data_1ZKK
# 
_entry.id   1ZKK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZKK         
RCSB  RCSB032824   
WWPDB D_1000032824 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZKK 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Couture, J.-F.'  1 
'Collazo, E.'     2 
'Brunzelle, J.S.' 3 
'Trievel, R.C.'   4 
# 
_citation.id                        primary 
_citation.title                     'Structural and functional analysis of SET8, a histone H4 Lys-20 methyltransferase' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            19 
_citation.page_first                1455 
_citation.page_last                 1465 
_citation.year                      2005 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15933070 
_citation.pdbx_database_id_DOI      10.1101/gad.1318405 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Couture, J.-F.'  1 
primary 'Collazo, E.'     2 
primary 'Brunzelle, J.S.' 3 
primary 'Trievel, R.C.'   4 
# 
_cell.entry_id           1ZKK 
_cell.length_a           43.960 
_cell.length_b           45.775 
_cell.length_c           94.435 
_cell.angle_alpha        89.22 
_cell.angle_beta         87.07 
_cell.angle_gamma        90.72 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZKK 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone-lysine N-methyltransferase, H4 lysine-20 specific' 18877.334 4    2.1.1.43 ? 
'sequence database residues 231-393' ? 
2 polymer     syn 'Peptide corresponding to residues 15-24 of histone H4'     1284.557  4    ?        ? ? ? 
3 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE                                   384.411   4    ?        ? ? ? 
4 water       nat water                                                       18.015    1007 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Histone H4-K20 methyltransferase, H4-K20-HMTase, SET domain-containing protein 8, PR/SET domain-containing protein 07, PR/SET07, PR-Set7, SET8
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GAMGSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQD
PSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIE
AHPWLKH
;
;GAMGSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQD
PSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIE
AHPWLKH
;
A,B,C,D ? 
2 'polypeptide(L)' no no AKRHRKVLRD AKRHRKVLRD E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   ARG n 
1 8   LYS n 
1 9   SER n 
1 10  LYS n 
1 11  ALA n 
1 12  GLU n 
1 13  LEU n 
1 14  GLN n 
1 15  SER n 
1 16  GLU n 
1 17  GLU n 
1 18  ARG n 
1 19  LYS n 
1 20  ARG n 
1 21  ILE n 
1 22  ASP n 
1 23  GLU n 
1 24  LEU n 
1 25  ILE n 
1 26  GLU n 
1 27  SER n 
1 28  GLY n 
1 29  LYS n 
1 30  GLU n 
1 31  GLU n 
1 32  GLY n 
1 33  MET n 
1 34  LYS n 
1 35  ILE n 
1 36  ASP n 
1 37  LEU n 
1 38  ILE n 
1 39  ASP n 
1 40  GLY n 
1 41  LYS n 
1 42  GLY n 
1 43  ARG n 
1 44  GLY n 
1 45  VAL n 
1 46  ILE n 
1 47  ALA n 
1 48  THR n 
1 49  LYS n 
1 50  GLN n 
1 51  PHE n 
1 52  SER n 
1 53  ARG n 
1 54  GLY n 
1 55  ASP n 
1 56  PHE n 
1 57  VAL n 
1 58  VAL n 
1 59  GLU n 
1 60  TYR n 
1 61  HIS n 
1 62  GLY n 
1 63  ASP n 
1 64  LEU n 
1 65  ILE n 
1 66  GLU n 
1 67  ILE n 
1 68  THR n 
1 69  ASP n 
1 70  ALA n 
1 71  LYS n 
1 72  LYS n 
1 73  ARG n 
1 74  GLU n 
1 75  ALA n 
1 76  LEU n 
1 77  TYR n 
1 78  ALA n 
1 79  GLN n 
1 80  ASP n 
1 81  PRO n 
1 82  SER n 
1 83  THR n 
1 84  GLY n 
1 85  CYS n 
1 86  TYR n 
1 87  MET n 
1 88  TYR n 
1 89  TYR n 
1 90  PHE n 
1 91  GLN n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  LYS n 
1 96  THR n 
1 97  TYR n 
1 98  CYS n 
1 99  VAL n 
1 100 ASP n 
1 101 ALA n 
1 102 THR n 
1 103 ARG n 
1 104 GLU n 
1 105 THR n 
1 106 ASN n 
1 107 ARG n 
1 108 LEU n 
1 109 GLY n 
1 110 ARG n 
1 111 LEU n 
1 112 ILE n 
1 113 ASN n 
1 114 HIS n 
1 115 SER n 
1 116 LYS n 
1 117 CYS n 
1 118 GLY n 
1 119 ASN n 
1 120 CYS n 
1 121 GLN n 
1 122 THR n 
1 123 LYS n 
1 124 LEU n 
1 125 HIS n 
1 126 ASP n 
1 127 ILE n 
1 128 ASP n 
1 129 GLY n 
1 130 VAL n 
1 131 PRO n 
1 132 HIS n 
1 133 LEU n 
1 134 ILE n 
1 135 LEU n 
1 136 ILE n 
1 137 ALA n 
1 138 SER n 
1 139 ARG n 
1 140 ASP n 
1 141 ILE n 
1 142 ALA n 
1 143 ALA n 
1 144 GLY n 
1 145 GLU n 
1 146 GLU n 
1 147 LEU n 
1 148 LEU n 
1 149 TYR n 
1 150 ASP n 
1 151 TYR n 
1 152 GLY n 
1 153 ASP n 
1 154 ARG n 
1 155 SER n 
1 156 LYS n 
1 157 ALA n 
1 158 SER n 
1 159 ILE n 
1 160 GLU n 
1 161 ALA n 
1 162 HIS n 
1 163 PRO n 
1 164 TRP n 
1 165 LEU n 
1 166 LYS n 
1 167 HIS n 
2 1   ALA n 
2 2   LYS n 
2 3   ARG n 
2 4   HIS n 
2 5   ARG n 
2 6   LYS n 
2 7   VAL n 
2 8   LEU n 
2 9   ARG n 
2 10  ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'SET8, PRSET7, SET07' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL-21-DE3pLysS 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHis2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'Chain E, F, G, H are synthetic peptide from New England Peptide corresponding to residue 15-24 of the histone H4' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SET07_HUMAN Q9NQR1 1 
;SSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTG
CYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPW
LKH
;
231 ? 
2 PDB 1ZKK        1ZKK   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZKK A 5 ? 167 ? Q9NQR1 231 ? 393 ? 190 352 
2 1 1ZKK B 5 ? 167 ? Q9NQR1 231 ? 393 ? 190 352 
3 1 1ZKK C 5 ? 167 ? Q9NQR1 231 ? 393 ? 190 352 
4 1 1ZKK D 5 ? 167 ? Q9NQR1 231 ? 393 ? 190 352 
5 2 1ZKK E 1 ? 10  ? 1ZKK   15  ? 24  ? 15  24  
6 2 1ZKK F 1 ? 10  ? 1ZKK   15  ? 24  ? 15  24  
7 2 1ZKK G 1 ? 10  ? 1ZKK   15  ? 24  ? 15  24  
8 2 1ZKK H 1 ? 10  ? 1ZKK   15  ? 24  ? 15  24  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ZKK GLY A 1 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 186 1  
1 1ZKK ALA A 2 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 187 2  
1 1ZKK MET A 3 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 188 3  
1 1ZKK GLY A 4 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 189 4  
2 1ZKK GLY B 1 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 186 5  
2 1ZKK ALA B 2 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 187 6  
2 1ZKK MET B 3 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 188 7  
2 1ZKK GLY B 4 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 189 8  
3 1ZKK GLY C 1 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 186 9  
3 1ZKK ALA C 2 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 187 10 
3 1ZKK MET C 3 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 188 11 
3 1ZKK GLY C 4 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 189 12 
4 1ZKK GLY D 1 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 186 13 
4 1ZKK ALA D 2 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 187 14 
4 1ZKK MET D 3 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 188 15 
4 1ZKK GLY D 4 ? UNP Q9NQR1 ? ? 'CLONING ARTIFACT' 189 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1ZKK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.35 
_exptl_crystal.density_percent_sol   47.72 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'pentaerythritol ethoxylate, ammonium sulfate, Bis-Tris, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2004-10-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Diamond 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9686 1.0 
2 0.9792 1.0 
3 0.9791 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 32-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   32-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9686, 0.9792, 0.9791' 
# 
_reflns.entry_id                     1ZKK 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            1.45 
_reflns.d_resolution_low             22 
_reflns.number_all                   ? 
_reflns.number_obs                   122425 
_reflns.percent_possible_obs         32 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.45 
_reflns_shell.d_res_low              1.5 
_reflns_shell.percent_possible_all   34 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1ZKK 
_refine.ls_number_reflns_obs                     117760 
_refine.ls_number_reflns_all                     122425 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.63 
_refine.ls_d_res_high                            1.45 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.17073 
_refine.ls_R_factor_all                          0.206 
_refine.ls_R_factor_R_work                       0.16924 
_refine.ls_R_factor_R_free                       0.19902 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  6198 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               16.084 
_refine.aniso_B[1][1]                            -0.02 
_refine.aniso_B[2][2]                            -0.02 
_refine.aniso_B[3][3]                            0.04 
_refine.aniso_B[1][2]                            0.03 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MAD, MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.083 
_refine.pdbx_overall_ESU_R_Free                  0.069 
_refine.overall_SU_ML                            0.038 
_refine.overall_SU_B                             2.134 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5434 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         104 
_refine_hist.number_atoms_solvent             1007 
_refine_hist.number_atoms_total               6545 
_refine_hist.d_res_high                       1.45 
_refine_hist.d_res_low                        19.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.008  0.021  ? 5632 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.278  1.985  ? 7554 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.092  5.000  ? 668  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   27.573 23.333 ? 276  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   11.594 15.000 ? 1054 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   15.900 15.000 ? 52   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.085  0.200  ? 806  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 4196 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.191  0.200  ? 2548 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.304  0.200  ? 3806 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.115  0.200  ? 835  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.165  0.200  ? 85   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.096  0.200  ? 91   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.986  1.500  ? 3470 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.518  2.000  ? 5344 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.162  3.000  ? 2478 'X-RAY DIFFRACTION' ? 
r_scangle_it             3.174  4.500  ? 2210 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       1.228  3.000  ? 5948 'X-RAY DIFFRACTION' ? 
r_sphericity_free        4.016  3.000  ? 1008 'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      2.540  3.000  ? 5536 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.451 
_refine_ls_shell.d_res_low                        1.489 
_refine_ls_shell.number_reflns_R_work             8436 
_refine_ls_shell.R_factor_R_work                  0.206 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.258 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             444 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1ZKK 
_struct.title                     'Crystal structure of hSET8 in ternary complex with H4 peptide (16-24) and AdoHcy' 
_struct.pdbx_descriptor           
'Histone-lysine N-methyltransferase, H4 lysine-20 specific (E.C.2.1.1.43), ALA-LYS-ARG-HIS-ARG-LYS-VAL-LEU-ARG-ASP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZKK 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'pseudo-knot, histone H4, beta-sheet, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 9   ? GLY A 28  ? SER A 194 GLY A 213 1 ? 20 
HELX_P HELX_P2  2  ILE A 67  ? ALA A 78  ? ILE A 252 ALA A 263 1 ? 12 
HELX_P HELX_P3  3  LEU A 108 ? ILE A 112 ? LEU A 293 ILE A 297 5 ? 5  
HELX_P HELX_P4  4  SER A 155 ? HIS A 162 ? SER A 340 HIS A 347 1 ? 8  
HELX_P HELX_P5  5  PRO A 163 ? HIS A 167 ? PRO A 348 HIS A 352 5 ? 5  
HELX_P HELX_P6  6  SER B 9   ? GLY B 28  ? SER B 194 GLY B 213 1 ? 20 
HELX_P HELX_P7  7  ILE B 67  ? ALA B 78  ? ILE B 252 ALA B 263 1 ? 12 
HELX_P HELX_P8  8  LEU B 108 ? ILE B 112 ? LEU B 293 ILE B 297 5 ? 5  
HELX_P HELX_P9  9  SER B 155 ? HIS B 162 ? SER B 340 HIS B 347 1 ? 8  
HELX_P HELX_P10 10 PRO B 163 ? HIS B 167 ? PRO B 348 HIS B 352 5 ? 5  
HELX_P HELX_P11 11 SER C 9   ? GLY C 28  ? SER C 194 GLY C 213 1 ? 20 
HELX_P HELX_P12 12 ILE C 67  ? ALA C 78  ? ILE C 252 ALA C 263 1 ? 12 
HELX_P HELX_P13 13 LEU C 108 ? ILE C 112 ? LEU C 293 ILE C 297 5 ? 5  
HELX_P HELX_P14 14 SER C 155 ? HIS C 162 ? SER C 340 HIS C 347 1 ? 8  
HELX_P HELX_P15 15 PRO C 163 ? HIS C 167 ? PRO C 348 HIS C 352 5 ? 5  
HELX_P HELX_P16 16 SER D 9   ? GLY D 28  ? SER D 194 GLY D 213 1 ? 20 
HELX_P HELX_P17 17 ILE D 67  ? ALA D 78  ? ILE D 252 ALA D 263 1 ? 12 
HELX_P HELX_P18 18 LEU D 108 ? ILE D 112 ? LEU D 293 ILE D 297 5 ? 5  
HELX_P HELX_P19 19 SER D 155 ? HIS D 162 ? SER D 340 HIS D 347 1 ? 8  
HELX_P HELX_P20 20 PRO D 163 ? HIS D 167 ? PRO D 348 HIS D 352 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 4 ? 
D ? 2 ? 
E ? 2 ? 
F ? 3 ? 
G ? 4 ? 
H ? 2 ? 
I ? 2 ? 
J ? 3 ? 
K ? 4 ? 
L ? 2 ? 
M ? 2 ? 
N ? 3 ? 
O ? 4 ? 
P ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
H 1 2 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? parallel      
L 1 2 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? parallel      
P 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 33  ? ILE A 38  ? MET A 218 ILE A 223 
A 2 GLY A 42  ? ALA A 47  ? GLY A 227 ALA A 232 
B 1 PHE A 56  ? TYR A 60  ? PHE A 241 TYR A 245 
B 2 VAL A 130 ? ALA A 137 ? VAL A 315 ALA A 322 
B 3 CYS A 120 ? ILE A 127 ? CYS A 305 ILE A 312 
C 1 ASP A 63  ? GLU A 66  ? ASP A 248 GLU A 251 
C 2 LYS A 95  ? ASP A 100 ? LYS A 280 ASP A 285 
C 3 MET A 87  ? TYR A 92  ? MET A 272 TYR A 277 
C 4 LYS E 6   ? VAL E 7   ? LYS E 20  VAL E 21  
D 1 ASN A 113 ? HIS A 114 ? ASN A 298 HIS A 299 
D 2 LEU A 148 ? TYR A 149 ? LEU A 333 TYR A 334 
E 1 MET B 33  ? ILE B 38  ? MET B 218 ILE B 223 
E 2 GLY B 42  ? ALA B 47  ? GLY B 227 ALA B 232 
F 1 PHE B 56  ? GLU B 59  ? PHE B 241 GLU B 244 
F 2 VAL B 130 ? ALA B 137 ? VAL B 315 ALA B 322 
F 3 CYS B 120 ? ILE B 127 ? CYS B 305 ILE B 312 
G 1 ASP B 63  ? GLU B 66  ? ASP B 248 GLU B 251 
G 2 LYS B 95  ? ASP B 100 ? LYS B 280 ASP B 285 
G 3 MET B 87  ? TYR B 92  ? MET B 272 TYR B 277 
G 4 LYS F 6   ? VAL F 7   ? LYS F 20  VAL F 21  
H 1 ASN B 113 ? HIS B 114 ? ASN B 298 HIS B 299 
H 2 LEU B 148 ? TYR B 149 ? LEU B 333 TYR B 334 
I 1 MET C 33  ? ILE C 38  ? MET C 218 ILE C 223 
I 2 GLY C 42  ? ALA C 47  ? GLY C 227 ALA C 232 
J 1 PHE C 56  ? GLU C 59  ? PHE C 241 GLU C 244 
J 2 VAL C 130 ? ALA C 137 ? VAL C 315 ALA C 322 
J 3 CYS C 120 ? ILE C 127 ? CYS C 305 ILE C 312 
K 1 ASP C 63  ? GLU C 66  ? ASP C 248 GLU C 251 
K 2 LYS C 95  ? ASP C 100 ? LYS C 280 ASP C 285 
K 3 MET C 87  ? TYR C 92  ? MET C 272 TYR C 277 
K 4 LYS G 6   ? VAL G 7   ? LYS G 20  VAL G 21  
L 1 ASN C 113 ? HIS C 114 ? ASN C 298 HIS C 299 
L 2 LEU C 148 ? TYR C 149 ? LEU C 333 TYR C 334 
M 1 MET D 33  ? ILE D 38  ? MET D 218 ILE D 223 
M 2 GLY D 42  ? ALA D 47  ? GLY D 227 ALA D 232 
N 1 PHE D 56  ? TYR D 60  ? PHE D 241 TYR D 245 
N 2 VAL D 130 ? ALA D 137 ? VAL D 315 ALA D 322 
N 3 CYS D 120 ? ILE D 127 ? CYS D 305 ILE D 312 
O 1 ASP D 63  ? GLU D 66  ? ASP D 248 GLU D 251 
O 2 LYS D 95  ? ASP D 100 ? LYS D 280 ASP D 285 
O 3 MET D 87  ? TYR D 92  ? MET D 272 TYR D 277 
O 4 LYS H 6   ? VAL H 7   ? LYS H 20  VAL H 21  
P 1 ASN D 113 ? HIS D 114 ? ASN D 298 HIS D 299 
P 2 LEU D 148 ? TYR D 149 ? LEU D 333 TYR D 334 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 34  ? N LYS A 219 O ILE A 46  ? O ILE A 231 
B 1 2 N VAL A 58  ? N VAL A 243 O LEU A 135 ? O LEU A 320 
B 2 3 O HIS A 132 ? O HIS A 317 N HIS A 125 ? N HIS A 310 
C 1 2 N ASP A 63  ? N ASP A 248 O ASP A 100 ? O ASP A 285 
C 2 3 O TYR A 97  ? O TYR A 282 N PHE A 90  ? N PHE A 275 
C 3 4 N TYR A 89  ? N TYR A 274 O LYS E 6   ? O LYS E 20  
D 1 2 N ASN A 113 ? N ASN A 298 O TYR A 149 ? O TYR A 334 
E 1 2 N LYS B 34  ? N LYS B 219 O ILE B 46  ? O ILE B 231 
F 1 2 N VAL B 58  ? N VAL B 243 O LEU B 135 ? O LEU B 320 
F 2 3 O ILE B 134 ? O ILE B 319 N LYS B 123 ? N LYS B 308 
G 1 2 N ASP B 63  ? N ASP B 248 O ASP B 100 ? O ASP B 285 
G 2 3 O TYR B 97  ? O TYR B 282 N PHE B 90  ? N PHE B 275 
G 3 4 N TYR B 89  ? N TYR B 274 O LYS F 6   ? O LYS F 20  
H 1 2 N ASN B 113 ? N ASN B 298 O TYR B 149 ? O TYR B 334 
I 1 2 N LYS C 34  ? N LYS C 219 O ILE C 46  ? O ILE C 231 
J 1 2 N VAL C 58  ? N VAL C 243 O LEU C 135 ? O LEU C 320 
J 2 3 O HIS C 132 ? O HIS C 317 N HIS C 125 ? N HIS C 310 
K 1 2 N ASP C 63  ? N ASP C 248 O ASP C 100 ? O ASP C 285 
K 2 3 O TYR C 97  ? O TYR C 282 N PHE C 90  ? N PHE C 275 
K 3 4 N TYR C 89  ? N TYR C 274 O LYS G 6   ? O LYS G 20  
L 1 2 N ASN C 113 ? N ASN C 298 O TYR C 149 ? O TYR C 334 
M 1 2 N LYS D 34  ? N LYS D 219 O ILE D 46  ? O ILE D 231 
N 1 2 N TYR D 60  ? N TYR D 245 O LEU D 133 ? O LEU D 318 
N 2 3 O HIS D 132 ? O HIS D 317 N HIS D 125 ? N HIS D 310 
O 1 2 N ASP D 63  ? N ASP D 248 O ASP D 100 ? O ASP D 285 
O 2 3 O TYR D 97  ? O TYR D 282 N PHE D 90  ? N PHE D 275 
O 3 4 N TYR D 89  ? N TYR D 274 O LYS H 6   ? O LYS H 20  
P 1 2 N ASN D 113 ? N ASN D 298 O TYR D 149 ? O TYR D 334 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE SAH A 2800' 
AC2 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE SAH B 2801' 
AC3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE SAH C 2802' 
AC4 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE SAH D 2803' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 GLY A 40  ? GLY A 225  . ? 1_555 ? 
2  AC1 20 LYS A 41  ? LYS A 226  . ? 1_555 ? 
3  AC1 20 ARG A 43  ? ARG A 228  . ? 1_555 ? 
4  AC1 20 CYS A 85  ? CYS A 270  . ? 1_555 ? 
5  AC1 20 TYR A 86  ? TYR A 271  . ? 1_555 ? 
6  AC1 20 ARG A 110 ? ARG A 295  . ? 1_555 ? 
7  AC1 20 LEU A 111 ? LEU A 296  . ? 1_555 ? 
8  AC1 20 ASN A 113 ? ASN A 298  . ? 1_555 ? 
9  AC1 20 HIS A 114 ? HIS A 299  . ? 1_555 ? 
10 AC1 20 TYR A 151 ? TYR A 336  . ? 1_555 ? 
11 AC1 20 TRP A 164 ? TRP A 349  . ? 1_555 ? 
12 AC1 20 HOH M .   ? HOH A 2829 . ? 1_555 ? 
13 AC1 20 HOH M .   ? HOH A 2835 . ? 1_555 ? 
14 AC1 20 HOH M .   ? HOH A 2863 . ? 1_555 ? 
15 AC1 20 HOH M .   ? HOH A 2879 . ? 1_555 ? 
16 AC1 20 HOH M .   ? HOH A 2901 . ? 1_555 ? 
17 AC1 20 HOH M .   ? HOH A 2906 . ? 1_555 ? 
18 AC1 20 HIS E 4   ? HIS E 18   . ? 1_555 ? 
19 AC1 20 LYS E 6   ? LYS E 20   . ? 1_555 ? 
20 AC1 20 HOH S .   ? HOH G 186  . ? 1_555 ? 
21 AC2 19 GLY B 40  ? GLY B 225  . ? 1_555 ? 
22 AC2 19 LYS B 41  ? LYS B 226  . ? 1_555 ? 
23 AC2 19 ARG B 43  ? ARG B 228  . ? 1_555 ? 
24 AC2 19 CYS B 85  ? CYS B 270  . ? 1_555 ? 
25 AC2 19 TYR B 86  ? TYR B 271  . ? 1_555 ? 
26 AC2 19 ARG B 110 ? ARG B 295  . ? 1_555 ? 
27 AC2 19 LEU B 111 ? LEU B 296  . ? 1_555 ? 
28 AC2 19 ASN B 113 ? ASN B 298  . ? 1_555 ? 
29 AC2 19 HIS B 114 ? HIS B 299  . ? 1_555 ? 
30 AC2 19 TYR B 151 ? TYR B 336  . ? 1_555 ? 
31 AC2 19 TRP B 164 ? TRP B 349  . ? 1_555 ? 
32 AC2 19 HOH N .   ? HOH B 2825 . ? 1_555 ? 
33 AC2 19 HOH N .   ? HOH B 2856 . ? 1_555 ? 
34 AC2 19 HOH N .   ? HOH B 2862 . ? 1_555 ? 
35 AC2 19 HOH N .   ? HOH B 2875 . ? 1_555 ? 
36 AC2 19 HOH N .   ? HOH B 2898 . ? 1_555 ? 
37 AC2 19 HOH N .   ? HOH B 2902 . ? 1_555 ? 
38 AC2 19 HIS F 4   ? HIS F 18   . ? 1_555 ? 
39 AC2 19 LYS F 6   ? LYS F 20   . ? 1_555 ? 
40 AC3 18 GLY C 40  ? GLY C 225  . ? 1_555 ? 
41 AC3 18 LYS C 41  ? LYS C 226  . ? 1_555 ? 
42 AC3 18 ARG C 43  ? ARG C 228  . ? 1_555 ? 
43 AC3 18 CYS C 85  ? CYS C 270  . ? 1_555 ? 
44 AC3 18 TYR C 86  ? TYR C 271  . ? 1_555 ? 
45 AC3 18 ARG C 110 ? ARG C 295  . ? 1_555 ? 
46 AC3 18 LEU C 111 ? LEU C 296  . ? 1_555 ? 
47 AC3 18 ASN C 113 ? ASN C 298  . ? 1_555 ? 
48 AC3 18 HIS C 114 ? HIS C 299  . ? 1_555 ? 
49 AC3 18 TYR C 151 ? TYR C 336  . ? 1_555 ? 
50 AC3 18 TRP C 164 ? TRP C 349  . ? 1_555 ? 
51 AC3 18 HOH O .   ? HOH C 2831 . ? 1_555 ? 
52 AC3 18 HOH O .   ? HOH C 2841 . ? 1_555 ? 
53 AC3 18 HOH O .   ? HOH C 2908 . ? 1_555 ? 
54 AC3 18 HOH O .   ? HOH C 2921 . ? 1_555 ? 
55 AC3 18 HOH O .   ? HOH C 2928 . ? 1_555 ? 
56 AC3 18 HIS G 4   ? HIS G 18   . ? 1_555 ? 
57 AC3 18 LYS G 6   ? LYS G 20   . ? 1_555 ? 
58 AC4 20 HOH N .   ? HOH B 2806 . ? 1_564 ? 
59 AC4 20 GLY D 40  ? GLY D 225  . ? 1_555 ? 
60 AC4 20 LYS D 41  ? LYS D 226  . ? 1_555 ? 
61 AC4 20 ARG D 43  ? ARG D 228  . ? 1_555 ? 
62 AC4 20 CYS D 85  ? CYS D 270  . ? 1_555 ? 
63 AC4 20 TYR D 86  ? TYR D 271  . ? 1_555 ? 
64 AC4 20 ARG D 110 ? ARG D 295  . ? 1_555 ? 
65 AC4 20 LEU D 111 ? LEU D 296  . ? 1_555 ? 
66 AC4 20 ASN D 113 ? ASN D 298  . ? 1_555 ? 
67 AC4 20 HIS D 114 ? HIS D 299  . ? 1_555 ? 
68 AC4 20 TYR D 151 ? TYR D 336  . ? 1_555 ? 
69 AC4 20 TRP D 164 ? TRP D 349  . ? 1_555 ? 
70 AC4 20 HOH P .   ? HOH D 2810 . ? 1_555 ? 
71 AC4 20 HOH P .   ? HOH D 2826 . ? 1_555 ? 
72 AC4 20 HOH P .   ? HOH D 2878 . ? 1_555 ? 
73 AC4 20 HOH P .   ? HOH D 2889 . ? 1_555 ? 
74 AC4 20 HOH P .   ? HOH D 2892 . ? 1_555 ? 
75 AC4 20 ARG F 9   ? ARG F 23   . ? 1_564 ? 
76 AC4 20 HIS H 4   ? HIS H 18   . ? 1_555 ? 
77 AC4 20 LYS H 6   ? LYS H 20   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZKK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZKK 
_atom_sites.fract_transf_matrix[1][1]   0.022748 
_atom_sites.fract_transf_matrix[1][2]   0.000287 
_atom_sites.fract_transf_matrix[1][3]   -0.001167 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021848 
_atom_sites.fract_transf_matrix[2][3]   -0.000313 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010604 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 8   ? 26.449  -24.204 -12.758 1.00 21.01  ? 193  LYS A N     1 
ATOM   2    C CA    . LYS A 1 8   ? 26.729  -22.986 -11.949 1.00 20.74  ? 193  LYS A CA    1 
ATOM   3    C C     . LYS A 1 8   ? 26.019  -23.050 -10.600 1.00 20.91  ? 193  LYS A C     1 
ATOM   4    O O     . LYS A 1 8   ? 24.932  -23.623 -10.487 1.00 20.80  ? 193  LYS A O     1 
ATOM   5    C CB    . LYS A 1 8   ? 26.305  -21.728 -12.715 1.00 20.61  ? 193  LYS A CB    1 
ATOM   6    C CG    . LYS A 1 8   ? 27.102  -21.481 -13.991 1.00 20.91  ? 193  LYS A CG    1 
ATOM   7    C CD    . LYS A 1 8   ? 26.443  -20.430 -14.867 1.00 21.70  ? 193  LYS A CD    1 
ATOM   8    C CE    . LYS A 1 8   ? 27.300  -20.147 -16.093 1.00 23.24  ? 193  LYS A CE    1 
ATOM   9    N NZ    . LYS A 1 8   ? 26.542  -19.384 -17.121 1.00 24.58  ? 193  LYS A NZ    1 
ATOM   10   N N     . SER A 1 9   ? 26.635  -22.448 -9.586  1.00 21.14  ? 194  SER A N     1 
ATOM   11   C CA    . SER A 1 9   ? 26.017  -22.322 -8.261  1.00 21.44  ? 194  SER A CA    1 
ATOM   12   C C     . SER A 1 9   ? 24.908  -21.269 -8.299  1.00 21.44  ? 194  SER A C     1 
ATOM   13   O O     . SER A 1 9   ? 24.816  -20.501 -9.262  1.00 21.01  ? 194  SER A O     1 
ATOM   14   C CB    . SER A 1 9   ? 27.069  -21.919 -7.231  1.00 21.61  ? 194  SER A CB    1 
ATOM   15   O OG    . SER A 1 9   ? 27.494  -20.582 -7.449  1.00 22.03  ? 194  SER A OG    1 
ATOM   16   N N     . LYS A 1 10  ? 24.071  -21.230 -7.263  1.00 21.48  ? 195  LYS A N     1 
ATOM   17   C CA    . LYS A 1 10  ? 23.038  -20.189 -7.154  1.00 21.57  ? 195  LYS A CA    1 
ATOM   18   C C     . LYS A 1 10  ? 23.674  -18.798 -7.144  1.00 21.46  ? 195  LYS A C     1 
ATOM   19   O O     . LYS A 1 10  ? 23.227  -17.899 -7.863  1.00 21.41  ? 195  LYS A O     1 
ATOM   20   C CB    . LYS A 1 10  ? 22.173  -20.395 -5.903  1.00 21.54  ? 195  LYS A CB    1 
ATOM   21   C CG    . LYS A 1 10  ? 21.049  -19.375 -5.745  1.00 21.94  ? 195  LYS A CG    1 
ATOM   22   C CD    . LYS A 1 10  ? 20.211  -19.661 -4.502  1.00 22.23  ? 195  LYS A CD    1 
ATOM   23   C CE    . LYS A 1 10  ? 19.080  -18.653 -4.370  1.00 23.72  ? 195  LYS A CE    1 
ATOM   24   N NZ    . LYS A 1 10  ? 18.070  -19.062 -3.351  1.00 24.45  ? 195  LYS A NZ    1 
ATOM   25   N N     . ALA A 1 11  ? 24.736  -18.645 -6.355  1.00 21.16  ? 196  ALA A N     1 
ATOM   26   C CA    . ALA A 1 11  ? 25.474  -17.385 -6.265  1.00 20.99  ? 196  ALA A CA    1 
ATOM   27   C C     . ALA A 1 11  ? 26.011  -16.935 -7.624  1.00 20.80  ? 196  ALA A C     1 
ATOM   28   O O     . ALA A 1 11  ? 25.947  -15.749 -7.960  1.00 20.88  ? 196  ALA A O     1 
ATOM   29   C CB    . ALA A 1 11  ? 26.603  -17.504 -5.256  1.00 21.09  ? 196  ALA A CB    1 
ATOM   30   N N     . GLU A 1 12  ? 26.532  -17.886 -8.399  1.00 20.48  ? 197  GLU A N     1 
ATOM   31   C CA    . GLU A 1 12  ? 27.070  -17.599 -9.731  1.00 20.39  ? 197  GLU A CA    1 
ATOM   32   C C     . GLU A 1 12  ? 25.988  -17.146 -10.694 1.00 19.60  ? 197  GLU A C     1 
ATOM   33   O O     . GLU A 1 12  ? 26.176  -16.186 -11.444 1.00 19.40  ? 197  GLU A O     1 
ATOM   34   C CB    . GLU A 1 12  ? 27.805  -18.812 -10.297 1.00 20.74  ? 197  GLU A CB    1 
ATOM   35   C CG    . GLU A 1 12  ? 29.203  -18.976 -9.723  1.00 21.27  ? 197  GLU A CG    1 
ATOM   36   C CD    . GLU A 1 12  ? 29.891  -20.269 -10.147 1.00 21.23  ? 197  GLU A CD    1 
ATOM   37   O OE1   . GLU A 1 12  ? 31.130  -20.340 -10.017 1.00 21.88  ? 197  GLU A OE1   1 
ATOM   38   O OE2   . GLU A 1 12  ? 29.208  -21.209 -10.606 1.00 21.43  ? 197  GLU A OE2   1 
ATOM   39   N N     . LEU A 1 13  ? 24.853  -17.838 -10.664 1.00 18.89  ? 198  LEU A N     1 
ATOM   40   C CA    . LEU A 1 13  ? 23.707  -17.465 -11.485 1.00 18.30  ? 198  LEU A CA    1 
ATOM   41   C C     . LEU A 1 13  ? 23.146  -16.104 -11.069 1.00 18.30  ? 198  LEU A C     1 
ATOM   42   O O     . LEU A 1 13  ? 22.779  -15.302 -11.927 1.00 17.68  ? 198  LEU A O     1 
ATOM   43   C CB    . LEU A 1 13  ? 22.623  -18.548 -11.437 1.00 18.05  ? 198  LEU A CB    1 
ATOM   44   C CG    . LEU A 1 13  ? 23.013  -19.885 -12.080 1.00 17.58  ? 198  LEU A CG    1 
ATOM   45   C CD1   . LEU A 1 13  ? 22.185  -21.015 -11.501 1.00 17.55  ? 198  LEU A CD1   1 
ATOM   46   C CD2   . LEU A 1 13  ? 22.892  -19.825 -13.606 1.00 17.03  ? 198  LEU A CD2   1 
ATOM   47   N N     . GLN A 1 14  ? 23.101  -15.843 -9.759  1.00 18.47  ? 199  GLN A N     1 
ATOM   48   C CA    . GLN A 1 14  ? 22.667  -14.532 -9.238  1.00 18.82  ? 199  GLN A CA    1 
ATOM   49   C C     . GLN A 1 14  ? 23.597  -13.385 -9.665  1.00 18.52  ? 199  GLN A C     1 
ATOM   50   O O     . GLN A 1 14  ? 23.130  -12.311 -10.064 1.00 18.18  ? 199  GLN A O     1 
ATOM   51   C CB    . GLN A 1 14  ? 22.514  -14.570 -7.711  1.00 19.24  ? 199  GLN A CB    1 
ATOM   52   C CG    . GLN A 1 14  ? 21.331  -15.409 -7.236  1.00 19.59  ? 199  GLN A CG    1 
ATOM   53   C CD    . GLN A 1 14  ? 21.225  -15.505 -5.726  1.00 20.41  ? 199  GLN A CD    1 
ATOM   54   O OE1   . GLN A 1 14  ? 22.225  -15.665 -5.024  1.00 22.80  ? 199  GLN A OE1   1 
ATOM   55   N NE2   . GLN A 1 14  ? 20.001  -15.421 -5.220  1.00 22.95  ? 199  GLN A NE2   1 
ATOM   56   N N     . SER A 1 15  ? 24.905  -13.618 -9.599  1.00 17.78  ? 200  SER A N     1 
ATOM   57   C CA    . SER A 1 15  ? 25.879  -12.612 -10.030 1.00 17.77  ? 200  SER A CA    1 
ATOM   58   C C     . SER A 1 15  ? 25.754  -12.326 -11.529 1.00 17.25  ? 200  SER A C     1 
ATOM   59   O O     . SER A 1 15  ? 25.819  -11.169 -11.955 1.00 17.13  ? 200  SER A O     1 
ATOM   60   C CB    . SER A 1 15  ? 27.311  -13.025 -9.659  1.00 18.09  ? 200  SER A CB    1 
ATOM   61   O OG    A SER A 1 15  ? 27.606  -14.328 -10.129 0.50 19.35  ? 200  SER A OG    1 
ATOM   62   O OG    B SER A 1 15  ? 28.256  -12.211 -10.168 0.00 499.99 ? 200  SER A OG    1 
ATOM   63   N N     . GLU A 1 16  ? 25.556  -13.375 -12.327 1.00 16.56  ? 201  GLU A N     1 
ATOM   64   C CA    . GLU A 1 16  ? 25.414  -13.197 -13.767 1.00 16.12  ? 201  GLU A CA    1 
ATOM   65   C C     . GLU A 1 16  ? 24.137  -12.428 -14.094 1.00 16.22  ? 201  GLU A C     1 
ATOM   66   O O     . GLU A 1 16  ? 24.142  -11.566 -14.979 1.00 16.21  ? 201  GLU A O     1 
ATOM   67   C CB    . GLU A 1 16  ? 25.467  -14.533 -14.509 1.00 16.12  ? 201  GLU A CB    1 
ATOM   68   C CG    . GLU A 1 16  ? 26.846  -15.188 -14.434 1.00 15.86  ? 201  GLU A CG    1 
ATOM   69   C CD    . GLU A 1 16  ? 26.967  -16.494 -15.204 1.00 15.90  ? 201  GLU A CD    1 
ATOM   70   O OE1   . GLU A 1 16  ? 26.035  -16.873 -15.945 1.00 15.08  ? 201  GLU A OE1   1 
ATOM   71   O OE2   . GLU A 1 16  ? 28.030  -17.140 -15.074 1.00 17.27  ? 201  GLU A OE2   1 
ATOM   72   N N     . GLU A 1 17  ? 23.056  -12.730 -13.377 1.00 16.22  ? 202  GLU A N     1 
ATOM   73   C CA    . GLU A 1 17  ? 21.806  -12.005 -13.580 1.00 16.55  ? 202  GLU A CA    1 
ATOM   74   C C     . GLU A 1 17  ? 21.958  -10.541 -13.173 1.00 16.73  ? 202  GLU A C     1 
ATOM   75   O O     . GLU A 1 17  ? 21.525  -9.637  -13.898 1.00 16.38  ? 202  GLU A O     1 
ATOM   76   C CB    . GLU A 1 17  ? 20.657  -12.650 -12.812 1.00 16.63  ? 202  GLU A CB    1 
ATOM   77   C CG    . GLU A 1 17  ? 19.306  -12.103 -13.282 1.00 17.48  ? 202  GLU A CG    1 
ATOM   78   C CD    . GLU A 1 17  ? 18.187  -12.320 -12.295 1.00 19.68  ? 202  GLU A CD    1 
ATOM   79   O OE1   . GLU A 1 17  ? 18.473  -12.616 -11.108 1.00 21.15  ? 202  GLU A OE1   1 
ATOM   80   O OE2   . GLU A 1 17  ? 17.016  -12.158 -12.714 1.00 20.32  ? 202  GLU A OE2   1 
ATOM   81   N N     . ARG A 1 18  ? 22.575  -10.312 -12.017 1.00 16.92  ? 203  ARG A N     1 
ATOM   82   C CA    . ARG A 1 18  ? 22.819  -8.946  -11.557 1.00 17.51  ? 203  ARG A CA    1 
ATOM   83   C C     . ARG A 1 18  ? 23.614  -8.156  -12.598 1.00 17.74  ? 203  ARG A C     1 
ATOM   84   O O     . ARG A 1 18  ? 23.304  -6.995  -12.889 1.00 17.83  ? 203  ARG A O     1 
ATOM   85   C CB    . ARG A 1 18  ? 23.521  -8.932  -10.193 1.00 17.58  ? 203  ARG A CB    1 
ATOM   86   C CG    . ARG A 1 18  ? 23.848  -7.539  -9.670  1.00 19.27  ? 203  ARG A CG    1 
ATOM   87   C CD    . ARG A 1 18  ? 24.211  -7.567  -8.188  1.00 21.26  ? 203  ARG A CD    1 
ATOM   88   N NE    . ARG A 1 18  ? 23.036  -7.817  -7.354  1.00 23.69  ? 203  ARG A NE    1 
ATOM   89   C CZ    . ARG A 1 18  ? 22.171  -6.882  -6.952  1.00 24.62  ? 203  ARG A CZ    1 
ATOM   90   N NH1   . ARG A 1 18  ? 22.339  -5.608  -7.283  1.00 24.43  ? 203  ARG A NH1   1 
ATOM   91   N NH2   . ARG A 1 18  ? 21.133  -7.226  -6.205  1.00 26.22  ? 203  ARG A NH2   1 
ATOM   92   N N     . LYS A 1 19  ? 24.634  -8.791  -13.173 1.00 17.80  ? 204  LYS A N     1 
ATOM   93   C CA    . LYS A 1 19  ? 25.446  -8.131  -14.187 1.00 17.99  ? 204  LYS A CA    1 
ATOM   94   C C     . LYS A 1 19  ? 24.652  -7.783  -15.457 1.00 17.26  ? 204  LYS A C     1 
ATOM   95   O O     . LYS A 1 19  ? 24.806  -6.679  -16.002 1.00 17.82  ? 204  LYS A O     1 
ATOM   96   C CB    . LYS A 1 19  ? 26.695  -8.968  -14.487 1.00 18.35  ? 204  LYS A CB    1 
ATOM   97   C CG    . LYS A 1 19  ? 27.775  -8.251  -15.267 1.00 20.88  ? 204  LYS A CG    1 
ATOM   98   C CD    . LYS A 1 19  ? 27.774  -8.713  -16.717 1.00 24.31  ? 204  LYS A CD    1 
ATOM   99   C CE    . LYS A 1 19  ? 29.190  -8.972  -17.228 1.00 25.84  ? 204  LYS A CE    1 
ATOM   100  N NZ    . LYS A 1 19  ? 30.091  -7.815  -16.991 1.00 26.31  ? 204  LYS A NZ    1 
ATOM   101  N N     . ARG A 1 20  ? 23.804  -8.700  -15.929 1.00 16.44  ? 205  ARG A N     1 
ATOM   102  C CA    . ARG A 1 20  ? 22.948  -8.407  -17.086 1.00 15.88  ? 205  ARG A CA    1 
ATOM   103  C C     . ARG A 1 20  ? 22.037  -7.229  -16.770 1.00 15.27  ? 205  ARG A C     1 
ATOM   104  O O     . ARG A 1 20  ? 21.876  -6.324  -17.591 1.00 15.60  ? 205  ARG A O     1 
ATOM   105  C CB    . ARG A 1 20  ? 22.062  -9.598  -17.492 1.00 15.75  ? 205  ARG A CB    1 
ATOM   106  C CG    . ARG A 1 20  ? 22.771  -10.732 -18.207 1.00 15.87  ? 205  ARG A CG    1 
ATOM   107  C CD    . ARG A 1 20  ? 21.775  -11.742 -18.754 1.00 15.97  ? 205  ARG A CD    1 
ATOM   108  N NE    . ARG A 1 20  ? 20.991  -12.389 -17.702 1.00 16.10  ? 205  ARG A NE    1 
ATOM   109  C CZ    . ARG A 1 20  ? 21.355  -13.493 -17.048 1.00 15.75  ? 205  ARG A CZ    1 
ATOM   110  N NH1   . ARG A 1 20  ? 22.513  -14.094 -17.313 1.00 15.69  ? 205  ARG A NH1   1 
ATOM   111  N NH2   . ARG A 1 20  ? 20.553  -14.000 -16.121 1.00 15.66  ? 205  ARG A NH2   1 
ATOM   112  N N     . ILE A 1 21  ? 21.443  -7.261  -15.579 1.00 14.48  ? 206  ILE A N     1 
ATOM   113  C CA    . ILE A 1 21  ? 20.499  -6.229  -15.168 1.00 13.75  ? 206  ILE A CA    1 
ATOM   114  C C     . ILE A 1 21  ? 21.188  -4.875  -15.029 1.00 14.43  ? 206  ILE A C     1 
ATOM   115  O O     . ILE A 1 21  ? 20.696  -3.872  -15.539 1.00 14.96  ? 206  ILE A O     1 
ATOM   116  C CB    . ILE A 1 21  ? 19.761  -6.603  -13.869 1.00 13.39  ? 206  ILE A CB    1 
ATOM   117  C CG1   . ILE A 1 21  ? 18.784  -7.765  -14.111 1.00 13.36  ? 206  ILE A CG1   1 
ATOM   118  C CG2   . ILE A 1 21  ? 18.976  -5.394  -13.342 1.00 13.08  ? 206  ILE A CG2   1 
ATOM   119  C CD1   . ILE A 1 21  ? 18.162  -8.333  -12.838 1.00 13.59  ? 206  ILE A CD1   1 
ATOM   120  N N     . ASP A 1 22  ? 22.343  -4.848  -14.368 1.00 14.81  ? 207  ASP A N     1 
ATOM   121  C CA    . ASP A 1 22  ? 23.108  -3.606  -14.264 1.00 15.44  ? 207  ASP A CA    1 
ATOM   122  C C     . ASP A 1 22  ? 23.440  -3.013  -15.636 1.00 15.24  ? 207  ASP A C     1 
ATOM   123  O O     . ASP A 1 22  ? 23.312  -1.796  -15.837 1.00 15.43  ? 207  ASP A O     1 
ATOM   124  C CB    . ASP A 1 22  ? 24.397  -3.839  -13.482 1.00 15.51  ? 207  ASP A CB    1 
ATOM   125  C CG    . ASP A 1 22  ? 24.163  -4.087  -11.991 1.00 17.29  ? 207  ASP A CG    1 
ATOM   126  O OD1   . ASP A 1 22  ? 22.986  -4.156  -11.545 1.00 20.16  ? 207  ASP A OD1   1 
ATOM   127  O OD2   . ASP A 1 22  ? 25.176  -4.213  -11.256 1.00 19.41  ? 207  ASP A OD2   1 
ATOM   128  N N     . GLU A 1 23  ? 23.874  -3.857  -16.581 1.00 15.44  ? 208  GLU A N     1 
ATOM   129  C CA    . GLU A 1 23  ? 24.185  -3.382  -17.935 1.00 16.50  ? 208  GLU A CA    1 
ATOM   130  C C     . GLU A 1 23  ? 22.968  -2.756  -18.609 1.00 15.33  ? 208  GLU A C     1 
ATOM   131  O O     . GLU A 1 23  ? 23.090  -1.747  -19.308 1.00 15.21  ? 208  GLU A O     1 
ATOM   132  C CB    . GLU A 1 23  ? 24.712  -4.504  -18.837 1.00 17.12  ? 208  GLU A CB    1 
ATOM   133  C CG    . GLU A 1 23  ? 26.120  -4.962  -18.559 1.00 19.00  ? 208  GLU A CG    1 
ATOM   134  C CD    . GLU A 1 23  ? 26.432  -6.328  -19.182 1.00 19.57  ? 208  GLU A CD    1 
ATOM   135  O OE1   . GLU A 1 23  ? 27.619  -6.686  -19.212 1.00 23.13  ? 208  GLU A OE1   1 
ATOM   136  O OE2   . GLU A 1 23  ? 25.493  -7.049  -19.618 1.00 22.94  ? 208  GLU A OE2   1 
ATOM   137  N N     . LEU A 1 24  ? 21.796  -3.365  -18.423 1.00 14.48  ? 209  LEU A N     1 
ATOM   138  C CA    . LEU A 1 24  ? 20.587  -2.873  -19.071 1.00 14.23  ? 209  LEU A CA    1 
ATOM   139  C C     . LEU A 1 24  ? 20.109  -1.588  -18.415 1.00 14.00  ? 209  LEU A C     1 
ATOM   140  O O     . LEU A 1 24  ? 19.638  -0.675  -19.098 1.00 13.67  ? 209  LEU A O     1 
ATOM   141  C CB    . LEU A 1 24  ? 19.500  -3.949  -19.063 1.00 14.46  ? 209  LEU A CB    1 
ATOM   142  C CG    . LEU A 1 24  ? 19.725  -5.011  -20.147 1.00 15.18  ? 209  LEU A CG    1 
ATOM   143  C CD1   . LEU A 1 24  ? 19.040  -6.321  -19.772 1.00 14.93  ? 209  LEU A CD1   1 
ATOM   144  C CD2   . LEU A 1 24  ? 19.246  -4.514  -21.502 1.00 17.21  ? 209  LEU A CD2   1 
ATOM   145  N N     . ILE A 1 25  ? 20.244  -1.504  -17.096 1.00 13.35  ? 210  ILE A N     1 
ATOM   146  C CA    . ILE A 1 25  ? 19.935  -0.253  -16.402 1.00 13.89  ? 210  ILE A CA    1 
ATOM   147  C C     . ILE A 1 25  ? 20.852  0.884   -16.904 1.00 14.27  ? 210  ILE A C     1 
ATOM   148  O O     . ILE A 1 25  ? 20.400  2.012   -17.151 1.00 14.31  ? 210  ILE A O     1 
ATOM   149  C CB    . ILE A 1 25  ? 19.988  -0.437  -14.863 1.00 13.30  ? 210  ILE A CB    1 
ATOM   150  C CG1   . ILE A 1 25  ? 18.782  -1.264  -14.383 1.00 12.93  ? 210  ILE A CG1   1 
ATOM   151  C CG2   . ILE A 1 25  ? 20.061  0.914   -14.133 1.00 14.60  ? 210  ILE A CG2   1 
ATOM   152  C CD1   . ILE A 1 25  ? 18.880  -1.672  -12.931 1.00 13.71  ? 210  ILE A CD1   1 
ATOM   153  N N     . GLU A 1 26  ? 22.134  0.564   -17.087 1.00 14.89  ? 211  GLU A N     1 
ATOM   154  C CA    . GLU A 1 26  ? 23.112  1.533   -17.600 1.00 16.09  ? 211  GLU A CA    1 
ATOM   155  C C     . GLU A 1 26  ? 22.776  2.032   -18.998 1.00 15.97  ? 211  GLU A C     1 
ATOM   156  O O     . GLU A 1 26  ? 22.732  3.249   -19.243 1.00 16.80  ? 211  GLU A O     1 
ATOM   157  C CB    . GLU A 1 26  ? 24.527  0.933   -17.593 1.00 16.24  ? 211  GLU A CB    1 
ATOM   158  C CG    . GLU A 1 26  ? 25.572  1.738   -18.385 1.00 18.09  ? 211  GLU A CG    1 
ATOM   159  C CD    . GLU A 1 26  ? 26.095  2.945   -17.640 1.00 21.79  ? 211  GLU A CD    1 
ATOM   160  O OE1   . GLU A 1 26  ? 27.205  3.394   -17.986 1.00 19.25  ? 211  GLU A OE1   1 
ATOM   161  O OE2   . GLU A 1 26  ? 25.421  3.444   -16.709 1.00 23.17  ? 211  GLU A OE2   1 
ATOM   162  N N     . SER A 1 27  ? 22.566  1.099   -19.926 1.00 15.80  ? 212  SER A N     1 
ATOM   163  C CA    . SER A 1 27  ? 22.341  1.434   -21.324 1.00 16.45  ? 212  SER A CA    1 
ATOM   164  C C     . SER A 1 27  ? 20.988  2.097   -21.564 1.00 16.40  ? 212  SER A C     1 
ATOM   165  O O     . SER A 1 27  ? 20.824  2.857   -22.519 1.00 16.79  ? 212  SER A O     1 
ATOM   166  C CB    . SER A 1 27  ? 22.464  0.187   -22.206 1.00 16.29  ? 212  SER A CB    1 
ATOM   167  O OG    . SER A 1 27  ? 21.391  -0.705  -21.953 1.00 16.29  ? 212  SER A OG    1 
ATOM   168  N N     . GLY A 1 28  ? 20.021  1.791   -20.703 1.00 16.46  ? 213  GLY A N     1 
ATOM   169  C CA    . GLY A 1 28  ? 18.642  2.243   -20.895 1.00 16.38  ? 213  GLY A CA    1 
ATOM   170  C C     . GLY A 1 28  ? 18.031  1.672   -22.162 1.00 16.62  ? 213  GLY A C     1 
ATOM   171  O O     . GLY A 1 28  ? 17.054  2.204   -22.683 1.00 16.44  ? 213  GLY A O     1 
ATOM   172  N N     . LYS A 1 29  ? 18.611  0.577   -22.651 1.00 17.11  ? 214  LYS A N     1 
ATOM   173  C CA    . LYS A 1 29  ? 18.155  -0.056  -23.871 1.00 17.62  ? 214  LYS A CA    1 
ATOM   174  C C     . LYS A 1 29  ? 16.796  -0.704  -23.617 1.00 16.95  ? 214  LYS A C     1 
ATOM   175  O O     . LYS A 1 29  ? 16.618  -1.431  -22.638 1.00 17.02  ? 214  LYS A O     1 
ATOM   176  C CB    . LYS A 1 29  ? 19.162  -1.102  -24.332 1.00 18.75  ? 214  LYS A CB    1 
ATOM   177  C CG    . LYS A 1 29  ? 19.166  -1.309  -25.816 1.00 22.02  ? 214  LYS A CG    1 
ATOM   178  C CD    . LYS A 1 29  ? 20.520  -1.810  -26.302 1.00 24.93  ? 214  LYS A CD    1 
ATOM   179  C CE    . LYS A 1 29  ? 20.748  -3.253  -25.876 1.00 27.23  ? 214  LYS A CE    1 
ATOM   180  N NZ    . LYS A 1 29  ? 22.126  -3.713  -26.197 1.00 28.52  ? 214  LYS A NZ    1 
ATOM   181  N N     . GLU A 1 30  ? 15.844  -0.407  -24.492 1.00 16.58  ? 215  GLU A N     1 
ATOM   182  C CA    . GLU A 1 30  ? 14.461  -0.849  -24.333 1.00 16.47  ? 215  GLU A CA    1 
ATOM   183  C C     . GLU A 1 30  ? 13.986  -1.558  -25.595 1.00 16.87  ? 215  GLU A C     1 
ATOM   184  O O     . GLU A 1 30  ? 13.020  -1.150  -26.245 1.00 18.18  ? 215  GLU A O     1 
ATOM   185  C CB    . GLU A 1 30  ? 13.574  0.336   -23.943 1.00 16.35  ? 215  GLU A CB    1 
ATOM   186  C CG    . GLU A 1 30  ? 14.021  0.931   -22.616 1.00 14.44  ? 215  GLU A CG    1 
ATOM   187  C CD    . GLU A 1 30  ? 13.094  1.961   -22.023 1.00 13.85  ? 215  GLU A CD    1 
ATOM   188  O OE1   . GLU A 1 30  ? 12.196  2.480   -22.732 1.00 13.73  ? 215  GLU A OE1   1 
ATOM   189  O OE2   . GLU A 1 30  ? 13.296  2.248   -20.818 1.00 12.43  ? 215  GLU A OE2   1 
ATOM   190  N N     . GLU A 1 31  ? 14.674  -2.648  -25.922 1.00 16.98  ? 216  GLU A N     1 
ATOM   191  C CA    . GLU A 1 31  ? 14.427  -3.375  -27.156 1.00 17.90  ? 216  GLU A CA    1 
ATOM   192  C C     . GLU A 1 31  ? 13.276  -4.351  -26.997 1.00 16.43  ? 216  GLU A C     1 
ATOM   193  O O     . GLU A 1 31  ? 12.954  -4.778  -25.880 1.00 17.19  ? 216  GLU A O     1 
ATOM   194  C CB    . GLU A 1 31  ? 15.690  -4.113  -27.605 1.00 17.98  ? 216  GLU A CB    1 
ATOM   195  C CG    . GLU A 1 31  ? 16.834  -3.146  -27.916 1.00 20.37  ? 216  GLU A CG    1 
ATOM   196  C CD    . GLU A 1 31  ? 18.042  -3.775  -28.600 1.00 21.33  ? 216  GLU A CD    1 
ATOM   197  O OE1   . GLU A 1 31  ? 18.112  -5.020  -28.730 1.00 26.63  ? 216  GLU A OE1   1 
ATOM   198  O OE2   . GLU A 1 31  ? 18.928  -2.999  -29.011 1.00 25.99  ? 216  GLU A OE2   1 
ATOM   199  N N     . GLY A 1 32  ? 12.663  -4.693  -28.125 1.00 15.55  ? 217  GLY A N     1 
ATOM   200  C CA    . GLY A 1 32  ? 11.614  -5.715  -28.150 1.00 14.16  ? 217  GLY A CA    1 
ATOM   201  C C     . GLY A 1 32  ? 10.243  -5.226  -27.711 1.00 13.63  ? 217  GLY A C     1 
ATOM   202  O O     . GLY A 1 32  ? 9.392   -6.028  -27.369 1.00 13.40  ? 217  GLY A O     1 
ATOM   203  N N     . MET A 1 33  ? 10.040  -3.910  -27.741 1.00 13.28  ? 218  MET A N     1 
ATOM   204  C CA    . MET A 1 33  ? 8.807   -3.272  -27.293 1.00 13.77  ? 218  MET A CA    1 
ATOM   205  C C     . MET A 1 33  ? 8.440   -2.132  -28.223 1.00 12.43  ? 218  MET A C     1 
ATOM   206  O O     . MET A 1 33  ? 9.321   -1.488  -28.794 1.00 13.10  ? 218  MET A O     1 
ATOM   207  C CB    . MET A 1 33  ? 9.019   -2.663  -25.898 1.00 14.63  ? 218  MET A CB    1 
ATOM   208  C CG    . MET A 1 33  ? 9.184   -3.631  -24.763 1.00 15.85  ? 218  MET A CG    1 
ATOM   209  S SD    . MET A 1 33  ? 9.617   -2.663  -23.307 1.00 17.63  ? 218  MET A SD    1 
ATOM   210  C CE    . MET A 1 33  ? 11.367  -2.523  -23.540 1.00 18.52  ? 218  MET A CE    1 
ATOM   211  N N     . LYS A 1 34  ? 7.147   -1.856  -28.339 1.00 11.21  ? 219  LYS A N     1 
ATOM   212  C CA    . LYS A 1 34  ? 6.694   -0.639  -29.000 1.00 11.26  ? 219  LYS A CA    1 
ATOM   213  C C     . LYS A 1 34  ? 5.395   -0.141  -28.369 1.00 10.35  ? 219  LYS A C     1 
ATOM   214  O O     . LYS A 1 34  ? 4.683   -0.890  -27.685 1.00 10.90  ? 219  LYS A O     1 
ATOM   215  C CB    . LYS A 1 34  ? 6.518   -0.874  -30.499 1.00 11.53  ? 219  LYS A CB    1 
ATOM   216  C CG    . LYS A 1 34  ? 5.308   -1.686  -30.844 1.00 12.84  ? 219  LYS A CG    1 
ATOM   217  C CD    . LYS A 1 34  ? 5.234   -1.888  -32.336 1.00 15.77  ? 219  LYS A CD    1 
ATOM   218  C CE    . LYS A 1 34  ? 4.091   -2.790  -32.694 1.00 18.96  ? 219  LYS A CE    1 
ATOM   219  N NZ    . LYS A 1 34  ? 4.070   -3.097  -34.168 1.00 22.00  ? 219  LYS A NZ    1 
ATOM   220  N N     . ILE A 1 35  ? 5.104   1.132   -28.582 1.00 10.41  ? 220  ILE A N     1 
ATOM   221  C CA    . ILE A 1 35  ? 3.869   1.737   -28.112 1.00 10.81  ? 220  ILE A CA    1 
ATOM   222  C C     . ILE A 1 35  ? 2.751   1.445   -29.101 1.00 11.56  ? 220  ILE A C     1 
ATOM   223  O O     . ILE A 1 35  ? 2.958   1.476   -30.323 1.00 13.43  ? 220  ILE A O     1 
ATOM   224  C CB    . ILE A 1 35  ? 4.034   3.270   -27.979 1.00 10.86  ? 220  ILE A CB    1 
ATOM   225  C CG1   . ILE A 1 35  ? 5.187   3.603   -27.034 1.00 11.76  ? 220  ILE A CG1   1 
ATOM   226  C CG2   . ILE A 1 35  ? 2.741   3.923   -27.511 1.00 12.91  ? 220  ILE A CG2   1 
ATOM   227  C CD1   . ILE A 1 35  ? 5.570   5.066   -27.064 1.00 13.46  ? 220  ILE A CD1   1 
ATOM   228  N N     . ASP A 1 36  ? 1.570   1.154   -28.565 1.00 12.34  ? 221  ASP A N     1 
ATOM   229  C CA    . ASP A 1 36  ? 0.365   0.948   -29.374 1.00 13.25  ? 221  ASP A CA    1 
ATOM   230  C C     . ASP A 1 36  ? -0.788  1.587   -28.626 1.00 12.74  ? 221  ASP A C     1 
ATOM   231  O O     . ASP A 1 36  ? -0.710  1.776   -27.411 1.00 13.03  ? 221  ASP A O     1 
ATOM   232  C CB    . ASP A 1 36  ? 0.095   -0.563  -29.569 1.00 14.63  ? 221  ASP A CB    1 
ATOM   233  C CG    . ASP A 1 36  ? -0.783  -0.875  -30.783 1.00 17.19  ? 221  ASP A CG    1 
ATOM   234  O OD1   . ASP A 1 36  ? -1.126  0.050   -31.557 1.00 20.14  ? 221  ASP A OD1   1 
ATOM   235  O OD2   . ASP A 1 36  ? -1.133  -2.072  -30.956 1.00 18.54  ? 221  ASP A OD2   1 
ATOM   236  N N     . LEU A 1 37  ? -1.855  1.942   -29.335 1.00 12.07  ? 222  LEU A N     1 
ATOM   237  C CA    . LEU A 1 37  ? -3.071  2.365   -28.655 1.00 11.69  ? 222  LEU A CA    1 
ATOM   238  C C     . LEU A 1 37  ? -3.869  1.120   -28.298 1.00 10.95  ? 222  LEU A C     1 
ATOM   239  O O     . LEU A 1 37  ? -4.122  0.261   -29.146 1.00 11.30  ? 222  LEU A O     1 
ATOM   240  C CB    . LEU A 1 37  ? -3.897  3.317   -29.537 1.00 12.45  ? 222  LEU A CB    1 
ATOM   241  C CG    . LEU A 1 37  ? -3.297  4.711   -29.797 1.00 14.34  ? 222  LEU A CG    1 
ATOM   242  C CD1   . LEU A 1 37  ? -4.245  5.506   -30.699 1.00 16.50  ? 222  LEU A CD1   1 
ATOM   243  C CD2   . LEU A 1 37  ? -3.018  5.454   -28.488 1.00 15.97  ? 222  LEU A CD2   1 
ATOM   244  N N     . ILE A 1 38  ? -4.216  1.004   -27.021 1.00 9.74   ? 223  ILE A N     1 
ATOM   245  C CA    . ILE A 1 38  ? -4.981  -0.144  -26.542 1.00 9.55   ? 223  ILE A CA    1 
ATOM   246  C C     . ILE A 1 38  ? -6.364  0.340   -26.126 1.00 9.07   ? 223  ILE A C     1 
ATOM   247  O O     . ILE A 1 38  ? -6.477  1.263   -25.314 1.00 8.86   ? 223  ILE A O     1 
ATOM   248  C CB    . ILE A 1 38  ? -4.260  -0.857  -25.371 1.00 9.97   ? 223  ILE A CB    1 
ATOM   249  C CG1   . ILE A 1 38  ? -2.863  -1.344  -25.801 1.00 11.58  ? 223  ILE A CG1   1 
ATOM   250  C CG2   . ILE A 1 38  ? -5.112  -2.017  -24.833 1.00 10.35  ? 223  ILE A CG2   1 
ATOM   251  C CD1   . ILE A 1 38  ? -2.851  -2.526  -26.761 1.00 14.42  ? 223  ILE A CD1   1 
ATOM   252  N N     . ASP A 1 39  ? -7.400  -0.289  -26.684 1.00 8.73   ? 224  ASP A N     1 
ATOM   253  C CA    . ASP A 1 39  ? -8.793  0.127   -26.486 1.00 8.19   ? 224  ASP A CA    1 
ATOM   254  C C     . ASP A 1 39  ? -9.090  0.290   -24.999 1.00 8.83   ? 224  ASP A C     1 
ATOM   255  O O     . ASP A 1 39  ? -8.949  -0.666  -24.218 1.00 9.92   ? 224  ASP A O     1 
ATOM   256  C CB    . ASP A 1 39  ? -9.725  -0.925  -27.126 1.00 8.65   ? 224  ASP A CB    1 
ATOM   257  C CG    . ASP A 1 39  ? -11.167 -0.488  -27.220 1.00 8.42   ? 224  ASP A CG    1 
ATOM   258  O OD1   . ASP A 1 39  ? -11.456 0.705   -27.032 1.00 9.61   ? 224  ASP A OD1   1 
ATOM   259  O OD2   . ASP A 1 39  ? -12.015 -1.360  -27.530 1.00 11.33  ? 224  ASP A OD2   1 
ATOM   260  N N     . GLY A 1 40  ? -9.475  1.508   -24.608 1.00 8.69   ? 225  GLY A N     1 
ATOM   261  C CA    . GLY A 1 40  ? -9.879  1.773   -23.233 1.00 9.64   ? 225  GLY A CA    1 
ATOM   262  C C     . GLY A 1 40  ? -8.759  2.076   -22.254 1.00 9.96   ? 225  GLY A C     1 
ATOM   263  O O     . GLY A 1 40  ? -9.019  2.317   -21.071 1.00 11.87  ? 225  GLY A O     1 
ATOM   264  N N     . LYS A 1 41  ? -7.515  2.080   -22.726 1.00 9.35   ? 226  LYS A N     1 
ATOM   265  C CA    . LYS A 1 41  ? -6.370  2.268   -21.826 1.00 9.61   ? 226  LYS A CA    1 
ATOM   266  C C     . LYS A 1 41  ? -5.467  3.429   -22.187 1.00 10.00  ? 226  LYS A C     1 
ATOM   267  O O     . LYS A 1 41  ? -4.554  3.736   -21.435 1.00 11.13  ? 226  LYS A O     1 
ATOM   268  C CB    . LYS A 1 41  ? -5.522  0.989   -21.739 1.00 9.45   ? 226  LYS A CB    1 
ATOM   269  C CG    . LYS A 1 41  ? -6.306  -0.256  -21.391 1.00 10.20  ? 226  LYS A CG    1 
ATOM   270  C CD    . LYS A 1 41  ? -5.371  -1.424  -21.104 1.00 10.15  ? 226  LYS A CD    1 
ATOM   271  C CE    . LYS A 1 41  ? -6.141  -2.739  -21.185 1.00 9.57   ? 226  LYS A CE    1 
ATOM   272  N NZ    . LYS A 1 41  ? -5.234  -3.925  -21.067 1.00 9.50   ? 226  LYS A NZ    1 
ATOM   273  N N     . GLY A 1 42  ? -5.713  4.078   -23.316 1.00 9.31   ? 227  GLY A N     1 
ATOM   274  C CA    . GLY A 1 42  ? -4.756  5.061   -23.819 1.00 9.66   ? 227  GLY A CA    1 
ATOM   275  C C     . GLY A 1 42  ? -3.618  4.361   -24.543 1.00 9.37   ? 227  GLY A C     1 
ATOM   276  O O     . GLY A 1 42  ? -3.852  3.450   -25.347 1.00 10.15  ? 227  GLY A O     1 
ATOM   277  N N     . ARG A 1 43  ? -2.384  4.778   -24.284 1.00 8.85   ? 228  ARG A N     1 
ATOM   278  C CA    . ARG A 1 43  ? -1.235  4.055   -24.810 1.00 9.39   ? 228  ARG A CA    1 
ATOM   279  C C     . ARG A 1 43  ? -0.960  2.851   -23.941 1.00 9.21   ? 228  ARG A C     1 
ATOM   280  O O     . ARG A 1 43  ? -1.197  2.868   -22.723 1.00 9.92   ? 228  ARG A O     1 
ATOM   281  C CB    . ARG A 1 43  ? 0.025   4.925   -24.803 1.00 9.34   ? 228  ARG A CB    1 
ATOM   282  C CG    . ARG A 1 43  ? -0.084  6.171   -25.664 1.00 9.50   ? 228  ARG A CG    1 
ATOM   283  C CD    . ARG A 1 43  ? 1.020   7.161   -25.316 1.00 10.17  ? 228  ARG A CD    1 
ATOM   284  N NE    . ARG A 1 43  ? 0.873   7.727   -23.977 1.00 9.41   ? 228  ARG A NE    1 
ATOM   285  C CZ    . ARG A 1 43  ? 1.658   8.694   -23.487 1.00 10.46  ? 228  ARG A CZ    1 
ATOM   286  N NH1   . ARG A 1 43  ? 2.657   9.185   -24.221 1.00 12.25  ? 228  ARG A NH1   1 
ATOM   287  N NH2   . ARG A 1 43  ? 1.457   9.164   -22.259 1.00 11.77  ? 228  ARG A NH2   1 
ATOM   288  N N     . GLY A 1 44  ? -0.433  1.811   -24.577 1.00 9.33   ? 229  GLY A N     1 
ATOM   289  C CA    . GLY A 1 44  ? 0.213   0.714   -23.872 1.00 9.29   ? 229  GLY A CA    1 
ATOM   290  C C     . GLY A 1 44  ? 1.483   0.321   -24.586 1.00 9.34   ? 229  GLY A C     1 
ATOM   291  O O     . GLY A 1 44  ? 1.822   0.888   -25.625 1.00 9.56   ? 229  GLY A O     1 
ATOM   292  N N     . VAL A 1 45  ? 2.189   -0.652  -24.022 1.00 8.99   ? 230  VAL A N     1 
ATOM   293  C CA    . VAL A 1 45  ? 3.430   -1.130  -24.607 1.00 9.77   ? 230  VAL A CA    1 
ATOM   294  C C     . VAL A 1 45  ? 3.246   -2.588  -24.946 1.00 9.91   ? 230  VAL A C     1 
ATOM   295  O O     . VAL A 1 45  ? 2.808   -3.369  -24.089 1.00 10.01  ? 230  VAL A O     1 
ATOM   296  C CB    . VAL A 1 45  ? 4.631   -0.941  -23.652 1.00 9.75   ? 230  VAL A CB    1 
ATOM   297  C CG1   . VAL A 1 45  ? 5.939   -1.346  -24.331 1.00 11.48  ? 230  VAL A CG1   1 
ATOM   298  C CG2   . VAL A 1 45  ? 4.711   0.521   -23.186 1.00 10.76  ? 230  VAL A CG2   1 
ATOM   299  N N     . ILE A 1 46  ? 3.581   -2.950  -26.184 1.00 10.41  ? 231  ILE A N     1 
ATOM   300  C CA    . ILE A 1 46  ? 3.422   -4.328  -26.620 1.00 10.88  ? 231  ILE A CA    1 
ATOM   301  C C     . ILE A 1 46  ? 4.762   -4.938  -26.983 1.00 10.22  ? 231  ILE A C     1 
ATOM   302  O O     . ILE A 1 46  ? 5.669   -4.242  -27.422 1.00 10.29  ? 231  ILE A O     1 
ATOM   303  C CB    . ILE A 1 46  ? 2.366   -4.486  -27.755 1.00 12.12  ? 231  ILE A CB    1 
ATOM   304  C CG1   . ILE A 1 46  ? 2.920   -4.018  -29.083 1.00 13.97  ? 231  ILE A CG1   1 
ATOM   305  C CG2   . ILE A 1 46  ? 1.030   -3.765  -27.390 1.00 13.93  ? 231  ILE A CG2   1 
ATOM   306  C CD1   . ILE A 1 46  ? 1.981   -4.300  -30.234 1.00 14.72  ? 231  ILE A CD1   1 
ATOM   307  N N     . ALA A 1 47  ? 4.888   -6.235  -26.737 1.00 9.83   ? 232  ALA A N     1 
ATOM   308  C CA    . ALA A 1 47  ? 6.091   -6.950  -27.089 1.00 10.14  ? 232  ALA A CA    1 
ATOM   309  C C     . ALA A 1 47  ? 6.192   -7.059  -28.613 1.00 10.55  ? 232  ALA A C     1 
ATOM   310  O O     . ALA A 1 47  ? 5.189   -7.311  -29.296 1.00 10.16  ? 232  ALA A O     1 
ATOM   311  C CB    . ALA A 1 47  ? 6.075   -8.322  -26.457 1.00 9.91   ? 232  ALA A CB    1 
ATOM   312  N N     . THR A 1 48  ? 7.390   -6.855  -29.146 1.00 10.70  ? 233  THR A N     1 
ATOM   313  C CA    . THR A 1 48  ? 7.624   -7.084  -30.579 1.00 11.63  ? 233  THR A CA    1 
ATOM   314  C C     . THR A 1 48  ? 8.496   -8.317  -30.814 1.00 11.94  ? 233  THR A C     1 
ATOM   315  O O     . THR A 1 48  ? 8.814   -8.666  -31.950 1.00 12.85  ? 233  THR A O     1 
ATOM   316  C CB    . THR A 1 48  ? 8.287   -5.869  -31.248 1.00 12.15  ? 233  THR A CB    1 
ATOM   317  O OG1   . THR A 1 48  ? 9.565   -5.658  -30.641 1.00 13.99  ? 233  THR A OG1   1 
ATOM   318  C CG2   . THR A 1 48  ? 7.419   -4.619  -31.074 1.00 13.52  ? 233  THR A CG2   1 
ATOM   319  N N     . LYS A 1 49  ? 8.901   -8.946  -29.721 1.00 11.92  ? 234  LYS A N     1 
ATOM   320  C CA    . LYS A 1 49  ? 9.625   -10.213 -29.749 1.00 12.18  ? 234  LYS A CA    1 
ATOM   321  C C     . LYS A 1 49  ? 9.091   -11.007 -28.575 1.00 11.58  ? 234  LYS A C     1 
ATOM   322  O O     . LYS A 1 49  ? 8.433   -10.443 -27.682 1.00 11.51  ? 234  LYS A O     1 
ATOM   323  C CB    . LYS A 1 49  ? 11.142  -9.994  -29.586 1.00 12.38  ? 234  LYS A CB    1 
ATOM   324  C CG    . LYS A 1 49  ? 11.519  -9.483  -28.217 1.00 14.73  ? 234  LYS A CG    1 
ATOM   325  C CD    . LYS A 1 49  ? 13.020  -9.402  -28.010 1.00 16.58  ? 234  LYS A CD    1 
ATOM   326  C CE    . LYS A 1 49  ? 13.339  -8.905  -26.606 1.00 19.69  ? 234  LYS A CE    1 
ATOM   327  N NZ    . LYS A 1 49  ? 14.809  -8.824  -26.354 1.00 22.98  ? 234  LYS A NZ    1 
ATOM   328  N N     . GLN A 1 50  ? 9.391   -12.300 -28.544 1.00 10.70  ? 235  GLN A N     1 
ATOM   329  C CA    . GLN A 1 50  ? 9.061   -13.093 -27.368 1.00 10.38  ? 235  GLN A CA    1 
ATOM   330  C C     . GLN A 1 50  ? 10.040  -12.789 -26.237 1.00 10.88  ? 235  GLN A C     1 
ATOM   331  O O     . GLN A 1 50  ? 11.257  -12.686 -26.464 1.00 12.19  ? 235  GLN A O     1 
ATOM   332  C CB    . GLN A 1 50  ? 9.066   -14.590 -27.703 1.00 10.52  ? 235  GLN A CB    1 
ATOM   333  C CG    . GLN A 1 50  ? 8.600   -15.469 -26.545 1.00 10.71  ? 235  GLN A CG    1 
ATOM   334  C CD    . GLN A 1 50  ? 8.070   -16.796 -27.005 1.00 10.53  ? 235  GLN A CD    1 
ATOM   335  O OE1   . GLN A 1 50  ? 7.337   -16.877 -28.003 1.00 11.84  ? 235  GLN A OE1   1 
ATOM   336  N NE2   . GLN A 1 50  ? 8.423   -17.849 -26.283 1.00 9.96   ? 235  GLN A NE2   1 
ATOM   337  N N     . PHE A 1 51  ? 9.505   -12.610 -25.036 1.00 10.50  ? 236  PHE A N     1 
ATOM   338  C CA    . PHE A 1 51  ? 10.324  -12.549 -23.821 1.00 10.25  ? 236  PHE A CA    1 
ATOM   339  C C     . PHE A 1 51  ? 10.167  -13.856 -23.078 1.00 10.51  ? 236  PHE A C     1 
ATOM   340  O O     . PHE A 1 51  ? 9.086   -14.442 -23.065 1.00 10.19  ? 236  PHE A O     1 
ATOM   341  C CB    . PHE A 1 51  ? 9.885   -11.410 -22.888 1.00 10.46  ? 236  PHE A CB    1 
ATOM   342  C CG    . PHE A 1 51  ? 10.225  -10.038 -23.395 1.00 10.40  ? 236  PHE A CG    1 
ATOM   343  C CD1   . PHE A 1 51  ? 11.312  -9.366  -22.874 1.00 11.58  ? 236  PHE A CD1   1 
ATOM   344  C CD2   . PHE A 1 51  ? 9.439   -9.407  -24.356 1.00 12.49  ? 236  PHE A CD2   1 
ATOM   345  C CE1   . PHE A 1 51  ? 11.643  -8.078  -23.318 1.00 12.91  ? 236  PHE A CE1   1 
ATOM   346  C CE2   . PHE A 1 51  ? 9.757   -8.133  -24.811 1.00 13.17  ? 236  PHE A CE2   1 
ATOM   347  C CZ    . PHE A 1 51  ? 10.859  -7.467  -24.291 1.00 13.21  ? 236  PHE A CZ    1 
