69  ? 28 LYS A N   1 
ATOM   234 C CA  . LYS A 1 28 ? 3.567  25.269 -4.249 1.00 62.68  ? 28 LYS A CA  1 
ATOM   235 C C   . LYS A 1 28 ? 2.818  24.307 -5.146 1.00 70.26  ? 28 LYS A C   1 
ATOM   236 O O   . LYS A 1 28 ? 1.635  24.457 -5.420 1.00 72.75  ? 28 LYS A O   1 
ATOM   237 C CB  . LYS A 1 28 ? 4.500  26.100 -5.127 1.00 67.77  ? 28 LYS A CB  1 
ATOM   238 C CG  . LYS A 1 28 ? 4.682  27.523 -4.642 1.00 70.82  ? 28 LYS A CG  1 
ATOM   239 C CD  . LYS A 1 28 ? 5.916  28.192 -5.218 1.00 75.73  ? 28 LYS A CD  1 
ATOM   240 C CE  . LYS A 1 28 ? 6.299  29.457 -4.462 1.00 99.71  ? 28 LYS A CE  1 
ATOM   241 N NZ  . LYS A 1 28 ? 6.483  29.239 -3.016 1.00 94.42  ? 28 LYS A NZ  1 
ATOM   242 N N   . LEU A 1 29 ? 3.559  23.308 -5.586 1.00 62.41  ? 29 LEU A N   1 
ATOM   243 C CA  . LEU A 1 29 ? 3.085  22.272 -6.460 1.00 57.34  ? 29 LEU A CA  1 
ATOM   244 C C   . LEU A 1 29 ? 1.693  21.814 -6.145 1.00 57.60  ? 29 LEU A C   1 
ATOM   245 O O   . LEU A 1 29 ? 1.023  21.294 -7.020 1.00 56.56  ? 29 LEU A O   1 
ATOM   246 C CB  . LEU A 1 29 ? 4.063  21.079 -6.509 1.00 56.12  ? 29 LEU A CB  1 
ATOM   247 C CG  . LEU A 1 29 ? 4.281  20.595 -7.935 1.00 54.32  ? 29 LEU A CG  1 
ATOM   248 C CD1 . LEU A 1 29 ? 3.928  21.735 -8.878 1.00 58.09  ? 29 LEU A CD1 1 
ATOM   249 C CD2 . LEU A 1 29 ? 5.737  20.201 -8.178 1.00 29.39  ? 29 LEU A CD2 1 
ATOM   250 N N   . VAL A 1 30 ? 1.261  21.993 -4.898 1.00 54.78  ? 30 VAL A N   1 
ATOM   251 C CA  . VAL A 1 30 ? -0.088 21.571 -4.519 1.00 71.37  ? 30 VAL A CA  1 
ATOM   252 C C   . VAL A 1 30 ? -1.100 22.720 -4.650 1.00 100.00 ? 30 VAL A C   1 
ATOM   253 O O   . VAL A 1 30 ? -0.866 23.872 -4.258 1.00 56.37  ? 30 VAL A O   1 
ATOM   254 C CB  . VAL A 1 30 ? -0.163 20.881 -3.148 1.00 70.48  ? 30 VAL A CB  1 
ATOM   255 C CG1 . VAL A 1 30 ? -1.348 19.924 -3.107 1.00 68.19  ? 30 VAL A CG1 1 
ATOM   256 C CG2 . VAL A 1 30 ? 1.131  20.131 -2.838 1.00 69.15  ? 30 VAL A CG2 1 
ATOM   257 N N   . ARG B 1 1  ? 34.429 21.471 21.610 1.00 68.98  ? 1  ARG B N   1 
ATOM   258 C CA  . ARG B 1 1  ? 33.902 20.503 22.555 1.00 65.94  ? 1  ARG B CA  1 
ATOM   259 C C   . ARG B 1 1  ? 33.064 19.451 21.831 1.00 61.61  ? 1  ARG B C   1 
ATOM   260 O O   . ARG B 1 1  ? 31.945 19.724 21.374 1.00 61.24  ? 1  ARG B O   1 
ATOM   261 C CB  . ARG B 1 1  ? 33.203 21.188 23.724 1.00 57.87  ? 1  ARG B CB  1 
ATOM   262 C CG  . ARG B 1 1  ? 32.682 20.215 24.756 1.00 52.32  ? 1  ARG B CG  1 
ATOM   263 C CD  . ARG B 1 1  ? 31.373 19.586 24.301 1.00 37.95  ? 1  ARG B CD  1 
ATOM   264 N NE  . ARG B 1 1  ? 30.952 18.482 25.144 1.00 48.63  ? 1  ARG B NE  1 
ATOM   265 C CZ  . ARG B 1 1  ? 30.445 18.628 26.355 1.00 55.95  ? 1  ARG B CZ  1 
ATOM   266 N NH1 . ARG B 1 1  ? 30.295 19.832 26.917 1.00 49.21  ? 1  ARG B NH1 1 
ATOM   267 N NH2 . ARG B 1 1  ? 30.079 17.530 27.021 1.00 45.13  ? 1  ARG B NH2 1 
ATOM   268 N N   . MET B 1 2  ? 33.655 18.248 21.735 1.00 49.21  ? 2  MET B N   1 
ATOM   269 C CA  . MET B 1 2  ? 33.115 17.057 21.063 1.00 45.33  ? 2  MET B CA  1 
ATOM   270 C C   . MET B 1 2  ? 31.650 16.638 21.162 1.00 37.03  ? 2  MET B C   1 
ATOM   271 O O   . MET B 1 2  ? 30.942 16.579 20.143 1.00 32.29  ? 2  MET B O   1 
ATOM   272 C CB  . MET B 1 2  ? 34.050 15.852 21.110 1.00 50.34  ? 2  MET B CB  1 
ATOM   273 C CG  . MET B 1 2  ? 34.885 15.745 19.846 1.00 55.87  ? 2  MET B CG  1 
ATOM   274 S SD  . MET B 1 2  ? 36.603 15.317 20.174 1.00 62.89  ? 2  MET B SD  1 
ATOM   275 C CE  . MET B 1 2  ? 36.362 13.978 21.364 1.00 60.82  ? 2  MET B CE  1 
ATOM   276 N N   . LYS B 1 3  ? 31.199 16.319 22.364 1.00 25.33  ? 3  LYS B N   1 
ATOM   277 C CA  . LYS B 1 3  ? 29.830 15.871 22.568 1.00 19.17  ? 3  LYS B CA  1 
ATOM   278 C C   . LYS B 1 3  ? 28.756 16.825 22.058 1.00 24.26  ? 3  LYS B C   1 