ATOM   348  N N     . SER A 1 52  ? 11.235  -14.301 -22.430 1.00 10.29  ? 237  SER A N     1 
ATOM   349  C CA    . SER A 1 52  ? 11.166  -15.518 -21.623 1.00 10.21  ? 237  SER A CA    1 
ATOM   350  C C     . SER A 1 52  ? 10.937  -15.194 -20.157 1.00 10.26  ? 237  SER A C     1 
ATOM   351  O O     . SER A 1 52  ? 11.397  -14.173 -19.663 1.00 9.72   ? 237  SER A O     1 
ATOM   352  C CB    . SER A 1 52  ? 12.445  -16.348 -21.769 1.00 10.57  ? 237  SER A CB    1 
ATOM   353  O OG    . SER A 1 52  ? 12.592  -16.813 -23.096 1.00 11.88  ? 237  SER A OG    1 
ATOM   354  N N     . ARG A 1 53  ? 10.225  -16.071 -19.458 1.00 10.03  ? 238  ARG A N     1 
ATOM   355  C CA    . ARG A 1 53  ? 10.064  -15.936 -18.018 1.00 10.80  ? 238  ARG A CA    1 
ATOM   356  C C     . ARG A 1 53  ? 11.417  -15.629 -17.364 1.00 10.13  ? 238  ARG A C     1 
ATOM   357  O O     . ARG A 1 53  ? 12.416  -16.334 -17.601 1.00 9.63   ? 238  ARG A O     1 
ATOM   358  C CB    . ARG A 1 53  ? 9.487   -17.230 -17.428 1.00 11.17  ? 238  ARG A CB    1 
ATOM   359  C CG    . ARG A 1 53  ? 9.222   -17.140 -15.946 1.00 12.09  ? 238  ARG A CG    1 
ATOM   360  C CD    . ARG A 1 53  ? 8.559   -18.401 -15.359 1.00 14.97  ? 238  ARG A CD    1 
ATOM   361  N NE    . ARG A 1 53  ? 8.508   -18.268 -13.902 1.00 23.50  ? 238  ARG A NE    1 
ATOM   362  C CZ    . ARG A 1 53  ? 7.842   -19.061 -13.071 1.00 26.66  ? 238  ARG A CZ    1 
ATOM   363  N NH1   . ARG A 1 53  ? 7.123   -20.079 -13.528 1.00 28.35  ? 238  ARG A NH1   1 
ATOM   364  N NH2   . ARG A 1 53  ? 7.886   -18.821 -11.768 1.00 28.05  ? 238  ARG A NH2   1 
ATOM   365  N N     . GLY A 1 54  ? 11.429  -14.587 -16.538 1.00 9.31   ? 239  GLY A N     1 
ATOM   366  C CA    . GLY A 1 54  ? 12.630  -14.197 -15.802 1.00 9.78   ? 239  GLY A CA    1 
ATOM   367  C C     . GLY A 1 54  ? 13.440  -13.101 -16.453 1.00 10.53  ? 239  GLY A C     1 
ATOM   368  O O     . GLY A 1 54  ? 14.314  -12.522 -15.807 1.00 10.90  ? 239  GLY A O     1 
ATOM   369  N N     . ASP A 1 55  ? 13.163  -12.815 -17.727 1.00 10.29  ? 240  ASP A N     1 
ATOM   370  C CA    . ASP A 1 55  ? 13.935  -11.791 -18.453 1.00 10.41  ? 240  ASP A CA    1 
ATOM   371  C C     . ASP A 1 55  ? 13.689  -10.406 -17.890 1.00 10.30  ? 240  ASP A C     1 
ATOM   372  O O     . ASP A 1 55  ? 12.564  -10.068 -17.522 1.00 11.02  ? 240  ASP A O     1 
ATOM   373  C CB    . ASP A 1 55  ? 13.511  -11.740 -19.920 1.00 11.41  ? 240  ASP A CB    1 
ATOM   374  C CG    . ASP A 1 55  ? 14.051  -12.872 -20.754 1.00 11.61  ? 240  ASP A CG    1 
ATOM   375  O OD1   . ASP A 1 55  ? 13.654  -12.925 -21.940 1.00 12.05  ? 240  ASP A OD1   1 
ATOM   376  O OD2   . ASP A 1 55  ? 14.870  -13.683 -20.270 1.00 12.85  ? 240  ASP A OD2   1 
ATOM   377  N N     . PHE A 1 56  ? 14.733  -9.579  -17.879 1.00 10.70  ? 241  PHE A N     1 
ATOM   378  C CA    . PHE A 1 56  ? 14.555  -8.143  -17.717 1.00 10.47  ? 241  PHE A CA    1 
ATOM   379  C C     . PHE A 1 56  ? 13.713  -7.629  -18.877 1.00 10.96  ? 241  PHE A C     1 
ATOM   380  O O     . PHE A 1 56  ? 13.981  -7.962  -20.038 1.00 11.59  ? 241  PHE A O     1 
ATOM   381  C CB    . PHE A 1 56  ? 15.932  -7.465  -17.758 1.00 10.72  ? 241  PHE A CB    1 
ATOM   382  C CG    . PHE A 1 56  ? 15.891  -5.958  -17.648 1.00 11.59  ? 241  PHE A CG    1 
ATOM   383  C CD1   . PHE A 1 56  ? 16.049  -5.335  -16.416 1.00 12.28  ? 241  PHE A CD1   1 
ATOM   384  C CD2   . PHE A 1 56  ? 15.735  -5.165  -18.780 1.00 11.48  ? 241  PHE A CD2   1 
ATOM   385  C CE1   . PHE A 1 56  ? 16.027  -3.943  -16.318 1.00 13.01  ? 241  PHE A CE1   1 
ATOM   386  C CE2   . PHE A 1 56  ? 15.736  -3.767  -18.687 1.00 11.96  ? 241  PHE A CE2   1 
ATOM   387  C CZ    . PHE A 1 56  ? 15.869  -3.164  -17.455 1.00 12.10  ? 241  PHE A CZ    1 
ATOM   388  N N     . VAL A 1 57  ? 12.717  -6.803  -18.563 1.00 10.47  ? 242  VAL A N     1 
ATOM   389  C CA    . VAL A 1 57  ? 11.874  -6.201  -19.596 1.00 10.62  ? 242  VAL A CA    1 
ATOM   390  C C     . VAL A 1 57  ? 12.215  -4.717  -19.729 1.00 10.02  ? 242  VAL A C     1 
ATOM   391  O O     . VAL A 1 57  ? 12.655  -4.278  -20.792 1.00 10.44  ? 242  VAL A O     1 
ATOM   392  C CB    . VAL A 1 57  ? 10.374  -6.416  -19.276 1.00 10.85  ? 242  VAL A CB    1 
ATOM   393  C CG1   . VAL A 1 57  ? 9.478   -5.687  -20.281 1.00 11.60  ? 242  VAL A CG1   1 
ATOM   394  C CG2   . VAL A 1 57  ? 10.050  -7.912  -19.306 1.00 11.26  ? 242  VAL A CG2   1 
ATOM   395  N N     . VAL A 1 58  ? 12.058  -3.957  -18.646 1.00 10.35  ? 243  VAL A N     1 
ATOM   396  C CA    . VAL A 1 58  ? 12.295  -2.516  -18.698 1.00 10.90  ? 243  VAL A CA    1 
ATOM   397  C C     . VAL A 1 58  ? 12.488  -1.980  -17.280 1.00 10.88  ? 243  VAL A C     1 
ATOM   398  O O     . VAL A 1 58  ? 12.018  -2.598  -16.323 1.00 11.21  ? 243  VAL A O     1 
ATOM   399  C CB    . VAL A 1 58  ? 11.097  -1.810  -19.425 1.00 11.70  ? 243  VAL A CB    1 
ATOM   400  C CG1   . VAL A 1 58  ? 9.879   -1.757  -18.543 1.00 12.06  ? 243  VAL A CG1   1 
ATOM   401  C CG2   . VAL A 1 58  ? 11.464  -0.433  -19.929 1.00 13.80  ? 243  VAL A CG2   1 
ATOM   402  N N     . GLU A 1 59  ? 13.191  -0.856  -17.139 1.00 10.70  ? 244  GLU A N     1 
ATOM   403  C CA    . GLU A 1 59  ? 13.201  -0.126  -15.863 1.00 10.67  ? 244  GLU A CA    1 
ATOM   404  C C     . GLU A 1 59  ? 11.972  0.783   -15.817 1.00 10.37  ? 244  GLU A C     1 
ATOM   405  O O     . GLU A 1 59  ? 11.571  1.323   -16.852 1.00 11.10  ? 244  GLU A O     1 
ATOM   406  C CB    . GLU A 1 59  ? 14.475  0.730   -15.722 1.00 10.69  ? 244  GLU A CB    1 
ATOM   407  C CG    . GLU A 1 59  ? 14.507  1.535   -14.406 1.00 11.26  ? 244  GLU A CG    1 
ATOM   408  C CD    . GLU A 1 59  ? 15.825  2.203   -14.069 1.00 11.47  ? 244  GLU A CD    1 
ATOM   409  O OE1   . GLU A 1 59  ? 16.748  2.210   -14.908 1.00 13.41  ? 244  GLU A OE1   1 
ATOM   410  O OE2   . GLU A 1 59  ? 15.915  2.732   -12.944 1.00 12.06  ? 244  GLU A OE2   1 
ATOM   411  N N     . TYR A 1 60  ? 11.373  0.943   -14.631 1.00 10.74  ? 245  TYR A N     1 
ATOM   412  C CA    . TYR A 1 60  ? 10.374  1.989   -14.446 1.00 10.27  ? 245  TYR A CA    1 
ATOM   413  C C     . TYR A 1 60  ? 11.204  3.236   -14.173 1.00 10.64  ? 245  TYR A C     1 
ATOM   414  O O     . TYR A 1 60  ? 11.665  3.447   -13.043 1.00 11.58  ? 245  TYR A O     1 
ATOM   415  C CB    . TYR A 1 60  ? 9.377   1.706   -13.304 1.00 10.59  ? 245  TYR A CB    1 
ATOM   416  C CG    . TYR A 1 60  ? 8.220   2.677   -13.368 1.00 8.73   ? 245  TYR A CG    1 
ATOM   417  C CD1   . TYR A 1 60  ? 7.086   2.372   -14.095 1.00 9.44   ? 245  TYR A CD1   1 
ATOM   418  C CD2   . TYR A 1 60  ? 8.289   3.934   -12.746 1.00 10.28  ? 245  TYR A CD2   1 
ATOM   419  C CE1   . TYR A 1 60  ? 6.033   3.284   -14.185 1.00 9.82   ? 245  TYR A CE1   1 
ATOM   420  C CE2   . TYR A 1 60  ? 7.241   4.852   -12.833 1.00 9.32   ? 245  TYR A CE2   1 
ATOM   421  C CZ    . TYR A 1 60  ? 6.118   4.518   -13.569 1.00 9.66   ? 245  TYR A CZ    1 
ATOM   422  O OH    . TYR A 1 60  ? 5.070   5.412   -13.670 1.00 9.96   ? 245  TYR A OH    1 
ATOM   423  N N     . HIS A 1 61  ? 11.415  4.033   -15.225 1.00 10.66  ? 246  HIS A N     1 
ATOM   424  C CA    . HIS A 1 61  ? 12.402  5.104   -15.201 1.00 11.20  ? 246  HIS A CA    1 
ATOM   425  C C     . HIS A 1 61  ? 11.724  6.464   -15.154 1.00 11.42  ? 246  HIS A C     1 
ATOM   426  O O     . HIS A 1 61  ? 10.770  6.715   -15.894 1.00 11.68  ? 246  HIS A O     1 
ATOM   427  C CB    . HIS A 1 61  ? 13.313  5.008   -16.421 1.00 11.42  ? 246  HIS A CB    1 
ATOM   428  C CG    . HIS A 1 61  ? 14.529  5.870   -16.315 1.00 12.18  ? 246  HIS A CG    1 
ATOM   429  N ND1   . HIS A 1 61  ? 14.550  7.185   -16.733 1.00 13.40  ? 246  HIS A ND1   1 
ATOM   430  C CD2   . HIS A 1 61  ? 15.760  5.609   -15.816 1.00 13.11  ? 246  HIS A CD2   1 
ATOM   431  C CE1   . HIS A 1 61  ? 15.747  7.696   -16.494 1.00 13.76  ? 246  HIS A CE1   1 
ATOM   432  N NE2   . HIS A 1 61  ? 16.501  6.761   -15.940 1.00 14.59  ? 246  HIS A NE2   1 
ATOM   433  N N     . GLY A 1 62  ? 12.221  7.327   -14.273 1.00 12.00  ? 247  GLY A N     1 
ATOM   434  C CA    . GLY A 1 62  ? 11.676  8.667   -14.076 1.00 12.68  ? 247  GLY A CA    1 
ATOM   435  C C     . GLY A 1 62  ? 12.538  9.407   -13.065 1.00 13.54  ? 247  GLY A C     1 
ATOM   436  O O     . GLY A 1 62  ? 13.724  9.094   -12.913 1.00 14.43  ? 247  GLY A O     1 
ATOM   437  N N     . ASP A 1 63  ? 11.932  10.368  -12.369 1.00 13.91  ? 248  ASP A N     1 
ATOM   438  C CA    . ASP A 1 63  ? 12.619  11.161  -11.345 1.00 14.97  ? 248  ASP A CA    1 
ATOM   439  C C     . ASP A 1 63  ? 12.564  10.427  -10.012 1.00 14.48  ? 248  ASP A C     1 
ATOM   440  O O     . ASP A 1 63  ? 11.485  10.272  -9.451  1.00 15.14  ? 248  ASP A O     1 
ATOM   441  C CB    . ASP A 1 63  ? 11.924  12.511  -11.157 1.00 16.01  ? 248  ASP A CB    1 
ATOM   442  C CG    . ASP A 1 63  ? 12.031  13.420  -12.352 1.00 19.12  ? 248  ASP A CG    1 
ATOM   443  O OD1   . ASP A 1 63  ? 12.922  13.231  -13.214 1.00 23.23  ? 248  ASP A OD1   1 
ATOM   444  O OD2   . ASP A 1 63  ? 11.205  14.357  -12.411 1.00 22.51  ? 248  ASP A OD2   1 
ATOM   445  N N     . LEU A 1 64  ? 13.709  9.986   -9.499  1.00 14.19  ? 249  LEU A N     1 
ATOM   446  C CA    . LEU A 1 64  ? 13.730  9.360   -8.173  1.00 13.82  ? 249  LEU A CA    1 
ATOM   447  C C     . LEU A 1 64  ? 13.720  10.431  -7.098  1.00 13.91  ? 249  LEU A C     1 
ATOM   448  O O     . LEU A 1 64  ? 14.642  11.251  -7.020  1.00 13.88  ? 249  LEU A O     1 
ATOM   449  C CB    . LEU A 1 64  ? 14.934  8.428   -8.004  1.00 13.78  ? 249  LEU A CB    1 
ATOM   450  C CG    . LEU A 1 64  ? 15.088  7.763   -6.622  1.00 13.66  ? 249  LEU A CG    1 
ATOM   451  C CD1   . LEU A 1 64  ? 13.936  6.789   -6.365  1.00 14.74  ? 249  LEU A CD1   1 
ATOM   452  C CD2   . LEU A 1 64  ? 16.442  7.088   -6.487  1.00 14.90  ? 249  LEU A CD2   1 
ATOM   453  N N     . ILE A 1 65  ? 12.677  10.405  -6.272  1.00 13.74  ? 250  ILE A N     1 
ATOM   454  C CA    . ILE A 1 65  ? 12.482  11.405  -5.222  1.00 13.44  ? 250  ILE A CA    1 
ATOM   455  C C     . ILE A 1 65  ? 12.106  10.775  -3.887  1.00 13.01  ? 250  ILE A C     1 
ATOM   456  O O     . ILE A 1 65  ? 11.672  9.620   -3.833  1.00 13.31  ? 250  ILE A O     1 
ATOM   457  C CB    . ILE A 1 65  ? 11.420  12.467  -5.634  1.00 13.25  ? 250  ILE A CB    1 
ATOM   458  C CG1   . ILE A 1 65  ? 10.032  11.835  -5.815  1.00 13.66  ? 250  ILE A CG1   1 
ATOM   459  C CG2   . ILE A 1 65  ? 11.846  13.197  -6.921  1.00 13.84  ? 250  ILE A CG2   1 
ATOM   460  C CD1   . ILE A 1 65  ? 8.976   12.823  -6.296  1.00 13.80  ? 250  ILE A CD1   1 
ATOM   461  N N     . GLU A 1 66  ? 12.290  11.537  -2.813  1.00 12.89  ? 251  GLU A N     1 
ATOM   462  C CA    . GLU A 1 66  ? 11.874  11.106  -1.480  1.00 13.50  ? 251  GLU A CA    1 
ATOM   463  C C     . GLU A 1 66  ? 10.486  11.645  -1.131  1.00 12.90  ? 251  GLU A C     1 
ATOM   464  O O     . GLU A 1 66  ? 9.839   12.298  -1.956  1.00 12.65  ? 251  GLU A O     1 
ATOM   465  C CB    . GLU A 1 66  ? 12.915  11.523  -0.428  1.00 13.91  ? 251  GLU A CB    1 
ATOM   466  C CG    . GLU A 1 66  ? 13.361  12.997  -0.437  1.00 17.38  ? 251  GLU A CG    1 
ATOM   467  C CD    . GLU A 1 66  ? 12.310  13.974  0.105   1.00 19.93  ? 251  GLU A CD    1 
ATOM   468  O OE1   . GLU A 1 66  ? 11.859  14.838  -0.679  1.00 20.03  ? 251  GLU A OE1   1 
ATOM   469  O OE2   . GLU A 1 66  ? 11.951  13.885  1.310   1.00 21.22  ? 251  GLU A OE2   1 
ATOM   470  N N     . ILE A 1 67  ? 10.037  11.387  0.101   1.00 12.89  ? 252  ILE A N     1 
ATOM   471  C CA    . ILE A 1 67  ? 8.615   11.565  0.418   1.00 13.48  ? 252  ILE A CA    1 
ATOM   472  C C     . ILE A 1 67  ? 8.119   13.015  0.459   1.00 13.45  ? 252  ILE A C     1 
ATOM   473  O O     . ILE A 1 67  ? 6.992   13.303  0.049   1.00 13.08  ? 252  ILE A O     1 
ATOM   474  C CB    . ILE A 1 67  ? 8.213   10.818  1.719   1.00 13.68  ? 252  ILE A CB    1 
ATOM   475  C CG1   . ILE A 1 67  ? 6.685   10.744  1.828   1.00 14.43  ? 252  ILE A CG1   1 
ATOM   476  C CG2   . ILE A 1 67  ? 8.856   11.461  2.941   1.00 13.75  ? 252  ILE A CG2   1 
ATOM   477  C CD1   . ILE A 1 67  ? 6.169   9.920   2.985   1.00 14.00  ? 252  ILE A CD1   1 
ATOM   478  N N     . THR A 1 68  ? 8.952   13.922  0.959   1.00 13.58  ? 253  THR A N     1 
ATOM   479  C CA    . THR A 1 68  ? 8.540   15.309  1.052   1.00 14.42  ? 253  THR A CA    1 
ATOM   480  C C     . THR A 1 68  ? 8.261   15.882  -0.341  1.00 14.29  ? 253  THR A C     1 
ATOM   481  O O     . THR A 1 68  ? 7.219   16.506  -0.571  1.00 14.31  ? 253  THR A O     1 
ATOM   482  C CB    . THR A 1 68  ? 9.586   16.150  1.797   1.00 14.30  ? 253  THR A CB    1 
ATOM   483  O OG1   . THR A 1 68  ? 9.802   15.574  3.094   1.00 15.49  ? 253  THR A OG1   1 
ATOM   484  C CG2   . THR A 1 68  ? 9.107   17.581  1.947   1.00 16.24  ? 253  THR A CG2   1 
ATOM   485  N N     . ASP A 1 69  ? 9.180   15.639  -1.270  1.00 14.66  ? 254  ASP A N     1 
ATOM   486  C CA    . ASP A 1 69  ? 8.995   16.088  -2.642  1.00 15.48  ? 254  ASP A CA    1 
ATOM   487  C C     . ASP A 1 69  ? 7.844   15.333  -3.317  1.00 15.47  ? 254  ASP A C     1 
ATOM   488  O O     . ASP A 1 69  ? 7.082   15.913  -4.084  1.00 15.40  ? 254  ASP A O     1 
ATOM   489  C CB    . ASP A 1 69  ? 10.291  15.931  -3.435  1.00 16.02  ? 254  ASP A CB    1 
ATOM   490  C CG    . ASP A 1 69  ? 10.300  16.753  -4.721  1.00 19.83  ? 254  ASP A CG    1 
ATOM   491  O OD1   . ASP A 1 69  ? 9.486   17.699  -4.856  1.00 22.98  ? 254  ASP A OD1   1 
ATOM   492  O OD2   . ASP A 1 69  ? 11.144  16.457  -5.594  1.00 22.18  ? 254  ASP A OD2   1 
ATOM   493  N N     . ALA A 1 70  ? 7.705   14.044  -3.026  1.00 15.44  ? 255  ALA A N     1 
ATOM   494  C CA    . ALA A 1 70  ? 6.606   13.274  -3.621  1.00 15.61  ? 255  ALA A CA    1 
ATOM   495  C C     . ALA A 1 70  ? 5.241   13.827  -3.205  1.00 16.28  ? 255  ALA A C     1 
ATOM   496  O O     . ALA A 1 70  ? 4.352   13.977  -4.032  1.00 16.22  ? 255  ALA A O     1 
ATOM   497  C CB    . ALA A 1 70  ? 6.728   11.786  -3.286  1.00 15.62  ? 255  ALA A CB    1 
ATOM   498  N N     . LYS A 1 71  ? 5.100   14.167  -1.925  1.00 16.92  ? 256  LYS A N     1 
ATOM   499  C CA    . LYS A 1 71  ? 3.846   14.726  -1.424  1.00 18.15  ? 256  LYS A CA    1 
ATOM   500  C C     . LYS A 1 71  ? 3.585   16.116  -1.998  1.00 18.57  ? 256  LYS A C     1 
ATOM   501  O O     . LYS A 1 71  ? 2.449   16.443  -2.343  1.00 19.00  ? 256  LYS A O     1 
ATOM   502  C CB    . LYS A 1 71  ? 3.850   14.799  0.097   1.00 18.18  ? 256  LYS A CB    1 
ATOM   503  C CG    . LYS A 1 71  ? 3.684   13.478  0.809   1.00 19.81  ? 256  LYS A CG    1 
ATOM   504  C CD    . LYS A 1 71  ? 3.210   13.762  2.218   1.00 21.30  ? 256  LYS A CD    1 
ATOM   505  C CE    . LYS A 1 71  ? 3.570   12.652  3.149   1.00 21.48  ? 256  LYS A CE    1 
ATOM   506  N NZ    . LYS A 1 71  ? 3.077   12.937  4.514   1.00 21.54  ? 256  LYS A NZ    1 
ATOM   507  N N     . LYS A 1 72  ? 4.644   16.920  -2.094  1.00 19.37  ? 257  LYS A N     1 
ATOM   508  C CA    . LYS A 1 72  ? 4.562   18.242  -2.707  1.00 20.27  ? 257  LYS A CA    1 
ATOM   509  C C     . LYS A 1 72  ? 4.025   18.129  -4.134  1.00 20.26  ? 257  LYS A C     1 
ATOM   510  O O     . LYS A 1 72  ? 3.065   18.816  -4.500  1.00 20.09  ? 257  LYS A O     1 
ATOM   511  C CB    . LYS A 1 72  ? 5.938   18.922  -2.674  1.00 20.58  ? 257  LYS A CB    1 
ATOM   512  C CG    . LYS A 1 72  ? 5.992   20.311  -3.285  1.00 21.82  ? 257  LYS A CG    1 
ATOM   513  C CD    . LYS A 1 72  ? 7.271   21.018  -2.874  1.00 23.94  ? 257  LYS A CD    1 
ATOM   514  C CE    . LYS A 1 72  ? 7.378   22.407  -3.481  1.00 26.21  ? 257  LYS A CE    1 
ATOM   515  N NZ    . LYS A 1 72  ? 7.859   22.374  -4.891  1.00 26.77  ? 257  LYS A NZ    1 
ATOM   516  N N     . ARG A 1 73  ? 4.625   17.228  -4.917  1.00 20.46  ? 258  ARG A N     1 
ATOM   517  C CA    . ARG A 1 73  ? 4.239   17.008  -6.312  1.00 21.12  ? 258  ARG A CA    1 
ATOM   518  C C     . ARG A 1 73  ? 2.821   16.446  -6.451  1.00 21.48  ? 258  ARG A C     1 
ATOM   519  O O     . ARG A 1 73  ? 2.067   16.890  -7.313  1.00 21.80  ? 258  ARG A O     1 
ATOM   520  C CB    . ARG A 1 73  ? 5.256   16.106  -7.018  1.00 21.07  ? 258  ARG A CB    1 
ATOM   521  C CG    . ARG A 1 73  ? 6.650   16.715  -7.153  1.00 20.58  ? 258  ARG A CG    1 
ATOM   522  C CD    . ARG A 1 73  ? 7.537   15.850  -8.025  1.00 20.54  ? 258  ARG A CD    1 
ATOM   523  N NE    . ARG A 1 73  ? 8.925   16.312  -8.057  1.00 20.09  ? 258  ARG A NE    1 
ATOM   524  C CZ    . ARG A 1 73  ? 9.830   15.905  -8.943  1.00 20.30  ? 258  ARG A CZ    1 
ATOM   525  N NH1   . ARG A 1 73  ? 9.500   15.026  -9.888  1.00 19.92  ? 258  ARG A NH1   1 
ATOM   526  N NH2   . ARG A 1 73  ? 11.065  16.382  -8.891  1.00 20.85  ? 258  ARG A NH2   1 
ATOM   527  N N     . GLU A 1 74  ? 2.457   15.485  -5.600  1.00 22.33  ? 259  GLU A N     1 
ATOM   528  C CA    . GLU A 1 74  ? 1.084   14.956  -5.573  1.00 23.57  ? 259  GLU A CA    1 
ATOM   529  C C     . GLU A 1 74  ? 0.060   16.069  -5.444  1.00 23.93  ? 259  GLU A C     1 
ATOM   530  O O     . GLU A 1 74  ? -0.903  16.125  -6.209  1.00 24.17  ? 259  GLU A O     1 
ATOM   531  C CB    . GLU A 1 74  ? 0.880   13.958  -4.431  1.00 24.03  ? 259  GLU A CB    1 
ATOM   532  C CG    . GLU A 1 74  ? 1.385   12.567  -4.749  1.00 25.18  ? 259  GLU A CG    1 
ATOM   533  C CD    . GLU A 1 74  ? 0.607   11.441  -4.072  1.00 26.70  ? 259  GLU A CD    1 
ATOM   534  O OE1   . GLU A 1 74  ? -0.120  11.677  -3.077  1.00 27.03  ? 259  GLU A OE1   1 
ATOM   535  O OE2   . GLU A 1 74  ? 0.736   10.295  -4.553  1.00 27.96  ? 259  GLU A OE2   1 
ATOM   536  N N     . ALA A 1 75  ? 0.285   16.954  -4.474  1.00 24.36  ? 260  ALA A N     1 
ATOM   537  C CA    . ALA A 1 75  ? -0.642  18.042  -4.189  1.00 24.77  ? 260  ALA A CA    1 
ATOM   538  C C     . ALA A 1 75  ? -0.802  18.969  -5.397  1.00 24.91  ? 260  ALA A C     1 
ATOM   539  O O     . ALA A 1 75  ? -1.897  19.475  -5.655  1.00 25.40  ? 260  ALA A O     1 
ATOM   540  C CB    . ALA A 1 75  ? -0.198  18.814  -2.951  1.00 24.69  ? 260  ALA A CB    1 
ATOM   541  N N     . LEU A 1 76  ? 0.286   19.163  -6.143  1.00 24.86  ? 261  LEU A N     1 
ATOM   542  C CA    . LEU A 1 76  ? 0.272   19.979  -7.355  1.00 24.86  ? 261  LEU A CA    1 
ATOM   543  C C     . LEU A 1 76  ? -0.403  19.264  -8.523  1.00 24.93  ? 261  LEU A C     1 
ATOM   544  O O     . LEU A 1 76  ? -1.197  19.866  -9.255  1.00 25.21  ? 261  LEU A O     1 
ATOM   545  C CB    . LEU A 1 76  ? 1.694   20.397  -7.748  1.00 25.11  ? 261  LEU A CB    1 
ATOM   546  C CG    . LEU A 1 76  ? 2.427   21.380  -6.828  1.00 25.43  ? 261  LEU A CG    1 
ATOM   547  C CD1   . LEU A 1 76  ? 3.892   21.451  -7.218  1.00 25.18  ? 261  LEU A CD1   1 
ATOM   548  C CD2   . LEU A 1 76  ? 1.787   22.770  -6.850  1.00 25.79  ? 261  LEU A CD2   1 
ATOM   549  N N     . TYR A 1 77  ? -0.090  17.982  -8.695  1.00 24.59  ? 262  TYR A N     1 
ATOM   550  C CA    . TYR A 1 77  ? -0.698  17.188  -9.758  1.00 24.60  ? 262  TYR A CA    1 
ATOM   551  C C     . TYR A 1 77  ? -2.218  17.090  -9.592  1.00 25.27  ? 262  TYR A C     1 
ATOM   552  O O     . TYR A 1 77  ? -2.962  17.168  -10.574 1.00 25.44  ? 262  TYR A O     1 
ATOM   553  C CB    . TYR A 1 77  ? -0.082  15.784  -9.816  1.00 23.78  ? 262  TYR A CB    1 
ATOM   554  C CG    . TYR A 1 77  ? 1.391   15.725  -10.194 1.00 22.91  ? 262  TYR A CG    1 
ATOM   555  C CD1   . TYR A 1 77  ? 1.985   16.718  -10.980 1.00 22.35  ? 262  TYR A CD1   1 
ATOM   556  C CD2   . TYR A 1 77  ? 2.184   14.657  -9.783  1.00 21.16  ? 262  TYR A CD2   1 
ATOM   557  C CE1   . TYR A 1 77  ? 3.329   16.652  -11.332 1.00 22.21  ? 262  TYR A CE1   1 
ATOM   558  C CE2   . TYR A 1 77  ? 3.533   14.580  -10.130 1.00 21.37  ? 262  TYR A CE2   1 
ATOM   559  C CZ    . TYR A 1 77  ? 4.099   15.577  -10.902 1.00 22.32  ? 262  TYR A CZ    1 
ATOM   560  O OH    . TYR A 1 77  ? 5.429   15.504  -11.251 1.00 22.14  ? 262  TYR A OH    1 
ATOM   561  N N     . ALA A 1 78  ? -2.662  16.940  -8.344  1.00 26.19  ? 263  ALA A N     1 
ATOM   562  C CA    . ALA A 1 78  ? -4.085  16.826  -8.000  1.00 27.16  ? 263  ALA A CA    1 
ATOM   563  C C     . ALA A 1 78  ? -4.924  18.031  -8.442  1.00 28.00  ? 263  ALA A C     1 
ATOM   564  O O     . ALA A 1 78  ? -6.137  17.904  -8.645  1.00 28.21  ? 263  ALA A O     1 
ATOM   565  C CB    . ALA A 1 78  ? -4.248  16.585  -6.507  1.00 27.20  ? 263  ALA A CB    1 
ATOM   566  N N     . GLN A 1 79  ? -4.269  19.184  -8.592  1.00 28.71  ? 264  GLN A N     1 
ATOM   567  C CA    . GLN A 1 79  ? -4.921  20.432  -9.001  1.00 29.60  ? 264  GLN A CA    1 
ATOM   568  C C     . GLN A 1 79  ? -5.105  20.533  -10.515 1.00 30.09  ? 264  GLN A C     1 
ATOM   569  O O     . GLN A 1 79  ? -5.830  21.404  -11.005 1.00 30.21  ? 264  GLN A O     1 
ATOM   570  C CB    . GLN A 1 79  ? -4.130  21.642  -8.490  1.00 29.55  ? 264  GLN A CB    1 
ATOM   571  C CG    . GLN A 1 79  ? -3.987  21.696  -6.976  1.00 30.10  ? 264  GLN A CG    1 
ATOM   572  C CD    . GLN A 1 79  ? -3.127  22.855  -6.508  1.00 30.11  ? 264  GLN A CD    1 
ATOM   573  O OE1   . GLN A 1 79  ? -3.610  23.977  -6.344  1.00 31.76  ? 264  GLN A OE1   1 
ATOM   574  N NE2   . GLN A 1 79  ? -1.848  22.587  -6.276  1.00 30.09  ? 264  GLN A NE2   1 
ATOM   575  N N     . ASP A 1 80  ? -4.451  19.638  -11.252 1.00 30.66  ? 265  ASP A N     1 
ATOM   576  C CA    . ASP A 1 80  ? -4.543  19.615  -12.710 1.00 31.29  ? 265  ASP A CA    1 
ATOM   577  C C     . ASP A 1 80  ? -5.041  18.250  -13.202 1.00 31.46  ? 265  ASP A C     1 
ATOM   578  O O     . ASP A 1 80  ? -4.283  17.276  -13.199 1.00 31.44  ? 265  ASP A O     1 
ATOM   579  C CB    . ASP A 1 80  ? -3.190  19.972  -13.337 1.00 31.55  ? 265  ASP A CB    1 
ATOM   580  C CG    . ASP A 1 80  ? -3.236  20.032  -14.863 1.00 32.37  ? 265  ASP A CG    1 
ATOM   581  O OD1   . ASP A 1 80  ? -4.318  19.831  -15.459 1.00 33.90  ? 265  ASP A OD1   1 
ATOM   582  O OD2   . ASP A 1 80  ? -2.178  20.288  -15.471 1.00 33.53  ? 265  ASP A OD2   1 
ATOM   583  N N     . PRO A 1 81  ? -6.318  18.183  -13.637 1.00 31.67  ? 266  PRO A N     1 
ATOM   584  C CA    . PRO A 1 81  ? -6.969  16.929  -14.049 1.00 31.62  ? 266  PRO A CA    1 
ATOM   585  C C     . PRO A 1 81  ? -6.383  16.331  -15.328 1.00 31.19  ? 266  PRO A C     1 
ATOM   586  O O     . PRO A 1 81  ? -6.593  15.146  -15.607 1.00 31.31  ? 266  PRO A O     1 
ATOM   587  C CB    . PRO A 1 81  ? -8.423  17.351  -14.287 1.00 31.74  ? 266  PRO A CB    1 
ATOM   588  C CG    . PRO A 1 81  ? -8.341  18.807  -14.624 1.00 31.86  ? 266  PRO A CG    1 
ATOM   589  C CD    . PRO A 1 81  ? -7.226  19.339  -13.772 1.00 31.81  ? 266  PRO A CD    1 
ATOM   590  N N     . SER A 1 82  ? -5.666  17.150  -16.095 1.00 30.79  ? 267  SER A N     1 
ATOM   591  C CA    . SER A 1 82  ? -5.033  16.707  -17.337 1.00 30.13  ? 267  SER A CA    1 
ATOM   592  C C     . SER A 1 82  ? -3.766  15.895  -17.075 1.00 29.12  ? 267  SER A C     1 
ATOM   593  O O     . SER A 1 82  ? -3.287  15.176  -17.957 1.00 29.60  ? 267  SER A O     1 
ATOM   594  C CB    . SER A 1 82  ? -4.708  17.907  -18.231 1.00 30.40  ? 267  SER A CB    1 
ATOM   595  O OG    . SER A 1 82  ? -3.612  18.647  -17.717 1.00 31.49  ? 267  SER A OG    1 
ATOM   596  N N     . THR A 1 83  ? -3.223  16.027  -15.867 1.00 27.67  ? 268  THR A N     1 
ATOM   597  C CA    . THR A 1 83  ? -2.019  15.313  -15.464 1.00 26.03  ? 268  THR A CA    1 
ATOM   598  C C     . THR A 1 83  ? -2.379  13.873  -15.119 1.00 24.47  ? 268  THR A C     1 
ATOM   599  O O     . THR A 1 83  ? -3.319  13.614  -14.355 1.00 24.68  ? 268  THR A O     1 
ATOM   600  C CB    . THR A 1 83  ? -1.336  15.988  -14.255 1.00 26.25  ? 268  THR A CB    1 
ATOM   601  O OG1   . THR A 1 83  ? -1.106  17.375  -14.544 1.00 27.06  ? 268  THR A OG1   1 
ATOM   602  C CG2   . THR A 1 83  ? -0.010  15.317  -13.933 1.00 26.06  ? 268  THR A CG2   1 
ATOM   603  N N     . GLY A 1 84  ? -1.631  12.943  -15.695 1.00 22.47  ? 269  GLY A N     1 
ATOM   604  C CA    . GLY A 1 84  ? -1.865  11.520  -15.462 1.00 19.62  ? 269  GLY A CA    1 
ATOM   605  C C     . GLY A 1 84  ? -1.219  11.010  -14.189 1.00 18.04  ? 269  GLY A C     1 
ATOM   606  O O     . GLY A 1 84  ? -0.646  11.789  -13.410 1.00 17.75  ? 269  GLY A O     1 
ATOM   607  N N     . CYS A 1 85  ? -1.311  9.696   -13.987 1.00 15.84  ? 270  CYS A N     1 
ATOM   608  C CA    . CYS A 1 85  ? -0.799  9.054   -12.777 1.00 14.73  ? 270  CYS A CA    1 
ATOM   609  C C     . CYS A 1 85  ? 0.394   8.150   -13.077 1.00 14.47  ? 270  CYS A C     1 
ATOM   610  O O     . CYS A 1 85  ? 0.235   7.039   -13.595 1.00 13.96  ? 270  CYS A O     1 
ATOM   611  C CB    . CYS A 1 85  ? -1.913  8.273   -12.090 1.00 14.50  ? 270  CYS A CB    1 
ATOM   612  S SG    . CYS A 1 85  ? -3.313  9.297   -11.575 1.00 14.94  ? 270  CYS A SG    1 
ATOM   613  N N     . TYR A 1 86  ? 1.586   8.650   -12.749 1.00 13.93  ? 271  TYR A N     1 
ATOM   614  C CA    . TYR A 1 86  ? 2.855   8.008   -13.114 1.00 13.85  ? 271  TYR A CA    1 
ATOM   615  C C     . TYR A 1 86  ? 3.801   7.870   -11.924 1.00 13.57  ? 271  TYR A C     1 
ATOM   616  O O     . TYR A 1 86  ? 4.987   7.566   -12.096 1.00 13.58  ? 271  TYR A O     1 
ATOM   617  C CB    . TYR A 1 86  ? 3.554   8.804   -14.220 1.00 14.04  ? 271  TYR A CB    1 
ATOM   618  C CG    . TYR A 1 86  ? 2.752   8.939   -15.488 1.00 13.31  ? 271  TYR A CG    1 
ATOM   619  C CD1   . TYR A 1 86  ? 2.810   7.957   -16.473 1.00 12.76  ? 271  TYR A CD1   1 
ATOM   620  C CD2   . TYR A 1 86  ? 1.936   10.053  -15.710 1.00 13.86  ? 271  TYR A CD2   1 
ATOM   621  C CE1   . TYR A 1 86  ? 2.056   8.070   -17.653 1.00 13.56  ? 271  TYR A CE1   1 
ATOM   622  C CE2   . TYR A 1 86  ? 1.199   10.186  -16.900 1.00 13.11  ? 271  TYR A CE2   1 
ATOM   623  C CZ    . TYR A 1 86  ? 1.247   9.187   -17.854 1.00 13.92  ? 271  TYR A CZ    1 
ATOM   624  O OH    . TYR A 1 86  ? 0.495   9.320   -18.999 1.00 14.56  ? 271  TYR A OH    1 
ATOM   625  N N     . MET A 1 87  ? 3.278   8.079   -10.721 1.00 13.94  ? 272  MET A N     1 
ATOM   626  C CA    . MET A 1 87  ? 4.111   8.086   -9.522  1.00 13.97  ? 272  MET A CA    1 
ATOM   627  C C     . MET A 1 87  ? 4.154   6.691   -8.932  1.00 13.04  ? 272  MET A C     1 
ATOM   628  O O     . MET A 1 87  ? 3.106   6.127   -8.587  1.00 14.17  ? 272  MET A O     1 
ATOM   629  C CB    . MET A 1 87  ? 3.572   9.082   -8.494  1.00 13.30  ? 272  MET A CB    1 
ATOM   630  C CG    . MET A 1 87  ? 3.529   10.492  -9.020  1.00 14.36  ? 272  MET A CG    1 
ATOM   631  S SD    . MET A 1 87  ? 3.105   11.719  -7.764  1.00 16.44  ? 272  MET A SD    1 
ATOM   632  C CE    . MET A 1 87  ? 4.694   11.985  -6.953  1.00 14.44  ? 272  MET A CE    1 
ATOM   633  N N     . TYR A 1 88  ? 5.362   6.134   -8.827  1.00 11.75  ? 273  TYR A N     1 
ATOM   634  C CA    . TYR A 1 88  ? 5.526   4.752   -8.367  1.00 11.30  ? 273  TYR A CA    1 
ATOM   635  C C     . TYR A 1 88  ? 6.266   4.726   -7.027  1.00 11.41  ? 273  TYR A C     1 
ATOM   636  O O     . TYR A 1 88  ? 7.478   4.956   -6.976  1.00 11.56  ? 273  TYR A O     1 
ATOM   637  C CB    . TYR A 1 88  ? 6.307   3.944   -9.413  1.00 10.83  ? 273  TYR A CB    1 
ATOM   638  C CG    . TYR A 1 88  ? 6.003   2.452   -9.463  1.00 10.59  ? 273  TYR A CG    1 
ATOM   639  C CD1   . TYR A 1 88  ? 5.751   1.706   -8.310  1.00 10.31  ? 273  TYR A CD1   1 
ATOM   640  C CD2   . TYR A 1 88  ? 6.002   1.785   -10.678 1.00 10.30  ? 273  TYR A CD2   1 
ATOM   641  C CE1   . TYR A 1 88  ? 5.474   0.333   -8.384  1.00 10.22  ? 273  TYR A CE1   1 
ATOM   642  C CE2   . TYR A 1 88  ? 5.761   0.432   -10.775 1.00 10.37  ? 273  TYR A CE2   1 
ATOM   643  C CZ    . TYR A 1 88  ? 5.481   -0.298  -9.630  1.00 9.72   ? 273  TYR A CZ    1 
ATOM   644  O OH    . TYR A 1 88  ? 5.215   -1.654  -9.727  1.00 11.34  ? 273  TYR A OH    1 
ATOM   645  N N     . TYR A 1 89  ? 5.530   4.408   -5.964  1.00 10.94  ? 274  TYR A N     1 
ATOM   646  C CA    . TYR A 1 89  ? 6.038   4.447   -4.571  1.00 11.47  ? 274  TYR A CA    1 
ATOM   647  C C     . TYR A 1 89  ? 6.601   3.107   -4.133  1.00 11.92  ? 274  TYR A C     1 
ATOM   648  O O     . TYR A 1 89  ? 6.087   2.051   -4.521  1.00 12.11  ? 274  TYR A O     1 
ATOM   649  C CB    . TYR A 1 89  ? 4.913   4.821   -3.595  1.00 11.83  ? 274  TYR A CB    1 
ATOM   650  C CG    . TYR A 1 89  ? 4.482   6.250   -3.720  1.00 12.66  ? 274  TYR A CG    1 
ATOM   651  C CD1   . TYR A 1 89  ? 5.054   7.242   -2.910  1.00 12.80  ? 274  TYR A CD1   1 
ATOM   652  C CD2   . TYR A 1 89  ? 3.534   6.630   -4.671  1.00 13.40  ? 274  TYR A CD2   1 
ATOM   653  C CE1   . TYR A 1 89  ? 4.679   8.562   -3.032  1.00 14.11  ? 274  TYR A CE1   1 
ATOM   654  C CE2   . TYR A 1 89  ? 3.155   7.962   -4.803  1.00 13.62  ? 274  TYR A CE2   1 
ATOM   655  C CZ    . TYR A 1 89  ? 3.731   8.916   -3.973  1.00 14.35  ? 274  TYR A CZ    1 
ATOM   656  O OH    . TYR A 1 89  ? 3.354   10.224  -4.099  1.00 17.02  ? 274  TYR A OH    1 
ATOM   657  N N     . PHE A 1 90  ? 7.633   3.142   -3.292  1.00 12.02  ? 275  PHE A N     1 
ATOM   658  C CA    . PHE A 1 90  ? 8.212   1.911   -2.770  1.00 12.16  ? 275  PHE A CA    1 
ATOM   659  C C     . PHE A 1 90  ? 8.990   2.224   -1.501  1.00 13.04  ? 275  PHE A C     1 
ATOM   660  O O     . PHE A 1 90  ? 9.275   3.382   -1.230  1.00 12.90  ? 275  PHE A O     1 
ATOM   661  C CB    . PHE A 1 90  ? 9.119   1.237   -3.817  1.00 12.70  ? 275  PHE A CB    1 
ATOM   662  C CG    . PHE A 1 90  ? 10.344  2.039   -4.195  1.00 11.57  ? 275  PHE A CG    1 
ATOM   663  C CD1   . PHE A 1 90  ? 11.587  1.746   -3.637  1.00 12.26  ? 275  PHE A CD1   1 
ATOM   664  C CD2   . PHE A 1 90  ? 10.263  3.060   -5.151  1.00 11.69  ? 275  PHE A CD2   1 
ATOM   665  C CE1   . PHE A 1 90  ? 12.726  2.478   -3.995  1.00 12.63  ? 275  PHE A CE1   1 
ATOM   666  C CE2   . PHE A 1 90  ? 11.404  3.789   -5.524  1.00 12.18  ? 275  PHE A CE2   1 
ATOM   667  C CZ    . PHE A 1 90  ? 12.635  3.489   -4.945  1.00 12.27  ? 275  PHE A CZ    1 
ATOM   668  N N     . GLN A 1 91  ? 9.301   1.176   -0.739  1.00 13.70  ? 276  GLN A N     1 
ATOM   669  C CA    . GLN A 1 91  ? 10.074  1.286   0.498   1.00 14.88  ? 276  GLN A CA    1 
ATOM   670  C C     . GLN A 1 91  ? 11.509  0.880   0.243   1.00 15.14  ? 276  GLN A C     1 
ATOM   671  O O     . GLN A 1 91  ? 11.767  -0.157  -0.370  1.00 15.54  ? 276  GLN A O     1 
ATOM   672  C CB    . GLN A 1 91  ? 9.513   0.322   1.544   1.00 15.23  ? 276  GLN A CB    1 
ATOM   673  C CG    . GLN A 1 91  ? 8.336   0.798   2.385   1.00 18.62  ? 276  GLN A CG    1 
ATOM   674  C CD    . GLN A 1 91  ? 7.421   1.781   1.712   1.00 20.84  ? 276  GLN A CD    1 
ATOM   675  O OE1   . GLN A 1 91  ? 7.208   2.895   2.206   1.00 25.91  ? 276  GLN A OE1   1 
ATOM   676  N NE2   . GLN A 1 91  ? 6.898   1.396   0.554   1.00 16.97  ? 276  GLN A NE2   1 
ATOM   677  N N     . TYR A 1 92  ? 12.447  1.665   0.766   1.00 15.02  ? 277  TYR A N     1 
ATOM   678  C CA    . TYR A 1 92  ? 13.854  1.348   0.631   1.00 15.72  ? 277  TYR A CA    1 
ATOM   679  C C     . TYR A 1 92  ? 14.571  1.907   1.840   1.00 15.45  ? 277  TYR A C     1 
ATOM   680  O O     . TYR A 1 92  ? 14.420  3.084   2.165   1.00 14.56  ? 277  TYR A O     1 
ATOM   681  C CB    . TYR A 1 92  ? 14.415  1.922   -0.672  1.00 16.36  ? 277  TYR A CB    1 
ATOM   682  C CG    . TYR A 1 92  ? 15.891  1.672   -0.905  1.00 16.41  ? 277  TYR A CG    1 
ATOM   683  C CD1   . TYR A 1 92  ? 16.381  0.379   -1.103  1.00 16.69  ? 277  TYR A CD1   1 
ATOM   684  C CD2   . TYR A 1 92  ? 16.792  2.733   -0.950  1.00 16.40  ? 277  TYR A CD2   1 
ATOM   685  C CE1   . TYR A 1 92  ? 17.740  0.152   -1.326  1.00 17.00  ? 277  TYR A CE1   1 
ATOM   686  C CE2   . TYR A 1 92  ? 18.140  2.517   -1.172  1.00 17.29  ? 277  TYR A CE2   1 
ATOM   687  C CZ    . TYR A 1 92  ? 18.607  1.227   -1.364  1.00 17.45  ? 277  TYR A CZ    1 
ATOM   688  O OH    . TYR A 1 92  ? 19.946  1.006   -1.580  1.00 18.74  ? 277  TYR A OH    1 
ATOM   689  N N     . LEU A 1 93  ? 15.317  1.042   2.522   1.00 15.92  ? 278  LEU A N     1 
ATOM   690  C CA    . LEU A 1 93  ? 16.063  1.420   3.729   1.00 16.20  ? 278  LEU A CA    1 
ATOM   691  C C     . LEU A 1 93  ? 15.230  2.233   4.731   1.00 15.49  ? 278  LEU A C     1 
ATOM   692  O O     . LEU A 1 93  ? 15.664  3.282   5.216   1.00 15.69  ? 278  LEU A O     1 
ATOM   693  C CB    . LEU A 1 93  ? 17.351  2.161   3.349   1.00 17.01  ? 278  LEU A CB    1 
ATOM   694  C CG    . LEU A 1 93  ? 18.302  1.506   2.334   1.00 19.10  ? 278  LEU A CG    1 
ATOM   695  C CD1   . LEU A 1 93  ? 19.522  2.393   2.114   1.00 20.41  ? 278  LEU A CD1   1 
ATOM   696  C CD2   . LEU A 1 93  ? 18.730  0.103   2.769   1.00 21.31  ? 278  LEU A CD2   1 
ATOM   697  N N     . SER A 1 94  ? 14.027  1.737   5.024   1.00 15.01  ? 279  SER A N     1 
ATOM   698  C CA    . SER A 1 94  ? 13.103  2.327   6.021   1.00 14.74  ? 279  SER A CA    1 
ATOM   699  C C     . SER A 1 94  ? 12.537  3.695   5.663   1.00 13.56  ? 279  SER A C     1 
ATOM   700  O O     . SER A 1 94  ? 12.067  4.427   6.537   1.00 13.76  ? 279  SER A O     1 
ATOM   701  C CB    . SER A 1 94  ? 13.729  2.374   7.423   1.00 15.07  ? 279  SER A CB    1 
ATOM   702  O OG    . SER A 1 94  ? 14.228  1.107   7.798   1.00 18.15  ? 279  SER A OG    1 
ATOM   703  N N     . LYS A 1 95  ? 12.578  4.037   4.374   1.00 12.40  ? 280  LYS A N     1 
ATOM   704  C CA    . LYS A 1 95  ? 12.070  5.312   3.896   1.00 12.43  ? 280  LYS A CA    1 
ATOM   705  C C     . LYS A 1 95  ? 11.202  5.085   2.667   1.00 11.36  ? 280  LYS A C     1 
ATOM   706  O O     . LYS A 1 95  ? 11.373  4.099   1.952   1.00 10.82  ? 280  LYS A O     1 
ATOM   707  C CB    . LYS A 1 95  ? 13.223  6.238   3.515   1.00 12.56  ? 280  LYS A CB    1 
ATOM   708  C CG    . LYS A 1 95  ? 13.892  6.920   4.696   1.00 14.05  ? 280  LYS A CG    1 
ATOM   709  C CD    . LYS A 1 95  ? 14.985  7.892   4.233   1.00 15.17  ? 280  LYS A CD    1 
ATOM   710  C CE    . LYS A 1 95  ? 14.407  9.155   3.577   1.00 18.79  ? 280  LYS A CE    1 
ATOM   711  N NZ    . LYS A 1 95  ? 13.613  9.979   4.547   1.00 20.88  ? 280  LYS A NZ    1 
ATOM   712  N N     . THR A 1 96  ? 10.289  6.025   2.432   1.00 10.66  ? 281  THR A N     1 
ATOM   713  C CA    . THR A 1 96  ? 9.462   6.009   1.242   1.00 10.61  ? 281  THR A CA    1 
ATOM   714  C C     . THR A 1 96  ? 10.153  6.739   0.103   1.00 10.99  ? 281  THR A C     1 
ATOM   715  O O     . THR A 1 96  ? 10.585  7.887   0.252   1.00 11.66  ? 281  THR A O     1 
ATOM   716  C CB    . THR A 1 96  ? 8.107   6.651   1.501   1.00 10.59  ? 281  THR A CB    1 
ATOM   717  O OG1   . THR A 1 96  ? 7.462   5.922   2.546   1.00 10.04  ? 281  THR A OG1   1 
ATOM   718  C CG2   . THR A 1 96  ? 7.230   6.567   0.247   1.00 10.66  ? 281  THR A CG2   1 
ATOM   719  N N     . TYR A 1 97  ? 10.272  6.046   -1.023  1.00 10.96  ? 282  TYR A N     1 
ATOM   720  C CA    . TYR A 1 97  ? 10.763  6.662   -2.246  1.00 11.56  ? 282  TYR A CA    1 
ATOM   721  C C     . TYR A 1 97  ? 9.708   6.616   -3.327  1.00 11.58  ? 282  TYR A C     1 
ATOM   722  O O     . TYR A 1 97  ? 8.706   5.903   -3.218  1.00 10.70  ? 282  TYR A O     1 
ATOM   723  C CB    . TYR A 1 97  ? 12.048  5.984   -2.718  1.00 13.22  ? 282  TYR A CB    1 
ATOM   724  C CG    . TYR A 1 97  ? 13.203  6.269   -1.795  1.00 14.54  ? 282  TYR A CG    1 
ATOM   725  C CD1   . TYR A 1 97  ? 13.980  7.417   -1.947  1.00 16.61  ? 282  TYR A CD1   1 
ATOM   726  C CD2   . TYR A 1 97  ? 13.491  5.410   -0.745  1.00 14.93  ? 282  TYR A CD2   1 
ATOM   727  C CE1   . TYR A 1 97  ? 15.030  7.685   -1.087  1.00 17.14  ? 282  TYR A CE1   1 
ATOM   728  C CE2   . TYR A 1 97  ? 14.537  5.661   0.113   1.00 15.62  ? 282  TYR A CE2   1 
ATOM   729  C CZ    . TYR A 1 97  ? 15.301  6.805   -0.054  1.00 15.96  ? 282  TYR A CZ    1 
ATOM   730  O OH    . TYR A 1 97  ? 16.347  7.073   0.791   1.00 19.30  ? 282  TYR A OH    1 
ATOM   731  N N     . CYS A 1 98  ? 9.939   7.376   -4.382  1.00 11.74  ? 283  CYS A N     1 
ATOM   732  C CA    . CYS A 1 98  ? 8.997   7.392   -5.480  1.00 12.23  ? 283  CYS A CA    1 
ATOM   733  C C     . CYS A 1 98  ? 9.750   7.605   -6.777  1.00 12.03  ? 283  CYS A C     1 
ATOM   734  O O     . CYS A 1 98  ? 10.589  8.507   -6.877  1.00 12.99  ? 283  CYS A O     1 
ATOM   735  C CB    . CYS A 1 98  ? 7.983   8.523   -5.266  1.00 12.77  ? 283  CYS A CB    1 
ATOM   736  S SG    . CYS A 1 98  ? 6.749   8.697   -6.575  1.00 13.29  ? 283  CYS A SG    1 
ATOM   737  N N     . VAL A 1 99  ? 9.454   6.779   -7.776  1.00 11.82  ? 284  VAL A N     1 
ATOM   738  C CA    . VAL A 1 99  ? 9.885   7.107   -9.127  1.00 12.17  ? 284  VAL A CA    1 
ATOM   739  C C     . VAL A 1 99  ? 8.748   7.885   -9.769  1.00 12.35  ? 284  VAL A C     1 
ATOM   740  O O     . VAL A 1 99  ? 7.694   7.335   -10.085 1.00 13.19  ? 284  VAL A O     1 
ATOM   741  C CB    . VAL A 1 99  ? 10.258  5.887   -9.979  1.00 11.74  ? 284  VAL A CB    1 
ATOM   742  C CG1   . VAL A 1 99  ? 10.741  6.349   -11.358 1.00 12.18  ? 284  VAL A CG1   1 
ATOM   743  C CG2   . VAL A 1 99  ? 11.329  5.060   -9.320  1.00 12.84  ? 284  VAL A CG2   1 
ATOM   744  N N     . ASP A 1 100 ? 8.958   9.185   -9.926  1.00 13.05  ? 285  ASP A N     1 
ATOM   745  C CA    . ASP A 1 100 ? 7.932   10.024  -10.507 1.00 13.62  ? 285  ASP A CA    1 
ATOM   746  C C     . ASP A 1 100 ? 8.181   10.125  -12.010 1.00 13.39  ? 285  ASP A C     1 
ATOM   747  O O     . ASP A 1 100 ? 9.070   10.848  -12.460 1.00 13.29  ? 285  ASP A O     1 
ATOM   748  C CB    . ASP A 1 100 ? 7.932   11.405  -9.845  1.00 14.35  ? 285  ASP A CB    1 
ATOM   749  C CG    . ASP A 1 100 ? 6.911   12.337  -10.446 1.00 16.02  ? 285  ASP A CG    1 
ATOM   750  O OD1   . ASP A 1 100 ? 6.977   13.546  -10.155 1.00 17.26  ? 285  ASP A OD1   1 
ATOM   751  O OD2   . ASP A 1 100 ? 6.056   11.873  -11.242 1.00 18.16  ? 285  ASP A OD2   1 
ATOM   752  N N     . ALA A 1 101 ? 7.394   9.382   -12.785 1.00 13.04  ? 286  ALA A N     1 
ATOM   753  C CA    . ALA A 1 101 ? 7.546   9.414   -14.233 1.00 13.46  ? 286  ALA A CA    1 
ATOM   754  C C     . ALA A 1 101 ? 6.479   10.262  -14.938 1.00 13.97  ? 286  ALA A C     1 
ATOM   755  O O     . ALA A 1 101 ? 6.082   9.964   -16.067 1.00 14.16  ? 286  ALA A O     1 
ATOM   756  C CB    . ALA A 1 101 ? 7.560   7.994   -14.787 1.00 12.78  ? 286  ALA A CB    1 
ATOM   757  N N     . THR A 1 102 ? 6.028   11.325  -14.281 1.00 15.23  ? 287  THR A N     1 
ATOM   758  C CA    . THR A 1 102 ? 4.981   12.183  -14.839 1.00 16.38  ? 287  THR A CA    1 
ATOM   759  C C     . THR A 1 102 ? 5.424   12.908  -16.113 1.00 17.22  ? 287  THR A C     1 
ATOM   760  O O     . THR A 1 102 ? 4.661   12.981  -17.081 1.00 17.60  ? 287  THR A O     1 
ATOM   761  C CB    . THR A 1 102 ? 4.465   13.181  -13.781 1.00 16.55  ? 287  THR A CB    1 
ATOM   762  O OG1   . THR A 1 102 ? 3.981   12.447  -12.658 1.00 16.49  ? 287  THR A OG1   1 
ATOM   763  C CG2   . THR A 1 102 ? 3.328   14.039  -14.336 1.00 16.43  ? 287  THR A CG2   1 
ATOM   764  N N     . ARG A 1 103 ? 6.647   13.438  -16.114 1.00 18.28  ? 288  ARG A N     1 
ATOM   765  C CA    . ARG A 1 103 ? 7.176   14.122  -17.296 1.00 19.28  ? 288  ARG A CA    1 
ATOM   766  C C     . ARG A 1 103 ? 7.226   13.184  -18.502 1.00 18.41  ? 288  ARG A C     1 
ATOM   767  O O     . ARG A 1 103 ? 7.659   12.034  -18.387 1.00 17.77  ? 288  ARG A O     1 
ATOM   768  C CB    . ARG A 1 103 ? 8.566   14.707  -17.022 1.00 19.63  ? 288  ARG A CB    1 
ATOM   769  C CG    . ARG A 1 103 ? 9.113   15.585  -18.154 1.00 20.89  ? 288  ARG A CG    1 
ATOM   770  C CD    . ARG A 1 103 ? 10.410  16.281  -17.759 1.00 21.49  ? 288  ARG A CD    1 
ATOM   771  N NE    . ARG A 1 103 ? 11.521  15.340  -17.599 1.00 24.76  ? 288  ARG A NE    1 
ATOM   772  C CZ    . ARG A 1 103 ? 12.313  14.932  -18.588 1.00 26.47  ? 288  ARG A CZ    1 
ATOM   773  N NH1   . ARG A 1 103 ? 12.125  15.373  -19.828 1.00 27.12  ? 288  ARG A NH1   1 
ATOM   774  N NH2   . ARG A 1 103 ? 13.296  14.074  -18.338 1.00 27.93  ? 288  ARG A NH2   1 
ATOM   775  N N     . GLU A 1 104 ? 6.766   13.678  -19.649 1.00 17.76  ? 289  GLU A N     1 
ATOM   776  C CA    . GLU A 1 104 ? 6.795   12.902  -20.877 1.00 17.10  ? 289  GLU A CA    1 
ATOM   777  C C     . GLU A 1 104 ? 8.229   12.755  -21.377 1.00 16.75  ? 289  GLU A C     1 
ATOM   778  O O     . GLU A 1 104 ? 8.928   13.748  -21.598 1.00 17.89  ? 289  GLU A O     1 
ATOM   779  C CB    . GLU A 1 104 ? 5.869   13.509  -21.950 1.00 16.99  ? 289  GLU A CB    1 
ATOM   780  C CG    . GLU A 1 104 ? 4.361   13.301  -21.675 1.00 17.63  ? 289  GLU A CG    1 
ATOM   781  C CD    . GLU A 1 104 ? 3.865   11.841  -21.867 1.00 17.13  ? 289  GLU A CD    1 
ATOM   782  O OE1   . GLU A 1 104 ? 4.357   11.128  -22.788 1.00 14.62  ? 289  GLU A OE1   1 
ATOM   783  O OE2   . GLU A 1 104 ? 2.962   11.414  -21.095 1.00 17.20  ? 289  GLU A OE2   1 
ATOM   784  N N     . THR A 1 105 ? 8.664   11.504  -21.500 1.00 16.03  ? 290  THR A N     1 
ATOM   785  C CA    . THR A 1 105 ? 9.992   11.133  -22.003 1.00 14.75  ? 290  THR A CA    1 
ATOM   786  C C     . THR A 1 105 ? 9.809   10.009  -23.023 1.00 14.59  ? 290  THR A C     1 
ATOM   787  O O     . THR A 1 105 ? 8.680   9.602   -23.297 1.00 14.33  ? 290  THR A O     1 
ATOM   788  C CB    . THR A 1 105 ? 10.893  10.594  -20.876 1.00 14.98  ? 290  THR A CB    1 
ATOM   789  O OG1   . THR A 1 105 ? 10.354  9.337   -20.446 1.00 14.98  ? 290  THR A OG1   1 
ATOM   790  C CG2   . THR A 1 105 ? 10.953  11.568  -19.692 1.00 14.68  ? 290  THR A CG2   1 
ATOM   791  N N     . ASN A 1 106 ? 10.905  9.510   -23.592 1.00 13.93  ? 291  ASN A N     1 
ATOM   792  C CA    . ASN A 1 106 ? 10.835  8.368   -24.515 1.00 14.10  ? 291  ASN A CA    1 
ATOM   793  C C     . ASN A 1 106 ? 10.936  7.007   -23.831 1.00 13.28  ? 291  ASN A C     1 
ATOM   794  O O     . ASN A 1 106 ? 10.929  5.970   -24.497 1.00 13.51  ? 291  ASN A O     1 
ATOM   795  C CB    . ASN A 1 106 ? 11.900  8.477   -25.611 1.00 14.80  ? 291  ASN A CB    1 
ATOM   796  C CG    . ASN A 1 106 ? 11.662  9.650   -26.548 1.00 17.14  ? 291  ASN A CG    1 
ATOM   797  O OD1   . ASN A 1 106 ? 12.598  10.158  -27.167 1.00 19.42  ? 291  ASN A OD1   1 
ATOM   798  N ND2   . ASN A 1 106 ? 10.409  10.091  -26.650 1.00 19.57  ? 291  ASN A ND2   1 
ATOM   799  N N     . ARG A 1 107 ? 11.021  7.010   -22.503 1.00 12.49  ? 292  ARG A N     1 
ATOM   800  C CA    . ARG A 1 107 ? 11.153  5.770   -21.750 1.00 12.14  ? 292  ARG A CA    1 
ATOM   801  C C     . ARG A 1 107 ? 9.809   5.060   -21.646 1.00 11.59  ? 292  ARG A C     1 
ATOM   802  O O     . ARG A 1 107 ? 8.763   5.704   -21.462 1.00 11.69  ? 292  ARG A O     1 
ATOM   803  C CB    . ARG A 1 107 ? 11.727  6.051   -20.360 1.00 12.55  ? 292  ARG A CB    1 
ATOM   804  C CG    . ARG A 1 107 ? 13.084  6.751   -20.363 1.00 13.00  ? 292  ARG A CG    1 
ATOM   805  C CD    . ARG A 1 107 ? 14.159  5.936   -21.082 1.00 15.14  ? 292  ARG A CD    1 
ATOM   806  N NE    . ARG A 1 107 ? 14.504  4.703   -20.378 1.00 15.88  ? 292  ARG A NE    1 
ATOM   807  C CZ    . ARG A 1 107 ? 15.575  4.555   -19.591 1.00 15.07  ? 292  ARG A CZ    1 
ATOM   808  N NH1   . ARG A 1 107 ? 16.416  5.561   -19.401 1.00 15.60  ? 292  ARG A NH1   1 
ATOM   809  N NH2   . ARG A 1 107 ? 15.810  3.397   -19.005 1.00 14.89  ? 292  ARG A NH2   1 
ATOM   810  N N     . LEU A 1 108 ? 9.835   3.732   -21.744 1.00 10.71  ? 293  LEU A N     1 
ATOM   811  C CA    . LEU A 1 108 ? 8.600   2.986   -21.941 1.00 10.93  ? 293  LEU A CA    1 
ATOM   812  C C     . LEU A 1 108 ? 7.936   2.413   -20.692 1.00 10.19  ? 293  LEU A C     1 
ATOM   813  O O     . LEU A 1 108 ? 6.733   2.146   -20.722 1.00 9.76   ? 293  LEU A O     1 
ATOM   814  C CB    . LEU A 1 108 ? 8.800   1.868   -22.967 1.00 11.32  ? 293  LEU A CB    1 
ATOM   815  C CG    . LEU A 1 108 ? 9.139   2.332   -24.389 1.00 12.49  ? 293  LEU A CG    1 
ATOM   816  C CD1   . LEU A 1 108 ? 9.298   1.123   -25.307 1.00 13.95  ? 293  LEU A CD1   1 
ATOM   817  C CD2   . LEU A 1 108 ? 8.096   3.312   -24.939 1.00 14.16  ? 293  LEU A CD2   1 
ATOM   818  N N     . GLY A 1 109 ? 8.684   2.235   -19.603 1.00 10.17  ? 294  GLY A N     1 
ATOM   819  C CA    . GLY A 1 109 ? 8.106   1.600   -18.419 1.00 9.65   ? 294  GLY A CA    1 
ATOM   820  C C     . GLY A 1 109 ? 6.888   2.358   -17.918 1.00 9.26   ? 294  GLY A C     1 
ATOM   821  O O     . GLY A 1 109 ? 5.891   1.751   -17.488 1.00 9.84   ? 294  GLY A O     1 
ATOM   822  N N     . ARG A 1 110 ? 6.974   3.691   -17.983 1.00 9.60   ? 295  ARG A N     1 
ATOM   823  C CA    . ARG A 1 110 ? 5.901   4.580   -17.542 1.00 9.68   ? 295  ARG A CA    1 
ATOM   824  C C     . ARG A 1 110 ? 4.586   4.396   -18.306 1.00 9.57   ? 295  ARG A C     1 
ATOM   825  O O     . ARG A 1 110 ? 3.533   4.831   -17.833 1.00 10.12  ? 295  ARG A O     1 
ATOM   826  C CB    . ARG A 1 110 ? 6.373   6.032   -17.629 1.00 9.62   ? 295  ARG A CB    1 
ATOM   827  C CG    . ARG A 1 110 ? 6.721   6.493   -19.050 1.00 9.85   ? 295  ARG A CG    1 
ATOM   828  C CD    . ARG A 1 110 ? 7.363   7.890   -19.055 1.00 10.51  ? 295  ARG A CD    1 
ATOM   829  N NE    . ARG A 1 110 ? 6.412   8.918   -18.624 1.00 11.65  ? 295  ARG A NE    1 
ATOM   830  C CZ    . ARG A 1 110 ? 5.534   9.506   -19.441 1.00 11.94  ? 295  ARG A CZ    1 
ATOM   831  N NH1   . ARG A 1 110 ? 5.495   9.183   -20.730 1.00 12.29  ? 295  ARG A NH1   1 
ATOM   832  N NH2   . ARG A 1 110 ? 4.694   10.420  -18.961 1.00 12.89  ? 295  ARG A NH2   1 
ATOM   833  N N     . LEU A 1 111 ? 4.658   3.763   -19.483 1.00 9.93   ? 296  LEU A N     1 
ATOM   834  C CA    . LEU A 1 111 ? 3.498   3.586   -20.358 1.00 9.52   ? 296  LEU A CA    1 
ATOM   835  C C     . LEU A 1 111 ? 2.836   2.218   -20.258 1.00 9.35   ? 296  LEU A C     1 
ATOM   836  O O     . LEU A 1 111 ? 1.827   1.962   -20.928 1.00 9.00   ? 296  LEU A O     1 
ATOM   837  C CB    . LEU A 1 111 ? 3.871   3.865   -21.818 1.00 9.50   ? 296  LEU A CB    1 
ATOM   838  C CG    . LEU A 1 111 ? 4.347   5.285   -22.139 1.00 10.68  ? 296  LEU A CG    1 
ATOM   839  C CD1   . LEU A 1 111 ? 4.500   5.399   -23.643 1.00 10.61  ? 296  LEU A CD1   1 
ATOM   840  C CD2   . LEU A 1 111 ? 3.358   6.335   -21.632 1.00 11.35  ? 296  LEU A CD2   1 
ATOM   841  N N     . ILE A 1 112 ? 3.397   1.348   -19.422 1.00 9.21   ? 297  ILE A N     1 
ATOM   842  C CA    . ILE A 1 112 ? 2.863   -0.005  -19.282 1.00 9.59   ? 297  ILE A CA    1 
ATOM   843  C C     . ILE A 1 112 ? 1.609   0.024   -18.395 1.00 9.01   ? 297  ILE A C     1 
ATOM   844  O O     . ILE A 1 112 ? 1.580   0.674   -17.328 1.00 9.21   ? 297  ILE A O     1 
ATOM   845  C CB    . ILE A 1 112 ? 3.947   -0.984  -18.768 1.00 9.44   ? 297  ILE A CB    1 
ATOM   846  C CG1   . ILE A 1 112 ? 5.066   -1.125  -19.810 1.00 10.13  ? 297  ILE A CG1   1 
ATOM   847  C CG2   . ILE A 1 112 ? 3.346   -2.345  -18.489 1.00 10.54  ? 297  ILE A CG2   1 
ATOM   848  C CD1   . ILE A 1 112 ? 6.267   -1.938  -19.382 1.00 11.04  ? 297  ILE A CD1   1 
ATOM   849  N N     . ASN A 1 113 ? 0.558   -0.643  -18.872 1.00 8.84   ? 298  ASN A N     1 
ATOM   850  C CA    . ASN A 1 113 ? -0.724  -0.651  -18.196 1.00 8.26   ? 298  ASN A CA    1 
ATOM   851  C C     . ASN A 1 113 ? -0.835  -1.718  -17.110 1.00 8.85   ? 298  ASN A C     1 
ATOM   852  O O     . ASN A 1 113 ? 0.086   -2.522  -16.918 1.00 8.85   ? 298  ASN A O     1 
ATOM   853  C CB    . ASN A 1 113 ? -1.852  -0.718  -19.231 1.00 8.87   ? 298  ASN A CB    1 
ATOM   854  C CG    . ASN A 1 113 ? -1.931  0.549   -20.042 1.00 8.21   ? 298  ASN A CG    1 
ATOM   855  O OD1   . ASN A 1 113 ? -1.859  1.638   -19.479 1.00 8.86   ? 298  ASN A OD1   1 
ATOM   856  N ND2   . ASN A 1 113 ? -2.054  0.422   -21.364 1.00 9.28   ? 298  ASN A ND2   1 
ATOM   857  N N     . HIS A 1 114 ? -1.969  -1.695  -16.414 1.00 8.80   ? 299  HIS A N     1 
ATOM   858  C CA    . HIS A 1 114 ? -2.202  -2.508  -15.210 1.00 9.22   ? 299  HIS A CA    1 
ATOM   859  C C     . HIS A 1 114 ? -3.001  -3.774  -15.494 1.00 9.54   ? 299  HIS A C     1 
ATOM   860  O O     . HIS A 1 114 ? -3.985  -3.751  -16.238 1.00 9.96   ? 299  HIS A O     1 
ATOM   861  C CB    . HIS A 1 114 ? -3.005  -1.676  -14.209 1.00 10.12  ? 299  HIS A CB    1 
ATOM   862  C CG    . HIS A 1 114 ? -3.644  -2.485  -13.123 1.00 9.41   ? 299  HIS A CG    1 
ATOM   863  N ND1   . HIS A 1 114 ? -2.979  -2.853  -11.971 1.00 9.40   ? 299  HIS A ND1   1 
ATOM   864  C CD2   . HIS A 1 114 ? -4.895  -2.998  -13.016 1.00 8.60   ? 299  HIS A CD2   1 
ATOM   865  C CE1   . HIS A 1 114 ? -3.783  -3.586  -11.219 1.00 10.61  ? 299  HIS A CE1   1 
ATOM   866  N NE2   . HIS A 1 114 ? -4.957  -3.673  -11.820 1.00 10.24  ? 299  HIS A NE2   1 
ATOM   867  N N     . SER A 1 115 ? -2.605  -4.859  -14.842 1.00 9.67   ? 300  SER A N     1 
ATOM   868  C CA    . SER A 1 115 ? -3.495  -5.994  -14.612 1.00 10.46  ? 300  SER A CA    1 
ATOM   869  C C     . SER A 1 115 ? -3.036  -6.706  -13.352 1.00 11.00  ? 300  SER A C     1 
ATOM   870  O O     . SER A 1 115 ? -1.851  -6.750  -13.081 1.00 11.39  ? 300  SER A O     1 
ATOM   871  C CB    . SER A 1 115 ? -3.457  -6.979  -15.779 1.00 10.79  ? 300  SER A CB    1 
ATOM   872  O OG    . SER A 1 115 ? -4.251  -8.126  -15.485 1.00 11.75  ? 300  SER A OG    1 
ATOM   873  N N     . LYS A 1 116 ? -3.978  -7.275  -12.606 1.00 12.69  ? 301  LYS A N     1 
ATOM   874  C CA    . LYS A 1 116 ? -3.634  -8.140  -11.489 1.00 13.74  ? 301  LYS A CA    1 
ATOM   875  C C     . LYS A 1 116 ? -3.160  -9.514  -11.966 1.00 14.43  ? 301  LYS A C     1 
ATOM   876  O O     . LYS A 1 116 ? -2.596  -10.290 -11.174 1.00 15.58  ? 301  LYS A O     1 
ATOM   877  C CB    . LYS A 1 116 ? -4.833  -8.349  -10.583 1.00 14.72  ? 301  LYS A CB    1 
ATOM   878  C CG    . LYS A 1 116 ? -5.197  -7.165  -9.742  1.00 16.13  ? 301  LYS A CG    1 
ATOM   879  C CD    . LYS A 1 116 ? -6.458  -7.520  -8.962  1.00 18.92  ? 301  LYS A CD    1 
ATOM   880  C CE    . LYS A 1 116 ? -6.838  -6.408  -8.067  1.00 22.50  ? 301  LYS A CE    1 
ATOM   881  N NZ    . LYS A 1 116 ? -5.983  -6.504  -6.865  1.00 25.21  ? 301  LYS A NZ    1 
ATOM   882  N N     . CYS A 1 117 ? -3.429  -9.834  -13.233 1.00 14.19  ? 302  CYS A N     1 
ATOM   883  C CA    . CYS A 1 117 ? -2.960  -11.090 -13.823 1.00 15.07  ? 302  CYS A CA    1 
ATOM   884  C C     . CYS A 1 117 ? -2.213  -10.792 -15.105 1.00 14.51  ? 302  CYS A C     1 
ATOM   885  O O     . CYS A 1 117 ? -2.585  -11.252 -16.184 1.00 14.84  ? 302  CYS A O     1 
ATOM   886  C CB    . CYS A 1 117 ? -4.117  -12.050 -14.106 1.00 16.19  ? 302  CYS A CB    1 
ATOM   887  S SG    A CYS A 1 117 ? -5.368  -12.197 -12.835 0.50 19.77  ? 302  CYS A SG    1 
ATOM   888  S SG    B CYS A 1 117 ? -7.346  -11.509 -14.251 0.50 59.93  ? 302  CYS A SG    1 
ATOM   889  N N     . GLY A 1 118 ? -1.151  -10.017 -14.964 1.00 13.66  ? 303  GLY A N     1 
ATOM   890  C CA    . GLY A 1 118 ? -0.362  -9.607  -16.118 1.00 12.65  ? 303  GLY A CA    1 
ATOM   891  C C     . GLY A 1 118 ? 0.783   -10.545 -16.420 1.00 12.48  ? 303  GLY A C     1 
ATOM   892  O O     . GLY A 1 118 ? 0.710   -11.753 -16.156 1.00 13.27  ? 303  GLY A O     1 
ATOM   893  N N     . ASN A 1 119 ? 1.842   -9.979  -16.996 1.00 10.23  ? 304  ASN A N     1 
ATOM   894  C CA    . ASN A 1 119 ? 2.968   -10.787 -17.439 1.00 9.42   ? 304  ASN A CA    1 
ATOM   895  C C     . ASN A 1 119 ? 4.323   -10.242 -16.989 1.00 9.55   ? 304  ASN A C     1 
ATOM   896  O O     . ASN A 1 119 ? 5.356   -10.807 -17.365 1.00 9.94   ? 304  ASN A O     1 
ATOM   897  C CB    . ASN A 1 119 ? 2.939   -10.966 -18.963 1.00 9.71   ? 304  ASN A CB    1 
ATOM   898  C CG    . ASN A 1 119 ? 2.737   -9.644  -19.706 1.00 8.93   ? 304  ASN A CG    1 
ATOM   899  O OD1   . ASN A 1 119 ? 3.232   -8.600  -19.273 1.00 9.74   ? 304  ASN A OD1   1 
ATOM   900  N ND2   . ASN A 1 119 ? 2.015   -9.686  -20.833 1.00 9.81   ? 304  ASN A ND2   1 
ATOM   901  N N     . CYS A 1 120 ? 4.309   -9.166  -16.186 1.00 9.44   ? 305  CYS A N     1 
ATOM   902  C CA    . CYS A 1 120 ? 5.519   -8.586  -15.619 1.00 10.55  ? 305  CYS A CA    1 
ATOM   903  C C     . CYS A 1 120 ? 5.340   -8.403  -14.126 1.00 10.30  ? 305  CYS A C     1 
ATOM   904  O O     . CYS A 1 120 ? 4.211   -8.198  -13.636 1.00 10.58  ? 305  CYS A O     1 
ATOM   905  C CB    . CYS A 1 120 ? 5.841   -7.219  -16.240 1.00 10.77  ? 305  CYS A CB    1 
ATOM   906  S SG    . CYS A 1 120 ? 6.280   -7.285  -17.989 1.00 11.89  ? 305  CYS A SG    1 
ATOM   907  N N     . GLN A 1 121 ? 6.463   -8.448  -13.417 1.00 11.77  ? 306  GLN A N     1 
ATOM   908  C CA    . GLN A 1 121 ? 6.495   -8.196  -11.980 1.00 12.40  ? 306  GLN A CA    1 
ATOM   909  C C     . GLN A 1 121 ? 7.574   -7.163  -11.688 1.00 11.98  ? 306  GLN A C     1 
ATOM   910  O O     . GLN A 1 121 ? 8.702   -7.287  -12.155 1.00 12.22  ? 306  GLN A O     1 
ATOM   911  C CB    . GLN A 1 121 ? 6.763   -9.499  -11.201 1.00 14.08  ? 306  GLN A CB    1 
ATOM   912  C CG    . GLN A 1 121 ? 7.072   -9.334  -9.701  1.00 18.72  ? 306  GLN A CG    1 
ATOM   913  C CD    . GLN A 1 121 ? 5.922   -8.737  -8.896  1.00 24.39  ? 306  GLN A CD    1 
ATOM   914  O OE1   . GLN A 1 121 ? 4.826   -9.306  -8.846  1.00 27.09  ? 306  GLN A OE1   1 
ATOM   915  N NE2   . GLN A 1 121 ? 6.177   -7.595  -8.236  1.00 25.96  ? 306  GLN A NE2   1 
ATOM   916  N N     . THR A 1 122 ? 7.221   -6.156  -10.898 1.00 11.78  ? 307  THR A N     1 
ATOM   917  C CA    . THR A 1 122 ? 8.186   -5.145  -10.513 1.00 11.60  ? 307  THR A CA    1 
ATOM   918  C C     . THR A 1 122 ? 9.013   -5.613  -9.308  1.00 12.04  ? 307  THR A C     1 
ATOM   919  O O     . THR A 1 122 ? 8.476   -6.203  -8.365  1.00 12.72  ? 307  THR A O     1 
ATOM   920  C CB    . THR A 1 122 ? 7.488   -3.806  -10.193 1.00 11.80  ? 307  THR A CB    1 
ATOM   921  O OG1   . THR A 1 122 ? 6.622   -3.439  -11.278 1.00 13.56  ? 307  THR A OG1   1 
ATOM   922  C CG2   . THR A 1 122 ? 8.532   -2.675  -9.960  1.00 12.05  ? 307  THR A CG2   1 
ATOM   923  N N     . LYS A 1 123 ? 10.321  -5.355  -9.382  1.00 11.82  ? 308  LYS A N     1 
ATOM   924  C CA    . LYS A 1 123 ? 11.289  -5.696  -8.335  1.00 12.82  ? 308  LYS A CA    1 
ATOM   925  C C     . LYS A 1 123 ? 12.097  -4.450  -8.023  1.00 12.18  ? 308  LYS A C     1 
ATOM   926  O O     . LYS A 1 123 ? 12.368  -3.629  -8.904  1.00 12.24  ? 308  LYS A O     1 
ATOM   927  C CB    . LYS A 1 123 ? 12.292  -6.778  -8.804  1.00 13.64  ? 308  LYS A CB    1 
ATOM   928  C CG    . LYS A 1 123 ? 11.682  -8.021  -9.455  1.00 18.69  ? 308  LYS A CG    1 
ATOM   929  C CD    . LYS A 1 123 ? 11.106  -8.962  -8.425  1.00 23.70  ? 308  LYS A CD    1 
ATOM   930  C CE    . LYS A 1 123 ? 10.690  -10.290 -9.052  1.00 27.06  ? 308  LYS A CE    1 
ATOM   931  N NZ    . LYS A 1 123 ? 10.147  -11.217 -8.018  1.00 29.90  ? 308  LYS A NZ    1 
ATOM   932  N N     . LEU A 1 124 ? 12.509  -4.335  -6.765  1.00 11.98  ? 309  LEU A N     1 
ATOM   933  C CA    . LEU A 1 124 ? 13.507  -3.342  -6.367  1.00 12.64  ? 309  LEU A CA    1 
ATOM   934  C C     . LEU A 1 124 ? 14.907  -3.914  -6.655  1.00 12.56  ? 309  LEU A C     1 
ATOM   935  O O     . LEU A 1 124 ? 15.233  -5.022  -6.230  1.00 13.79  ? 309  LEU A O     1 
ATOM   936  C CB    . LEU A 1 124 ? 13.340  -3.005  -4.876  1.00 13.87  ? 309  LEU A CB    1 
ATOM   937  C CG    . LEU A 1 124 ? 14.245  -1.946  -4.223  1.00 16.92  ? 309  LEU A CG    1 
ATOM   938  C CD1   . LEU A 1 124 ? 15.699  -2.378  -4.123  1.00 19.64  ? 309  LEU A CD1   1 
ATOM   939  C CD2   . LEU A 1 124 ? 14.144  -0.639  -4.932  1.00 18.78  ? 309  LEU A CD2   1 
ATOM   940  N N     . HIS A 1 125 ? 15.730  -3.151  -7.366  1.00 12.66  ? 310  HIS A N     1 
ATOM   941  C CA    . HIS A 1 125 ? 17.090  -3.578  -7.692  1.00 13.01  ? 310  HIS A CA    1 
ATOM   942  C C     . HIS A 1 125 ? 18.046  -2.482  -7.273  1.00 13.20  ? 310  HIS A C     1 
ATOM   943  O O     . HIS A 1 125 ? 17.991  -1.373  -7.796  1.00 13.84  ? 310  HIS A O     1 
ATOM   944  C CB    . HIS A 1 125 ? 17.217  -3.842  -9.194  1.00 12.99  ? 310  HIS A CB    1 
ATOM   945  C CG    . HIS A 1 125 ? 18.547  -4.389  -9.605  1.00 13.33  ? 310  HIS A CG    1 
ATOM   946  N ND1   . HIS A 1 125 ? 18.849  -5.732  -9.530  1.00 14.39  ? 310  HIS A ND1   1 
ATOM   947  C CD2   . HIS A 1 125 ? 19.646  -3.779  -10.113 1.00 14.28  ? 310  HIS A CD2   1 
ATOM   948  C CE1   . HIS A 1 125 ? 20.086  -5.923  -9.959  1.00 14.52  ? 310  HIS A CE1   1 
ATOM   949  N NE2   . HIS A 1 125 ? 20.591  -4.757  -10.322 1.00 13.34  ? 310  HIS A NE2   1 
ATOM   950  N N     . ASP A 1 126 ? 18.923  -2.817  -6.330  1.00 13.71  ? 311  ASP A N     1 
ATOM   951  C CA    . ASP A 1 126 ? 19.843  -1.874  -5.714  1.00 14.50  ? 311  ASP A CA    1 
ATOM   952  C C     . ASP A 1 126 ? 21.191  -1.954  -6.425  1.00 14.15  ? 311  ASP A C     1 
ATOM   953  O O     . ASP A 1 126 ? 21.759  -3.037  -6.542  1.00 15.13  ? 311  ASP A O     1 
ATOM   954  C CB    . ASP A 1 126 ? 19.972  -2.294  -4.238  1.00 15.39  ? 311  ASP A CB    1 
ATOM   955  C CG    . ASP A 1 126 ? 20.973  -1.471  -3.444  1.00 17.59  ? 311  ASP A CG    1 
ATOM   956  O OD1   . ASP A 1 126 ? 20.784  -1.404  -2.210  1.00 20.15  ? 311  ASP A OD1   1 
ATOM   957  O OD2   . ASP A 1 126 ? 21.945  -0.926  -4.008  1.00 19.44  ? 311  ASP A OD2   1 
ATOM   958  N N     . ILE A 1 127 ? 21.693  -0.825  -6.917  1.00 13.30  ? 312  ILE A N     1 
ATOM   959  C CA    . ILE A 1 127 ? 23.077  -0.772  -7.419  1.00 13.63  ? 312  ILE A CA    1 
ATOM   960  C C     . ILE A 1 127 ? 23.901  0.162   -6.543  1.00 14.34  ? 312  ILE A C     1 
ATOM   961  O O     . ILE A 1 127 ? 23.772  1.382   -6.630  1.00 14.11  ? 312  ILE A O     1 
ATOM   962  C CB    . ILE A 1 127 ? 23.189  -0.338  -8.900  1.00 13.33  ? 312  ILE A CB    1 
ATOM   963  C CG1   . ILE A 1 127 ? 22.205  -1.124  -9.774  1.00 13.49  ? 312  ILE A CG1   1 
ATOM   964  C CG2   . ILE A 1 127 ? 24.656  -0.501  -9.399  1.00 13.54  ? 312  ILE A CG2   1 
ATOM   965  C CD1   . ILE A 1 127 ? 22.161  -0.668  -11.222 1.00 13.78  ? 312  ILE A CD1   1 
ATOM   966  N N     . ASP A 1 128 ? 24.717  -0.443  -5.674  1.00 14.68  ? 313  ASP A N     1 
ATOM   967  C CA    . ASP A 1 128 ? 25.645  0.285   -4.799  1.00 16.40  ? 313  ASP A CA    1 
ATOM   968  C C     . ASP A 1 128 ? 24.948  1.419   -4.047  1.00 16.37  ? 313  ASP A C     1 
ATOM   969  O O     . ASP A 1 128 ? 25.474  2.526   -3.921  1.00 17.45  ? 313  ASP A O     1 
ATOM   970  C CB    . ASP A 1 128 ? 26.855  0.796   -5.601  1.00 17.24  ? 313  ASP A CB    1 
ATOM   971  C CG    . ASP A 1 128 ? 27.737  -0.340  -6.109  1.00 19.40  ? 313  ASP A CG    1 
ATOM   972  O OD1   . ASP A 1 128 ? 27.943  -0.428  -7.341  1.00 20.86  ? 313  ASP A OD1   1 
ATOM   973  O OD2   . ASP A 1 128 ? 28.187  -1.162  -5.284  1.00 21.35  ? 313  ASP A OD2   1 
ATOM   974  N N     . GLY A 1 129 ? 23.745  1.126   -3.561  1.00 16.21  ? 314  GLY A N     1 
ATOM   975  C CA    . GLY A 1 129 ? 22.999  2.062   -2.740  1.00 16.52  ? 314  GLY A CA    1 
ATOM   976  C C     . GLY A 1 129 ? 21.986  2.927   -3.465  1.00 16.43  ? 314  GLY A C     1 
ATOM   977  O O     . GLY A 1 129 ? 21.282  3.704   -2.819  1.00 17.49  ? 314  GLY A O     1 
ATOM   978  N N     . VAL A 1 130 ? 21.905  2.802   -4.794  1.00 15.59  ? 315  VAL A N     1 
ATOM   979  C CA    . VAL A 1 130 ? 20.885  3.514   -5.568  1.00 15.21  ? 315  VAL A CA    1 
ATOM   980  C C     . VAL A 1 130 ? 19.776  2.527   -5.957  1.00 14.35  ? 315  VAL A C     1 
ATOM   981  O O     . VAL A 1 130 ? 20.041  1.522   -6.613  1.00 14.68  ? 315  VAL A O     1 
ATOM   982  C CB    . VAL A 1 130 ? 21.468  4.203   -6.827  1.00 15.09  ? 315  VAL A CB    1 
ATOM   983  C CG1   . VAL A 1 130 ? 20.395  5.030   -7.518  1.00 15.95  ? 315  VAL A CG1   1 
ATOM   984  C CG2   . VAL A 1 130 ? 22.644  5.123   -6.442  1.00 16.07  ? 315  VAL A CG2   1 
ATOM   985  N N     . PRO A 1 131 ? 18.537  2.799   -5.523  1.00 14.24  ? 316  PRO A N     1 
ATOM   986  C CA    . PRO A 1 131 ? 17.420  1.899   -5.858  1.00 13.48  ? 316  PRO A CA    1 
ATOM   987  C C     . PRO A 1 131 ? 16.871  2.127   -7.263  1.00 13.34  ? 316  PRO A C     1 
ATOM   988  O O     . PRO A 1 131 ? 16.792  3.263   -7.729  1.00 13.64  ? 316  PRO A O     1 
ATOM   989  C CB    . PRO A 1 131 ? 16.355  2.282   -4.834  1.00 14.35  ? 316  PRO A CB    1 
ATOM   990  C CG    . PRO A 1 131 ? 16.608  3.737   -4.586  1.00 14.89  ? 316  PRO A CG    1 
ATOM   991  C CD    . PRO A 1 131 ? 18.101  3.929   -4.685  1.00 14.25  ? 316  PRO A CD    1 
ATOM   992  N N     . HIS A 1 132 ? 16.485  1.029   -7.910  1.00 11.69  ? 317  HIS A N     1 
ATOM   993  C CA    . HIS A 1 132 ? 15.831  1.099   -9.219  1.00 11.95  ? 317  HIS A CA    1 
ATOM   994  C C     . HIS A 1 132 ? 14.618  0.182   -9.172  1.00 11.73  ? 317  HIS A C     1 
ATOM   995  O O     . HIS A 1 132 ? 14.668  -0.866  -8.534  1.00 12.62  ? 317  HIS A O     1 
ATOM   996  C CB    . HIS A 1 132 ? 16.776  0.628   -10.324 1.00 12.38  ? 317  HIS A CB    1 
ATOM   997  C CG    . HIS A 1 132 ? 17.986  1.491   -10.498 1.00 12.04  ? 317  HIS A CG    1 
ATOM   998  N ND1   . HIS A 1 132 ? 18.080  2.457   -11.477 1.00 12.44  ? 317  HIS A ND1   1 
ATOM   999  C CD2   . HIS A 1 132 ? 19.155  1.538   -9.811  1.00 12.93  ? 317  HIS A CD2   1 
ATOM   1000 C CE1   . HIS A 1 132 ? 19.252  3.064   -11.385 1.00 13.64  ? 317  HIS A CE1   1 
ATOM   1001 N NE2   . HIS A 1 132 ? 19.923  2.524   -10.382 1.00 13.53  ? 317  HIS A NE2   1 
ATOM   1002 N N     . LEU A 1 133 ? 13.532  0.585   -9.831  1.00 11.46  ? 318  LEU A N     1 
ATOM   1003 C CA    . LEU A 1 133 ? 12.388  -0.309  -10.030 1.00 10.97  ? 318  LEU A CA    1 
ATOM   1004 C C     . LEU A 1 133 ? 12.503  -0.915  -11.405 1.00 11.19  ? 318  LEU A C     1 
ATOM   1005 O O     . LEU A 1 133 ? 12.599  -0.195  -12.395 1.00 11.00  ? 318  LEU A O     1 
ATOM   1006 C CB    . LEU A 1 133 ? 11.077  0.477   -9.939  1.00 10.70  ? 318  LEU A CB    1 
ATOM   1007 C CG    . LEU A 1 133 ? 10.769  1.074   -8.567  1.00 12.03  ? 318  LEU A CG    1 
ATOM   1008 C CD1   . LEU A 1 133 ? 9.423   1.790   -8.632  1.00 12.34  ? 318  LEU A CD1   1 
ATOM   1009 C CD2   . LEU A 1 133 ? 10.757  -0.004  -7.475  1.00 12.14  ? 318  LEU A CD2   1 
ATOM   1010 N N     . ILE A 1 134 ? 12.513  -2.245  -11.466 1.00 10.68  ? 319  ILE A N     1 
ATOM   1011 C CA    . ILE A 1 134 ? 12.637  -2.936  -12.741 1.00 11.57  ? 319  ILE A CA    1 
ATOM   1012 C C     . ILE A 1 134 ? 11.478  -3.899  -12.924 1.00 10.81  ? 319  ILE A C     1 
ATOM   1013 O O     . ILE A 1 134 ? 10.931  -4.428  -11.945 1.00 11.33  ? 319  ILE A O     1 
ATOM   1014 C CB    . ILE A 1 134 ? 13.993  -3.674  -12.883 1.00 11.51  ? 319  ILE A CB    1 
ATOM   1015 C CG1   . ILE A 1 134 ? 14.125  -4.792  -11.845 1.00 12.06  ? 319  ILE A CG1   1 
ATOM   1016 C CG2   . ILE A 1 134 ? 15.166  -2.668  -12.776 1.00 12.34  ? 319  ILE A CG2   1 
ATOM   1017 C CD1   . ILE A 1 134 ? 15.392  -5.654  -11.992 1.00 13.64  ? 319  ILE A CD1   1 
ATOM   1018 N N     . LEU A 1 135 ? 11.103  -4.106  -14.183 1.00 9.91   ? 320  LEU A N     1 
ATOM   1019 C CA    . LEU A 1 135 ? 10.075  -5.087  -14.534 1.00 10.22  ? 320  LEU A CA    1 
ATOM   1020 C C     . LEU A 1 135 ? 10.717  -6.338  -15.109 1.00 10.49  ? 320  LEU A C     1 
ATOM   1021 O O     . LEU A 1 135 ? 11.530  -6.257  -16.021 1.00 11.07  ? 320  LEU A O     1 
ATOM   1022 C CB    . LEU A 1 135 ? 9.067   -4.489  -15.508 1.00 10.99  ? 320  LEU A CB    1 
ATOM   1023 C CG    . LEU A 1 135 ? 7.978   -3.602  -14.903 1.00 11.89  ? 320  LEU A CG    1 
ATOM   1024 C CD1   . LEU A 1 135 ? 8.537   -2.303  -14.290 1.00 14.01  ? 320  LEU A CD1   1 
ATOM   1025 C CD2   . LEU A 1 135 ? 6.957   -3.300  -15.992 1.00 13.94  ? 320  LEU A CD2   1 
ATOM   1026 N N     . ILE A 1 136 ? 10.354  -7.474  -14.525 1.00 10.96  ? 321  ILE A N     1 
ATOM   1027 C CA    . ILE A 1 136 ? 10.822  -8.802  -14.931 1.00 12.48  ? 321  ILE A CA    1 
ATOM   1028 C C     . ILE A 1 136 ? 9.630   -9.578  -15.486 1.00 11.57  ? 321  ILE A C     1 
ATOM   1029 O O     . ILE A 1 136 ? 8.519   -9.492  -14.943 1.00 12.01  ? 321  ILE A O     1 
ATOM   1030 C CB    . ILE A 1 136 ? 11.399  -9.536  -13.686 1.00 12.92  ? 321  ILE A CB    1 
ATOM   1031 C CG1   . ILE A 1 136 ? 12.541  -8.700  -13.077 1.00 14.60  ? 321  ILE A CG1   1 
ATOM   1032 C CG2   . ILE A 1 136 ? 11.871  -10.961 -13.988 1.00 14.69  ? 321  ILE A CG2   1 
ATOM   1033 C CD1   . ILE A 1 136 ? 13.717  -8.445  -14.016 1.00 16.10  ? 321  ILE A CD1   1 
ATOM   1034 N N     . ALA A 1 137 ? 9.846   -10.330 -16.561 1.00 10.80  ? 322  ALA A N     1 
ATOM   1035 C CA    . ALA A 1 137 ? 8.760   -11.166 -17.107 1.00 10.15  ? 322  ALA A CA    1 
ATOM   1036 C C     . ALA A 1 137 ? 8.395   -12.253 -16.113 1.00 10.17  ? 322  ALA A C     1 
ATOM   1037 O O     . ALA A 1 137 ? 9.272   -12.989 -15.640 1.00 10.37  ? 322  ALA A O     1 
ATOM   1038 C CB    . ALA A 1 137 ? 9.165   -11.784 -18.441 1.00 10.49  ? 322  ALA A CB    1 
ATOM   1039 N N     . SER A 1 138 ? 7.109   -12.344 -15.782 1.00 9.62   ? 323  SER A N     1 
ATOM   1040 C CA    . SER A 1 138 ? 6.652   -13.348 -14.819 1.00 10.74  ? 323  SER A CA    1 
ATOM   1041 C C     . SER A 1 138 ? 6.250   -14.644 -15.511 1.00 10.46  ? 323  SER A C     1 
ATOM   1042 O O     . SER A 1 138 ? 5.967   -15.644 -14.864 1.00 11.68  ? 323  SER A O     1 
ATOM   1043 C CB    . SER A 1 138 ? 5.473   -12.796 -14.028 1.00 11.67  ? 323  SER A CB    1 
ATOM   1044 O OG    . SER A 1 138 ? 4.389   -12.519 -14.900 1.00 13.31  ? 323  SER A OG    1 
ATOM   1045 N N     . ARG A 1 139 ? 6.206   -14.606 -16.842 1.00 9.82   ? 324  ARG A N     1 
ATOM   1046 C CA    . ARG A 1 139 ? 5.937   -15.774 -17.665 1.00 9.71   ? 324  ARG A CA    1 
ATOM   1047 C C     . ARG A 1 139 ? 6.484   -15.446 -19.055 1.00 9.28   ? 324  ARG A C     1 
ATOM   1048 O O     . ARG A 1 139 ? 6.825   -14.286 -19.308 1.00 9.71   ? 324  ARG A O     1 
ATOM   1049 C CB    . ARG A 1 139 ? 4.422   -16.047 -17.758 1.00 9.60   ? 324  ARG A CB    1 
ATOM   1050 C CG    . ARG A 1 139 ? 3.585   -14.877 -18.299 1.00 10.27  ? 324  ARG A CG    1 
ATOM   1051 C CD    . ARG A 1 139 ? 2.205   -15.390 -18.698 1.00 11.13  ? 324  ARG A CD    1 
ATOM   1052 N NE    . ARG A 1 139 ? 1.250   -14.348 -19.059 1.00 11.09  ? 324  ARG A NE    1 
ATOM   1053 C CZ    . ARG A 1 139 ? 1.179   -13.752 -20.246 1.00 10.22  ? 324  ARG A CZ    1 
ATOM   1054 N NH1   . ARG A 1 139 ? 2.074   -14.012 -21.213 1.00 10.71  ? 324  ARG A NH1   1 
ATOM   1055 N NH2   . ARG A 1 139 ? 0.218   -12.866 -20.456 1.00 10.62  ? 324  ARG A NH2   1 
ATOM   1056 N N     . ASP A 1 140 ? 6.539   -16.438 -19.954 1.00 9.37   ? 325  ASP A N     1 
ATOM   1057 C CA    . ASP A 1 140 ? 6.864   -16.145 -21.344 1.00 9.31   ? 325  ASP A CA    1 
ATOM   1058 C C     . ASP A 1 140 ? 5.824   -15.172 -21.892 1.00 9.38   ? 325  ASP A C     1 
ATOM   1059 O O     . ASP A 1 140 ? 4.619   -15.319 -21.641 1.00 10.09  ? 325  ASP A O     1 
ATOM   1060 C CB    . ASP A 1 140 ? 6.873   -17.423 -22.181 1.00 8.70   ? 325  ASP A CB    1 
ATOM   1061 C CG    . ASP A 1 140 ? 8.077   -18.322 -21.894 1.00 9.46   ? 325  ASP A CG    1 
ATOM   1062 O OD1   . ASP A 1 140 ? 8.956   -17.967 -21.074 1.00 10.56  ? 325  ASP A OD1   1 
ATOM   1063 O OD2   . ASP A 1 140 ? 8.149   -19.400 -22.516 1.00 11.70  ? 325  ASP A OD2   1 
ATOM   1064 N N     . ILE A 1 141 ? 6.306   -14.184 -22.639 1.00 9.29   ? 326  ILE A N     1 
ATOM   1065 C CA    . ILE A 1 141 ? 5.470   -13.139 -23.201 1.00 9.22   ? 326  ILE A CA    1 
ATOM   1066 C C     . ILE A 1 141 ? 5.508   -13.257 -24.722 1.00 9.07   ? 326  ILE A C     1 
ATOM   1067 O O     . ILE A 1 141 ? 6.579   -13.247 -25.324 1.00 9.86   ? 326  ILE A O     1 
ATOM   1068 C CB    . ILE A 1 141 ? 5.953   -11.744 -22.778 1.00 9.20   ? 326  ILE A CB    1 
ATOM   1069 C CG1   . ILE A 1 141 ? 6.026   -11.636 -21.250 1.00 9.77   ? 326  ILE A CG1   1 
ATOM   1070 C CG2   . ILE A 1 141 ? 5.046   -10.677 -23.364 1.00 9.96   ? 326  ILE A CG2   1 
ATOM   1071 C CD1   . ILE A 1 141 ? 6.506   -10.292 -20.761 1.00 10.38  ? 326  ILE A CD1   1 
ATOM   1072 N N     . ALA A 1 142 ? 4.333   -13.380 -25.336 1.00 8.76   ? 327  ALA A N     1 
ATOM   1073 C CA    . ALA A 1 142 ? 4.233   -13.552 -26.779 1.00 8.74   ? 327  ALA A CA    1 
ATOM   1074 C C     . ALA A 1 142 ? 4.472   -12.266 -27.522 1.00 9.17   ? 327  ALA A C     1 
ATOM   1075 O O     . ALA A 1 142 ? 4.030   -11.208 -27.096 1.00 9.22   ? 327  ALA A O     1 
ATOM   1076 C CB    . ALA A 1 142 ? 2.866   -14.063 -27.137 1.00 8.83   ? 327  ALA A CB    1 
ATOM   1077 N N     . ALA A 1 143 ? 5.091   -12.367 -28.696 1.00 9.41   ? 328  ALA A N     1 
ATOM   1078 C CA    . ALA A 1 143 ? 5.145   -11.231 -29.580 1.00 9.09   ? 328  ALA A CA    1 
ATOM   1079 C C     . ALA A 1 143 ? 3.718   -10.742 -29.824 1.00 8.94   ? 328  ALA A C     1 
ATOM   1080 O O     . ALA A 1 143 ? 2.784   -11.556 -30.027 1.00 9.21   ? 328  ALA A O     1 
ATOM   1081 C CB    . ALA A 1 143 ? 5.801   -11.632 -30.897 1.00 9.29   ? 328  ALA A CB    1 
ATOM   1082 N N     . GLY A 1 144 ? 3.542   -9.419  -29.789 1.00 8.30   ? 329  GLY A N     1 
ATOM   1083 C CA    . GLY A 1 144 ? 2.255   -8.821  -30.088 1.00 8.96   ? 329  GLY A CA    1 
ATOM   1084 C C     . GLY A 1 144 ? 1.349   -8.621  -28.891 1.00 8.60   ? 329  GLY A C     1 
ATOM   1085 O O     . GLY A 1 144 ? 0.348   -7.931  -29.005 1.00 9.80   ? 329  GLY A O     1 
ATOM   1086 N N     . GLU A 1 145 ? 1.680   -9.215  -27.741 1.00 7.92   ? 330  GLU A N     1 
ATOM   1087 C CA    . GLU A 1 145 ? 0.820   -9.025  -26.568 1.00 8.93   ? 330  GLU A CA    1 
ATOM   1088 C C     . GLU A 1 145 ? 1.264   -7.849  -25.727 1.00 8.67   ? 330  GLU A C     1 
ATOM   1089 O O     . GLU A 1 145 ? 2.437   -7.469  -25.712 1.00 9.09   ? 330  GLU A O     1 
ATOM   1090 C CB    . GLU A 1 145 ? 0.664   -10.302 -25.735 1.00 10.52  ? 330  GLU A CB    1 
ATOM   1091 C CG    . GLU A 1 145 ? 1.759   -10.611 -24.757 1.00 10.80  ? 330  GLU A CG    1 
ATOM   1092 C CD    . GLU A 1 145 ? 1.347   -11.738 -23.793 1.00 9.98   ? 330  GLU A CD    1 
ATOM   1093 O OE1   . GLU A 1 145 ? 0.464   -11.521 -22.925 1.00 9.75   ? 330  GLU A OE1   1 
ATOM   1094 O OE2   . GLU A 1 145 ? 1.922   -12.832 -23.894 1.00 9.57   ? 330  GLU A OE2   1 
ATOM   1095 N N     . GLU A 1 146 ? 0.295   -7.276  -25.026 1.00 8.15   ? 331  GLU A N     1 
ATOM   1096 C CA    . GLU A 1 146 ? 0.537   -6.112  -24.207 1.00 8.22   ? 331  GLU A CA    1 
ATOM   1097 C C     . GLU A 1 146 ? 1.293   -6.482  -22.935 1.00 8.16   ? 331  GLU A C     1 
ATOM   1098 O O     . GLU A 1 146 ? 0.945   -7.451  -22.249 1.00 8.70   ? 331  GLU A O     1 
ATOM   1099 C CB    . GLU A 1 146 ? -0.802  -5.463  -23.843 1.00 8.17   ? 331  GLU A CB    1 
ATOM   1100 C CG    . GLU A 1 146 ? -0.628  -4.116  -23.160 1.00 8.44   ? 331  GLU A CG    1 
ATOM   1101 C CD    . GLU A 1 146 ? -1.920  -3.461  -22.717 1.00 8.68   ? 331  GLU A CD    1 
ATOM   1102 O OE1   . GLU A 1 146 ? -3.016  -4.114  -22.745 1.00 8.97   ? 331  GLU A OE1   1 
ATOM   1103 O OE2   . GLU A 1 146 ? -1.786  -2.283  -22.274 1.00 9.15   ? 331  GLU A OE2   1 
ATOM   1104 N N     . LEU A 1 147 ? 2.297   -5.682  -22.599 1.00 8.34   ? 332  LEU A N     1 
ATOM   1105 C CA    . LEU A 1 147 ? 2.957   -5.803  -21.300 1.00 8.01   ? 332  LEU A CA    1 
ATOM   1106 C C     . LEU A 1 147 ? 2.039   -5.261  -20.227 1.00 7.94   ? 332  LEU A C     1 
ATOM   1107 O O     . LEU A 1 147 ? 1.442   -4.209  -20.410 1.00 7.70   ? 332  LEU A O     1 
ATOM   1108 C CB    . LEU A 1 147 ? 4.264   -5.013  -21.298 1.00 8.57   ? 332  LEU A CB    1 
ATOM   1109 C CG    . LEU A 1 147 ? 5.292   -5.413  -22.358 1.00 9.76   ? 332  LEU A CG    1 
ATOM   1110 C CD1   . LEU A 1 147 ? 6.509   -4.521  -22.215 1.00 10.83  ? 332  LEU A CD1   1 
ATOM   1111 C CD2   . LEU A 1 147 ? 5.681   -6.888  -22.237 1.00 11.20  ? 332  LEU A CD2   1 
ATOM   1112 N N     . LEU A 1 148 ? 1.935   -5.979  -19.101 1.00 8.44   ? 333  LEU A N     1 
ATOM   1113 C CA    . LEU A 1 148 ? 1.029   -5.592  -18.012 1.00 8.86   ? 333  LEU A CA    1 
ATOM   1114 C C     . LEU A 1 148 ? 1.605   -6.029  -16.690 1.00 8.82   ? 333  LEU A C     1 
ATOM   1115 O O     . LEU A 1 148 ? 2.188   -7.103  -16.597 1.00 9.25   ? 333  LEU A O     1 
ATOM   1116 C CB    . LEU A 1 148 ? -0.341  -6.255  -18.177 1.00 9.52   ? 333  LEU A CB    1 
ATOM   1117 C CG    . LEU A 1 148 ? -1.154  -5.864  -19.421 1.00 9.53   ? 333  LEU A CG    1 
ATOM   1118 C CD1   . LEU A 1 148 ? -2.329  -6.815  -19.639 1.00 10.13  ? 333  LEU A CD1   1 
ATOM   1119 C CD2   . LEU A 1 148 ? -1.642  -4.431  -19.317 1.00 10.78  ? 333  LEU A CD2   1 
ATOM   1120 N N     . TYR A 1 149 ? 1.449   -5.186  -15.673 1.00 8.90   ? 334  TYR A N     1 
ATOM   1121 C CA    . TYR A 1 149 ? 1.843   -5.578  -14.319 1.00 8.76   ? 334  TYR A CA    1 
ATOM   1122 C C     . TYR A 1 149 ? 0.826   -5.035  -13.314 1.00 8.94   ? 334  TYR A C     1 
ATOM   1123 O O     . TYR A 1 149 ? -0.017  -4.207  -13.656 1.00 9.28   ? 334  TYR A O     1 
ATOM   1124 C CB    . TYR A 1 149 ? 3.268   -5.091  -13.973 1.00 9.32   ? 334  TYR A CB    1 
ATOM   1125 C CG    . TYR A 1 149 ? 3.388   -3.584  -13.858 1.00 9.24   ? 334  TYR A CG    1 
ATOM   1126 C CD1   . TYR A 1 149 ? 3.345   -2.942  -12.619 1.00 9.68   ? 334  TYR A CD1   1 
ATOM   1127 C CD2   . TYR A 1 149 ? 3.549   -2.795  -14.999 1.00 9.44   ? 334  TYR A CD2   1 
ATOM   1128 C CE1   . TYR A 1 149 ? 3.441   -1.557  -12.521 1.00 9.20   ? 334  TYR A CE1   1 
ATOM   1129 C CE2   . TYR A 1 149 ? 3.652   -1.423  -14.912 1.00 10.03  ? 334  TYR A CE2   1 
ATOM   1130 C CZ    . TYR A 1 149 ? 3.603   -0.801  -13.679 1.00 9.84   ? 334  TYR A CZ    1 
ATOM   1131 O OH    . TYR A 1 149 ? 3.713   0.577   -13.618 1.00 10.25  ? 334  TYR A OH    1 
ATOM   1132 N N     . ASP A 1 150 ? 0.907   -5.508  -12.070 1.00 9.28   ? 335  ASP A N     1 
ATOM   1133 C CA    . ASP A 1 150 ? -0.034  -5.084  -11.040 1.00 9.54   ? 335  ASP A CA    1 
ATOM   1134 C C     . ASP A 1 150 ? 0.436   -3.760  -10.461 1.00 9.94   ? 335  ASP A C     1 
ATOM   1135 O O     . ASP A 1 150 ? 1.496   -3.701  -9.815  1.00 10.38  ? 335  ASP A O     1 
ATOM   1136 C CB    . ASP A 1 150 ? -0.080  -6.142  -9.941  1.00 9.96   ? 335  ASP A CB    1 
ATOM   1137 C CG    . ASP A 1 150 ? -1.065  -5.813  -8.831  1.00 11.36  ? 335  ASP A CG    1 
ATOM   1138 O OD1   . ASP A 1 150 ? -1.765  -4.786  -8.895  1.00 11.67  ? 335  ASP A OD1   1 
ATOM   1139 O OD2   . ASP A 1 150 ? -1.103  -6.608  -7.865  1.00 15.59  ? 335  ASP A OD2   1 
ATOM   1140 N N     . TYR A 1 151 ? -0.338  -2.700  -10.706 1.00 10.01  ? 336  TYR A N     1 
ATOM   1141 C CA    . TYR A 1 151 ? -0.024  -1.373  -10.143 1.00 10.28  ? 336  TYR A CA    1 
ATOM   1142 C C     . TYR A 1 151 ? -0.017  -1.362  -8.620  1.00 10.39  ? 336  TYR A C     1 
ATOM   1143 O O     . TYR A 1 151 ? 0.610   -0.490  -8.017  1.00 10.90  ? 336  TYR A O     1 
ATOM   1144 C CB    . TYR A 1 151 ? -1.025  -0.336  -10.629 1.00 9.94   ? 336  TYR A CB    1 
ATOM   1145 C CG    . TYR A 1 151 ? -0.822  0.185   -12.037 1.00 9.66   ? 336  TYR A CG    1 
ATOM   1146 C CD1   . TYR A 1 151 ? 0.101   -0.394  -12.902 1.00 9.52   ? 336  TYR A CD1   1 
ATOM   1147 C CD2   . TYR A 1 151 ? -1.582  1.269   -12.499 1.00 10.15  ? 336  TYR A CD2   1 
ATOM   1148 C CE1   . TYR A 1 151 ? 0.271   0.110   -14.206 1.00 8.68   ? 336  TYR A CE1   1 
ATOM   1149 C CE2   . TYR A 1 151 ? -1.419  1.774   -13.783 1.00 9.99   ? 336  TYR A CE2   1 
ATOM   1150 C CZ    . TYR A 1 151 ? -0.480  1.203   -14.620 1.00 8.64   ? 336  TYR A CZ    1 
ATOM   1151 O OH    . TYR A 1 151 ? -0.344  1.733   -15.878 1.00 9.10   ? 336  TYR A OH    1 
ATOM   1152 N N     . GLY A 1 152 ? -0.748  -2.287  -8.001  1.00 10.16  ? 337  GLY A N     1 
ATOM   1153 C CA    . GLY A 1 152 ? -0.680  -2.446  -6.535  1.00 11.03  ? 337  GLY A CA    1 
ATOM   1154 C C     . GLY A 1 152 ? -1.518  -1.505  -5.690  1.00 11.21  ? 337  GLY A C     1 
ATOM   1155 O O     . GLY A 1 152 ? -1.537  -1.643  -4.472  1.00 11.15  ? 337  GLY A O     1 
ATOM   1156 N N     . ASP A 1 153 ? -2.189  -0.542  -6.321  1.00 11.32  ? 338  ASP A N     1 
ATOM   1157 C CA    . ASP A 1 153 ? -3.100  0.339   -5.603  1.00 11.19  ? 338  ASP A CA    1 
ATOM   1158 C C     . ASP A 1 153 ? -4.458  -0.353  -5.535  1.00 11.09  ? 338  ASP A C     1 
ATOM   1159 O O     . ASP A 1 153 ? -5.166  -0.465  -6.554  1.00 11.17  ? 338  ASP A O     1 
ATOM   1160 C CB    . ASP A 1 153 ? -3.212  1.691   -6.311  1.00 11.76  ? 338  ASP A CB    1 
ATOM   1161 C CG    . ASP A 1 153 ? -3.986  2.725   -5.498  1.00 11.72  ? 338  ASP A CG    1 
ATOM   1162 O OD1   . ASP A 1 153 ? -4.651  2.355   -4.494  1.00 12.21  ? 338  ASP A OD1   1 
ATOM   1163 O OD2   . ASP A 1 153 ? -3.953  3.907   -5.895  1.00 12.40  ? 338  ASP A OD2   1 
ATOM   1164 N N     . ARG A 1 154 ? -4.801  -0.844  -4.341  1.00 11.21  ? 339  ARG A N     1 
ATOM   1165 C CA    . ARG A 1 154 ? -6.035  -1.589  -4.130  1.00 11.92  ? 339  ARG A CA    1 
ATOM   1166 C C     . ARG A 1 154 ? -7.011  -0.775  -3.297  1.00 12.10  ? 339  ARG A C     1 
ATOM   1167 O O     . ARG A 1 154 ? -8.090  -1.255  -2.972  1.00 12.59  ? 339  ARG A O     1 
ATOM   1168 C CB    . ARG A 1 154 ? -5.729  -2.927  -3.442  1.00 12.22  ? 339  ARG A CB    1 
ATOM   1169 C CG    . ARG A 1 154 ? -4.829  -3.785  -4.271  1.00 13.09  ? 339  ARG A CG    1 
ATOM   1170 C CD    . ARG A 1 154 ? -4.485  -5.115  -3.683  1.00 13.61  ? 339  ARG A CD    1 
ATOM   1171 N NE    . ARG A 1 154 ? -3.528  -5.753  -4.581  1.00 13.68  ? 339  ARG A NE    1 
ATOM   1172 C CZ    . ARG A 1 154 ? -2.824  -6.841  -4.304  1.00 14.93  ? 339  ARG A CZ    1 
ATOM   1173 N NH1   . ARG A 1 154 ? -2.968  -7.457  -3.130  1.00 16.40  ? 339  ARG A NH1   1 
ATOM   1174 N NH2   . ARG A 1 154 ? -1.974  -7.315  -5.211  1.00 16.95  ? 339  ARG A NH2   1 
ATOM   1175 N N     . SER A 1 155 ? -6.634  0.467   -3.000  1.00 11.62  ? 340  SER A N     1 
ATOM   1176 C CA    . SER A 1 155 ? -7.425  1.332   -2.117  1.00 11.65  ? 340  SER A CA    1 
ATOM   1177 C C     . SER A 1 155 ? -8.823  1.584   -2.665  1.00 11.74  ? 340  SER A C     1 
ATOM   1178 O O     . SER A 1 155 ? -9.029  1.737   -3.875  1.00 11.48  ? 340  SER A O     1 
ATOM   1179 C CB    . SER A 1 155 ? -6.714  2.671   -1.849  1.00 11.61  ? 340  SER A CB    1 
ATOM   1180 O OG    . SER A 1 155 ? -6.676  3.497   -3.005  1.00 11.82  ? 340  SER A OG    1 
ATOM   1181 N N     . LYS A 1 156 ? -9.786  1.652   -1.753  1.00 12.62  ? 341  LYS A N     1 
ATOM   1182 C CA    . LYS A 1 156 ? -11.170 1.895   -2.116  1.00 13.70  ? 341  LYS A CA    1 
ATOM   1183 C C     . LYS A 1 156 ? -11.274 3.213   -2.874  1.00 13.74  ? 341  LYS A C     1 
ATOM   1184 O O     . LYS A 1 156 ? -11.942 3.292   -3.910  1.00 13.67  ? 341  LYS A O     1 
ATOM   1185 C CB    . LYS A 1 156 ? -12.042 1.897   -0.849  1.00 14.18  ? 341  LYS A CB    1 
ATOM   1186 C CG    . LYS A 1 156 ? -13.531 2.050   -1.103  1.00 16.69  ? 341  LYS A CG    1 
ATOM   1187 C CD    . LYS A 1 156 ? -14.191 0.722   -1.501  1.00 20.88  ? 341  LYS A CD    1 
ATOM   1188 C CE    . LYS A 1 156 ? -15.485 0.955   -2.280  1.00 23.34  ? 341  LYS A CE    1 
ATOM   1189 N NZ    . LYS A 1 156 ? -16.441 1.893   -1.614  1.00 23.88  ? 341  LYS A NZ    1 
ATOM   1190 N N     . ALA A 1 157 ? -10.565 4.229   -2.379  1.00 14.40  ? 342  ALA A N     1 
ATOM   1191 C CA    . ALA A 1 157 ? -10.601 5.555   -2.978  1.00 14.83  ? 342  ALA A CA    1 
ATOM   1192 C C     . ALA A 1 157 ? -10.142 5.535   -4.437  1.00 14.96  ? 342  ALA A C     1 
ATOM   1193 O O     . ALA A 1 157 ? -10.706 6.239   -5.269  1.00 16.17  ? 342  ALA A O     1 
ATOM   1194 C CB    . ALA A 1 157 ? -9.780  6.530   -2.163  1.00 15.23  ? 342  ALA A CB    1 
ATOM   1195 N N     . SER A 1 158 ? -9.136  4.716   -4.747  1.00 14.50  ? 343  SER A N     1 
ATOM   1196 C CA    . SER A 1 158 ? -8.670  4.587   -6.129  1.00 13.87  ? 343  SER A CA    1 
ATOM   1197 C C     . SER A 1 158 ? -9.569  3.733   -7.010  1.00 14.53  ? 343  SER A C     1 
ATOM   1198 O O     . SER A 1 158 ? -9.817  4.110   -8.163  1.00 14.54  ? 343  SER A O     1 
ATOM   1199 C CB    . SER A 1 158 ? -7.241  4.063   -6.170  1.00 13.04  ? 343  SER A CB    1 
ATOM   1200 O OG    . SER A 1 158 ? -6.365  5.022   -5.611  1.00 12.83  ? 343  SER A OG    1 
ATOM   1201 N N     . ILE A 1 159 ? -10.053 2.600   -6.494  1.00 14.73  ? 344  ILE A N     1 
ATOM   1202 C CA    . ILE A 1 159 ? -10.874 1.693   -7.317  1.00 15.64  ? 344  ILE A CA    1 
ATOM   1203 C C     . ILE A 1 159 ? -12.236 2.297   -7.655  1.00 16.12  ? 344  ILE A C     1 
ATOM   1204 O O     . ILE A 1 159 ? -12.768 2.030   -8.739  1.00 16.03  ? 344  ILE A O     1 
ATOM   1205 C CB    . ILE A 1 159 ? -11.023 0.234   -6.746  1.00 15.95  ? 344  ILE A CB    1 
ATOM   1206 C CG1   . ILE A 1 159 ? -11.873 0.203   -5.473  1.00 17.09  ? 344  ILE A CG1   1 
ATOM   1207 C CG2   . ILE A 1 159 ? -9.662  -0.429  -6.566  1.00 15.73  ? 344  ILE A CG2   1 
ATOM   1208 C CD1   . ILE A 1 159 ? -11.992 -1.176  -4.833  1.00 17.14  ? 344  ILE A CD1   1 
ATOM   1209 N N     . GLU A 1 160 ? -12.775 3.125   -6.757  1.00 16.42  ? 345  GLU A N     1 
ATOM   1210 C CA    . GLU A 1 160 ? -14.035 3.836   -7.019  1.00 17.75  ? 345  GLU A CA    1 
ATOM   1211 C C     . GLU A 1 160 ? -13.920 4.682   -8.289  1.00 16.87  ? 345  GLU A C     1 
ATOM   1212 O O     . GLU A 1 160 ? -14.838 4.701   -9.115  1.00 17.73  ? 345  GLU A O     1 
ATOM   1213 C CB    . GLU A 1 160 ? -14.431 4.734   -5.835  1.00 17.87  ? 345  GLU A CB    1 
ATOM   1214 C CG    . GLU A 1 160 ? -15.016 4.013   -4.611  1.00 20.10  ? 345  GLU A CG    1 
ATOM   1215 C CD    . GLU A 1 160 ? -15.015 4.869   -3.341  1.00 20.08  ? 345  GLU A CD    1 
ATOM   1216 O OE1   . GLU A 1 160 ? -14.605 6.054   -3.383  1.00 22.57  ? 345  GLU A OE1   1 
ATOM   1217 O OE2   . GLU A 1 160 ? -15.399 4.344   -2.268  1.00 23.42  ? 345  GLU A OE2   1 
ATOM   1218 N N     . ALA A 1 161 ? -12.792 5.378   -8.430  1.00 16.40  ? 346  ALA A N     1 
ATOM   1219 C CA    . ALA A 1 161 ? -12.532 6.280   -9.558  1.00 16.04  ? 346  ALA A CA    1 
ATOM   1220 C C     . ALA A 1 161 ? -11.883 5.592   -10.763 1.00 15.72  ? 346  ALA A C     1 
ATOM   1221 O O     . ALA A 1 161 ? -11.964 6.093   -11.896 1.00 16.14  ? 346  ALA A O     1 
ATOM   1222 C CB    . ALA A 1 161 ? -11.665 7.435   -9.087  1.00 16.43  ? 346  ALA A CB    1 
ATOM   1223 N N     . HIS A 1 162 ? -11.233 4.457   -10.514 1.00 15.11  ? 347  HIS A N     1 
ATOM   1224 C CA    . HIS A 1 162 ? -10.506 3.714   -11.543 1.00 14.25  ? 347  HIS A CA    1 
ATOM   1225 C C     . HIS A 1 162 ? -10.815 2.223   -11.412 1.00 14.36  ? 347  HIS A C     1 
ATOM   1226 O O     . HIS A 1 162 ? -9.978  1.449   -10.960 1.00 14.14  ? 347  HIS A O     1 
ATOM   1227 C CB    . HIS A 1 162 ? -8.992  3.962   -11.431 1.00 14.47  ? 347  HIS A CB    1 
ATOM   1228 C CG    . HIS A 1 162 ? -8.615  5.410   -11.394 1.00 14.80  ? 347  HIS A CG    1 
ATOM   1229 N ND1   . HIS A 1 162 ? -8.423  6.161   -12.535 1.00 16.81  ? 347  HIS A ND1   1 
ATOM   1230 C CD2   . HIS A 1 162 ? -8.408  6.249   -10.352 1.00 15.65  ? 347  HIS A CD2   1 
ATOM   1231 C CE1   . HIS A 1 162 ? -8.100  7.395   -12.195 1.00 16.35  ? 347  HIS A CE1   1 
ATOM   1232 N NE2   . HIS A 1 162 ? -8.099  7.477   -10.877 1.00 17.09  ? 347  HIS A NE2   1 
ATOM   1233 N N     . PRO A 1 163 ? -12.034 1.811   -11.806 1.00 13.90  ? 348  PRO A N     1 
ATOM   1234 C CA    . PRO A 1 163 ? -12.462 0.422   -11.566 1.00 13.85  ? 348  PRO A CA    1 
ATOM   1235 C C     . PRO A 1 163 ? -11.625 -0.661  -12.251 1.00 13.56  ? 348  PRO A C     1 
ATOM   1236 O O     . PRO A 1 163 ? -11.649 -1.819  -11.820 1.00 13.83  ? 348  PRO A O     1 
ATOM   1237 C CB    . PRO A 1 163 ? -13.896 0.385   -12.096 1.00 14.15  ? 348  PRO A CB    1 
ATOM   1238 C CG    . PRO A 1 163 ? -14.272 1.786   -12.407 1.00 14.90  ? 348  PRO A CG    1 
ATOM   1239 C CD    . PRO A 1 163 ? -13.073 2.636   -12.452 1.00 14.33  ? 348  PRO A CD    1 
ATOM   1240 N N     . TRP A 1 164 ? -10.899 -0.292  -13.305 1.00 13.09  ? 349  TRP A N     1 
ATOM   1241 C CA    . TRP A 1 164 ? -9.994  -1.226  -13.978 1.00 12.21  ? 349  TRP A CA    1 
ATOM   1242 C C     . TRP A 1 164 ? -8.861  -1.715  -13.038 1.00 12.43  ? 349  TRP A C     1 
ATOM   1243 O O     . TRP A 1 164 ? -8.187  -2.711  -13.313 1.00 12.80  ? 349  TRP A O     1 
ATOM   1244 C CB    . TRP A 1 164 ? -9.427  -0.593  -15.266 1.00 12.26  ? 349  TRP A CB    1 
ATOM   1245 C CG    . TRP A 1 164 ? -8.869  0.771   -15.035 1.00 11.66  ? 349  TRP A CG    1 
ATOM   1246 C CD1   . TRP A 1 164 ? -9.507  1.960   -15.239 1.00 12.02  ? 349  TRP A CD1   1 
ATOM   1247 C CD2   . TRP A 1 164 ? -7.581  1.094   -14.507 1.00 11.64  ? 349  TRP A CD2   1 
ATOM   1248 N NE1   . TRP A 1 164 ? -8.695  3.008   -14.884 1.00 13.21  ? 349  TRP A NE1   1 
ATOM   1249 C CE2   . TRP A 1 164 ? -7.504  2.504   -14.424 1.00 11.79  ? 349  TRP A CE2   1 
ATOM   1250 C CE3   . TRP A 1 164 ? -6.475  0.333   -14.111 1.00 10.97  ? 349  TRP A CE3   1 
ATOM   1251 C CZ2   . TRP A 1 164 ? -6.362  3.167   -13.958 1.00 11.89  ? 349  TRP A CZ2   1 
ATOM   1252 C CZ3   . TRP A 1 164 ? -5.338  0.997   -13.645 1.00 11.40  ? 349  TRP A CZ3   1 
ATOM   1253 C CH2   . TRP A 1 164 ? -5.299  2.398   -13.560 1.00 11.50  ? 349  TRP A CH2   1 
ATOM   1254 N N     . LEU A 1 165 ? -8.660  -1.023  -11.922 1.00 12.25  ? 350  LEU A N     1 
ATOM   1255 C CA    . LEU A 1 165 ? -7.687  -1.467  -10.921 1.00 12.26  ? 350  LEU A CA    1 
ATOM   1256 C C     . LEU A 1 165 ? -8.105  -2.790  -10.274 1.00 13.57  ? 350  LEU A C     1 
ATOM   1257 O O     . LEU A 1 165 ? -7.266  -3.517  -9.732  1.00 13.57  ? 350  LEU A O     1 
ATOM   1258 C CB    . LEU A 1 165 ? -7.491  -0.387  -9.851  1.00 11.55  ? 350  LEU A CB    1 
ATOM   1259 C CG    . LEU A 1 165 ? -6.507  0.735   -10.190 1.00 11.19  ? 350  LEU A CG    1 
ATOM   1260 C CD1   . LEU A 1 165 ? -6.588  1.868   -9.148  1.00 10.78  ? 350  LEU A CD1   1 
ATOM   1261 C CD2   . LEU A 1 165 ? -5.084  0.194   -10.246 1.00 11.00  ? 350  LEU A CD2   1 
ATOM   1262 N N     . LYS A 1 166 ? -9.398  -3.107  -10.353 1.00 15.06  ? 351  LYS A N     1 
ATOM   1263 C CA    . LYS A 1 166 ? -9.948  -4.261  -9.627  1.00 17.30  ? 351  LYS A CA    1 
ATOM   1264 C C     . LYS A 1 166 ? -9.617  -5.609  -10.234 1.00 18.85  ? 351  LYS A C     1 
ATOM   1265 O O     . LYS A 1 166 ? -9.783  -6.646  -9.575  1.00 19.86  ? 351  LYS A O     1 
ATOM   1266 C CB    . LYS A 1 166 ? -11.469 -4.145  -9.512  1.00 17.07  ? 351  LYS A CB    1 
ATOM   1267 C CG    . LYS A 1 166 ? -11.885 -3.054  -8.562  1.00 18.40  ? 351  LYS A CG    1 
ATOM   1268 C CD    . LYS A 1 166 ? -13.326 -3.182  -8.171  1.00 19.73  ? 351  LYS A CD    1 
ATOM   1269 C CE    . LYS A 1 166 ? -14.197 -2.717  -9.299  1.00 18.32  ? 351  LYS A CE    1 
ATOM   1270 N NZ    . LYS A 1 166 ? -15.650 -2.755  -8.950  1.00 17.65  ? 351  LYS A NZ    1 
ATOM   1271 N N     . HIS A 1 167 ? -9.165  -5.604  -11.479 1.00 19.93  ? 352  HIS A N     1 
ATOM   1272 C CA    . HIS A 1 167 ? -8.984  -6.840  -12.224 1.00 21.31  ? 352  HIS A CA    1 
ATOM   1273 C C     . HIS A 1 167 ? -7.515  -7.102  -12.546 1.00 21.17  ? 352  HIS A C     1 
ATOM   1274 O O     . HIS A 1 167 ? -7.153  -8.148  -13.075 1.00 21.16  ? 352  HIS A O     1 
ATOM   1275 C CB    . HIS A 1 167 ? -9.827  -6.783  -13.494 1.00 21.96  ? 352  HIS A CB    1 
ATOM   1276 C CG    . HIS A 1 167 ? -11.251 -6.388  -13.246 1.00 23.47  ? 352  HIS A CG    1 
ATOM   1277 N ND1   . HIS A 1 167 ? -12.143 -7.209  -12.591 1.00 24.72  ? 352  HIS A ND1   1 
ATOM   1278 C CD2   . HIS A 1 167 ? -11.929 -5.253  -13.540 1.00 24.35  ? 352  HIS A CD2   1 
ATOM   1279 C CE1   . HIS A 1 167 ? -13.315 -6.604  -12.505 1.00 24.90  ? 352  HIS A CE1   1 
ATOM   1280 N NE2   . HIS A 1 167 ? -13.211 -5.415  -13.071 1.00 24.95  ? 352  HIS A NE2   1 
ATOM   1281 N N     . ARG B 1 7   ? -23.236 14.937  41.692  1.00 25.42  ? 192  ARG B N     1 
ATOM   1282 C CA    . ARG B 1 7   ? -23.973 14.924  40.397  1.00 24.86  ? 192  ARG B CA    1 
ATOM   1283 C C     . ARG B 1 7   ? -24.551 13.543  40.058  1.00 23.98  ? 192  ARG B C     1 
ATOM   1284 O O     . ARG B 1 7   ? -25.625 13.185  40.544  1.00 24.91  ? 192  ARG B O     1 
ATOM   1285 C CB    . ARG B 1 7   ? -23.077 15.435  39.290  1.00 25.48  ? 192  ARG B CB    1 
ATOM   1286 N N     . LYS B 1 8   ? -23.840 12.778  39.231  1.00 22.47  ? 193  LYS B N     1 
ATOM   1287 C CA    . LYS B 1 8   ? -24.218 11.402  38.909  1.00 21.13  ? 193  LYS B CA    1 
ATOM   1288 C C     . LYS B 1 8   ? -23.329 10.415  39.653  1.00 21.22  ? 193  LYS B C     1 
ATOM   1289 O O     . LYS B 1 8   ? -22.203 10.750  40.038  1.00 21.42  ? 193  LYS B O     1 
ATOM   1290 C CB    . LYS B 1 8   ? -24.107 11.150  37.405  1.00 20.37  ? 193  LYS B CB    1 
ATOM   1291 C CG    . LYS B 1 8   ? -25.172 11.848  36.594  1.00 18.29  ? 193  LYS B CG    1 
ATOM   1292 C CD    . LYS B 1 8   ? -24.832 11.766  35.143  1.00 14.08  ? 193  LYS B CD    1 
ATOM   1293 C CE    . LYS B 1 8   ? -25.810 12.562  34.300  1.00 13.03  ? 193  LYS B CE    1 
ATOM   1294 N NZ    . LYS B 1 8   ? -25.273 12.726  32.926  1.00 12.31  ? 193  LYS B NZ    1 
ATOM   1295 N N     . SER B 1 9   ? -23.833 9.197   39.840  1.00 21.01  ? 194  SER B N     1 
ATOM   1296 C CA    . SER B 1 9   ? -23.055 8.123   40.450  1.00 21.21  ? 194  SER B CA    1 
ATOM   1297 C C     . SER B 1 9   ? -22.038 7.594   39.450  1.00 21.23  ? 194  SER B C     1 
ATOM   1298 O O     . SER B 1 9   ? -22.211 7.759   38.242  1.00 21.04  ? 194  SER B O     1 
ATOM   1299 C CB    . SER B 1 9   ? -23.980 6.986   40.882  1.00 21.35  ? 194  SER B CB    1 
ATOM   1300 O OG    . SER B 1 9   ? -24.373 6.206   39.762  1.00 21.98  ? 194  SER B OG    1 
ATOM   1301 N N     . LYS B 1 10  ? -20.987 6.950   39.950  1.00 21.52  ? 195  LYS B N     1 
ATOM   1302 C CA    . LYS B 1 10  ? -20.002 6.294   39.088  1.00 22.02  ? 195  LYS B CA    1 
ATOM   1303 C C     . LYS B 1 10  ? -20.682 5.333   38.102  1.00 21.59  ? 195  LYS B C     1 
ATOM   1304 O O     . LYS B 1 10  ? -20.354 5.320   36.913  1.00 20.94  ? 195  LYS B O     1 
ATOM   1305 C CB    . LYS B 1 10  ? -18.958 5.546   39.932  1.00 22.17  ? 195  LYS B CB    1 
ATOM   1306 C CG    . LYS B 1 10  ? -17.875 4.872   39.106  1.00 22.94  ? 195  LYS B CG    1 
ATOM   1307 C CD    . LYS B 1 10  ? -16.862 4.136   39.962  1.00 23.27  ? 195  LYS B CD    1 
ATOM   1308 C CE    . LYS B 1 10  ? -15.861 3.414   39.071  1.00 25.40  ? 195  LYS B CE    1 
ATOM   1309 N NZ    . LYS B 1 10  ? -14.666 2.897   39.801  1.00 26.65  ? 195  LYS B NZ    1 
ATOM   1310 N N     . ALA B 1 11  ? -21.631 4.542   38.609  1.00 21.52  ? 196  ALA B N     1 
ATOM   1311 C CA    . ALA B 1 11  ? -22.370 3.564   37.804  1.00 21.60  ? 196  ALA B CA    1 
ATOM   1312 C C     . ALA B 1 11  ? -23.116 4.222   36.645  1.00 21.15  ? 196  ALA B C     1 
ATOM   1313 O O     . ALA B 1 11  ? -23.070 3.732   35.514  1.00 21.52  ? 196  ALA B O     1 
ATOM   1314 C CB    . ALA B 1 11  ? -23.335 2.773   38.680  1.00 22.05  ? 196  ALA B CB    1 
ATOM   1315 N N     . GLU B 1 12  ? -23.791 5.333   36.936  1.00 20.73  ? 197  GLU B N     1 
ATOM   1316 C CA    . GLU B 1 12  ? -24.503 6.094   35.914  1.00 20.23  ? 197  GLU B CA    1 
ATOM   1317 C C     . GLU B 1 12  ? -23.545 6.640   34.868  1.00 19.05  ? 197  GLU B C     1 
ATOM   1318 O O     . GLU B 1 12  ? -23.827 6.572   33.679  1.00 19.30  ? 197  GLU B O     1 
ATOM   1319 C CB    . GLU B 1 12  ? -25.294 7.239   36.545  1.00 20.26  ? 197  GLU B CB    1 
ATOM   1320 C CG    . GLU B 1 12  ? -26.515 6.788   37.329  1.00 21.49  ? 197  GLU B CG    1 
ATOM   1321 C CD    . GLU B 1 12  ? -27.204 7.926   38.051  1.00 21.93  ? 197  GLU B CD    1 
ATOM   1322 O OE1   . GLU B 1 12  ? -26.507 8.775   38.656  1.00 23.78  ? 197  GLU B OE1   1 
ATOM   1323 O OE2   . GLU B 1 12  ? -28.453 7.972   38.016  1.00 24.71  ? 197  GLU B OE2   1 
ATOM   1324 N N     . LEU B 1 13  ? -22.408 7.177   35.311  1.00 18.18  ? 198  LEU B N     1 
ATOM   1325 C CA    . LEU B 1 13  ? -21.414 7.740   34.400  1.00 17.06  ? 198  LEU B CA    1 
ATOM   1326 C C     . LEU B 1 13  ? -20.789 6.681   33.493  1.00 16.65  ? 198  LEU B C     1 
ATOM   1327 O O     . LEU B 1 13  ? -20.566 6.923   32.309  1.00 16.24  ? 198  LEU B O     1 
ATOM   1328 C CB    . LEU B 1 13  ? -20.320 8.500   35.162  1.00 16.93  ? 198  LEU B CB    1 
ATOM   1329 C CG    . LEU B 1 13  ? -20.768 9.777   35.878  1.00 17.25  ? 198  LEU B CG    1 
ATOM   1330 C CD1   . LEU B 1 13  ? -19.701 10.218  36.862  1.00 18.65  ? 198  LEU B CD1   1 
ATOM   1331 C CD2   . LEU B 1 13  ? -21.079 10.893  34.892  1.00 17.21  ? 198  LEU B CD2   1 
ATOM   1332 N N     . GLN B 1 14  ? -20.505 5.510   34.060  1.00 17.12  ? 199  GLN B N     1 
ATOM   1333 C CA    . GLN B 1 14  ? -19.940 4.416   33.280  1.00 17.43  ? 199  GLN B CA    1 
ATOM   1334 C C     . GLN B 1 14  ? -20.936 3.901   32.244  1.00 17.30  ? 199  GLN B C     1 
ATOM   1335 O O     . GLN B 1 14  ? -20.560 3.626   31.108  1.00 17.32  ? 199  GLN B O     1 
ATOM   1336 C CB    . GLN B 1 14  ? -19.495 3.279   34.194  1.00 18.02  ? 199  GLN B CB    1 
ATOM   1337 C CG    . GLN B 1 14  ? -18.246 3.598   34.989  1.00 19.70  ? 199  GLN B CG    1 
ATOM   1338 C CD    . GLN B 1 14  ? -17.841 2.462   35.901  1.00 22.42  ? 199  GLN B CD    1 
ATOM   1339 O OE1   . GLN B 1 14  ? -18.685 1.819   36.526  1.00 23.60  ? 199  GLN B OE1   1 
ATOM   1340 N NE2   . GLN B 1 14  ? -16.541 2.216   35.988  1.00 24.35  ? 199  GLN B NE2   1 
ATOM   1341 N N     . SER B 1 15  ? -22.202 3.800   32.642  1.00 17.18  ? 200  SER B N     1 
ATOM   1342 C CA    . SER B 1 15  ? -23.272 3.350   31.757  1.00 17.55  ? 200  SER B CA    1 
ATOM   1343 C C     . SER B 1 15  ? -23.471 4.296   30.566  1.00 16.74  ? 200  SER B C     1 
ATOM   1344 O O     . SER B 1 15  ? -23.566 3.858   29.424  1.00 16.99  ? 200  SER B O     1 
ATOM   1345 C CB    . SER B 1 15  ? -24.573 3.187   32.545  1.00 17.94  ? 200  SER B CB    1 
ATOM   1346 O OG    . SER B 1 15  ? -25.636 2.780   31.700  1.00 21.08  ? 200  SER B OG    1 
ATOM   1347 N N     . GLU B 1 16  ? -23.529 5.598   30.845  1.00 16.15  ? 201  GLU B N     1 
ATOM   1348 C CA    . GLU B 1 16  ? -23.682 6.603   29.803  1.00 15.10  ? 201  GLU B CA    1 
ATOM   1349 C C     . GLU B 1 16  ? -22.454 6.653   28.881  1.00 15.04  ? 201  GLU B C     1 
ATOM   1350 O O     . GLU B 1 16  ? -22.576 6.854   27.668  1.00 14.15  ? 201  GLU B O     1 
ATOM   1351 C CB    . GLU B 1 16  ? -23.995 7.967   30.438  1.00 14.77  ? 201  GLU B CB    1 
ATOM   1352 C CG    . GLU B 1 16  ? -25.335 7.973   31.204  1.00 14.76  ? 201  GLU B CG    1 
ATOM   1353 C CD    . GLU B 1 16  ? -25.700 9.317   31.840  1.00 14.55  ? 201  GLU B CD    1 
ATOM   1354 O OE1   . GLU B 1 16  ? -26.651 9.362   32.657  1.00 13.05  ? 201  GLU B OE1   1 
ATOM   1355 O OE2   . GLU B 1 16  ? -25.034 10.323  31.519  1.00 15.08  ? 201  GLU B OE2   1 
ATOM   1356 N N     . GLU B 1 17  ? -21.270 6.449   29.453  1.00 15.33  ? 202  GLU B N     1 
ATOM   1357 C CA    . GLU B 1 17  ? -20.052 6.353   28.653  1.00 16.31  ? 202  GLU B CA    1 
ATOM   1358 C C     . GLU B 1 17  ? -20.086 5.125   27.737  1.00 16.08  ? 202  GLU B C     1 
ATOM   1359 O O     . GLU B 1 17  ? -19.774 5.224   26.561  1.00 15.70  ? 202  GLU B O     1 
ATOM   1360 C CB    . GLU B 1 17  ? -18.809 6.321   29.550  1.00 17.10  ? 202  GLU B CB    1 
ATOM   1361 C CG    . GLU B 1 17  ? -17.499 6.063   28.808  1.00 18.83  ? 202  GLU B CG    1 
ATOM   1362 C CD    . GLU B 1 17  ? -17.033 7.224   27.954  1.00 21.87  ? 202  GLU B CD    1 
ATOM   1363 O OE1   . GLU B 1 17  ? -17.592 8.339   28.092  1.00 22.83  ? 202  GLU B OE1   1 
ATOM   1364 O OE2   . GLU B 1 17  ? -16.095 7.020   27.146  1.00 23.94  ? 202  GLU B OE2   1 
ATOM   1365 N N     . ARG B 1 18  ? -20.470 3.970   28.279  1.00 16.41  ? 203  ARG B N     1 
ATOM   1366 C CA    . ARG B 1 18  ? -20.529 2.756   27.462  1.00 16.46  ? 203  ARG B CA    1 
ATOM   1367 C C     . ARG B 1 18  ? -21.527 2.900   26.309  1.00 15.75  ? 203  ARG B C     1 
ATOM   1368 O O     . ARG B 1 18  ? -21.267 2.462   25.191  1.00 15.18  ? 203  ARG B O     1 
ATOM   1369 C CB    . ARG B 1 18  ? -20.876 1.542   28.318  1.00 16.97  ? 203  ARG B CB    1 
ATOM   1370 C CG    . ARG B 1 18  ? -20.603 0.233   27.598  1.00 19.29  ? 203  ARG B CG    1 
ATOM   1371 C CD    . ARG B 1 18  ? -20.799 -0.990  28.479  1.00 22.40  ? 203  ARG B CD    1 
ATOM   1372 N NE    . ARG B 1 18  ? -20.448 -2.193  27.727  1.00 25.54  ? 203  ARG B NE    1 
ATOM   1373 C CZ    . ARG B 1 18  ? -19.231 -2.721  27.662  1.00 27.18  ? 203  ARG B CZ    1 
ATOM   1374 N NH1   . ARG B 1 18  ? -18.219 -2.181  28.331  1.00 29.38  ? 203  ARG B NH1   1 
ATOM   1375 N NH2   . ARG B 1 18  ? -19.026 -3.808  26.927  1.00 28.91  ? 203  ARG B NH2   1 
ATOM   1376 N N     . LYS B 1 19  ? -22.664 3.533   26.574  1.00 15.17  ? 204  LYS B N     1 
ATOM   1377 C CA    . LYS B 1 19  ? -23.642 3.772   25.511  1.00 15.35  ? 204  LYS B CA    1 
ATOM   1378 C C     . LYS B 1 19  ? -23.094 4.651   24.382  1.00 14.59  ? 204  LYS B C     1 
ATOM   1379 O O     . LYS B 1 19  ? -23.390 4.422   23.212  1.00 14.11  ? 204  LYS B O     1 
ATOM   1380 C CB    . LYS B 1 19  ? -24.952 4.324   26.082  1.00 15.85  ? 204  LYS B CB    1 
ATOM   1381 C CG    . LYS B 1 19  ? -25.702 3.285   26.902  1.00 18.18  ? 204  LYS B CG    1 
ATOM   1382 C CD    . LYS B 1 19  ? -26.897 3.856   27.633  1.00 21.14  ? 204  LYS B CD    1 
ATOM   1383 C CE    . LYS B 1 19  ? -27.593 2.770   28.451  1.00 22.56  ? 204  LYS B CE    1 
ATOM   1384 N NZ    . LYS B 1 19  ? -28.695 3.315   29.283  1.00 24.91  ? 204  LYS B NZ    1 
ATOM   1385 N N     . ARG B 1 20  ? -22.281 5.647   24.725  1.00 13.72  ? 205  ARG B N     1 
ATOM   1386 C CA    . ARG B 1 20  ? -21.675 6.495   23.698  1.00 13.49  ? 205  ARG B CA    1 
ATOM   1387 C C     . ARG B 1 20  ? -20.740 5.667   22.813  1.00 13.43  ? 205  ARG B C     1 
ATOM   1388 O O     . ARG B 1 20  ? -20.707 5.843   21.591  1.00 13.39  ? 205  ARG B O     1 
ATOM   1389 C CB    . ARG B 1 20  ? -20.929 7.679   24.325  1.00 13.57  ? 205  ARG B CB    1 
ATOM   1390 C CG    . ARG B 1 20  ? -21.872 8.791   24.782  1.00 13.82  ? 205  ARG B CG    1 
ATOM   1391 C CD    . ARG B 1 20  ? -21.134 10.039  25.271  1.00 14.12  ? 205  ARG B CD    1 
ATOM   1392 N NE    . ARG B 1 20  ? -20.388 9.793   26.501  1.00 15.76  ? 205  ARG B NE    1 
ATOM   1393 C CZ    . ARG B 1 20  ? -20.839 10.032  27.737  1.00 14.85  ? 205  ARG B CZ    1 
ATOM   1394 N NH1   . ARG B 1 20  ? -22.051 10.536  27.949  1.00 15.95  ? 205  ARG B NH1   1 
ATOM   1395 N NH2   . ARG B 1 20  ? -20.059 9.759   28.774  1.00 15.80  ? 205  ARG B NH2   1 
ATOM   1396 N N     . ILE B 1 21  ? -19.992 4.766   23.443  1.00 13.56  ? 206  ILE B N     1 
ATOM   1397 C CA    . ILE B 1 21  ? -19.058 3.920   22.706  1.00 14.55  ? 206  ILE B CA    1 
ATOM   1398 C C     . ILE B 1 21  ? -19.829 2.940   21.812  1.00 14.30  ? 206  ILE B C     1 
ATOM   1399 O O     . ILE B 1 21  ? -19.514 2.793   20.629  1.00 14.59  ? 206  ILE B O     1 
ATOM   1400 C CB    . ILE B 1 21  ? -18.069 3.207   23.661  1.00 14.69  ? 206  ILE B CB    1 
ATOM   1401 C CG1   . ILE B 1 21  ? -17.276 4.256   24.461  1.00 16.42  ? 206  ILE B CG1   1 
ATOM   1402 C CG2   . ILE B 1 21  ? -17.118 2.305   22.875  1.00 15.38  ? 206  ILE B CG2   1 
ATOM   1403 C CD1   . ILE B 1 21  ? -16.423 3.692   25.591  1.00 17.13  ? 206  ILE B CD1   1 
ATOM   1404 N N     . ASP B 1 22  ? -20.867 2.309   22.364  1.00 14.28  ? 207  ASP B N     1 
ATOM   1405 C CA    . ASP B 1 22  ? -21.725 1.431   21.565  1.00 14.75  ? 207  ASP B CA    1 
ATOM   1406 C C     . ASP B 1 22  ? -22.252 2.157   20.328  1.00 14.71  ? 207  ASP B C     1 
ATOM   1407 O O     . ASP B 1 22  ? -22.315 1.580   19.248  1.00 14.90  ? 207  ASP B O     1 
ATOM   1408 C CB    . ASP B 1 22  ? -22.936 0.937   22.371  1.00 15.00  ? 207  ASP B CB    1 
ATOM   1409 C CG    . ASP B 1 22  ? -22.569 -0.043  23.476  1.00 16.84  ? 207  ASP B CG    1 
ATOM   1410 O OD1   . ASP B 1 22  ? -21.426 -0.536  23.521  1.00 18.51  ? 207  ASP B OD1   1 
ATOM   1411 O OD2   . ASP B 1 22  ? -23.463 -0.314  24.314  1.00 20.18  ? 207  ASP B OD2   1 
ATOM   1412 N N     . GLU B 1 23  ? -22.670 3.413   20.490  1.00 14.94  ? 208  GLU B N     1 
ATOM   1413 C CA    . GLU B 1 23  ? -23.228 4.167   19.363  1.00 15.89  ? 208  GLU B CA    1 
ATOM   1414 C C     . GLU B 1 23  ? -22.201 4.488   18.274  1.00 15.89  ? 208  GLU B C     1 
ATOM   1415 O O     . GLU B 1 23  ? -22.528 4.456   17.082  1.00 16.40  ? 208  GLU B O     1 
ATOM   1416 C CB    . GLU B 1 23  ? -23.928 5.445   19.830  1.00 16.31  ? 208  GLU B CB    1 
ATOM   1417 C CG    . GLU B 1 23  ? -24.497 6.291   18.693  1.00 19.82  ? 208  GLU B CG    1 
ATOM   1418 C CD    . GLU B 1 23  ? -25.547 5.554   17.856  1.00 24.05  ? 208  GLU B CD    1 
ATOM   1419 O OE1   . GLU B 1 23  ? -26.350 4.780   18.430  1.00 25.82  ? 208  GLU B OE1   1 
ATOM   1420 O OE2   . GLU B 1 23  ? -25.569 5.759   16.620  1.00 26.42  ? 208  GLU B OE2   1 
ATOM   1421 N N     . LEU B 1 24  ? -20.978 4.819   18.692  1.00 15.70  ? 209  LEU B N     1 
ATOM   1422 C CA    . LEU B 1 24  ? -19.877 5.051   17.761  1.00 16.23  ? 209  LEU B CA    1 
ATOM   1423 C C     . LEU B 1 24  ? -19.553 3.780   16.981  1.00 16.17  ? 209  LEU B C     1 
ATOM   1424 O O     . LEU B 1 24  ? -19.319 3.833   15.784  1.00 16.10  ? 209  LEU B O     1 
ATOM   1425 C CB    . LEU B 1 24  ? -18.643 5.558   18.501  1.00 16.78  ? 209  LEU B CB    1 
ATOM   1426 C CG    . LEU B 1 24  ? -18.739 6.999   19.031  1.00 17.30  ? 209  LEU B CG    1 
ATOM   1427 C CD1   . LEU B 1 24  ? -17.659 7.290   20.045  1.00 18.30  ? 209  LEU B CD1   1 
ATOM   1428 C CD2   . LEU B 1 24  ? -18.710 8.008   17.890  1.00 19.82  ? 209  LEU B CD2   1 
ATOM   1429 N N     . ILE B 1 25  ? -19.549 2.635   17.663  1.00 16.12  ? 210  ILE B N     1 
ATOM   1430 C CA    . ILE B 1 25  ? -19.310 1.354   16.989  1.00 16.34  ? 210  ILE B CA    1 
ATOM   1431 C C     . ILE B 1 25  ? -20.408 1.062   15.964  1.00 17.09  ? 210  ILE B C     1 
ATOM   1432 O O     . ILE B 1 25  ? -20.129 0.739   14.806  1.00 17.04  ? 210  ILE B O     1 
ATOM   1433 C CB    . ILE B 1 25  ? -19.157 0.202   18.018  1.00 16.05  ? 210  ILE B CB    1 
ATOM   1434 C CG1   . ILE B 1 25  ? -17.837 0.382   18.783  1.00 15.15  ? 210  ILE B CG1   1 
ATOM   1435 C CG2   . ILE B 1 25  ? -19.212 -1.166  17.335  1.00 16.87  ? 210  ILE B CG2   1 
ATOM   1436 C CD1   . ILE B 1 25  ? -17.737 -0.386  20.109  1.00 15.36  ? 210  ILE B CD1   1 
ATOM   1437 N N     . GLU B 1 26  ? -21.661 1.219   16.378  1.00 18.02  ? 211  GLU B N     1 
ATOM   1438 C CA    . GLU B 1 26  ? -22.786 0.902   15.503  1.00 18.82  ? 211  GLU B CA    1 
ATOM   1439 C C     . GLU B 1 26  ? -22.889 1.839   14.306  1.00 18.50  ? 211  GLU B C     1 
ATOM   1440 O O     . GLU B 1 26  ? -23.217 1.405   13.204  1.00 18.56  ? 211  GLU B O     1 
ATOM   1441 C CB    . GLU B 1 26  ? -24.099 0.885   16.290  1.00 19.06  ? 211  GLU B CB    1 
ATOM   1442 C CG    . GLU B 1 26  ? -24.070 -0.123  17.432  1.00 22.53  ? 211  GLU B CG    1 
ATOM   1443 C CD    . GLU B 1 26  ? -25.418 -0.716  17.774  1.00 25.96  ? 211  GLU B CD    1 
ATOM   1444 O OE1   . GLU B 1 26  ? -26.454 -0.237  17.258  1.00 27.32  ? 211  GLU B OE1   1 
ATOM   1445 O OE2   . GLU B 1 26  ? -25.430 -1.680  18.571  1.00 28.18  ? 211  GLU B OE2   1 
ATOM   1446 N N     . SER B 1 27  ? -22.592 3.117   14.513  1.00 18.08  ? 212  SER B N     1 
ATOM   1447 C CA    . SER B 1 27  ? -22.716 4.085   13.424  1.00 18.15  ? 212  SER B CA    1 
ATOM   1448 C C     . SER B 1 27  ? -21.541 4.017   12.450  1.00 17.89  ? 212  SER B C     1 
ATOM   1449 O O     . SER B 1 27  ? -21.676 4.376   11.282  1.00 18.05  ? 212  SER B O     1 
ATOM   1450 C CB    . SER B 1 27  ? -22.857 5.501   13.975  1.00 18.38  ? 212  SER B CB    1 
ATOM   1451 O OG    . SER B 1 27  ? -21.634 5.957   14.513  1.00 19.47  ? 212  SER B OG    1 
ATOM   1452 N N     . GLY B 1 28  ? -20.385 3.568   12.937  1.00 17.11  ? 213  GLY B N     1 
ATOM   1453 C CA    . GLY B 1 28  ? -19.185 3.528   12.107  1.00 17.09  ? 213  GLY B CA    1 
ATOM   1454 C C     . GLY B 1 28  ? -18.622 4.910   11.833  1.00 16.85  ? 213  GLY B C     1 
ATOM   1455 O O     . GLY B 1 28  ? -17.807 5.089   10.930  1.00 16.85  ? 213  GLY B O     1 
ATOM   1456 N N     . LYS B 1 29  ? -19.063 5.895   12.610  1.00 17.04  ? 214  LYS B N     1 
ATOM   1457 C CA    . LYS B 1 29  ? -18.535 7.242   12.504  1.00 16.88  ? 214  LYS B CA    1 
ATOM   1458 C C     . LYS B 1 29  ? -17.065 7.256   12.925  1.00 16.19  ? 214  LYS B C     1 
ATOM   1459 O O     . LYS B 1 29  ? -16.721 6.820   14.027  1.00 16.48  ? 214  LYS B O     1 
ATOM   1460 C CB    . LYS B 1 29  ? -19.342 8.197   13.384  1.00 17.97  ? 214  LYS B CB    1 
ATOM   1461 C CG    . LYS B 1 29  ? -18.938 9.658   13.225  1.00 19.81  ? 214  LYS B CG    1 
ATOM   1462 C CD    . LYS B 1 29  ? -20.006 10.622  13.765  1.00 23.71  ? 214  LYS B CD    1 
ATOM   1463 C CE    . LYS B 1 29  ? -19.889 10.813  15.268  1.00 25.66  ? 214  LYS B CE    1 
ATOM   1464 N NZ    . LYS B 1 29  ? -20.824 11.882  15.748  1.00 27.60  ? 214  LYS B NZ    1 
ATOM   1465 N N     . GLU B 1 30  ? -16.218 7.769   12.038  1.00 14.83  ? 215  GLU B N     1 
ATOM   1466 C CA    . GLU B 1 30  ? -14.767 7.780   12.237  1.00 14.17  ? 215  GLU B CA    1 
ATOM   1467 C C     . GLU B 1 30  ? -14.203 9.185   12.054  1.00 14.80  ? 215  GLU B C     1 
ATOM   1468 O O     . GLU B 1 30  ? -13.494 9.475   11.096  1.00 15.75  ? 215  GLU B O     1 
ATOM   1469 C CB    . GLU B 1 30  ? -14.083 6.751   11.311  1.00 13.90  ? 215  GLU B CB    1 
ATOM   1470 C CG    . GLU B 1 30  ? -14.532 5.327   11.596  1.00 13.11  ? 215  GLU B CG    1 
ATOM   1471 C CD    . GLU B 1 30  ? -13.757 4.250   10.859  1.00 13.44  ? 215  GLU B CD    1 
ATOM   1472 O OE1   . GLU B 1 30  ? -13.002 4.572   9.915   1.00 12.98  ? 215  GLU B OE1   1 
ATOM   1473 O OE2   . GLU B 1 30  ? -13.912 3.067   11.245  1.00 13.02  ? 215  GLU B OE2   1 
ATOM   1474 N N     . GLU B 1 31  ? -14.524 10.050  13.007  1.00 14.92  ? 216  GLU B N     1 
ATOM   1475 C CA    . GLU B 1 31  ? -14.163 11.456  12.942  1.00 16.16  ? 216  GLU B CA    1 
ATOM   1476 C C     . GLU B 1 31  ? -12.791 11.706  13.548  1.00 15.00  ? 216  GLU B C     1 
ATOM   1477 O O     . GLU B 1 31  ? -12.293 10.907  14.341  1.00 15.20  ? 216  GLU B O     1 
ATOM   1478 C CB    . GLU B 1 31  ? -15.205 12.295  13.686  1.00 16.83  ? 216  GLU B CB    1 
ATOM   1479 C CG    . GLU B 1 31  ? -16.524 12.431  12.960  1.00 19.31  ? 216  GLU B CG    1 
ATOM   1480 C CD    . GLU B 1 31  ? -17.538 13.259  13.745  1.00 19.65  ? 216  GLU B CD    1 
ATOM   1481 O OE1   . GLU B 1 31  ? -17.531 13.201  14.999  1.00 23.90  ? 216  GLU B OE1   1 
ATOM   1482 O OE2   . GLU B 1 31  ? -18.345 13.962  13.104  1.00 24.70  ? 216  GLU B OE2   1 
ATOM   1483 N N     . GLY B 1 32  ? -12.189 12.822  13.156  1.00 13.91  ? 217  GLY B N     1 
ATOM   1484 C CA    . GLY B 1 32  ? -10.949 13.293  13.752  1.00 12.67  ? 217  GLY B CA    1 
ATOM   1485 C C     . GLY B 1 32  ? -9.700  12.641  13.205  1.00 13.05  ? 217  GLY B C     1 
ATOM   1486 O O     . GLY B 1 32  ? -8.650  12.707  13.846  1.00 13.11  ? 217  GLY B O     1 
ATOM   1487 N N     . MET B 1 33  ? -9.810  12.037  12.012  1.00 12.63  ? 218  MET B N     1 
ATOM   1488 C CA    . MET B 1 33  ? -8.708  11.281  11.426  1.00 12.48  ? 218  MET B CA    1 
ATOM   1489 C C     . MET B 1 33  ? -8.585  11.522  9.925   1.00 12.45  ? 218  MET B C     1 
ATOM   1490 O O     . MET B 1 33  ? -9.593  11.697  9.242   1.00 12.62  ? 218  MET B O     1 
ATOM   1491 C CB    . MET B 1 33  ? -8.939  9.788   11.649  1.00 12.77  ? 218  MET B CB    1 
ATOM   1492 C CG    . MET B 1 33  ? -8.823  9.366   13.106  1.00 13.31  ? 218  MET B CG    1 
ATOM   1493 S SD    . MET B 1 33  ? -9.241  7.630   13.342  1.00 13.84  ? 218  MET B SD    1 
ATOM   1494 C CE    . MET B 1 33  ? -11.030 7.698   13.185  1.00 16.15  ? 218  MET B CE    1 
ATOM   1495 N N     . LYS B 1 34  ? -7.357  11.504  9.410   1.00 11.97  ? 219  LYS B N     1 
ATOM   1496 C CA    . LYS B 1 34  ? -7.162  11.533  7.945   1.00 12.65  ? 219  LYS B CA    1 
ATOM   1497 C C     . LYS B 1 34  ? -6.066  10.554  7.542   1.00 11.94  ? 219  LYS B C     1 
ATOM   1498 O O     . LYS B 1 34  ? -5.194  10.240  8.346   1.00 11.82  ? 219  LYS B O     1 
ATOM   1499 C CB    . LYS B 1 34  ? -6.831  12.958  7.456   1.00 12.71  ? 219  LYS B CB    1 
ATOM   1500 C CG    . LYS B 1 34  ? -5.452  13.465  7.851   1.00 14.90  ? 219  LYS B CG    1 
ATOM   1501 C CD    . LYS B 1 34  ? -5.271  14.920  7.416   1.00 15.64  ? 219  LYS B CD    1 
ATOM   1502 C CE    . LYS B 1 34  ? -3.879  15.461  7.757   1.00 19.79  ? 219  LYS B CE    1 
ATOM   1503 N NZ    . LYS B 1 34  ? -3.706  16.910  7.373   1.00 22.87  ? 219  LYS B NZ    1 