ATOM   279 O O   . LYS B 1 3  ? 27.686 16.414 21.615 1.00 31.30  ? 3  LYS B O   1 
ATOM   280 C CB  . LYS B 1 3  ? 29.576 15.458 23.999 1.00 25.12  ? 3  LYS B CB  1 
ATOM   281 C CG  . LYS B 1 3  ? 30.383 14.245 24.422 1.00 69.05  ? 3  LYS B CG  1 
ATOM   282 C CD  . LYS B 1 3  ? 31.887 14.466 24.353 1.00 92.12  ? 3  LYS B CD  1 
ATOM   283 C CE  . LYS B 1 3  ? 32.499 14.968 25.654 1.00 100.00 ? 3  LYS B CE  1 
ATOM   284 N NZ  . LYS B 1 3  ? 33.975 15.044 25.593 1.00 88.00  ? 3  LYS B NZ  1 
ATOM   285 N N   . GLN B 1 4  ? 28.999 18.108 22.135 1.00 22.60  ? 4  GLN B N   1 
ATOM   286 C CA  . GLN B 1 4  ? 27.972 18.992 21.645 1.00 27.82  ? 4  GLN B CA  1 
ATOM   287 C C   . GLN B 1 4  ? 27.970 18.921 20.118 1.00 22.15  ? 4  GLN B C   1 
ATOM   288 O O   . GLN B 1 4  ? 26.922 18.837 19.496 1.00 26.09  ? 4  GLN B O   1 
ATOM   289 C CB  . GLN B 1 4  ? 27.896 20.408 22.308 1.00 36.18  ? 4  GLN B CB  1 
ATOM   290 C CG  . GLN B 1 4  ? 27.512 20.391 23.830 1.00 38.50  ? 4  GLN B CG  1 
ATOM   291 C CD  . GLN B 1 4  ? 27.452 21.776 24.512 1.00 57.21  ? 4  GLN B CD  1 
ATOM   292 O OE1 . GLN B 1 4  ? 26.793 22.724 24.047 1.00 43.91  ? 4  GLN B OE1 1 
ATOM   293 N NE2 . GLN B 1 4  ? 28.146 21.905 25.632 1.00 46.71  ? 4  GLN B NE2 1 
ATOM   294 N N   . LEU B 1 5  ? 29.170 18.904 19.518 1.00 14.69  ? 5  LEU B N   1 
ATOM   295 C CA  . LEU B 1 5  ? 29.339 18.804 18.051 1.00 21.18  ? 5  LEU B CA  1 
ATOM   296 C C   . LEU B 1 5  ? 28.757 17.484 17.612 1.00 24.84  ? 5  LEU B C   1 
ATOM   297 O O   . LEU B 1 5  ? 28.015 17.412 16.640 1.00 32.38  ? 5  LEU B O   1 
ATOM   298 C CB  . LEU B 1 5  ? 30.825 18.883 17.572 1.00 22.06  ? 5  LEU B CB  1 
ATOM   299 C CG  . LEU B 1 5  ? 31.472 20.291 17.390 1.00 21.82  ? 5  LEU B CG  1 
ATOM   300 C CD1 . LEU B 1 5  ? 32.982 20.118 17.420 1.00 17.44  ? 5  LEU B CD1 1 
ATOM   301 C CD2 . LEU B 1 5  ? 31.137 20.919 16.036 1.00 1.00   ? 5  LEU B CD2 1 
ATOM   302 N N   . GLU B 1 6  ? 29.111 16.436 18.366 1.00 24.52  ? 6  GLU B N   1 
ATOM   303 C CA  . GLU B 1 6  ? 28.630 15.069 18.116 1.00 18.73  ? 6  GLU B CA  1 
ATOM   304 C C   . GLU B 1 6  ? 27.093 15.038 18.207 1.00 18.73  ? 6  GLU B C   1 
ATOM   305 O O   . GLU B 1 6  ? 26.416 14.382 17.450 1.00 28.39  ? 6  GLU B O   1 
ATOM   306 C CB  . GLU B 1 6  ? 29.286 14.059 19.100 1.00 12.75  ? 6  GLU B CB  1 
ATOM   307 C CG  . GLU B 1 6  ? 30.692 13.588 18.654 1.00 11.48  ? 6  GLU B CG  1 
ATOM   308 C CD  . GLU B 1 6  ? 31.612 13.219 19.802 1.00 9.88   ? 6  GLU B CD  1 
ATOM   309 O OE1 . GLU B 1 6  ? 31.272 12.547 20.754 1.00 27.19  ? 6  GLU B OE1 1 
ATOM   310 O OE2 . GLU B 1 6  ? 32.804 13.766 19.703 1.00 43.54  ? 6  GLU B OE2 1 
ATOM   311 N N   . ASP B 1 7  ? 26.576 15.806 19.159 1.00 21.32  ? 7  ASP B N   1 
ATOM   312 C CA  . ASP B 1 7  ? 25.148 15.954 19.440 1.00 23.26  ? 7  ASP B CA  1 
ATOM   313 C C   . ASP B 1 7  ? 24.404 16.668 18.344 1.00 16.53  ? 7  ASP B C   1 
ATOM   314 O O   . ASP B 1 7  ? 23.292 16.301 18.019 1.00 16.19  ? 7  ASP B O   1 
ATOM   315 C CB  . ASP B 1 7  ? 24.914 16.688 20.767 1.00 25.69  ? 7  ASP B CB  1 
ATOM   316 C CG  . ASP B 1 7  ? 24.912 15.779 21.949 1.00 28.60  ? 7  ASP B CG  1 
ATOM   317 O OD1 . ASP B 1 7  ? 25.118 14.587 21.845 1.00 30.54  ? 7  ASP B OD1 1 
ATOM   318 O OD2 . ASP B 1 7  ? 24.638 16.392 23.086 1.00 45.08  ? 7  ASP B OD2 1 
ATOM   319 N N   . LYS B 1 8  ? 25.057 17.702 17.813 1.00 19.14  ? 8  LYS B N   1 
ATOM   320 C CA  . LYS B 1 8  ? 24.549 18.543 16.730 1.00 20.08  ? 8  LYS B CA  1 
ATOM   321 C C   . LYS B 1 8  ? 24.452 17.735 15.429 1.00 21.90  ? 8  LYS B C   1 
ATOM   322 O O   . LYS B 1 8  ? 23.549 17.935 14.599 1.00 26.80  ? 8  LYS B O   1 
ATOM   323 C CB  . LYS B 1 8  ? 25.420 19.800 16.559 1.00 19.48  ? 8  LYS B CB  1 