ATOM   1504 N N     . ILE B 1 35  ? -6.130  10.063  6.309   1.00 11.56  ? 220  ILE B N     1 
ATOM   1505 C CA    . ILE B 1 35  ? -5.085  9.214   5.762   1.00 12.24  ? 220  ILE B CA    1 
ATOM   1506 C C     . ILE B 1 35  ? -3.958  10.078  5.224   1.00 12.48  ? 220  ILE B C     1 
ATOM   1507 O O     . ILE B 1 35  ? -4.191  11.107  4.582   1.00 13.88  ? 220  ILE B O     1 
ATOM   1508 C CB    . ILE B 1 35  ? -5.615  8.327   4.611   1.00 11.96  ? 220  ILE B CB    1 
ATOM   1509 C CG1   . ILE B 1 35  ? -6.774  7.449   5.091   1.00 12.31  ? 220  ILE B CG1   1 
ATOM   1510 C CG2   . ILE B 1 35  ? -4.495  7.454   4.046   1.00 12.53  ? 220  ILE B CG2   1 
ATOM   1511 C CD1   . ILE B 1 35  ? -7.554  6.776   3.975   1.00 13.27  ? 220  ILE B CD1   1 
ATOM   1512 N N     . ASP B 1 36  ? -2.723  9.664   5.484   1.00 12.40  ? 221  ASP B N     1 
ATOM   1513 C CA    . ASP B 1 36  ? -1.558  10.352  4.930   1.00 13.16  ? 221  ASP B CA    1 
ATOM   1514 C C     . ASP B 1 36  ? -0.505  9.305   4.561   1.00 12.31  ? 221  ASP B C     1 
ATOM   1515 O O     . ASP B 1 36  ? -0.527  8.179   5.077   1.00 12.94  ? 221  ASP B O     1 
ATOM   1516 C CB    . ASP B 1 36  ? -1.010  11.338  5.974   1.00 14.45  ? 221  ASP B CB    1 
ATOM   1517 C CG    . ASP B 1 36  ? -0.082  12.383  5.386   1.00 17.46  ? 221  ASP B CG    1 
ATOM   1518 O OD1   . ASP B 1 36  ? -0.054  12.584  4.148   1.00 19.71  ? 221  ASP B OD1   1 
ATOM   1519 O OD2   . ASP B 1 36  ? 0.625   13.022  6.195   1.00 21.24  ? 221  ASP B OD2   1 
ATOM   1520 N N     . LEU B 1 37  ? 0.413   9.658   3.670   1.00 12.05  ? 222  LEU B N     1 
ATOM   1521 C CA    . LEU B 1 37  ? 1.597   8.824   3.449   1.00 11.96  ? 222  LEU B CA    1 
ATOM   1522 C C     . LEU B 1 37  ? 2.589   9.109   4.562   1.00 11.99  ? 222  LEU B C     1 
ATOM   1523 O O     . LEU B 1 37  ? 2.875   10.272  4.861   1.00 12.68  ? 222  LEU B O     1 
ATOM   1524 C CB    . LEU B 1 37  ? 2.225   9.122   2.088   1.00 12.64  ? 222  LEU B CB    1 
ATOM   1525 C CG    . LEU B 1 37  ? 1.373   8.710   0.886   1.00 12.93  ? 222  LEU B CG    1 
ATOM   1526 C CD1   . LEU B 1 37  ? 2.138   8.946   -0.408  1.00 14.71  ? 222  LEU B CD1   1 
ATOM   1527 C CD2   . LEU B 1 37  ? 0.939   7.234   0.992   1.00 15.56  ? 222  LEU B CD2   1 
ATOM   1528 N N     . ILE B 1 38  ? 3.082   8.048   5.196   1.00 11.39  ? 223  ILE B N     1 
ATOM   1529 C CA    . ILE B 1 38  ? 4.029   8.157   6.299   1.00 11.55  ? 223  ILE B CA    1 
ATOM   1530 C C     . ILE B 1 38  ? 5.377   7.539   5.890   1.00 11.26  ? 223  ILE B C     1 
ATOM   1531 O O     . ILE B 1 38  ? 5.437   6.388   5.417   1.00 10.45  ? 223  ILE B O     1 
ATOM   1532 C CB    . ILE B 1 38  ? 3.519   7.431   7.572   1.00 11.85  ? 223  ILE B CB    1 
ATOM   1533 C CG1   . ILE B 1 38  ? 2.086   7.862   7.936   1.00 13.68  ? 223  ILE B CG1   1 
ATOM   1534 C CG2   . ILE B 1 38  ? 4.494   7.667   8.717   1.00 13.15  ? 223  ILE B CG2   1 
ATOM   1535 C CD1   . ILE B 1 38  ? 1.952   9.320   8.362   1.00 14.90  ? 223  ILE B CD1   1 
ATOM   1536 N N     . ASP B 1 39  ? 6.450   8.305   6.072   1.00 11.18  ? 224  ASP B N     1 
ATOM   1537 C CA    . ASP B 1 39  ? 7.777   7.878   5.641   1.00 10.70  ? 224  ASP B CA    1 
ATOM   1538 C C     . ASP B 1 39  ? 8.127   6.484   6.185   1.00 10.54  ? 224  ASP B C     1 
ATOM   1539 O O     . ASP B 1 39  ? 8.158   6.259   7.412   1.00 10.96  ? 224  ASP B O     1 
ATOM   1540 C CB    . ASP B 1 39  ? 8.816   8.918   6.078   1.00 10.65  ? 224  ASP B CB    1 
ATOM   1541 C CG    . ASP B 1 39  ? 10.078  8.889   5.236   1.00 12.17  ? 224  ASP B CG    1 
ATOM   1542 O OD1   . ASP B 1 39  ? 10.087  8.303   4.132   1.00 13.23  ? 224  ASP B OD1   1 
ATOM   1543 O OD2   . ASP B 1 39  ? 11.075  9.498   5.681   1.00 14.90  ? 224  ASP B OD2   1 
ATOM   1544 N N     . GLY B 1 40  ? 8.366   5.550   5.257   1.00 10.21  ? 225  GLY B N     1 
ATOM   1545 C CA    . GLY B 1 40  ? 8.811   4.206   5.581   1.00 10.79  ? 225  GLY B CA    1 
ATOM   1546 C C     . GLY B 1 40  ? 7.701   3.261   5.983   1.00 10.66  ? 225  GLY B C     1 
ATOM   1547 O O     . GLY B 1 40  ? 7.979   2.095   6.257   1.00 11.79  ? 225  GLY B O     1 
ATOM   1548 N N     . LYS B 1 41  ? 6.453   3.737   6.025   1.00 9.95   ? 226  LYS B N     1 
ATOM   1549 C CA    . LYS B 1 41  ? 5.378   2.913   6.582   1.00 10.39  ? 226  LYS B CA    1 
ATOM   1550 C C     . LYS B 1 41  ? 4.230   2.638   5.618   1.00 10.32  ? 226  LYS B C     1 
ATOM   1551 O O     . LYS B 1 41  ? 3.359   1.840   5.939   1.00 11.52  ? 226  LYS B O     1 
ATOM   1552 C CB    . LYS B 1 41  ? 4.805   3.551   7.849   1.00 10.23  ? 226  LYS B CB    1 
ATOM   1553 C CG    . LYS B 1 41  ? 5.841   3.888   8.917   1.00 10.54  ? 226  LYS B CG    1 
ATOM   1554 C CD    . LYS B 1 41  ? 5.162   4.308   10.214  1.00 11.94  ? 226  LYS B CD    1 
ATOM   1555 C CE    . LYS B 1 41  ? 6.126   5.092   11.110  1.00 13.50  ? 226  LYS B CE    1 
ATOM   1556 N NZ    . LYS B 1 41  ? 5.457   5.715   12.276  1.00 14.16  ? 226  LYS B NZ    1 
ATOM   1557 N N     . GLY B 1 42  ? 4.236   3.258   4.439   1.00 9.69   ? 227  GLY B N     1 
ATOM   1558 C CA    . GLY B 1 42  ? 3.080   3.175   3.534   1.00 9.62   ? 227  GLY B CA    1 
ATOM   1559 C C     . GLY B 1 42  ? 2.082   4.246   3.904   1.00 10.15  ? 227  GLY B C     1 
ATOM   1560 O O     . GLY B 1 42  ? 2.473   5.392   4.140   1.00 10.79  ? 227  GLY B O     1 
ATOM   1561 N N     . ARG B 1 43  ? 0.796   3.899   3.938   1.00 9.78   ? 228  ARG B N     1 
ATOM   1562 C CA    . ARG B 1 43  ? -0.206  4.833   4.434   1.00 9.99   ? 228  ARG B CA    1 
ATOM   1563 C C     . ARG B 1 43  ? -0.260  4.745   5.953   1.00 9.97   ? 228  ARG B C     1 
ATOM   1564 O O     . ARG B 1 43  ? 0.109   3.724   6.539   1.00 10.36  ? 228  ARG B O     1 
ATOM   1565 C CB    . ARG B 1 43  ? -1.586  4.480   3.894   1.00 10.49  ? 228  ARG B CB    1 
ATOM   1566 C CG    . ARG B 1 43  ? -1.675  4.508   2.367   1.00 11.16  ? 228  ARG B CG    1 
ATOM   1567 C CD    . ARG B 1 43  ? -2.946  3.791   1.904   1.00 11.61  ? 228  ARG B CD    1 
ATOM   1568 N NE    . ARG B 1 43  ? -2.863  2.351   2.153   1.00 12.56  ? 228  ARG B NE    1 
ATOM   1569 C CZ    . ARG B 1 43  ? -3.823  1.487   1.831   1.00 12.25  ? 228  ARG B CZ    1 
ATOM   1570 N NH1   . ARG B 1 43  ? -4.963  1.919   1.284   1.00 13.04  ? 228  ARG B NH1   1 
ATOM   1571 N NH2   . ARG B 1 43  ? -3.648  0.198   2.065   1.00 12.53  ? 228  ARG B NH2   1 
ATOM   1572 N N     . GLY B 1 44  ? -0.744  5.816   6.575   1.00 9.96   ? 229  GLY B N     1 
ATOM   1573 C CA    . GLY B 1 44  ? -1.044  5.798   8.000   1.00 10.19  ? 229  GLY B CA    1 
ATOM   1574 C C     . GLY B 1 44  ? -2.169  6.762   8.286   1.00 10.11  ? 229  GLY B C     1 
ATOM   1575 O O     . GLY B 1 44  ? -2.721  7.367   7.365   1.00 10.73  ? 229  GLY B O     1 
ATOM   1576 N N     . VAL B 1 45  ? -2.522  6.889   9.563   1.00 9.43   ? 230  VAL B N     1 
ATOM   1577 C CA    . VAL B 1 45  ? -3.656  7.729   9.942   1.00 9.55   ? 230  VAL B CA    1 
ATOM   1578 C C     . VAL B 1 45  ? -3.173  8.805   10.920  1.00 10.06  ? 230  VAL B C     1 
ATOM   1579 O O     . VAL B 1 45  ? -2.503  8.500   11.914  1.00 9.97   ? 230  VAL B O     1 
ATOM   1580 C CB    . VAL B 1 45  ? -4.799  6.886   10.550  1.00 9.75   ? 230  VAL B CB    1 
ATOM   1581 C CG1   . VAL B 1 45  ? -6.030  7.748   10.841  1.00 11.71  ? 230  VAL B CG1   1 
ATOM   1582 C CG2   . VAL B 1 45  ? -5.203  5.748   9.603   1.00 10.31  ? 230  VAL B CG2   1 
ATOM   1583 N N     . ILE B 1 46  ? -3.534  10.055  10.630  1.00 10.87  ? 231  ILE B N     1 
ATOM   1584 C CA    . ILE B 1 46  ? -3.129  11.231  11.421  1.00 11.80  ? 231  ILE B CA    1 
ATOM   1585 C C     . ILE B 1 46  ? -4.348  11.779  12.130  1.00 11.86  ? 231  ILE B C     1 
ATOM   1586 O O     . ILE B 1 46  ? -5.437  11.836  11.549  1.00 12.31  ? 231  ILE B O     1 
ATOM   1587 C CB    . ILE B 1 46  ? -2.564  12.354  10.488  1.00 12.54  ? 231  ILE B CB    1 
ATOM   1588 C CG1   . ILE B 1 46  ? -1.372  11.841  9.674   1.00 14.93  ? 231  ILE B CG1   1 
ATOM   1589 C CG2   . ILE B 1 46  ? -2.235  13.659  11.245  1.00 14.47  ? 231  ILE B CG2   1 
ATOM   1590 C CD1   . ILE B 1 46  ? -0.150  11.544  10.470  1.00 17.48  ? 231  ILE B CD1   1 
ATOM   1591 N N     . ALA B 1 47  ? -4.162  12.199  13.379  1.00 10.83  ? 232  ALA B N     1 
ATOM   1592 C CA    . ALA B 1 47  ? -5.243  12.841  14.116  1.00 11.81  ? 232  ALA B CA    1 
ATOM   1593 C C     . ALA B 1 47  ? -5.451  14.241  13.555  1.00 12.52  ? 232  ALA B C     1 
ATOM   1594 O O     . ALA B 1 47  ? -4.486  14.968  13.299  1.00 12.50  ? 232  ALA B O     1 
ATOM   1595 C CB    . ALA B 1 47  ? -4.900  12.904  15.616  1.00 11.88  ? 232  ALA B CB    1 
ATOM   1596 N N     . THR B 1 48  ? -6.709  14.616  13.357  1.00 12.48  ? 233  THR B N     1 
ATOM   1597 C CA    . THR B 1 48  ? -7.016  15.971  12.908  1.00 13.28  ? 233  THR B CA    1 
ATOM   1598 C C     . THR B 1 48  ? -7.617  16.815  14.039  1.00 13.73  ? 233  THR B C     1 
ATOM   1599 O O     . THR B 1 48  ? -7.977  17.982  13.841  1.00 14.73  ? 233  THR B O     1 
ATOM   1600 C CB    . THR B 1 48  ? -8.000  15.973  11.715  1.00 13.34  ? 233  THR B CB    1 
ATOM   1601 O OG1   . THR B 1 48  ? -9.224  15.350  12.111  1.00 15.06  ? 233  THR B OG1   1 
ATOM   1602 C CG2   . THR B 1 48  ? -7.401  15.254  10.503  1.00 14.40  ? 233  THR B CG2   1 
ATOM   1603 N N     . LYS B 1 49  ? -7.723  16.219  15.224  1.00 14.19  ? 234  LYS B N     1 
ATOM   1604 C CA    . LYS B 1 49  ? -8.178  16.908  16.430  1.00 14.75  ? 234  LYS B CA    1 
ATOM   1605 C C     . LYS B 1 49  ? -7.484  16.255  17.611  1.00 14.18  ? 234  LYS B C     1 
ATOM   1606 O O     . LYS B 1 49  ? -6.895  15.182  17.462  1.00 13.08  ? 234  LYS B O     1 
ATOM   1607 C CB    . LYS B 1 49  ? -9.693  16.749  16.599  1.00 15.15  ? 234  LYS B CB    1 
ATOM   1608 C CG    . LYS B 1 49  ? -10.117 15.339  16.961  1.00 16.30  ? 234  LYS B CG    1 
ATOM   1609 C CD    . LYS B 1 49  ? -11.629 15.168  17.017  1.00 16.92  ? 234  LYS B CD    1 
ATOM   1610 C CE    . LYS B 1 49  ? -11.990 13.848  17.663  1.00 20.23  ? 234  LYS B CE    1 
ATOM   1611 N NZ    . LYS B 1 49  ? -11.650 13.828  19.119  1.00 22.23  ? 234  LYS B NZ    1 
ATOM   1612 N N     . GLN B 1 50  ? -7.570  16.889  18.777  1.00 13.72  ? 235  GLN B N     1 
ATOM   1613 C CA    . GLN B 1 50  ? -7.060  16.292  20.011  1.00 14.09  ? 235  GLN B CA    1 
ATOM   1614 C C     . GLN B 1 50  ? -7.947  15.119  20.449  1.00 13.46  ? 235  GLN B C     1 
ATOM   1615 O O     . GLN B 1 50  ? -9.176  15.170  20.323  1.00 14.01  ? 235  GLN B O     1 
ATOM   1616 C CB    . GLN B 1 50  ? -6.972  17.356  21.121  1.00 13.96  ? 235  GLN B CB    1 
ATOM   1617 C CG    . GLN B 1 50  ? -6.118  16.923  22.309  1.00 17.06  ? 235  GLN B CG    1 
ATOM   1618 C CD    . GLN B 1 50  ? -5.983  17.971  23.412  1.00 16.41  ? 235  GLN B CD    1 
ATOM   1619 O OE1   . GLN B 1 50  ? -5.488  19.087  23.178  1.00 17.99  ? 235  GLN B OE1   1 
ATOM   1620 N NE2   . GLN B 1 50  ? -6.401  17.605  24.631  1.00 19.27  ? 235  GLN B NE2   1 
ATOM   1621 N N     . PHE B 1 51  ? -7.319  14.057  20.952  1.00 12.90  ? 236  PHE B N     1 
ATOM   1622 C CA    . PHE B 1 51  ? -8.023  13.004  21.675  1.00 12.95  ? 236  PHE B CA    1 
ATOM   1623 C C     . PHE B 1 51  ? -7.508  13.018  23.107  1.00 12.94  ? 236  PHE B C     1 
ATOM   1624 O O     . PHE B 1 51  ? -6.315  13.219  23.334  1.00 13.82  ? 236  PHE B O     1 
ATOM   1625 C CB    . PHE B 1 51  ? -7.774  11.626  21.047  1.00 12.11  ? 236  PHE B CB    1 
ATOM   1626 C CG    . PHE B 1 51  ? -8.393  11.453  19.683  1.00 11.71  ? 236  PHE B CG    1 
ATOM   1627 C CD1   . PHE B 1 51  ? -9.606  10.775  19.539  1.00 12.25  ? 236  PHE B CD1   1 
ATOM   1628 C CD2   . PHE B 1 51  ? -7.756  11.948  18.548  1.00 11.78  ? 236  PHE B CD2   1 
ATOM   1629 C CE1   . PHE B 1 51  ? -10.193 10.595  18.271  1.00 12.19  ? 236  PHE B CE1   1 
ATOM   1630 C CE2   . PHE B 1 51  ? -8.344  11.769  17.267  1.00 12.96  ? 236  PHE B CE2   1 
ATOM   1631 C CZ    . PHE B 1 51  ? -9.568  11.093  17.145  1.00 12.22  ? 236  PHE B CZ    1 
ATOM   1632 N N     . SER B 1 52  ? -8.395  12.851  24.078  1.00 12.76  ? 237  SER B N     1 
ATOM   1633 C CA    . SER B 1 52  ? -7.970  12.751  25.475  1.00 13.31  ? 237  SER B CA    1 
ATOM   1634 C C     . SER B 1 52  ? -7.712  11.289  25.819  1.00 12.49  ? 237  SER B C     1 
ATOM   1635 O O     . SER B 1 52  ? -8.328  10.387  25.236  1.00 12.77  ? 237  SER B O     1 
ATOM   1636 C CB    . SER B 1 52  ? -9.015  13.343  26.419  1.00 13.70  ? 237  SER B CB    1 
ATOM   1637 O OG    . SER B 1 52  ? -9.196  14.725  26.148  1.00 16.60  ? 237  SER B OG    1 
ATOM   1638 N N     . ARG B 1 53  ? -6.825  11.052  26.784  1.00 12.03  ? 238  ARG B N     1 
ATOM   1639 C CA    . ARG B 1 53  ? -6.546  9.701   27.250  1.00 12.15  ? 238  ARG B CA    1 
ATOM   1640 C C     . ARG B 1 53  ? -7.863  9.013   27.585  1.00 11.53  ? 238  ARG B C     1 
ATOM   1641 O O     . ARG B 1 53  ? -8.734  9.591   28.256  1.00 12.53  ? 238  ARG B O     1 
ATOM   1642 C CB    . ARG B 1 53  ? -5.650  9.724   28.492  1.00 12.90  ? 238  ARG B CB    1 
ATOM   1643 C CG    . ARG B 1 53  ? -5.163  8.353   28.915  1.00 16.18  ? 238  ARG B CG    1 
ATOM   1644 C CD    . ARG B 1 53  ? -4.921  8.303   30.419  1.00 21.08  ? 238  ARG B CD    1 
ATOM   1645 N NE    . ARG B 1 53  ? -4.958  6.943   30.967  1.00 27.29  ? 238  ARG B NE    1 
ATOM   1646 C CZ    . ARG B 1 53  ? -6.062  6.205   31.110  1.00 30.14  ? 238  ARG B CZ    1 
ATOM   1647 N NH1   . ARG B 1 53  ? -7.253  6.676   30.737  1.00 31.18  ? 238  ARG B NH1   1 
ATOM   1648 N NH2   . ARG B 1 53  ? -5.976  4.980   31.622  1.00 31.56  ? 238  ARG B NH2   1 
ATOM   1649 N N     . GLY B 1 54  ? -8.022  7.791   27.084  1.00 11.90  ? 239  GLY B N     1 
ATOM   1650 C CA    . GLY B 1 54  ? -9.228  7.024   27.338  1.00 12.17  ? 239  GLY B CA    1 
ATOM   1651 C C     . GLY B 1 54  ? -10.322 7.181   26.297  1.00 12.73  ? 239  GLY B C     1 
ATOM   1652 O O     . GLY B 1 54  ? -11.267 6.388   26.286  1.00 13.47  ? 239  GLY B O     1 
ATOM   1653 N N     . ASP B 1 55  ? -10.209 8.189   25.422  1.00 12.40  ? 240  ASP B N     1 
ATOM   1654 C CA    . ASP B 1 55  ? -11.190 8.392   24.351  1.00 12.78  ? 240  ASP B CA    1 
ATOM   1655 C C     . ASP B 1 55  ? -11.179 7.271   23.317  1.00 12.89  ? 240  ASP B C     1 
ATOM   1656 O O     . ASP B 1 55  ? -10.119 6.743   22.952  1.00 13.07  ? 240  ASP B O     1 
ATOM   1657 C CB    . ASP B 1 55  ? -10.925 9.687   23.587  1.00 13.24  ? 240  ASP B CB    1 
ATOM   1658 C CG    . ASP B 1 55  ? -11.323 10.940  24.350  1.00 13.57  ? 240  ASP B CG    1 
ATOM   1659 O OD1   . ASP B 1 55  ? -11.821 10.855  25.489  1.00 13.98  ? 240  ASP B OD1   1 
ATOM   1660 O OD2   . ASP B 1 55  ? -11.126 12.029  23.777  1.00 15.18  ? 240  ASP B OD2   1 
ATOM   1661 N N     . PHE B 1 56  ? -12.370 6.970   22.809  1.00 12.97  ? 241  PHE B N     1 
ATOM   1662 C CA    . PHE B 1 56  ? -12.546 6.143   21.626  1.00 12.69  ? 241  PHE B CA    1 
ATOM   1663 C C     . PHE B 1 56  ? -11.865 6.828   20.462  1.00 12.44  ? 241  PHE B C     1 
ATOM   1664 O O     . PHE B 1 56  ? -12.103 8.006   20.211  1.00 13.14  ? 241  PHE B O     1 
ATOM   1665 C CB    . PHE B 1 56  ? -14.039 6.011   21.314  1.00 13.15  ? 241  PHE B CB    1 
ATOM   1666 C CG    . PHE B 1 56  ? -14.345 5.216   20.066  1.00 12.58  ? 241  PHE B CG    1 
ATOM   1667 C CD1   . PHE B 1 56  ? -14.476 3.833   20.130  1.00 14.19  ? 241  PHE B CD1   1 
ATOM   1668 C CD2   . PHE B 1 56  ? -14.505 5.843   18.832  1.00 13.39  ? 241  PHE B CD2   1 
ATOM   1669 C CE1   . PHE B 1 56  ? -14.774 3.086   18.985  1.00 14.25  ? 241  PHE B CE1   1 
ATOM   1670 C CE2   . PHE B 1 56  ? -14.797 5.093   17.674  1.00 13.48  ? 241  PHE B CE2   1 
ATOM   1671 C CZ    . PHE B 1 56  ? -14.939 3.715   17.768  1.00 13.00  ? 241  PHE B CZ    1 
ATOM   1672 N N     . VAL B 1 57  ? -11.027 6.079   19.745  1.00 11.33  ? 242  VAL B N     1 
ATOM   1673 C CA    . VAL B 1 57  ? -10.420 6.573   18.517  1.00 11.71  ? 242  VAL B CA    1 
ATOM   1674 C C     . VAL B 1 57  ? -11.105 5.946   17.289  1.00 11.12  ? 242  VAL B C     1 
ATOM   1675 O O     . VAL B 1 57  ? -11.693 6.648   16.461  1.00 10.96  ? 242  VAL B O     1 
ATOM   1676 C CB    . VAL B 1 57  ? -8.884  6.324   18.514  1.00 11.53  ? 242  VAL B CB    1 
ATOM   1677 C CG1   . VAL B 1 57  ? -8.249  6.823   17.227  1.00 11.73  ? 242  VAL B CG1   1 
ATOM   1678 C CG2   . VAL B 1 57  ? -8.238  7.035   19.692  1.00 11.58  ? 242  VAL B CG2   1 
ATOM   1679 N N     . VAL B 1 58  ? -11.049 4.621   17.182  1.00 10.86  ? 243  VAL B N     1 
ATOM   1680 C CA    . VAL B 1 58  ? -11.611 3.940   16.025  1.00 10.78  ? 243  VAL B CA    1 
ATOM   1681 C C     . VAL B 1 58  ? -11.769 2.450   16.313  1.00 10.30  ? 243  VAL B C     1 
ATOM   1682 O O     . VAL B 1 58  ? -11.039 1.895   17.141  1.00 10.61  ? 243  VAL B O     1 
ATOM   1683 C CB    . VAL B 1 58  ? -10.714 4.186   14.766  1.00 10.72  ? 243  VAL B CB    1 
ATOM   1684 C CG1   . VAL B 1 58  ? -9.422  3.388   14.846  1.00 12.61  ? 243  VAL B CG1   1 
ATOM   1685 C CG2   . VAL B 1 58  ? -11.453 3.911   13.475  1.00 11.07  ? 243  VAL B CG2   1 
ATOM   1686 N N     . GLU B 1 59  ? -12.727 1.795   15.650  1.00 10.31  ? 244  GLU B N     1 
ATOM   1687 C CA    . GLU B 1 59  ? -12.782 0.341   15.683  1.00 10.27  ? 244  GLU B CA    1 
ATOM   1688 C C     . GLU B 1 59  ? -11.753 -0.260  14.713  1.00 10.11  ? 244  GLU B C     1 
ATOM   1689 O O     . GLU B 1 59  ? -11.511 0.284   13.632  1.00 10.93  ? 244  GLU B O     1 
ATOM   1690 C CB    . GLU B 1 59  ? -14.191 -0.167  15.326  1.00 10.70  ? 244  GLU B CB    1 
ATOM   1691 C CG    . GLU B 1 59  ? -14.302 -1.677  15.405  1.00 10.27  ? 244  GLU B CG    1 
ATOM   1692 C CD    . GLU B 1 59  ? -15.715 -2.206  15.256  1.00 10.77  ? 244  GLU B CD    1 
ATOM   1693 O OE1   . GLU B 1 59  ? -16.636 -1.416  14.938  1.00 12.45  ? 244  GLU B OE1   1 
ATOM   1694 O OE2   . GLU B 1 59  ? -15.902 -3.435  15.433  1.00 13.16  ? 244  GLU B OE2   1 
ATOM   1695 N N     . TYR B 1 60  ? -11.154 -1.389  15.090  1.00 10.05  ? 245  TYR B N     1 
ATOM   1696 C CA    . TYR B 1 60  ? -10.449 -2.207  14.113  1.00 10.39  ? 245  TYR B CA    1 
ATOM   1697 C C     . TYR B 1 60  ? -11.495 -3.055  13.412  1.00 10.45  ? 245  TYR B C     1 
ATOM   1698 O O     . TYR B 1 60  ? -11.898 -4.098  13.913  1.00 10.65  ? 245  TYR B O     1 
ATOM   1699 C CB    . TYR B 1 60  ? -9.351  -3.073  14.742  1.00 9.69   ? 245  TYR B CB    1 
ATOM   1700 C CG    . TYR B 1 60  ? -8.425  -3.604  13.668  1.00 9.03   ? 245  TYR B CG    1 
ATOM   1701 C CD1   . TYR B 1 60  ? -7.282  -2.898  13.307  1.00 9.83   ? 245  TYR B CD1   1 
ATOM   1702 C CD2   . TYR B 1 60  ? -8.734  -4.766  12.946  1.00 9.26   ? 245  TYR B CD2   1 
ATOM   1703 C CE1   . TYR B 1 60  ? -6.435  -3.356  12.304  1.00 9.96   ? 245  TYR B CE1   1 
ATOM   1704 C CE2   . TYR B 1 60  ? -7.893  -5.229  11.925  1.00 8.76   ? 245  TYR B CE2   1 
ATOM   1705 C CZ    . TYR B 1 60  ? -6.742  -4.514  11.609  1.00 9.67   ? 245  TYR B CZ    1 
ATOM   1706 O OH    . TYR B 1 60  ? -5.908  -4.950  10.600  1.00 10.57  ? 245  TYR B OH    1 
ATOM   1707 N N     . HIS B 1 61  ? -11.964 -2.577  12.265  1.00 10.65  ? 246  HIS B N     1 
ATOM   1708 C CA    . HIS B 1 61  ? -13.168 -3.112  11.641  1.00 11.33  ? 246  HIS B CA    1 
ATOM   1709 C C     . HIS B 1 61  ? -12.814 -3.913  10.396  1.00 11.47  ? 246  HIS B C     1 
ATOM   1710 O O     . HIS B 1 61  ? -12.035 -3.443  9.551   1.00 11.30  ? 246  HIS B O     1 
ATOM   1711 C CB    . HIS B 1 61  ? -14.083 -1.962  11.240  1.00 11.59  ? 246  HIS B CB    1 
ATOM   1712 C CG    . HIS B 1 61  ? -15.469 -2.399  10.889  1.00 12.84  ? 246  HIS B CG    1 
ATOM   1713 N ND1   . HIS B 1 61  ? -15.815 -2.860  9.635   1.00 13.40  ? 246  HIS B ND1   1 
ATOM   1714 C CD2   . HIS B 1 61  ? -16.598 -2.448  11.635  1.00 14.92  ? 246  HIS B CD2   1 
ATOM   1715 C CE1   . HIS B 1 61  ? -17.103 -3.157  9.620   1.00 13.94  ? 246  HIS B CE1   1 
ATOM   1716 N NE2   . HIS B 1 61  ? -17.601 -2.916  10.821  1.00 15.48  ? 246  HIS B NE2   1 
ATOM   1717 N N     . GLY B 1 62  ? -13.410 -5.097  10.282  1.00 11.69  ? 247  GLY B N     1 
ATOM   1718 C CA    . GLY B 1 62  ? -13.213 -5.972  9.121   1.00 11.80  ? 247  GLY B CA    1 
ATOM   1719 C C     . GLY B 1 62  ? -14.083 -7.203  9.287   1.00 12.76  ? 247  GLY B C     1 
ATOM   1720 O O     . GLY B 1 62  ? -15.138 -7.124  9.904   1.00 14.20  ? 247  GLY B O     1 
ATOM   1721 N N     . ASP B 1 63  ? -13.653 -8.337  8.741   1.00 12.77  ? 248  ASP B N     1 
ATOM   1722 C CA    . ASP B 1 63  ? -14.443 -9.574  8.814   1.00 13.51  ? 248  ASP B CA    1 
ATOM   1723 C C     . ASP B 1 63  ? -14.120 -10.312 10.109  1.00 13.41  ? 248  ASP B C     1 
ATOM   1724 O O     . ASP B 1 63  ? -13.003 -10.774 10.286  1.00 13.44  ? 248  ASP B O     1 
ATOM   1725 C CB    . ASP B 1 63  ? -14.091 -10.499 7.650   1.00 14.57  ? 248  ASP B CB    1 
ATOM   1726 C CG    . ASP B 1 63  ? -14.552 -9.978  6.310   1.00 18.02  ? 248  ASP B CG    1 
ATOM   1727 O OD1   . ASP B 1 63  ? -15.419 -9.080  6.264   1.00 21.39  ? 248  ASP B OD1   1 
ATOM   1728 O OD2   . ASP B 1 63  ? -14.045 -10.502 5.290   1.00 22.11  ? 248  ASP B OD2   1 
ATOM   1729 N N     . LEU B 1 64  ? -15.100 -10.451 10.994  1.00 12.96  ? 249  LEU B N     1 
ATOM   1730 C CA    . LEU B 1 64  ? -14.916 -11.240 12.213  1.00 13.56  ? 249  LEU B CA    1 
ATOM   1731 C C     . LEU B 1 64  ? -15.071 -12.731 11.920  1.00 13.10  ? 249  LEU B C     1 
ATOM   1732 O O     . LEU B 1 64  ? -16.131 -13.186 11.467  1.00 14.22  ? 249  LEU B O     1 
ATOM   1733 C CB    . LEU B 1 64  ? -15.888 -10.811 13.312  1.00 13.13  ? 249  LEU B CB    1 
ATOM   1734 C CG    . LEU B 1 64  ? -15.796 -11.582 14.642  1.00 13.54  ? 249  LEU B CG    1 
ATOM   1735 C CD1   . LEU B 1 64  ? -14.439 -11.409 15.322  1.00 14.16  ? 249  LEU B CD1   1 
ATOM   1736 C CD2   . LEU B 1 64  ? -16.926 -11.183 15.572  1.00 14.19  ? 249  LEU B CD2   1 
ATOM   1737 N N     . ILE B 1 65  ? -14.003 -13.478 12.189  1.00 13.41  ? 250  ILE B N     1 
ATOM   1738 C CA    . ILE B 1 65  ? -13.939 -14.921 11.911  1.00 13.46  ? 250  ILE B CA    1 
ATOM   1739 C C     . ILE B 1 65  ? -13.292 -15.704 13.054  1.00 13.84  ? 250  ILE B C     1 
ATOM   1740 O O     . ILE B 1 65  ? -12.675 -15.123 13.939  1.00 13.43  ? 250  ILE B O     1 
ATOM   1741 C CB    . ILE B 1 65  ? -13.196 -15.224 10.568  1.00 13.74  ? 250  ILE B CB    1 
ATOM   1742 C CG1   . ILE B 1 65  ? -11.740 -14.728 10.618  1.00 13.62  ? 250  ILE B CG1   1 
ATOM   1743 C CG2   . ILE B 1 65  ? -13.961 -14.620 9.382   1.00 13.37  ? 250  ILE B CG2   1 
ATOM   1744 C CD1   . ILE B 1 65  ? -10.975 -14.887 9.319   1.00 14.17  ? 250  ILE B CD1   1 
ATOM   1745 N N     . GLU B 1 66  ? -13.434 -17.025 13.021  1.00 14.54  ? 251  GLU B N     1 
ATOM   1746 C CA    . GLU B 1 66  ? -12.830 -17.875 14.041  1.00 15.28  ? 251  GLU B CA    1 
ATOM   1747 C C     . GLU B 1 66  ? -11.422 -18.314 13.674  1.00 14.34  ? 251  GLU B C     1 
ATOM   1748 O O     . GLU B 1 66  ? -11.030 -18.256 12.505  1.00 13.86  ? 251  GLU B O     1 
ATOM   1749 C CB    . GLU B 1 66  ? -13.743 -19.063 14.334  1.00 16.86  ? 251  GLU B CB    1 
ATOM   1750 C CG    . GLU B 1 66  ? -14.952 -18.602 15.130  1.00 20.63  ? 251  GLU B CG    1 
ATOM   1751 C CD    . GLU B 1 66  ? -15.960 -19.682 15.413  1.00 24.72  ? 251  GLU B CD    1 
ATOM   1752 O OE1   . GLU B 1 66  ? -15.633 -20.882 15.275  1.00 27.49  ? 251  GLU B OE1   1 
ATOM   1753 O OE2   . GLU B 1 66  ? -17.102 -19.323 15.781  1.00 27.61  ? 251  GLU B OE2   1 
ATOM   1754 N N     . ILE B 1 67  ? -10.655 -18.725 14.683  1.00 14.01  ? 252  ILE B N     1 
ATOM   1755 C CA    . ILE B 1 67  ? -9.237  -19.020 14.498  1.00 14.10  ? 252  ILE B CA    1 
ATOM   1756 C C     . ILE B 1 67  ? -8.942  -20.043 13.391  1.00 14.39  ? 252  ILE B C     1 
ATOM   1757 O O     . ILE B 1 67  ? -7.988  -19.868 12.639  1.00 14.00  ? 252  ILE B O     1 
ATOM   1758 C CB    . ILE B 1 67  ? -8.535  -19.423 15.825  1.00 13.87  ? 252  ILE B CB    1 
ATOM   1759 C CG1   . ILE B 1 67  ? -7.011  -19.519 15.621  1.00 13.77  ? 252  ILE B CG1   1 
ATOM   1760 C CG2   . ILE B 1 67  ? -9.137  -20.707 16.400  1.00 14.61  ? 252  ILE B CG2   1 
ATOM   1761 C CD1   . ILE B 1 67  ? -6.216  -19.846 16.888  1.00 14.38  ? 252  ILE B CD1   1 
ATOM   1762 N N     . THR B 1 68  ? -9.750  -21.099 13.299  1.00 14.92  ? 253  THR B N     1 
ATOM   1763 C CA    . THR B 1 68  ? -9.496  -22.148 12.322  1.00 15.78  ? 253  THR B CA    1 
ATOM   1764 C C     . THR B 1 68  ? -9.642  -21.586 10.904  1.00 15.65  ? 253  THR B C     1 
ATOM   1765 O O     . THR B 1 68  ? -8.768  -21.794 10.063  1.00 16.15  ? 253  THR B O     1 
ATOM   1766 C CB    . THR B 1 68  ? -10.403 -23.373 12.587  1.00 15.86  ? 253  THR B CB    1 
ATOM   1767 O OG1   . THR B 1 68  ? -10.151 -23.862 13.913  1.00 17.16  ? 253  THR B OG1   1 
ATOM   1768 C CG2   . THR B 1 68  ? -10.146 -24.487 11.576  1.00 16.83  ? 253  THR B CG2   1 
ATOM   1769 N N     . ASP B 1 69  ? -10.729 -20.851 10.671  1.00 16.09  ? 254  ASP B N     1 
ATOM   1770 C CA    . ASP B 1 69  ? -10.986 -20.143 9.404   1.00 16.62  ? 254  ASP B CA    1 
ATOM   1771 C C     . ASP B 1 69  ? -9.889  -19.105 9.118   1.00 16.08  ? 254  ASP B C     1 
ATOM   1772 O O     . ASP B 1 69  ? -9.426  -18.966 7.981   1.00 16.32  ? 254  ASP B O     1 
ATOM   1773 C CB    . ASP B 1 69  ? -12.373 -19.476 9.469   1.00 17.43  ? 254  ASP B CB    1 
ATOM   1774 C CG    . ASP B 1 69  ? -12.769 -18.732 8.187   1.00 20.84  ? 254  ASP B CG    1 
ATOM   1775 O OD1   . ASP B 1 69  ? -12.130 -18.907 7.125   1.00 24.70  ? 254  ASP B OD1   1 
ATOM   1776 O OD2   . ASP B 1 69  ? -13.768 -17.974 8.248   1.00 23.39  ? 254  ASP B OD2   1 
ATOM   1777 N N     . ALA B 1 70  ? -9.481  -18.373 10.149  1.00 15.15  ? 255  ALA B N     1 
ATOM   1778 C CA    . ALA B 1 70  ? -8.432  -17.366 9.983   1.00 14.81  ? 255  ALA B CA    1 
ATOM   1779 C C     . ALA B 1 70  ? -7.110  -17.974 9.503   1.00 14.93  ? 255  ALA B C     1 
ATOM   1780 O O     . ALA B 1 70  ? -6.492  -17.464 8.561   1.00 15.21  ? 255  ALA B O     1 
ATOM   1781 C CB    . ALA B 1 70  ? -8.238  -16.594 11.271  1.00 14.31  ? 255  ALA B CB    1 
ATOM   1782 N N     . LYS B 1 71  ? -6.697  -19.070 10.134  1.00 15.07  ? 256  LYS B N     1 
ATOM   1783 C CA    . LYS B 1 71  ? -5.458  -19.754 9.774   1.00 15.20  ? 256  LYS B CA    1 
ATOM   1784 C C     . LYS B 1 71  ? -5.504  -20.319 8.358   1.00 15.54  ? 256  LYS B C     1 
ATOM   1785 O O     . LYS B 1 71  ? -4.487  -20.326 7.665   1.00 15.40  ? 256  LYS B O     1 
ATOM   1786 C CB    . LYS B 1 71  ? -5.106  -20.839 10.799  1.00 15.18  ? 256  LYS B CB    1 
ATOM   1787 C CG    . LYS B 1 71  ? -4.611  -20.256 12.143  1.00 14.96  ? 256  LYS B CG    1 
ATOM   1788 C CD    . LYS B 1 71  ? -4.105  -21.333 13.099  1.00 15.45  ? 256  LYS B CD    1 
ATOM   1789 C CE    . LYS B 1 71  ? -3.525  -20.722 14.386  1.00 15.59  ? 256  LYS B CE    1 
ATOM   1790 N NZ    A LYS B 1 71  ? -2.621  -19.574 14.151  0.50 18.57  ? 256  LYS B NZ    1 
ATOM   1791 N NZ    B LYS B 1 71  ? -3.046  -21.783 15.304  0.50 14.01  ? 256  LYS B NZ    1 
ATOM   1792 N N     . LYS B 1 72  ? -6.684  -20.784 7.942   1.00 16.06  ? 257  LYS B N     1 
ATOM   1793 C CA    . LYS B 1 72  ? -6.880  -21.241 6.558   1.00 16.90  ? 257  LYS B CA    1 
ATOM   1794 C C     . LYS B 1 72  ? -6.770  -20.078 5.559   1.00 16.72  ? 257  LYS B C     1 
ATOM   1795 O O     . LYS B 1 72  ? -6.096  -20.200 4.530   1.00 16.24  ? 257  LYS B O     1 
ATOM   1796 C CB    . LYS B 1 72  ? -8.206  -21.995 6.412   1.00 16.71  ? 257  LYS B CB    1 
ATOM   1797 C CG    . LYS B 1 72  ? -8.208  -23.370 7.106   1.00 17.92  ? 257  LYS B CG    1 
ATOM   1798 C CD    . LYS B 1 72  ? -9.516  -24.153 6.905   1.00 19.57  ? 257  LYS B CD    1 
ATOM   1799 C CE    . LYS B 1 72  ? -9.491  -24.972 5.613   1.00 23.28  ? 257  LYS B CE    1 
ATOM   1800 N NZ    . LYS B 1 72  ? -10.837 -25.500 5.239   1.00 25.06  ? 257  LYS B NZ    1 
ATOM   1801 N N     . ARG B 1 73  ? -7.411  -18.949 5.869   1.00 16.03  ? 258  ARG B N     1 
ATOM   1802 C CA    . ARG B 1 73  ? -7.338  -17.766 5.011   1.00 16.23  ? 258  ARG B CA    1 
ATOM   1803 C C     . ARG B 1 73  ? -5.900  -17.294 4.916   1.00 16.10  ? 258  ARG B C     1 
ATOM   1804 O O     . ARG B 1 73  ? -5.415  -16.932 3.837   1.00 16.19  ? 258  ARG B O     1 
ATOM   1805 C CB    . ARG B 1 73  ? -8.173  -16.618 5.578   1.00 16.03  ? 258  ARG B CB    1 
ATOM   1806 C CG    . ARG B 1 73  ? -9.664  -16.738 5.391   1.00 16.95  ? 258  ARG B CG    1 
ATOM   1807 C CD    . ARG B 1 73  ? -10.338 -15.411 5.701   1.00 17.63  ? 258  ARG B CD    1 
ATOM   1808 N NE    . ARG B 1 73  ? -11.799 -15.505 5.692   1.00 17.45  ? 258  ARG B NE    1 
ATOM   1809 C CZ    . ARG B 1 73  ? -12.619 -14.457 5.759   1.00 17.82  ? 258  ARG B CZ    1 
ATOM   1810 N NH1   . ARG B 1 73  ? -12.129 -13.221 5.843   1.00 17.33  ? 258  ARG B NH1   1 
ATOM   1811 N NH2   . ARG B 1 73  ? -13.938 -14.646 5.741   1.00 18.64  ? 258  ARG B NH2   1 
ATOM   1812 N N     . GLU B 1 74  ? -5.224  -17.284 6.062   1.00 15.87  ? 259  GLU B N     1 
ATOM   1813 C CA    . GLU B 1 74  ? -3.865  -16.791 6.115   1.00 16.13  ? 259  GLU B CA    1 
ATOM   1814 C C     . GLU B 1 74  ? -2.888  -17.661 5.294   1.00 16.37  ? 259  GLU B C     1 
ATOM   1815 O O     . GLU B 1 74  ? -2.004  -17.123 4.631   1.00 16.66  ? 259  GLU B O     1 
ATOM   1816 C CB    . GLU B 1 74  ? -3.398  -16.616 7.561   1.00 16.13  ? 259  GLU B CB    1 
ATOM   1817 C CG    . GLU B 1 74  ? -2.122  -15.830 7.601   1.00 16.94  ? 259  GLU B CG    1 
ATOM   1818 C CD    . GLU B 1 74  ? -1.762  -15.299 8.957   1.00 17.22  ? 259  GLU B CD    1 
ATOM   1819 O OE1   . GLU B 1 74  ? -2.352  -15.698 9.978   1.00 17.26  ? 259  GLU B OE1   1 
ATOM   1820 O OE2   . GLU B 1 74  ? -0.848  -14.473 8.982   1.00 17.34  ? 259  GLU B OE2   1 
ATOM   1821 N N     . ALA B 1 75  ? -3.064  -18.984 5.322   1.00 16.81  ? 260  ALA B N     1 
ATOM   1822 C CA    . ALA B 1 75  ? -2.224  -19.889 4.539   1.00 16.58  ? 260  ALA B CA    1 
ATOM   1823 C C     . ALA B 1 75  ? -2.381  -19.631 3.040   1.00 16.76  ? 260  ALA B C     1 
ATOM   1824 O O     . ALA B 1 75  ? -1.433  -19.804 2.275   1.00 17.76  ? 260  ALA B O     1 
ATOM   1825 C CB    . ALA B 1 75  ? -2.530  -21.348 4.865   1.00 16.59  ? 260  ALA B CB    1 
ATOM   1826 N N     . LEU B 1 76  ? -3.576  -19.211 2.634   1.00 16.88  ? 261  LEU B N     1 
ATOM   1827 C CA    . LEU B 1 76  ? -3.810  -18.790 1.249   1.00 17.15  ? 261  LEU B CA    1 
ATOM   1828 C C     . LEU B 1 76  ? -3.205  -17.418 0.947   1.00 16.78  ? 261  LEU B C     1 
ATOM   1829 O O     . LEU B 1 76  ? -2.565  -17.229 -0.088  1.00 17.64  ? 261  LEU B O     1 
ATOM   1830 C CB    . LEU B 1 76  ? -5.304  -18.805 0.918   1.00 17.74  ? 261  LEU B CB    1 
ATOM   1831 C CG    . LEU B 1 76  ? -5.931  -20.204 0.935   1.00 18.94  ? 261  LEU B CG    1 
ATOM   1832 C CD1   . LEU B 1 76  ? -7.449  -20.113 1.026   1.00 20.59  ? 261  LEU B CD1   1 
ATOM   1833 C CD2   . LEU B 1 76  ? -5.491  -21.030 -0.278  1.00 19.50  ? 261  LEU B CD2   1 
ATOM   1834 N N     . TYR B 1 77  ? -3.392  -16.461 1.856   1.00 16.26  ? 262  TYR B N     1 
ATOM   1835 C CA    . TYR B 1 77  ? -2.774  -15.151 1.687   1.00 15.82  ? 262  TYR B CA    1 
ATOM   1836 C C     . TYR B 1 77  ? -1.259  -15.271 1.558   1.00 16.10  ? 262  TYR B C     1 
ATOM   1837 O O     . TYR B 1 77  ? -0.645  -14.522 0.799   1.00 15.77  ? 262  TYR B O     1 
ATOM   1838 C CB    . TYR B 1 77  ? -3.065  -14.229 2.875   1.00 15.10  ? 262  TYR B CB    1 
ATOM   1839 C CG    . TYR B 1 77  ? -4.493  -13.792 3.075   1.00 14.14  ? 262  TYR B CG    1 
ATOM   1840 C CD1   . TYR B 1 77  ? -5.362  -13.602 2.002   1.00 12.37  ? 262  TYR B CD1   1 
ATOM   1841 C CD2   . TYR B 1 77  ? -4.962  -13.516 4.360   1.00 13.46  ? 262  TYR B CD2   1 
ATOM   1842 C CE1   . TYR B 1 77  ? -6.680  -13.187 2.204   1.00 12.57  ? 262  TYR B CE1   1 
ATOM   1843 C CE2   . TYR B 1 77  ? -6.272  -13.097 4.576   1.00 13.20  ? 262  TYR B CE2   1 
ATOM   1844 C CZ    . TYR B 1 77  ? -7.123  -12.929 3.492   1.00 13.88  ? 262  TYR B CZ    1 
ATOM   1845 O OH    . TYR B 1 77  ? -8.419  -12.513 3.689   1.00 14.24  ? 262  TYR B OH    1 
ATOM   1846 N N     . ALA B 1 78  ? -0.665  -16.198 2.316   1.00 17.00  ? 263  ALA B N     1 
ATOM   1847 C CA    . ALA B 1 78  ? 0.789   -16.367 2.357   1.00 17.99  ? 263  ALA B CA    1 
ATOM   1848 C C     . ALA B 1 78  ? 1.381   -16.795 1.014   1.00 18.63  ? 263  ALA B C     1 
ATOM   1849 O O     . ALA B 1 78  ? 2.580   -16.639 0.779   1.00 19.60  ? 263  ALA B O     1 
ATOM   1850 C CB    . ALA B 1 78  ? 1.174   -17.351 3.445   1.00 17.71  ? 263  ALA B CB    1 
ATOM   1851 N N     . GLN B 1 79  ? 0.531   -17.305 0.130   1.00 19.12  ? 264  GLN B N     1 
ATOM   1852 C CA    . GLN B 1 79  ? 0.944   -17.693 -1.222  1.00 19.86  ? 264  GLN B CA    1 
ATOM   1853 C C     . GLN B 1 79  ? 1.087   -16.491 -2.157  1.00 19.17  ? 264  GLN B C     1 
ATOM   1854 O O     . GLN B 1 79  ? 1.652   -16.612 -3.245  1.00 19.37  ? 264  GLN B O     1 
ATOM   1855 C CB    . GLN B 1 79  ? -0.052  -18.683 -1.818  1.00 19.67  ? 264  GLN B CB    1 
ATOM   1856 C CG    . GLN B 1 79  ? -0.194  -19.986 -1.030  1.00 21.82  ? 264  GLN B CG    1 
ATOM   1857 C CD    . GLN B 1 79  ? -1.344  -20.844 -1.525  1.00 22.52  ? 264  GLN B CD    1 
ATOM   1858 O OE1   . GLN B 1 79  ? -1.641  -20.872 -2.724  1.00 26.04  ? 264  GLN B OE1   1 
ATOM   1859 N NE2   . GLN B 1 79  ? -1.994  -21.560 -0.606  1.00 24.39  ? 264  GLN B NE2   1 
ATOM   1860 N N     . ASP B 1 80  ? 0.571   -15.338 -1.739  1.00 18.29  ? 265  ASP B N     1 
ATOM   1861 C CA    . ASP B 1 80  ? 0.666   -14.112 -2.532  1.00 17.52  ? 265  ASP B CA    1 
ATOM   1862 C C     . ASP B 1 80  ? 1.340   -13.049 -1.670  1.00 16.96  ? 265  ASP B C     1 
ATOM   1863 O O     . ASP B 1 80  ? 0.683   -12.443 -0.832  1.00 16.15  ? 265  ASP B O     1 
ATOM   1864 C CB    . ASP B 1 80  ? -0.734  -13.647 -2.972  1.00 17.76  ? 265  ASP B CB    1 
ATOM   1865 C CG    . ASP B 1 80  ? -0.707  -12.405 -3.865  1.00 18.65  ? 265  ASP B CG    1 
ATOM   1866 O OD1   . ASP B 1 80  ? 0.334   -11.731 -3.946  1.00 18.90  ? 265  ASP B OD1   1 
ATOM   1867 O OD2   . ASP B 1 80  ? -1.751  -12.095 -4.479  1.00 19.88  ? 265  ASP B OD2   1 
ATOM   1868 N N     . PRO B 1 81  ? 2.655   -12.811 -1.877  1.00 16.57  ? 266  PRO B N     1 
ATOM   1869 C CA    . PRO B 1 81  ? 3.392   -11.891 -1.003  1.00 16.68  ? 266  PRO B CA    1 
ATOM   1870 C C     . PRO B 1 81  ? 2.893   -10.439 -1.068  1.00 15.78  ? 266  PRO B C     1 
ATOM   1871 O O     . PRO B 1 81  ? 3.261   -9.635  -0.210  1.00 16.27  ? 266  PRO B O     1 
ATOM   1872 C CB    . PRO B 1 81  ? 4.838   -11.994 -1.513  1.00 17.35  ? 266  PRO B CB    1 
ATOM   1873 C CG    . PRO B 1 81  ? 4.885   -13.224 -2.323  1.00 17.82  ? 266  PRO B CG    1 
ATOM   1874 C CD    . PRO B 1 81  ? 3.526   -13.376 -2.925  1.00 17.36  ? 266  PRO B CD    1 
ATOM   1875 N N     . SER B 1 82  ? 2.057   -10.125 -2.064  1.00 14.84  ? 267  SER B N     1 
ATOM   1876 C CA    . SER B 1 82  ? 1.492   -8.782  -2.213  1.00 14.17  ? 267  SER B CA    1 
ATOM   1877 C C     . SER B 1 82  ? 0.302   -8.513  -1.295  1.00 13.37  ? 267  SER B C     1 
ATOM   1878 O O     . SER B 1 82  ? -0.145  -7.377  -1.181  1.00 12.86  ? 267  SER B O     1 
ATOM   1879 C CB    . SER B 1 82  ? 1.045   -8.525  -3.655  1.00 13.89  ? 267  SER B CB    1 
ATOM   1880 O OG    . SER B 1 82  ? -0.183  -9.186  -3.927  1.00 15.03  ? 267  SER B OG    1 
ATOM   1881 N N     . THR B 1 83  ? -0.220  -9.552  -0.653  1.00 12.88  ? 268  THR B N     1 
ATOM   1882 C CA    . THR B 1 83  ? -1.469  -9.421  0.104   1.00 12.68  ? 268  THR B CA    1 
ATOM   1883 C C     . THR B 1 83  ? -1.421  -8.308  1.159   1.00 12.56  ? 268  THR B C     1 
ATOM   1884 O O     . THR B 1 83  ? -2.321  -7.472  1.236   1.00 12.59  ? 268  THR B O     1 
ATOM   1885 C CB    . THR B 1 83  ? -1.854  -10.755 0.761   1.00 13.29  ? 268  THR B CB    1 
ATOM   1886 O OG1   . THR B 1 83  ? -1.885  -11.778 -0.244  1.00 14.88  ? 268  THR B OG1   1 
ATOM   1887 C CG2   . THR B 1 83  ? -3.212  -10.663 1.433   1.00 13.09  ? 268  THR B CG2   1 
ATOM   1888 N N     . GLY B 1 84  ? -0.355  -8.283  1.942   1.00 12.18  ? 269  GLY B N     1 
ATOM   1889 C CA    . GLY B 1 84  ? -0.293  -7.383  3.089   1.00 11.65  ? 269  GLY B CA    1 
ATOM   1890 C C     . GLY B 1 84  ? -0.927  -8.026  4.317   1.00 11.37  ? 269  GLY B C     1 
ATOM   1891 O O     . GLY B 1 84  ? -1.655  -9.026  4.221   1.00 11.66  ? 269  GLY B O     1 
ATOM   1892 N N     . CYS B 1 85  ? -0.627  -7.448  5.472   1.00 11.05  ? 270  CYS B N     1 
ATOM   1893 C CA    . CYS B 1 85  ? -0.994  -8.034  6.756   1.00 10.34  ? 270  CYS B CA    1 
ATOM   1894 C C     . CYS B 1 85  ? -1.994  -7.173  7.528   1.00 10.12  ? 270  CYS B C     1 
ATOM   1895 O O     . CYS B 1 85  ? -1.623  -6.176  8.154   1.00 10.50  ? 270  CYS B O     1 
ATOM   1896 C CB    . CYS B 1 85  ? 0.259   -8.310  7.588   1.00 10.79  ? 270  CYS B CB    1 
ATOM   1897 S SG    . CYS B 1 85  ? 1.401   -9.498  6.812   1.00 12.21  ? 270  CYS B SG    1 
ATOM   1898 N N     . TYR B 1 86  ? -3.258  -7.592  7.485   1.00 10.18  ? 271  TYR B N     1 
ATOM   1899 C CA    . TYR B 1 86  ? -4.387  -6.818  8.030   1.00 10.32  ? 271  TYR B CA    1 
ATOM   1900 C C     . TYR B 1 86  ? -5.237  -7.653  8.983   1.00 10.22  ? 271  TYR B C     1 
ATOM   1901 O O     . TYR B 1 86  ? -6.344  -7.250  9.340   1.00 10.77  ? 271  TYR B O     1 
ATOM   1902 C CB    . TYR B 1 86  ? -5.278  -6.291  6.891   1.00 10.27  ? 271  TYR B CB    1 
ATOM   1903 C CG    . TYR B 1 86  ? -4.548  -5.376  5.940   1.00 9.69   ? 271  TYR B CG    1 
ATOM   1904 C CD1   . TYR B 1 86  ? -4.381  -4.023  6.238   1.00 10.23  ? 271  TYR B CD1   1 
ATOM   1905 C CD2   . TYR B 1 86  ? -3.979  -5.869  4.772   1.00 9.89   ? 271  TYR B CD2   1 
ATOM   1906 C CE1   . TYR B 1 86  ? -3.691  -3.185  5.372   1.00 9.96   ? 271  TYR B CE1   1 
ATOM   1907 C CE2   . TYR B 1 86  ? -3.279  -5.028  3.896   1.00 10.13  ? 271  TYR B CE2   1 
ATOM   1908 C CZ    . TYR B 1 86  ? -3.137  -3.689  4.213   1.00 9.96   ? 271  TYR B CZ    1 
ATOM   1909 O OH    . TYR B 1 86  ? -2.430  -2.856  3.364   1.00 10.78  ? 271  TYR B OH    1 
ATOM   1910 N N     . MET B 1 87  ? -4.716  -8.810  9.383   1.00 9.90   ? 272  MET B N     1 
ATOM   1911 C CA    . MET B 1 87  ? -5.433  -9.729  10.273  1.00 10.21  ? 272  MET B CA    1 
ATOM   1912 C C     . MET B 1 87  ? -5.101  -9.472  11.736  1.00 10.01  ? 272  MET B C     1 
ATOM   1913 O O     . MET B 1 87  ? -3.927  -9.392  12.096  1.00 10.96  ? 272  MET B O     1 
ATOM   1914 C CB    . MET B 1 87  ? -5.087  -11.175 9.916   1.00 10.37  ? 272  MET B CB    1 
ATOM   1915 C CG    . MET B 1 87  ? -5.357  -11.511 8.451   1.00 11.55  ? 272  MET B CG    1 
ATOM   1916 S SD    . MET B 1 87  ? -5.080  -13.259 8.107   1.00 12.27  ? 272  MET B SD    1 
ATOM   1917 C CE    . MET B 1 87  ? -6.643  -13.956 8.631   1.00 12.47  ? 272  MET B CE    1 
ATOM   1918 N N     . TYR B 1 88  ? -6.132  -9.366  12.577  1.00 10.10  ? 273  TYR B N     1 
ATOM   1919 C CA    . TYR B 1 88  ? -5.920  -9.039  13.989  1.00 9.97   ? 273  TYR B CA    1 
ATOM   1920 C C     . TYR B 1 88  ? -6.548  -10.132 14.853  1.00 9.71   ? 273  TYR B C     1 
ATOM   1921 O O     . TYR B 1 88  ? -7.775  -10.193 15.029  1.00 9.58   ? 273  TYR B O     1 
ATOM   1922 C CB    . TYR B 1 88  ? -6.540  -7.675  14.325  1.00 9.72   ? 273  TYR B CB    1 
ATOM   1923 C CG    . TYR B 1 88  ? -5.888  -6.916  15.465  1.00 9.62   ? 273  TYR B CG    1 
ATOM   1924 C CD1   . TYR B 1 88  ? -5.313  -7.580  16.554  1.00 9.70   ? 273  TYR B CD1   1 
ATOM   1925 C CD2   . TYR B 1 88  ? -5.888  -5.520  15.466  1.00 11.30  ? 273  TYR B CD2   1 
ATOM   1926 C CE1   . TYR B 1 88  ? -4.712  -6.858  17.599  1.00 10.66  ? 273  TYR B CE1   1 
ATOM   1927 C CE2   . TYR B 1 88  ? -5.309  -4.798  16.497  1.00 10.86  ? 273  TYR B CE2   1 
ATOM   1928 C CZ    . TYR B 1 88  ? -4.727  -5.466  17.563  1.00 10.71  ? 273  TYR B CZ    1 
ATOM   1929 O OH    . TYR B 1 88  ? -4.147  -4.713  18.558  1.00 11.67  ? 273  TYR B OH    1 
ATOM   1930 N N     . TYR B 1 89  ? -5.693  -11.003 15.373  1.00 9.63   ? 274  TYR B N     1 
ATOM   1931 C CA    . TYR B 1 89  ? -6.140  -12.129 16.202  1.00 10.05  ? 274  TYR B CA    1 
ATOM   1932 C C     . TYR B 1 89  ? -6.293  -11.704 17.652  1.00 9.88   ? 274  TYR B C     1 
ATOM   1933 O O     . TYR B 1 89  ? -5.528  -10.876 18.144  1.00 10.72  ? 274  TYR B O     1 
ATOM   1934 C CB    . TYR B 1 89  ? -5.106  -13.252 16.146  1.00 11.22  ? 274  TYR B CB    1 
ATOM   1935 C CG    . TYR B 1 89  ? -5.016  -13.982 14.824  1.00 11.55  ? 274  TYR B CG    1 
ATOM   1936 C CD1   . TYR B 1 89  ? -5.675  -15.196 14.647  1.00 12.63  ? 274  TYR B CD1   1 
ATOM   1937 C CD2   . TYR B 1 89  ? -4.236  -13.483 13.761  1.00 13.32  ? 274  TYR B CD2   1 
ATOM   1938 C CE1   . TYR B 1 89  ? -5.587  -15.891 13.451  1.00 12.25  ? 274  TYR B CE1   1 
ATOM   1939 C CE2   . TYR B 1 89  ? -4.139  -14.179 12.558  1.00 13.92  ? 274  TYR B CE2   1 
ATOM   1940 C CZ    . TYR B 1 89  ? -4.818  -15.388 12.415  1.00 12.97  ? 274  TYR B CZ    1 
ATOM   1941 O OH    . TYR B 1 89  ? -4.748  -16.108 11.245  1.00 14.56  ? 274  TYR B OH    1 
ATOM   1942 N N     . PHE B 1 90  ? -7.260  -12.303 18.346  1.00 9.69   ? 275  PHE B N     1 
ATOM   1943 C CA    . PHE B 1 90  ? -7.525  -11.943 19.727  1.00 10.09  ? 275  PHE B CA    1 
ATOM   1944 C C     . PHE B 1 90  ? -8.285  -13.034 20.456  1.00 10.41  ? 275  PHE B C     1 
ATOM   1945 O O     . PHE B 1 90  ? -8.962  -13.851 19.829  1.00 11.08  ? 275  PHE B O     1 
ATOM   1946 C CB    . PHE B 1 90  ? -8.302  -10.620 19.799  1.00 10.27  ? 275  PHE B CB    1 
ATOM   1947 C CG    . PHE B 1 90  ? -9.699  -10.687 19.228  1.00 11.18  ? 275  PHE B CG    1 
ATOM   1948 C CD1   . PHE B 1 90  ? -10.791 -10.842 20.068  1.00 11.26  ? 275  PHE B CD1   1 
ATOM   1949 C CD2   . PHE B 1 90  ? -9.923  -10.541 17.857  1.00 10.56  ? 275  PHE B CD2   1 
ATOM   1950 C CE1   . PHE B 1 90  ? -12.085 -10.872 19.553  1.00 11.34  ? 275  PHE B CE1   1 
ATOM   1951 C CE2   . PHE B 1 90  ? -11.220 -10.566 17.342  1.00 10.63  ? 275  PHE B CE2   1 
ATOM   1952 C CZ    . PHE B 1 90  ? -12.293 -10.735 18.192  1.00 11.77  ? 275  PHE B CZ    1 
ATOM   1953 N N     . GLN B 1 91  ? -8.156  -13.037 21.778  1.00 11.32  ? 276  GLN B N     1 
ATOM   1954 C CA    . GLN B 1 91  ? -8.938  -13.928 22.627  1.00 12.21  ? 276  GLN B CA    1 
ATOM   1955 C C     . GLN B 1 91  ? -10.254 -13.264 23.010  1.00 12.15  ? 276  GLN B C     1 
ATOM   1956 O O     . GLN B 1 91  ? -10.289 -12.089 23.387  1.00 11.86  ? 276  GLN B O     1 
ATOM   1957 C CB    . GLN B 1 91  ? -8.193  -14.219 23.929  1.00 12.55  ? 276  GLN B CB    1 
ATOM   1958 C CG    . GLN B 1 91  ? -6.895  -14.986 23.826  1.00 14.44  ? 276  GLN B CG    1 
ATOM   1959 C CD    . GLN B 1 91  ? -6.397  -15.423 25.206  1.00 14.31  ? 276  GLN B CD    1 
ATOM   1960 O OE1   . GLN B 1 91  ? -5.379  -14.907 25.716  1.00 15.52  ? 276  GLN B OE1   1 
ATOM   1961 N NE2   . GLN B 1 91  ? -7.102  -16.397 25.814  1.00 12.02  ? 276  GLN B NE2   1 
ATOM   1962 N N     . TYR B 1 92  ? -11.339 -14.030 22.956  1.00 12.29  ? 277  TYR B N     1 
ATOM   1963 C CA    . TYR B 1 92  ? -12.597 -13.582 23.521  1.00 13.16  ? 277  TYR B CA    1 
ATOM   1964 C C     . TYR B 1 92  ? -13.230 -14.756 24.242  1.00 12.93  ? 277  TYR B C     1 
ATOM   1965 O O     . TYR B 1 92  ? -13.511 -15.805 23.647  1.00 12.53  ? 277  TYR B O     1 
ATOM   1966 C CB    . TYR B 1 92  ? -13.527 -13.000 22.459  1.00 13.87  ? 277  TYR B CB    1 
ATOM   1967 C CG    . TYR B 1 92  ? -14.888 -12.584 22.981  1.00 14.71  ? 277  TYR B CG    1 
ATOM   1968 C CD1   . TYR B 1 92  ? -15.016 -11.603 23.961  1.00 14.56  ? 277  TYR B CD1   1 
ATOM   1969 C CD2   . TYR B 1 92  ? -16.049 -13.152 22.464  1.00 15.25  ? 277  TYR B CD2   1 
ATOM   1970 C CE1   . TYR B 1 92  ? -16.264 -11.212 24.444  1.00 16.55  ? 277  TYR B CE1   1 
ATOM   1971 C CE2   . TYR B 1 92  ? -17.307 -12.766 22.940  1.00 16.39  ? 277  TYR B CE2   1 
ATOM   1972 C CZ    . TYR B 1 92  ? -17.402 -11.797 23.922  1.00 15.86  ? 277  TYR B CZ    1 
ATOM   1973 O OH    . TYR B 1 92  ? -18.633 -11.397 24.399  1.00 17.42  ? 277  TYR B OH    1 
ATOM   1974 N N     . LEU B 1 93  ? -13.415 -14.564 25.542  1.00 13.55  ? 278  LEU B N     1 
ATOM   1975 C CA    . LEU B 1 93  ? -13.829 -15.632 26.447  1.00 13.94  ? 278  LEU B CA    1 
ATOM   1976 C C     . LEU B 1 93  ? -12.864 -16.812 26.305  1.00 13.59  ? 278  LEU B C     1 
ATOM   1977 O O     . LEU B 1 93  ? -11.652 -16.638 26.465  1.00 14.01  ? 278  LEU B O     1 
ATOM   1978 C CB    . LEU B 1 93  ? -15.304 -16.010 26.224  1.00 14.56  ? 278  LEU B CB    1 
ATOM   1979 C CG    . LEU B 1 93  ? -16.255 -14.806 26.086  1.00 15.86  ? 278  LEU B CG    1 
ATOM   1980 C CD1   . LEU B 1 93  ? -17.685 -15.246 25.759  1.00 16.47  ? 278  LEU B CD1   1 
ATOM   1981 C CD2   . LEU B 1 93  ? -16.238 -13.926 27.328  1.00 17.89  ? 278  LEU B CD2   1 
ATOM   1982 N N     . SER B 1 94  ? -13.364 -17.989 25.965  1.00 13.07  ? 279  SER B N     1 
ATOM   1983 C CA    . SER B 1 94  ? -12.523 -19.175 25.936  1.00 12.80  ? 279  SER B CA    1 
ATOM   1984 C C     . SER B 1 94  ? -12.127 -19.603 24.523  1.00 12.22  ? 279  SER B C     1 
ATOM   1985 O O     . SER B 1 94  ? -11.682 -20.725 24.304  1.00 12.65  ? 279  SER B O     1 
ATOM   1986 C CB    . SER B 1 94  ? -13.201 -20.289 26.720  1.00 13.15  ? 279  SER B CB    1 
ATOM   1987 O OG    . SER B 1 94  ? -13.411 -19.833 28.052  1.00 16.45  ? 279  SER B OG    1 
ATOM   1988 N N     . LYS B 1 95  ? -12.271 -18.689 23.571  1.00 11.80  ? 280  LYS B N     1 
ATOM   1989 C CA    . LYS B 1 95  ? -11.900 -18.966 22.192  1.00 12.17  ? 280  LYS B CA    1 
ATOM   1990 C C     . LYS B 1 95  ? -11.072 -17.835 21.597  1.00 11.62  ? 280  LYS B C     1 
ATOM   1991 O O     . LYS B 1 95  ? -10.951 -16.750 22.187  1.00 11.80  ? 280  LYS B O     1 
ATOM   1992 C CB    . LYS B 1 95  ? -13.150 -19.240 21.355  1.00 12.63  ? 280  LYS B CB    1 
ATOM   1993 C CG    . LYS B 1 95  ? -13.812 -20.566 21.711  1.00 15.00  ? 280  LYS B CG    1 
ATOM   1994 C CD    . LYS B 1 95  ? -15.132 -20.787 20.988  1.00 19.38  ? 280  LYS B CD    1 
ATOM   1995 C CE    . LYS B 1 95  ? -15.414 -22.279 20.814  1.00 22.86  ? 280  LYS B CE    1 
ATOM   1996 N NZ    . LYS B 1 95  ? -15.024 -23.129 21.985  1.00 25.24  ? 280  LYS B NZ    1 
ATOM   1997 N N     . THR B 1 96  ? -10.493 -18.116 20.442  1.00 10.79  ? 281  THR B N     1 
ATOM   1998 C CA    . THR B 1 96  ? -9.696  -17.158 19.695  1.00 10.37  ? 281  THR B CA    1 
ATOM   1999 C C     . THR B 1 96  ? -10.403 -16.828 18.385  1.00 10.34  ? 281  THR B C     1 
ATOM   2000 O O     . THR B 1 96  ? -10.942 -17.720 17.705  1.00 10.74  ? 281  THR B O     1 
ATOM   2001 C CB    . THR B 1 96  ? -8.293  -17.707 19.432  1.00 10.69  ? 281  THR B CB    1 
ATOM   2002 O OG1   . THR B 1 96  ? -7.685  -17.989 20.699  1.00 10.93  ? 281  THR B OG1   1 
ATOM   2003 C CG2   . THR B 1 96  ? -7.440  -16.697 18.654  1.00 10.99  ? 281  THR B CG2   1 
ATOM   2004 N N     . TYR B 1 97  ? -10.394 -15.533 18.060  1.00 10.46  ? 282  TYR B N     1 
ATOM   2005 C CA    . TYR B 1 97  ? -11.022 -14.987 16.864  1.00 10.58  ? 282  TYR B CA    1 
ATOM   2006 C C     . TYR B 1 97  ? -10.045 -14.116 16.109  1.00 10.32  ? 282  TYR B C     1 
ATOM   2007 O O     . TYR B 1 97  ? -8.913  -13.925 16.524  1.00 9.93   ? 282  TYR B O     1 
ATOM   2008 C CB    . TYR B 1 97  ? -12.260 -14.169 17.235  1.00 11.96  ? 282  TYR B CB    1 
ATOM   2009 C CG    . TYR B 1 97  ? -13.273 -14.993 17.980  1.00 11.74  ? 282  TYR B CG    1 
ATOM   2010 C CD1   . TYR B 1 97  ? -14.232 -15.744 17.291  1.00 12.73  ? 282  TYR B CD1   1 
ATOM   2011 C CD2   . TYR B 1 97  ? -13.248 -15.060 19.370  1.00 12.78  ? 282  TYR B CD2   1 
ATOM   2012 C CE1   . TYR B 1 97  ? -15.153 -16.527 17.978  1.00 12.80  ? 282  TYR B CE1   1 
ATOM   2013 C CE2   . TYR B 1 97  ? -14.155 -15.842 20.060  1.00 13.12  ? 282  TYR B CE2   1 
ATOM   2014 C CZ    . TYR B 1 97  ? -15.107 -16.569 19.365  1.00 13.50  ? 282  TYR B CZ    1 
ATOM   2015 O OH    . TYR B 1 97  ? -16.012 -17.346 20.047  1.00 14.13  ? 282  TYR B OH    1 
ATOM   2016 N N     . CYS B 1 98  ? -10.496 -13.591 14.982  1.00 10.41  ? 283  CYS B N     1 
ATOM   2017 C CA    . CYS B 1 98  ? -9.660  -12.719 14.180  1.00 10.44  ? 283  CYS B CA    1 
ATOM   2018 C C     . CYS B 1 98  ? -10.553 -11.700 13.495  1.00 10.98  ? 283  CYS B C     1 
ATOM   2019 O O     . CYS B 1 98  ? -11.622 -12.059 12.974  1.00 11.56  ? 283  CYS B O     1 
ATOM   2020 C CB    . CYS B 1 98  ? -8.941  -13.542 13.116  1.00 11.01  ? 283  CYS B CB    1 
ATOM   2021 S SG    . CYS B 1 98  ? -7.794  -12.607 12.103  1.00 11.80  ? 283  CYS B SG    1 
ATOM   2022 N N     . VAL B 1 99  ? -10.120 -10.443 13.492  1.00 10.72  ? 284  VAL B N     1 
ATOM   2023 C CA    . VAL B 1 99  ? -10.708 -9.468  12.580  1.00 9.95   ? 284  VAL B CA    1 
ATOM   2024 C C     . VAL B 1 99  ? -9.829  -9.430  11.337  1.00 10.04  ? 284  VAL B C     1 
ATOM   2025 O O     . VAL B 1 99  ? -8.698  -8.935  11.373  1.00 10.32  ? 284  VAL B O     1 
ATOM   2026 C CB    . VAL B 1 99  ? -10.859 -8.059  13.199  1.00 9.58   ? 284  VAL B CB    1 
ATOM   2027 C CG1   . VAL B 1 99  ? -11.488 -7.126  12.186  1.00 10.75  ? 284  VAL B CG1   1 
ATOM   2028 C CG2   . VAL B 1 99  ? -11.695 -8.118  14.470  1.00 11.06  ? 284  VAL B CG2   1 
ATOM   2029 N N     . ASP B 1 100 ? -10.342 -9.987  10.247  1.00 10.35  ? 285  ASP B N     1 
ATOM   2030 C CA    . ASP B 1 100 ? -9.594  -10.019 9.004   1.00 10.96  ? 285  ASP B CA    1 
ATOM   2031 C C     . ASP B 1 100 ? -9.965  -8.789  8.180   1.00 11.26  ? 285  ASP B C     1 
ATOM   2032 O O     . ASP B 1 100 ? -11.019 -8.761  7.537   1.00 11.44  ? 285  ASP B O     1 
ATOM   2033 C CB    . ASP B 1 100 ? -9.878  -11.304 8.216   1.00 11.84  ? 285  ASP B CB    1 
ATOM   2034 C CG    . ASP B 1 100 ? -9.114  -11.362 6.905   1.00 11.84  ? 285  ASP B CG    1 
ATOM   2035 O OD1   . ASP B 1 100 ? -8.324  -10.420 6.645   1.00 13.55  ? 285  ASP B OD1   1 
ATOM   2036 O OD2   . ASP B 1 100 ? -9.296  -12.347 6.140   1.00 13.51  ? 285  ASP B OD2   1 
ATOM   2037 N N     . ALA B 1 101 ? -9.100  -7.774  8.208   1.00 10.80  ? 286  ALA B N     1 
ATOM   2038 C CA    . ALA B 1 101 ? -9.360  -6.538  7.454   1.00 10.95  ? 286  ALA B CA    1 
ATOM   2039 C C     . ALA B 1 101 ? -8.562  -6.434  6.157   1.00 11.10  ? 286  ALA B C     1 
ATOM   2040 O O     . ALA B 1 101 ? -8.233  -5.328  5.707   1.00 10.99  ? 286  ALA B O     1 
ATOM   2041 C CB    . ALA B 1 101 ? -9.128  -5.299  8.344   1.00 11.13  ? 286  ALA B CB    1 
ATOM   2042 N N     . THR B 1 102 ? -8.275  -7.582  5.548   1.00 11.30  ? 287  THR B N     1 
ATOM   2043 C CA    . THR B 1 102 ? -7.488  -7.599  4.312   1.00 11.51  ? 287  THR B CA    1 
ATOM   2044 C C     . THR B 1 102 ? -8.155  -6.812  3.200   1.00 12.02  ? 287  THR B C     1 
ATOM   2045 O O     . THR B 1 102 ? -7.487  -6.080  2.483   1.00 12.52  ? 287  THR B O     1 
ATOM   2046 C CB    . THR B 1 102 ? -7.193  -9.038  3.847   1.00 10.95  ? 287  THR B CB    1 
ATOM   2047 O OG1   . THR B 1 102 ? -6.458  -9.708  4.874   1.00 11.13  ? 287  THR B OG1   1 
ATOM   2048 C CG2   . THR B 1 102 ? -6.376  -9.063  2.560   1.00 12.11  ? 287  THR B CG2   1 
ATOM   2049 N N     . ARG B 1 103 ? -9.467  -6.958  3.068   1.00 12.71  ? 288  ARG B N     1 
ATOM   2050 C CA    . ARG B 1 103 ? -10.181 -6.263  1.997   1.00 12.95  ? 288  ARG B CA    1 
ATOM   2051 C C     . ARG B 1 103 ? -10.121 -4.754  2.204   1.00 12.71  ? 288  ARG B C     1 
ATOM   2052 O O     . ARG B 1 103 ? -10.356 -4.266  3.311   1.00 13.09  ? 288  ARG B O     1 
ATOM   2053 C CB    . ARG B 1 103 ? -11.632 -6.731  1.944   1.00 13.64  ? 288  ARG B CB    1 
ATOM   2054 C CG    . ARG B 1 103 ? -12.464 -6.024  0.887   1.00 15.11  ? 288  ARG B CG    1 
ATOM   2055 C CD    . ARG B 1 103 ? -13.832 -6.667  0.741   1.00 18.29  ? 288  ARG B CD    1 
ATOM   2056 N NE    . ARG B 1 103 ? -14.693 -6.332  1.873   1.00 20.68  ? 288  ARG B NE    1 
ATOM   2057 C CZ    . ARG B 1 103 ? -15.417 -5.219  1.972   1.00 21.33  ? 288  ARG B CZ    1 
ATOM   2058 N NH1   . ARG B 1 103 ? -15.411 -4.314  0.995   1.00 21.60  ? 288  ARG B NH1   1 
ATOM   2059 N NH2   . ARG B 1 103 ? -16.165 -5.016  3.052   1.00 22.11  ? 288  ARG B NH2   1 
ATOM   2060 N N     . GLU B 1 104 ? -9.803  -4.020  1.140   1.00 12.86  ? 289  GLU B N     1 
ATOM   2061 C CA    . GLU B 1 104 ? -9.737  -2.565  1.202   1.00 12.86  ? 289  GLU B CA    1 
ATOM   2062 C C     . GLU B 1 104 ? -11.126 -1.951  1.335   1.00 12.95  ? 289  GLU B C     1 
ATOM   2063 O O     . GLU B 1 104 ? -12.006 -2.195  0.511   1.00 14.06  ? 289  GLU B O     1 
ATOM   2064 C CB    . GLU B 1 104 ? -9.000  -1.987  -0.020  1.00 13.05  ? 289  GLU B CB    1 
ATOM   2065 C CG    . GLU B 1 104 ? -7.486  -2.272  -0.006  1.00 13.61  ? 289  GLU B CG    1 
ATOM   2066 C CD    . GLU B 1 104 ? -6.688  -1.337  0.893   1.00 13.78  ? 289  GLU B CD    1 
ATOM   2067 O OE1   . GLU B 1 104 ? -7.035  -0.152  1.008   1.00 13.19  ? 289  GLU B OE1   1 
ATOM   2068 O OE2   . GLU B 1 104 ? -5.692  -1.797  1.488   1.00 15.18  ? 289  GLU B OE2   1 
ATOM   2069 N N     . THR B 1 105 ? -11.300 -1.147  2.378   1.00 12.91  ? 290  THR B N     1 
ATOM   2070 C CA    . THR B 1 105 ? -12.565 -0.454  2.648   1.00 12.48  ? 290  THR B CA    1 
ATOM   2071 C C     . THR B 1 105 ? -12.237 1.001   2.978   1.00 12.36  ? 290  THR B C     1 
ATOM   2072 O O     . THR B 1 105 ? -11.076 1.423   2.897   1.00 11.55  ? 290  THR B O     1 
ATOM   2073 C CB    . THR B 1 105 ? -13.298 -1.076  3.861   1.00 12.61  ? 290  THR B CB    1 
ATOM   2074 O OG1   . THR B 1 105 ? -12.487 -0.872  5.024   1.00 12.62  ? 290  THR B OG1   1 
ATOM   2075 C CG2   . THR B 1 105 ? -13.545 -2.564  3.666   1.00 12.85  ? 290  THR B CG2   1 
ATOM   2076 N N     . ASN B 1 106 ? -13.240 1.780   3.359   1.00 12.71  ? 291  ASN B N     1 
ATOM   2077 C CA    . ASN B 1 106 ? -12.980 3.152   3.803   1.00 12.83  ? 291  ASN B CA    1 
ATOM   2078 C C     . ASN B 1 106 ? -12.679 3.257   5.285   1.00 12.57  ? 291  ASN B C     1 
ATOM   2079 O O     . ASN B 1 106 ? -12.465 4.351   5.805   1.00 13.31  ? 291  ASN B O     1 
ATOM   2080 C CB    . ASN B 1 106 ? -14.137 4.088   3.446   1.00 13.83  ? 291  ASN B CB    1 
ATOM   2081 C CG    . ASN B 1 106 ? -14.271 4.295   1.955   1.00 15.18  ? 291  ASN B CG    1 
ATOM   2082 O OD1   . ASN B 1 106 ? -13.286 4.552   1.262   1.00 17.23  ? 291  ASN B OD1   1 
ATOM   2083 N ND2   . ASN B 1 106 ? -15.489 4.162   1.450   1.00 19.23  ? 291  ASN B ND2   1 
ATOM   2084 N N     . ARG B 1 107 ? -12.658 2.110   5.955   1.00 12.27  ? 292  ARG B N     1 
ATOM   2085 C CA    . ARG B 1 107 ? -12.465 2.081   7.410   1.00 12.04  ? 292  ARG B CA    1 
ATOM   2086 C C     . ARG B 1 107 ? -11.006 2.331   7.752   1.00 11.73  ? 292  ARG B C     1 
ATOM   2087 O O     . ARG B 1 107 ? -10.112 1.780   7.097   1.00 12.53  ? 292  ARG B O     1 
ATOM   2088 C CB    . ARG B 1 107 ? -12.895 0.733   7.972   1.00 12.91  ? 292  ARG B CB    1 
ATOM   2089 C CG    . ARG B 1 107 ? -14.377 0.457   7.806   1.00 14.32  ? 292  ARG B CG    1 
ATOM   2090 C CD    . ARG B 1 107 ? -15.238 1.475   8.547   1.00 18.67  ? 292  ARG B CD    1 
ATOM   2091 N NE    . ARG B 1 107 ? -16.533 0.898   8.892   1.00 20.82  ? 292  ARG B NE    1 
ATOM   2092 C CZ    . ARG B 1 107 ? -17.049 0.837   10.119  1.00 18.30  ? 292  ARG B CZ    1 
ATOM   2093 N NH1   . ARG B 1 107 ? -16.409 1.354   11.178  1.00 15.80  ? 292  ARG B NH1   1 
ATOM   2094 N NH2   . ARG B 1 107 ? -18.239 0.279   10.282  1.00 18.21  ? 292  ARG B NH2   1 
ATOM   2095 N N     . LEU B 1 108 ? -10.755 3.138   8.787   1.00 10.55  ? 293  LEU B N     1 
ATOM   2096 C CA    . LEU B 1 108 ? -9.392  3.620   9.056   1.00 10.46  ? 293  LEU B CA    1 
ATOM   2097 C C     . LEU B 1 108 ? -8.558  2.764   10.013  1.00 9.70   ? 293  LEU B C     1 
ATOM   2098 O O     . LEU B 1 108 ? -7.331  2.851   10.009  1.00 10.00  ? 293  LEU B O     1 
ATOM   2099 C CB    . LEU B 1 108 ? -9.418  5.074   9.550   1.00 10.80  ? 293  LEU B CB    1 
ATOM   2100 C CG    . LEU B 1 108 ? -9.961  6.072   8.513   1.00 12.25  ? 293  LEU B CG    1 
ATOM   2101 C CD1   . LEU B 1 108 ? -10.074 7.450   9.136   1.00 13.51  ? 293  LEU B CD1   1 
ATOM   2102 C CD2   . LEU B 1 108 ? -9.057  6.116   7.302   1.00 14.35  ? 293  LEU B CD2   1 
ATOM   2103 N N     . GLY B 1 109 ? -9.205  1.960   10.856  1.00 9.27   ? 294  GLY B N     1 
ATOM   2104 C CA    . GLY B 1 109 ? -8.460  1.215   11.869  1.00 9.41   ? 294  GLY B CA    1 
ATOM   2105 C C     . GLY B 1 109 ? -7.376  0.354   11.252  1.00 9.03   ? 294  GLY B C     1 
ATOM   2106 O O     . GLY B 1 109 ? -6.258  0.261   11.780  1.00 9.37   ? 294  GLY B O     1 
ATOM   2107 N N     . ARG B 1 110 ? -7.722  -0.276  10.125  1.00 9.61   ? 295  ARG B N     1 
ATOM   2108 C CA    . ARG B 1 110 ? -6.833  -1.194  9.414   1.00 10.37  ? 295  ARG B CA    1 
ATOM   2109 C C     . ARG B 1 110 ? -5.599  -0.515  8.840   1.00 10.12  ? 295  ARG B C     1 
ATOM   2110 O O     . ARG B 1 110 ? -4.638  -1.198  8.495   1.00 11.13  ? 295  ARG B O     1 
ATOM   2111 C CB    . ARG B 1 110 ? -7.593  -1.896  8.286   1.00 10.07  ? 295  ARG B CB    1 
ATOM   2112 C CG    . ARG B 1 110 ? -8.201  -0.939  7.267   1.00 10.72  ? 295  ARG B CG    1 
ATOM   2113 C CD    . ARG B 1 110 ? -9.081  -1.661  6.241   1.00 11.10  ? 295  ARG B CD    1 
ATOM   2114 N NE    . ARG B 1 110 ? -8.328  -2.631  5.443   1.00 9.98   ? 295  ARG B NE    1 
ATOM   2115 C CZ    . ARG B 1 110 ? -7.586  -2.311  4.386   1.00 10.49  ? 295  ARG B CZ    1 
ATOM   2116 N NH1   . ARG B 1 110 ? -7.470  -1.037  4.013   1.00 10.86  ? 295  ARG B NH1   1 
ATOM   2117 N NH2   . ARG B 1 110 ? -6.938  -3.267  3.726   1.00 11.03  ? 295  ARG B NH2   1 
ATOM   2118 N N     . LEU B 1 111 ? -5.616  0.818   8.774   1.00 9.99   ? 296  LEU B N     1 
ATOM   2119 C CA    . LEU B 1 111 ? -4.493  1.576   8.204   1.00 10.06  ? 296  LEU B CA    1 
ATOM   2120 C C     . LEU B 1 111 ? -3.520  2.116   9.242   1.00 10.27  ? 296  LEU B C     1 
ATOM   2121 O O     . LEU B 1 111 ? -2.509  2.714   8.891   1.00 10.27  ? 296  LEU B O     1 
ATOM   2122 C CB    . LEU B 1 111 ? -4.995  2.737   7.337   1.00 10.67  ? 296  LEU B CB    1 
ATOM   2123 C CG    . LEU B 1 111 ? -5.790  2.344   6.089   1.00 10.27  ? 296  LEU B CG    1 
ATOM   2124 C CD1   . LEU B 1 111 ? -6.219  3.600   5.351   1.00 11.85  ? 296  LEU B CD1   1 
ATOM   2125 C CD2   . LEU B 1 111 ? -4.978  1.415   5.189   1.00 12.63  ? 296  LEU B CD2   1 
ATOM   2126 N N     . ILE B 1 112 ? -3.822  1.898   10.512  1.00 9.20   ? 297  ILE B N     1 
ATOM   2127 C CA    . ILE B 1 112 ? -3.002  2.485   11.568  1.00 9.17   ? 297  ILE B CA    1 
ATOM   2128 C C     . ILE B 1 112 ? -1.737  1.657   11.746  1.00 8.82   ? 297  ILE B C     1 
ATOM   2129 O O     . ILE B 1 112 ? -1.788  0.428   11.799  1.00 9.44   ? 297  ILE B O     1 
ATOM   2130 C CB    . ILE B 1 112 ? -3.804  2.612   12.874  1.00 9.59   ? 297  ILE B CB    1 
ATOM   2131 C CG1   . ILE B 1 112 ? -4.882  3.685   12.666  1.00 11.02  ? 297  ILE B CG1   1 
ATOM   2132 C CG2   . ILE B 1 112 ? -2.903  3.014   14.061  1.00 9.18   ? 297  ILE B CG2   1 
ATOM   2133 C CD1   . ILE B 1 112 ? -5.868  3.838   13.761  1.00 11.55  ? 297  ILE B CD1   1 
ATOM   2134 N N     . ASN B 1 113 ? -0.611  2.347   11.841  1.00 8.16   ? 298  ASN B N     1 
ATOM   2135 C CA    . ASN B 1 113 ? 0.670   1.676   11.918  1.00 7.83   ? 298  ASN B CA    1 
ATOM   2136 C C     . ASN B 1 113 ? 1.112   1.301   13.330  1.00 8.30   ? 298  ASN B C     1 
ATOM   2137 O O     . ASN B 1 113 ? 0.409   1.597   14.317  1.00 8.71   ? 298  ASN B O     1 
ATOM   2138 C CB    . ASN B 1 113 ? 1.713   2.516   11.182  1.00 7.78   ? 298  ASN B CB    1 
ATOM   2139 C CG    . ASN B 1 113 ? 1.446   2.543   9.688   1.00 8.55   ? 298  ASN B CG    1 
ATOM   2140 O OD1   . ASN B 1 113 ? 1.192   1.494   9.081   1.00 9.17   ? 298  ASN B OD1   1 
ATOM   2141 N ND2   . ASN B 1 113 ? 1.464   3.743   9.090   1.00 9.09   ? 298  ASN B ND2   1 
ATOM   2142 N N     . HIS B 1 114 ? 2.262   0.614   13.398  1.00 8.48   ? 299  HIS B N     1 
ATOM   2143 C CA    . HIS B 1 114 ? 2.766   0.004   14.620  1.00 8.80   ? 299  HIS B CA    1 
ATOM   2144 C C     . HIS B 1 114 ? 3.795   0.842   15.352  1.00 8.97   ? 299  HIS B C     1 
ATOM   2145 O O     . HIS B 1 114 ? 4.667   1.457   14.730  1.00 9.70   ? 299  HIS B O     1 
ATOM   2146 C CB    . HIS B 1 114 ? 3.426   -1.342  14.271  1.00 8.63   ? 299  HIS B CB    1 
ATOM   2147 C CG    . HIS B 1 114 ? 4.305   -1.874  15.359  1.00 9.09   ? 299  HIS B CG    1 
ATOM   2148 N ND1   . HIS B 1 114 ? 3.823   -2.593  16.436  1.00 9.09   ? 299  HIS B ND1   1 
ATOM   2149 C CD2   . HIS B 1 114 ? 5.641   -1.769  15.548  1.00 8.76   ? 299  HIS B CD2   1 
ATOM   2150 C CE1   . HIS B 1 114 ? 4.820   -2.898  17.247  1.00 9.41   ? 299  HIS B CE1   1 
ATOM   2151 N NE2   . HIS B 1 114 ? 5.938   -2.409  16.732  1.00 10.13  ? 299  HIS B NE2   1 
ATOM   2152 N N     . SER B 1 115 ? 3.711   0.803   16.684  1.00 9.49   ? 300  SER B N     1 
ATOM   2153 C CA    . SER B 1 115 ? 4.808   1.228   17.560  1.00 10.04  ? 300  SER B CA    1 
ATOM   2154 C C     . SER B 1 115 ? 4.637   0.532   18.892  1.00 10.76  ? 300  SER B C     1 
ATOM   2155 O O     . SER B 1 115 ? 3.511   0.356   19.356  1.00 11.99  ? 300  SER B O     1 
ATOM   2156 C CB    . SER B 1 115 ? 4.755   2.739   17.811  1.00 10.47  ? 300  SER B CB    1 
ATOM   2157 O OG    . SER B 1 115 ? 5.794   3.145   18.688  1.00 11.95  ? 300  SER B OG    1 
ATOM   2158 N N     . LYS B 1 116 ? 5.748   0.202   19.540  1.00 12.34  ? 301  LYS B N     1 
ATOM   2159 C CA    . LYS B 1 116 ? 5.678   -0.276  20.918  1.00 13.75  ? 301  LYS B CA    1 
ATOM   2160 C C     . LYS B 1 116 ? 5.512   0.880   21.891  1.00 15.03  ? 301  LYS B C     1 
ATOM   2161 O O     . LYS B 1 116 ? 5.266   0.658   23.088  1.00 16.85  ? 301  LYS B O     1 
ATOM   2162 C CB    . LYS B 1 116 ? 6.951   -1.023  21.294  1.00 14.33  ? 301  LYS B CB    1 
ATOM   2163 C CG    . LYS B 1 116 ? 7.171   -2.324  20.585  1.00 14.40  ? 301  LYS B CG    1 
ATOM   2164 C CD    . LYS B 1 116 ? 8.512   -2.877  21.038  1.00 16.66  ? 301  LYS B CD    1 
ATOM   2165 C CE    . LYS B 1 116 ? 8.791   -4.197  20.399  1.00 18.46  ? 301  LYS B CE    1 
ATOM   2166 N NZ    . LYS B 1 116 ? 10.000  -4.778  21.031  1.00 20.36  ? 301  LYS B NZ    1 
ATOM   2167 N N     . CYS B 1 117 ? 5.714   2.106   21.410  1.00 14.95  ? 302  CYS B N     1 
ATOM   2168 C CA    . CYS B 1 117 ? 5.552   3.295   22.249  1.00 16.33  ? 302  CYS B CA    1 
ATOM   2169 C C     . CYS B 1 117 ? 4.610   4.266   21.570  1.00 15.43  ? 302  CYS B C     1 
ATOM   2170 O O     . CYS B 1 117 ? 4.909   5.453   21.425  1.00 15.98  ? 302  CYS B O     1 
ATOM   2171 C CB    . CYS B 1 117 ? 6.908   3.947   22.527  1.00 17.58  ? 302  CYS B CB    1 
ATOM   2172 S SG    . CYS B 1 117 ? 7.892   4.258   21.055  1.00 23.57  ? 302  CYS B SG    1 
ATOM   2173 N N     . GLY B 1 118 ? 3.449   3.754   21.179  1.00 14.37  ? 303  GLY B N     1 
ATOM   2174 C CA    . GLY B 1 118 ? 2.478   4.558   20.458  1.00 13.71  ? 303  GLY B CA    1 
ATOM   2175 C C     . GLY B 1 118 ? 1.552   5.356   21.351  1.00 12.90  ? 303  GLY B C     1 
ATOM   2176 O O     . GLY B 1 118 ? 1.883   5.666   22.521  1.00 13.83  ? 303  GLY B O     1 
ATOM   2177 N N     . ASN B 1 119 ? 0.389   5.702   20.801  1.00 11.52  ? 304  ASN B N     1 
ATOM   2178 C CA    . ASN B 1 119 ? -0.559  6.559   21.503  1.00 11.32  ? 304  ASN B CA    1 
ATOM   2179 C C     . ASN B 1 119 ? -1.962  5.969   21.584  1.00 11.01  ? 304  ASN B C     1 
ATOM   2180 O O     . ASN B 1 119 ? -2.869  6.610   22.109  1.00 11.43  ? 304  ASN B O     1 
ATOM   2181 C CB    . ASN B 1 119 ? -0.592  7.973   20.894  1.00 11.30  ? 304  ASN B CB    1 
ATOM   2182 C CG    . ASN B 1 119 ? -0.725  7.945   19.385  1.00 10.34  ? 304  ASN B CG    1 
ATOM   2183 O OD1   . ASN B 1 119 ? -1.325  7.021   18.825  1.00 10.45  ? 304  ASN B OD1   1 
ATOM   2184 N ND2   . ASN B 1 119 ? -0.172  8.956   18.719  1.00 10.95  ? 304  ASN B ND2   1 
ATOM   2185 N N     . CYS B 1 120 ? -2.125  4.750   21.060  1.00 11.21  ? 305  CYS B N     1 
ATOM   2186 C CA    . CYS B 1 120 ? -3.393  4.027   21.131  1.00 11.31  ? 305  CYS B CA    1 
ATOM   2187 C C     . CYS B 1 120 ? -3.171  2.639   21.727  1.00 11.21  ? 305  CYS B C     1 
ATOM   2188 O O     . CYS B 1 120 ? -2.083  2.077   21.616  1.00 11.29  ? 305  CYS B O     1 
ATOM   2189 C CB    . CYS B 1 120 ? -4.014  3.880   19.733  1.00 11.57  ? 305  CYS B CB    1 
ATOM   2190 S SG    . CYS B 1 120 ? -4.555  5.438   18.994  1.00 12.36  ? 305  CYS B SG    1 
ATOM   2191 N N     . GLN B 1 121 ? -4.206  2.109   22.372  1.00 12.21  ? 306  GLN B N     1 
ATOM   2192 C CA    . GLN B 1 121 ? -4.187  0.755   22.920  1.00 13.85  ? 306  GLN B CA    1 
ATOM   2193 C C     . GLN B 1 121 ? -5.459  0.043   22.452  1.00 12.70  ? 306  GLN B C     1 
ATOM   2194 O O     . GLN B 1 121 ? -6.553  0.596   22.536  1.00 13.05  ? 306  GLN B O     1 
ATOM   2195 C CB    . GLN B 1 121 ? -4.136  0.799   24.458  1.00 14.21  ? 306  GLN B CB    1 
ATOM   2196 C CG    . GLN B 1 121 ? -4.045  -0.582  25.134  1.00 17.91  ? 306  GLN B CG    1 
ATOM   2197 C CD    . GLN B 1 121 ? -4.015  -0.499  26.648  1.00 19.20  ? 306  GLN B CD    1 
ATOM   2198 O OE1   . GLN B 1 121 ? -3.919  0.585   27.220  1.00 24.84  ? 306  GLN B OE1   1 
ATOM   2199 N NE2   . GLN B 1 121 ? -4.089  -1.654  27.307  1.00 24.11  ? 306  GLN B NE2   1 
ATOM   2200 N N     . THR B 1 122 ? -5.318  -1.172  21.946  1.00 12.77  ? 307  THR B N     1 
ATOM   2201 C CA    . THR B 1 122 ? -6.476  -1.941  21.493  1.00 13.29  ? 307  THR B CA    1 
ATOM   2202 C C     . THR B 1 122 ? -7.142  -2.618  22.680  1.00 13.72  ? 307  THR B C     1 
ATOM   2203 O O     . THR B 1 122 ? -6.467  -3.132  23.573  1.00 14.41  ? 307  THR B O     1 
ATOM   2204 C CB    . THR B 1 122 ? -6.029  -2.985  20.470  1.00 13.40  ? 307  THR B CB    1 
ATOM   2205 O OG1   . THR B 1 122 ? -5.316  -2.306  19.433  1.00 14.02  ? 307  THR B OG1   1 
ATOM   2206 C CG2   . THR B 1 122 ? -7.228  -3.737  19.849  1.00 13.08  ? 307  THR B CG2   1 
ATOM   2207 N N     . LYS B 1 123 ? -8.468  -2.608  22.693  1.00 14.34  ? 308  LYS B N     1 
ATOM   2208 C CA    . LYS B 1 123 ? -9.207  -3.329  23.717  1.00 16.37  ? 308  LYS B CA    1 
ATOM   2209 C C     . LYS B 1 123 ? -10.439 -3.988  23.137  1.00 15.94  ? 308  LYS B C     1 
ATOM   2210 O O     . LYS B 1 123 ? -10.930 -3.594  22.071  1.00 14.32  ? 308  LYS B O     1 
ATOM   2211 C CB    . LYS B 1 123 ? -9.583  -2.416  24.885  1.00 17.38  ? 308  LYS B CB    1 
ATOM   2212 C CG    . LYS B 1 123 ? -10.667 -1.421  24.589  1.00 19.07  ? 308  LYS B CG    1 
ATOM   2213 C CD    . LYS B 1 123 ? -11.152 -0.701  25.858  1.00 19.89  ? 308  LYS B CD    1 
ATOM   2214 C CE    . LYS B 1 123 ? -11.768 -1.668  26.872  1.00 24.45  ? 308  LYS B CE    1 
ATOM   2215 N NZ    . LYS B 1 123 ? -12.064 -1.002  28.169  1.00 27.37  ? 308  LYS B NZ    1 
ATOM   2216 N N     . LEU B 1 124 ? -10.899 -5.019  23.836  1.00 16.66  ? 309  LEU B N     1 
ATOM   2217 C CA    . LEU B 1 124 ? -12.147 -5.681  23.532  1.00 18.13  ? 309  LEU B CA    1 
ATOM   2218 C C     . LEU B 1 124 ? -13.305 -4.874  24.084  1.00 17.87  ? 309  LEU B C     1 
ATOM   2219 O O     . LEU B 1 124 ? -13.287 -4.464  25.250  1.00 19.03  ? 309  LEU B O     1 
ATOM   2220 C CB    . LEU B 1 124 ? -12.161 -7.075  24.170  1.00 19.17  ? 309  LEU B CB    1 
ATOM   2221 C CG    . LEU B 1 124 ? -11.852 -8.289  23.311  1.00 21.97  ? 309  LEU B CG    1 
ATOM   2222 C CD1   . LEU B 1 124 ? -11.595 -9.498  24.185  1.00 24.39  ? 309  LEU B CD1   1 
ATOM   2223 C CD2   . LEU B 1 124 ? -13.000 -8.560  22.373  1.00 22.43  ? 309  LEU B CD2   1 
ATOM   2224 N N     . HIS B 1 125 ? -14.301 -4.635  23.246  1.00 17.44  ? 310  HIS B N     1 
ATOM   2225 C CA    . HIS B 1 125 ? -15.544 -4.012  23.670  1.00 17.74  ? 310  HIS B CA    1 
ATOM   2226 C C     . HIS B 1 125 ? -16.644 -4.884  23.115  1.00 18.44  ? 310  HIS B C     1 
ATOM   2227 O O     . HIS B 1 125 ? -16.898 -4.875  21.911  1.00 18.51  ? 310  HIS B O     1 
ATOM   2228 C CB    . HIS B 1 125 ? -15.647 -2.582  23.130  1.00 18.13  ? 310  HIS B CB    1 
ATOM   2229 C CG    . HIS B 1 125 ? -16.815 -1.811  23.660  1.00 17.09  ? 310  HIS B CG    1 
ATOM   2230 N ND1   . HIS B 1 125 ? -16.720 -0.964  24.746  1.00 17.91  ? 310  HIS B ND1   1 
ATOM   2231 C CD2   . HIS B 1 125 ? -18.102 -1.750  23.247  1.00 17.50  ? 310  HIS B CD2   1 
ATOM   2232 C CE1   . HIS B 1 125 ? -17.903 -0.425  24.983  1.00 17.70  ? 310  HIS B CE1   1 
ATOM   2233 N NE2   . HIS B 1 125 ? -18.757 -0.877  24.080  1.00 16.44  ? 310  HIS B NE2   1 
ATOM   2234 N N     . ASP B 1 126 ? -17.286 -5.679  23.964  1.00 19.07  ? 311  ASP B N     1 
ATOM   2235 C CA    . ASP B 1 126 ? -18.354 -6.491  23.413  1.00 19.97  ? 311  ASP B CA    1 
ATOM   2236 C C     . ASP B 1 126 ? -19.704 -5.793  23.496  1.00 19.63  ? 311  ASP B C     1 
ATOM   2237 O O     . ASP B 1 126 ? -19.946 -4.947  24.371  1.00 20.41  ? 311  ASP B O     1 
ATOM   2238 C CB    . ASP B 1 126 ? -18.358 -7.937  23.934  1.00 20.82  ? 311  ASP B CB    1 
ATOM   2239 C CG    . ASP B 1 126 ? -18.636 -8.040  25.410  1.00 22.96  ? 311  ASP B CG    1 
ATOM   2240 O OD1   . ASP B 1 126 ? -18.582 -7.002  26.105  1.00 24.82  ? 311  ASP B OD1   1 
ATOM   2241 O OD2   . ASP B 1 126 ? -18.895 -9.181  25.872  1.00 24.32  ? 311  ASP B OD2   1 
ATOM   2242 N N     . ILE B 1 127 ? -20.546 -6.098  22.524  1.00 19.00  ? 312  ILE B N     1 
ATOM   2243 C CA    . ILE B 1 127 ? -21.887 -5.552  22.484  1.00 18.93  ? 312  ILE B CA    1 
ATOM   2244 C C     . ILE B 1 127 ? -22.783 -6.767  22.363  1.00 18.39  ? 312  ILE B C     1 
ATOM   2245 O O     . ILE B 1 127 ? -22.793 -7.442  21.329  1.00 17.95  ? 312  ILE B O     1 
ATOM   2246 C CB    . ILE B 1 127 ? -22.096 -4.583  21.293  1.00 18.68  ? 312  ILE B CB    1 
ATOM   2247 C CG1   . ILE B 1 127 ? -21.109 -3.403  21.381  1.00 19.14  ? 312  ILE B CG1   1 
ATOM   2248 C CG2   . ILE B 1 127 ? -23.555 -4.096  21.228  1.00 19.20  ? 312  ILE B CG2   1 
ATOM   2249 C CD1   . ILE B 1 127 ? -21.235 -2.393  20.260  1.00 19.56  ? 312  ILE B CD1   1 
ATOM   2250 N N     . ASP B 1 128 ? -23.494 -7.060  23.454  1.00 18.38  ? 313  ASP B N     1 
ATOM   2251 C CA    . ASP B 1 128 ? -24.437 -8.169  23.509  1.00 18.29  ? 313  ASP B CA    1 
ATOM   2252 C C     . ASP B 1 128 ? -23.822 -9.477  22.994  1.00 17.33  ? 313  ASP B C     1 
ATOM   2253 O O     . ASP B 1 128 ? -24.411 -10.167 22.154  1.00 17.17  ? 313  ASP B O     1 
ATOM   2254 C CB    . ASP B 1 128 ? -25.716 -7.801  22.739  1.00 18.62  ? 313  ASP B CB    1 
ATOM   2255 C CG    . ASP B 1 128 ? -26.897 -8.665  23.116  1.00 20.72  ? 313  ASP B CG    1 
ATOM   2256 O OD1   . ASP B 1 128 ? -27.827 -8.759  22.288  1.00 23.88  ? 313  ASP B OD1   1 
ATOM   2257 O OD2   . ASP B 1 128 ? -26.894 -9.232  24.232  1.00 22.90  ? 313  ASP B OD2   1 
ATOM   2258 N N     . GLY B 1 129 ? -22.623 -9.793  23.495  1.00 16.10  ? 314  GLY B N     1 
ATOM   2259 C CA    . GLY B 1 129 ? -21.935 -11.046 23.172  1.00 15.39  ? 314  GLY B CA    1 
ATOM   2260 C C     . GLY B 1 129 ? -21.194 -11.070 21.841  1.00 14.24  ? 314  GLY B C     1 
ATOM   2261 O O     . GLY B 1 129 ? -20.685 -12.123 21.426  1.00 13.69  ? 314  GLY B O     1 
ATOM   2262 N N     . VAL B 1 130 ? -21.124 -9.918  21.168  1.00 13.90  ? 315  VAL B N     1 
ATOM   2263 C CA    . VAL B 1 130 ? -20.342 -9.803  19.944  1.00 13.17  ? 315  VAL B CA    1 
ATOM   2264 C C     . VAL B 1 130 ? -19.129 -8.946  20.255  1.00 12.45  ? 315  VAL B C     1 
ATOM   2265 O O     . VAL B 1 130 ? -19.278 -7.808  20.704  1.00 12.83  ? 315  VAL B O     1 
ATOM   2266 C CB    . VAL B 1 130 ? -21.167 -9.177  18.800  1.00 13.42  ? 315  VAL B CB    1 
ATOM   2267 C CG1   . VAL B 1 130 ? -20.315 -9.028  17.537  1.00 14.85  ? 315  VAL B CG1   1 
ATOM   2268 C CG2   . VAL B 1 130 ? -22.372 -10.054 18.515  1.00 13.31  ? 315  VAL B CG2   1 
ATOM   2269 N N     . PRO B 1 131 ? -17.918 -9.510  20.072  1.00 11.79  ? 316  PRO B N     1 
ATOM   2270 C CA    . PRO B 1 131 ? -16.711 -8.765  20.382  1.00 12.05  ? 316  PRO B CA    1 
ATOM   2271 C C     . PRO B 1 131 ? -16.332 -7.778  19.287  1.00 12.48  ? 316  PRO B C     1 
ATOM   2272 O O     . PRO B 1 131 ? -16.498 -8.048  18.097  1.00 13.41  ? 316  PRO B O     1 
ATOM   2273 C CB    . PRO B 1 131 ? -15.651 -9.868  20.497  1.00 12.80  ? 316  PRO B CB    1 
ATOM   2274 C CG    . PRO B 1 131 ? -16.103 -10.913 19.558  1.00 13.07  ? 316  PRO B CG    1 
ATOM   2275 C CD    . PRO B 1 131 ? -17.617 -10.869 19.574  1.00 12.46  ? 316  PRO B CD    1 
ATOM   2276 N N     . HIS B 1 132 ? -15.859 -6.623  19.724  1.00 12.43  ? 317  HIS B N     1 
ATOM   2277 C CA    . HIS B 1 132 ? -15.300 -5.623  18.836  1.00 12.53  ? 317  HIS B CA    1 
ATOM   2278 C C     . HIS B 1 132 ? -13.936 -5.245  19.348  1.00 12.29  ? 317  HIS B C     1 
ATOM   2279 O O     . HIS B 1 132 ? -13.736 -5.123  20.564  1.00 13.21  ? 317  HIS B O     1 
ATOM   2280 C CB    . HIS B 1 132 ? -16.194 -4.379  18.804  1.00 12.79  ? 317  HIS B CB    1 
ATOM   2281 C CG    . HIS B 1 132 ? -17.558 -4.650  18.262  1.00 12.99  ? 317  HIS B CG    1 
ATOM   2282 N ND1   . HIS B 1 132 ? -17.875 -4.480  16.932  1.00 12.11  ? 317  HIS B ND1   1 
ATOM   2283 C CD2   . HIS B 1 132 ? -18.678 -5.125  18.861  1.00 13.88  ? 317  HIS B CD2   1 
ATOM   2284 C CE1   . HIS B 1 132 ? -19.140 -4.820  16.739  1.00 13.36  ? 317  HIS B CE1   1 
ATOM   2285 N NE2   . HIS B 1 132 ? -19.650 -5.203  17.897  1.00 14.04  ? 317  HIS B NE2   1 
ATOM   2286 N N     . LEU B 1 133 ? -12.992 -5.101  18.431  1.00 11.61  ? 318  LEU B N     1 
ATOM   2287 C CA    . LEU B 1 133 ? -11.682 -4.562  18.776  1.00 11.92  ? 318  LEU B CA    1 
ATOM   2288 C C     . LEU B 1 133 ? -11.724 -3.069  18.545  1.00 11.65  ? 318  LEU B C     1 
ATOM   2289 O O     . LEU B 1 133 ? -11.999 -2.620  17.431  1.00 11.38  ? 318  LEU B O     1 
ATOM   2290 C CB    . LEU B 1 133 ? -10.575 -5.156  17.901  1.00 12.36  ? 318  LEU B CB    1 
ATOM   2291 C CG    . LEU B 1 133 ? -10.206 -6.618  18.110  1.00 12.94  ? 318  LEU B CG    1 
ATOM   2292 C CD1   . LEU B 1 133 ? -8.969  -6.968  17.273  1.00 14.01  ? 318  LEU B CD1   1 
ATOM   2293 C CD2   . LEU B 1 133 ? -9.979  -6.938  19.588  1.00 14.13  ? 318  LEU B CD2   1 
ATOM   2294 N N     . ILE B 1 134 ? -11.477 -2.298  19.601  1.00 10.96  ? 319  ILE B N     1 
ATOM   2295 C CA    . ILE B 1 134 ? -11.468 -0.846  19.482  1.00 11.63  ? 319  ILE B CA    1 
ATOM   2296 C C     . ILE B 1 134 ? -10.140 -0.269  19.946  1.00 11.31  ? 319  ILE B C     1 
ATOM   2297 O O     . ILE B 1 134 ? -9.498  -0.805  20.843  1.00 12.46  ? 319  ILE B O     1 
ATOM   2298 C CB    . ILE B 1 134 ? -12.669 -0.173  20.210  1.00 11.41  ? 319  ILE B CB    1 
ATOM   2299 C CG1   . ILE B 1 134 ? -12.601 -0.372  21.730  1.00 12.50  ? 319  ILE B CG1   1 
ATOM   2300 C CG2   . ILE B 1 134 ? -13.989 -0.682  19.608  1.00 11.89  ? 319  ILE B CG2   1 
ATOM   2301 C CD1   . ILE B 1 134 ? -13.655 0.415   22.510  1.00 12.90  ? 319  ILE B CD1   1 
ATOM   2302 N N     . LEU B 1 135 ? -9.733  0.819   19.321  1.00 11.15  ? 320  LEU B N     1 
ATOM   2303 C CA    . LEU B 1 135 ? -8.552  1.546   19.747  1.00 11.30  ? 320  LEU B CA    1 
ATOM   2304 C C     . LEU B 1 135 ? -8.972  2.735   20.595  1.00 11.69  ? 320  LEU B C     1 
ATOM   2305 O O     . LEU B 1 135 ? -9.843  3.518   20.184  1.00 11.41  ? 320  LEU B O     1 
ATOM   2306 C CB    . LEU B 1 135 ? -7.780  2.029   18.529  1.00 11.94  ? 320  LEU B CB    1 
ATOM   2307 C CG    . LEU B 1 135 ? -6.888  0.996   17.837  1.00 14.09  ? 320  LEU B CG    1 
ATOM   2308 C CD1   . LEU B 1 135 ? -7.687  -0.134  17.253  1.00 16.84  ? 320  LEU B CD1   1 
ATOM   2309 C CD2   . LEU B 1 135 ? -6.113  1.704   16.751  1.00 16.23  ? 320  LEU B CD2   1 
ATOM   2310 N N     . ILE B 1 136 ? -8.355  2.814   21.773  1.00 11.82  ? 321  ILE B N     1 
ATOM   2311 C CA    . ILE B 1 136 ? -8.563  3.859   22.778  1.00 12.97  ? 321  ILE B CA    1 
ATOM   2312 C C     . ILE B 1 136 ? -7.257  4.660   22.871  1.00 12.25  ? 321  ILE B C     1 
ATOM   2313 O O     . ILE B 1 136 ? -6.162  4.096   22.750  1.00 12.80  ? 321  ILE B O     1 
ATOM   2314 C CB    . ILE B 1 136 ? -8.877  3.199   24.171  1.00 14.49  ? 321  ILE B CB    1 
ATOM   2315 C CG1   . ILE B 1 136 ? -10.171 2.364   24.101  1.00 16.34  ? 321  ILE B CG1   1 
ATOM   2316 C CG2   . ILE B 1 136 ? -8.944  4.226   25.289  1.00 16.68  ? 321  ILE B CG2   1 
ATOM   2317 C CD1   . ILE B 1 136 ? -11.381 3.120   23.719  1.00 18.68  ? 321  ILE B CD1   1 
ATOM   2318 N N     . ALA B 1 137 ? -7.352  5.972   23.083  1.00 11.01  ? 322  ALA B N     1 
ATOM   2319 C CA    . ALA B 1 137 ? -6.155  6.774   23.264  1.00 11.08  ? 322  ALA B CA    1 
ATOM   2320 C C     . ALA B 1 137 ? -5.483  6.381   24.582  1.00 10.98  ? 322  ALA B C     1 
ATOM   2321 O O     . ALA B 1 137 ? -6.111  6.382   25.645  1.00 10.96  ? 322  ALA B O     1 
ATOM   2322 C CB    . ALA B 1 137 ? -6.504  8.265   23.265  1.00 11.10  ? 322  ALA B CB    1 
ATOM   2323 N N     . SER B 1 138 ? -4.202  6.049   24.523  1.00 10.37  ? 323  SER B N     1 
ATOM   2324 C CA    . SER B 1 138 ? -3.497  5.651   25.749  1.00 11.02  ? 323  SER B CA    1 
ATOM   2325 C C     . SER B 1 138 ? -2.876  6.829   26.486  1.00 11.21  ? 323  SER B C     1 
ATOM   2326 O O     . SER B 1 138 ? -2.375  6.682   27.604  1.00 11.97  ? 323  SER B O     1 
ATOM   2327 C CB    . SER B 1 138 ? -2.420  4.616   25.428  1.00 11.66  ? 323  SER B CB    1 
ATOM   2328 O OG    . SER B 1 138 ? -1.437  5.178   24.592  1.00 14.54  ? 323  SER B OG    1 
ATOM   2329 N N     . ARG B 1 139 ? -2.901  7.980   25.821  1.00 10.67  ? 324  ARG B N     1 
ATOM   2330 C CA    . ARG B 1 139 ? -2.466  9.258   26.372  1.00 10.34  ? 324  ARG B CA    1 
ATOM   2331 C C     . ARG B 1 139 ? -3.198  10.322  25.562  1.00 10.29  ? 324  ARG B C     1 
ATOM   2332 O O     . ARG B 1 139 ? -3.808  9.998   24.528  1.00 10.37  ? 324  ARG B O     1 
ATOM   2333 C CB    . ARG B 1 139 ? -0.940  9.412   26.195  1.00 10.05  ? 324  ARG B CB    1 
ATOM   2334 C CG    . ARG B 1 139 ? -0.430  9.297   24.741  1.00 10.70  ? 324  ARG B CG    1 
ATOM   2335 C CD    . ARG B 1 139 ? 0.977   9.876   24.668  1.00 11.43  ? 324  ARG B CD    1 
ATOM   2336 N NE    . ARG B 1 139 ? 1.634   9.714   23.372  1.00 11.21  ? 324  ARG B NE    1 
ATOM   2337 C CZ    . ARG B 1 139 ? 1.475   10.518  22.320  1.00 9.71   ? 324  ARG B CZ    1 
ATOM   2338 N NH1   . ARG B 1 139 ? 0.625   11.546  22.359  1.00 10.13  ? 324  ARG B NH1   1 
ATOM   2339 N NH2   . ARG B 1 139 ? 2.160   10.282  21.203  1.00 10.58  ? 324  ARG B NH2   1 
ATOM   2340 N N     . ASP B 1 140 ? -3.150  11.579  25.999  1.00 10.74  ? 325  ASP B N     1 
ATOM   2341 C CA    . ASP B 1 140 ? -3.659  12.642  25.153  1.00 10.75  ? 325  ASP B CA    1 
ATOM   2342 C C     . ASP B 1 140 ? -2.881  12.656  23.841  1.00 10.27  ? 325  ASP B C     1 
ATOM   2343 O O     . ASP B 1 140 ? -1.655  12.497  23.834  1.00 9.91   ? 325  ASP B O     1 
ATOM   2344 C CB    . ASP B 1 140 ? -3.490  14.002  25.823  1.00 11.31  ? 325  ASP B CB    1 
ATOM   2345 C CG    . ASP B 1 140 ? -4.447  14.237  26.982  1.00 12.08  ? 325  ASP B CG    1 
ATOM   2346 O OD1   . ASP B 1 140 ? -5.174  13.323  27.420  1.00 12.22  ? 325  ASP B OD1   1 
ATOM   2347 O OD2   . ASP B 1 140 ? -4.458  15.391  27.465  1.00 14.79  ? 325  ASP B OD2   1 
ATOM   2348 N N     . ILE B 1 141 ? -3.596  12.876  22.743  1.00 9.98   ? 326  ILE B N     1 
ATOM   2349 C CA    . ILE B 1 141 ? -3.006  12.908  21.400  1.00 10.02  ? 326  ILE B CA    1 
ATOM   2350 C C     . ILE B 1 141 ? -3.267  14.282  20.797  1.00 10.05  ? 326  ILE B C     1 
ATOM   2351 O O     . ILE B 1 141 ? -4.401  14.768  20.831  1.00 10.00  ? 326  ILE B O     1 
ATOM   2352 C CB    . ILE B 1 141 ? -3.629  11.821  20.482  1.00 9.98   ? 326  ILE B CB    1 
ATOM   2353 C CG1   . ILE B 1 141 ? -3.470  10.442  21.109  1.00 10.68  ? 326  ILE B CG1   1 
ATOM   2354 C CG2   . ILE B 1 141 ? -2.982  11.842  19.086  1.00 11.78  ? 326  ILE B CG2   1 
ATOM   2355 C CD1   . ILE B 1 141 ? -4.249  9.365   20.370  1.00 10.11  ? 326  ILE B CD1   1 
ATOM   2356 N N     . ALA B 1 142 ? -2.223  14.895  20.242  1.00 9.90   ? 327  ALA B N     1 
ATOM   2357 C CA    . ALA B 1 142 ? -2.346  16.210  19.616  1.00 9.28   ? 327  ALA B CA    1 
ATOM   2358 C C     . ALA B 1 142 ? -2.797  16.082  18.168  1.00 10.23  ? 327  ALA B C     1 
ATOM   2359 O O     . ALA B 1 142 ? -2.475  15.104  17.492  1.00 10.17  ? 327  ALA B O     1 
ATOM   2360 C CB    . ALA B 1 142 ? -1.013  16.955  19.692  1.00 9.90   ? 327  ALA B CB    1 
ATOM   2361 N N     . ALA B 1 143 ? -3.548  17.072  17.700  1.00 9.79   ? 328  ALA B N     1 
ATOM   2362 C CA    . ALA B 1 143 ? -3.814  17.194  16.271  1.00 10.56  ? 328  ALA B CA    1 
ATOM   2363 C C     . ALA B 1 143 ? -2.476  17.185  15.536  1.00 10.32  ? 328  ALA B C     1 
ATOM   2364 O O     . ALA B 1 143 ? -1.512  17.845  15.954  1.00 10.23  ? 328  ALA B O     1 
ATOM   2365 C CB    . ALA B 1 143 ? -4.586  18.472  15.982  1.00 10.81  ? 328  ALA B CB    1 
ATOM   2366 N N     . GLY B 1 144 ? -2.406  16.385  14.473  1.00 10.79  ? 329  GLY B N     1 
ATOM   2367 C CA    . GLY B 1 144 ? -1.193  16.268  13.679  1.00 10.92  ? 329  GLY B CA    1 
ATOM   2368 C C     . GLY B 1 144 ? -0.379  15.025  13.951  1.00 11.30  ? 329  GLY B C     1 
ATOM   2369 O O     . GLY B 1 144 ? 0.490   14.676  13.153  1.00 12.29  ? 329  GLY B O     1 
ATOM   2370 N N     . GLU B 1 145 ? -0.639  14.354  15.070  1.00 10.62  ? 330  GLU B N     1 
ATOM   2371 C CA    . GLU B 1 145 ? 0.110   13.129  15.393  1.00 9.85   ? 330  GLU B CA    1 
ATOM   2372 C C     . GLU B 1 145 ? -0.365  11.940  14.580  1.00 10.05  ? 330  GLU B C     1 
ATOM   2373 O O     . GLU B 1 145 ? -1.561  11.776  14.369  1.00 9.61   ? 330  GLU B O     1 
ATOM   2374 C CB    . GLU B 1 145 ? -0.057  12.759  16.861  1.00 10.25  ? 330  GLU B CB    1 
ATOM   2375 C CG    . GLU B 1 145 ? 0.592   13.725  17.837  1.00 10.10  ? 330  GLU B CG    1 
ATOM   2376 C CD    . GLU B 1 145 ? 0.845   13.066  19.165  1.00 10.52  ? 330  GLU B CD    1 
ATOM   2377 O OE1   . GLU B 1 145 ? 1.646   12.119  19.193  1.00 12.39  ? 330  GLU B OE1   1 
ATOM   2378 O OE2   . GLU B 1 145 ? 0.234   13.470  20.179  1.00 10.42  ? 330  GLU B OE2   1 
ATOM   2379 N N     . GLU B 1 146 ? 0.574   11.104  14.150  1.00 9.02   ? 331  GLU B N     1 
ATOM   2380 C CA    . GLU B 1 146 ? 0.213   9.777   13.650  1.00 9.21   ? 331  GLU B CA    1 
ATOM   2381 C C     . GLU B 1 146 ? -0.302  8.898   14.774  1.00 9.29   ? 331  GLU B C     1 
ATOM   2382 O O     . GLU B 1 146 ? 0.319   8.818   15.844  1.00 9.45   ? 331  GLU B O     1 
ATOM   2383 C CB    . GLU B 1 146 ? 1.400   9.093   12.969  1.00 8.64   ? 331  GLU B CB    1 
ATOM   2384 C CG    . GLU B 1 146 ? 0.954   7.850   12.232  1.00 9.10   ? 331  GLU B CG    1 
ATOM   2385 C CD    . GLU B 1 146 ? 2.081   7.016   11.647  1.00 9.26   ? 331  GLU B CD    1 
ATOM   2386 O OE1   . GLU B 1 146 ? 3.275   7.308   11.890  1.00 10.50  ? 331  GLU B OE1   1 
ATOM   2387 O OE2   . GLU B 1 146 ? 1.744   6.031   10.952  1.00 9.18   ? 331  GLU B OE2   1 
ATOM   2388 N N     . LEU B 1 147 ? -1.438  8.246   14.524  1.00 9.52   ? 332  LEU B N     1 
ATOM   2389 C CA    . LEU B 1 147 ? -1.946  7.232   15.437  1.00 9.47   ? 332  LEU B CA    1 
ATOM   2390 C C     . LEU B 1 147 ? -1.095  5.967   15.310  1.00 9.26   ? 332  LEU B C     1 
ATOM   2391 O O     . LEU B 1 147 ? -0.801  5.534   14.187  1.00 9.05   ? 332  LEU B O     1 
ATOM   2392 C CB    . LEU B 1 147 ? -3.410  6.920   15.121  1.00 10.30  ? 332  LEU B CB    1 
ATOM   2393 C CG    . LEU B 1 147 ? -4.365  8.122   15.191  1.00 9.96   ? 332  LEU B CG    1 
ATOM   2394 C CD1   . LEU B 1 147 ? -5.740  7.683   14.758  1.00 11.74  ? 332  LEU B CD1   1 
ATOM   2395 C CD2   . LEU B 1 147 ? -4.394  8.730   16.608  1.00 10.69  ? 332  LEU B CD2   1 
ATOM   2396 N N     . LEU B 1 148 ? -0.723  5.368   16.448  1.00 8.65   ? 333  LEU B N     1 
ATOM   2397 C CA    . LEU B 1 148 ? 0.129   4.167   16.459  1.00 9.17   ? 333  LEU B CA    1 
ATOM   2398 C C     . LEU B 1 148 ? -0.227  3.302   17.646  1.00 9.67   ? 333  LEU B C     1 
ATOM   2399 O O     . LEU B 1 148 ? -0.486  3.820   18.733  1.00 9.78   ? 333  LEU B O     1 
ATOM   2400 C CB    . LEU B 1 148 ? 1.618   4.558   16.547  1.00 9.15   ? 333  LEU B CB    1 
ATOM   2401 C CG    . LEU B 1 148 ? 2.227   5.373   15.397  1.00 9.00   ? 333  LEU B CG    1 
ATOM   2402 C CD1   . LEU B 1 148 ? 3.597   5.877   15.790  1.00 8.69   ? 333  LEU B CD1   1 
ATOM   2403 C CD2   . LEU B 1 148 ? 2.336   4.505   14.154  1.00 9.26   ? 333  LEU B CD2   1 
ATOM   2404 N N     . TYR B 1 149 ? -0.203  1.986   17.450  1.00 9.08   ? 334  TYR B N     1 
ATOM   2405 C CA    . TYR B 1 149 ? -0.378  1.055   18.573  1.00 9.40   ? 334  TYR B CA    1 
ATOM   2406 C C     . TYR B 1 149 ? 0.533   -0.149  18.391  1.00 9.25   ? 334  TYR B C     1 
ATOM   2407 O O     . TYR B 1 149 ? 1.099   -0.339  17.327  1.00 9.09   ? 334  TYR B O     1 
ATOM   2408 C CB    . TYR B 1 149 ? -1.829  0.591   18.699  1.00 9.41   ? 334  TYR B CB    1 
ATOM   2409 C CG    . TYR B 1 149 ? -2.289  -0.255  17.534  1.00 8.74   ? 334  TYR B CG    1 
ATOM   2410 C CD1   . TYR B 1 149 ? -2.284  -1.652  17.606  1.00 8.64   ? 334  TYR B CD1   1 
ATOM   2411 C CD2   . TYR B 1 149 ? -2.758  0.340   16.367  1.00 10.27  ? 334  TYR B CD2   1 
ATOM   2412 C CE1   . TYR B 1 149 ? -2.705  -2.441  16.528  1.00 9.62   ? 334  TYR B CE1   1 
ATOM   2413 C CE2   . TYR B 1 149 ? -3.183  -0.437  15.286  1.00 10.44  ? 334  TYR B CE2   1 
ATOM   2414 C CZ    . TYR B 1 149 ? -3.158  -1.828  15.372  1.00 9.47   ? 334  TYR B CZ    1 
ATOM   2415 O OH    . TYR B 1 149 ? -3.586  -2.591  14.312  1.00 10.99  ? 334  TYR B OH    1 
ATOM   2416 N N     . ASP B 1 150 ? 0.637   -0.973  19.428  1.00 9.36   ? 335  ASP B N     1 
ATOM   2417 C CA    . ASP B 1 150 ? 1.551   -2.103  19.409  1.00 9.38   ? 335  ASP B CA    1 
ATOM   2418 C C     . ASP B 1 150 ? 0.856   -3.303  18.764  1.00 9.44   ? 335  ASP B C     1 
ATOM   2419 O O     . ASP B 1 150 ? -0.123  -3.832  19.302  1.00 10.17  ? 335  ASP B O     1 
ATOM   2420 C CB    . ASP B 1 150 ? 1.974   -2.403  20.850  1.00 9.66   ? 335  ASP B CB    1 
ATOM   2421 C CG    . ASP B 1 150 ? 3.040   -3.480  20.965  1.00 11.89  ? 335  ASP B CG    1 
ATOM   2422 O OD1   . ASP B 1 150 ? 3.369   -4.163  19.978  1.00 10.37  ? 335  ASP B OD1   1 
ATOM   2423 O OD2   . ASP B 1 150 ? 3.523   -3.637  22.108  1.00 15.22  ? 335  ASP B OD2   1 
ATOM   2424 N N     . TYR B 1 151 ? 1.352   -3.709  17.595  1.00 9.42   ? 336  TYR B N     1 
ATOM   2425 C CA    . TYR B 1 151 ? 0.816   -4.867  16.886  1.00 9.54   ? 336  TYR B CA    1 
ATOM   2426 C C     . TYR B 1 151 ? 0.929   -6.154  17.704  1.00 9.39   ? 336  TYR B C     1 
ATOM   2427 O O     . TYR B 1 151 ? 0.205   -7.107  17.441  1.00 10.43  ? 336  TYR B O     1 
ATOM   2428 C CB    . TYR B 1 151 ? 1.515   -5.062  15.531  1.00 9.44   ? 336  TYR B CB    1 
ATOM   2429 C CG    . TYR B 1 151 ? 1.088   -4.112  14.419  1.00 8.78   ? 336  TYR B CG    1 
ATOM   2430 C CD1   . TYR B 1 151 ? 0.251   -3.018  14.661  1.00 8.97   ? 336  TYR B CD1   1 
ATOM   2431 C CD2   . TYR B 1 151 ? 1.554   -4.301  13.126  1.00 8.52   ? 336  TYR B CD2   1 
ATOM   2432 C CE1   . TYR B 1 151 ? -0.129  -2.152  13.622  1.00 8.40   ? 336  TYR B CE1   1 
ATOM   2433 C CE2   . TYR B 1 151 ? 1.187   -3.457  12.099  1.00 8.25   ? 336  TYR B CE2   1 
ATOM   2434 C CZ    . TYR B 1 151 ? 0.339   -2.392  12.344  1.00 8.39   ? 336  TYR B CZ    1 
ATOM   2435 O OH    . TYR B 1 151 ? -0.018  -1.573  11.300  1.00 9.00   ? 336  TYR B OH    1 
ATOM   2436 N N     . GLY B 1 152 ? 1.873   -6.207  18.651  1.00 8.98   ? 337  GLY B N     1 
ATOM   2437 C CA    . GLY B 1 152 ? 1.923   -7.334  19.592  1.00 9.72   ? 337  GLY B CA    1 
ATOM   2438 C C     . GLY B 1 152 ? 2.504   -8.624  19.041  1.00 10.09  ? 337  GLY B C     1 
ATOM   2439 O O     . GLY B 1 152 ? 2.320   -9.696  19.640  1.00 10.43  ? 337  GLY B O     1 
ATOM   2440 N N     . ASP B 1 153 ? 3.229   -8.541  17.926  1.00 9.72   ? 338  ASP B N     1 
ATOM   2441 C CA    . ASP B 1 153 ? 3.859   -9.724  17.325  1.00 9.99   ? 338  ASP B CA    1 
ATOM   2442 C C     . ASP B 1 153 ? 5.330   -9.785  17.723  1.00 10.39  ? 338  ASP B C     1 
ATOM   2443 O O     . ASP B 1 153 ? 6.138   -8.966  17.264  1.00 10.71  ? 338  ASP B O     1 
ATOM   2444 C CB    . ASP B 1 153 ? 3.717   -9.702  15.793  1.00 10.23  ? 338  ASP B CB    1 
ATOM   2445 C CG    . ASP B 1 153 ? 4.111   -11.034 15.142  1.00 10.80  ? 338  ASP B CG    1 
ATOM   2446 O OD1   . ASP B 1 153 ? 4.689   -11.918 15.820  1.00 11.83  ? 338  ASP B OD1   1 
ATOM   2447 O OD2   . ASP B 1 153 ? 3.843   -11.193 13.935  1.00 10.95  ? 338  ASP B OD2   1 
ATOM   2448 N N     . ARG B 1 154 ? 5.657   -10.741 18.604  1.00 9.90   ? 339  ARG B N     1 
ATOM   2449 C CA    . ARG B 1 154 ? 7.018   -10.919 19.119  1.00 10.44  ? 339  ARG B CA    1 
ATOM   2450 C C     . ARG B 1 154 ? 7.784   -12.037 18.419  1.00 10.82  ? 339  ARG B C     1 
ATOM   2451 O O     . ARG B 1 154 ? 8.903   -12.382 18.830  1.00 11.00  ? 339  ARG B O     1 
ATOM   2452 C CB    . ARG B 1 154 ? 6.984   -11.242 20.622  1.00 10.97  ? 339  ARG B CB    1 
ATOM   2453 C CG    . ARG B 1 154 ? 6.109   -10.359 21.473  1.00 12.90  ? 339  ARG B CG    1 
ATOM   2454 C CD    . ARG B 1 154 ? 6.457   -8.883  21.394  1.00 14.60  ? 339  ARG B CD    1 
ATOM   2455 N NE    . ARG B 1 154 ? 5.398   -8.125  22.053  1.00 14.18  ? 339  ARG B NE    1 
ATOM   2456 C CZ    . ARG B 1 154 ? 4.898   -6.961  21.644  1.00 13.60  ? 339  ARG B CZ    1 
ATOM   2457 N NH1   . ARG B 1 154 ? 5.356   -6.329  20.540  1.00 12.48  ? 339  ARG B NH1   1 
ATOM   2458 N NH2   . ARG B 1 154 ? 3.930   -6.413  22.366  1.00 16.20  ? 339  ARG B NH2   1 
ATOM   2459 N N     . SER B 1 155 ? 7.203   -12.603 17.365  1.00 10.63  ? 340  SER B N     1 
ATOM   2460 C CA    . SER B 1 155 ? 7.810   -13.764 16.717  1.00 11.48  ? 340  SER B CA    1 
ATOM   2461 C C     . SER B 1 155 ? 9.114   -13.405 16.027  1.00 12.13  ? 340  SER B C     1 
ATOM   2462 O O     . SER B 1 155 ? 9.176   -12.435 15.293  1.00 12.19  ? 340  SER B O     1 
ATOM   2463 C CB    . SER B 1 155 ? 6.854   -14.345 15.686  1.00 11.96  ? 340  SER B CB    1 
ATOM   2464 O OG    . SER B 1 155 ? 7.502   -15.351 14.921  1.00 14.25  ? 340  SER B OG    1 
ATOM   2465 N N     . LYS B 1 156 ? 10.148  -14.211 16.243  1.00 12.91  ? 341  LYS B N     1 
ATOM   2466 C CA    . LYS B 1 156 ? 11.448  -13.980 15.621  1.00 14.07  ? 341  LYS B CA    1 
ATOM   2467 C C     . LYS B 1 156 ? 11.351  -13.894 14.108  1.00 13.74  ? 341  LYS B C     1 
ATOM   2468 O O     . LYS B 1 156 ? 11.985  -13.034 13.489  1.00 14.47  ? 341  LYS B O     1 
ATOM   2469 C CB    . LYS B 1 156 ? 12.411  -15.094 16.034  1.00 15.05  ? 341  LYS B CB    1 
ATOM   2470 C CG    . LYS B 1 156 ? 13.614  -15.311 15.140  1.00 19.30  ? 341  LYS B CG    1 
ATOM   2471 C CD    . LYS B 1 156 ? 14.807  -14.499 15.603  1.00 23.56  ? 341  LYS B CD    1 
ATOM   2472 C CE    . LYS B 1 156 ? 15.923  -14.516 14.573  1.00 25.37  ? 341  LYS B CE    1 
ATOM   2473 N NZ    . LYS B 1 156 ? 16.578  -13.184 14.514  1.00 26.92  ? 341  LYS B NZ    1 
ATOM   2474 N N     . ALA B 1 157 ? 10.560  -14.784 13.516  1.00 13.50  ? 342  ALA B N     1 
ATOM   2475 C CA    . ALA B 1 157 ? 10.417  -14.821 12.067  1.00 13.65  ? 342  ALA B CA    1 
ATOM   2476 C C     . ALA B 1 157 ? 9.699   -13.578 11.567  1.00 13.31  ? 342  ALA B C     1 
ATOM   2477 O O     . ALA B 1 157 ? 10.033  -13.060 10.496  1.00 13.83  ? 342  ALA B O     1 
ATOM   2478 C CB    . ALA B 1 157 ? 9.695   -16.092 11.607  1.00 13.93  ? 342  ALA B CB    1 
ATOM   2479 N N     . SER B 1 158 ? 8.708   -13.107 12.330  1.00 12.93  ? 343  SER B N     1 
ATOM   2480 C CA    . SER B 1 158 ? 8.005   -11.892 11.954  1.00 12.73  ? 343  SER B CA    1 
ATOM   2481 C C     . SER B 1 158 ? 8.949   -10.704 11.977  1.00 12.55  ? 343  SER B C     1 
ATOM   2482 O O     . SER B 1 158 ? 8.950   -9.887  11.051  1.00 12.94  ? 343  SER B O     1 
ATOM   2483 C CB    . SER B 1 158 ? 6.843   -11.609 12.897  1.00 12.48  ? 343  SER B CB    1 
ATOM   2484 O OG    . SER B 1 158 ? 5.798   -12.548 12.700  1.00 13.36  ? 343  SER B OG    1 
ATOM   2485 N N     . ILE B 1 159 ? 9.719   -10.589 13.058  1.00 12.66  ? 344  ILE B N     1 
ATOM   2486 C CA    . ILE B 1 159 ? 10.646  -9.482  13.254  1.00 13.21  ? 344  ILE B CA    1 
ATOM   2487 C C     . ILE B 1 159 ? 11.762  -9.484  12.202  1.00 13.95  ? 344  ILE B C     1 
ATOM   2488 O O     . ILE B 1 159 ? 12.166  -8.427  11.730  1.00 13.87  ? 344  ILE B O     1 
ATOM   2489 C CB    . ILE B 1 159 ? 11.213  -9.476  14.704  1.00 13.25  ? 344  ILE B CB    1 
ATOM   2490 C CG1   . ILE B 1 159 ? 10.096  -9.169  15.712  1.00 14.51  ? 344  ILE B CG1   1 
ATOM   2491 C CG2   . ILE B 1 159 ? 12.330  -8.456  14.862  1.00 15.04  ? 344  ILE B CG2   1 
ATOM   2492 C CD1   . ILE B 1 159 ? 10.467  -9.491  17.155  1.00 14.29  ? 344  ILE B CD1   1 
ATOM   2493 N N     . GLU B 1 160 ? 12.252  -10.667 11.839  1.00 14.04  ? 345  GLU B N     1 
ATOM   2494 C CA    . GLU B 1 160 ? 13.266  -10.781 10.788  1.00 15.35  ? 345  GLU B CA    1 
ATOM   2495 C C     . GLU B 1 160 ? 12.756  -10.209 9.466   1.00 15.07  ? 345  GLU B C     1 
ATOM   2496 O O     . GLU B 1 160 ? 13.484  -9.501  8.759   1.00 15.89  ? 345  GLU B O     1 
ATOM   2497 C CB    . GLU B 1 160 ? 13.691  -12.248 10.602  1.00 16.12  ? 345  GLU B CB    1 
ATOM   2498 C CG    . GLU B 1 160 ? 14.709  -12.467 9.464   1.00 19.38  ? 345  GLU B CG    1 
ATOM   2499 C CD    . GLU B 1 160 ? 15.923  -11.554 9.558   1.00 26.49  ? 345  GLU B CD    1 
ATOM   2500 O OE1   . GLU B 1 160 ? 16.681  -11.650 10.554  1.00 27.01  ? 345  GLU B OE1   1 
ATOM   2501 O OE2   . GLU B 1 160 ? 16.125  -10.739 8.627   1.00 27.68  ? 345  GLU B OE2   1 
ATOM   2502 N N     . ALA B 1 161 ? 11.506  -10.520 9.130   1.00 14.94  ? 346  ALA B N     1 
ATOM   2503 C CA    . ALA B 1 161 ? 10.916  -10.048 7.867   1.00 14.08  ? 346  ALA B CA    1 
ATOM   2504 C C     . ALA B 1 161 ? 10.363  -8.617  7.923   1.00 14.53  ? 346  ALA B C     1 
ATOM   2505 O O     . ALA B 1 161 ? 10.217  -7.964  6.881   1.00 14.90  ? 346  ALA B O     1 
ATOM   2506 C CB    . ALA B 1 161 ? 9.839   -11.012 7.403   1.00 14.66  ? 346  ALA B CB    1 
ATOM   2507 N N     . HIS B 1 162 ? 10.060  -8.150  9.135   1.00 13.66  ? 347  HIS B N     1 
ATOM   2508 C CA    . HIS B 1 162 ? 9.450   -6.838  9.369   1.00 12.97  ? 347  HIS B CA    1 
ATOM   2509 C C     . HIS B 1 162 ? 10.185  -6.195  10.543  1.00 12.99  ? 347  HIS B C     1 
ATOM   2510 O O     . HIS B 1 162 ? 9.674   -6.164  11.664  1.00 12.91  ? 347  HIS B O     1 
ATOM   2511 C CB    . HIS B 1 162 ? 7.944   -6.999  9.654   1.00 13.02  ? 347  HIS B CB    1 
ATOM   2512 C CG    . HIS B 1 162 ? 7.229   -7.789  8.601   1.00 13.28  ? 347  HIS B CG    1 
ATOM   2513 N ND1   . HIS B 1 162 ? 6.726   -7.220  7.449   1.00 14.39  ? 347  HIS B ND1   1 
ATOM   2514 C CD2   . HIS B 1 162 ? 6.969   -9.113  8.508   1.00 12.96  ? 347  HIS B CD2   1 
ATOM   2515 C CE1   . HIS B 1 162 ? 6.184   -8.162  6.695   1.00 13.50  ? 347  HIS B CE1   1 
ATOM   2516 N NE2   . HIS B 1 162 ? 6.320   -9.320  7.313   1.00 14.03  ? 347  HIS B NE2   1 
ATOM   2517 N N     . PRO B 1 163 ? 11.418  -5.714  10.303  1.00 13.91  ? 348  PRO B N     1 
ATOM   2518 C CA    . PRO B 1 163 ? 12.252  -5.263  11.419  1.00 13.68  ? 348  PRO B CA    1 
ATOM   2519 C C     . PRO B 1 163 ? 11.699  -4.093  12.227  1.00 13.49  ? 348  PRO B C     1 
ATOM   2520 O O     . PRO B 1 163 ? 12.099  -3.903  13.368  1.00 14.24  ? 348  PRO B O     1 
ATOM   2521 C CB    . PRO B 1 163 ? 13.597  -4.912  10.753  1.00 13.64  ? 348  PRO B CB    1 
ATOM   2522 C CG    . PRO B 1 163 ? 13.561  -5.626  9.430   1.00 14.97  ? 348  PRO B CG    1 
ATOM   2523 C CD    . PRO B 1 163 ? 12.121  -5.611  9.014   1.00 14.51  ? 348  PRO B CD    1 
ATOM   2524 N N     . TRP B 1 164 ? 10.772  -3.336  11.642  1.00 12.82  ? 349  TRP B N     1 
ATOM   2525 C CA    . TRP B 1 164 ? 10.117  -2.228  12.341  1.00 12.59  ? 349  TRP B CA    1 
ATOM   2526 C C     . TRP B 1 164 ? 9.298   -2.699  13.553  1.00 12.69  ? 349  TRP B C     1 
ATOM   2527 O O     . TRP B 1 164 ? 8.954   -1.894  14.417  1.00 12.92  ? 349  TRP B O     1 
ATOM   2528 C CB    . TRP B 1 164 ? 9.251   -1.406  11.373  1.00 12.31  ? 349  TRP B CB    1 
ATOM   2529 C CG    . TRP B 1 164 ? 8.406   -2.265  10.509  1.00 11.28  ? 349  TRP B CG    1 
ATOM   2530 C CD1   . TRP B 1 164 ? 8.695   -2.696  9.242   1.00 10.54  ? 349  TRP B CD1   1 
ATOM   2531 C CD2   . TRP B 1 164 ? 7.139   -2.840  10.848  1.00 10.68  ? 349  TRP B CD2   1 
ATOM   2532 N NE1   . TRP B 1 164 ? 7.695   -3.500  8.776   1.00 11.30  ? 349  TRP B NE1   1 
ATOM   2533 C CE2   . TRP B 1 164 ? 6.723   -3.606  9.736   1.00 11.25  ? 349  TRP B CE2   1 
ATOM   2534 C CE3   . TRP B 1 164 ? 6.320   -2.789  11.986  1.00 11.32  ? 349  TRP B CE3   1 
ATOM   2535 C CZ2   . TRP B 1 164 ? 5.522   -4.321  9.729   1.00 10.75  ? 349  TRP B CZ2   1 
ATOM   2536 C CZ3   . TRP B 1 164 ? 5.115   -3.478  11.978  1.00 10.40  ? 349  TRP B CZ3   1 
ATOM   2537 C CH2   . TRP B 1 164 ? 4.734   -4.252  10.854  1.00 10.72  ? 349  TRP B CH2   1 
ATOM   2538 N N     . LEU B 1 165 ? 9.019   -4.003  13.629  1.00 12.91  ? 350  LEU B N     1 
ATOM   2539 C CA    . LEU B 1 165 ? 8.349   -4.585  14.807  1.00 13.43  ? 350  LEU B CA    1 
ATOM   2540 C C     . LEU B 1 165 ? 9.159   -4.484  16.103  1.00 15.16  ? 350  LEU B C     1 
ATOM   2541 O O     . LEU B 1 165 ? 8.594   -4.580  17.202  1.00 15.57  ? 350  LEU B O     1 
ATOM   2542 C CB    . LEU B 1 165 ? 7.973   -6.052  14.560  1.00 12.67  ? 350  LEU B CB    1 
ATOM   2543 C CG    . LEU B 1 165 ? 6.693   -6.311  13.769  1.00 11.64  ? 350  LEU B CG    1 
ATOM   2544 C CD1   . LEU B 1 165 ? 6.610   -7.768  13.352  1.00 12.00  ? 350  LEU B CD1   1 
ATOM   2545 C CD2   . LEU B 1 165 ? 5.453   -5.929  14.564  1.00 12.15  ? 350  LEU B CD2   1 
ATOM   2546 N N     . LYS B 1 166 ? 10.465  -4.266  15.957  1.00 16.89  ? 351  LYS B N     1 
ATOM   2547 C CA    . LYS B 1 166 ? 11.417  -4.200  17.082  1.00 18.81  ? 351  LYS B CA    1 
ATOM   2548 C C     . LYS B 1 166 ? 11.193  -3.006  17.987  1.00 19.50  ? 351  LYS B C     1 
ATOM   2549 O O     . LYS B 1 166 ? 11.632  -3.012  19.143  1.00 19.17  ? 351  LYS B O     1 
ATOM   2550 C CB    . LYS B 1 166 ? 12.859  -4.111  16.572  1.00 19.62  ? 351  LYS B CB    1 
ATOM   2551 C CG    . LYS B 1 166 ? 13.423  -5.367  15.968  1.00 22.21  ? 351  LYS B CG    1 
ATOM   2552 C CD    . LYS B 1 166 ? 14.932  -5.249  15.860  1.00 25.22  ? 351  LYS B CD    1 
ATOM   2553 C CE    . LYS B 1 166 ? 15.529  -6.448  15.157  1.00 27.85  ? 351  LYS B CE    1 
ATOM   2554 N NZ    . LYS B 1 166 ? 17.013  -6.453  15.249  1.00 29.58  ? 351  LYS B NZ    1 
ATOM   2555 N N     . HIS B 1 167 ? 10.553  -1.969  17.456  1.00 20.08  ? 352  HIS B N     1 
ATOM   2556 C CA    . HIS B 1 167 ? 10.330  -0.752  18.223  1.00 21.05  ? 352  HIS B CA    1 
ATOM   2557 C C     . HIS B 1 167 ? 8.888   -0.253  18.117  1.00 21.16  ? 352  HIS B C     1 
ATOM   2558 O O     . HIS B 1 167 ? 8.543   0.707   18.796  1.00 21.31  ? 352  HIS B O     1 
ATOM   2559 C CB    . HIS B 1 167 ? 11.318  0.342   17.796  1.00 21.80  ? 352  HIS B CB    1 
ATOM   2560 C CG    . HIS B 1 167 ? 12.754  -0.004  18.061  1.00 24.01  ? 352  HIS B CG    1 
ATOM   2561 N ND1   . HIS B 1 167 ? 13.264  -0.151  19.334  1.00 26.27  ? 352  HIS B ND1   1 
ATOM   2562 C CD2   . HIS B 1 167 ? 13.786  -0.234  17.215  1.00 25.21  ? 352  HIS B CD2   1 
ATOM   2563 C CE1   . HIS B 1 167 ? 14.547  -0.460  19.261  1.00 25.81  ? 352  HIS B CE1   1 
ATOM   2564 N NE2   . HIS B 1 167 ? 14.890  -0.513  17.986  1.00 25.85  ? 352  HIS B NE2   1 
ATOM   2565 N N     . LYS C 1 8   ? -30.374 30.551  -7.108  1.00 25.63  ? 193  LYS C N     1 
ATOM   2566 C CA    . LYS C 1 8   ? -30.397 29.261  -7.859  1.00 25.57  ? 193  LYS C CA    1 
ATOM   2567 C C     . LYS C 1 8   ? -29.660 28.173  -7.096  1.00 25.63  ? 193  LYS C C     1 
ATOM   2568 O O     . LYS C 1 8   ? -28.667 28.450  -6.418  1.00 26.25  ? 193  LYS C O     1 
ATOM   2569 C CB    . LYS C 1 8   ? -29.728 29.414  -9.224  1.00 25.11  ? 193  LYS C CB    1 
ATOM   2570 C CG    . LYS C 1 8   ? -30.389 30.392  -10.168 1.00 23.87  ? 193  LYS C CG    1 
ATOM   2571 C CD    . LYS C 1 8   ? -29.601 30.432  -11.465 1.00 21.19  ? 193  LYS C CD    1 
ATOM   2572 C CE    . LYS C 1 8   ? -30.157 31.493  -12.401 1.00 20.00  ? 193  LYS C CE    1 
ATOM   2573 N NZ    . LYS C 1 8   ? -29.318 31.586  -13.634 1.00 16.37  ? 193  LYS C NZ    1 
ATOM   2574 N N     . SER C 1 9   ? -30.133 26.935  -7.232  1.00 25.73  ? 194  SER C N     1 
ATOM   2575 C CA    . SER C 1 9   ? -29.448 25.782  -6.654  1.00 25.61  ? 194  SER C CA    1 
ATOM   2576 C C     . SER C 1 9   ? -28.259 25.380  -7.522  1.00 25.54  ? 194  SER C C     1 
ATOM   2577 O O     . SER C 1 9   ? -28.124 25.843  -8.659  1.00 25.32  ? 194  SER C O     1 
ATOM   2578 C CB    . SER C 1 9   ? -30.409 24.602  -6.543  1.00 25.84  ? 194  SER C CB    1 
ATOM   2579 O OG    . SER C 1 9   ? -30.700 24.071  -7.825  1.00 25.77  ? 194  SER C OG    1 
ATOM   2580 N N     . LYS C 1 10  ? -27.409 24.502  -6.997  1.00 25.00  ? 195  LYS C N     1 
ATOM   2581 C CA    . LYS C 1 10  ? -26.311 23.945  -7.787  1.00 24.73  ? 195  LYS C CA    1 
ATOM   2582 C C     . LYS C 1 10  ? -26.851 23.166  -8.989  1.00 24.16  ? 195  LYS C C     1 
ATOM   2583 O O     . LYS C 1 10  ? -26.310 23.258  -10.097 1.00 24.02  ? 195  LYS C O     1 
ATOM   2584 C CB    . LYS C 1 10  ? -25.396 23.054  -6.924  1.00 24.67  ? 195  LYS C CB    1 
ATOM   2585 C CG    . LYS C 1 10  ? -24.215 22.487  -7.701  1.00 25.07  ? 195  LYS C CG    1 
ATOM   2586 C CD    . LYS C 1 10  ? -23.366 21.517  -6.892  1.00 25.70  ? 195  LYS C CD    1 
ATOM   2587 C CE    . LYS C 1 10  ? -22.165 21.086  -7.724  1.00 27.21  ? 195  LYS C CE    1 
ATOM   2588 N NZ    . LYS C 1 10  ? -21.288 20.101  -7.037  1.00 28.37  ? 195  LYS C NZ    1 
ATOM   2589 N N     . ALA C 1 11  ? -27.930 22.416  -8.776  1.00 23.75  ? 196  ALA C N     1 
ATOM   2590 C CA    . ALA C 1 11  ? -28.546 21.629  -9.836  1.00 23.29  ? 196  ALA C CA    1 
ATOM   2591 C C     . ALA C 1 11  ? -29.016 22.531  -10.979 1.00 22.95  ? 196  ALA C C     1 
ATOM   2592 O O     . ALA C 1 11  ? -28.820 22.202  -12.149 1.00 22.40  ? 196  ALA C O     1 
ATOM   2593 C CB    . ALA C 1 11  ? -29.701 20.811  -9.284  1.00 23.71  ? 196  ALA C CB    1 
ATOM   2594 N N     . GLU C 1 12  ? -29.629 23.659  -10.623 1.00 22.71  ? 197  GLU C N     1 
ATOM   2595 C CA    . GLU C 1 12  ? -30.103 24.639  -11.610 1.00 22.78  ? 197  GLU C CA    1 
ATOM   2596 C C     . GLU C 1 12  ? -28.946 25.231  -12.410 1.00 21.64  ? 197  GLU C C     1 
ATOM   2597 O O     . GLU C 1 12  ? -29.004 25.273  -13.639 1.00 20.95  ? 197  GLU C O     1 
ATOM   2598 C CB    . GLU C 1 12  ? -30.934 25.744  -10.940 1.00 22.68  ? 197  GLU C CB    1 
ATOM   2599 C CG    . GLU C 1 12  ? -32.336 25.273  -10.524 1.00 24.78  ? 197  GLU C CG    1 
ATOM   2600 C CD    . GLU C 1 12  ? -33.071 26.247  -9.600  1.00 25.13  ? 197  GLU C CD    1 
ATOM   2601 O OE1   . GLU C 1 12  ? -34.321 26.309  -9.686  1.00 28.95  ? 197  GLU C OE1   1 
ATOM   2602 O OE2   . GLU C 1 12  ? -32.423 26.948  -8.794  1.00 26.54  ? 197  GLU C OE2   1 
ATOM   2603 N N     . LEU C 1 13  ? -27.897 25.662  -11.712 1.00 20.57  ? 198  LEU C N     1 
ATOM   2604 C CA    . LEU C 1 13  ? -26.692 26.203  -12.354 1.00 20.17  ? 198  LEU C CA    1 
ATOM   2605 C C     . LEU C 1 13  ? -26.023 25.180  -13.276 1.00 20.03  ? 198  LEU C C     1 
ATOM   2606 O O     . LEU C 1 13  ? -25.614 25.519  -14.385 1.00 18.98  ? 198  LEU C O     1 
ATOM   2607 C CB    . LEU C 1 13  ? -25.703 26.720  -11.300 1.00 20.47  ? 198  LEU C CB    1 
ATOM   2608 C CG    . LEU C 1 13  ? -26.081 27.991  -10.528 1.00 21.76  ? 198  LEU C CG    1 
ATOM   2609 C CD1   . LEU C 1 13  ? -25.438 27.990  -9.140  1.00 22.86  ? 198  LEU C CD1   1 
ATOM   2610 C CD2   . LEU C 1 13  ? -25.716 29.270  -11.296 1.00 21.67  ? 198  LEU C CD2   1 
ATOM   2611 N N     . GLN C 1 14  ? -25.920 23.931  -12.827 1.00 19.86  ? 199  GLN C N     1 
ATOM   2612 C CA    . GLN C 1 14  ? -25.344 22.860  -13.650 1.00 20.51  ? 199  GLN C CA    1 
ATOM   2613 C C     . GLN C 1 14  ? -26.153 22.592  -14.921 1.00 19.50  ? 199  GLN C C     1 
ATOM   2614 O O     . GLN C 1 14  ? -25.591 22.477  -16.012 1.00 18.93  ? 199  GLN C O     1 
ATOM   2615 C CB    . GLN C 1 14  ? -25.216 21.556  -12.846 1.00 20.49  ? 199  GLN C CB    1 
ATOM   2616 C CG    . GLN C 1 14  ? -24.025 21.492  -11.903 1.00 22.99  ? 199  GLN C CG    1 
ATOM   2617 C CD    . GLN C 1 14  ? -23.954 20.162  -11.156 1.00 23.58  ? 199  GLN C CD    1 
ATOM   2618 O OE1   . GLN C 1 14  ? -23.124 19.308  -11.468 1.00 28.79  ? 199  GLN C OE1   1 
ATOM   2619 N NE2   . GLN C 1 14  ? -24.840 19.976  -10.183 1.00 26.48  ? 199  GLN C NE2   1 
ATOM   2620 N N     . SER C 1 15  ? -27.472 22.485  -14.779 1.00 19.03  ? 200  SER C N     1 
ATOM   2621 C CA    . SER C 1 15  ? -28.324 22.174  -15.921 1.00 18.65  ? 200  SER C CA    1 
ATOM   2622 C C     . SER C 1 15  ? -28.332 23.325  -16.919 1.00 17.54  ? 200  SER C C     1 
ATOM   2623 O O     . SER C 1 15  ? -28.338 23.094  -18.129 1.00 16.87  ? 200  SER C O     1 
ATOM   2624 C CB    . SER C 1 15  ? -29.750 21.821  -15.493 1.00 19.70  ? 200  SER C CB    1 
ATOM   2625 O OG    . SER C 1 15  ? -30.328 22.873  -14.758 1.00 22.74  ? 200  SER C OG    1 
ATOM   2626 N N     . GLU C 1 16  ? -28.323 24.558  -16.412 1.00 15.80  ? 201  GLU C N     1 
ATOM   2627 C CA    . GLU C 1 16  ? -28.262 25.720  -17.294 1.00 15.11  ? 201  GLU C CA    1 
ATOM   2628 C C     . GLU C 1 16  ? -26.947 25.735  -18.078 1.00 14.43  ? 201  GLU C C     1 
ATOM   2629 O O     . GLU C 1 16  ? -26.945 25.995  -19.286 1.00 13.24  ? 201  GLU C O     1 
ATOM   2630 C CB    . GLU C 1 16  ? -28.506 27.015  -16.514 1.00 15.04  ? 201  GLU C CB    1 
ATOM   2631 C CG    . GLU C 1 16  ? -29.963 27.098  -15.992 1.00 16.45  ? 201  GLU C CG    1 
ATOM   2632 C CD    . GLU C 1 16  ? -30.225 28.209  -14.976 1.00 16.70  ? 201  GLU C CD    1 
ATOM   2633 O OE1   . GLU C 1 16  ? -29.413 29.153  -14.870 1.00 16.05  ? 201  GLU C OE1   1 
ATOM   2634 O OE2   . GLU C 1 16  ? -31.278 28.134  -14.287 1.00 18.68  ? 201  GLU C OE2   1 
ATOM   2635 N N     . GLU C 1 17  ? -25.844 25.441  -17.392 1.00 14.36  ? 202  GLU C N     1 
ATOM   2636 C CA    . GLU C 1 17  ? -24.534 25.333  -18.038 1.00 14.82  ? 202  GLU C CA    1 
ATOM   2637 C C     . GLU C 1 17  ? -24.503 24.214  -19.092 1.00 15.27  ? 202  GLU C C     1 
ATOM   2638 O O     . GLU C 1 17  ? -24.035 24.431  -20.215 1.00 15.67  ? 202  GLU C O     1 
ATOM   2639 C CB    . GLU C 1 17  ? -23.448 25.136  -16.979 1.00 15.33  ? 202  GLU C CB    1 
ATOM   2640 C CG    . GLU C 1 17  ? -22.057 24.816  -17.550 1.00 16.51  ? 202  GLU C CG    1 
ATOM   2641 C CD    . GLU C 1 17  ? -21.357 25.993  -18.223 1.00 19.84  ? 202  GLU C CD    1 
ATOM   2642 O OE1   . GLU C 1 17  ? -21.859 27.141  -18.158 1.00 21.13  ? 202  GLU C OE1   1 
ATOM   2643 O OE2   . GLU C 1 17  ? -20.274 25.747  -18.818 1.00 20.74  ? 202  GLU C OE2   1 
ATOM   2644 N N     . ARG C 1 18  ? -25.003 23.028  -18.740 1.00 15.60  ? 203  ARG C N     1 
ATOM   2645 C CA    . ARG C 1 18  ? -25.031 21.886  -19.658 1.00 17.15  ? 203  ARG C CA    1 
ATOM   2646 C C     . ARG C 1 18  ? -25.793 22.237  -20.924 1.00 15.83  ? 203  ARG C C     1 
ATOM   2647 O O     . ARG C 1 18  ? -25.343 21.947  -22.032 1.00 15.26  ? 203  ARG C O     1 
ATOM   2648 C CB    . ARG C 1 18  ? -25.667 20.642  -19.001 1.00 17.22  ? 203  ARG C CB    1 
ATOM   2649 C CG    . ARG C 1 18  ? -26.095 19.526  -19.981 1.00 20.77  ? 203  ARG C CG    1 
ATOM   2650 C CD    . ARG C 1 18  ? -26.667 18.303  -19.271 1.00 21.01  ? 203  ARG C CD    1 
ATOM   2651 N NE    . ARG C 1 18  ? -25.614 17.570  -18.564 1.00 27.06  ? 203  ARG C NE    1 
ATOM   2652 C CZ    . ARG C 1 18  ? -25.779 16.415  -17.916 1.00 29.16  ? 203  ARG C CZ    1 
ATOM   2653 N NH1   . ARG C 1 18  ? -26.968 15.812  -17.874 1.00 29.93  ? 203  ARG C NH1   1 
ATOM   2654 N NH2   . ARG C 1 18  ? -24.738 15.858  -17.308 1.00 28.81  ? 203  ARG C NH2   1 
ATOM   2655 N N     . LYS C 1 19  ? -26.962 22.849  -20.750 1.00 14.90  ? 204  LYS C N     1 
ATOM   2656 C CA    . LYS C 1 19  ? -27.797 23.228  -21.890 1.00 14.74  ? 204  LYS C CA    1 
ATOM   2657 C C     . LYS C 1 19  ? -27.113 24.234  -22.803 1.00 13.63  ? 204  LYS C C     1 
ATOM   2658 O O     . LYS C 1 19  ? -27.206 24.126  -24.025 1.00 13.76  ? 204  LYS C O     1 
ATOM   2659 C CB    . LYS C 1 19  ? -29.170 23.748  -21.436 1.00 15.18  ? 204  LYS C CB    1 
ATOM   2660 C CG    . LYS C 1 19  ? -30.141 22.644  -21.015 1.00 18.67  ? 204  LYS C CG    1 