ATOM   324 C CG  . LYS B 1 8  ? 25.098 20.593 15.325 1.00 14.94  ? 8  LYS B CG  1 
ATOM   325 C CD  . LYS B 1 8  ? 23.725 21.224 15.376 1.00 31.30  ? 8  LYS B CD  1 
ATOM   326 C CE  . LYS B 1 8  ? 23.702 22.576 16.066 1.00 54.77  ? 8  LYS B CE  1 
ATOM   327 N NZ  . LYS B 1 8  ? 22.402 23.244 15.954 1.00 54.98  ? 8  LYS B NZ  1 
ATOM   328 N N   . VAL B 1 9  ? 25.391 16.800 15.263 1.00 18.04  ? 9  VAL B N   1 
ATOM   329 C CA  . VAL B 1 9  ? 25.414 15.934 14.092 1.00 17.54  ? 9  VAL B CA  1 
ATOM   330 C C   . VAL B 1 9  ? 24.197 14.992 14.115 1.00 23.10  ? 9  VAL B C   1 
ATOM   331 O O   . VAL B 1 9  ? 23.409 14.902 13.146 1.00 13.60  ? 9  VAL B O   1 
ATOM   332 C CB  . VAL B 1 9  ? 26.744 15.156 13.981 1.00 14.48  ? 9  VAL B CB  1 
ATOM   333 C CG1 . VAL B 1 9  ? 26.596 13.921 13.063 1.00 7.37   ? 9  VAL B CG1 1 
ATOM   334 C CG2 . VAL B 1 9  ? 27.821 16.071 13.382 1.00 12.99  ? 9  VAL B CG2 1 
ATOM   335 N N   . GLU B 1 10 ? 24.053 14.290 15.251 1.00 20.97  ? 10 GLU B N   1 
ATOM   336 C CA  . GLU B 1 10 ? 22.963 13.381 15.428 1.00 14.96  ? 10 GLU B CA  1 
ATOM   337 C C   . GLU B 1 10 ? 21.676 14.163 15.391 1.00 21.42  ? 10 GLU B C   1 
ATOM   338 O O   . GLU B 1 10 ? 20.610 13.635 15.112 1.00 23.67  ? 10 GLU B O   1 
ATOM   339 C CB  . GLU B 1 10 ? 23.066 12.632 16.760 1.00 18.96  ? 10 GLU B CB  1 
ATOM   340 C CG  . GLU B 1 10 ? 24.321 11.742 16.855 1.00 39.76  ? 10 GLU B CG  1 
ATOM   341 C CD  . GLU B 1 10 ? 24.751 11.443 18.275 1.00 59.85  ? 10 GLU B CD  1 
ATOM   342 O OE1 . GLU B 1 10 ? 23.995 11.363 19.215 1.00 27.63  ? 10 GLU B OE1 1 
ATOM   343 O OE2 . GLU B 1 10 ? 26.039 11.348 18.388 1.00 62.27  ? 10 GLU B OE2 1 
ATOM   344 N N   . GLU B 1 11 ? 21.773 15.448 15.671 1.00 25.34  ? 11 GLU B N   1 
ATOM   345 C CA  . GLU B 1 11 ? 20.585 16.272 15.662 1.00 24.43  ? 11 GLU B CA  1 
ATOM   346 C C   . GLU B 1 11 ? 20.149 16.629 14.250 1.00 20.21  ? 11 GLU B C   1 
ATOM   347 O O   . GLU B 1 11 ? 18.991 16.465 13.876 1.00 18.05  ? 11 GLU B O   1 
ATOM   348 C CB  . GLU B 1 11 ? 20.640 17.444 16.662 1.00 26.32  ? 11 GLU B CB  1 
ATOM   349 C CG  . GLU B 1 11 ? 20.313 16.945 18.083 1.00 20.94  ? 11 GLU B CG  1 
ATOM   350 C CD  . GLU B 1 11 ? 20.477 17.987 19.134 1.00 53.16  ? 11 GLU B CD  1 
ATOM   351 O OE1 . GLU B 1 11 ? 20.880 19.118 18.891 1.00 47.70  ? 11 GLU B OE1 1 
ATOM   352 O OE2 . GLU B 1 11 ? 20.151 17.537 20.333 1.00 35.90  ? 11 GLU B OE2 1 
ATOM   353 N N   . LEU B 1 12 ? 21.109 17.099 13.462 1.00 19.50  ? 12 LEU B N   1 
ATOM   354 C CA  . LEU B 1 12 ? 20.886 17.477 12.075 1.00 19.25  ? 12 LEU B CA  1 
ATOM   355 C C   . LEU B 1 12 ? 20.456 16.277 11.216 1.00 30.69  ? 12 LEU B C   1 
ATOM   356 O O   . LEU B 1 12 ? 19.531 16.342 10.390 1.00 29.94  ? 12 LEU B O   1 
ATOM   357 C CB  . LEU B 1 12 ? 22.187 18.050 11.485 1.00 15.75  ? 12 LEU B CB  1 
ATOM   358 C CG  . LEU B 1 12 ? 22.513 19.452 11.960 1.00 17.73  ? 12 LEU B CG  1 
ATOM   359 C CD1 . LEU B 1 12 ? 23.991 19.703 11.786 1.00 17.72  ? 12 LEU B CD1 1 
ATOM   360 C CD2 . LEU B 1 12 ? 21.775 20.473 11.115 1.00 18.15  ? 12 LEU B CD2 1 
ATOM   361 N N   . LEU B 1 13 ? 21.165 15.177 11.428 1.00 25.48  ? 13 LEU B N   1 
ATOM   362 C CA  . LEU B 1 13 ? 20.958 13.928 10.726 1.00 23.68  ? 13 LEU B CA  1 
ATOM   363 C C   . LEU B 1 13 ? 19.536 13.359 10.817 1.00 25.56  ? 13 LEU B C   1 
ATOM   364 O O   . LEU B 1 13 ? 19.042 12.718 9.881  1.00 23.55  ? 13 LEU B O   1 
ATOM   365 C CB  . LEU B 1 13 ? 22.046 12.918 11.148 1.00 25.82  ? 13 LEU B CB  1 
ATOM   366 C CG  . LEU B 1 13 ? 22.002 11.587 10.406 1.00 27.83  ? 13 LEU B CG  1 
ATOM   367 C CD1 . LEU B 1 13 ? 22.317 11.771 8.918  1.00 19.55  ? 13 LEU B CD1 1 
ATOM   368 C CD2 . LEU B 1 13 ? 22.978 10.611 11.065 1.00 29.38  ? 13 LEU B CD2 1 
ATOM   369 N N   . SER B 1 14 ? 18.874 13.595 11.951 1.00 22.94  ? 14 SER B N   1 