ATOM   2661 C CD    . LYS C 1 19  ? -31.530 23.219  -20.799 1.00 22.20  ? 204  LYS C CD    1 
ATOM   2662 C CE    . LYS C 1 19  ? -32.413 22.294  -19.971 1.00 24.41  ? 204  LYS C CE    1 
ATOM   2663 N NZ    . LYS C 1 19  ? -32.198 22.465  -18.504 1.00 26.69  ? 204  LYS C NZ    1 
ATOM   2664 N N     . ARG C 1 20  ? -26.419 25.205  -22.220 1.00 12.90  ? 205  ARG C N     1 
ATOM   2665 C CA    . ARG C 1 20  ? -25.693 26.160  -23.055 1.00 12.66  ? 205  ARG C CA    1 
ATOM   2666 C C     . ARG C 1 20  ? -24.625 25.464  -23.886 1.00 12.53  ? 205  ARG C C     1 
ATOM   2667 O O     . ARG C 1 20  ? -24.474 25.751  -25.080 1.00 12.37  ? 205  ARG C O     1 
ATOM   2668 C CB    . ARG C 1 20  ? -25.041 27.243  -22.216 1.00 13.18  ? 205  ARG C CB    1 
ATOM   2669 C CG    . ARG C 1 20  ? -26.009 28.310  -21.775 1.00 13.37  ? 205  ARG C CG    1 
ATOM   2670 C CD    . ARG C 1 20  ? -25.269 29.516  -21.226 1.00 14.46  ? 205  ARG C CD    1 
ATOM   2671 N NE    . ARG C 1 20  ? -24.547 29.180  -20.001 1.00 15.40  ? 205  ARG C NE    1 
ATOM   2672 C CZ    . ARG C 1 20  ? -25.083 29.184  -18.783 1.00 14.98  ? 205  ARG C CZ    1 
ATOM   2673 N NH1   . ARG C 1 20  ? -26.361 29.519  -18.624 1.00 15.12  ? 205  ARG C NH1   1 
ATOM   2674 N NH2   . ARG C 1 20  ? -24.341 28.842  -17.729 1.00 16.03  ? 205  ARG C NH2   1 
ATOM   2675 N N     . ILE C 1 21  ? -23.841 24.587  -23.259 1.00 12.77  ? 206  ILE C N     1 
ATOM   2676 C CA    . ILE C 1 21  ? -22.794 23.895  -24.011 1.00 12.86  ? 206  ILE C CA    1 
ATOM   2677 C C     . ILE C 1 21  ? -23.390 22.949  -25.049 1.00 12.58  ? 206  ILE C C     1 
ATOM   2678 O O     . ILE C 1 21  ? -22.935 22.924  -26.198 1.00 12.94  ? 206  ILE C O     1 
ATOM   2679 C CB    . ILE C 1 21  ? -21.789 23.159  -23.092 1.00 12.66  ? 206  ILE C CB    1 
ATOM   2680 C CG1   . ILE C 1 21  ? -21.121 24.143  -22.124 1.00 13.25  ? 206  ILE C CG1   1 
ATOM   2681 C CG2   . ILE C 1 21  ? -20.747 22.402  -23.933 1.00 13.51  ? 206  ILE C CG2   1 
ATOM   2682 C CD1   . ILE C 1 21  ? -20.264 25.233  -22.807 1.00 13.70  ? 206  ILE C CD1   1 
ATOM   2683 N N     . ASP C 1 22  ? -24.419 22.194  -24.660 1.00 13.25  ? 207  ASP C N     1 
ATOM   2684 C CA    . ASP C 1 22  ? -25.122 21.331  -25.605 1.00 14.04  ? 207  ASP C CA    1 
ATOM   2685 C C     . ASP C 1 22  ? -25.563 22.127  -26.834 1.00 14.34  ? 207  ASP C C     1 
ATOM   2686 O O     . ASP C 1 22  ? -25.443 21.654  -27.960 1.00 14.76  ? 207  ASP C O     1 
ATOM   2687 C CB    . ASP C 1 22  ? -26.382 20.725  -24.970 1.00 14.07  ? 207  ASP C CB    1 
ATOM   2688 C CG    . ASP C 1 22  ? -26.094 19.614  -23.957 1.00 16.79  ? 207  ASP C CG    1 
ATOM   2689 O OD1   . ASP C 1 22  ? -24.924 19.234  -23.736 1.00 18.03  ? 207  ASP C OD1   1 
ATOM   2690 O OD2   . ASP C 1 22  ? -27.091 19.120  -23.374 1.00 20.18  ? 207  ASP C OD2   1 
ATOM   2691 N N     . GLU C 1 23  ? -26.096 23.330  -26.604 1.00 14.72  ? 208  GLU C N     1 
ATOM   2692 C CA    . GLU C 1 23  ? -26.651 24.143  -27.693 1.00 16.31  ? 208  GLU C CA    1 
ATOM   2693 C C     . GLU C 1 23  ? -25.567 24.773  -28.571 1.00 15.37  ? 208  GLU C C     1 
ATOM   2694 O O     . GLU C 1 23  ? -25.741 24.896  -29.791 1.00 15.18  ? 208  GLU C O     1 
ATOM   2695 C CB    . GLU C 1 23  ? -27.677 25.154  -27.148 1.00 16.15  ? 208  GLU C CB    1 
ATOM   2696 C CG    . GLU C 1 23  ? -29.000 24.456  -26.720 1.00 19.62  ? 208  GLU C CG    1 
ATOM   2697 C CD    . GLU C 1 23  ? -29.860 25.234  -25.713 1.00 20.24  ? 208  GLU C CD    1 
ATOM   2698 O OE1   . GLU C 1 23  ? -30.938 24.705  -25.340 1.00 25.46  ? 208  GLU C OE1   1 
ATOM   2699 O OE2   . GLU C 1 23  ? -29.473 26.356  -25.287 1.00 25.20  ? 208  GLU C OE2   1 
ATOM   2700 N N     . LEU C 1 24  ? -24.434 25.134  -27.963 1.00 13.98  ? 209  LEU C N     1 
ATOM   2701 C CA    . LEU C 1 24  ? -23.281 25.615  -28.739 1.00 14.07  ? 209  LEU C CA    1 
ATOM   2702 C C     . LEU C 1 24  ? -22.774 24.522  -29.673 1.00 13.99  ? 209  LEU C C     1 
ATOM   2703 O O     . LEU C 1 24  ? -22.434 24.789  -30.834 1.00 14.69  ? 209  LEU C O     1 
ATOM   2704 C CB    . LEU C 1 24  ? -22.164 26.111  -27.809 1.00 14.34  ? 209  LEU C CB    1 
ATOM   2705 C CG    . LEU C 1 24  ? -22.356 27.533  -27.257 1.00 13.90  ? 209  LEU C CG    1 
ATOM   2706 C CD1   . LEU C 1 24  ? -21.555 27.748  -25.985 1.00 14.91  ? 209  LEU C CD1   1 
ATOM   2707 C CD2   . LEU C 1 24  ? -21.984 28.595  -28.312 1.00 15.80  ? 209  LEU C CD2   1 
ATOM   2708 N N     . ILE C 1 25  ? -22.727 23.292  -29.163 1.00 13.85  ? 210  ILE C N     1 
ATOM   2709 C CA    . ILE C 1 25  ? -22.349 22.122  -29.949 1.00 14.15  ? 210  ILE C CA    1 
ATOM   2710 C C     . ILE C 1 25  ? -23.363 21.874  -31.072 1.00 15.00  ? 210  ILE C C     1 
ATOM   2711 O O     . ILE C 1 25  ? -22.982 21.761  -32.242 1.00 14.60  ? 210  ILE C O     1 
ATOM   2712 C CB    . ILE C 1 25  ? -22.173 20.875  -29.041 1.00 13.91  ? 210  ILE C CB    1 
ATOM   2713 C CG1   . ILE C 1 25  ? -20.919 21.034  -28.182 1.00 13.78  ? 210  ILE C CG1   1 
ATOM   2714 C CG2   . ILE C 1 25  ? -22.089 19.572  -29.871 1.00 14.18  ? 210  ILE C CG2   1 
ATOM   2715 C CD1   . ILE C 1 25  ? -20.848 20.055  -27.008 1.00 14.49  ? 210  ILE C CD1   1 
ATOM   2716 N N     . GLU C 1 26  ? -24.650 21.810  -30.718 1.00 15.26  ? 211  GLU C N     1 
ATOM   2717 C CA    . GLU C 1 26  ? -25.667 21.400  -31.677 1.00 16.67  ? 211  GLU C CA    1 
ATOM   2718 C C     . GLU C 1 26  ? -25.895 22.403  -32.796 1.00 16.50  ? 211  GLU C C     1 
ATOM   2719 O O     . GLU C 1 26  ? -26.106 22.017  -33.952 1.00 17.48  ? 211  GLU C O     1 
ATOM   2720 C CB    . GLU C 1 26  ? -26.962 21.052  -30.949 1.00 17.21  ? 211  GLU C CB    1 
ATOM   2721 C CG    . GLU C 1 26  ? -26.820 19.736  -30.209 1.00 20.96  ? 211  GLU C CG    1 
ATOM   2722 C CD    . GLU C 1 26  ? -27.940 19.444  -29.231 1.00 24.66  ? 211  GLU C CD    1 
ATOM   2723 O OE1   . GLU C 1 26  ? -27.903 18.343  -28.635 1.00 27.23  ? 211  GLU C OE1   1 
ATOM   2724 O OE2   . GLU C 1 26  ? -28.842 20.293  -29.042 1.00 27.40  ? 211  GLU C OE2   1 
ATOM   2725 N N     . SER C 1 27  ? -25.803 23.682  -32.469 1.00 16.09  ? 212  SER C N     1 
ATOM   2726 C CA    . SER C 1 27  ? -25.990 24.723  -33.480 1.00 16.63  ? 212  SER C CA    1 
ATOM   2727 C C     . SER C 1 27  ? -24.790 24.842  -34.420 1.00 16.74  ? 212  SER C C     1 
ATOM   2728 O O     . SER C 1 27  ? -24.946 25.198  -35.588 1.00 17.04  ? 212  SER C O     1 
ATOM   2729 C CB    . SER C 1 27  ? -26.226 26.054  -32.796 1.00 16.75  ? 212  SER C CB    1 
ATOM   2730 O OG    . SER C 1 27  ? -25.064 26.419  -32.081 1.00 19.12  ? 212  SER C OG    1 
ATOM   2731 N N     . GLY C 1 28  ? -23.589 24.593  -33.890 1.00 16.70  ? 213  GLY C N     1 
ATOM   2732 C CA    . GLY C 1 28  ? -22.369 24.590  -34.709 1.00 16.81  ? 213  GLY C CA    1 
ATOM   2733 C C     . GLY C 1 28  ? -22.051 25.901  -35.415 1.00 16.63  ? 213  GLY C C     1 
ATOM   2734 O O     . GLY C 1 28  ? -21.491 25.888  -36.510 1.00 16.95  ? 213  GLY C O     1 
ATOM   2735 N N     . LYS C 1 29  ? -22.398 27.033  -34.800 1.00 16.88  ? 214  LYS C N     1 
ATOM   2736 C CA    . LYS C 1 29  ? -22.212 28.350  -35.449 1.00 16.98  ? 214  LYS C CA    1 
ATOM   2737 C C     . LYS C 1 29  ? -20.748 28.782  -35.583 1.00 16.06  ? 214  LYS C C     1 
ATOM   2738 O O     . LYS C 1 29  ? -20.377 29.504  -36.525 1.00 16.91  ? 214  LYS C O     1 
ATOM   2739 C CB    . LYS C 1 29  ? -22.979 29.433  -34.703 1.00 18.02  ? 214  LYS C CB    1 
ATOM   2740 C CG    . LYS C 1 29  ? -24.490 29.325  -34.841 1.00 20.78  ? 214  LYS C CG    1 
ATOM   2741 C CD    . LYS C 1 29  ? -25.184 30.427  -34.051 1.00 24.97  ? 214  LYS C CD    1 
ATOM   2742 C CE    . LYS C 1 29  ? -25.162 30.159  -32.551 1.00 27.03  ? 214  LYS C CE    1 
ATOM   2743 N NZ    . LYS C 1 29  ? -23.907 30.601  -31.874 1.00 28.99  ? 214  LYS C NZ    1 
ATOM   2744 N N     . GLU C 1 30  ? -19.933 28.350  -34.629 1.00 14.13  ? 215  GLU C N     1 
ATOM   2745 C CA    . GLU C 1 30  ? -18.487 28.558  -34.678 1.00 13.09  ? 215  GLU C CA    1 
ATOM   2746 C C     . GLU C 1 30  ? -18.158 30.032  -34.845 1.00 13.71  ? 215  GLU C C     1 
ATOM   2747 O O     . GLU C 1 30  ? -17.394 30.428  -35.725 1.00 15.13  ? 215  GLU C O     1 
ATOM   2748 C CB    . GLU C 1 30  ? -17.858 27.666  -35.756 1.00 12.64  ? 215  GLU C CB    1 
ATOM   2749 C CG    . GLU C 1 30  ? -18.251 26.195  -35.559 1.00 11.27  ? 215  GLU C CG    1 
ATOM   2750 C CD    . GLU C 1 30  ? -17.315 25.194  -36.203 1.00 10.87  ? 215  GLU C CD    1 
ATOM   2751 O OE1   . GLU C 1 30  ? -16.546 25.555  -37.124 1.00 11.69  ? 215  GLU C OE1   1 
ATOM   2752 O OE2   . GLU C 1 30  ? -17.369 24.023  -35.770 1.00 10.26  ? 215  GLU C OE2   1 
ATOM   2753 N N     . GLU C 1 31  ? -18.728 30.839  -33.962 1.00 13.70  ? 216  GLU C N     1 
ATOM   2754 C CA    . GLU C 1 31  ? -18.532 32.280  -34.018 1.00 14.09  ? 216  GLU C CA    1 
ATOM   2755 C C     . GLU C 1 31  ? -17.202 32.710  -33.426 1.00 13.47  ? 216  GLU C C     1 
ATOM   2756 O O     . GLU C 1 31  ? -16.631 32.031  -32.570 1.00 13.21  ? 216  GLU C O     1 
ATOM   2757 C CB    . GLU C 1 31  ? -19.673 32.995  -33.297 1.00 15.26  ? 216  GLU C CB    1 
ATOM   2758 C CG    . GLU C 1 31  ? -21.022 32.761  -33.951 1.00 19.69  ? 216  GLU C CG    1 
ATOM   2759 C CD    . GLU C 1 31  ? -22.153 33.454  -33.217 1.00 24.50  ? 216  GLU C CD    1 
ATOM   2760 O OE1   . GLU C 1 31  ? -22.141 33.478  -31.963 1.00 27.47  ? 216  GLU C OE1   1 
ATOM   2761 O OE2   . GLU C 1 31  ? -23.053 33.972  -33.906 1.00 27.68  ? 216  GLU C OE2   1 
ATOM   2762 N N     . GLY C 1 32  ? -16.713 33.852  -33.889 1.00 12.42  ? 217  GLY C N     1 
ATOM   2763 C CA    . GLY C 1 32  ? -15.539 34.468  -33.297 1.00 11.80  ? 217  GLY C CA    1 
ATOM   2764 C C     . GLY C 1 32  ? -14.218 33.954  -33.819 1.00 11.53  ? 217  GLY C C     1 
ATOM   2765 O O     . GLY C 1 32  ? -13.196 34.175  -33.188 1.00 10.71  ? 217  GLY C O     1 
ATOM   2766 N N     . MET C 1 33  ? -14.240 33.318  -34.990 1.00 10.75  ? 218  MET C N     1 
ATOM   2767 C CA    . MET C 1 33  ? -13.073 32.678  -35.579 1.00 11.03  ? 218  MET C CA    1 
ATOM   2768 C C     . MET C 1 33  ? -13.036 32.884  -37.082 1.00 10.74  ? 218  MET C C     1 
ATOM   2769 O O     . MET C 1 33  ? -14.081 32.997  -37.733 1.00 11.76  ? 218  MET C O     1 
ATOM   2770 C CB    . MET C 1 33  ? -13.123 31.172  -35.325 1.00 11.81  ? 218  MET C CB    1 
ATOM   2771 C CG    . MET C 1 33  ? -12.892 30.786  -33.905 1.00 12.36  ? 218  MET C CG    1 
ATOM   2772 S SD    . MET C 1 33  ? -13.234 29.026  -33.700 1.00 11.72  ? 218  MET C SD    1 
ATOM   2773 C CE    . MET C 1 33  ? -15.029 29.040  -33.659 1.00 15.12  ? 218  MET C CE    1 
ATOM   2774 N N     . LYS C 1 34  ? -11.831 32.931  -37.638 1.00 10.38  ? 219  LYS C N     1 
ATOM   2775 C CA    . LYS C 1 34  ? -11.687 32.981  -39.090 1.00 11.82  ? 219  LYS C CA    1 
ATOM   2776 C C     . LYS C 1 34  ? -10.447 32.189  -39.504 1.00 10.96  ? 219  LYS C C     1 
ATOM   2777 O O     . LYS C 1 34  ? -9.469  32.101  -38.752 1.00 10.65  ? 219  LYS C O     1 
ATOM   2778 C CB    . LYS C 1 34  ? -11.616 34.441  -39.571 1.00 12.82  ? 219  LYS C CB    1 
ATOM   2779 C CG    . LYS C 1 34  ? -10.278 35.122  -39.367 1.00 15.66  ? 219  LYS C CG    1 
ATOM   2780 C CD    . LYS C 1 34  ? -10.151 36.477  -40.073 1.00 16.94  ? 219  LYS C CD    1 
ATOM   2781 C CE    . LYS C 1 34  ? -10.954 37.563  -39.393 1.00 23.12  ? 219  LYS C CE    1 
ATOM   2782 N NZ    . LYS C 1 34  ? -10.459 38.932  -39.705 1.00 27.73  ? 219  LYS C NZ    1 
ATOM   2783 N N     . ILE C 1 35  ? -10.493 31.608  -40.701 1.00 10.58  ? 220  ILE C N     1 
ATOM   2784 C CA    . ILE C 1 35  ? -9.340  30.919  -41.256 1.00 11.13  ? 220  ILE C CA    1 
ATOM   2785 C C     . ILE C 1 35  ? -8.310  31.942  -41.730 1.00 11.36  ? 220  ILE C C     1 
ATOM   2786 O O     . ILE C 1 35  ? -8.661  32.992  -42.282 1.00 12.03  ? 220  ILE C O     1 
ATOM   2787 C CB    . ILE C 1 35  ? -9.747  30.046  -42.445 1.00 10.92  ? 220  ILE C CB    1 
ATOM   2788 C CG1   . ILE C 1 35  ? -10.772 29.005  -42.003 1.00 11.59  ? 220  ILE C CG1   1 
ATOM   2789 C CG2   . ILE C 1 35  ? -8.520  29.371  -43.066 1.00 12.44  ? 220  ILE C CG2   1 
ATOM   2790 C CD1   . ILE C 1 35  ? -11.435 28.246  -43.170 1.00 13.04  ? 220  ILE C CD1   1 
ATOM   2791 N N     . ASP C 1 36  ? -7.037  31.644  -41.501 1.00 11.08  ? 221  ASP C N     1 
ATOM   2792 C CA    . ASP C 1 36  ? -5.964  32.483  -42.037 1.00 11.96  ? 221  ASP C CA    1 
ATOM   2793 C C     . ASP C 1 36  ? -4.814  31.580  -42.445 1.00 11.59  ? 221  ASP C C     1 
ATOM   2794 O O     . ASP C 1 36  ? -4.701  30.446  -41.961 1.00 12.47  ? 221  ASP C O     1 
ATOM   2795 C CB    . ASP C 1 36  ? -5.512  33.505  -40.974 1.00 12.92  ? 221  ASP C CB    1 
ATOM   2796 C CG    . ASP C 1 36  ? -4.719  34.671  -41.565 1.00 15.56  ? 221  ASP C CG    1 
ATOM   2797 O OD1   . ASP C 1 36  ? -4.939  35.036  -42.751 1.00 18.26  ? 221  ASP C OD1   1 
ATOM   2798 O OD2   . ASP C 1 36  ? -3.876  35.237  -40.839 1.00 19.70  ? 221  ASP C OD2   1 
ATOM   2799 N N     . LEU C 1 37  ? -3.982  32.046  -43.368 1.00 11.31  ? 222  LEU C N     1 
ATOM   2800 C CA    . LEU C 1 37  ? -2.743  31.340  -43.644 1.00 11.32  ? 222  LEU C CA    1 
ATOM   2801 C C     . LEU C 1 37  ? -1.748  31.707  -42.561 1.00 10.68  ? 222  LEU C C     1 
ATOM   2802 O O     . LEU C 1 37  ? -1.539  32.884  -42.268 1.00 11.85  ? 222  LEU C O     1 
ATOM   2803 C CB    . LEU C 1 37  ? -2.179  31.682  -45.027 1.00 12.32  ? 222  LEU C CB    1 
ATOM   2804 C CG    . LEU C 1 37  ? -3.061  31.257  -46.199 1.00 14.19  ? 222  LEU C CG    1 
ATOM   2805 C CD1   . LEU C 1 37  ? -2.392  31.715  -47.494 1.00 16.39  ? 222  LEU C CD1   1 
ATOM   2806 C CD2   . LEU C 1 37  ? -3.333  29.743  -46.173 1.00 16.73  ? 222  LEU C CD2   1 
ATOM   2807 N N     . ILE C 1 38  ? -1.144  30.683  -41.970 1.00 9.82   ? 223  ILE C N     1 
ATOM   2808 C CA    . ILE C 1 38  ? -0.191  30.859  -40.883 1.00 9.22   ? 223  ILE C CA    1 
ATOM   2809 C C     . ILE C 1 38  ? 1.203   30.402  -41.300 1.00 9.66   ? 223  ILE C C     1 
ATOM   2810 O O     . ILE C 1 38  ? 1.393   29.270  -41.770 1.00 9.43   ? 223  ILE C O     1 
ATOM   2811 C CB    . ILE C 1 38  ? -0.626  30.043  -39.624 1.00 9.26   ? 223  ILE C CB    1 
ATOM   2812 C CG1   . ILE C 1 38  ? -2.056  30.390  -39.183 1.00 10.78  ? 223  ILE C CG1   1 
ATOM   2813 C CG2   . ILE C 1 38  ? 0.372   30.253  -38.504 1.00 10.44  ? 223  ILE C CG2   1 
ATOM   2814 C CD1   . ILE C 1 38  ? -2.243  31.793  -38.685 1.00 11.55  ? 223  ILE C CD1   1 
ATOM   2815 N N     . ASP C 1 39  ? 2.180   31.279  -41.096 1.00 9.99   ? 224  ASP C N     1 
ATOM   2816 C CA    . ASP C 1 39  ? 3.547   31.029  -41.550 1.00 10.45  ? 224  ASP C CA    1 
ATOM   2817 C C     . ASP C 1 39  ? 4.082   29.687  -41.034 1.00 10.13  ? 224  ASP C C     1 
ATOM   2818 O O     . ASP C 1 39  ? 4.150   29.455  -39.811 1.00 10.86  ? 224  ASP C O     1 
ATOM   2819 C CB    . ASP C 1 39  ? 4.441   32.177  -41.070 1.00 10.66  ? 224  ASP C CB    1 
ATOM   2820 C CG    . ASP C 1 39  ? 5.702   32.335  -41.900 1.00 12.76  ? 224  ASP C CG    1 
ATOM   2821 O OD1   . ASP C 1 39  ? 5.765   31.823  -43.039 1.00 13.50  ? 224  ASP C OD1   1 
ATOM   2822 O OD2   . ASP C 1 39  ? 6.639   33.010  -41.408 1.00 15.88  ? 224  ASP C OD2   1 
ATOM   2823 N N     . GLY C 1 40  ? 4.405   28.791  -41.969 1.00 10.35  ? 225  GLY C N     1 
ATOM   2824 C CA    . GLY C 1 40  ? 4.995   27.509  -41.646 1.00 11.03  ? 225  GLY C CA    1 
ATOM   2825 C C     . GLY C 1 40  ? 4.017   26.429  -41.207 1.00 10.65  ? 225  GLY C C     1 
ATOM   2826 O O     . GLY C 1 40  ? 4.427   25.300  -40.959 1.00 11.92  ? 225  GLY C O     1 
ATOM   2827 N N     . LYS C 1 41  ? 2.724   26.753  -41.115 1.00 9.98   ? 226  LYS C N     1 
ATOM   2828 C CA    . LYS C 1 41  ? 1.756   25.799  -40.547 1.00 10.06  ? 226  LYS C CA    1 
ATOM   2829 C C     . LYS C 1 41  ? 0.630   25.409  -41.497 1.00 10.00  ? 226  LYS C C     1 
ATOM   2830 O O     . LYS C 1 41  ? -0.198  24.581  -41.135 1.00 11.30  ? 226  LYS C O     1 
ATOM   2831 C CB    . LYS C 1 41  ? 1.144   26.364  -39.253 1.00 10.09  ? 226  LYS C CB    1 
ATOM   2832 C CG    . LYS C 1 41  ? 2.159   26.831  -38.232 1.00 10.39  ? 226  LYS C CG    1 
ATOM   2833 C CD    . LYS C 1 41  ? 1.503   27.178  -36.903 1.00 9.68   ? 226  LYS C CD    1 
ATOM   2834 C CE    . LYS C 1 41  ? 2.360   28.181  -36.150 1.00 10.57  ? 226  LYS C CE    1 
ATOM   2835 N NZ    . LYS C 1 41  ? 1.716   28.600  -34.885 1.00 10.83  ? 226  LYS C NZ    1 
ATOM   2836 N N     . GLY C 1 42  ? 0.598   25.988  -42.699 1.00 9.55   ? 227  GLY C N     1 
ATOM   2837 C CA    . GLY C 1 42  ? -0.554  25.820  -43.584 1.00 9.74   ? 227  GLY C CA    1 
ATOM   2838 C C     . GLY C 1 42  ? -1.663  26.783  -43.199 1.00 9.17   ? 227  GLY C C     1 
ATOM   2839 O O     . GLY C 1 42  ? -1.408  27.972  -42.926 1.00 10.11  ? 227  GLY C O     1 
ATOM   2840 N N     . ARG C 1 43  ? -2.907  26.296  -43.194 1.00 8.74   ? 228  ARG C N     1 
ATOM   2841 C CA    . ARG C 1 43  ? -4.015  27.096  -42.706 1.00 8.99   ? 228  ARG C CA    1 
ATOM   2842 C C     . ARG C 1 43  ? -4.058  27.014  -41.186 1.00 8.91   ? 228  ARG C C     1 
ATOM   2843 O O     . ARG C 1 43  ? -3.571  26.052  -40.600 1.00 8.61   ? 228  ARG C O     1 
ATOM   2844 C CB    . ARG C 1 43  ? -5.340  26.582  -43.254 1.00 9.87   ? 228  ARG C CB    1 
ATOM   2845 C CG    . ARG C 1 43  ? -5.442  26.605  -44.769 1.00 11.86  ? 228  ARG C CG    1 
ATOM   2846 C CD    . ARG C 1 43  ? -6.664  25.769  -45.178 1.00 14.66  ? 228  ARG C CD    1 
ATOM   2847 N NE    . ARG C 1 43  ? -6.417  24.355  -44.909 1.00 14.69  ? 228  ARG C NE    1 
ATOM   2848 C CZ    . ARG C 1 43  ? -7.267  23.383  -45.216 1.00 13.72  ? 228  ARG C CZ    1 
ATOM   2849 N NH1   . ARG C 1 43  ? -8.445  23.674  -45.772 1.00 15.98  ? 228  ARG C NH1   1 
ATOM   2850 N NH2   . ARG C 1 43  ? -6.952  22.132  -44.947 1.00 13.94  ? 228  ARG C NH2   1 
ATOM   2851 N N     . GLY C 1 44  ? -4.656  28.020  -40.567 1.00 8.95   ? 229  GLY C N     1 
ATOM   2852 C CA    . GLY C 1 44  ? -4.932  27.977  -39.141 1.00 8.62   ? 229  GLY C CA    1 
ATOM   2853 C C     . GLY C 1 44  ? -6.165  28.797  -38.851 1.00 8.41   ? 229  GLY C C     1 
ATOM   2854 O O     . GLY C 1 44  ? -6.833  29.267  -39.783 1.00 8.81   ? 229  GLY C O     1 
ATOM   2855 N N     . VAL C 1 45  ? -6.460  28.981  -37.567 1.00 8.02   ? 230  VAL C N     1 
ATOM   2856 C CA    . VAL C 1 45  ? -7.682  29.683  -37.173 1.00 7.47   ? 230  VAL C CA    1 
ATOM   2857 C C     . VAL C 1 45  ? -7.301  30.786  -36.205 1.00 8.22   ? 230  VAL C C     1 
ATOM   2858 O O     . VAL C 1 45  ? -6.578  30.532  -35.235 1.00 8.66   ? 230  VAL C O     1 
ATOM   2859 C CB    . VAL C 1 45  ? -8.716  28.711  -36.548 1.00 7.88   ? 230  VAL C CB    1 
ATOM   2860 C CG1   . VAL C 1 45  ? -10.036 29.420  -36.246 1.00 8.81   ? 230  VAL C CG1   1 
ATOM   2861 C CG2   . VAL C 1 45  ? -8.956  27.544  -37.491 1.00 8.77   ? 230  VAL C CG2   1 
ATOM   2862 N N     . ILE C 1 46  ? -7.770  32.002  -36.493 1.00 8.81   ? 231  ILE C N     1 
ATOM   2863 C CA    . ILE C 1 46  ? -7.496  33.174  -35.663 1.00 10.14  ? 231  ILE C CA    1 
ATOM   2864 C C     . ILE C 1 46  ? -8.780  33.603  -34.956 1.00 9.79   ? 231  ILE C C     1 
ATOM   2865 O O     . ILE C 1 46  ? -9.869  33.501  -35.498 1.00 10.54  ? 231  ILE C O     1 
ATOM   2866 C CB    . ILE C 1 46  ? -6.897  34.318  -36.546 1.00 11.53  ? 231  ILE C CB    1 
ATOM   2867 C CG1   . ILE C 1 46  ? -5.442  33.970  -36.940 1.00 14.77  ? 231  ILE C CG1   1 
ATOM   2868 C CG2   . ILE C 1 46  ? -6.980  35.698  -35.874 1.00 15.15  ? 231  ILE C CG2   1 
ATOM   2869 C CD1   . ILE C 1 46  ? -5.320  32.894  -37.981 1.00 19.41  ? 231  ILE C CD1   1 
ATOM   2870 N N     . ALA C 1 47  ? -8.645  34.060  -33.714 1.00 10.04  ? 232  ALA C N     1 
ATOM   2871 C CA    . ALA C 1 47  ? -9.778  34.639  -32.992 1.00 10.21  ? 232  ALA C CA    1 
ATOM   2872 C C     . ALA C 1 47  ? -10.161 35.977  -33.614 1.00 10.91  ? 232  ALA C C     1 
ATOM   2873 O O     . ALA C 1 47  ? -9.288  36.790  -33.927 1.00 10.71  ? 232  ALA C O     1 
ATOM   2874 C CB    . ALA C 1 47  ? -9.398  34.833  -31.527 1.00 10.58  ? 232  ALA C CB    1 
ATOM   2875 N N     . THR C 1 48  ? -11.457 36.229  -33.771 1.00 11.25  ? 233  THR C N     1 
ATOM   2876 C CA    . THR C 1 48  ? -11.910 37.541  -34.254 1.00 12.54  ? 233  THR C CA    1 
ATOM   2877 C C     . THR C 1 48  ? -12.597 38.327  -33.141 1.00 12.86  ? 233  THR C C     1 
ATOM   2878 O O     . THR C 1 48  ? -13.080 39.448  -33.359 1.00 14.99  ? 233  THR C O     1 
ATOM   2879 C CB    . THR C 1 48  ? -12.898 37.411  -35.429 1.00 12.53  ? 233  THR C CB    1 
ATOM   2880 O OG1   . THR C 1 48  ? -14.060 36.699  -34.987 1.00 14.20  ? 233  THR C OG1   1 
ATOM   2881 C CG2   . THR C 1 48  ? -12.262 36.658  -36.562 1.00 13.51  ? 233  THR C CG2   1 
ATOM   2882 N N     . LYS C 1 49  ? -12.650 37.731  -31.952 1.00 12.62  ? 234  LYS C N     1 
ATOM   2883 C CA    . LYS C 1 49  ? -13.206 38.372  -30.762 1.00 13.23  ? 234  LYS C CA    1 
ATOM   2884 C C     . LYS C 1 49  ? -12.386 37.899  -29.585 1.00 13.12  ? 234  LYS C C     1 
ATOM   2885 O O     . LYS C 1 49  ? -11.590 36.961  -29.719 1.00 12.83  ? 234  LYS C O     1 
ATOM   2886 C CB    . LYS C 1 49  ? -14.676 37.977  -30.561 1.00 13.60  ? 234  LYS C CB    1 
ATOM   2887 C CG    . LYS C 1 49  ? -14.898 36.500  -30.242 1.00 14.08  ? 234  LYS C CG    1 
ATOM   2888 C CD    . LYS C 1 49  ? -16.386 36.213  -29.970 1.00 14.46  ? 234  LYS C CD    1 
ATOM   2889 C CE    . LYS C 1 49  ? -16.605 34.836  -29.384 1.00 17.63  ? 234  LYS C CE    1 
ATOM   2890 N NZ    . LYS C 1 49  ? -18.056 34.509  -29.246 1.00 19.64  ? 234  LYS C NZ    1 
ATOM   2891 N N     . GLN C 1 50  ? -12.573 38.541  -28.437 1.00 12.58  ? 235  GLN C N     1 
ATOM   2892 C CA    . GLN C 1 50  ? -11.967 38.062  -27.200 1.00 13.34  ? 235  GLN C CA    1 
ATOM   2893 C C     . GLN C 1 50  ? -12.642 36.768  -26.750 1.00 12.53  ? 235  GLN C C     1 
ATOM   2894 O O     . GLN C 1 50  ? -13.868 36.621  -26.838 1.00 13.33  ? 235  GLN C O     1 
ATOM   2895 C CB    . GLN C 1 50  ? -12.093 39.093  -26.073 1.00 14.71  ? 235  GLN C CB    1 
ATOM   2896 C CG    . GLN C 1 50  ? -11.200 38.719  -24.899 1.00 18.78  ? 235  GLN C CG    1 
ATOM   2897 C CD    . GLN C 1 50  ? -11.433 39.520  -23.645 1.00 23.07  ? 235  GLN C CD    1 
ATOM   2898 O OE1   . GLN C 1 50  ? -11.444 40.757  -23.672 1.00 26.67  ? 235  GLN C OE1   1 
ATOM   2899 N NE2   . GLN C 1 50  ? -11.575 38.817  -22.514 1.00 22.91  ? 235  GLN C NE2   1 
ATOM   2900 N N     . PHE C 1 51  ? -11.835 35.827  -26.271 1.00 11.99  ? 236  PHE C N     1 
ATOM   2901 C CA    . PHE C 1 51  ? -12.359 34.705  -25.503 1.00 11.78  ? 236  PHE C CA    1 
ATOM   2902 C C     . PHE C 1 51  ? -11.762 34.814  -24.121 1.00 12.46  ? 236  PHE C C     1 
ATOM   2903 O O     . PHE C 1 51  ? -10.573 35.098  -23.971 1.00 13.56  ? 236  PHE C O     1 
ATOM   2904 C CB    . PHE C 1 51  ? -11.985 33.355  -26.120 1.00 11.41  ? 236  PHE C CB    1 
ATOM   2905 C CG    . PHE C 1 51  ? -12.632 33.087  -27.450 1.00 11.24  ? 236  PHE C CG    1 
ATOM   2906 C CD1   . PHE C 1 51  ? -13.764 32.277  -27.531 1.00 11.09  ? 236  PHE C CD1   1 
ATOM   2907 C CD2   . PHE C 1 51  ? -12.083 33.592  -28.633 1.00 11.78  ? 236  PHE C CD2   1 
ATOM   2908 C CE1   . PHE C 1 51  ? -14.362 32.005  -28.761 1.00 12.06  ? 236  PHE C CE1   1 
ATOM   2909 C CE2   . PHE C 1 51  ? -12.680 33.329  -29.865 1.00 12.81  ? 236  PHE C CE2   1 
ATOM   2910 C CZ    . PHE C 1 51  ? -13.812 32.526  -29.926 1.00 11.87  ? 236  PHE C CZ    1 
ATOM   2911 N N     . SER C 1 52  ? -12.582 34.640  -23.101 1.00 12.44  ? 237  SER C N     1 
ATOM   2912 C CA    . SER C 1 52  ? -12.069 34.633  -21.750 1.00 12.92  ? 237  SER C CA    1 
ATOM   2913 C C     . SER C 1 52  ? -11.740 33.215  -21.315 1.00 12.24  ? 237  SER C C     1 
ATOM   2914 O O     . SER C 1 52  ? -12.333 32.252  -21.805 1.00 11.42  ? 237  SER C O     1 
ATOM   2915 C CB    . SER C 1 52  ? -13.079 35.245  -20.779 1.00 13.95  ? 237  SER C CB    1 
ATOM   2916 O OG    . SER C 1 52  ? -13.304 36.610  -21.067 1.00 17.05  ? 237  SER C OG    1 
ATOM   2917 N N     . ARG C 1 53  ? -10.798 33.083  -20.384 1.00 12.22  ? 238  ARG C N     1 
ATOM   2918 C CA    . ARG C 1 53  ? -10.432 31.787  -19.841 1.00 12.66  ? 238  ARG C CA    1 
ATOM   2919 C C     . ARG C 1 53  ? -11.700 31.036  -19.464 1.00 12.90  ? 238  ARG C C     1 
ATOM   2920 O O     . ARG C 1 53  ? -12.576 31.577  -18.778 1.00 13.79  ? 238  ARG C O     1 
ATOM   2921 C CB    . ARG C 1 53  ? -9.547  31.975  -18.600 1.00 13.16  ? 238  ARG C CB    1 
ATOM   2922 C CG    . ARG C 1 53  ? -9.043  30.694  -17.964 1.00 16.20  ? 238  ARG C CG    1 
ATOM   2923 C CD    . ARG C 1 53  ? -8.292  31.062  -16.688 1.00 21.48  ? 238  ARG C CD    1 
ATOM   2924 N NE    . ARG C 1 53  ? -7.905  29.918  -15.871 1.00 26.61  ? 238  ARG C NE    1 
ATOM   2925 C CZ    . ARG C 1 53  ? -7.509  30.009  -14.601 1.00 30.02  ? 238  ARG C CZ    1 
ATOM   2926 N NH1   . ARG C 1 53  ? -7.461  31.192  -13.992 1.00 29.70  ? 238  ARG C NH1   1 
ATOM   2927 N NH2   . ARG C 1 53  ? -7.169  28.917  -13.929 1.00 30.34  ? 238  ARG C NH2   1 
ATOM   2928 N N     . GLY C 1 54  ? -11.798 29.804  -19.951 1.00 12.25  ? 239  GLY C N     1 
ATOM   2929 C CA    . GLY C 1 54  ? -12.923 28.937  -19.633 1.00 12.61  ? 239  GLY C CA    1 
ATOM   2930 C C     . GLY C 1 54  ? -14.039 28.929  -20.662 1.00 12.41  ? 239  GLY C C     1 
ATOM   2931 O O     . GLY C 1 54  ? -14.889 28.033  -20.628 1.00 13.93  ? 239  GLY C O     1 
ATOM   2932 N N     . ASP C 1 55  ? -14.038 29.902  -21.582 1.00 11.41  ? 240  ASP C N     1 
ATOM   2933 C CA    . ASP C 1 55  ? -15.097 30.018  -22.578 1.00 10.97  ? 240  ASP C CA    1 
ATOM   2934 C C     . ASP C 1 55  ? -15.026 28.891  -23.612 1.00 10.17  ? 240  ASP C C     1 
ATOM   2935 O O     . ASP C 1 55  ? -13.936 28.485  -24.029 1.00 9.79   ? 240  ASP C O     1 
ATOM   2936 C CB    . ASP C 1 55  ? -14.982 31.328  -23.353 1.00 11.55  ? 240  ASP C CB    1 
ATOM   2937 C CG    . ASP C 1 55  ? -15.372 32.546  -22.541 1.00 13.74  ? 240  ASP C CG    1 
ATOM   2938 O OD1   . ASP C 1 55  ? -15.780 32.406  -21.359 1.00 15.93  ? 240  ASP C OD1   1 
ATOM   2939 O OD2   . ASP C 1 55  ? -15.270 33.645  -23.127 1.00 15.05  ? 240  ASP C OD2   1 
ATOM   2940 N N     . PHE C 1 56  ? -16.193 28.419  -24.043 1.00 10.04  ? 241  PHE C N     1 
ATOM   2941 C CA    . PHE C 1 56  ? -16.306 27.545  -25.204 1.00 9.39   ? 241  PHE C CA    1 
ATOM   2942 C C     . PHE C 1 56  ? -15.699 28.232  -26.421 1.00 9.56   ? 241  PHE C C     1 
ATOM   2943 O O     . PHE C 1 56  ? -16.004 29.390  -26.692 1.00 9.74   ? 241  PHE C O     1 
ATOM   2944 C CB    . PHE C 1 56  ? -17.784 27.236  -25.476 1.00 10.08  ? 241  PHE C CB    1 
ATOM   2945 C CG    . PHE C 1 56  ? -18.011 26.357  -26.662 1.00 10.22  ? 241  PHE C CG    1 
ATOM   2946 C CD1   . PHE C 1 56  ? -18.081 24.976  -26.505 1.00 11.60  ? 241  PHE C CD1   1 
ATOM   2947 C CD2   . PHE C 1 56  ? -18.174 26.900  -27.931 1.00 9.55   ? 241  PHE C CD2   1 
ATOM   2948 C CE1   . PHE C 1 56  ? -18.309 24.156  -27.598 1.00 11.44  ? 241  PHE C CE1   1 
ATOM   2949 C CE2   . PHE C 1 56  ? -18.423 26.060  -29.042 1.00 9.76   ? 241  PHE C CE2   1 
ATOM   2950 C CZ    . PHE C 1 56  ? -18.473 24.694  -28.857 1.00 11.44  ? 241  PHE C CZ    1 
ATOM   2951 N N     . VAL C 1 57  ? -14.840 27.509  -27.141 1.00 8.44   ? 242  VAL C N     1 
ATOM   2952 C CA    . VAL C 1 57  ? -14.277 28.019  -28.390 1.00 8.40   ? 242  VAL C CA    1 
ATOM   2953 C C     . VAL C 1 57  ? -14.946 27.311  -29.584 1.00 8.22   ? 242  VAL C C     1 
ATOM   2954 O O     . VAL C 1 57  ? -15.628 27.957  -30.402 1.00 8.81   ? 242  VAL C O     1 
ATOM   2955 C CB    . VAL C 1 57  ? -12.723 27.922  -28.413 1.00 8.05   ? 242  VAL C CB    1 
ATOM   2956 C CG1   . VAL C 1 57  ? -12.171 28.410  -29.748 1.00 8.55   ? 242  VAL C CG1   1 
ATOM   2957 C CG2   . VAL C 1 57  ? -12.135 28.745  -27.270 1.00 8.95   ? 242  VAL C CG2   1 
ATOM   2958 N N     . VAL C 1 58  ? -14.754 25.994  -29.693 1.00 7.68   ? 243  VAL C N     1 
ATOM   2959 C CA    . VAL C 1 58  ? -15.270 25.261  -30.854 1.00 7.94   ? 243  VAL C CA    1 
ATOM   2960 C C     . VAL C 1 58  ? -15.266 23.765  -30.588 1.00 7.79   ? 243  VAL C C     1 
ATOM   2961 O O     . VAL C 1 58  ? -14.470 23.285  -29.790 1.00 8.36   ? 243  VAL C O     1 
ATOM   2962 C CB    . VAL C 1 58  ? -14.438 25.608  -32.133 1.00 8.56   ? 243  VAL C CB    1 
ATOM   2963 C CG1   . VAL C 1 58  ? -13.061 24.947  -32.111 1.00 9.53   ? 243  VAL C CG1   1 
ATOM   2964 C CG2   . VAL C 1 58  ? -15.201 25.247  -33.395 1.00 9.49   ? 243  VAL C CG2   1 
ATOM   2965 N N     . GLU C 1 59  ? -16.154 23.025  -31.241 1.00 7.54   ? 244  GLU C N     1 
ATOM   2966 C CA    . GLU C 1 59  ? -16.043 21.570  -31.210 1.00 7.94   ? 244  GLU C CA    1 
ATOM   2967 C C     . GLU C 1 59  ? -14.928 21.105  -32.148 1.00 7.30   ? 244  GLU C C     1 
ATOM   2968 O O     . GLU C 1 59  ? -14.706 21.716  -33.204 1.00 7.96   ? 244  GLU C O     1 
ATOM   2969 C CB    . GLU C 1 59  ? -17.358 20.928  -31.647 1.00 8.38   ? 244  GLU C CB    1 
ATOM   2970 C CG    . GLU C 1 59  ? -17.354 19.395  -31.568 1.00 8.60   ? 244  GLU C CG    1 
ATOM   2971 C CD    . GLU C 1 59  ? -18.681 18.730  -31.865 1.00 9.92   ? 244  GLU C CD    1 
ATOM   2972 O OE1   . GLU C 1 59  ? -19.641 19.426  -32.266 1.00 13.16  ? 244  GLU C OE1   1 
ATOM   2973 O OE2   . GLU C 1 59  ? -18.735 17.490  -31.684 1.00 10.89  ? 244  GLU C OE2   1 
ATOM   2974 N N     . TYR C 1 60  ? -14.237 20.022  -31.790 1.00 7.56   ? 245  TYR C N     1 
ATOM   2975 C CA    . TYR C 1 60  ? -13.447 19.294  -32.777 1.00 7.74   ? 245  TYR C CA    1 
ATOM   2976 C C     . TYR C 1 60  ? -14.413 18.367  -33.505 1.00 8.55   ? 245  TYR C C     1 
ATOM   2977 O O     . TYR C 1 60  ? -14.694 17.261  -33.047 1.00 9.15   ? 245  TYR C O     1 
ATOM   2978 C CB    . TYR C 1 60  ? -12.273 18.520  -32.150 1.00 7.69   ? 245  TYR C CB    1 
ATOM   2979 C CG    . TYR C 1 60  ? -11.313 18.072  -33.228 1.00 7.40   ? 245  TYR C CG    1 
ATOM   2980 C CD1   . TYR C 1 60  ? -10.273 18.900  -33.624 1.00 7.61   ? 245  TYR C CD1   1 
ATOM   2981 C CD2   . TYR C 1 60  ? -11.504 16.871  -33.924 1.00 7.98   ? 245  TYR C CD2   1 
ATOM   2982 C CE1   . TYR C 1 60  ? -9.403  18.514  -34.630 1.00 8.42   ? 245  TYR C CE1   1 
ATOM   2983 C CE2   . TYR C 1 60  ? -10.638 16.488  -34.955 1.00 8.92   ? 245  TYR C CE2   1 
ATOM   2984 C CZ    . TYR C 1 60  ? -9.591  17.332  -35.306 1.00 8.02   ? 245  TYR C CZ    1 
ATOM   2985 O OH    . TYR C 1 60  ? -8.722  16.999  -36.328 1.00 8.85   ? 245  TYR C OH    1 
ATOM   2986 N N     . HIS C 1 61  ? -14.973 18.865  -34.606 1.00 9.37   ? 246  HIS C N     1 
ATOM   2987 C CA    . HIS C 1 61  ? -16.096 18.185  -35.270 1.00 9.60   ? 246  HIS C CA    1 
ATOM   2988 C C     . HIS C 1 61  ? -15.618 17.385  -36.461 1.00 9.71   ? 246  HIS C C     1 
ATOM   2989 O O     . HIS C 1 61  ? -14.786 17.864  -37.259 1.00 9.72   ? 246  HIS C O     1 
ATOM   2990 C CB    . HIS C 1 61  ? -17.112 19.224  -35.747 1.00 10.28  ? 246  HIS C CB    1 
ATOM   2991 C CG    . HIS C 1 61  ? -18.431 18.633  -36.129 1.00 13.18  ? 246  HIS C CG    1 
ATOM   2992 N ND1   . HIS C 1 61  ? -18.681 18.112  -37.381 1.00 16.48  ? 246  HIS C ND1   1 
ATOM   2993 C CD2   . HIS C 1 61  ? -19.583 18.497  -35.426 1.00 15.87  ? 246  HIS C CD2   1 
ATOM   2994 C CE1   . HIS C 1 61  ? -19.929 17.682  -37.433 1.00 15.56  ? 246  HIS C CE1   1 
ATOM   2995 N NE2   . HIS C 1 61  ? -20.494 17.897  -36.258 1.00 17.63  ? 246  HIS C NE2   1 
ATOM   2996 N N     . GLY C 1 62  ? -16.133 16.163  -36.570 1.00 9.73   ? 247  GLY C N     1 
ATOM   2997 C CA    . GLY C 1 62  ? -15.845 15.297  -37.696 1.00 9.78   ? 247  GLY C CA    1 
ATOM   2998 C C     . GLY C 1 62  ? -16.595 13.993  -37.517 1.00 11.23  ? 247  GLY C C     1 
ATOM   2999 O O     . GLY C 1 62  ? -17.612 13.960  -36.843 1.00 13.25  ? 247  GLY C O     1 
ATOM   3000 N N     . ASP C 1 63  ? -16.077 12.922  -38.104 1.00 10.92  ? 248  ASP C N     1 
ATOM   3001 C CA    . ASP C 1 63  ? -16.773 11.647  -38.063 1.00 12.19  ? 248  ASP C CA    1 
ATOM   3002 C C     . ASP C 1 63  ? -16.325 10.810  -36.878 1.00 11.77  ? 248  ASP C C     1 
ATOM   3003 O O     . ASP C 1 63  ? -15.170 10.384  -36.818 1.00 12.33  ? 248  ASP C O     1 
ATOM   3004 C CB    . ASP C 1 63  ? -16.566 10.903  -39.373 1.00 13.54  ? 248  ASP C CB    1 
ATOM   3005 C CG    . ASP C 1 63  ? -17.278 11.574  -40.540 1.00 17.09  ? 248  ASP C CG    1 
ATOM   3006 O OD1   . ASP C 1 63  ? -18.317 12.239  -40.325 1.00 22.16  ? 248  ASP C OD1   1 
ATOM   3007 O OD2   . ASP C 1 63  ? -16.800 11.431  -41.681 1.00 24.01  ? 248  ASP C OD2   1 
ATOM   3008 N N     . LEU C 1 64  ? -17.246 10.572  -35.944 1.00 11.04  ? 249  LEU C N     1 
ATOM   3009 C CA    . LEU C 1 64  ? -16.921 9.818   -34.744 1.00 11.47  ? 249  LEU C CA    1 
ATOM   3010 C C     . LEU C 1 64  ? -16.878 8.319   -35.069 1.00 11.41  ? 249  LEU C C     1 
ATOM   3011 O O     . LEU C 1 64  ? -17.850 7.751   -35.581 1.00 12.80  ? 249  LEU C O     1 
ATOM   3012 C CB    . LEU C 1 64  ? -17.929 10.110  -33.631 1.00 11.27  ? 249  LEU C CB    1 
ATOM   3013 C CG    . LEU C 1 64  ? -17.759 9.319   -32.321 1.00 11.76  ? 249  LEU C CG    1 
ATOM   3014 C CD1   . LEU C 1 64  ? -16.510 9.788   -31.547 1.00 11.73  ? 249  LEU C CD1   1 
ATOM   3015 C CD2   . LEU C 1 64  ? -18.996 9.465   -31.478 1.00 14.24  ? 249  LEU C CD2   1 
ATOM   3016 N N     . ILE C 1 65  ? -15.734 7.697   -34.803 1.00 11.35  ? 250  ILE C N     1 
ATOM   3017 C CA    . ILE C 1 65  ? -15.544 6.264   -35.051 1.00 11.87  ? 250  ILE C CA    1 
ATOM   3018 C C     . ILE C 1 65  ? -14.890 5.605   -33.834 1.00 12.48  ? 250  ILE C C     1 
ATOM   3019 O O     . ILE C 1 65  ? -14.372 6.285   -32.941 1.00 12.54  ? 250  ILE C O     1 
ATOM   3020 C CB    . ILE C 1 65  ? -14.712 6.016   -36.350 1.00 11.48  ? 250  ILE C CB    1 
ATOM   3021 C CG1   . ILE C 1 65  ? -13.307 6.635   -36.236 1.00 11.62  ? 250  ILE C CG1   1 
ATOM   3022 C CG2   . ILE C 1 65  ? -15.451 6.587   -37.589 1.00 12.19  ? 250  ILE C CG2   1 
ATOM   3023 C CD1   . ILE C 1 65  ? -12.472 6.534   -37.490 1.00 12.53  ? 250  ILE C CD1   1 
ATOM   3024 N N     . GLU C 1 66  ? -14.947 4.279   -33.784 1.00 13.55  ? 251  GLU C N     1 
ATOM   3025 C CA    . GLU C 1 66  ? -14.236 3.533   -32.751 1.00 15.13  ? 251  GLU C CA    1 
ATOM   3026 C C     . GLU C 1 66  ? -12.808 3.177   -33.179 1.00 13.92  ? 251  GLU C C     1 
ATOM   3027 O O     . GLU C 1 66  ? -12.438 3.275   -34.350 1.00 12.83  ? 251  GLU C O     1 
ATOM   3028 C CB    . GLU C 1 66  ? -15.020 2.280   -32.326 1.00 15.48  ? 251  GLU C CB    1 
ATOM   3029 C CG    . GLU C 1 66  ? -16.428 2.562   -31.791 1.00 19.90  ? 251  GLU C CG    1 
ATOM   3030 C CD    . GLU C 1 66  ? -17.240 1.298   -31.572 1.00 20.42  ? 251  GLU C CD    1 
ATOM   3031 O OE1   . GLU C 1 66  ? -16.791 0.212   -31.992 1.00 25.87  ? 251  GLU C OE1   1 
ATOM   3032 O OE2   . GLU C 1 66  ? -18.338 1.381   -30.978 1.00 26.42  ? 251  GLU C OE2   1 
ATOM   3033 N N     . ILE C 1 67  ? -12.007 2.766   -32.204 1.00 13.96  ? 252  ILE C N     1 
ATOM   3034 C CA    . ILE C 1 67  ? -10.570 2.580   -32.397 1.00 15.02  ? 252  ILE C CA    1 
ATOM   3035 C C     . ILE C 1 67  ? -10.197 1.607   -33.529 1.00 15.38  ? 252  ILE C C     1 
ATOM   3036 O O     . ILE C 1 67  ? -9.252  1.855   -34.261 1.00 14.82  ? 252  ILE C O     1 
ATOM   3037 C CB    . ILE C 1 67  ? -9.887  2.157   -31.070 1.00 14.62  ? 252  ILE C CB    1 
ATOM   3038 C CG1   . ILE C 1 67  ? -8.361  2.067   -31.227 1.00 15.20  ? 252  ILE C CG1   1 
ATOM   3039 C CG2   . ILE C 1 67  ? -10.490 0.857   -30.530 1.00 14.99  ? 252  ILE C CG2   1 
ATOM   3040 C CD1   . ILE C 1 67  ? -7.604  1.733   -29.928 1.00 15.78  ? 252  ILE C CD1   1 
ATOM   3041 N N     . THR C 1 68  ? -10.914 0.501   -33.662 1.00 16.87  ? 253  THR C N     1 
ATOM   3042 C CA    . THR C 1 68  ? -10.493 -0.474  -34.663 1.00 18.00  ? 253  THR C CA    1 
ATOM   3043 C C     . THR C 1 68  ? -10.687 0.061   -36.086 1.00 17.53  ? 253  THR C C     1 
ATOM   3044 O O     . THR C 1 68  ? -9.825  -0.134  -36.937 1.00 17.49  ? 253  THR C O     1 
ATOM   3045 C CB    . THR C 1 68  ? -11.176 -1.818  -34.478 1.00 19.09  ? 253  THR C CB    1 
ATOM   3046 O OG1   . THR C 1 68  ? -12.595 -1.646  -34.619 1.00 21.87  ? 253  THR C OG1   1 
ATOM   3047 C CG2   . THR C 1 68  ? -10.824 -2.372  -33.094 1.00 19.47  ? 253  THR C CG2   1 
ATOM   3048 N N     . ASP C 1 69  ? -11.795 0.752   -36.327 1.00 17.53  ? 254  ASP C N     1 
ATOM   3049 C CA    . ASP C 1 69  ? -11.979 1.422   -37.611 1.00 17.56  ? 254  ASP C CA    1 
ATOM   3050 C C     . ASP C 1 69  ? -10.953 2.535   -37.809 1.00 16.44  ? 254  ASP C C     1 
ATOM   3051 O O     . ASP C 1 69  ? -10.421 2.712   -38.903 1.00 16.62  ? 254  ASP C O     1 
ATOM   3052 C CB    . ASP C 1 69  ? -13.382 1.986   -37.770 1.00 18.97  ? 254  ASP C CB    1 
ATOM   3053 C CG    . ASP C 1 69  ? -13.709 2.311   -39.215 1.00 22.51  ? 254  ASP C CG    1 
ATOM   3054 O OD1   . ASP C 1 69  ? -14.369 3.343   -39.464 1.00 26.28  ? 254  ASP C OD1   1 
ATOM   3055 O OD2   . ASP C 1 69  ? -13.305 1.529   -40.117 1.00 26.38  ? 254  ASP C OD2   1 
ATOM   3056 N N     . ALA C 1 70  ? -10.669 3.284   -36.749 1.00 14.97  ? 255  ALA C N     1 
ATOM   3057 C CA    . ALA C 1 70  ? -9.642  4.331   -36.845 1.00 14.01  ? 255  ALA C CA    1 
ATOM   3058 C C     . ALA C 1 70  ? -8.302  3.756   -37.320 1.00 14.14  ? 255  ALA C C     1 
ATOM   3059 O O     . ALA C 1 70  ? -7.647  4.321   -38.208 1.00 14.12  ? 255  ALA C O     1 
ATOM   3060 C CB    . ALA C 1 70  ? -9.491  5.043   -35.522 1.00 13.60  ? 255  ALA C CB    1 
ATOM   3061 N N     . LYS C 1 71  ? -7.910  2.613   -36.746 1.00 14.55  ? 256  LYS C N     1 
ATOM   3062 C CA    . LYS C 1 71  ? -6.658  1.973   -37.124 1.00 14.94  ? 256  LYS C CA    1 
ATOM   3063 C C     . LYS C 1 71  ? -6.684  1.554   -38.596 1.00 14.82  ? 256  LYS C C     1 
ATOM   3064 O O     . LYS C 1 71  ? -5.682  1.708   -39.297 1.00 15.18  ? 256  LYS C O     1 
ATOM   3065 C CB    . LYS C 1 71  ? -6.333  0.789   -36.198 1.00 15.05  ? 256  LYS C CB    1 
ATOM   3066 C CG    . LYS C 1 71  ? -5.873  1.224   -34.813 1.00 16.43  ? 256  LYS C CG    1 
ATOM   3067 C CD    . LYS C 1 71  ? -5.575  0.026   -33.933 1.00 18.19  ? 256  LYS C CD    1 
ATOM   3068 C CE    . LYS C 1 71  ? -5.030  0.493   -32.589 1.00 18.09  ? 256  LYS C CE    1 
ATOM   3069 N NZ    . LYS C 1 71  ? -4.775  -0.668  -31.698 1.00 19.28  ? 256  LYS C NZ    1 
ATOM   3070 N N     . LYS C 1 72  ? -7.835  1.063   -39.058 1.00 15.59  ? 257  LYS C N     1 
ATOM   3071 C CA    . LYS C 1 72  ? -8.004  0.718   -40.474 1.00 16.66  ? 257  LYS C CA    1 
ATOM   3072 C C     . LYS C 1 72  ? -7.827  1.945   -41.372 1.00 16.62  ? 257  LYS C C     1 
ATOM   3073 O O     . LYS C 1 72  ? -7.121  1.896   -42.383 1.00 17.02  ? 257  LYS C O     1 
ATOM   3074 C CB    . LYS C 1 72  ? -9.372  0.086   -40.719 1.00 17.38  ? 257  LYS C CB    1 
ATOM   3075 C CG    . LYS C 1 72  ? -9.561  -1.297  -40.115 1.00 20.03  ? 257  LYS C CG    1 
ATOM   3076 C CD    . LYS C 1 72  ? -10.901 -1.883  -40.529 1.00 23.97  ? 257  LYS C CD    1 
ATOM   3077 C CE    . LYS C 1 72  ? -10.829 -2.546  -41.899 1.00 26.97  ? 257  LYS C CE    1 
ATOM   3078 N NZ    . LYS C 1 72  ? -12.164 -2.603  -42.567 1.00 29.30  ? 257  LYS C NZ    1 
ATOM   3079 N N     . ARG C 1 73  ? -8.458  3.050   -40.983 1.00 16.11  ? 258  ARG C N     1 
ATOM   3080 C CA    . ARG C 1 73  ? -8.378  4.277   -41.767 1.00 16.09  ? 258  ARG C CA    1 
ATOM   3081 C C     . ARG C 1 73  ? -6.954  4.828   -41.803 1.00 16.49  ? 258  ARG C C     1 
ATOM   3082 O O     . ARG C 1 73  ? -6.506  5.292   -42.854 1.00 16.80  ? 258  ARG C O     1 
ATOM   3083 C CB    . ARG C 1 73  ? -9.349  5.323   -41.233 1.00 15.70  ? 258  ARG C CB    1 
ATOM   3084 C CG    . ARG C 1 73  ? -10.813 4.967   -41.428 1.00 14.68  ? 258  ARG C CG    1 
ATOM   3085 C CD    . ARG C 1 73  ? -11.711 6.142   -41.118 1.00 14.32  ? 258  ARG C CD    1 
ATOM   3086 N NE    . ARG C 1 73  ? -13.127 5.795   -41.219 1.00 15.64  ? 258  ARG C NE    1 
ATOM   3087 C CZ    . ARG C 1 73  ? -14.118 6.674   -41.174 1.00 17.01  ? 258  ARG C CZ    1 
ATOM   3088 N NH1   . ARG C 1 73  ? -13.857 7.967   -41.036 1.00 15.90  ? 258  ARG C NH1   1 
ATOM   3089 N NH2   . ARG C 1 73  ? -15.377 6.263   -41.270 1.00 18.59  ? 258  ARG C NH2   1 
ATOM   3090 N N     . GLU C 1 74  ? -6.249  4.778   -40.669 1.00 16.50  ? 259  GLU C N     1 
ATOM   3091 C CA    . GLU C 1 74  ? -4.842  5.216   -40.590 1.00 17.67  ? 259  GLU C CA    1 
ATOM   3092 C C     . GLU C 1 74  ? -3.989  4.552   -41.652 1.00 18.10  ? 259  GLU C C     1 
ATOM   3093 O O     . GLU C 1 74  ? -3.205  5.211   -42.349 1.00 17.94  ? 259  GLU C O     1 
ATOM   3094 C CB    . GLU C 1 74  ? -4.224  4.868   -39.230 1.00 18.02  ? 259  GLU C CB    1 
ATOM   3095 C CG    . GLU C 1 74  ? -4.679  5.738   -38.066 1.00 17.87  ? 259  GLU C CG    1 
ATOM   3096 C CD    . GLU C 1 74  ? -3.845  6.983   -37.877 1.00 17.36  ? 259  GLU C CD    1 
ATOM   3097 O OE1   . GLU C 1 74  ? -2.958  7.271   -38.714 1.00 18.50  ? 259  GLU C OE1   1 
ATOM   3098 O OE2   . GLU C 1 74  ? -4.088  7.692   -36.883 1.00 17.46  ? 259  GLU C OE2   1 
ATOM   3099 N N     . ALA C 1 75  ? -4.143  3.237   -41.765 1.00 18.42  ? 260  ALA C N     1 
ATOM   3100 C CA    . ALA C 1 75  ? -3.326  2.455   -42.677 1.00 19.18  ? 260  ALA C CA    1 
ATOM   3101 C C     . ALA C 1 75  ? -3.654  2.804   -44.129 1.00 19.14  ? 260  ALA C C     1 
ATOM   3102 O O     . ALA C 1 75  ? -2.753  2.861   -44.971 1.00 20.50  ? 260  ALA C O     1 
ATOM   3103 C CB    . ALA C 1 75  ? -3.507  0.978   -42.410 1.00 19.41  ? 260  ALA C CB    1 
ATOM   3104 N N     . LEU C 1 76  ? -4.929  3.075   -44.405 1.00 18.82  ? 261  LEU C N     1 
ATOM   3105 C CA    . LEU C 1 76  ? -5.341  3.523   -45.736 1.00 19.02  ? 261  LEU C CA    1 
ATOM   3106 C C     . LEU C 1 76  ? -4.845  4.936   -46.030 1.00 18.46  ? 261  LEU C C     1 
ATOM   3107 O O     . LEU C 1 76  ? -4.306  5.199   -47.112 1.00 19.41  ? 261  LEU C O     1 
ATOM   3108 C CB    . LEU C 1 76  ? -6.861  3.436   -45.915 1.00 19.12  ? 261  LEU C CB    1 
ATOM   3109 C CG    . LEU C 1 76  ? -7.505  2.037   -45.870 1.00 21.79  ? 261  LEU C CG    1 
ATOM   3110 C CD1   . LEU C 1 76  ? -9.012  2.148   -45.726 1.00 24.11  ? 261  LEU C CD1   1 
ATOM   3111 C CD2   . LEU C 1 76  ? -7.147  1.201   -47.096 1.00 23.56  ? 261  LEU C CD2   1 
ATOM   3112 N N     . TYR C 1 77  ? -5.027  5.850   -45.075 1.00 17.75  ? 262  TYR C N     1 
ATOM   3113 C CA    . TYR C 1 77  ? -4.546  7.217   -45.264 1.00 17.38  ? 262  TYR C CA    1 
ATOM   3114 C C     . TYR C 1 77  ? -3.032  7.265   -45.470 1.00 18.13  ? 262  TYR C C     1 
ATOM   3115 O O     . TYR C 1 77  ? -2.542  8.084   -46.247 1.00 18.05  ? 262  TYR C O     1 
ATOM   3116 C CB    . TYR C 1 77  ? -4.913  8.110   -44.074 1.00 16.18  ? 262  TYR C CB    1 
ATOM   3117 C CG    . TYR C 1 77  ? -6.392  8.374   -43.862 1.00 14.79  ? 262  TYR C CG    1 
ATOM   3118 C CD1   . TYR C 1 77  ? -7.276  8.489   -44.933 1.00 15.06  ? 262  TYR C CD1   1 
ATOM   3119 C CD2   . TYR C 1 77  ? -6.900  8.537   -42.572 1.00 13.54  ? 262  TYR C CD2   1 
ATOM   3120 C CE1   . TYR C 1 77  ? -8.626  8.751   -44.727 1.00 14.84  ? 262  TYR C CE1   1 
ATOM   3121 C CE2   . TYR C 1 77  ? -8.248  8.804   -42.348 1.00 12.38  ? 262  TYR C CE2   1 
ATOM   3122 C CZ    . TYR C 1 77  ? -9.114  8.914   -43.427 1.00 13.63  ? 262  TYR C CZ    1 
ATOM   3123 O OH    . TYR C 1 77  ? -10.453 9.162   -43.211 1.00 14.87  ? 262  TYR C OH    1 
ATOM   3124 N N     . ALA C 1 78  ? -2.299  6.385   -44.781 1.00 19.43  ? 263  ALA C N     1 
ATOM   3125 C CA    . ALA C 1 78  ? -0.831  6.361   -44.861 1.00 20.22  ? 263  ALA C CA    1 
ATOM   3126 C C     . ALA C 1 78  ? -0.332  6.033   -46.272 1.00 20.98  ? 263  ALA C C     1 
ATOM   3127 O O     . ALA C 1 78  ? 0.819   6.345   -46.617 1.00 21.33  ? 263  ALA C O     1 
ATOM   3128 C CB    . ALA C 1 78  ? -0.231  5.386   -43.832 1.00 20.40  ? 263  ALA C CB    1 
ATOM   3129 N N     . GLN C 1 79  ? -1.198  5.409   -47.072 1.00 21.47  ? 264  GLN C N     1 
ATOM   3130 C CA    . GLN C 1 79  ? -0.908  5.112   -48.482 1.00 22.42  ? 264  GLN C CA    1 
ATOM   3131 C C     . GLN C 1 79  ? -0.748  6.359   -49.339 1.00 21.86  ? 264  GLN C C     1 
ATOM   3132 O O     . GLN C 1 79  ? -0.094  6.317   -50.383 1.00 22.19  ? 264  GLN C O     1 
ATOM   3133 C CB    . GLN C 1 79  ? -2.024  4.265   -49.094 1.00 23.28  ? 264  GLN C CB    1 
ATOM   3134 C CG    . GLN C 1 79  ? -2.040  2.809   -48.666 1.00 25.94  ? 264  GLN C CG    1 
ATOM   3135 C CD    . GLN C 1 79  ? -2.871  1.940   -49.609 1.00 29.59  ? 264  GLN C CD    1 
ATOM   3136 O OE1   . GLN C 1 79  ? -2.361  0.986   -50.203 1.00 32.33  ? 264  GLN C OE1   1 
ATOM   3137 N NE2   . GLN C 1 79  ? -4.152  2.278   -49.761 1.00 30.95  ? 264  GLN C NE2   1 
ATOM   3138 N N     . ASP C 1 80  ? -1.374  7.456   -48.913 1.00 20.93  ? 265  ASP C N     1 
ATOM   3139 C CA    . ASP C 1 80  ? -1.362  8.702   -49.667 1.00 20.23  ? 265  ASP C CA    1 
ATOM   3140 C C     . ASP C 1 80  ? -0.772  9.788   -48.762 1.00 19.52  ? 265  ASP C C     1 
ATOM   3141 O O     . ASP C 1 80  ? -1.471  10.335  -47.914 1.00 18.79  ? 265  ASP C O     1 
ATOM   3142 C CB    . ASP C 1 80  ? -2.783  9.068   -50.142 1.00 20.56  ? 265  ASP C CB    1 
ATOM   3143 C CG    . ASP C 1 80  ? -2.818  10.355  -50.973 1.00 21.33  ? 265  ASP C CG    1 
ATOM   3144 O OD1   . ASP C 1 80  ? -1.815  11.080  -50.991 1.00 21.85  ? 265  ASP C OD1   1 
ATOM   3145 O OD2   . ASP C 1 80  ? -3.850  10.641  -51.617 1.00 24.12  ? 265  ASP C OD2   1 
ATOM   3146 N N     . PRO C 1 81  ? 0.532   10.079  -48.919 1.00 19.17  ? 266  PRO C N     1 
ATOM   3147 C CA    . PRO C 1 81  ? 1.215   11.087  -48.100 1.00 18.77  ? 266  PRO C CA    1 
ATOM   3148 C C     . PRO C 1 81  ? 0.587   12.483  -48.174 1.00 17.89  ? 266  PRO C C     1 
ATOM   3149 O O     . PRO C 1 81  ? 0.860   13.324  -47.314 1.00 17.64  ? 266  PRO C O     1 
ATOM   3150 C CB    . PRO C 1 81  ? 2.645   11.113  -48.663 1.00 19.19  ? 266  PRO C CB    1 
ATOM   3151 C CG    . PRO C 1 81  ? 2.600   10.339  -49.943 1.00 20.20  ? 266  PRO C CG    1 
ATOM   3152 C CD    . PRO C 1 81  ? 1.442   9.411   -49.871 1.00 19.52  ? 266  PRO C CD    1 
ATOM   3153 N N     . SER C 1 82  ? -0.267  12.710  -49.167 1.00 17.10  ? 267  SER C N     1 
ATOM   3154 C CA    . SER C 1 82  ? -0.914  14.009  -49.319 1.00 16.54  ? 267  SER C CA    1 
ATOM   3155 C C     . SER C 1 82  ? -2.138  14.180  -48.414 1.00 16.15  ? 267  SER C C     1 
ATOM   3156 O O     . SER C 1 82  ? -2.693  15.266  -48.337 1.00 15.57  ? 267  SER C O     1 
ATOM   3157 C CB    . SER C 1 82  ? -1.334  14.242  -50.778 1.00 16.68  ? 267  SER C CB    1 
ATOM   3158 O OG    . SER C 1 82  ? -2.564  13.599  -51.064 1.00 17.21  ? 267  SER C OG    1 
ATOM   3159 N N     . THR C 1 83  ? -2.571  13.116  -47.738 1.00 15.64  ? 268  THR C N     1 
ATOM   3160 C CA    . THR C 1 83  ? -3.844  13.156  -47.006 1.00 15.56  ? 268  THR C CA    1 
ATOM   3161 C C     . THR C 1 83  ? -3.956  14.252  -45.934 1.00 15.20  ? 268  THR C C     1 
ATOM   3162 O O     . THR C 1 83  ? -4.921  15.033  -45.918 1.00 15.79  ? 268  THR C O     1 
ATOM   3163 C CB    . THR C 1 83  ? -4.160  11.789  -46.394 1.00 15.66  ? 268  THR C CB    1 
ATOM   3164 O OG1   . THR C 1 83  ? -4.104  10.811  -47.433 1.00 17.33  ? 268  THR C OG1   1 
ATOM   3165 C CG2   . THR C 1 83  ? -5.555  11.786  -45.778 1.00 15.03  ? 268  THR C CG2   1 
ATOM   3166 N N     . GLY C 1 84  ? -2.968  14.314  -45.056 1.00 14.56  ? 269  GLY C N     1 
ATOM   3167 C CA    . GLY C 1 84  ? -3.047  15.194  -43.895 1.00 13.12  ? 269  GLY C CA    1 
ATOM   3168 C C     . GLY C 1 84  ? -3.563  14.442  -42.684 1.00 12.99  ? 269  GLY C C     1 
ATOM   3169 O O     . GLY C 1 84  ? -4.222  13.392  -42.823 1.00 12.84  ? 269  GLY C O     1 
ATOM   3170 N N     . CYS C 1 85  ? -3.244  14.976  -41.508 1.00 12.87  ? 270  CYS C N     1 
ATOM   3171 C CA    . CYS C 1 85  ? -3.557  14.339  -40.218 1.00 12.29  ? 270  CYS C CA    1 
ATOM   3172 C C     . CYS C 1 85  ? -4.610  15.116  -39.420 1.00 11.79  ? 270  CYS C C     1 
ATOM   3173 O O     . CYS C 1 85  ? -4.316  16.147  -38.793 1.00 11.37  ? 270  CYS C O     1 
ATOM   3174 C CB    . CYS C 1 85  ? -2.288  14.135  -39.381 1.00 12.63  ? 270  CYS C CB    1 
ATOM   3175 S SG    . CYS C 1 85  ? -1.042  13.083  -40.183 1.00 13.23  ? 270  CYS C SG    1 
ATOM   3176 N N     . TYR C 1 86  ? -5.826  14.573  -39.430 1.00 10.95  ? 271  TYR C N     1 
ATOM   3177 C CA    . TYR C 1 86  ? -7.014  15.202  -38.840 1.00 10.84  ? 271  TYR C CA    1 
ATOM   3178 C C     . TYR C 1 86  ? -7.773  14.283  -37.878 1.00 10.69  ? 271  TYR C C     1 
ATOM   3179 O O     . TYR C 1 86  ? -8.909  14.577  -37.503 1.00 10.52  ? 271  TYR C O     1 
ATOM   3180 C CB    . TYR C 1 86  ? -7.964  15.672  -39.945 1.00 11.09  ? 271  TYR C CB    1 
ATOM   3181 C CG    . TYR C 1 86  ? -7.348  16.639  -40.918 1.00 11.12  ? 271  TYR C CG    1 
ATOM   3182 C CD1   . TYR C 1 86  ? -7.332  18.007  -40.647 1.00 11.96  ? 271  TYR C CD1   1 
ATOM   3183 C CD2   . TYR C 1 86  ? -6.782  16.186  -42.116 1.00 12.28  ? 271  TYR C CD2   1 
ATOM   3184 C CE1   . TYR C 1 86  ? -6.777  18.907  -41.548 1.00 10.95  ? 271  TYR C CE1   1 
ATOM   3185 C CE2   . TYR C 1 86  ? -6.199  17.072  -43.022 1.00 12.15  ? 271  TYR C CE2   1 
ATOM   3186 C CZ    . TYR C 1 86  ? -6.198  18.435  -42.726 1.00 11.27  ? 271  TYR C CZ    1 
ATOM   3187 O OH    . TYR C 1 86  ? -5.638  19.313  -43.603 1.00 12.13  ? 271  TYR C OH    1 
ATOM   3188 N N     . MET C 1 87  ? -7.140  13.185  -37.487 1.00 10.32  ? 272  MET C N     1 
ATOM   3189 C CA    . MET C 1 87  ? -7.745  12.207  -36.584 1.00 10.21  ? 272  MET C CA    1 
ATOM   3190 C C     . MET C 1 87  ? -7.396  12.490  -35.124 1.00 10.02  ? 272  MET C C     1 
ATOM   3191 O O     . MET C 1 87  ? -6.213  12.662  -34.796 1.00 10.41  ? 272  MET C O     1 
ATOM   3192 C CB    . MET C 1 87  ? -7.273  10.797  -36.967 1.00 10.80  ? 272  MET C CB    1 
ATOM   3193 C CG    . MET C 1 87  ? -7.549  10.437  -38.426 1.00 11.24  ? 272  MET C CG    1 
ATOM   3194 S SD    . MET C 1 87  ? -7.038  8.758   -38.858 1.00 12.93  ? 272  MET C SD    1 
ATOM   3195 C CE    . MET C 1 87  ? -8.387  7.817   -38.130 1.00 12.81  ? 272  MET C CE    1 
ATOM   3196 N N     . TYR C 1 88  ? -8.419  12.493  -34.253 1.00 8.82   ? 273  TYR C N     1 
ATOM   3197 C CA    . TYR C 1 88  ? -8.253  12.893  -32.840 1.00 8.84   ? 273  TYR C CA    1 
ATOM   3198 C C     . TYR C 1 88  ? -8.776  11.782  -31.924 1.00 9.14   ? 273  TYR C C     1 
ATOM   3199 O O     . TYR C 1 88  ? -9.992  11.573  -31.796 1.00 9.02   ? 273  TYR C O     1 
ATOM   3200 C CB    . TYR C 1 88  ? -9.030  14.198  -32.593 1.00 8.70   ? 273  TYR C CB    1 
ATOM   3201 C CG    . TYR C 1 88  ? -8.517  15.073  -31.466 1.00 8.61   ? 273  TYR C CG    1 
ATOM   3202 C CD1   . TYR C 1 88  ? -7.995  14.525  -30.295 1.00 9.21   ? 273  TYR C CD1   1 
ATOM   3203 C CD2   . TYR C 1 88  ? -8.577  16.460  -31.569 1.00 9.06   ? 273  TYR C CD2   1 
ATOM   3204 C CE1   . TYR C 1 88  ? -7.534  15.341  -29.257 1.00 9.02   ? 273  TYR C CE1   1 
ATOM   3205 C CE2   . TYR C 1 88  ? -8.127  17.293  -30.538 1.00 8.68   ? 273  TYR C CE2   1 
ATOM   3206 C CZ    . TYR C 1 88  ? -7.593  16.725  -29.389 1.00 9.37   ? 273  TYR C CZ    1 
ATOM   3207 O OH    . TYR C 1 88  ? -7.134  17.552  -28.364 1.00 10.64  ? 273  TYR C OH    1 
ATOM   3208 N N     . TYR C 1 89  ? -7.843  11.084  -31.285 1.00 9.36   ? 274  TYR C N     1 
ATOM   3209 C CA    . TYR C 1 89  ? -8.155  9.940   -30.434 1.00 9.99   ? 274  TYR C CA    1 
ATOM   3210 C C     . TYR C 1 89  ? -8.448  10.384  -29.008 1.00 10.26  ? 274  TYR C C     1 
ATOM   3211 O O     . TYR C 1 89  ? -7.869  11.359  -28.510 1.00 10.84  ? 274  TYR C O     1 
ATOM   3212 C CB    . TYR C 1 89  ? -6.967  8.960   -30.431 1.00 11.08  ? 274  TYR C CB    1 
ATOM   3213 C CG    . TYR C 1 89  ? -6.717  8.341   -31.771 1.00 11.29  ? 274  TYR C CG    1 
ATOM   3214 C CD1   . TYR C 1 89  ? -7.239  7.086   -32.079 1.00 12.97  ? 274  TYR C CD1   1 
ATOM   3215 C CD2   . TYR C 1 89  ? -5.964  9.011   -32.741 1.00 13.34  ? 274  TYR C CD2   1 
ATOM   3216 C CE1   . TYR C 1 89  ? -7.006  6.499   -33.327 1.00 13.94  ? 274  TYR C CE1   1 
ATOM   3217 C CE2   . TYR C 1 89  ? -5.747  8.451   -33.993 1.00 14.28  ? 274  TYR C CE2   1 
ATOM   3218 C CZ    . TYR C 1 89  ? -6.260  7.193   -34.275 1.00 13.65  ? 274  TYR C CZ    1 
ATOM   3219 O OH    . TYR C 1 89  ? -6.031  6.638   -35.510 1.00 15.82  ? 274  TYR C OH    1 
ATOM   3220 N N     . PHE C 1 90  ? -9.363  9.672   -28.349 1.00 10.44  ? 275  PHE C N     1 
ATOM   3221 C CA    . PHE C 1 90  ? -9.722  9.990   -26.976 1.00 10.41  ? 275  PHE C CA    1 
ATOM   3222 C C     . PHE C 1 90  ? -10.429 8.812   -26.340 1.00 11.16  ? 275  PHE C C     1 
ATOM   3223 O O     . PHE C 1 90  ? -10.813 7.863   -27.027 1.00 11.12  ? 275  PHE C O     1 
ATOM   3224 C CB    . PHE C 1 90  ? -10.611 11.246  -26.901 1.00 10.46  ? 275  PHE C CB    1 
ATOM   3225 C CG    . PHE C 1 90  ? -11.989 11.060  -27.489 1.00 10.24  ? 275  PHE C CG    1 
ATOM   3226 C CD1   . PHE C 1 90  ? -13.084 10.800  -26.663 1.00 11.35  ? 275  PHE C CD1   1 
ATOM   3227 C CD2   . PHE C 1 90  ? -12.191 11.138  -28.871 1.00 9.10   ? 275  PHE C CD2   1 
ATOM   3228 C CE1   . PHE C 1 90  ? -14.371 10.613  -27.202 1.00 10.91  ? 275  PHE C CE1   1 
ATOM   3229 C CE2   . PHE C 1 90  ? -13.465 10.964  -29.408 1.00 10.26  ? 275  PHE C CE2   1 
ATOM   3230 C CZ    . PHE C 1 90  ? -14.553 10.719  -28.577 1.00 11.19  ? 275  PHE C CZ    1 
ATOM   3231 N N     . GLN C 1 91  ? -10.588 8.885   -25.023 1.00 11.69  ? 276  GLN C N     1 
ATOM   3232 C CA    . GLN C 1 91  ? -11.239 7.835   -24.260 1.00 12.53  ? 276  GLN C CA    1 
ATOM   3233 C C     . GLN C 1 91  ? -12.605 8.281   -23.765 1.00 12.27  ? 276  GLN C C     1 
ATOM   3234 O O     . GLN C 1 91  ? -12.798 9.430   -23.364 1.00 12.76  ? 276  GLN C O     1 
ATOM   3235 C CB    . GLN C 1 91  ? -10.373 7.439   -23.066 1.00 12.99  ? 276  GLN C CB    1 
ATOM   3236 C CG    . GLN C 1 91  ? -8.867  7.357   -23.322 1.00 18.13  ? 276  GLN C CG    1 
ATOM   3237 C CD    . GLN C 1 91  ? -8.475  6.376   -24.420 1.00 21.64  ? 276  GLN C CD    1 
ATOM   3238 O OE1   . GLN C 1 91  ? -8.936  5.231   -24.444 1.00 24.64  ? 276  GLN C OE1   1 
ATOM   3239 N NE2   . GLN C 1 91  ? -7.632  6.819   -25.333 1.00 24.68  ? 276  GLN C NE2   1 
ATOM   3240 N N     . TYR C 1 92  ? -13.556 7.354   -23.786 1.00 11.71  ? 277  TYR C N     1 
ATOM   3241 C CA    . TYR C 1 92  ? -14.897 7.610   -23.279 1.00 12.78  ? 277  TYR C CA    1 
ATOM   3242 C C     . TYR C 1 92  ? -15.484 6.302   -22.795 1.00 12.94  ? 277  TYR C C     1 
ATOM   3243 O O     . TYR C 1 92  ? -15.514 5.328   -23.544 1.00 11.44  ? 277  TYR C O     1 
ATOM   3244 C CB    . TYR C 1 92  ? -15.769 8.223   -24.376 1.00 13.36  ? 277  TYR C CB    1 
ATOM   3245 C CG    . TYR C 1 92  ? -17.222 8.461   -23.996 1.00 13.45  ? 277  TYR C CG    1 
ATOM   3246 C CD1   . TYR C 1 92  ? -17.568 9.343   -22.981 1.00 14.80  ? 277  TYR C CD1   1 
ATOM   3247 C CD2   . TYR C 1 92  ? -18.244 7.827   -24.695 1.00 14.60  ? 277  TYR C CD2   1 
ATOM   3248 C CE1   . TYR C 1 92  ? -18.906 9.564   -22.643 1.00 14.75  ? 277  TYR C CE1   1 
ATOM   3249 C CE2   . TYR C 1 92  ? -19.589 8.042   -24.371 1.00 15.23  ? 277  TYR C CE2   1 
ATOM   3250 C CZ    . TYR C 1 92  ? -19.907 8.906   -23.344 1.00 15.21  ? 277  TYR C CZ    1 
ATOM   3251 O OH    . TYR C 1 92  ? -21.244 9.114   -23.044 1.00 16.59  ? 277  TYR C OH    1 
ATOM   3252 N N     . LEU C 1 93  ? -15.938 6.284   -21.538 1.00 14.23  ? 278  LEU C N     1 
ATOM   3253 C CA    . LEU C 1 93  ? -16.598 5.097   -20.953 1.00 15.15  ? 278  LEU C CA    1 
ATOM   3254 C C     . LEU C 1 93  ? -15.829 3.797   -21.188 1.00 15.57  ? 278  LEU C C     1 
ATOM   3255 O O     . LEU C 1 93  ? -16.394 2.787   -21.606 1.00 16.02  ? 278  LEU C O     1 
ATOM   3256 C CB    . LEU C 1 93  ? -18.033 4.968   -21.449 1.00 16.05  ? 278  LEU C CB    1 
ATOM   3257 C CG    . LEU C 1 93  ? -18.966 6.113   -21.068 1.00 17.40  ? 278  LEU C CG    1 
ATOM   3258 C CD1   . LEU C 1 93  ? -20.344 5.764   -21.541 1.00 19.40  ? 278  LEU C CD1   1 
ATOM   3259 C CD2   . LEU C 1 93  ? -18.960 6.407   -19.569 1.00 18.98  ? 278  LEU C CD2   1 
ATOM   3260 N N     . SER C 1 94  ? -14.540 3.838   -20.903 1.00 15.68  ? 279  SER C N     1 
ATOM   3261 C CA    . SER C 1 94  ? -13.686 2.649   -20.966 1.00 15.03  ? 279  SER C CA    1 
ATOM   3262 C C     . SER C 1 94  ? -13.426 2.111   -22.370 1.00 14.32  ? 279  SER C C     1 
ATOM   3263 O O     . SER C 1 94  ? -12.950 0.987   -22.551 1.00 14.12  ? 279  SER C O     1 
ATOM   3264 C CB    . SER C 1 94  ? -14.179 1.559   -19.995 1.00 15.99  ? 279  SER C CB    1 
ATOM   3265 O OG    . SER C 1 94  ? -14.230 2.103   -18.685 1.00 19.64  ? 279  SER C OG    1 
ATOM   3266 N N     . LYS C 1 95  ? -13.681 2.960   -23.367 1.00 12.22  ? 280  LYS C N     1 
ATOM   3267 C CA    . LYS C 1 95  ? -13.358 2.635   -24.749 1.00 11.85  ? 280  LYS C CA    1 
ATOM   3268 C C     . LYS C 1 95  ? -12.619 3.766   -25.436 1.00 10.62  ? 280  LYS C C     1 
ATOM   3269 O O     . LYS C 1 95  ? -12.727 4.926   -25.018 1.00 10.85  ? 280  LYS C O     1 
ATOM   3270 C CB    . LYS C 1 95  ? -14.631 2.327   -25.534 1.00 12.73  ? 280  LYS C CB    1 
ATOM   3271 C CG    . LYS C 1 95  ? -15.475 1.188   -24.963 1.00 15.22  ? 280  LYS C CG    1 
ATOM   3272 C CD    . LYS C 1 95  ? -14.745 -0.130  -24.979 1.00 18.76  ? 280  LYS C CD    1 
ATOM   3273 C CE    . LYS C 1 95  ? -15.487 -1.183  -24.160 1.00 21.85  ? 280  LYS C CE    1 
ATOM   3274 N NZ    . LYS C 1 95  ? -14.659 -2.406  -23.988 1.00 24.86  ? 280  LYS C NZ    1 
ATOM   3275 N N     . THR C 1 96  ? -11.888 3.428   -26.498 1.00 9.38   ? 281  THR C N     1 
ATOM   3276 C CA    . THR C 1 96  ? -11.177 4.441   -27.279 1.00 9.60   ? 281  THR C CA    1 
ATOM   3277 C C     . THR C 1 96  ? -11.955 4.774   -28.536 1.00 9.75   ? 281  THR C C     1 
ATOM   3278 O O     . THR C 1 96  ? -12.400 3.883   -29.274 1.00 9.92   ? 281  THR C O     1 
ATOM   3279 C CB    . THR C 1 96  ? -9.765  3.977   -27.646 1.00 9.29   ? 281  THR C CB    1 
ATOM   3280 O OG1   . THR C 1 96  ? -9.065  3.644   -26.438 1.00 10.30  ? 281  THR C OG1   1 
ATOM   3281 C CG2   . THR C 1 96  ? -8.986  5.065   -28.409 1.00 10.54  ? 281  THR C CG2   1 
ATOM   3282 N N     . TYR C 1 97  ? -12.120 6.073   -28.762 1.00 10.87  ? 282  TYR C N     1 
ATOM   3283 C CA    . TYR C 1 97  ? -12.794 6.601   -29.944 1.00 10.88  ? 282  TYR C CA    1 
ATOM   3284 C C     . TYR C 1 97  ? -11.875 7.532   -30.711 1.00 10.29  ? 282  TYR C C     1 
ATOM   3285 O O     . TYR C 1 97  ? -10.777 7.847   -30.251 1.00 10.29  ? 282  TYR C O     1 
ATOM   3286 C CB    . TYR C 1 97  ? -14.054 7.373   -29.524 1.00 12.47  ? 282  TYR C CB    1 
ATOM   3287 C CG    . TYR C 1 97  ? -15.093 6.497   -28.894 1.00 13.75  ? 282  TYR C CG    1 
ATOM   3288 C CD1   . TYR C 1 97  ? -16.067 5.884   -29.673 1.00 16.37  ? 282  TYR C CD1   1 
ATOM   3289 C CD2   . TYR C 1 97  ? -15.104 6.279   -27.519 1.00 14.06  ? 282  TYR C CD2   1 
ATOM   3290 C CE1   . TYR C 1 97  ? -17.024 5.070   -29.107 1.00 17.58  ? 282  TYR C CE1   1 
ATOM   3291 C CE2   . TYR C 1 97  ? -16.042 5.459   -26.939 1.00 16.43  ? 282  TYR C CE2   1 
ATOM   3292 C CZ    . TYR C 1 97  ? -17.007 4.859   -27.735 1.00 17.18  ? 282  TYR C CZ    1 
ATOM   3293 O OH    . TYR C 1 97  ? -17.963 4.036   -27.174 1.00 18.99  ? 282  TYR C OH    1 
ATOM   3294 N N     . CYS C 1 98  ? -12.323 7.952   -31.891 1.00 10.03  ? 283  CYS C N     1 
ATOM   3295 C CA    . CYS C 1 98  ? -11.567 8.899   -32.702 1.00 9.35   ? 283  CYS C CA    1 
ATOM   3296 C C     . CYS C 1 98  ? -12.539 9.805   -33.419 1.00 9.25   ? 283  CYS C C     1 
ATOM   3297 O O     . CYS C 1 98  ? -13.508 9.307   -34.005 1.00 9.39   ? 283  CYS C O     1 
ATOM   3298 C CB    . CYS C 1 98  ? -10.759 8.122   -33.744 1.00 10.16  ? 283  CYS C CB    1 
ATOM   3299 S SG    . CYS C 1 98  ? -9.690  9.142   -34.796 1.00 11.41  ? 283  CYS C SG    1 
ATOM   3300 N N     . VAL C 1 99  ? -12.298 11.118  -33.362 1.00 8.37   ? 284  VAL C N     1 
ATOM   3301 C CA    . VAL C 1 99  ? -12.997 12.021  -34.269 1.00 8.31   ? 284  VAL C CA    1 
ATOM   3302 C C     . VAL C 1 99  ? -12.129 12.122  -35.532 1.00 8.75   ? 284  VAL C C     1 
ATOM   3303 O O     . VAL C 1 99  ? -11.034 12.725  -35.522 1.00 9.40   ? 284  VAL C O     1 
ATOM   3304 C CB    . VAL C 1 99  ? -13.232 13.426  -33.677 1.00 8.22   ? 284  VAL C CB    1 
ATOM   3305 C CG1   . VAL C 1 99  ? -13.998 14.279  -34.680 1.00 8.68   ? 284  VAL C CG1   1 
ATOM   3306 C CG2   . VAL C 1 99  ? -13.973 13.347  -32.369 1.00 9.91   ? 284  VAL C CG2   1 
ATOM   3307 N N     . ASP C 1 100 ? -12.593 11.478  -36.603 1.00 9.49   ? 285  ASP C N     1 
ATOM   3308 C CA    . ASP C 1 100 ? -11.871 11.521  -37.866 1.00 9.48   ? 285  ASP C CA    1 
ATOM   3309 C C     . ASP C 1 100 ? -12.356 12.719  -38.679 1.00 9.97   ? 285  ASP C C     1 
ATOM   3310 O O     . ASP C 1 100 ? -13.425 12.660  -39.276 1.00 10.87  ? 285  ASP C O     1 
ATOM   3311 C CB    . ASP C 1 100 ? -12.059 10.231  -38.675 1.00 9.99   ? 285  ASP C CB    1 
ATOM   3312 C CG    . ASP C 1 100 ? -11.268 10.247  -39.977 1.00 10.64  ? 285  ASP C CG    1 
ATOM   3313 O OD1   . ASP C 1 100 ? -10.557 11.249  -40.245 1.00 11.63  ? 285  ASP C OD1   1 
ATOM   3314 O OD2   . ASP C 1 100 ? -11.343 9.258   -40.735 1.00 13.25  ? 285  ASP C OD2   1 
ATOM   3315 N N     . ALA C 1 101 ? -11.587 13.810  -38.658 1.00 9.76   ? 286  ALA C N     1 
ATOM   3316 C CA    . ALA C 1 101 ? -11.962 15.014  -39.400 1.00 9.97   ? 286  ALA C CA    1 
ATOM   3317 C C     . ALA C 1 101 ? -11.195 15.169  -40.729 1.00 10.40  ? 286  ALA C C     1 
ATOM   3318 O O     . ALA C 1 101 ? -10.987 16.278  -41.211 1.00 11.01  ? 286  ALA C O     1 
ATOM   3319 C CB    . ALA C 1 101 ? -11.836 16.278  -38.514 1.00 9.31   ? 286  ALA C CB    1 
ATOM   3320 N N     . THR C 1 102 ? -10.804 14.054  -41.339 1.00 11.83  ? 287  THR C N     1 
ATOM   3321 C CA    . THR C 1 102 ? -10.065 14.120  -42.600 1.00 12.99  ? 287  THR C CA    1 
ATOM   3322 C C     . THR C 1 102 ? -10.854 14.799  -43.697 1.00 13.71  ? 287  THR C C     1 
ATOM   3323 O O     . THR C 1 102 ? -10.298 15.589  -44.466 1.00 14.06  ? 287  THR C O     1 
ATOM   3324 C CB    . THR C 1 102 ? -9.636  12.726  -43.055 1.00 12.99  ? 287  THR C CB    1 
ATOM   3325 O OG1   . THR C 1 102 ? -8.830  12.163  -42.024 1.00 12.72  ? 287  THR C OG1   1 
ATOM   3326 C CG2   . THR C 1 102 ? -8.823  12.788  -44.357 1.00 14.35  ? 287  THR C CG2   1 
ATOM   3327 N N     . ARG C 1 103 ? -12.143 14.500  -43.774 1.00 14.10  ? 288  ARG C N     1 
ATOM   3328 C CA    . ARG C 1 103 ? -12.937 15.057  -44.858 1.00 15.10  ? 288  ARG C CA    1 
ATOM   3329 C C     . ARG C 1 103 ? -13.019 16.560  -44.707 1.00 14.51  ? 288  ARG C C     1 
ATOM   3330 O O     . ARG C 1 103 ? -13.288 17.073  -43.619 1.00 13.59  ? 288  ARG C O     1 
ATOM   3331 C CB    . ARG C 1 103 ? -14.323 14.455  -44.876 1.00 15.83  ? 288  ARG C CB    1 
ATOM   3332 C CG    . ARG C 1 103 ? -15.126 14.860  -46.096 1.00 18.69  ? 288  ARG C CG    1 
ATOM   3333 C CD    . ARG C 1 103 ? -16.472 14.179  -46.094 1.00 22.78  ? 288  ARG C CD    1 
ATOM   3334 N NE    . ARG C 1 103 ? -17.291 14.553  -44.943 1.00 25.02  ? 288  ARG C NE    1 
ATOM   3335 C CZ    . ARG C 1 103 ? -18.200 15.524  -44.951 1.00 26.66  ? 288  ARG C CZ    1 
ATOM   3336 N NH1   . ARG C 1 103 ? -18.408 16.242  -46.053 1.00 27.18  ? 288  ARG C NH1   1 
ATOM   3337 N NH2   . ARG C 1 103 ? -18.901 15.785  -43.856 1.00 27.23  ? 288  ARG C NH2   1 
ATOM   3338 N N     . GLU C 1 104 ? -12.780 17.270  -45.810 1.00 14.56  ? 289  GLU C N     1 
ATOM   3339 C CA    . GLU C 1 104 ? -12.842 18.717  -45.795 1.00 14.42  ? 289  GLU C CA    1 
ATOM   3340 C C     . GLU C 1 104 ? -14.275 19.218  -45.702 1.00 14.00  ? 289  GLU C C     1 
ATOM   3341 O O     . GLU C 1 104 ? -15.092 19.024  -46.598 1.00 15.51  ? 289  GLU C O     1 
ATOM   3342 C CB    . GLU C 1 104 ? -12.124 19.305  -47.006 1.00 15.36  ? 289  GLU C CB    1 
ATOM   3343 C CG    . GLU C 1 104 ? -10.585 19.160  -46.921 1.00 15.19  ? 289  GLU C CG    1 
ATOM   3344 C CD    . GLU C 1 104 ? -9.909  20.227  -46.073 1.00 16.21  ? 289  GLU C CD    1 
ATOM   3345 O OE1   . GLU C 1 104 ? -10.425 21.354  -45.971 1.00 17.91  ? 289  GLU C OE1   1 
ATOM   3346 O OE2   . GLU C 1 104 ? -8.815  19.950  -45.522 1.00 18.46  ? 289  GLU C OE2   1 
ATOM   3347 N N     . THR C 1 105 ? -14.557 19.883  -44.593 1.00 13.25  ? 290  THR C N     1 
ATOM   3348 C CA    . THR C 1 105 ? -15.873 20.448  -44.300 1.00 11.69  ? 290  THR C CA    1 
ATOM   3349 C C     . THR C 1 105 ? -15.696 21.948  -44.045 1.00 11.01  ? 290  THR C C     1 
ATOM   3350 O O     . THR C 1 105 ? -14.575 22.467  -44.129 1.00 11.27  ? 290  THR C O     1 
ATOM   3351 C CB    . THR C 1 105 ? -16.460 19.830  -43.022 1.00 12.06  ? 290  THR C CB    1 
ATOM   3352 O OG1   . THR C 1 105 ? -15.635 20.213  -41.909 1.00 10.46  ? 290  THR C OG1   1 
ATOM   3353 C CG2   . THR C 1 105 ? -16.523 18.309  -43.107 1.00 12.92  ? 290  THR C CG2   1 
ATOM   3354 N N     . ASN C 1 106 ? -16.771 22.635  -43.668 1.00 10.39  ? 291  ASN C N     1 
ATOM   3355 C CA    . ASN C 1 106 ? -16.647 24.046  -43.288 1.00 11.53  ? 291  ASN C CA    1 
ATOM   3356 C C     . ASN C 1 106 ? -16.296 24.241  -41.810 1.00 10.52  ? 291  ASN C C     1 
ATOM   3357 O O     . ASN C 1 106 ? -16.236 25.376  -41.334 1.00 11.06  ? 291  ASN C O     1 
ATOM   3358 C CB    . ASN C 1 106 ? -17.916 24.842  -43.646 1.00 12.62  ? 291  ASN C CB    1 
ATOM   3359 C CG    . ASN C 1 106 ? -19.119 24.468  -42.798 1.00 17.15  ? 291  ASN C CG    1 
ATOM   3360 O OD1   . ASN C 1 106 ? -19.092 23.494  -42.047 1.00 20.31  ? 291  ASN C OD1   1 
ATOM   3361 N ND2   . ASN C 1 106 ? -20.194 25.249  -42.927 1.00 22.37  ? 291  ASN C ND2   1 
ATOM   3362 N N     . ARG C 1 107 ? -16.050 23.140  -41.092 1.00 9.64   ? 292  ARG C N     1 
ATOM   3363 C CA    . ARG C 1 107 ? -15.835 23.231  -39.641 1.00 9.26   ? 292  ARG C CA    1 
ATOM   3364 C C     . ARG C 1 107 ? -14.408 23.634  -39.314 1.00 9.09   ? 292  ARG C C     1 
ATOM   3365 O O     . ARG C 1 107 ? -13.479 23.231  -40.006 1.00 10.07  ? 292  ARG C O     1 
ATOM   3366 C CB    . ARG C 1 107 ? -16.175 21.900  -38.974 1.00 9.78   ? 292  ARG C CB    1 
ATOM   3367 C CG    . ARG C 1 107 ? -17.647 21.524  -39.153 1.00 11.24  ? 292  ARG C CG    1 
ATOM   3368 C CD    . ARG C 1 107 ? -18.597 22.607  -38.616 1.00 15.59  ? 292  ARG C CD    1 
ATOM   3369 N NE    . ARG C 1 107 ? -19.895 22.020  -38.312 1.00 18.78  ? 292  ARG C NE    1 
ATOM   3370 C CZ    . ARG C 1 107 ? -20.379 21.819  -37.083 1.00 17.22  ? 292  ARG C CZ    1 
ATOM   3371 N NH1   . ARG C 1 107 ? -19.709 22.199  -35.985 1.00 14.67  ? 292  ARG C NH1   1 
ATOM   3372 N NH2   . ARG C 1 107 ? -21.566 21.255  -36.953 1.00 18.65  ? 292  ARG C NH2   1 
ATOM   3373 N N     . LEU C 1 108 ? -14.229 24.400  -38.238 1.00 7.74   ? 293  LEU C N     1 
ATOM   3374 C CA    . LEU C 1 108 ? -12.934 25.029  -37.995 1.00 8.14   ? 293  LEU C CA    1 
ATOM   3375 C C     . LEU C 1 108 ? -12.016 24.293  -37.018 1.00 7.31   ? 293  LEU C C     1 
ATOM   3376 O O     . LEU C 1 108 ? -10.797 24.493  -37.050 1.00 7.74   ? 293  LEU C O     1 
ATOM   3377 C CB    . LEU C 1 108 ? -13.143 26.470  -37.516 1.00 8.51   ? 293  LEU C CB    1 
ATOM   3378 C CG    . LEU C 1 108 ? -13.858 27.363  -38.532 1.00 10.55  ? 293  LEU C CG    1 
ATOM   3379 C CD1   . LEU C 1 108 ? -14.084 28.764  -37.973 1.00 12.81  ? 293  LEU C CD1   1 
ATOM   3380 C CD2   . LEU C 1 108 ? -13.062 27.446  -39.816 1.00 13.46  ? 293  LEU C CD2   1 
ATOM   3381 N N     . GLY C 1 109 ? -12.569 23.441  -36.151 1.00 6.70   ? 294  GLY C N     1 
ATOM   3382 C CA    . GLY C 1 109 ? -11.723 22.826  -35.125 1.00 7.10   ? 294  GLY C CA    1 
ATOM   3383 C C     . GLY C 1 109 ? -10.577 22.044  -35.737 1.00 6.41   ? 294  GLY C C     1 
ATOM   3384 O O     . GLY C 1 109 ? -9.446  22.066  -35.220 1.00 7.05   ? 294  GLY C O     1 
ATOM   3385 N N     . ARG C 1 110 ? -10.874 21.353  -36.837 1.00 6.92   ? 295  ARG C N     1 
ATOM   3386 C CA    . ARG C 1 110 ? -9.920  20.519  -37.558 1.00 7.24   ? 295  ARG C CA    1 
ATOM   3387 C C     . ARG C 1 110 ? -8.760  21.313  -38.146 1.00 6.85   ? 295  ARG C C     1 
ATOM   3388 O O     . ARG C 1 110 ? -7.737  20.722  -38.481 1.00 8.06   ? 295  ARG C O     1 
ATOM   3389 C CB    . ARG C 1 110 ? -10.648 19.756  -38.670 1.00 7.42   ? 295  ARG C CB    1 
ATOM   3390 C CG    . ARG C 1 110 ? -11.322 20.675  -39.696 1.00 7.98   ? 295  ARG C CG    1 
ATOM   3391 C CD    . ARG C 1 110 ? -12.217 19.901  -40.676 1.00 7.86   ? 295  ARG C CD    1 
ATOM   3392 N NE    . ARG C 1 110 ? -11.419 18.987  -41.490 1.00 8.71   ? 295  ARG C NE    1 
ATOM   3393 C CZ    . ARG C 1 110 ? -10.741 19.346  -42.583 1.00 8.96   ? 295  ARG C CZ    1 
ATOM   3394 N NH1   . ARG C 1 110 ? -10.768 20.609  -43.015 1.00 9.74   ? 295  ARG C NH1   1 
ATOM   3395 N NH2   . ARG C 1 110 ? -10.025 18.436  -43.249 1.00 10.50  ? 295  ARG C NH2   1 
ATOM   3396 N N     . LEU C 1 111 ? -8.912  22.641  -38.226 1.00 6.79   ? 296  LEU C N     1 
ATOM   3397 C CA    . LEU C 1 111 ? -7.887  23.512  -38.829 1.00 6.77   ? 296  LEU C CA    1 
ATOM   3398 C C     . LEU C 1 111 ? -6.998  24.182  -37.800 1.00 7.01   ? 296  LEU C C     1 
ATOM   3399 O O     . LEU C 1 111 ? -6.051  24.884  -38.156 1.00 8.22   ? 296  LEU C O     1 
ATOM   3400 C CB    . LEU C 1 111 ? -8.515  24.593  -39.697 1.00 7.41   ? 296  LEU C CB    1 
ATOM   3401 C CG    . LEU C 1 111 ? -9.239  24.078  -40.936 1.00 8.53   ? 296  LEU C CG    1 
ATOM   3402 C CD1   . LEU C 1 111 ? -9.708  25.268  -41.771 1.00 10.87  ? 296  LEU C CD1   1 
ATOM   3403 C CD2   . LEU C 1 111 ? -8.366  23.122  -41.784 1.00 10.94  ? 296  LEU C CD2   1 
ATOM   3404 N N     . ILE C 1 112 ? -7.277  23.937  -36.527 1.00 6.74   ? 297  ILE C N     1 
ATOM   3405 C CA    . ILE C 1 112 ? -6.497  24.586  -35.462 1.00 6.92   ? 297  ILE C CA    1 
ATOM   3406 C C     . ILE C 1 112 ? -5.139  23.904  -35.289 1.00 7.08   ? 297  ILE C C     1 
ATOM   3407 O O     . ILE C 1 112 ? -5.046  22.679  -35.212 1.00 7.75   ? 297  ILE C O     1 
ATOM   3408 C CB    . ILE C 1 112 ? -7.290  24.662  -34.136 1.00 6.91   ? 297  ILE C CB    1 
ATOM   3409 C CG1   . ILE C 1 112 ? -8.490  25.602  -34.331 1.00 6.88   ? 297  ILE C CG1   1 
ATOM   3410 C CG2   . ILE C 1 112 ? -6.393  25.135  -32.992 1.00 7.24   ? 297  ILE C CG2   1 
ATOM   3411 C CD1   . ILE C 1 112 ? -9.476  25.606  -33.176 1.00 7.54   ? 297  ILE C CD1   1 
ATOM   3412 N N     . ASN C 1 113 ? -4.079  24.713  -35.233 1.00 6.70   ? 298  ASN C N     1 
ATOM   3413 C CA    . ASN C 1 113 ? -2.722  24.194  -35.163 1.00 6.80   ? 298  ASN C CA    1 
ATOM   3414 C C     . ASN C 1 113 ? -2.250  23.855  -33.740 1.00 7.06   ? 298  ASN C C     1 
ATOM   3415 O O     . ASN C 1 113 ? -2.953  24.104  -32.749 1.00 7.15   ? 298  ASN C O     1 
ATOM   3416 C CB    . ASN C 1 113 ? -1.782  25.126  -35.921 1.00 7.55   ? 298  ASN C CB    1 
ATOM   3417 C CG    . ASN C 1 113 ? -2.061  25.100  -37.406 1.00 7.33   ? 298  ASN C CG    1 
ATOM   3418 O OD1   . ASN C 1 113 ? -2.204  24.022  -37.997 1.00 8.81   ? 298  ASN C OD1   1 
ATOM   3419 N ND2   . ASN C 1 113 ? -2.148  26.275  -38.020 1.00 7.60   ? 298  ASN C ND2   1 
ATOM   3420 N N     . HIS C 1 114 ? -1.055  23.262  -33.687 1.00 6.90   ? 299  HIS C N     1 
ATOM   3421 C CA    . HIS C 1 114 ? -0.461  22.732  -32.472 1.00 7.04   ? 299  HIS C CA    1 
ATOM   3422 C C     . HIS C 1 114 ? 0.489   23.697  -31.795 1.00 7.83   ? 299  HIS C C     1 
ATOM   3423 O O     . HIS C 1 114 ? 1.279   24.362  -32.454 1.00 7.92   ? 299  HIS C O     1 
ATOM   3424 C CB    . HIS C 1 114 ? 0.333   21.472  -32.822 1.00 7.26   ? 299  HIS C CB    1 
ATOM   3425 C CG    . HIS C 1 114 ? 1.257   21.021  -31.734 1.00 8.62   ? 299  HIS C CG    1 
ATOM   3426 N ND1   . HIS C 1 114 ? 0.838   20.284  -30.644 1.00 9.12   ? 299  HIS C ND1   1 
ATOM   3427 C CD2   . HIS C 1 114 ? 2.580   21.246  -31.554 1.00 8.43   ? 299  HIS C CD2   1 
ATOM   3428 C CE1   . HIS C 1 114 ? 1.870   20.067  -29.841 1.00 9.90   ? 299  HIS C CE1   1 
ATOM   3429 N NE2   . HIS C 1 114 ? 2.942   20.635  -30.374 1.00 8.87   ? 299  HIS C NE2   1 
ATOM   3430 N N     . SER C 1 115 ? 0.440   23.708  -30.465 1.00 7.97   ? 300  SER C N     1 
ATOM   3431 C CA    . SER C 1 115 ? 1.469   24.315  -29.622 1.00 8.74   ? 300  SER C CA    1 
ATOM   3432 C C     . SER C 1 115 ? 1.420   23.643  -28.256 1.00 9.10   ? 300  SER C C     1 
ATOM   3433 O O     . SER C 1 115 ? 0.356   23.244  -27.801 1.00 9.36   ? 300  SER C O     1 
ATOM   3434 C CB    . SER C 1 115 ? 1.173   25.797  -29.425 1.00 8.94   ? 300  SER C CB    1 
ATOM   3435 O OG    . SER C 1 115 ? 2.170   26.400  -28.596 1.00 10.40  ? 300  SER C OG    1 
ATOM   3436 N N     . LYS C 1 116 ? 2.558   23.573  -27.585 1.00 9.53   ? 301  LYS C N     1 
ATOM   3437 C CA    . LYS C 1 116 ? 2.589   23.203  -26.169 1.00 9.79   ? 301  LYS C CA    1 
ATOM   3438 C C     . LYS C 1 116 ? 2.376   24.423  -25.272 1.00 10.99  ? 301  LYS C C     1 
ATOM   3439 O O     . LYS C 1 116 ? 2.215   24.280  -24.052 1.00 11.98  ? 301  LYS C O     1 
ATOM   3440 C CB    . LYS C 1 116 ? 3.902   22.501  -25.808 1.00 10.52  ? 301  LYS C CB    1 
ATOM   3441 C CG    . LYS C 1 116 ? 4.086   21.155  -26.482 1.00 10.37  ? 301  LYS C CG    1 
ATOM   3442 C CD    . LYS C 1 116 ? 5.427   20.575  -25.994 1.00 14.65  ? 301  LYS C CD    1 
ATOM   3443 C CE    . LYS C 1 116 ? 5.755   19.253  -26.614 1.00 16.88  ? 301  LYS C CE    1 
ATOM   3444 N NZ    . LYS C 1 116 ? 7.063   18.795  -26.054 1.00 19.23  ? 301  LYS C NZ    1 
ATOM   3445 N N     . CYS C 1 117 ? 2.398   25.627  -25.857 1.00 9.68   ? 302  CYS C N     1 
ATOM   3446 C CA    . CYS C 1 117 ? 2.017   26.831  -25.117 1.00 10.67  ? 302  CYS C CA    1 
ATOM   3447 C C     . CYS C 1 117 ? 0.853   27.525  -25.806 1.00 9.71   ? 302  CYS C C     1 
ATOM   3448 O O     . CYS C 1 117 ? 0.841   28.746  -26.051 1.00 10.43  ? 302  CYS C O     1 
ATOM   3449 C CB    . CYS C 1 117 ? 3.196   27.766  -24.855 1.00 11.83  ? 302  CYS C CB    1 
ATOM   3450 S SG    . CYS C 1 117 ? 4.066   28.349  -26.303 1.00 13.44  ? 302  CYS C SG    1 
ATOM   3451 N N     . GLY C 1 118 ? -0.177  26.723  -26.043 1.00 8.67   ? 303  GLY C N     1 
ATOM   3452 C CA    . GLY C 1 118 ? -1.359  27.199  -26.720 1.00 8.59   ? 303  GLY C CA    1 
ATOM   3453 C C     . GLY C 1 118 ? -2.319  27.932  -25.809 1.00 8.67   ? 303  GLY C C     1 
ATOM   3454 O O     . GLY C 1 118 ? -2.010  28.265  -24.648 1.00 9.66   ? 303  GLY C O     1 
ATOM   3455 N N     . ASN C 1 119 ? -3.522  28.145  -26.334 1.00 7.78   ? 304  ASN C N     1 
ATOM   3456 C CA    . ASN C 1 119 ? -4.538  28.916  -25.630 1.00 7.86   ? 304  ASN C CA    1 
ATOM   3457 C C     . ASN C 1 119 ? -5.871  28.190  -25.520 1.00 8.16   ? 304  ASN C C     1 
ATOM   3458 O O     . ASN C 1 119 ? -6.833  28.753  -24.984 1.00 8.21   ? 304  ASN C O     1 
ATOM   3459 C CB    . ASN C 1 119 ? -4.711  30.298  -26.272 1.00 7.90   ? 304  ASN C CB    1 
ATOM   3460 C CG    . ASN C 1 119 ? -4.846  30.227  -27.772 1.00 6.72   ? 304  ASN C CG    1 
ATOM   3461 O OD1   . ASN C 1 119 ? -5.396  29.255  -28.311 1.00 7.18   ? 304  ASN C OD1   1 
ATOM   3462 N ND2   . ASN C 1 119 ? -4.374  31.266  -28.461 1.00 8.79   ? 304  ASN C ND2   1 
ATOM   3463 N N     . CYS C 1 120 ? -5.911  26.939  -25.989 1.00 7.55   ? 305  CYS C N     1 
ATOM   3464 C CA    . CYS C 1 120 ? -7.113  26.115  -25.867 1.00 8.51   ? 305  CYS C CA    1 
ATOM   3465 C C     . CYS C 1 120 ? -6.770  24.791  -25.226 1.00 8.17   ? 305  CYS C C     1 
ATOM   3466 O O     . CYS C 1 120 ? -5.657  24.290  -25.388 1.00 8.62   ? 305  CYS C O     1 
ATOM   3467 C CB    . CYS C 1 120 ? -7.730  25.852  -27.241 1.00 9.42   ? 305  CYS C CB    1 
ATOM   3468 S SG    . CYS C 1 120 ? -8.391  27.318  -28.069 1.00 9.58   ? 305  CYS C SG    1 
ATOM   3469 N N     . GLN C 1 121 ? -7.753  24.228  -24.519 1.00 8.48   ? 306  GLN C N     1 
ATOM   3470 C CA    . GLN C 1 121 ? -7.655  22.909  -23.912 1.00 9.36   ? 306  GLN C CA    1 
ATOM   3471 C C     . GLN C 1 121 ? -8.837  22.076  -24.395 1.00 8.90   ? 306  GLN C C     1 
ATOM   3472 O O     . GLN C 1 121 ? -9.977  22.545  -24.377 1.00 9.47   ? 306  GLN C O     1 
ATOM   3473 C CB    . GLN C 1 121 ? -7.716  23.041  -22.385 1.00 10.53  ? 306  GLN C CB    1 
ATOM   3474 C CG    . GLN C 1 121 ? -7.780  21.724  -21.621 1.00 12.55  ? 306  GLN C CG    1 
ATOM   3475 C CD    . GLN C 1 121 ? -6.572  20.843  -21.870 1.00 15.83  ? 306  GLN C CD    1 
ATOM   3476 O OE1   . GLN C 1 121 ? -5.426  21.278  -21.703 1.00 17.65  ? 306  GLN C OE1   1 
ATOM   3477 N NE2   . GLN C 1 121 ? -6.819  19.588  -22.274 1.00 16.46  ? 306  GLN C NE2   1 
ATOM   3478 N N     . THR C 1 122 ? -8.568  20.841  -24.802 1.00 8.84   ? 307  THR C N     1 
ATOM   3479 C CA    . THR C 1 122 ? -9.626  19.948  -25.253 1.00 9.71   ? 307  THR C CA    1 
ATOM   3480 C C     . THR C 1 122 ? -10.265 19.228  -24.058 1.00 9.90   ? 307  THR C C     1 
ATOM   3481 O O     . THR C 1 122 ? -9.570  18.790  -23.143 1.00 10.47  ? 307  THR C O     1 
ATOM   3482 C CB    . THR C 1 122 ? -9.065  18.951  -26.257 1.00 9.97   ? 307  THR C CB    1 
ATOM   3483 O OG1   . THR C 1 122 ? -8.415  19.680  -27.302 1.00 11.30  ? 307  THR C OG1   1 
ATOM   3484 C CG2   . THR C 1 122 ? -10.173 18.087  -26.874 1.00 10.76  ? 307  THR C CG2   1 
ATOM   3485 N N     . LYS C 1 123 ? -11.590 19.129  -24.089 1.00 10.14  ? 308  LYS C N     1 
ATOM   3486 C CA    . LYS C 1 123 ? -12.397 18.526  -23.031 1.00 11.46  ? 308  LYS C CA    1 
ATOM   3487 C C     . LYS C 1 123 ? -13.397 17.584  -23.695 1.00 10.87  ? 308  LYS C C     1 
ATOM   3488 O O     . LYS C 1 123 ? -13.863 17.832  -24.809 1.00 10.71  ? 308  LYS C O     1 
ATOM   3489 C CB    . LYS C 1 123 ? -13.196 19.603  -22.250 1.00 12.57  ? 308  LYS C CB    1 
ATOM   3490 C CG    . LYS C 1 123 ? -12.373 20.744  -21.662 1.00 17.68  ? 308  LYS C CG    1 
ATOM   3491 C CD    . LYS C 1 123 ? -12.129 20.589  -20.178 1.00 23.66  ? 308  LYS C CD    1 
ATOM   3492 C CE    . LYS C 1 123 ? -10.659 20.382  -19.888 1.00 26.57  ? 308  LYS C CE    1 
ATOM   3493 N NZ    . LYS C 1 123 ? -10.328 20.697  -18.474 1.00 28.34  ? 308  LYS C NZ    1 
ATOM   3494 N N     . LEU C 1 124 ? -13.750 16.528  -22.981 1.00 10.95  ? 309  LEU C N     1 
ATOM   3495 C CA    . LEU C 1 124 ? -14.854 15.664  -23.354 1.00 11.82  ? 309  LEU C CA    1 
ATOM   3496 C C     . LEU C 1 124 ? -16.166 16.251  -22.846 1.00 11.61  ? 309  LEU C C     1 
ATOM   3497 O O     . LEU C 1 124 ? -16.268 16.621  -21.672 1.00 13.04  ? 309  LEU C O     1 
ATOM   3498 C CB    . LEU C 1 124 ? -14.633 14.291  -22.718 1.00 12.38  ? 309  LEU C CB    1 
ATOM   3499 C CG    . LEU C 1 124 ? -15.706 13.217  -22.839 1.00 15.07  ? 309  LEU C CG    1 
ATOM   3500 C CD1   . LEU C 1 124 ? -15.745 12.689  -24.252 1.00 16.38  ? 309  LEU C CD1   1 
ATOM   3501 C CD2   . LEU C 1 124 ? -15.428 12.078  -21.846 1.00 14.76  ? 309  LEU C CD2   1 
ATOM   3502 N N     . HIS C 1 125 ? -17.169 16.298  -23.717 1.00 11.31  ? 310  HIS C N     1 
ATOM   3503 C CA    . HIS C 1 125 ? -18.523 16.699  -23.334 1.00 12.31  ? 310  HIS C CA    1 
ATOM   3504 C C     . HIS C 1 125 ? -19.511 15.725  -23.944 1.00 13.27  ? 310  HIS C C     1 
ATOM   3505 O O     . HIS C 1 125 ? -19.646 15.660  -25.166 1.00 13.88  ? 310  HIS C O     1 
ATOM   3506 C CB    . HIS C 1 125 ? -18.819 18.126  -23.818 1.00 12.46  ? 310  HIS C CB    1 
ATOM   3507 C CG    . HIS C 1 125 ? -20.139 18.655  -23.351 1.00 13.21  ? 310  HIS C CG    1 
ATOM   3508 N ND1   . HIS C 1 125 ? -20.291 19.314  -22.151 1.00 13.80  ? 310  HIS C ND1   1 
ATOM   3509 C CD2   . HIS C 1 125 ? -21.373 18.593  -23.909 1.00 13.55  ? 310  HIS C CD2   1 
ATOM   3510 C CE1   . HIS C 1 125 ? -21.563 19.650  -21.998 1.00 14.35  ? 310  HIS C CE1   1 
ATOM   3511 N NE2   . HIS C 1 125 ? -22.241 19.220  -23.049 1.00 13.37  ? 310  HIS C NE2   1 
ATOM   3512 N N     . ASP C 1 126 ? -20.201 14.951  -23.115 1.00 14.13  ? 311  ASP C N     1 
ATOM   3513 C CA    . ASP C 1 126 ? -21.153 14.013  -23.710 1.00 15.32  ? 311  ASP C CA    1 
ATOM   3514 C C     . ASP C 1 126 ? -22.589 14.517  -23.687 1.00 15.42  ? 311  ASP C C     1 
ATOM   3515 O O     . ASP C 1 126 ? -22.977 15.292  -22.812 1.00 16.17  ? 311  ASP C O     1 
ATOM   3516 C CB    . ASP C 1 126 ? -20.988 12.570  -23.200 1.00 16.88  ? 311  ASP C CB    1 
ATOM   3517 C CG    . ASP C 1 126 ? -21.324 12.412  -21.750 1.00 18.67  ? 311  ASP C CG    1 
ATOM   3518 O OD1   . ASP C 1 126 ? -21.188 13.388  -20.980 1.00 21.02  ? 311  ASP C OD1   1 
ATOM   3519 O OD2   . ASP C 1 126 ? -21.688 11.266  -21.379 1.00 20.84  ? 311  ASP C OD2   1 
ATOM   3520 N N     . ILE C 1 127 ? -23.347 14.085  -24.689 1.00 15.28  ? 312  ILE C N     1 
ATOM   3521 C CA    . ILE C 1 127 ? -24.754 14.443  -24.825 1.00 15.53  ? 312  ILE C CA    1 
ATOM   3522 C C     . ILE C 1 127 ? -25.503 13.158  -25.098 1.00 15.91  ? 312  ILE C C     1 
ATOM   3523 O O     . ILE C 1 127 ? -25.291 12.518  -26.133 1.00 15.89  ? 312  ILE C O     1 
ATOM   3524 C CB    . ILE C 1 127 ? -25.002 15.426  -25.987 1.00 14.96  ? 312  ILE C CB    1 
ATOM   3525 C CG1   . ILE C 1 127 ? -24.068 16.642  -25.886 1.00 15.05  ? 312  ILE C CG1   1 
ATOM   3526 C CG2   . ILE C 1 127 ? -26.468 15.874  -25.989 1.00 15.47  ? 312  ILE C CG2   1 
ATOM   3527 C CD1   . ILE C 1 127 ? -24.210 17.621  -27.048 1.00 15.56  ? 312  ILE C CD1   1 
ATOM   3528 N N     . ASP C 1 128 ? -26.348 12.768  -24.143 1.00 17.54  ? 313  ASP C N     1 
ATOM   3529 C CA    . ASP C 1 128 ? -27.159 11.545  -24.261 1.00 18.27  ? 313  ASP C CA    1 
ATOM   3530 C C     . ASP C 1 128 ? -26.324 10.350  -24.696 1.00 17.73  ? 313  ASP C C     1 
ATOM   3531 O O     . ASP C 1 128 ? -26.704 9.603   -25.598 1.00 18.28  ? 313  ASP C O     1 
ATOM   3532 C CB    . ASP C 1 128 ? -28.343 11.757  -25.217 1.00 19.25  ? 313  ASP C CB    1 
ATOM   3533 C CG    . ASP C 1 128 ? -29.286 12.838  -24.743 1.00 21.85  ? 313  ASP C CG    1 
ATOM   3534 O OD1   . ASP C 1 128 ? -29.546 13.771  -25.526 1.00 23.77  ? 313  ASP C OD1   1 
ATOM   3535 O OD2   . ASP C 1 128 ? -29.758 12.763  -23.587 1.00 25.11  ? 313  ASP C OD2   1 
ATOM   3536 N N     . GLY C 1 129 ? -25.179 10.183  -24.048 1.00 16.80  ? 314  GLY C N     1 
ATOM   3537 C CA    . GLY C 1 129 ? -24.293 9.057   -24.332 1.00 15.83  ? 314  GLY C CA    1 
ATOM   3538 C C     . GLY C 1 129 ? -23.448 9.165   -25.590 1.00 15.83  ? 314  GLY C C     1 
ATOM   3539 O O     . GLY C 1 129 ? -22.754 8.215   -25.944 1.00 16.16  ? 314  GLY C O     1 
ATOM   3540 N N     . VAL C 1 130 ? -23.499 10.317  -26.266 1.00 14.32  ? 315  VAL C N     1 
ATOM   3541 C CA    . VAL C 1 130 ? -22.656 10.543  -27.443 1.00 14.21  ? 315  VAL C CA    1 
ATOM   3542 C C     . VAL C 1 130 ? -21.542 11.506  -27.044 1.00 12.60  ? 315  VAL C C     1 
ATOM   3543 O O     . VAL C 1 130 ? -21.809 12.629  -26.596 1.00 13.01  ? 315  VAL C O     1 
ATOM   3544 C CB    . VAL C 1 130 ? -23.446 11.105  -28.646 1.00 14.20  ? 315  VAL C CB    1 
ATOM   3545 C CG1   . VAL C 1 130 ? -22.514 11.323  -29.843 1.00 15.76  ? 315  VAL C CG1   1 
ATOM   3546 C CG2   . VAL C 1 130 ? -24.589 10.160  -29.015 1.00 16.33  ? 315  VAL C CG2   1 
ATOM   3547 N N     . PRO C 1 131 ? -20.286 11.056  -27.165 1.00 12.16  ? 316  PRO C N     1 
ATOM   3548 C CA    . PRO C 1 131 ? -19.181 11.933  -26.763 1.00 11.47  ? 316  PRO C CA    1 
ATOM   3549 C C     . PRO C 1 131 ? -18.843 12.972  -27.827 1.00 11.54  ? 316  PRO C C     1 
ATOM   3550 O O     . PRO C 1 131 ? -18.897 12.675  -29.027 1.00 12.74  ? 316  PRO C O     1 
ATOM   3551 C CB    . PRO C 1 131 ? -18.018 10.966  -26.606 1.00 11.81  ? 316  PRO C CB    1 
ATOM   3552 C CG    . PRO C 1 131 ? -18.321 9.862   -27.608 1.00 12.45  ? 316  PRO C CG    1 
ATOM   3553 C CD    . PRO C 1 131 ? -19.809 9.740   -27.642 1.00 12.46  ? 316  PRO C CD    1 
ATOM   3554 N N     . HIS C 1 132 ? -18.494 14.169  -27.362 1.00 10.29  ? 317  HIS C N     1 
ATOM   3555 C CA    . HIS C 1 132 ? -17.974 15.232  -28.223 1.00 10.64  ? 317  HIS C CA    1 
ATOM   3556 C C     . HIS C 1 132 ? -16.676 15.768  -27.635 1.00 10.75  ? 317  HIS C C     1 
ATOM   3557 O O     . HIS C 1 132 ? -16.528 15.839  -26.418 1.00 11.45  ? 317  HIS C O     1 
ATOM   3558 C CB    . HIS C 1 132 ? -18.979 16.376  -28.318 1.00 11.51  ? 317  HIS C CB    1 
ATOM   3559 C CG    . HIS C 1 132 ? -20.277 15.973  -28.940 1.00 12.43  ? 317  HIS C CG    1 
ATOM   3560 N ND1   . HIS C 1 132 ? -20.578 16.224  -30.263 1.00 11.70  ? 317  HIS C ND1   1 
ATOM   3561 C CD2   . HIS C 1 132 ? -21.348 15.323  -28.424 1.00 14.65  ? 317  HIS C CD2   1 
ATOM   3562 C CE1   . HIS C 1 132 ? -21.775 15.733  -30.537 1.00 14.59  ? 317  HIS C CE1   1 
ATOM   3563 N NE2   . HIS C 1 132 ? -22.266 15.193  -29.437 1.00 15.10  ? 317  HIS C NE2   1 
ATOM   3564 N N     . LEU C 1 133 ? -15.740 16.138  -28.506 1.00 9.89   ? 318  LEU C N     1 
ATOM   3565 C CA    . LEU C 1 133 ? -14.539 16.855  -28.083 1.00 9.56   ? 318  LEU C CA    1 
ATOM   3566 C C     . LEU C 1 133 ? -14.740 18.328  -28.321 1.00 9.39   ? 318  LEU C C     1 
ATOM   3567 O O     . LEU C 1 133 ? -15.080 18.728  -29.436 1.00 9.44   ? 318  LEU C O     1 
ATOM   3568 C CB    . LEU C 1 133 ? -13.319 16.410  -28.883 1.00 9.87   ? 318  LEU C CB    1 
ATOM   3569 C CG    . LEU C 1 133 ? -12.832 14.992  -28.637 1.00 10.31  ? 318  LEU C CG    1 
ATOM   3570 C CD1   . LEU C 1 133 ? -11.600 14.779  -29.494 1.00 11.90  ? 318  LEU C CD1   1 
ATOM   3571 C CD2   . LEU C 1 133 ? -12.501 14.754  -27.168 1.00 11.27  ? 318  LEU C CD2   1 
ATOM   3572 N N     . ILE C 1 134 ? -14.551 19.130  -27.274 1.00 8.69   ? 319  ILE C N     1 
ATOM   3573 C CA    . ILE C 1 134 ? -14.671 20.571  -27.399 1.00 9.10   ? 319  ILE C CA    1 
ATOM   3574 C C     . ILE C 1 134 ? -13.408 21.256  -26.926 1.00 8.72   ? 319  ILE C C     1 
ATOM   3575 O O     . ILE C 1 134 ? -12.696 20.747  -26.060 1.00 9.68   ? 319  ILE C O     1 
ATOM   3576 C CB    . ILE C 1 134 ? -15.901 21.129  -26.663 1.00 9.08   ? 319  ILE C CB    1 
ATOM   3577 C CG1   . ILE C 1 134 ? -15.817 20.879  -25.154 1.00 9.70   ? 319  ILE C CG1   1 
ATOM   3578 C CG2   . ILE C 1 134 ? -17.167 20.503  -27.244 1.00 10.29  ? 319  ILE C CG2   1 
ATOM   3579 C CD1   . ILE C 1 134 ? -16.939 21.532  -24.360 1.00 10.94  ? 319  ILE C CD1   1 
ATOM   3580 N N     . LEU C 1 135 ? -13.106 22.385  -27.552 1.00 7.99   ? 320  LEU C N     1 
ATOM   3581 C CA    . LEU C 1 135 ? -11.981 23.208  -27.132 1.00 8.11   ? 320  LEU C CA    1 
ATOM   3582 C C     . LEU C 1 135 ? -12.502 24.374  -26.324 1.00 9.17   ? 320  LEU C C     1 
ATOM   3583 O O     . LEU C 1 135 ? -13.430 25.066  -26.748 1.00 8.71   ? 320  LEU C O     1 
ATOM   3584 C CB    . LEU C 1 135 ? -11.219 23.737  -28.343 1.00 8.44   ? 320  LEU C CB    1 
ATOM   3585 C CG    . LEU C 1 135 ? -10.266 22.749  -28.993 1.00 10.32  ? 320  LEU C CG    1 
ATOM   3586 C CD1   . LEU C 1 135 ? -10.943 21.541  -29.557 1.00 14.45  ? 320  LEU C CD1   1 
ATOM   3587 C CD2   . LEU C 1 135 ? -9.567  23.503  -30.093 1.00 12.14  ? 320  LEU C CD2   1 
ATOM   3588 N N     . ILE C 1 136 ? -11.886 24.582  -25.164 1.00 9.04   ? 321  ILE C N     1 
ATOM   3589 C CA    . ILE C 1 136 ? -12.209 25.722  -24.307 1.00 10.39  ? 321  ILE C CA    1 
ATOM   3590 C C     . ILE C 1 136 ? -10.956 26.582  -24.123 1.00 9.27   ? 321  ILE C C     1 
ATOM   3591 O O     . ILE C 1 136 ? -9.838  26.083  -24.174 1.00 9.97   ? 321  ILE C O     1 
ATOM   3592 C CB    . ILE C 1 136 ? -12.778 25.261  -22.933 1.00 10.75  ? 321  ILE C CB    1 
ATOM   3593 C CG1   . ILE C 1 136 ? -11.737 24.577  -22.070 1.00 12.78  ? 321  ILE C CG1   1 
ATOM   3594 C CG2   . ILE C 1 136 ? -13.988 24.319  -23.096 1.00 13.64  ? 321  ILE C CG2   1 
ATOM   3595 C CD1   . ILE C 1 136 ? -12.254 24.379  -20.631 1.00 13.70  ? 321  ILE C CD1   1 
ATOM   3596 N N     . ALA C 1 137 ? -11.138 27.875  -23.928 1.00 8.25   ? 322  ALA C N     1 
ATOM   3597 C CA    . ALA C 1 137 ? -9.982  28.753  -23.755 1.00 8.52   ? 322  ALA C CA    1 
ATOM   3598 C C     . ALA C 1 137 ? -9.282  28.448  -22.432 1.00 9.15   ? 322  ALA C C     1 
ATOM   3599 O O     . ALA C 1 137 ? -9.922  28.378  -21.369 1.00 10.24  ? 322  ALA C O     1 
ATOM   3600 C CB    . ALA C 1 137 ? -10.427 30.211  -23.804 1.00 9.15   ? 322  ALA C CB    1 
ATOM   3601 N N     . SER C 1 138 ? -7.966  28.278  -22.487 1.00 9.16   ? 323  SER C N     1 
ATOM   3602 C CA    . SER C 1 138 ? -7.191  28.015  -21.271 1.00 9.90   ? 323  SER C CA    1 
ATOM   3603 C C     . SER C 1 138 ? -6.597  29.283  -20.654 1.00 10.14  ? 323  SER C C     1 
ATOM   3604 O O     . SER C 1 138 ? -6.007  29.225  -19.573 1.00 11.46  ? 323  SER C O     1 
ATOM   3605 C CB    . SER C 1 138 ? -6.098  26.993  -21.564 1.00 10.18  ? 323  SER C CB    1 
ATOM   3606 O OG    . SER C 1 138 ? -5.224  27.476  -22.571 1.00 12.66  ? 323  SER C OG    1 
ATOM   3607 N N     . ARG C 1 139 ? -6.759  30.403  -21.350 1.00 10.27  ? 324  ARG C N     1 
ATOM   3608 C CA    . ARG C 1 139 ? -6.374  31.735  -20.877 1.00 9.63   ? 324  ARG C CA    1 
ATOM   3609 C C     . ARG C 1 139 ? -7.236  32.727  -21.657 1.00 9.65   ? 324  ARG C C     1 
ATOM   3610 O O     . ARG C 1 139 ? -7.964  32.324  -22.582 1.00 9.62   ? 324  ARG C O     1 
ATOM   3611 C CB    . ARG C 1 139 ? -4.887  32.010  -21.151 1.00 9.45   ? 324  ARG C CB    1 
ATOM   3612 C CG    . ARG C 1 139 ? -4.504  31.896  -22.644 1.00 9.09   ? 324  ARG C CG    1 
ATOM   3613 C CD    . ARG C 1 139 ? -3.082  32.379  -22.813 1.00 9.95   ? 324  ARG C CD    1 
ATOM   3614 N NE    . ARG C 1 139 ? -2.549  32.273  -24.171 1.00 9.49   ? 324  ARG C NE    1 
ATOM   3615 C CZ    . ARG C 1 139 ? -2.792  33.122  -25.177 1.00 8.96   ? 324  ARG C CZ    1 
ATOM   3616 N NH1   . ARG C 1 139 ? -3.605  34.162  -25.017 1.00 9.74   ? 324  ARG C NH1   1 
ATOM   3617 N NH2   . ARG C 1 139 ? -2.209  32.922  -26.360 1.00 9.47   ? 324  ARG C NH2   1 
ATOM   3618 N N     . ASP C 1 140 ? -7.189  34.012  -21.304 1.00 9.98   ? 325  ASP C N     1 
ATOM   3619 C CA    . ASP C 1 140 ? -7.804  35.023  -22.142 1.00 10.00  ? 325  ASP C CA    1 
ATOM   3620 C C     . ASP C 1 140 ? -7.096  35.083  -23.478 1.00 9.81   ? 325  ASP C C     1 
ATOM   3621 O O     . ASP C 1 140 ? -5.854  35.099  -23.543 1.00 9.99   ? 325  ASP C O     1 
ATOM   3622 C CB    . ASP C 1 140 ? -7.744  36.406  -21.501 1.00 10.66  ? 325  ASP C CB    1 
ATOM   3623 C CG    . ASP C 1 140 ? -8.672  36.555  -20.318 1.00 11.91  ? 325  ASP C CG    1 
ATOM   3624 O OD1   . ASP C 1 140 ? -9.414  35.608  -19.960 1.00 13.10  ? 325  ASP C OD1   1 
ATOM   3625 O OD2   . ASP C 1 140 ? -8.659  37.667  -19.731 1.00 15.32  ? 325  ASP C OD2   1 
ATOM   3626 N N     . ILE C 1 141 ? -7.894  35.098  -24.542 1.00 9.72   ? 326  ILE C N     1 
ATOM   3627 C CA    . ILE C 1 141 ? -7.397  35.161  -25.904 1.00 9.35   ? 326  ILE C CA    1 
ATOM   3628 C C     . ILE C 1 141 ? -7.813  36.496  -26.517 1.00 9.66   ? 326  ILE C C     1 
ATOM   3629 O O     . ILE C 1 141 ? -8.993  36.833  -26.514 1.00 9.64   ? 326  ILE C O     1 
ATOM   3630 C CB    . ILE C 1 141 ? -7.955  33.997  -26.766 1.00 8.97   ? 326  ILE C CB    1 
ATOM   3631 C CG1   . ILE C 1 141 ? -7.678  32.654  -26.093 1.00 9.25   ? 326  ILE C CG1   1 
ATOM   3632 C CG2   . ILE C 1 141 ? -7.363  34.051  -28.178 1.00 10.62  ? 326  ILE C CG2   1 
ATOM   3633 C CD1   . ILE C 1 141 ? -8.251  31.432  -26.807 1.00 9.63   ? 326  ILE C CD1   1 
ATOM   3634 N N     . ALA C 1 142 ? -6.846  37.248  -27.033 1.00 9.66   ? 327  ALA C N     1 
ATOM   3635 C CA    . ALA C 1 142 ? -7.130  38.534  -27.673 1.00 9.65   ? 327  ALA C CA    1 
ATOM   3636 C C     . ALA C 1 142 ? -7.504  38.322  -29.132 1.00 9.67   ? 327  ALA C C     1 
ATOM   3637 O O     . ALA C 1 142 ? -6.988  37.410  -29.799 1.00 9.24   ? 327  ALA C O     1 
ATOM   3638 C CB    . ALA C 1 142 ? -5.919  39.466  -27.550 1.00 9.67   ? 327  ALA C CB    1 
ATOM   3639 N N     . ALA C 1 143 ? -8.394  39.166  -29.644 1.00 10.02  ? 328  ALA C N     1 
ATOM   3640 C CA    . ALA C 1 143 ? -8.674  39.154  -31.073 1.00 10.04  ? 328  ALA C CA    1 
ATOM   3641 C C     . ALA C 1 143 ? -7.367  39.226  -31.856 1.00 10.40  ? 328  ALA C C     1 
ATOM   3642 O O     . ALA C 1 143 ? -6.442  39.980  -31.502 1.00 11.36  ? 328  ALA C O     1 
ATOM   3643 C CB    . ALA C 1 143 ? -9.595  40.304  -31.454 1.00 10.21  ? 328  ALA C CB    1 
ATOM   3644 N N     . GLY C 1 144 ? -7.286  38.404  -32.902 1.00 10.39  ? 329  GLY C N     1 
ATOM   3645 C CA    . GLY C 1 144 ? -6.119  38.364  -33.768 1.00 10.45  ? 329  GLY C CA    1 
ATOM   3646 C C     . GLY C 1 144 ? -5.128  37.257  -33.437 1.00 9.98   ? 329  GLY C C     1 
ATOM   3647 O O     . GLY C 1 144 ? -4.291  36.909  -34.267 1.00 11.01  ? 329  GLY C O     1 
ATOM   3648 N N     . GLU C 1 145 ? -5.197  36.709  -32.225 1.00 9.01   ? 330  GLU C N     1 
ATOM   3649 C CA    . GLU C 1 145 ? -4.312  35.596  -31.880 1.00 8.55   ? 330  GLU C CA    1 
ATOM   3650 C C     . GLU C 1 145 ? -4.699  34.326  -32.617 1.00 8.25   ? 330  GLU C C     1 
ATOM   3651 O O     . GLU C 1 145 ? -5.895  34.039  -32.782 1.00 8.55   ? 330  GLU C O     1 
ATOM   3652 C CB    . GLU C 1 145 ? -4.349  35.279  -30.383 1.00 8.38   ? 330  GLU C CB    1 
ATOM   3653 C CG    . GLU C 1 145 ? -3.771  36.353  -29.488 1.00 8.71   ? 330  GLU C CG    1 
ATOM   3654 C CD    . GLU C 1 145 ? -3.404  35.815  -28.126 1.00 9.82   ? 330  GLU C CD    1 
ATOM   3655 O OE1   . GLU C 1 145 ? -4.176  36.032  -27.167 1.00 8.61   ? 330  GLU C OE1   1 
ATOM   3656 O OE2   . GLU C 1 145 ? -2.335  35.163  -28.030 1.00 9.88   ? 330  GLU C OE2   1 
ATOM   3657 N N     . GLU C 1 146 ? -3.699  33.533  -32.982 1.00 7.82   ? 331  GLU C N     1 
ATOM   3658 C CA    . GLU C 1 146 ? -3.974  32.201  -33.503 1.00 7.33   ? 331  GLU C CA    1 
ATOM   3659 C C     . GLU C 1 146 ? -4.406  31.272  -32.369 1.00 7.82   ? 331  GLU C C     1 
ATOM   3660 O O     . GLU C 1 146 ? -3.762  31.217  -31.301 1.00 8.35   ? 331  GLU C O     1 
ATOM   3661 C CB    . GLU C 1 146 ? -2.745  31.611  -34.201 1.00 7.88   ? 331  GLU C CB    1 
ATOM   3662 C CG    . GLU C 1 146 ? -3.057  30.297  -34.900 1.00 7.26   ? 331  GLU C CG    1 
ATOM   3663 C CD    . GLU C 1 146 ? -1.843  29.577  -35.474 1.00 7.40   ? 331  GLU C CD    1 
ATOM   3664 O OE1   . GLU C 1 146 ? -0.680  30.002  -35.233 1.00 8.15   ? 331  GLU C OE1   1 
ATOM   3665 O OE2   . GLU C 1 146 ? -2.073  28.561  -36.173 1.00 7.52   ? 331  GLU C OE2   1 
ATOM   3666 N N     . LEU C 1 147 ? -5.489  30.538  -32.612 1.00 7.58   ? 332  LEU C N     1 
ATOM   3667 C CA    . LEU C 1 147 ? -5.914  29.480  -31.702 1.00 6.66   ? 332  LEU C CA    1 
ATOM   3668 C C     . LEU C 1 147 ? -4.955  28.314  -31.833 1.00 7.20   ? 332  LEU C C     1 
ATOM   3669 O O     . LEU C 1 147 ? -4.595  27.925  -32.943 1.00 7.57   ? 332  LEU C O     1 
ATOM   3670 C CB    . LEU C 1 147 ? -7.327  29.018  -32.056 1.00 7.21   ? 332  LEU C CB    1 
ATOM   3671 C CG    . LEU C 1 147 ? -8.404  30.091  -31.925 1.00 7.30   ? 332  LEU C CG    1 
ATOM   3672 C CD1   . LEU C 1 147 ? -9.725  29.470  -32.325 1.00 10.11  ? 332  LEU C CD1   1 
ATOM   3673 C CD2   . LEU C 1 147 ? -8.479  30.676  -30.510 1.00 10.05  ? 332  LEU C CD2   1 
ATOM   3674 N N     . LEU C 1 148 ? -4.554  27.757  -30.691 1.00 6.60   ? 333  LEU C N     1 
ATOM   3675 C CA    . LEU C 1 148 ? -3.582  26.671  -30.659 1.00 6.57   ? 333  LEU C CA    1 
ATOM   3676 C C     . LEU C 1 148 ? -3.853  25.774  -29.473 1.00 6.66   ? 333  LEU C C     1 
ATOM   3677 O O     . LEU C 1 148 ? -4.248  26.260  -28.400 1.00 7.17   ? 333  LEU C O     1 
ATOM   3678 C CB    . LEU C 1 148 ? -2.153  27.222  -30.544 1.00 7.00   ? 333  LEU C CB    1 
ATOM   3679 C CG    . LEU C 1 148 ? -1.596  28.014  -31.727 1.00 6.88   ? 333  LEU C CG    1 
ATOM   3680 C CD1   . LEU C 1 148 ? -0.320  28.737  -31.371 1.00 8.04   ? 333  LEU C CD1   1 
ATOM   3681 C CD2   . LEU C 1 148 ? -1.400  27.165  -32.959 1.00 6.80   ? 333  LEU C CD2   1 
ATOM   3682 N N     . TYR C 1 149 ? -3.628  24.473  -29.656 1.00 7.13   ? 334  TYR C N     1 
ATOM   3683 C CA    . TYR C 1 149 ? -3.704  23.530  -28.514 1.00 7.67   ? 334  TYR C CA    1 
ATOM   3684 C C     . TYR C 1 149 ? -2.653  22.451  -28.676 1.00 7.99   ? 334  TYR C C     1 
ATOM   3685 O O     . TYR C 1 149 ? -2.051  22.326  -29.739 1.00 8.10   ? 334  TYR C O     1 
ATOM   3686 C CB    . TYR C 1 149 ? -5.113  22.915  -28.333 1.00 7.31   ? 334  TYR C CB    1 
ATOM   3687 C CG    . TYR C 1 149 ? -5.509  22.001  -29.475 1.00 6.30   ? 334  TYR C CG    1 
ATOM   3688 C CD1   . TYR C 1 149 ? -5.357  20.606  -29.386 1.00 6.96   ? 334  TYR C CD1   1 
ATOM   3689 C CD2   . TYR C 1 149 ? -6.037  22.528  -30.649 1.00 6.49   ? 334  TYR C CD2   1 
ATOM   3690 C CE1   . TYR C 1 149 ? -5.697  19.790  -30.438 1.00 7.66   ? 334  TYR C CE1   1 
ATOM   3691 C CE2   . TYR C 1 149 ? -6.384  21.703  -31.701 1.00 8.06   ? 334  TYR C CE2   1 
ATOM   3692 C CZ    . TYR C 1 149 ? -6.220  20.333  -31.590 1.00 7.03   ? 334  TYR C CZ    1 
ATOM   3693 O OH    . TYR C 1 149 ? -6.560  19.512  -32.651 1.00 8.08   ? 334  TYR C OH    1 
ATOM   3694 N N     . ASP C 1 150 ? -2.447  21.664  -27.629 1.00 8.67   ? 335  ASP C N     1 
ATOM   3695 C CA    . ASP C 1 150 ? -1.433  20.620  -27.646 1.00 9.14   ? 335  ASP C CA    1 
ATOM   3696 C C     . ASP C 1 150 ? -2.028  19.378  -28.282 1.00 9.02   ? 335  ASP C C     1 
ATOM   3697 O O     . ASP C 1 150 ? -2.979  18.802  -27.744 1.00 9.86   ? 335  ASP C O     1 
ATOM   3698 C CB    . ASP C 1 150 ? -1.023  20.326  -26.206 1.00 9.13   ? 335  ASP C CB    1 
ATOM   3699 C CG    . ASP C 1 150 ? 0.182   19.414  -26.095 1.00 11.76  ? 335  ASP C CG    1 
ATOM   3700 O OD1   . ASP C 1 150 ? 0.578   18.762  -27.072 1.00 11.67  ? 335  ASP C OD1   1 
ATOM   3701 O OD2   . ASP C 1 150 ? 0.721   19.350  -24.966 1.00 15.76  ? 335  ASP C OD2   1 
ATOM   3702 N N     . TYR C 1 151 ? -1.506  18.989  -29.445 1.00 8.83   ? 336  TYR C N     1 
ATOM   3703 C CA    . TYR C 1 151 ? -1.954  17.775  -30.142 1.00 9.51   ? 336  TYR C CA    1 
ATOM   3704 C C     . TYR C 1 151 ? -1.709  16.515  -29.323 1.00 9.98   ? 336  TYR C C     1 
ATOM   3705 O O     . TYR C 1 151 ? -2.328  15.487  -29.588 1.00 10.46  ? 336  TYR C O     1 
ATOM   3706 C CB    . TYR C 1 151 ? -1.246  17.637  -31.489 1.00 9.37   ? 336  TYR C CB    1 
ATOM   3707 C CG    . TYR C 1 151 ? -1.772  18.518  -32.603 1.00 8.74   ? 336  TYR C CG    1 
ATOM   3708 C CD1   . TYR C 1 151 ? -2.697  19.539  -32.362 1.00 8.29   ? 336  TYR C CD1   1 
ATOM   3709 C CD2   . TYR C 1 151 ? -1.311  18.332  -33.902 1.00 7.66   ? 336  TYR C CD2   1 
ATOM   3710 C CE1   . TYR C 1 151 ? -3.171  20.331  -33.405 1.00 7.58   ? 336  TYR C CE1   1 
ATOM   3711 C CE2   . TYR C 1 151 ? -1.760  19.109  -34.946 1.00 8.74   ? 336  TYR C CE2   1 
ATOM   3712 C CZ    . TYR C 1 151 ? -2.699  20.104  -34.697 1.00 7.63   ? 336  TYR C CZ    1 
ATOM   3713 O OH    . TYR C 1 151 ? -3.140  20.883  -35.743 1.00 7.69   ? 336  TYR C OH    1 
ATOM   3714 N N     . GLY C 1 152 ? -0.780  16.580  -28.363 1.00 10.52  ? 337  GLY C N     1 
ATOM   3715 C CA    . GLY C 1 152 ? -0.583  15.478  -27.419 1.00 11.78  ? 337  GLY C CA    1 
ATOM   3716 C C     . GLY C 1 152 ? 0.248   14.307  -27.920 1.00 13.14  ? 337  GLY C C     1 
ATOM   3717 O O     . GLY C 1 152 ? 0.567   13.404  -27.135 1.00 15.33  ? 337  GLY C O     1 
ATOM   3718 N N     . ASP C 1 153 ? 0.606   14.300  -29.204 1.00 12.63  ? 338  ASP C N     1 
ATOM   3719 C CA    . ASP C 1 153 ? 1.380   13.197  -29.785 1.00 13.45  ? 338  ASP C CA    1 
ATOM   3720 C C     . ASP C 1 153 ? 2.853   13.389  -29.471 1.00 14.38  ? 338  ASP C C     1 
ATOM   3721 O O     . ASP C 1 153 ? 3.509   14.288  -30.014 1.00 14.27  ? 338  ASP C O     1 
ATOM   3722 C CB    . ASP C 1 153 ? 1.142   13.107  -31.299 1.00 12.88  ? 338  ASP C CB    1 
ATOM   3723 C CG    . ASP C 1 153 ? 1.777   11.883  -31.935 1.00 13.57  ? 338  ASP C CG    1 
ATOM   3724 O OD1   . ASP C 1 153 ? 2.514   11.135  -31.247 1.00 15.96  ? 338  ASP C OD1   1 
ATOM   3725 O OD2   . ASP C 1 153 ? 1.532   11.687  -33.137 1.00 14.01  ? 338  ASP C OD2   1 
ATOM   3726 N N     . ARG C 1 154 ? 3.362   12.520  -28.599 1.00 16.61  ? 339  ARG C N     1 
ATOM   3727 C CA    . ARG C 1 154 ? 4.714   12.627  -28.066 1.00 18.71  ? 339  ARG C CA    1 
ATOM   3728 C C     . ARG C 1 154 ? 5.605   11.536  -28.614 1.00 19.66  ? 339  ARG C C     1 
ATOM   3729 O O     . ARG C 1 154 ? 6.775   11.426  -28.218 1.00 21.43  ? 339  ARG C O     1 
ATOM   3730 C CB    . ARG C 1 154 ? 4.681   12.488  -26.542 1.00 18.84  ? 339  ARG C CB    1 
ATOM   3731 C CG    . ARG C 1 154 ? 3.907   13.554  -25.822 1.00 19.83  ? 339  ARG C CG    1 
ATOM   3732 C CD    . ARG C 1 154 ? 4.612   14.900  -25.877 1.00 20.26  ? 339  ARG C CD    1 
ATOM   3733 N NE    . ARG C 1 154 ? 4.013   15.827  -24.933 1.00 20.60  ? 339  ARG C NE    1 
ATOM   3734 C CZ    . ARG C 1 154 ? 3.083   16.733  -25.241 1.00 19.01  ? 339  ARG C CZ    1 
ATOM   3735 N NH1   . ARG C 1 154 ? 2.650   16.881  -26.502 1.00 15.03  ? 339  ARG C NH1   1 
ATOM   3736 N NH2   . ARG C 1 154 ? 2.598   17.501  -24.278 1.00 19.52  ? 339  ARG C NH2   1 
ATOM   3737 N N     . SER C 1 155 ? 5.068   10.702  -29.492 1.00 20.34  ? 340  SER C N     1 
ATOM   3738 C CA    . SER C 1 155 ? 5.837   9.551   -29.940 1.00 21.07  ? 340  SER C CA    1 
ATOM   3739 C C     . SER C 1 155 ? 7.085   9.978   -30.700 1.00 21.23  ? 340  SER C C     1 
ATOM   3740 O O     . SER C 1 155 ? 7.040   10.854  -31.574 1.00 21.07  ? 340  SER C O     1 
ATOM   3741 C CB    . SER C 1 155 ? 4.989   8.609   -30.767 1.00 21.68  ? 340  SER C CB    1 
ATOM   3742 O OG    . SER C 1 155 ? 4.633   9.195   -31.989 1.00 21.97  ? 340  SER C OG    1 
ATOM   3743 N N     . LYS C 1 156 ? 8.203   9.361   -30.328 1.00 21.36  ? 341  LYS C N     1 
ATOM   3744 C CA    . LYS C 1 156 ? 9.495   9.580   -30.977 1.00 21.25  ? 341  LYS C CA    1 
ATOM   3745 C C     . LYS C 1 156 ? 9.362   9.633   -32.509 1.00 20.77  ? 341  LYS C C     1 
ATOM   3746 O O     . LYS C 1 156 ? 9.920   10.513  -33.156 1.00 20.83  ? 341  LYS C O     1 
ATOM   3747 C CB    . LYS C 1 156 ? 10.467  8.466   -30.542 1.00 21.47  ? 341  LYS C CB    1 
ATOM   3748 C CG    . LYS C 1 156 ? 11.940  8.715   -30.822 1.00 22.27  ? 341  LYS C CG    1 
ATOM   3749 C CD    . LYS C 1 156 ? 12.779  7.517   -30.349 1.00 22.80  ? 341  LYS C CD    1 
ATOM   3750 C CE    . LYS C 1 156 ? 14.209  7.574   -30.881 1.00 25.26  ? 341  LYS C CE    1 
ATOM   3751 N NZ    . LYS C 1 156 ? 14.258  7.543   -32.378 1.00 27.38  ? 341  LYS C NZ    1 
ATOM   3752 N N     . ALA C 1 157 ? 8.584   8.711   -33.072 1.00 20.27  ? 342  ALA C N     1 
ATOM   3753 C CA    . ALA C 1 157 ? 8.387   8.606   -34.521 1.00 19.84  ? 342  ALA C CA    1 
ATOM   3754 C C     . ALA C 1 157 ? 7.642   9.806   -35.126 1.00 19.49  ? 342  ALA C C     1 
ATOM   3755 O O     . ALA C 1 157 ? 7.982   10.297  -36.211 1.00 19.58  ? 342  ALA C O     1 
ATOM   3756 C CB    . ALA C 1 157 ? 7.652   7.314   -34.857 1.00 20.46  ? 342  ALA C CB    1 
ATOM   3757 N N     . SER C 1 158 ? 6.600   10.253  -34.432 1.00 18.97  ? 343  SER C N     1 
ATOM   3758 C CA    . SER C 1 158 ? 5.848   11.419  -34.887 1.00 18.18  ? 343  SER C CA    1 
ATOM   3759 C C     . SER C 1 158 ? 6.706   12.674  -34.838 1.00 18.39  ? 343  SER C C     1 
ATOM   3760 O O     . SER C 1 158 ? 6.651   13.500  -35.745 1.00 17.65  ? 343  SER C O     1 
ATOM   3761 C CB    . SER C 1 158 ? 4.583   11.601  -34.049 1.00 17.30  ? 343  SER C CB    1 
ATOM   3762 O OG    . SER C 1 158 ? 3.661   10.553  -34.319 1.00 16.45  ? 343  SER C OG    1 
ATOM   3763 N N     . ILE C 1 159 ? 7.493   12.804  -33.775 1.00 18.77  ? 344  ILE C N     1 
ATOM   3764 C CA    . ILE C 1 159 ? 8.343   13.974  -33.585 1.00 19.88  ? 344  ILE C CA    1 
ATOM   3765 C C     . ILE C 1 159 ? 9.476   14.042  -34.616 1.00 19.81  ? 344  ILE C C     1 
ATOM   3766 O O     . ILE C 1 159 ? 9.853   15.126  -35.068 1.00 19.65  ? 344  ILE C O     1 
ATOM   3767 C CB    . ILE C 1 159 ? 8.869   14.047  -32.134 1.00 20.28  ? 344  ILE C CB    1 
ATOM   3768 C CG1   . ILE C 1 159 ? 7.734   14.484  -31.189 1.00 21.19  ? 344  ILE C CG1   1 
ATOM   3769 C CG2   . ILE C 1 159 ? 10.058  14.986  -32.035 1.00 22.23  ? 344  ILE C CG2   1 
ATOM   3770 C CD1   . ILE C 1 159 ? 8.034   14.325  -29.706 1.00 21.45  ? 344  ILE C CD1   1 
ATOM   3771 N N     . GLU C 1 160 ? 10.006  12.884  -34.998 1.00 20.42  ? 345  GLU C N     1 
ATOM   3772 C CA    . GLU C 1 160 ? 11.015  12.819  -36.053 1.00 21.15  ? 345  GLU C CA    1 
ATOM   3773 C C     . GLU C 1 160 ? 10.435  13.299  -37.391 1.00 20.15  ? 345  GLU C C     1 
ATOM   3774 O O     . GLU C 1 160 ? 11.067  14.077  -38.115 1.00 20.06  ? 345  GLU C O     1 
ATOM   3775 C CB    . GLU C 1 160 ? 11.556  11.388  -36.164 1.00 22.02  ? 345  GLU C CB    1 
ATOM   3776 C CG    . GLU C 1 160 ? 12.168  11.003  -37.521 1.00 26.12  ? 345  GLU C CG    1 
ATOM   3777 C CD    . GLU C 1 160 ? 13.532  11.626  -37.786 1.00 32.18  ? 345  GLU C CD    1 
ATOM   3778 O OE1   . GLU C 1 160 ? 14.159  12.165  -36.843 1.00 33.17  ? 345  GLU C OE1   1 
ATOM   3779 O OE2   . GLU C 1 160 ? 13.990  11.560  -38.951 1.00 33.04  ? 345  GLU C OE2   1 
ATOM   3780 N N     . ALA C 1 161 ? 9.217   12.852  -37.695 1.00 19.37  ? 346  ALA C N     1 
ATOM   3781 C CA    . ALA C 1 161 ? 8.544   13.209  -38.938 1.00 18.17  ? 346  ALA C CA    1 
ATOM   3782 C C     . ALA C 1 161 ? 7.914   14.622  -38.925 1.00 17.48  ? 346  ALA C C     1 
ATOM   3783 O O     . ALA C 1 161 ? 7.748   15.239  -39.980 1.00 17.39  ? 346  ALA C O     1 
ATOM   3784 C CB    . ALA C 1 161 ? 7.503   12.153  -39.283 1.00 19.09  ? 346  ALA C CB    1 
ATOM   3785 N N     . HIS C 1 162 ? 7.599   15.119  -37.730 1.00 16.29  ? 347  HIS C N     1 
ATOM   3786 C CA    . HIS C 1 162 ? 6.880   16.394  -37.543 1.00 14.98  ? 347  HIS C CA    1 
ATOM   3787 C C     . HIS C 1 162 ? 7.519   17.146  -36.378 1.00 14.25  ? 347  HIS C C     1 
ATOM   3788 O O     . HIS C 1 162 ? 6.969   17.173  -35.274 1.00 14.07  ? 347  HIS C O     1 
ATOM   3789 C CB    . HIS C 1 162 ? 5.390   16.125  -37.274 1.00 14.41  ? 347  HIS C CB    1 
ATOM   3790 C CG    . HIS C 1 162 ? 4.748   15.259  -38.310 1.00 14.81  ? 347  HIS C CG    1 
ATOM   3791 N ND1   . HIS C 1 162 ? 4.256   15.756  -39.495 1.00 16.30  ? 347  HIS C ND1   1 
ATOM   3792 C CD2   . HIS C 1 162 ? 4.557   13.919  -38.356 1.00 15.36  ? 347  HIS C CD2   1 
ATOM   3793 C CE1   . HIS C 1 162 ? 3.770   14.763  -40.220 1.00 16.10  ? 347  HIS C CE1   1 
ATOM   3794 N NE2   . HIS C 1 162 ? 3.946   13.637  -39.554 1.00 15.95  ? 347  HIS C NE2   1 
ATOM   3795 N N     . PRO C 1 163 ? 8.710   17.736  -36.604 1.00 14.52  ? 348  PRO C N     1 
ATOM   3796 C CA    . PRO C 1 163 ? 9.507   18.292  -35.508 1.00 14.15  ? 348  PRO C CA    1 
ATOM   3797 C C     . PRO C 1 163 ? 8.831   19.422  -34.736 1.00 13.05  ? 348  PRO C C     1 
ATOM   3798 O O     . PRO C 1 163 ? 9.157   19.654  -33.568 1.00 13.50  ? 348  PRO C O     1 
ATOM   3799 C CB    . PRO C 1 163 ? 10.787  18.779  -36.212 1.00 14.23  ? 348  PRO C CB    1 
ATOM   3800 C CG    . PRO C 1 163 ? 10.855  17.957  -37.442 1.00 15.46  ? 348  PRO C CG    1 
ATOM   3801 C CD    . PRO C 1 163 ? 9.428   17.841  -37.886 1.00 14.99  ? 348  PRO C CD    1 
ATOM   3802 N N     . TRP C 1 164 ? 7.880   20.090  -35.376 1.00 12.74  ? 349  TRP C N     1 
ATOM   3803 C CA    . TRP C 1 164 ? 7.092   21.141  -34.725 1.00 12.03  ? 349  TRP C CA    1 
ATOM   3804 C C     . TRP C 1 164 ? 6.274   20.613  -33.532 1.00 11.71  ? 349  TRP C C     1 
ATOM   3805 O O     . TRP C 1 164 ? 5.860   21.391  -32.677 1.00 11.63  ? 349  TRP C O     1 
ATOM   3806 C CB    . TRP C 1 164 ? 6.202   21.876  -35.755 1.00 11.68  ? 349  TRP C CB    1 
ATOM   3807 C CG    . TRP C 1 164 ? 5.420   20.929  -36.611 1.00 11.10  ? 349  TRP C CG    1 
ATOM   3808 C CD1   . TRP C 1 164 ? 5.748   20.492  -37.861 1.00 11.86  ? 349  TRP C CD1   1 
ATOM   3809 C CD2   . TRP C 1 164 ? 4.186   20.272  -36.273 1.00 10.68  ? 349  TRP C CD2   1 
ATOM   3810 N NE1   . TRP C 1 164 ? 4.812   19.597  -38.320 1.00 11.56  ? 349  TRP C NE1   1 
ATOM   3811 C CE2   . TRP C 1 164 ? 3.836   19.450  -37.370 1.00 10.80  ? 349  TRP C CE2   1 
ATOM   3812 C CE3   . TRP C 1 164 ? 3.355   20.289  -35.148 1.00 10.16  ? 349  TRP C CE3   1 
ATOM   3813 C CZ2   . TRP C 1 164 ? 2.699   18.639  -37.364 1.00 11.35  ? 349  TRP C CZ2   1 
ATOM   3814 C CZ3   . TRP C 1 164 ? 2.207   19.500  -35.157 1.00 10.46  ? 349  TRP C CZ3   1 
ATOM   3815 C CH2   . TRP C 1 164 ? 1.897   18.681  -36.254 1.00 10.94  ? 349  TRP C CH2   1 
ATOM   3816 N N     . LEU C 1 165 ? 6.074   19.295  -33.457 1.00 11.78  ? 350  LEU C N     1 
ATOM   3817 C CA    . LEU C 1 165 ? 5.400   18.700  -32.300 1.00 11.98  ? 350  LEU C CA    1 