ATOM   370 C CA  . SER B 1 14 ? 17.495 13.131 12.158 1.00 23.92  ? 14 SER B CA  1 
ATOM   371 C C   . SER B 1 14 ? 16.512 14.054 11.458 1.00 22.29  ? 14 SER B C   1 
ATOM   372 O O   . SER B 1 14 ? 15.454 13.635 11.013 1.00 22.11  ? 14 SER B O   1 
ATOM   373 C CB  . SER B 1 14 ? 17.111 13.004 13.622 1.00 28.69  ? 14 SER B CB  1 
ATOM   374 O OG  . SER B 1 14 ? 16.268 14.088 13.962 1.00 43.29  ? 14 SER B OG  1 
ATOM   375 N N   . LYS B 1 15 ? 16.866 15.343 11.364 1.00 28.08  ? 15 LYS B N   1 
ATOM   376 C CA  . LYS B 1 15 ? 16.004 16.295 10.684 1.00 24.28  ? 15 LYS B CA  1 
ATOM   377 C C   . LYS B 1 15 ? 16.097 15.979 9.214  1.00 22.18  ? 15 LYS B C   1 
ATOM   378 O O   . LYS B 1 15 ? 15.163 16.088 8.454  1.00 19.39  ? 15 LYS B O   1 
ATOM   379 C CB  . LYS B 1 15 ? 16.408 17.739 10.907 1.00 32.36  ? 15 LYS B CB  1 
ATOM   380 C CG  . LYS B 1 15 ? 15.493 18.734 10.215 1.00 42.35  ? 15 LYS B CG  1 
ATOM   381 C CD  . LYS B 1 15 ? 16.293 19.840 9.554  1.00 67.47  ? 15 LYS B CD  1 
ATOM   382 C CE  . LYS B 1 15 ? 15.736 21.233 9.799  1.00 90.64  ? 15 LYS B CE  1 
ATOM   383 N NZ  . LYS B 1 15 ? 14.391 21.428 9.240  1.00 100.00 ? 15 LYS B NZ  1 
ATOM   384 N N   . GLN B 1 16 ? 17.268 15.543 8.815  1.00 25.19  ? 16 GLN B N   1 
ATOM   385 C CA  . GLN B 1 16 ? 17.470 15.188 7.442  1.00 24.05  ? 16 GLN B CA  1 
ATOM   386 C C   . GLN B 1 16 ? 16.569 14.051 6.988  1.00 28.18  ? 16 GLN B C   1 
ATOM   387 O O   . GLN B 1 16 ? 16.058 14.076 5.872  1.00 33.14  ? 16 GLN B O   1 
ATOM   388 C CB  . GLN B 1 16 ? 18.923 14.826 7.184  1.00 29.48  ? 16 GLN B CB  1 
ATOM   389 C CG  . GLN B 1 16 ? 19.079 14.214 5.797  1.00 39.15  ? 16 GLN B CG  1 
ATOM   390 C CD  . GLN B 1 16 ? 20.507 14.210 5.397  1.00 30.18  ? 16 GLN B CD  1 
ATOM   391 O OE1 . GLN B 1 16 ? 21.073 15.273 5.114  1.00 32.90  ? 16 GLN B OE1 1 
ATOM   392 N NE2 . GLN B 1 16 ? 21.116 13.036 5.473  1.00 40.21  ? 16 GLN B NE2 1 
ATOM   393 N N   . TYR B 1 17 ? 16.386 13.046 7.865  1.00 31.03  ? 17 TYR B N   1 
ATOM   394 C CA  . TYR B 1 17 ? 15.547 11.872 7.580  1.00 22.07  ? 17 TYR B CA  1 
ATOM   395 C C   . TYR B 1 17 ? 14.092 12.262 7.499  1.00 21.68  ? 17 TYR B C   1 
ATOM   396 O O   . TYR B 1 17 ? 13.335 11.743 6.682  1.00 19.34  ? 17 TYR B O   1 
ATOM   397 C CB  . TYR B 1 17 ? 15.754 10.722 8.595  1.00 24.72  ? 17 TYR B CB  1 
ATOM   398 C CG  . TYR B 1 17 ? 17.124 10.088 8.480  1.00 32.95  ? 17 TYR B CG  1 
ATOM   399 C CD1 . TYR B 1 17 ? 17.713 9.972  7.221  1.00 39.53  ? 17 TYR B CD1 1 
ATOM   400 C CD2 . TYR B 1 17 ? 17.831 9.599  9.581  1.00 31.56  ? 17 TYR B CD2 1 
ATOM   401 C CE1 . TYR B 1 17 ? 18.979 9.412  7.053  1.00 44.69  ? 17 TYR B CE1 1 
ATOM   402 C CE2 . TYR B 1 17 ? 19.093 9.020  9.434  1.00 31.41  ? 17 TYR B CE2 1 
ATOM   403 C CZ  . TYR B 1 17 ? 19.665 8.935  8.164  1.00 34.41  ? 17 TYR B CZ  1 
ATOM   404 O OH  . TYR B 1 17 ? 20.893 8.374  7.995  1.00 39.13  ? 17 TYR B OH  1 
ATOM   405 N N   . HIS B 1 18 ? 13.705 13.199 8.358  1.00 17.29  ? 18 HIS B N   1 
ATOM   406 C CA  . HIS B 1 18 ? 12.329 13.663 8.367  1.00 24.03  ? 18 HIS B CA  1 
ATOM   407 C C   . HIS B 1 18 ? 11.959 14.566 7.175  1.00 28.19  ? 18 HIS B C   1 
ATOM   408 O O   . HIS B 1 18 ? 10.805 14.619 6.749  1.00 36.48  ? 18 HIS B O   1 
ATOM   409 C CB  . HIS B 1 18 ? 11.902 14.287 9.703  1.00 30.56  ? 18 HIS B CB  1 
ATOM   410 C CG  . HIS B 1 18 ? 10.588 14.957 9.536  1.00 35.05  ? 18 HIS B CG  1 
ATOM   411 N ND1 . HIS B 1 18 ? 10.506 16.314 9.253  1.00 37.79  ? 18 HIS B ND1 1 
ATOM   412 C CD2 . HIS B 1 18 ? 9.330  14.447 9.566  1.00 38.77  ? 18 HIS B CD2 1 
ATOM   413 C CE1 . HIS B 1 18 ? 9.219  16.603 9.125  1.00 37.27  ? 18 HIS B CE1 1 
ATOM   414 N NE2 . HIS B 1 18 ? 8.487  15.503 9.322  1.00 38.79  ? 18 HIS B NE2 1 
ATOM   415 N N   . LEU B 1 19 ? 12.931 15.297 6.640  1.00 21.01  ? 19 LEU B N   1 
ATOM   416 C CA  . LEU B 1 19 ? 12.692 16.174 5.509  1.00 23.00  ? 19 LEU B CA  1 
ATOM   417 C C   . LEU B 1 19 ? 12.628 15.340 4.247  1.00 23.98  ? 19 LEU B C   1 
ATOM   418 O O   . LEU B 1 19 ? 11.753 15.534 3.425  1.00 35.73  ? 19 LEU B O   1 
ATOM   419 C CB  . LEU B 1 19 ? 13.769 17.277 5.365  1.00 28.83  ? 19 LEU B CB  1 
ATOM   420 C CG  . LEU B 1 19 ? 13.723 18.341 6.467  1.00 37.03  ? 19 LEU B CG  1 
ATOM   421 C CD1 . LEU B 1 19 ? 14.579 19.551 6.084  1.00 30.99  ? 19 LEU B CD1 1 
ATOM   422 C CD2 . LEU B 1 19 ? 12.276 18.764 6.739  1.00 36.71  ? 19 LEU B CD2 1 
ATOM   423 N N   . GLU B 1 20 ? 13.582 14.414 4.140  1.00 15.81  ? 20 GLU B N   1 
ATOM   424 C CA  . GLU B 1 20 ? 13.720 13.482 3.036  1.00 14.11  ? 20 GLU B CA  1 
ATOM   425 C C   . GLU B 1 20 ? 12.423 12.735 2.783  1.00 21.63  ? 20 GLU B C   1 
ATOM   426 O O   . GLU B 1 20 ? 11.932 12.708 1.652  1.00 32.46  ? 20 GLU B O   1 
ATOM   427 C CB  . GLU B 1 20 ? 14.829 12.446 3.328  1.00 13.28  ? 20 GLU B CB  1 
ATOM   428 C CG  . GLU B 1 20 ? 16.212 12.778 2.769  1.00 20.72  ? 20 GLU B CG  1 
ATOM   429 C CD  . GLU B 1 20 ? 17.251 11.737 3.132  1.00 50.22  ? 20 GLU B CD  1 
ATOM   430 O OE1 . GLU B 1 20 ? 17.005 10.743 3.778  1.00 55.96  ? 20 GLU B OE1 1 
ATOM   431 O OE2 . GLU B 1 20 ? 18.457 12.047 2.706  1.00 37.55  ? 20 GLU B OE2 1 
ATOM   432 N N   . ASN B 1 21 ? 11.861 12.119 3.839  1.00 25.88  ? 21 ASN B N   1 
ATOM   433 C CA  . ASN B 1 21 ? 10.602 11.372 3.707  1.00 26.17  ? 21 ASN B CA  1 
ATOM   434 C C   . ASN B 1 21 ? 9.412  12.292 3.427  1.00 29.39  ? 21 ASN B C   1 
ATOM   435 O O   . ASN B 1 21 ? 8.337  11.873 2.963  1.00 19.77  ? 21 ASN B O   1 
ATOM   436 C CB  . ASN B 1 21 ? 10.208 10.498 4.926  1.00 33.22  ? 21 ASN B CB  1 
ATOM   437 C CG  . ASN B 1 21 ? 11.288 10.003 5.856  1.00 27.83  ? 21 ASN B CG  1 
ATOM   438 O OD1 . ASN B 1 21 ? 12.456 9.829  5.475  1.00 43.59  ? 21 ASN B OD1 1 
ATOM   439 N ND2 . ASN B 1 21 ? 10.869 9.748  7.098  1.00 21.95  ? 21 ASN B ND2 1 
ATOM   440 N N   . GLU B 1 22 ? 9.586  13.558 3.745  1.00 33.12  ? 22 GLU B N   1 
ATOM   441 C CA  . GLU B 1 22 ? 8.528  14.508 3.508  1.00 38.35  ? 22 GLU B CA  1 
ATOM   442 C C   . GLU B 1 22 ? 8.388  14.699 2.012  1.00 33.83  ? 22 GLU B C   1 
ATOM   443 O O   . GLU B 1 22 ? 7.322  14.575 1.424  1.00 29.35  ? 22 GLU B O   1 
ATOM   444 C CB  . GLU B 1 22 ? 8.844  15.853 4.169  1.00 42.94  ? 22 GLU B CB  1 
ATOM   445 C CG  . GLU B 1 22 ? 7.588  16.724 4.328  1.00 58.07  ? 22 GLU B CG  1 
ATOM   446 C CD  . GLU B 1 22 ? 7.918  18.113 4.743  1.00 42.87  ? 22 GLU B CD  1 
ATOM   447 O OE1 . GLU B 1 22 ? 8.962  18.423 5.278  1.00 61.30  ? 22 GLU B OE1 1 
ATOM   448 O OE2 . GLU B 1 22 ? 6.999  18.959 4.405  1.00 35.58  ? 22 GLU B OE2 1 
ATOM   449 N N   . VAL B 1 23 ? 9.524  15.011 1.421  1.00 31.26  ? 23 VAL B N   1 
ATOM   450 C CA  . VAL B 1 23 ? 9.617  15.210 0.012  1.00 33.17  ? 23 VAL B CA  1 
ATOM   451 C C   . VAL B 1 23 ? 9.023  13.993 -0.640 1.00 40.06  ? 23 VAL B C   1 
ATOM   452 O O   . VAL B 1 23 ? 8.078  14.078 -1.394 1.00 34.98  ? 23 VAL B O   1 
ATOM   453 C CB  . VAL B 1 23 ? 11.082 15.337 -0.381 1.00 30.10  ? 23 VAL B CB  1 
ATOM   454 C CG1 . VAL B 1 23 ? 11.187 15.536 -1.877 1.00 30.67  ? 23 VAL B CG1 1 
ATOM   455 C CG2 . VAL B 1 23 ? 11.710 16.520 0.350  1.00 27.95  ? 23 VAL B CG2 1 
ATOM   456 N N   . ALA B 1 24 ? 9.594  12.840 -0.307 1.00 40.46  ? 24 ALA B N   1 
ATOM   457 C CA  . ALA B 1 24 ? 9.117  11.596 -0.844 1.00 40.83  ? 24 ALA B CA  1 
ATOM   458 C C   . ALA B 1 24 ? 7.590  11.513 -0.811 1.00 48.69  ? 24 ALA B C   1 
ATOM   459 O O   . ALA B 1 24 ? 6.977  11.129 -1.805 1.00 44.26  ? 24 ALA B O   1 
ATOM   460 C CB  . ALA B 1 24 ? 9.783  10.423 -0.144 1.00 42.77  ? 24 ALA B CB  1 
ATOM   461 N N   . ARG B 1 25 ? 6.974  11.885 0.337  1.00 55.38  ? 25 ARG B N   1 
ATOM   462 C CA  . ARG B 1 25 ? 5.509  11.864 0.496  1.00 52.45  ? 25 ARG B CA  1 
ATOM   463 C C   . ARG B 1 25 ? 4.839  12.865 -0.419 1.00 46.73  ? 25 ARG B C   1 
ATOM   464 O O   . ARG B 1 25 ? 3.793  12.589 -0.977 1.00 48.08  ? 25 ARG B O   1 
ATOM   465 C CB  . ARG B 1 25 ? 5.025  12.101 1.933  1.00 54.84  ? 25 ARG B CB  1 
ATOM   466 C CG  . ARG B 1 25 ? 5.628  11.166 2.989  1.00 83.68  ? 25 ARG B CG  1 
ATOM   467 C CD  . ARG B 1 25 ? 4.726  10.931 4.216  1.00 100.00 ? 25 ARG B CD  1 
ATOM   468 N NE  . ARG B 1 25 ? 4.214  12.151 4.862  1.00 100.00 ? 25 ARG B NE  1 
ATOM   469 C CZ  . ARG B 1 25 ? 4.892  12.872 5.767  1.00 100.00 ? 25 ARG B CZ  1 
ATOM   470 N NH1 . ARG B 1 25 ? 6.125  12.539 6.165  1.00 100.00 ? 25 ARG B NH1 1 
ATOM   471 N NH2 . ARG B 1 25 ? 4.326  13.964 6.292  1.00 80.62  ? 25 ARG B NH2 1 
ATOM   472 N N   . LEU B 1 26 ? 5.475  14.031 -0.550 1.00 43.75  ? 26 LEU B N   1 
ATOM   473 C CA  . LEU B 1 26 ? 5.019  15.146 -1.383 1.00 38.97  ? 26 LEU B CA  1 
ATOM   474 C C   . LEU B 1 26 ? 5.030  14.818 -2.872 1.00 33.38  ? 26 LEU B C   1 
ATOM   475 O O   . LEU B 1 26 ? 4.137  15.228 -3.597 1.00 36.60  ? 26 LEU B O   1 
ATOM   476 C CB  . LEU B 1 26 ? 5.816  16.453 -1.105 1.00 36.20  ? 26 LEU B CB  1 
ATOM   477 C CG  . LEU B 1 26 ? 5.205  17.368 -0.037 1.00 35.81  ? 26 LEU B CG  1 
ATOM   478 C CD1 . LEU B 1 26 ? 6.174  18.483 0.326  1.00 29.87  ? 26 LEU B CD1 1 
ATOM   479 C CD2 . LEU B 1 26 ? 3.908  17.979 -0.556 1.00 39.89  ? 26 LEU B CD2 1 
ATOM   480 N N   . LYS B 1 27 ? 6.051  14.081 -3.315 1.00 34.84  ? 27 LYS B N   1 
ATOM   481 C CA  . LYS B 1 27 ? 6.195  13.679 -4.717 1.00 39.52  ? 27 LYS B CA  1 
ATOM   482 C C   . LYS B 1 27 ? 5.040  12.824 -5.168 1.00 49.85  ? 27 LYS B C   1 
ATOM   483 O O   . LYS B 1 27 ? 4.587  12.907 -6.308 1.00 50.31  ? 27 LYS B O   1 
ATOM   484 C CB  . LYS B 1 27 ? 7.482  12.929 -5.001 1.00 41.41  ? 27 LYS B CB  1 
ATOM   485 C CG  . LYS B 1 27 ? 8.638  13.811 -5.435 1.00 37.76  ? 27 LYS B CG  1 
ATOM   486 C CD  . LYS B 1 27 ? 9.967  13.108 -5.199 1.00 34.59  ? 27 LYS B CD  1 
ATOM   487 C CE  . LYS B 1 27 ? 11.131 14.064 -4.971 1.00 43.34  ? 27 LYS B CE  1 
ATOM   488 N NZ  . LYS B 1 27 ? 11.868 14.400 -6.197 1.00 48.58  ? 27 LYS B NZ  1 
ATOM   489 N N   . LYS B 1 28 ? 4.557  11.971 -4.279 1.00 50.57  ? 28 LYS B N   1 
ATOM   490 C CA  . LYS B 1 28 ? 3.453  11.165 -4.698 1.00 52.57  ? 28 LYS B CA  1 
ATOM   491 C C   . LYS B 1 28 ? 2.279  12.092 -4.939 1.00 58.20  ? 28 LYS B C   1 
ATOM   492 O O   . LYS B 1 28 ? 1.933  12.374 -6.079 1.00 64.13  ? 28 LYS B O   1 
ATOM   493 C CB  . LYS B 1 28 ? 3.159  9.976  -3.799 1.00 56.62  ? 28 LYS B CB  1 
ATOM   494 C CG  . LYS B 1 28 ? 4.385  9.102  -3.572 1.00 56.78  ? 28 LYS B CG  1 
ATOM   495 C CD  . LYS B 1 28 ? 4.138  7.623  -3.837 1.00 57.96  ? 28 LYS B CD  1 
ATOM   496 C CE  . LYS B 1 28 ? 2.859  7.093  -3.206 1.00 83.55  ? 28 LYS B CE  1 
ATOM   497 N NZ  . LYS B 1 28 ? 2.957  6.936  -1.748 1.00 96.97  ? 28 LYS B NZ  1 
ATOM   498 N N   . LEU B 1 29 ? 1.700  12.612 -3.867 1.00 48.49  ? 29 LEU B N   1 
ATOM   499 C CA  . LEU B 1 29 ? 0.581  13.536 -3.953 1.00 44.49  ? 29 LEU B CA  1 
ATOM   500 C C   . LEU B 1 29 ? 0.662  14.434 -5.209 1.00 53.63  ? 29 LEU B C   1 
ATOM   501 O O   . LEU B 1 29 ? -0.336 14.818 -5.808 1.00 50.87  ? 29 LEU B O   1 
ATOM   502 C CB  . LEU B 1 29 ? 0.532  14.342 -2.634 1.00 41.06  ? 29 LEU B CB  1 
ATOM   503 C CG  . LEU B 1 29 ? -0.307 15.607 -2.639 1.00 43.98  ? 29 LEU B CG  1 
ATOM   504 C CD1 . LEU B 1 29 ? -1.767 15.272 -2.377 1.00 48.15  ? 29 LEU B CD1 1 
ATOM   505 C CD2 . LEU B 1 29 ? 0.194  16.538 -1.544 1.00 39.54  ? 29 LEU B CD2 1 
ATOM   506 N N   . VAL B 1 30 ? 1.886  14.762 -5.609 1.00 62.62  ? 30 VAL B N   1 
ATOM   507 C CA  . VAL B 1 30 ? 2.166  15.597 -6.775 1.00 64.37  ? 30 VAL B CA  1 
ATOM   508 C C   . VAL B 1 30 ? 2.939  14.799 -7.830 1.00 87.14  ? 30 VAL B C   1 
ATOM   509 O O   . VAL B 1 30 ? 2.364  14.171 -8.722 1.00 49.31  ? 30 VAL B O   1 
ATOM   510 C CB  . VAL B 1 30 ? 2.948  16.849 -6.361 1.00 60.49  ? 30 VAL B CB  1 
ATOM   511 C CG1 . VAL B 1 30 ? 3.066  17.830 -7.523 1.00 59.56  ? 30 VAL B CG1 1 
ATOM   512 C CG2 . VAL B 1 30 ? 2.259  17.515 -5.170 1.00 56.24  ? 30 VAL B CG2 1 
HETATM 513 O O   . HOH C 2 .  ? 27.395 24.900 5.482  1.00 32.64  ? 51 HOH A O   1 
HETATM 514 O O   . HOH C 2 .  ? 17.341 22.153 -3.643 1.00 24.00  ? 56 HOH A O   1 
HETATM 515 O O   . HOH C 2 .  ? 7.490  25.726 3.153  1.00 53.29  ? 59 HOH A O   1 
HETATM 516 O O   . HOH C 2 .  ? 25.562 10.837 7.669  1.00 38.00  ? 60 HOH A O   1 
HETATM 517 O O   . HOH C 2 .  ? 33.871 23.905 5.421  1.00 26.59  ? 63 HOH A O   1 
HETATM 518 O O   . HOH C 2 .  ? 16.052 24.802 13.223 1.00 27.71  ? 67 HOH A O   1 
HETATM 519 O O   . HOH C 2 .  ? 10.418 24.058 2.875  1.00 38.23  ? 70 HOH A O   1 
HETATM 520 O O   . HOH C 2 .  ? 33.781 15.442 8.605  1.00 27.46  ? 71 HOH A O   1 
HETATM 521 O O   . HOH C 2 .  ? 17.932 27.864 10.015 1.00 24.76  ? 72 HOH A O   1 
HETATM 522 O O   . HOH C 2 .  ? 37.026 12.837 7.780  1.00 27.98  ? 73 HOH A O   1 
HETATM 523 O O   . HOH C 2 .  ? 14.137 26.255 -5.025 1.00 21.24  ? 75 HOH A O   1 
HETATM 524 O O   . HOH C 2 .  ? 6.889  24.782 -7.577 1.00 45.66  ? 76 HOH A O   1 
HETATM 525 O O   . HOH C 2 .  ? 35.284 25.053 17.141 1.00 45.81  ? 81 HOH A O   1 
HETATM 526 O O   . HOH D 2 .  ? 23.633 20.751 20.431 1.00 35.08  ? 50 HOH B O   1 
HETATM 527 O O   . HOH D 2 .  ? 18.727 18.594 8.443  1.00 11.46  ? 52 HOH B O   1 
HETATM 528 O O   . HOH D 2 .  ? 26.809 10.006 20.061 1.00 41.51  ? 53 HOH B O   1 
HETATM 529 O O   . HOH D 2 .  ? 7.801  13.756 7.178  1.00 48.73  ? 54 HOH B O   1 
HETATM 530 O O   . HOH D 2 .  ? 21.539 20.192 21.077 1.00 32.63  ? 55 HOH B O   1 
HETATM 531 O O   . HOH D 2 .  ? 13.557 14.798 13.549 1.00 15.63  ? 57 HOH B O   1 
HETATM 532 O O   . HOH D 2 .  ? 17.785 15.038 21.152 1.00 53.24  ? 58 HOH B O   1 
HETATM 533 O O   . HOH D 2 .  ? 21.039 7.942  2.853  1.00 45.20  ? 61 HOH B O   1 
HETATM 534 O O   . HOH D 2 .  ? 8.932  6.382  6.131  1.00 38.05  ? 62 HOH B O   1 
HETATM 535 O O   . HOH D 2 .  ? 20.361 20.211 16.378 1.00 22.10  ? 64 HOH B O   1 
HETATM 536 O O   . HOH D 2 .  ? 10.262 7.819  2.647  1.00 28.45  ? 65 HOH B O   1 
HETATM 537 O O   . HOH D 2 .  ? 12.497 12.503 -0.567 1.00 14.98  ? 66 HOH B O   1 
HETATM 538 O O   . HOH D 2 .  ? 6.633  15.153 12.956 1.00 41.35  ? 68 HOH B O   1 
HETATM 539 O O   . HOH D 2 .  ? 37.746 19.108 22.665 1.00 38.06  ? 69 HOH B O   1 
HETATM 540 O O   . HOH D 2 .  ? 23.394 12.493 4.453  1.00 51.99  ? 74 HOH B O   1 
HETATM 541 O O   . HOH D 2 .  ? 22.099 8.172  5.893  1.00 29.97  ? 77 HOH B O   1 
HETATM 542 O O   . HOH D 2 .  ? 14.385 11.267 11.511 1.00 29.40  ? 78 HOH B O   1 
HETATM 543 O O   . HOH D 2 .  ? 12.080 17.275 11.707 1.00 37.65  ? 79 HOH B O   1 
HETATM 544 O O   . HOH D 2 .  ? 17.140 16.293 17.351 1.00 53.11  ? 80 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ARG 1  1  1  ARG ARG A . n 
A 1 2  MET 2  2  2  MET MET A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  GLN 4  4  4  GLN GLN A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  GLU 6  6  6  GLU GLU A . n 
A 1 7  ASP 7  7  7  ASP ASP A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 GLU 10 10 10 GLU GLU A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 LEU 12 12 12 LEU LEU A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 GLN 16 16 16 GLN GLN A . n 
A 1 17 TYR 17 17 17 TYR TYR A . n 
A 1 18 HIS 18 18 18 HIS HIS A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 GLU 20 20 20 GLU GLU A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 ALA 24 24 24 ALA ALA A . n 
A 1 25 ARG 25 25 25 ARG ARG A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 VAL 30 30 30 VAL VAL A . n 
A 1 31 GLY 31 31 ?  ?   ?   A . n 
A 1 32 GLU 32 32 ?  ?   ?   A . n 
A 1 33 ARG 33 33 ?  ?   ?   A . n 
B 1 1  ARG 1  1  1  ARG ARG B . n 
B 1 2  MET 2  2  2  MET MET B . n 
B 1 3  LYS 3  3  3  LYS LYS B . n 
B 1 4  GLN 4  4  4  GLN GLN B . n 
B 1 5  LEU 5  5  5  LEU LEU B . n 
B 1 6  GLU 6  6  6  GLU GLU B . n 
B 1 7  ASP 7  7  7  ASP ASP B . n 
B 1 8  LYS 8  8  8  LYS LYS B . n 
B 1 9  VAL 9  9  9  VAL VAL B . n 
B 1 10 GLU 10 10 10 GLU GLU B . n 
B 1 11 GLU 11 11 11 GLU GLU B . n 
B 1 12 LEU 12 12 12 LEU LEU B . n 
B 1 13 LEU 13 13 13 LEU LEU B . n 
B 1 14 SER 14 14 14 SER SER B . n 
B 1 15 LYS 15 15 15 LYS LYS B . n 
B 1 16 GLN 16 16 16 GLN GLN B . n 
B 1 17 TYR 17 17 17 TYR TYR B . n 
B 1 18 HIS 18 18 18 HIS HIS B . n 
B 1 19 LEU 19 19 19 LEU LEU B . n 
B 1 20 GLU 20 20 20 GLU GLU B . n 
B 1 21 ASN 21 21 21 ASN ASN B . n 
B 1 22 GLU 22 22 22 GLU GLU B . n 
B 1 23 VAL 23 23 23 VAL VAL B . n 
B 1 24 ALA 24 24 24 ALA ALA B . n 
B 1 25 ARG 25 25 25 ARG ARG B . n 
B 1 26 LEU 26 26 26 LEU LEU B . n 
B 1 27 LYS 27 27 27 LYS LYS B . n 
B 1 28 LYS 28 28 28 LYS LYS B . n 
B 1 29 LEU 29 29 29 LEU LEU B . n 
B 1 30 VAL 30 30 30 VAL VAL B . n 
B 1 31 GLY 31 31 ?  ?   ?   B . n 
B 1 32 GLU 32 32 ?  ?   ?   B . n 
B 1 33 ARG 33 33 ?  ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  51 51 HOH HOH A . 
C 2 HOH 2  56 56 HOH HOH A . 
C 2 HOH 3  59 59 HOH HOH A . 
C 2 HOH 4  60 60 HOH HOH A . 
C 2 HOH 5  63 63 HOH HOH A . 
C 2 HOH 6  67 67 HOH HOH A . 
C 2 HOH 7  70 70 HOH HOH A . 
C 2 HOH 8  71 71 HOH HOH A . 
C 2 HOH 9  72 72 HOH HOH A . 
C 2 HOH 10 73 73 HOH HOH A . 
C 2 HOH 11 75 75 HOH HOH A . 
C 2 HOH 12 76 76 HOH HOH A . 
C 2 HOH 13 81 81 HOH HOH A . 
D 2 HOH 1  50 50 HOH HOH B . 
D 2 HOH 2  52 52 HOH HOH B . 
D 2 HOH 3  53 53 HOH HOH B . 
D 2 HOH 4  54 54 HOH HOH B . 
D 2 HOH 5  55 55 HOH HOH B . 
D 2 HOH 6  57 57 HOH HOH B . 
D 2 HOH 7  58 58 HOH HOH B . 
D 2 HOH 8  61 61 HOH HOH B . 
D 2 HOH 9  62 62 HOH HOH B . 
D 2 HOH 10 64 64 HOH HOH B . 
D 2 HOH 11 65 65 HOH HOH B . 
D 2 HOH 12 66 66 HOH HOH B . 
D 2 HOH 13 68 68 HOH HOH B . 
D 2 HOH 14 69 69 HOH HOH B . 
D 2 HOH 15 74 74 HOH HOH B . 
D 2 HOH 16 77 77 HOH HOH B . 
D 2 HOH 17 78 78 HOH HOH B . 
D 2 HOH 18 79 79 HOH HOH B . 
D 2 HOH 19 80 80 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1710 ? 
1 MORE         -19  ? 
1 'SSA (A^2)'  4670 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-07-07 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT    refinement       . ? 1 
R-AXIS 'data reduction' . ? 2 
R-AXIS 'data scaling'   . ? 3 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             11 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             11 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.322 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.070 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 7 ? ? CG A ASP 7 ? ? OD1 A ASP 7 ? ? 124.19 118.30 5.89  0.90 N 
2 1 CB A ASP 7 ? ? CG A ASP 7 ? ? OD2 A ASP 7 ? ? 112.30 118.30 -6.00 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 29 ? ? -39.37 -24.49 
2 1 LYS B 28 ? ? -65.55 -72.51 
3 1 LEU B 29 ? ? -32.96 -33.04 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 31 ? A GLY 31 
2 1 Y 1 A GLU 32 ? A GLU 32 
3 1 Y 1 A ARG 33 ? A ARG 33 
4 1 Y 1 B GLY 31 ? B GLY 31 
5 1 Y 1 B GLU 32 ? B GLU 32 
6 1 Y 1 B ARG 33 ? B ARG 33 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#