ATOM   3818 C C     . LEU C 1 165 ? 6.148   18.903  -30.990 1.00 12.69  ? 350  LEU C C     1 
ATOM   3819 O O     . LEU C 1 165 ? 5.555   18.800  -29.916 1.00 12.96  ? 350  LEU C O     1 
ATOM   3820 C CB    . LEU C 1 165 ? 5.170   17.207  -32.510 1.00 11.19  ? 350  LEU C CB    1 
ATOM   3821 C CG    . LEU C 1 165 ? 3.947   16.860  -33.368 1.00 10.40  ? 350  LEU C CG    1 
ATOM   3822 C CD1   . LEU C 1 165 ? 4.001   15.385  -33.790 1.00 11.18  ? 350  LEU C CD1   1 
ATOM   3823 C CD2   . LEU C 1 165 ? 2.627   17.217  -32.660 1.00 10.47  ? 350  LEU C CD2   1 
ATOM   3824 N N     . LYS C 1 166 ? 7.444   19.214  -31.091 1.00 12.98  ? 351  LYS C N     1 
ATOM   3825 C CA    . LYS C 1 166 ? 8.304   19.356  -29.914 1.00 14.66  ? 351  LYS C CA    1 
ATOM   3826 C C     . LYS C 1 166 ? 8.004   20.598  -29.076 1.00 14.46  ? 351  LYS C C     1 
ATOM   3827 O O     . LYS C 1 166 ? 8.423   20.687  -27.915 1.00 15.09  ? 351  LYS C O     1 
ATOM   3828 C CB    . LYS C 1 166 ? 9.771   19.410  -30.341 1.00 15.11  ? 351  LYS C CB    1 
ATOM   3829 C CG    . LYS C 1 166 ? 10.348  18.105  -30.831 1.00 19.06  ? 351  LYS C CG    1 
ATOM   3830 C CD    . LYS C 1 166 ? 11.872  18.170  -30.797 1.00 23.38  ? 351  LYS C CD    1 
ATOM   3831 C CE    . LYS C 1 166 ? 12.470  16.890  -30.222 1.00 27.08  ? 351  LYS C CE    1 
ATOM   3832 N NZ    . LYS C 1 166 ? 13.841  17.101  -29.680 1.00 30.70  ? 351  LYS C NZ    1 
ATOM   3833 N N     . HIS C 1 167 ? 7.318   21.575  -29.666 1.00 13.23  ? 352  HIS C N     1 
ATOM   3834 C CA    . HIS C 1 167 ? 7.060   22.852  -28.968 1.00 13.47  ? 352  HIS C CA    1 
ATOM   3835 C C     . HIS C 1 167 ? 5.605   23.303  -29.120 1.00 12.65  ? 352  HIS C C     1 
ATOM   3836 O O     . HIS C 1 167 ? 4.838   22.613  -29.785 1.00 12.16  ? 352  HIS C O     1 
ATOM   3837 C CB    . HIS C 1 167 ? 8.036   23.905  -29.479 1.00 14.69  ? 352  HIS C CB    1 
ATOM   3838 C CG    . HIS C 1 167 ? 9.472   23.517  -29.286 1.00 17.65  ? 352  HIS C CG    1 
ATOM   3839 N ND1   . HIS C 1 167 ? 10.084  23.519  -28.049 1.00 20.19  ? 352  HIS C ND1   1 
ATOM   3840 C CD2   . HIS C 1 167 ? 10.399  23.069  -30.165 1.00 19.60  ? 352  HIS C CD2   1 
ATOM   3841 C CE1   . HIS C 1 167 ? 11.338  23.118  -28.180 1.00 21.32  ? 352  HIS C CE1   1 
ATOM   3842 N NE2   . HIS C 1 167 ? 11.551  22.833  -29.452 1.00 20.23  ? 352  HIS C NE2   1 
ATOM   3843 N N     . ARG D 1 7   ? 29.566  0.567   -63.530 1.00 28.55  ? 192  ARG D N     1 
ATOM   3844 C CA    . ARG D 1 7   ? 28.279  1.207   -63.129 1.00 28.06  ? 192  ARG D CA    1 
ATOM   3845 C C     . ARG D 1 7   ? 28.503  2.590   -62.521 1.00 27.79  ? 192  ARG D C     1 
ATOM   3846 O O     . ARG D 1 7   ? 29.560  2.879   -61.952 1.00 27.72  ? 192  ARG D O     1 
ATOM   3847 C CB    . ARG D 1 7   ? 27.511  0.308   -62.152 1.00 28.35  ? 192  ARG D CB    1 
ATOM   3848 N N     . LYS D 1 8   ? 27.498  3.450   -62.648 1.00 27.32  ? 193  LYS D N     1 
ATOM   3849 C CA    . LYS D 1 8   ? 27.540  4.756   -62.007 1.00 26.61  ? 193  LYS D CA    1 
ATOM   3850 C C     . LYS D 1 8   ? 27.282  4.597   -60.512 1.00 26.34  ? 193  LYS D C     1 
ATOM   3851 O O     . LYS D 1 8   ? 26.462  3.774   -60.099 1.00 26.28  ? 193  LYS D O     1 
ATOM   3852 C CB    . LYS D 1 8   ? 26.542  5.718   -62.656 1.00 26.48  ? 193  LYS D CB    1 
ATOM   3853 C CG    . LYS D 1 8   ? 27.055  6.328   -63.964 1.00 25.43  ? 193  LYS D CG    1 
ATOM   3854 C CD    . LYS D 1 8   ? 26.026  7.228   -64.608 1.00 24.56  ? 193  LYS D CD    1 
ATOM   3855 C CE    . LYS D 1 8   ? 26.391  7.556   -66.052 1.00 22.65  ? 193  LYS D CE    1 
ATOM   3856 N NZ    . LYS D 1 8   ? 27.557  8.500   -66.181 1.00 21.38  ? 193  LYS D NZ    1 
ATOM   3857 N N     . SER D 1 9   ? 28.017  5.358   -59.706 1.00 25.78  ? 194  SER D N     1 
ATOM   3858 C CA    . SER D 1 9   ? 27.827  5.357   -58.252 1.00 25.72  ? 194  SER D CA    1 
ATOM   3859 C C     . SER D 1 9   ? 26.557  6.119   -57.892 1.00 25.78  ? 194  SER D C     1 
ATOM   3860 O O     . SER D 1 9   ? 26.057  6.910   -58.692 1.00 24.79  ? 194  SER D O     1 
ATOM   3861 C CB    . SER D 1 9   ? 29.023  6.011   -57.558 1.00 25.74  ? 194  SER D CB    1 
ATOM   3862 O OG    . SER D 1 9   ? 28.999  7.425   -57.727 1.00 26.48  ? 194  SER D OG    1 
ATOM   3863 N N     . LYS D 1 10  ? 26.043  5.876   -56.686 1.00 26.01  ? 195  LYS D N     1 
ATOM   3864 C CA    . LYS D 1 10  ? 24.909  6.627   -56.151 1.00 26.67  ? 195  LYS D CA    1 
ATOM   3865 C C     . LYS D 1 10  ? 25.180  8.136   -56.229 1.00 25.84  ? 195  LYS D C     1 
ATOM   3866 O O     . LYS D 1 10  ? 24.323  8.896   -56.679 1.00 25.43  ? 195  LYS D O     1 
ATOM   3867 C CB    . LYS D 1 10  ? 24.612  6.177   -54.711 1.00 27.00  ? 195  LYS D CB    1 
ATOM   3868 C CG    . LYS D 1 10  ? 23.455  6.891   -54.022 1.00 28.38  ? 195  LYS D CG    1 
ATOM   3869 C CD    . LYS D 1 10  ? 23.334  6.440   -52.559 1.00 28.42  ? 195  LYS D CD    1 
ATOM   3870 C CE    . LYS D 1 10  ? 22.235  7.197   -51.812 1.00 31.16  ? 195  LYS D CE    1 
ATOM   3871 N NZ    . LYS D 1 10  ? 20.879  7.010   -52.421 1.00 32.40  ? 195  LYS D NZ    1 
ATOM   3872 N N     . ALA D 1 11  ? 26.380  8.557   -55.824 1.00 25.35  ? 196  ALA D N     1 
ATOM   3873 C CA    . ALA D 1 11  ? 26.760  9.975   -55.868 1.00 24.58  ? 196  ALA D CA    1 
ATOM   3874 C C     . ALA D 1 11  ? 26.719  10.531  -57.285 1.00 23.97  ? 196  ALA D C     1 
ATOM   3875 O O     . ALA D 1 11  ? 26.205  11.633  -57.501 1.00 23.62  ? 196  ALA D O     1 
ATOM   3876 C CB    . ALA D 1 11  ? 28.137  10.192  -55.251 1.00 24.90  ? 196  ALA D CB    1 
ATOM   3877 N N     . GLU D 1 12  ? 27.264  9.777   -58.239 1.00 22.97  ? 197  GLU D N     1 
ATOM   3878 C CA    . GLU D 1 12  ? 27.219  10.159  -59.648 1.00 22.53  ? 197  GLU D CA    1 
ATOM   3879 C C     . GLU D 1 12  ? 25.770  10.261  -60.107 1.00 21.63  ? 197  GLU D C     1 
ATOM   3880 O O     . GLU D 1 12  ? 25.404  11.234  -60.749 1.00 21.02  ? 197  GLU D O     1 
ATOM   3881 C CB    . GLU D 1 12  ? 27.965  9.152   -60.532 1.00 22.95  ? 197  GLU D CB    1 
ATOM   3882 C CG    . GLU D 1 12  ? 29.481  9.264   -60.519 1.00 25.58  ? 197  GLU D CG    1 
ATOM   3883 C CD    . GLU D 1 12  ? 30.148  7.903   -60.515 1.00 28.90  ? 197  GLU D CD    1 
ATOM   3884 O OE1   . GLU D 1 12  ? 30.971  7.658   -59.606 1.00 31.26  ? 197  GLU D OE1   1 
ATOM   3885 O OE2   . GLU D 1 12  ? 29.829  7.067   -61.392 1.00 29.55  ? 197  GLU D OE2   1 
ATOM   3886 N N     . LEU D 1 13  ? 24.964  9.249   -59.783 1.00 20.59  ? 198  LEU D N     1 
ATOM   3887 C CA    . LEU D 1 13  ? 23.548  9.242   -60.154 1.00 19.70  ? 198  LEU D CA    1 
ATOM   3888 C C     . LEU D 1 13  ? 22.786  10.435  -59.590 1.00 19.25  ? 198  LEU D C     1 
ATOM   3889 O O     . LEU D 1 13  ? 22.006  11.051  -60.309 1.00 17.77  ? 198  LEU D O     1 
ATOM   3890 C CB    . LEU D 1 13  ? 22.870  7.944   -59.729 1.00 20.02  ? 198  LEU D CB    1 
ATOM   3891 C CG    . LEU D 1 13  ? 23.199  6.697   -60.571 1.00 19.79  ? 198  LEU D CG    1 
ATOM   3892 C CD1   . LEU D 1 13  ? 22.613  5.483   -59.885 1.00 21.07  ? 198  LEU D CD1   1 
ATOM   3893 C CD2   . LEU D 1 13  ? 22.713  6.789   -62.030 1.00 19.49  ? 198  LEU D CD2   1 
ATOM   3894 N N     . GLN D 1 14  ? 23.018  10.754  -58.318 1.00 19.06  ? 199  GLN D N     1 
ATOM   3895 C CA    . GLN D 1 14  ? 22.368  11.912  -57.687 1.00 18.90  ? 199  GLN D CA    1 
ATOM   3896 C C     . GLN D 1 14  ? 22.842  13.205  -58.322 1.00 18.37  ? 199  GLN D C     1 
ATOM   3897 O O     . GLN D 1 14  ? 22.029  14.089  -58.616 1.00 17.30  ? 199  GLN D O     1 
ATOM   3898 C CB    . GLN D 1 14  ? 22.608  11.960  -56.174 1.00 19.55  ? 199  GLN D CB    1 
ATOM   3899 C CG    . GLN D 1 14  ? 21.811  10.940  -55.377 1.00 21.59  ? 199  GLN D CG    1 
ATOM   3900 C CD    . GLN D 1 14  ? 20.330  11.303  -55.175 1.00 24.13  ? 199  GLN D CD    1 
ATOM   3901 O OE1   . GLN D 1 14  ? 19.589  10.565  -54.513 1.00 26.95  ? 199  GLN D OE1   1 
ATOM   3902 N NE2   . GLN D 1 14  ? 19.898  12.428  -55.742 1.00 24.81  ? 199  GLN D NE2   1 
ATOM   3903 N N     . SER D 1 15  ? 24.147  13.335  -58.529 1.00 17.90  ? 200  SER D N     1 
ATOM   3904 C CA    . SER D 1 15  ? 24.665  14.570  -59.118 1.00 18.45  ? 200  SER D CA    1 
ATOM   3905 C C     . SER D 1 15  ? 24.224  14.738  -60.584 1.00 18.45  ? 200  SER D C     1 
ATOM   3906 O O     . SER D 1 15  ? 23.933  15.849  -61.019 1.00 17.99  ? 200  SER D O     1 
ATOM   3907 C CB    . SER D 1 15  ? 26.188  14.748  -58.906 1.00 19.27  ? 200  SER D CB    1 
ATOM   3908 O OG    . SER D 1 15  ? 26.969  13.924  -59.741 1.00 22.43  ? 200  SER D OG    1 
ATOM   3909 N N     . GLU D 1 16  ? 24.157  13.625  -61.319 1.00 18.23  ? 201  GLU D N     1 
ATOM   3910 C CA    . GLU D 1 16  ? 23.685  13.631  -62.705 1.00 18.10  ? 201  GLU D CA    1 
ATOM   3911 C C     . GLU D 1 16  ? 22.195  13.967  -62.776 1.00 16.92  ? 201  GLU D C     1 
ATOM   3912 O O     . GLU D 1 16  ? 21.776  14.672  -63.684 1.00 17.12  ? 201  GLU D O     1 
ATOM   3913 C CB    . GLU D 1 16  ? 23.958  12.285  -63.378 1.00 19.05  ? 201  GLU D CB    1 
ATOM   3914 C CG    . GLU D 1 16  ? 25.396  12.136  -63.828 1.00 20.96  ? 201  GLU D CG    1 
ATOM   3915 C CD    . GLU D 1 16  ? 25.681  10.815  -64.517 1.00 23.66  ? 201  GLU D CD    1 
ATOM   3916 O OE1   . GLU D 1 16  ? 24.745  10.172  -65.044 1.00 26.03  ? 201  GLU D OE1   1 
ATOM   3917 O OE2   . GLU D 1 16  ? 26.856  10.408  -64.509 1.00 25.97  ? 201  GLU D OE2   1 
ATOM   3918 N N     . GLU D 1 17  ? 21.423  13.468  -61.812 1.00 16.20  ? 202  GLU D N     1 
ATOM   3919 C CA    . GLU D 1 17  ? 19.984  13.757  -61.700 1.00 15.83  ? 202  GLU D CA    1 
ATOM   3920 C C     . GLU D 1 17  ? 19.764  15.248  -61.450 1.00 15.54  ? 202  GLU D C     1 
ATOM   3921 O O     . GLU D 1 17  ? 18.988  15.907  -62.153 1.00 15.21  ? 202  GLU D O     1 
ATOM   3922 C CB    . GLU D 1 17  ? 19.353  12.911  -60.584 1.00 16.38  ? 202  GLU D CB    1 
ATOM   3923 C CG    . GLU D 1 17  ? 17.971  13.355  -60.078 1.00 17.83  ? 202  GLU D CG    1 
ATOM   3924 C CD    . GLU D 1 17  ? 16.816  12.979  -60.993 1.00 19.52  ? 202  GLU D CD    1 
ATOM   3925 O OE1   . GLU D 1 17  ? 17.045  12.363  -62.054 1.00 21.06  ? 202  GLU D OE1   1 
ATOM   3926 O OE2   . GLU D 1 17  ? 15.667  13.304  -60.631 1.00 20.73  ? 202  GLU D OE2   1 
ATOM   3927 N N     . ARG D 1 18  ? 20.477  15.783  -60.466 1.00 14.90  ? 203  ARG D N     1 
ATOM   3928 C CA    . ARG D 1 18  ? 20.400  17.214  -60.169 1.00 14.64  ? 203  ARG D CA    1 
ATOM   3929 C C     . ARG D 1 18  ? 20.869  18.087  -61.335 1.00 14.26  ? 203  ARG D C     1 
ATOM   3930 O O     . ARG D 1 18  ? 20.320  19.168  -61.572 1.00 13.86  ? 203  ARG D O     1 
ATOM   3931 C CB    . ARG D 1 18  ? 21.184  17.534  -58.893 1.00 14.64  ? 203  ARG D CB    1 
ATOM   3932 C CG    . ARG D 1 18  ? 21.267  19.007  -58.579 1.00 15.59  ? 203  ARG D CG    1 
ATOM   3933 C CD    . ARG D 1 18  ? 21.907  19.285  -57.225 1.00 14.96  ? 203  ARG D CD    1 
ATOM   3934 N NE    . ARG D 1 18  ? 21.001  18.994  -56.113 1.00 15.64  ? 203  ARG D NE    1 
ATOM   3935 C CZ    . ARG D 1 18  ? 20.034  19.821  -55.714 1.00 15.55  ? 203  ARG D CZ    1 
ATOM   3936 N NH1   . ARG D 1 18  ? 19.856  20.981  -56.327 1.00 16.45  ? 203  ARG D NH1   1 
ATOM   3937 N NH2   . ARG D 1 18  ? 19.245  19.492  -54.700 1.00 18.41  ? 203  ARG D NH2   1 
ATOM   3938 N N     . LYS D 1 19  ? 21.893  17.624  -62.051 1.00 14.65  ? 204  LYS D N     1 
ATOM   3939 C CA    . LYS D 1 19  ? 22.393  18.322  -63.218 1.00 15.33  ? 204  LYS D CA    1 
ATOM   3940 C C     . LYS D 1 19  ? 21.301  18.447  -64.290 1.00 15.11  ? 204  LYS D C     1 
ATOM   3941 O O     . LYS D 1 19  ? 21.112  19.525  -64.841 1.00 15.31  ? 204  LYS D O     1 
ATOM   3942 C CB    . LYS D 1 19  ? 23.608  17.578  -63.767 1.00 16.33  ? 204  LYS D CB    1 
ATOM   3943 C CG    . LYS D 1 19  ? 24.348  18.311  -64.849 1.00 18.46  ? 204  LYS D CG    1 
ATOM   3944 C CD    . LYS D 1 19  ? 25.605  17.539  -65.254 1.00 19.68  ? 204  LYS D CD    1 
ATOM   3945 C CE    . LYS D 1 19  ? 26.225  18.129  -66.508 1.00 21.88  ? 204  LYS D CE    1 
ATOM   3946 N NZ    . LYS D 1 19  ? 26.699  19.521  -66.303 1.00 23.07  ? 204  LYS D NZ    1 
ATOM   3947 N N     . ARG D 1 20  ? 20.576  17.356  -64.560 1.00 14.69  ? 205  ARG D N     1 
ATOM   3948 C CA    . ARG D 1 20  ? 19.491  17.403  -65.558 1.00 14.72  ? 205  ARG D CA    1 
ATOM   3949 C C     . ARG D 1 20  ? 18.452  18.441  -65.149 1.00 13.93  ? 205  ARG D C     1 
ATOM   3950 O O     . ARG D 1 20  ? 18.088  19.317  -65.935 1.00 14.56  ? 205  ARG D O     1 
ATOM   3951 C CB    . ARG D 1 20  ? 18.820  16.036  -65.748 1.00 14.84  ? 205  ARG D CB    1 
ATOM   3952 C CG    . ARG D 1 20  ? 19.643  15.024  -66.576 1.00 15.82  ? 205  ARG D CG    1 
ATOM   3953 C CD    . ARG D 1 20  ? 18.849  13.732  -66.874 1.00 15.94  ? 205  ARG D CD    1 
ATOM   3954 N NE    . ARG D 1 20  ? 18.572  12.933  -65.684 1.00 17.37  ? 205  ARG D NE    1 
ATOM   3955 C CZ    . ARG D 1 20  ? 19.416  12.055  -65.155 1.00 17.42  ? 205  ARG D CZ    1 
ATOM   3956 N NH1   . ARG D 1 20  ? 20.594  11.840  -65.721 1.00 19.49  ? 205  ARG D NH1   1 
ATOM   3957 N NH2   . ARG D 1 20  ? 19.076  11.392  -64.064 1.00 18.03  ? 205  ARG D NH2   1 
ATOM   3958 N N     . ILE D 1 21  ? 17.997  18.336  -63.903 1.00 13.44  ? 206  ILE D N     1 
ATOM   3959 C CA    . ILE D 1 21  ? 16.942  19.197  -63.384 1.00 13.10  ? 206  ILE D CA    1 
ATOM   3960 C C     . ILE D 1 21  ? 17.376  20.657  -63.340 1.00 13.04  ? 206  ILE D C     1 
ATOM   3961 O O     . ILE D 1 21  ? 16.704  21.546  -63.875 1.00 12.78  ? 206  ILE D O     1 
ATOM   3962 C CB    . ILE D 1 21  ? 16.536  18.780  -61.959 1.00 13.33  ? 206  ILE D CB    1 
ATOM   3963 C CG1   . ILE D 1 21  ? 15.879  17.401  -61.962 1.00 14.69  ? 206  ILE D CG1   1 
ATOM   3964 C CG2   . ILE D 1 21  ? 15.603  19.814  -61.345 1.00 14.32  ? 206  ILE D CG2   1 
ATOM   3965 C CD1   . ILE D 1 21  ? 15.748  16.801  -60.558 1.00 16.15  ? 206  ILE D CD1   1 
ATOM   3966 N N     . ASP D 1 22  ? 18.521  20.909  -62.709 1.00 13.65  ? 207  ASP D N     1 
ATOM   3967 C CA    . ASP D 1 22  ? 18.924  22.283  -62.441 1.00 14.27  ? 207  ASP D CA    1 
ATOM   3968 C C     . ASP D 1 22  ? 19.270  23.021  -63.735 1.00 14.14  ? 207  ASP D C     1 
ATOM   3969 O O     . ASP D 1 22  ? 19.004  24.218  -63.870 1.00 15.05  ? 207  ASP D O     1 
ATOM   3970 C CB    . ASP D 1 22  ? 20.038  22.347  -61.380 1.00 15.01  ? 207  ASP D CB    1 
ATOM   3971 C CG    . ASP D 1 22  ? 19.560  21.876  -60.002 1.00 15.24  ? 207  ASP D CG    1 
ATOM   3972 O OD1   . ASP D 1 22  ? 18.374  21.490  -59.851 1.00 17.39  ? 207  ASP D OD1   1 
ATOM   3973 O OD2   . ASP D 1 22  ? 20.372  21.867  -59.046 1.00 17.97  ? 207  ASP D OD2   1 
ATOM   3974 N N     . GLU D 1 23  ? 19.791  22.295  -64.721 1.00 14.76  ? 208  GLU D N     1 
ATOM   3975 C CA    . GLU D 1 23  ? 20.078  22.923  -66.003 1.00 14.97  ? 208  GLU D CA    1 
ATOM   3976 C C     . GLU D 1 23  ? 18.816  23.276  -66.819 1.00 14.59  ? 208  GLU D C     1 
ATOM   3977 O O     . GLU D 1 23  ? 18.765  24.307  -67.490 1.00 15.11  ? 208  GLU D O     1 
ATOM   3978 C CB    . GLU D 1 23  ? 21.129  22.121  -66.774 1.00 15.57  ? 208  GLU D CB    1 
ATOM   3979 C CG    . GLU D 1 23  ? 22.478  22.172  -66.026 1.00 16.45  ? 208  GLU D CG    1 
ATOM   3980 C CD    . GLU D 1 23  ? 23.592  21.360  -66.663 1.00 16.98  ? 208  GLU D CD    1 
ATOM   3981 O OE1   . GLU D 1 23  ? 23.407  20.845  -67.781 1.00 19.43  ? 208  GLU D OE1   1 
ATOM   3982 O OE2   . GLU D 1 23  ? 24.679  21.263  -66.038 1.00 19.35  ? 208  GLU D OE2   1 
ATOM   3983 N N     . LEU D 1 24  ? 17.771  22.450  -66.700 1.00 13.39  ? 209  LEU D N     1 
ATOM   3984 C CA    . LEU D 1 24  ? 16.458  22.779  -67.280 1.00 12.72  ? 209  LEU D CA    1 
ATOM   3985 C C     . LEU D 1 24  ? 15.764  23.934  -66.544 1.00 12.21  ? 209  LEU D C     1 
ATOM   3986 O O     . LEU D 1 24  ? 15.142  24.795  -67.181 1.00 12.50  ? 209  LEU D O     1 
ATOM   3987 C CB    . LEU D 1 24  ? 15.552  21.544  -67.317 1.00 12.50  ? 209  LEU D CB    1 
ATOM   3988 C CG    . LEU D 1 24  ? 15.955  20.496  -68.363 1.00 13.01  ? 209  LEU D CG    1 
ATOM   3989 C CD1   . LEU D 1 24  ? 15.321  19.158  -68.071 1.00 13.19  ? 209  LEU D CD1   1 
ATOM   3990 C CD2   . LEU D 1 24  ? 15.591  20.935  -69.786 1.00 15.42  ? 209  LEU D CD2   1 
ATOM   3991 N N     . ILE D 1 25  ? 15.869  23.954  -65.214 1.00 12.11  ? 210  ILE D N     1 
ATOM   3992 C CA    . ILE D 1 25  ? 15.364  25.084  -64.425 1.00 12.53  ? 210  ILE D CA    1 
ATOM   3993 C C     . ILE D 1 25  ? 16.023  26.389  -64.849 1.00 13.15  ? 210  ILE D C     1 
ATOM   3994 O O     . ILE D 1 25  ? 15.337  27.384  -65.132 1.00 13.92  ? 210  ILE D O     1 
ATOM   3995 C CB    . ILE D 1 25  ? 15.565  24.873  -62.904 1.00 11.73  ? 210  ILE D CB    1 
ATOM   3996 C CG1   . ILE D 1 25  ? 14.621  23.785  -62.387 1.00 11.88  ? 210  ILE D CG1   1 
ATOM   3997 C CG2   . ILE D 1 25  ? 15.340  26.189  -62.126 1.00 12.77  ? 210  ILE D CG2   1 
ATOM   3998 C CD1   . ILE D 1 25  ? 14.864  23.404  -60.932 1.00 12.90  ? 210  ILE D CD1   1 
ATOM   3999 N N     . GLU D 1 26  ? 17.355  26.382  -64.891 1.00 13.81  ? 211  GLU D N     1 
ATOM   4000 C CA    . GLU D 1 26  ? 18.091  27.605  -65.163 1.00 15.28  ? 211  GLU D CA    1 
ATOM   4001 C C     . GLU D 1 26  ? 17.920  28.123  -66.584 1.00 14.79  ? 211  GLU D C     1 
ATOM   4002 O O     . GLU D 1 26  ? 17.800  29.335  -66.782 1.00 14.98  ? 211  GLU D O     1 
ATOM   4003 C CB    . GLU D 1 26  ? 19.568  27.429  -64.839 1.00 16.17  ? 211  GLU D CB    1 
ATOM   4004 C CG    . GLU D 1 26  ? 19.949  28.008  -63.506 1.00 21.74  ? 211  GLU D CG    1 
ATOM   4005 C CD    . GLU D 1 26  ? 21.438  28.278  -63.418 1.00 26.53  ? 211  GLU D CD    1 
ATOM   4006 O OE1   . GLU D 1 26  ? 22.204  27.458  -63.963 1.00 28.95  ? 211  GLU D OE1   1 
ATOM   4007 O OE2   . GLU D 1 26  ? 21.847  29.303  -62.817 1.00 29.21  ? 211  GLU D OE2   1 
ATOM   4008 N N     . SER D 1 27  ? 17.878  27.213  -67.557 1.00 14.46  ? 212  SER D N     1 
ATOM   4009 C CA    . SER D 1 27  ? 17.698  27.612  -68.952 1.00 15.11  ? 212  SER D CA    1 
ATOM   4010 C C     . SER D 1 27  ? 16.278  28.090  -69.226 1.00 14.94  ? 212  SER D C     1 
ATOM   4011 O O     . SER D 1 27  ? 16.066  29.028  -69.987 1.00 15.58  ? 212  SER D O     1 
ATOM   4012 C CB    . SER D 1 27  ? 18.074  26.475  -69.899 1.00 15.35  ? 212  SER D CB    1 
ATOM   4013 O OG    . SER D 1 27  ? 17.119  25.437  -69.837 1.00 17.27  ? 212  SER D OG    1 
ATOM   4014 N N     . GLY D 1 28  ? 15.305  27.430  -68.598 1.00 14.51  ? 213  GLY D N     1 
ATOM   4015 C CA    . GLY D 1 28  ? 13.900  27.804  -68.759 1.00 14.43  ? 213  GLY D CA    1 
ATOM   4016 C C     . GLY D 1 28  ? 13.345  27.732  -70.171 1.00 14.15  ? 213  GLY D C     1 
ATOM   4017 O O     . GLY D 1 28  ? 12.381  28.416  -70.476 1.00 15.02  ? 213  GLY D O     1 
ATOM   4018 N N     . LYS D 1 29  ? 13.931  26.888  -71.025 1.00 14.68  ? 214  LYS D N     1 
ATOM   4019 C CA    . LYS D 1 29  ? 13.482  26.784  -72.427 1.00 14.79  ? 214  LYS D CA    1 
ATOM   4020 C C     . LYS D 1 29  ? 12.146  26.062  -72.606 1.00 14.09  ? 214  LYS D C     1 
ATOM   4021 O O     . LYS D 1 29  ? 11.422  26.287  -73.584 1.00 14.86  ? 214  LYS D O     1 
ATOM   4022 C CB    . LYS D 1 29  ? 14.560  26.145  -73.304 1.00 15.73  ? 214  LYS D CB    1 
ATOM   4023 C CG    . LYS D 1 29  ? 15.895  26.912  -73.315 1.00 17.95  ? 214  LYS D CG    1 
ATOM   4024 C CD    . LYS D 1 29  ? 15.726  28.423  -73.522 1.00 23.36  ? 214  LYS D CD    1 
ATOM   4025 C CE    . LYS D 1 29  ? 15.550  28.800  -74.978 1.00 25.96  ? 214  LYS D CE    1 
ATOM   4026 N NZ    . LYS D 1 29  ? 15.581  30.283  -75.157 1.00 27.80  ? 214  LYS D NZ    1 
ATOM   4027 N N     . GLU D 1 30  ? 11.837  25.173  -71.668 1.00 12.44  ? 215  GLU D N     1 
ATOM   4028 C CA    . GLU D 1 30  ? 10.524  24.498  -71.638 1.00 12.17  ? 215  GLU D CA    1 
ATOM   4029 C C     . GLU D 1 30  ? 10.177  23.837  -72.973 1.00 12.96  ? 215  GLU D C     1 
ATOM   4030 O O     . GLU D 1 30  ? 9.078   23.996  -73.511 1.00 13.09  ? 215  GLU D O     1 
ATOM   4031 C CB    . GLU D 1 30  ? 9.435   25.477  -71.170 1.00 11.66  ? 215  GLU D CB    1 
ATOM   4032 C CG    . GLU D 1 30  ? 9.874   26.157  -69.882 1.00 10.81  ? 215  GLU D CG    1 
ATOM   4033 C CD    . GLU D 1 30  ? 8.802   26.940  -69.155 1.00 10.64  ? 215  GLU D CD    1 
ATOM   4034 O OE1   . GLU D 1 30  ? 7.796   27.330  -69.781 1.00 11.04  ? 215  GLU D OE1   1 
ATOM   4035 O OE2   . GLU D 1 30  ? 9.006   27.180  -67.942 1.00 9.99   ? 215  GLU D OE2   1 
ATOM   4036 N N     . GLU D 1 31  ? 11.146  23.084  -73.488 1.00 13.90  ? 216  GLU D N     1 
ATOM   4037 C CA    . GLU D 1 31  ? 11.005  22.364  -74.750 1.00 15.53  ? 216  GLU D CA    1 
ATOM   4038 C C     . GLU D 1 31  ? 10.124  21.133  -74.578 1.00 13.81  ? 216  GLU D C     1 
ATOM   4039 O O     . GLU D 1 31  ? 10.088  20.541  -73.499 1.00 14.53  ? 216  GLU D O     1 
ATOM   4040 C CB    . GLU D 1 31  ? 12.393  21.961  -75.277 1.00 15.77  ? 216  GLU D CB    1 
ATOM   4041 C CG    . GLU D 1 31  ? 13.262  23.137  -75.695 1.00 19.40  ? 216  GLU D CG    1 
ATOM   4042 C CD    . GLU D 1 31  ? 14.414  22.742  -76.607 1.00 20.87  ? 216  GLU D CD    1 
ATOM   4043 O OE1   . GLU D 1 31  ? 15.306  21.990  -76.157 1.00 26.24  ? 216  GLU D OE1   1 
ATOM   4044 O OE2   . GLU D 1 31  ? 14.435  23.198  -77.778 1.00 27.12  ? 216  GLU D OE2   1 
ATOM   4045 N N     . GLY D 1 32  ? 9.407   20.765  -75.635 1.00 12.92  ? 217  GLY D N     1 
ATOM   4046 C CA    . GLY D 1 32  ? 8.603   19.542  -75.635 1.00 12.14  ? 217  GLY D CA    1 
ATOM   4047 C C     . GLY D 1 32  ? 7.168   19.740  -75.173 1.00 11.74  ? 217  GLY D C     1 
ATOM   4048 O O     . GLY D 1 32  ? 6.460   18.776  -74.861 1.00 11.77  ? 217  GLY D O     1 
ATOM   4049 N N     . MET D 1 33  ? 6.727   21.002  -75.168 1.00 11.20  ? 218  MET D N     1 
ATOM   4050 C CA    . MET D 1 33  ? 5.380   21.363  -74.739 1.00 11.60  ? 218  MET D CA    1 
ATOM   4051 C C     . MET D 1 33  ? 4.848   22.476  -75.614 1.00 11.18  ? 218  MET D C     1 
ATOM   4052 O O     . MET D 1 33  ? 5.626   23.266  -76.135 1.00 11.82  ? 218  MET D O     1 
ATOM   4053 C CB    . MET D 1 33  ? 5.429   21.883  -73.304 1.00 11.32  ? 218  MET D CB    1 
ATOM   4054 C CG    . MET D 1 33  ? 5.744   20.816  -72.263 1.00 12.03  ? 218  MET D CG    1 
ATOM   4055 S SD    . MET D 1 33  ? 6.089   21.580  -70.658 1.00 13.28  ? 218  MET D SD    1 
ATOM   4056 C CE    . MET D 1 33  ? 7.824   21.970  -70.850 1.00 15.34  ? 218  MET D CE    1 
ATOM   4057 N N     . LYS D 1 34  ? 3.526   22.536  -75.748 1.00 10.87  ? 219  LYS D N     1 
ATOM   4058 C CA    . LYS D 1 34  ? 2.870   23.660  -76.416 1.00 11.53  ? 219  LYS D CA    1 
ATOM   4059 C C     . LYS D 1 34  ? 1.569   24.012  -75.719 1.00 11.06  ? 219  LYS D C     1 
ATOM   4060 O O     . LYS D 1 34  ? 0.999   23.209  -74.992 1.00 10.60  ? 219  LYS D O     1 
ATOM   4061 C CB    . LYS D 1 34  ? 2.592   23.328  -77.886 1.00 12.45  ? 219  LYS D CB    1 
ATOM   4062 C CG    . LYS D 1 34  ? 1.482   22.305  -78.063 1.00 13.40  ? 219  LYS D CG    1 
ATOM   4063 C CD    . LYS D 1 34  ? 1.212   21.996  -79.534 1.00 14.12  ? 219  LYS D CD    1 
ATOM   4064 C CE    . LYS D 1 34  ? 0.087   20.977  -79.661 1.00 18.71  ? 219  LYS D CE    1 
ATOM   4065 N NZ    . LYS D 1 34  ? -0.116  20.560  -81.083 1.00 21.90  ? 219  LYS D NZ    1 
ATOM   4066 N N     . ILE D 1 35  ? 1.111   25.230  -75.948 1.00 11.05  ? 220  ILE D N     1 
ATOM   4067 C CA    . ILE D 1 35  ? -0.187  25.658  -75.482 1.00 11.49  ? 220  ILE D CA    1 
ATOM   4068 C C     . ILE D 1 35  ? -1.265  25.191  -76.446 1.00 12.41  ? 220  ILE D C     1 
ATOM   4069 O O     . ILE D 1 35  ? -1.073  25.221  -77.666 1.00 13.16  ? 220  ILE D O     1 
ATOM   4070 C CB    . ILE D 1 35  ? -0.254  27.202  -75.402 1.00 10.89  ? 220  ILE D CB    1 
ATOM   4071 C CG1   . ILE D 1 35  ? 0.813   27.721  -74.428 1.00 10.37  ? 220  ILE D CG1   1 
ATOM   4072 C CG2   . ILE D 1 35  ? -1.683  27.665  -75.039 1.00 11.33  ? 220  ILE D CG2   1 
ATOM   4073 C CD1   . ILE D 1 35  ? 0.921   29.226  -74.371 1.00 10.22  ? 220  ILE D CD1   1 
ATOM   4074 N N     . ASP D 1 36  ? -2.391  24.752  -75.891 1.00 12.89  ? 221  ASP D N     1 
ATOM   4075 C CA    . ASP D 1 36  ? -3.613  24.676  -76.677 1.00 14.15  ? 221  ASP D CA    1 
ATOM   4076 C C     . ASP D 1 36  ? -4.800  25.112  -75.841 1.00 12.86  ? 221  ASP D C     1 
ATOM   4077 O O     . ASP D 1 36  ? -4.685  25.354  -74.629 1.00 11.87  ? 221  ASP D O     1 
ATOM   4078 C CB    . ASP D 1 36  ? -3.851  23.287  -77.263 1.00 16.38  ? 221  ASP D CB    1 
ATOM   4079 C CG    . ASP D 1 36  ? -4.652  23.325  -78.577 1.00 18.82  ? 221  ASP D CG    1 
ATOM   4080 O OD1   . ASP D 1 36  ? -5.141  24.412  -79.008 1.00 18.53  ? 221  ASP D OD1   1 
ATOM   4081 O OD2   . ASP D 1 36  ? -4.765  22.246  -79.197 1.00 24.82  ? 221  ASP D OD2   1 
ATOM   4082 N N     . LEU D 1 37  ? -5.934  25.232  -76.514 1.00 12.26  ? 222  LEU D N     1 
ATOM   4083 C CA    . LEU D 1 37  ? -7.175  25.573  -75.861 1.00 11.33  ? 222  LEU D CA    1 
ATOM   4084 C C     . LEU D 1 37  ? -7.918  24.292  -75.565 1.00 11.15  ? 222  LEU D C     1 
ATOM   4085 O O     . LEU D 1 37  ? -8.169  23.466  -76.450 1.00 12.35  ? 222  LEU D O     1 
ATOM   4086 C CB    . LEU D 1 37  ? -7.995  26.545  -76.715 1.00 12.15  ? 222  LEU D CB    1 
ATOM   4087 C CG    . LEU D 1 37  ? -7.173  27.804  -77.044 1.00 13.64  ? 222  LEU D CG    1 
ATOM   4088 C CD1   . LEU D 1 37  ? -7.942  28.717  -77.975 1.00 16.09  ? 222  LEU D CD1   1 
ATOM   4089 C CD2   . LEU D 1 37  ? -6.765  28.548  -75.781 1.00 14.91  ? 222  LEU D CD2   1 
ATOM   4090 N N     . ILE D 1 38  ? -8.234  24.107  -74.294 1.00 10.50  ? 223  ILE D N     1 
ATOM   4091 C CA    . ILE D 1 38  ? -8.860  22.893  -73.831 1.00 9.95   ? 223  ILE D CA    1 
ATOM   4092 C C     . ILE D 1 38  ? -10.282 23.242  -73.411 1.00 9.89   ? 223  ILE D C     1 
ATOM   4093 O O     . ILE D 1 38  ? -10.491 24.117  -72.556 1.00 9.62   ? 223  ILE D O     1 
ATOM   4094 C CB    . ILE D 1 38  ? -8.091  22.312  -72.618 1.00 10.00  ? 223  ILE D CB    1 
ATOM   4095 C CG1   . ILE D 1 38  ? -6.581  22.184  -72.921 1.00 11.10  ? 223  ILE D CG1   1 
ATOM   4096 C CG2   . ILE D 1 38  ? -8.719  20.951  -72.162 1.00 9.82   ? 223  ILE D CG2   1 
ATOM   4097 C CD1   . ILE D 1 38  ? -6.206  21.236  -74.065 1.00 13.69  ? 223  ILE D CD1   1 
ATOM   4098 N N     . ASP D 1 39  ? -11.258 22.575  -74.017 1.00 10.62  ? 224  ASP D N     1 
ATOM   4099 C CA    . ASP D 1 39  ? -12.665 22.882  -73.792 1.00 10.19  ? 224  ASP D CA    1 
ATOM   4100 C C     . ASP D 1 39  ? -12.996 22.895  -72.298 1.00 10.49  ? 224  ASP D C     1 
ATOM   4101 O O     . ASP D 1 39  ? -12.774 21.906  -71.588 1.00 11.33  ? 224  ASP D O     1 
ATOM   4102 C CB    . ASP D 1 39  ? -13.553 21.888  -74.553 1.00 10.73  ? 224  ASP D CB    1 
ATOM   4103 C CG    . ASP D 1 39  ? -15.016 22.326  -74.619 1.00 12.02  ? 224  ASP D CG    1 
ATOM   4104 O OD1   . ASP D 1 39  ? -15.330 23.514  -74.385 1.00 12.10  ? 224  ASP D OD1   1 
ATOM   4105 O OD2   . ASP D 1 39  ? -15.860 21.460  -74.942 1.00 16.36  ? 224  ASP D OD2   1 
ATOM   4106 N N     . GLY D 1 40  ? -13.488 24.043  -71.827 1.00 10.39  ? 225  GLY D N     1 
ATOM   4107 C CA    . GLY D 1 40  ? -13.896 24.178  -70.432 1.00 10.35  ? 225  GLY D CA    1 
ATOM   4108 C C     . GLY D 1 40  ? -12.784 24.385  -69.424 1.00 10.45  ? 225  GLY D C     1 
ATOM   4109 O O     . GLY D 1 40  ? -13.055 24.469  -68.216 1.00 11.19  ? 225  GLY D O     1 
ATOM   4110 N N     . LYS D 1 41  ? -11.543 24.494  -69.900 1.00 9.37   ? 226  LYS D N     1 
ATOM   4111 C CA    . LYS D 1 41  ? -10.417 24.730  -68.978 1.00 9.12   ? 226  LYS D CA    1 
ATOM   4112 C C     . LYS D 1 41  ? -9.690  26.034  -69.233 1.00 9.08   ? 226  LYS D C     1 
ATOM   4113 O O     . LYS D 1 41  ? -8.936  26.480  -68.372 1.00 10.11  ? 226  LYS D O     1 
ATOM   4114 C CB    . LYS D 1 41  ? -9.392  23.590  -69.028 1.00 8.68   ? 226  LYS D CB    1 
ATOM   4115 C CG    . LYS D 1 41  ? -9.984  22.212  -68.778 1.00 8.95   ? 226  LYS D CG    1 
ATOM   4116 C CD    . LYS D 1 41  ? -8.879  21.171  -68.541 1.00 9.62   ? 226  LYS D CD    1 
ATOM   4117 C CE    . LYS D 1 41  ? -9.418  19.748  -68.651 1.00 11.34  ? 226  LYS D CE    1 
ATOM   4118 N NZ    . LYS D 1 41  ? -8.331  18.726  -68.581 1.00 11.12  ? 226  LYS D NZ    1 
ATOM   4119 N N     . GLY D 1 42  ? -9.898  26.649  -70.398 1.00 8.84   ? 227  GLY D N     1 
ATOM   4120 C CA    . GLY D 1 42  ? -9.061  27.768  -70.799 1.00 8.77   ? 227  GLY D CA    1 
ATOM   4121 C C     . GLY D 1 42  ? -7.896  27.275  -71.629 1.00 8.42   ? 227  GLY D C     1 
ATOM   4122 O O     . GLY D 1 42  ? -8.064  26.437  -72.523 1.00 9.82   ? 227  GLY D O     1 
ATOM   4123 N N     . ARG D 1 43  ? -6.707  27.779  -71.334 1.00 7.89   ? 228  ARG D N     1 
ATOM   4124 C CA    . ARG D 1 43  ? -5.489  27.238  -71.934 1.00 8.12   ? 228  ARG D CA    1 
ATOM   4125 C C     . ARG D 1 43  ? -5.071  26.008  -71.150 1.00 7.88   ? 228  ARG D C     1 
ATOM   4126 O O     . ARG D 1 43  ? -5.374  25.887  -69.957 1.00 8.49   ? 228  ARG D O     1 
ATOM   4127 C CB    . ARG D 1 43  ? -4.371  28.284  -71.898 1.00 8.49   ? 228  ARG D CB    1 
ATOM   4128 C CG    . ARG D 1 43  ? -4.724  29.531  -72.693 1.00 8.64   ? 228  ARG D CG    1 
ATOM   4129 C CD    . ARG D 1 43  ? -3.787  30.654  -72.394 1.00 8.94   ? 228  ARG D CD    1 
ATOM   4130 N NE    . ARG D 1 43  ? -3.938  31.138  -71.021 1.00 8.05   ? 228  ARG D NE    1 
ATOM   4131 C CZ    . ARG D 1 43  ? -3.287  32.184  -70.523 1.00 8.17   ? 228  ARG D CZ    1 
ATOM   4132 N NH1   . ARG D 1 43  ? -2.407  32.844  -71.272 1.00 9.29   ? 228  ARG D NH1   1 
ATOM   4133 N NH2   . ARG D 1 43  ? -3.491  32.549  -69.257 1.00 9.81   ? 228  ARG D NH2   1 
ATOM   4134 N N     . GLY D 1 44  ? -4.337  25.130  -71.824 1.00 7.77   ? 229  GLY D N     1 
ATOM   4135 C CA    . GLY D 1 44  ? -3.679  24.007  -71.193 1.00 8.10   ? 229  GLY D CA    1 
ATOM   4136 C C     . GLY D 1 44  ? -2.378  23.761  -71.918 1.00 8.17   ? 229  GLY D C     1 
ATOM   4137 O O     . GLY D 1 44  ? -2.072  24.442  -72.906 1.00 9.50   ? 229  GLY D O     1 
ATOM   4138 N N     . VAL D 1 45  ? -1.618  22.782  -71.429 1.00 7.75   ? 230  VAL D N     1 
ATOM   4139 C CA    . VAL D 1 45  ? -0.322  22.478  -72.019 1.00 8.07   ? 230  VAL D CA    1 
ATOM   4140 C C     . VAL D 1 45  ? -0.325  21.025  -72.498 1.00 7.91   ? 230  VAL D C     1 
ATOM   4141 O O     . VAL D 1 45  ? -0.695  20.119  -71.746 1.00 8.29   ? 230  VAL D O     1 
ATOM   4142 C CB    . VAL D 1 45  ? 0.831   22.748  -71.024 1.00 8.55   ? 230  VAL D CB    1 
ATOM   4143 C CG1   . VAL D 1 45  ? 2.206   22.503  -71.679 1.00 9.45   ? 230  VAL D CG1   1 
ATOM   4144 C CG2   . VAL D 1 45  ? 0.739   24.187  -70.488 1.00 9.07   ? 230  VAL D CG2   1 
ATOM   4145 N N     . ILE D 1 46  ? 0.055   20.839  -73.761 1.00 8.39   ? 231  ILE D N     1 
ATOM   4146 C CA    . ILE D 1 46  ? 0.133   19.518  -74.397 1.00 9.15   ? 231  ILE D CA    1 
ATOM   4147 C C     . ILE D 1 46  ? 1.592   19.108  -74.566 1.00 9.79   ? 231  ILE D C     1 
ATOM   4148 O O     . ILE D 1 46  ? 2.420   19.900  -75.028 1.00 10.37  ? 231  ILE D O     1 
ATOM   4149 C CB    . ILE D 1 46  ? -0.554  19.546  -75.779 1.00 9.19   ? 231  ILE D CB    1 
ATOM   4150 C CG1   . ILE D 1 46  ? -2.018  19.993  -75.648 1.00 10.56  ? 231  ILE D CG1   1 
ATOM   4151 C CG2   . ILE D 1 46  ? -0.394  18.202  -76.515 1.00 11.62  ? 231  ILE D CG2   1 
ATOM   4152 C CD1   . ILE D 1 46  ? -2.952  19.051  -74.927 1.00 11.59  ? 231  ILE D CD1   1 
ATOM   4153 N N     . ALA D 1 47  ? 1.904   17.870  -74.194 1.00 9.69   ? 232  ALA D N     1 
ATOM   4154 C CA    . ALA D 1 47  ? 3.229   17.310  -74.456 1.00 10.54  ? 232  ALA D CA    1 
ATOM   4155 C C     . ALA D 1 47  ? 3.420   17.126  -75.964 1.00 11.35  ? 232  ALA D C     1 
ATOM   4156 O O     . ALA D 1 47  ? 2.561   16.540  -76.629 1.00 12.19  ? 232  ALA D O     1 
ATOM   4157 C CB    . ALA D 1 47  ? 3.374   15.967  -73.729 1.00 10.48  ? 232  ALA D CB    1 
ATOM   4158 N N     . THR D 1 48  ? 4.533   17.624  -76.505 1.00 11.13  ? 233  THR D N     1 
ATOM   4159 C CA    . THR D 1 48  ? 4.834   17.420  -77.934 1.00 12.26  ? 233  THR D CA    1 
ATOM   4160 C C     . THR D 1 48  ? 5.940   16.381  -78.128 1.00 12.45  ? 233  THR D C     1 
ATOM   4161 O O     . THR D 1 48  ? 6.344   16.088  -79.254 1.00 14.57  ? 233  THR D O     1 
ATOM   4162 C CB    . THR D 1 48  ? 5.227   18.735  -78.638 1.00 12.08  ? 233  THR D CB    1 
ATOM   4163 O OG1   . THR D 1 48  ? 6.412   19.265  -78.041 1.00 13.27  ? 233  THR D OG1   1 
ATOM   4164 C CG2   . THR D 1 48  ? 4.106   19.759  -78.526 1.00 12.96  ? 233  THR D CG2   1 
ATOM   4165 N N     . LYS D 1 49  ? 6.422   15.832  -77.016 1.00 12.69  ? 234  LYS D N     1 
ATOM   4166 C CA    . LYS D 1 49  ? 7.379   14.722  -77.023 1.00 13.05  ? 234  LYS D CA    1 
ATOM   4167 C C     . LYS D 1 49  ? 7.029   13.791  -75.880 1.00 13.27  ? 234  LYS D C     1 
ATOM   4168 O O     . LYS D 1 49  ? 6.252   14.154  -74.999 1.00 12.79  ? 234  LYS D O     1 
ATOM   4169 C CB    . LYS D 1 49  ? 8.815   15.233  -76.850 1.00 12.98  ? 234  LYS D CB    1 
ATOM   4170 C CG    . LYS D 1 49  ? 9.147   15.748  -75.446 1.00 12.91  ? 234  LYS D CG    1 
ATOM   4171 C CD    . LYS D 1 49  ? 10.595  16.183  -75.335 1.00 14.08  ? 234  LYS D CD    1 
ATOM   4172 C CE    . LYS D 1 49  ? 10.937  16.605  -73.921 1.00 15.83  ? 234  LYS D CE    1 
ATOM   4173 N NZ    . LYS D 1 49  ? 12.387  16.866  -73.768 1.00 17.21  ? 234  LYS D NZ    1 
ATOM   4174 N N     . GLN D 1 50  ? 7.610   12.596  -75.895 1.00 13.90  ? 235  GLN D N     1 
ATOM   4175 C CA    . GLN D 1 50  ? 7.488   11.689  -74.766 1.00 14.55  ? 235  GLN D CA    1 
ATOM   4176 C C     . GLN D 1 50  ? 8.300   12.206  -73.590 1.00 13.88  ? 235  GLN D C     1 
ATOM   4177 O O     . GLN D 1 50  ? 9.376   12.776  -73.765 1.00 14.30  ? 235  GLN D O     1 
ATOM   4178 C CB    . GLN D 1 50  ? 8.035   10.310  -75.125 1.00 16.14  ? 235  GLN D CB    1 
ATOM   4179 C CG    . GLN D 1 50  ? 7.232   9.546   -76.120 1.00 19.86  ? 235  GLN D CG    1 
ATOM   4180 C CD    . GLN D 1 50  ? 7.802   8.166   -76.343 1.00 24.52  ? 235  GLN D CD    1 
ATOM   4181 O OE1   . GLN D 1 50  ? 7.895   7.358   -75.405 1.00 26.84  ? 235  GLN D OE1   1 
ATOM   4182 N NE2   . GLN D 1 50  ? 8.205   7.883   -77.584 1.00 26.22  ? 235  GLN D NE2   1 
ATOM   4183 N N     . PHE D 1 51  ? 7.786   11.973  -72.389 1.00 13.24  ? 236  PHE D N     1 
ATOM   4184 C CA    . PHE D 1 51  ? 8.558   12.134  -71.152 1.00 12.87  ? 236  PHE D CA    1 
ATOM   4185 C C     . PHE D 1 51  ? 8.538   10.782  -70.453 1.00 13.06  ? 236  PHE D C     1 
ATOM   4186 O O     . PHE D 1 51  ? 7.535   10.082  -70.486 1.00 13.59  ? 236  PHE D O     1 
ATOM   4187 C CB    . PHE D 1 51  ? 7.959   13.197  -70.217 1.00 12.91  ? 236  PHE D CB    1 
ATOM   4188 C CG    . PHE D 1 51  ? 8.055   14.605  -70.736 1.00 12.50  ? 236  PHE D CG    1 
ATOM   4189 C CD1   . PHE D 1 51  ? 9.039   15.467  -70.261 1.00 12.37  ? 236  PHE D CD1   1 
ATOM   4190 C CD2   . PHE D 1 51  ? 7.139   15.083  -71.673 1.00 12.21  ? 236  PHE D CD2   1 
ATOM   4191 C CE1   . PHE D 1 51  ? 9.125   16.785  -70.716 1.00 12.48  ? 236  PHE D CE1   1 
ATOM   4192 C CE2   . PHE D 1 51  ? 7.217   16.406  -72.142 1.00 12.63  ? 236  PHE D CE2   1 
ATOM   4193 C CZ    . PHE D 1 51  ? 8.212   17.253  -71.662 1.00 12.68  ? 236  PHE D CZ    1 
ATOM   4194 N N     . SER D 1 52  ? 9.644   10.425  -69.818 1.00 12.80  ? 237  SER D N     1 
ATOM   4195 C CA    . SER D 1 52  ? 9.691   9.206   -69.033 1.00 12.82  ? 237  SER D CA    1 
ATOM   4196 C C     . SER D 1 52  ? 9.405   9.461   -67.559 1.00 12.12  ? 237  SER D C     1 
ATOM   4197 O O     . SER D 1 52  ? 9.653   10.563  -67.038 1.00 12.29  ? 237  SER D O     1 
ATOM   4198 C CB    . SER D 1 52  ? 11.068  8.556   -69.190 1.00 12.85  ? 237  SER D CB    1 
ATOM   4199 O OG    . SER D 1 52  ? 11.294  8.243   -70.549 1.00 15.27  ? 237  SER D OG    1 
ATOM   4200 N N     . ARG D 1 53  ? 8.915   8.432   -66.875 1.00 12.50  ? 238  ARG D N     1 
ATOM   4201 C CA    . ARG D 1 53  ? 8.666   8.517   -65.450 1.00 12.55  ? 238  ARG D CA    1 
ATOM   4202 C C     . ARG D 1 53  ? 9.903   9.085   -64.751 1.00 12.61  ? 238  ARG D C     1 
ATOM   4203 O O     . ARG D 1 53  ? 11.026  8.613   -64.971 1.00 12.93  ? 238  ARG D O     1 
ATOM   4204 C CB    . ARG D 1 53  ? 8.347   7.125   -64.902 1.00 12.93  ? 238  ARG D CB    1 
ATOM   4205 C CG    . ARG D 1 53  ? 8.055   7.084   -63.417 1.00 15.76  ? 238  ARG D CG    1 
ATOM   4206 C CD    . ARG D 1 53  ? 7.807   5.650   -62.951 1.00 21.54  ? 238  ARG D CD    1 
ATOM   4207 N NE    . ARG D 1 53  ? 6.749   4.983   -63.713 1.00 26.28  ? 238  ARG D NE    1 
ATOM   4208 C CZ    . ARG D 1 53  ? 5.488   4.854   -63.301 1.00 28.97  ? 238  ARG D CZ    1 
ATOM   4209 N NH1   . ARG D 1 53  ? 5.105   5.345   -62.127 1.00 30.11  ? 238  ARG D NH1   1 
ATOM   4210 N NH2   . ARG D 1 53  ? 4.602   4.230   -64.066 1.00 30.35  ? 238  ARG D NH2   1 
ATOM   4211 N N     . GLY D 1 54  ? 9.697   10.111  -63.930 1.00 11.96  ? 239  GLY D N     1 
ATOM   4212 C CA    . GLY D 1 54  ? 10.787  10.694  -63.166 1.00 12.42  ? 239  GLY D CA    1 
ATOM   4213 C C     . GLY D 1 54  ? 11.412  11.896  -63.834 1.00 12.33  ? 239  GLY D C     1 
ATOM   4214 O O     . GLY D 1 54  ? 12.138  12.645  -63.180 1.00 13.50  ? 239  GLY D O     1 
ATOM   4215 N N     . ASP D 1 55  ? 11.136  12.087  -65.127 1.00 12.18  ? 240  ASP D N     1 
ATOM   4216 C CA    . ASP D 1 55  ? 11.708  13.210  -65.875 1.00 12.37  ? 240  ASP D CA    1 
ATOM   4217 C C     . ASP D 1 55  ? 11.186  14.553  -65.382 1.00 11.47  ? 240  ASP D C     1 
ATOM   4218 O O     . ASP D 1 55  ? 10.000  14.699  -65.071 1.00 11.88  ? 240  ASP D O     1 
ATOM   4219 C CB    . ASP D 1 55  ? 11.340  13.133  -67.360 1.00 12.57  ? 240  ASP D CB    1 
ATOM   4220 C CG    . ASP D 1 55  ? 12.165  12.134  -68.142 1.00 14.94  ? 240  ASP D CG    1 
ATOM   4221 O OD1   . ASP D 1 55  ? 13.054  11.471  -67.564 1.00 15.68  ? 240  ASP D OD1   1 
ATOM   4222 O OD2   . ASP D 1 55  ? 11.905  12.042  -69.358 1.00 16.21  ? 240  ASP D OD2   1 
ATOM   4223 N N     . PHE D 1 56  ? 12.073  15.543  -65.344 1.00 11.61  ? 241  PHE D N     1 
ATOM   4224 C CA    . PHE D 1 56  ? 11.663  16.931  -65.183 1.00 10.96  ? 241  PHE D CA    1 
ATOM   4225 C C     . PHE D 1 56  ? 10.764  17.299  -66.356 1.00 11.07  ? 241  PHE D C     1 
ATOM   4226 O O     . PHE D 1 56  ? 11.105  17.034  -67.516 1.00 11.59  ? 241  PHE D O     1 
ATOM   4227 C CB    . PHE D 1 56  ? 12.905  17.825  -65.173 1.00 11.30  ? 241  PHE D CB    1 
ATOM   4228 C CG    . PHE D 1 56  ? 12.600  19.294  -65.039 1.00 11.71  ? 241  PHE D CG    1 
ATOM   4229 C CD1   . PHE D 1 56  ? 12.542  19.901  -63.790 1.00 12.57  ? 241  PHE D CD1   1 
ATOM   4230 C CD2   . PHE D 1 56  ? 12.405  20.081  -66.173 1.00 11.12  ? 241  PHE D CD2   1 
ATOM   4231 C CE1   . PHE D 1 56  ? 12.264  21.277  -63.667 1.00 12.57  ? 241  PHE D CE1   1 
ATOM   4232 C CE2   . PHE D 1 56  ? 12.134  21.449  -66.058 1.00 11.88  ? 241  PHE D CE2   1 
ATOM   4233 C CZ    . PHE D 1 56  ? 12.081  22.042  -64.811 1.00 11.51  ? 241  PHE D CZ    1 
ATOM   4234 N N     . VAL D 1 57  ? 9.620   17.905  -66.054 1.00 10.31  ? 242  VAL D N     1 
ATOM   4235 C CA    . VAL D 1 57  ? 8.727   18.371  -67.109 1.00 9.61   ? 242  VAL D CA    1 
ATOM   4236 C C     . VAL D 1 57  ? 8.852   19.892  -67.251 1.00 9.67   ? 242  VAL D C     1 
ATOM   4237 O O     . VAL D 1 57  ? 9.224   20.392  -68.320 1.00 9.86   ? 242  VAL D O     1 
ATOM   4238 C CB    . VAL D 1 57  ? 7.261   17.927  -66.866 1.00 9.35   ? 242  VAL D CB    1 
ATOM   4239 C CG1   . VAL D 1 57  ? 6.353   18.514  -67.924 1.00 9.60   ? 242  VAL D CG1   1 
ATOM   4240 C CG2   . VAL D 1 57  ? 7.160   16.402  -66.876 1.00 10.07  ? 242  VAL D CG2   1 
ATOM   4241 N N     . VAL D 1 58  ? 8.591   20.619  -66.165 1.00 9.29   ? 243  VAL D N     1 
ATOM   4242 C CA    . VAL D 1 58  ? 8.610   22.082  -66.226 1.00 9.34   ? 243  VAL D CA    1 
ATOM   4243 C C     . VAL D 1 58  ? 8.623   22.655  -64.813 1.00 9.14   ? 243  VAL D C     1 
ATOM   4244 O O     . VAL D 1 58  ? 8.114   22.026  -63.878 1.00 9.36   ? 243  VAL D O     1 
ATOM   4245 C CB    . VAL D 1 58  ? 7.400   22.625  -67.041 1.00 9.37   ? 243  VAL D CB    1 
ATOM   4246 C CG1   . VAL D 1 58  ? 6.095   22.499  -66.244 1.00 10.32  ? 243  VAL D CG1   1 
ATOM   4247 C CG2   . VAL D 1 58  ? 7.644   24.067  -67.503 1.00 10.36  ? 243  VAL D CG2   1 
ATOM   4248 N N     . GLU D 1 59  ? 9.209   23.843  -64.649 1.00 9.22   ? 244  GLU D N     1 
ATOM   4249 C CA    . GLU D 1 59  ? 9.107   24.538  -63.377 1.00 9.31   ? 244  GLU D CA    1 
ATOM   4250 C C     . GLU D 1 59  ? 7.752   25.237  -63.250 1.00 8.76   ? 244  GLU D C     1 
ATOM   4251 O O     . GLU D 1 59  ? 7.203   25.717  -64.242 1.00 8.98   ? 244  GLU D O     1 
ATOM   4252 C CB    . GLU D 1 59  ? 10.247  25.551  -63.215 1.00 9.73   ? 244  GLU D CB    1 
ATOM   4253 C CG    . GLU D 1 59  ? 10.248  26.238  -61.845 1.00 9.45   ? 244  GLU D CG    1 
ATOM   4254 C CD    . GLU D 1 59  ? 11.407  27.176  -61.605 1.00 10.22  ? 244  GLU D CD    1 
ATOM   4255 O OE1   . GLU D 1 59  ? 12.177  27.465  -62.548 1.00 11.59  ? 244  GLU D OE1   1 
ATOM   4256 O OE2   . GLU D 1 59  ? 11.514  27.631  -60.457 1.00 10.71  ? 244  GLU D OE2   1 
ATOM   4257 N N     . TYR D 1 60  ? 7.210   25.289  -62.036 1.00 9.24   ? 245  TYR D N     1 
ATOM   4258 C CA    . TYR D 1 60  ? 6.124   26.228  -61.777 1.00 8.46   ? 245  TYR D CA    1 
ATOM   4259 C C     . TYR D 1 60  ? 6.814   27.566  -61.491 1.00 9.27   ? 245  TYR D C     1 
ATOM   4260 O O     . TYR D 1 60  ? 7.250   27.827  -60.359 1.00 9.32   ? 245  TYR D O     1 
ATOM   4261 C CB    . TYR D 1 60  ? 5.207   25.791  -60.619 1.00 8.39   ? 245  TYR D CB    1 
ATOM   4262 C CG    . TYR D 1 60  ? 3.943   26.620  -60.633 1.00 6.91   ? 245  TYR D CG    1 
ATOM   4263 C CD1   . TYR D 1 60  ? 2.834   26.201  -61.374 1.00 6.57   ? 245  TYR D CD1   1 
ATOM   4264 C CD2   . TYR D 1 60  ? 3.873   27.857  -59.982 1.00 7.72   ? 245  TYR D CD2   1 
ATOM   4265 C CE1   . TYR D 1 60  ? 1.684   26.962  -61.419 1.00 6.82   ? 245  TYR D CE1   1 
ATOM   4266 C CE2   . TYR D 1 60  ? 2.720   28.641  -60.039 1.00 7.30   ? 245  TYR D CE2   1 
ATOM   4267 C CZ    . TYR D 1 60  ? 1.615   28.173  -60.760 1.00 6.52   ? 245  TYR D CZ    1 
ATOM   4268 O OH    . TYR D 1 60  ? 0.471   28.928  -60.845 1.00 7.85   ? 245  TYR D OH    1 
ATOM   4269 N N     . HIS D 1 61  ? 6.920   28.393  -62.531 1.00 9.11   ? 246  HIS D N     1 
ATOM   4270 C CA    . HIS D 1 61  ? 7.764   29.596  -62.505 1.00 9.51   ? 246  HIS D CA    1 
ATOM   4271 C C     . HIS D 1 61  ? 6.916   30.859  -62.413 1.00 9.47   ? 246  HIS D C     1 
ATOM   4272 O O     . HIS D 1 61  ? 5.959   31.024  -63.172 1.00 9.69   ? 246  HIS D O     1 
ATOM   4273 C CB    . HIS D 1 61  ? 8.622   29.647  -63.771 1.00 9.49   ? 246  HIS D CB    1 
ATOM   4274 C CG    . HIS D 1 61  ? 9.738   30.641  -63.703 1.00 10.72  ? 246  HIS D CG    1 
ATOM   4275 N ND1   . HIS D 1 61  ? 9.575   31.970  -64.032 1.00 11.76  ? 246  HIS D ND1   1 
ATOM   4276 C CD2   . HIS D 1 61  ? 11.032  30.496  -63.328 1.00 12.49  ? 246  HIS D CD2   1 
ATOM   4277 C CE1   . HIS D 1 61  ? 10.727  32.601  -63.867 1.00 11.90  ? 246  HIS D CE1   1 
ATOM   4278 N NE2   . HIS D 1 61  ? 11.623  31.732  -63.433 1.00 12.95  ? 246  HIS D NE2   1 
ATOM   4279 N N     . GLY D 1 62  ? 7.296   31.743  -61.491 1.00 9.59   ? 247  GLY D N     1 
ATOM   4280 C CA    . GLY D 1 62  ? 6.611   33.016  -61.264 1.00 10.71  ? 247  GLY D CA    1 
ATOM   4281 C C     . GLY D 1 62  ? 7.373   33.797  -60.202 1.00 11.42  ? 247  GLY D C     1 
ATOM   4282 O O     . GLY D 1 62  ? 8.595   33.615  -60.033 1.00 13.20  ? 247  GLY D O     1 
ATOM   4283 N N     . ASP D 1 63  ? 6.666   34.668  -59.490 1.00 11.93  ? 248  ASP D N     1 
ATOM   4284 C CA    . ASP D 1 63  ? 7.302   35.507  -58.463 1.00 12.82  ? 248  ASP D CA    1 
ATOM   4285 C C     . ASP D 1 63  ? 7.344   34.738  -57.149 1.00 12.62  ? 248  ASP D C     1 
ATOM   4286 O O     . ASP D 1 63  ? 6.293   34.430  -56.590 1.00 12.53  ? 248  ASP D O     1 
ATOM   4287 C CB    . ASP D 1 63  ? 6.494   36.774  -58.227 1.00 14.21  ? 248  ASP D CB    1 
ATOM   4288 C CG    . ASP D 1 63  ? 6.434   37.680  -59.419 1.00 18.12  ? 248  ASP D CG    1 
ATOM   4289 O OD1   . ASP D 1 63  ? 7.312   37.597  -60.298 1.00 21.26  ? 248  ASP D OD1   1 
ATOM   4290 O OD2   . ASP D 1 63  ? 5.494   38.505  -59.456 1.00 23.14  ? 248  ASP D OD2   1 
ATOM   4291 N N     . LEU D 1 64  ? 8.536   34.426  -56.656 1.00 12.35  ? 249  LEU D N     1 
ATOM   4292 C CA    . LEU D 1 64  ? 8.681   33.789  -55.361 1.00 12.58  ? 249  LEU D CA    1 
ATOM   4293 C C     . LEU D 1 64  ? 8.554   34.834  -54.260 1.00 12.53  ? 249  LEU D C     1 
ATOM   4294 O O     . LEU D 1 64  ? 9.363   35.771  -54.187 1.00 12.55  ? 249  LEU D O     1 
ATOM   4295 C CB    . LEU D 1 64  ? 10.014  33.043  -55.262 1.00 13.19  ? 249  LEU D CB    1 
ATOM   4296 C CG    . LEU D 1 64  ? 10.283  32.339  -53.928 1.00 12.37  ? 249  LEU D CG    1 
ATOM   4297 C CD1   . LEU D 1 64  ? 9.305   31.184  -53.707 1.00 12.84  ? 249  LEU D CD1   1 
ATOM   4298 C CD2   . LEU D 1 64  ? 11.719  31.848  -53.843 1.00 13.89  ? 249  LEU D CD2   1 
ATOM   4299 N N     . ILE D 1 65  ? 7.545   34.660  -53.407 1.00 12.16  ? 250  ILE D N     1 
ATOM   4300 C CA    . ILE D 1 65  ? 7.215   35.620  -52.359 1.00 12.17  ? 250  ILE D CA    1 
ATOM   4301 C C     . ILE D 1 65  ? 6.980   34.909  -51.024 1.00 12.44  ? 250  ILE D C     1 
ATOM   4302 O O     . ILE D 1 65  ? 6.746   33.693  -50.986 1.00 11.83  ? 250  ILE D O     1 
ATOM   4303 C CB    . ILE D 1 65  ? 6.005   36.524  -52.753 1.00 12.16  ? 250  ILE D CB    1 
ATOM   4304 C CG1   . ILE D 1 65  ? 4.708   35.701  -52.891 1.00 12.47  ? 250  ILE D CG1   1 
ATOM   4305 C CG2   . ILE D 1 65  ? 6.336   37.348  -54.016 1.00 13.21  ? 250  ILE D CG2   1 
ATOM   4306 C CD1   . ILE D 1 65  ? 3.507   36.493  -53.346 1.00 12.84  ? 250  ILE D CD1   1 
ATOM   4307 N N     . GLU D 1 66  ? 7.090   35.671  -49.939 1.00 12.39  ? 251  GLU D N     1 
ATOM   4308 C CA    . GLU D 1 66  ? 6.832   35.142  -48.604 1.00 13.14  ? 251  GLU D CA    1 
ATOM   4309 C C     . GLU D 1 66  ? 5.392   35.428  -48.192 1.00 13.10  ? 251  GLU D C     1 
ATOM   4310 O O     . GLU D 1 66  ? 4.625   36.018  -48.948 1.00 12.86  ? 251  GLU D O     1 
ATOM   4311 C CB    . GLU D 1 66  ? 7.864   35.623  -47.558 1.00 13.39  ? 251  GLU D CB    1 
ATOM   4312 C CG    . GLU D 1 66  ? 8.067   37.131  -47.440 1.00 17.10  ? 251  GLU D CG    1 
ATOM   4313 C CD    . GLU D 1 66  ? 6.860   37.882  -46.906 1.00 20.71  ? 251  GLU D CD    1 
ATOM   4314 O OE1   . GLU D 1 66  ? 6.463   37.658  -45.726 1.00 23.23  ? 251  GLU D OE1   1 
ATOM   4315 O OE2   . GLU D 1 66  ? 6.317   38.706  -47.669 1.00 21.73  ? 251  GLU D OE2   1 
ATOM   4316 N N     . ILE D 1 67  ? 5.025   35.003  -46.989 1.00 13.38  ? 252  ILE D N     1 
ATOM   4317 C CA    . ILE D 1 67  ? 3.621   34.946  -46.626 1.00 14.07  ? 252  ILE D CA    1 
ATOM   4318 C C     . ILE D 1 67  ? 2.928   36.306  -46.523 1.00 14.26  ? 252  ILE D C     1 
ATOM   4319 O O     . ILE D 1 67  ? 1.767   36.436  -46.895 1.00 14.05  ? 252  ILE D O     1 
ATOM   4320 C CB    . ILE D 1 67  ? 3.387   34.096  -45.348 1.00 14.01  ? 252  ILE D CB    1 
ATOM   4321 C CG1   . ILE D 1 67  ? 1.899   33.762  -45.199 1.00 14.95  ? 252  ILE D CG1   1 
ATOM   4322 C CG2   . ILE D 1 67  ? 3.953   34.800  -44.108 1.00 15.69  ? 252  ILE D CG2   1 
ATOM   4323 C CD1   . ILE D 1 67  ? 1.563   32.882  -44.025 1.00 14.68  ? 252  ILE D CD1   1 
ATOM   4324 N N     . THR D 1 68  ? 3.621   37.315  -46.006 1.00 14.84  ? 253  THR D N     1 
ATOM   4325 C CA    . THR D 1 68  ? 2.951   38.592  -45.803 1.00 15.99  ? 253  THR D CA    1 
ATOM   4326 C C     . THR D 1 68  ? 2.574   39.202  -47.153 1.00 15.59  ? 253  THR D C     1 
ATOM   4327 O O     . THR D 1 68  ? 1.450   39.671  -47.329 1.00 15.90  ? 253  THR D O     1 
ATOM   4328 C CB    . THR D 1 68  ? 3.765   39.575  -44.939 1.00 16.72  ? 253  THR D CB    1 
ATOM   4329 O OG1   . THR D 1 68  ? 4.884   40.054  -45.673 1.00 19.96  ? 253  THR D OG1   1 
ATOM   4330 C CG2   . THR D 1 68  ? 4.253   38.912  -43.661 1.00 16.43  ? 253  THR D CG2   1 
ATOM   4331 N N     . ASP D 1 69  ? 3.499   39.153  -48.111 1.00 15.45  ? 254  ASP D N     1 
ATOM   4332 C CA    . ASP D 1 69  ? 3.202   39.656  -49.444 1.00 15.84  ? 254  ASP D CA    1 
ATOM   4333 C C     . ASP D 1 69  ? 2.144   38.809  -50.139 1.00 14.83  ? 254  ASP D C     1 
ATOM   4334 O O     . ASP D 1 69  ? 1.269   39.344  -50.812 1.00 14.58  ? 254  ASP D O     1 
ATOM   4335 C CB    . ASP D 1 69  ? 4.451   39.741  -50.308 1.00 16.99  ? 254  ASP D CB    1 
ATOM   4336 C CG    . ASP D 1 69  ? 4.248   40.628  -51.520 1.00 20.78  ? 254  ASP D CG    1 
ATOM   4337 O OD1   . ASP D 1 69  ? 3.565   41.673  -51.385 1.00 24.27  ? 254  ASP D OD1   1 
ATOM   4338 O OD2   . ASP D 1 69  ? 4.770   40.285  -52.605 1.00 24.75  ? 254  ASP D OD2   1 
ATOM   4339 N N     . ALA D 1 70  ? 2.204   37.493  -49.954 1.00 14.04  ? 255  ALA D N     1 
ATOM   4340 C CA    . ALA D 1 70  ? 1.179   36.624  -50.561 1.00 14.03  ? 255  ALA D CA    1 
ATOM   4341 C C     . ALA D 1 70  ? -0.229  36.995  -50.091 1.00 14.20  ? 255  ALA D C     1 
ATOM   4342 O O     . ALA D 1 70  ? -1.155  37.100  -50.896 1.00 14.48  ? 255  ALA D O     1 
ATOM   4343 C CB    . ALA D 1 70  ? 1.482   35.168  -50.284 1.00 13.60  ? 255  ALA D CB    1 
ATOM   4344 N N     . LYS D 1 71  ? -0.387  37.216  -48.787 1.00 14.35  ? 256  LYS D N     1 
ATOM   4345 C CA    . LYS D 1 71  ? -1.676  37.590  -48.230 1.00 15.39  ? 256  LYS D CA    1 
ATOM   4346 C C     . LYS D 1 71  ? -2.147  38.929  -48.763 1.00 15.71  ? 256  LYS D C     1 
ATOM   4347 O O     . LYS D 1 71  ? -3.330  39.102  -49.070 1.00 15.46  ? 256  LYS D O     1 
ATOM   4348 C CB    . LYS D 1 71  ? -1.596  37.611  -46.703 1.00 15.80  ? 256  LYS D CB    1 
ATOM   4349 C CG    . LYS D 1 71  ? -1.367  36.218  -46.149 1.00 18.02  ? 256  LYS D CG    1 
ATOM   4350 C CD    . LYS D 1 71  ? -0.955  36.203  -44.693 1.00 21.09  ? 256  LYS D CD    1 
ATOM   4351 C CE    . LYS D 1 71  ? -2.127  35.984  -43.798 1.00 21.60  ? 256  LYS D CE    1 
ATOM   4352 N NZ    . LYS D 1 71  ? -1.645  35.640  -42.441 1.00 19.76  ? 256  LYS D NZ    1 
ATOM   4353 N N     . LYS D 1 72  ? -1.209  39.866  -48.876 1.00 16.34  ? 257  LYS D N     1 
ATOM   4354 C CA    . LYS D 1 72  ? -1.500  41.172  -49.457 1.00 17.57  ? 257  LYS D CA    1 
ATOM   4355 C C     . LYS D 1 72  ? -2.011  41.035  -50.886 1.00 17.16  ? 257  LYS D C     1 
ATOM   4356 O O     . LYS D 1 72  ? -3.047  41.600  -51.249 1.00 17.25  ? 257  LYS D O     1 
ATOM   4357 C CB    . LYS D 1 72  ? -0.255  42.060  -49.422 1.00 18.30  ? 257  LYS D CB    1 
ATOM   4358 C CG    . LYS D 1 72  ? 0.004   42.727  -48.091 1.00 21.94  ? 257  LYS D CG    1 
ATOM   4359 C CD    . LYS D 1 72  ? -1.001  43.840  -47.815 1.00 26.13  ? 257  LYS D CD    1 
ATOM   4360 C CE    . LYS D 1 72  ? -2.212  43.317  -47.053 1.00 28.60  ? 257  LYS D CE    1 
ATOM   4361 N NZ    . LYS D 1 72  ? -3.451  44.014  -47.464 1.00 30.03  ? 257  LYS D NZ    1 
ATOM   4362 N N     . ARG D 1 73  ? -1.276  40.269  -51.686 1.00 17.08  ? 258  ARG D N     1 
ATOM   4363 C CA    . ARG D 1 73  ? -1.640  40.051  -53.089 1.00 16.80  ? 258  ARG D CA    1 
ATOM   4364 C C     . ARG D 1 73  ? -2.978  39.340  -53.245 1.00 16.97  ? 258  ARG D C     1 
ATOM   4365 O O     . ARG D 1 73  ? -3.784  39.716  -54.089 1.00 16.94  ? 258  ARG D O     1 
ATOM   4366 C CB    . ARG D 1 73  ? -0.537  39.280  -53.800 1.00 17.03  ? 258  ARG D CB    1 
ATOM   4367 C CG    . ARG D 1 73  ? 0.730   40.099  -53.979 1.00 16.29  ? 258  ARG D CG    1 
ATOM   4368 C CD    . ARG D 1 73  ? 1.704   39.393  -54.887 1.00 17.11  ? 258  ARG D CD    1 
ATOM   4369 N NE    . ARG D 1 73  ? 3.023   40.028  -54.949 1.00 16.97  ? 258  ARG D NE    1 
ATOM   4370 C CZ    . ARG D 1 73  ? 3.961   39.724  -55.846 1.00 17.84  ? 258  ARG D CZ    1 
ATOM   4371 N NH1   . ARG D 1 73  ? 3.725   38.811  -56.780 1.00 17.98  ? 258  ARG D NH1   1 
ATOM   4372 N NH2   . ARG D 1 73  ? 5.140   40.346  -55.828 1.00 18.97  ? 258  ARG D NH2   1 
ATOM   4373 N N     . GLU D 1 74  ? -3.224  38.325  -52.420 1.00 16.59  ? 259  GLU D N     1 
ATOM   4374 C CA    . GLU D 1 74  ? -4.515  37.633  -52.428 1.00 17.20  ? 259  GLU D CA    1 
ATOM   4375 C C     . GLU D 1 74  ? -5.681  38.588  -52.272 1.00 17.17  ? 259  GLU D C     1 
ATOM   4376 O O     . GLU D 1 74  ? -6.682  38.495  -52.981 1.00 16.96  ? 259  GLU D O     1 
ATOM   4377 C CB    . GLU D 1 74  ? -4.596  36.604  -51.299 1.00 18.20  ? 259  GLU D CB    1 
ATOM   4378 C CG    . GLU D 1 74  ? -3.758  35.371  -51.540 1.00 19.55  ? 259  GLU D CG    1 
ATOM   4379 C CD    . GLU D 1 74  ? -4.369  34.104  -50.987 1.00 22.32  ? 259  GLU D CD    1 
ATOM   4380 O OE1   . GLU D 1 74  ? -5.093  34.157  -49.956 1.00 24.27  ? 259  GLU D OE1   1 
ATOM   4381 O OE2   . GLU D 1 74  ? -4.135  33.040  -51.619 1.00 22.89  ? 259  GLU D OE2   1 
ATOM   4382 N N     . ALA D 1 75  ? -5.557  39.494  -51.304 1.00 16.81  ? 260  ALA D N     1 
ATOM   4383 C CA    . ALA D 1 75  ? -6.638  40.413  -50.994 1.00 17.07  ? 260  ALA D CA    1 
ATOM   4384 C C     . ALA D 1 75  ? -6.852  41.406  -52.135 1.00 16.85  ? 260  ALA D C     1 
ATOM   4385 O O     . ALA D 1 75  ? -7.981  41.811  -52.394 1.00 17.41  ? 260  ALA D O     1 
ATOM   4386 C CB    . ALA D 1 75  ? -6.365  41.127  -49.696 1.00 17.53  ? 260  ALA D CB    1 
ATOM   4387 N N     . LEU D 1 76  ? -5.776  41.776  -52.825 1.00 16.43  ? 261  LEU D N     1 
ATOM   4388 C CA    . LEU D 1 76  ? -5.902  42.589  -54.041 1.00 16.72  ? 261  LEU D CA    1 
ATOM   4389 C C     . LEU D 1 76  ? -6.539  41.825  -55.214 1.00 16.20  ? 261  LEU D C     1 
ATOM   4390 O O     . LEU D 1 76  ? -7.475  42.319  -55.856 1.00 15.94  ? 261  LEU D O     1 
ATOM   4391 C CB    . LEU D 1 76  ? -4.556  43.189  -54.445 1.00 17.64  ? 261  LEU D CB    1 
ATOM   4392 C CG    . LEU D 1 76  ? -3.958  44.193  -53.454 1.00 19.58  ? 261  LEU D CG    1 
ATOM   4393 C CD1   . LEU D 1 76  ? -2.540  44.548  -53.848 1.00 20.76  ? 261  LEU D CD1   1 
ATOM   4394 C CD2   . LEU D 1 76  ? -4.822  45.447  -53.357 1.00 20.93  ? 261  LEU D CD2   1 
ATOM   4395 N N     . TYR D 1 77  ? -6.049  40.611  -55.475 1.00 15.72  ? 262  TYR D N     1 
ATOM   4396 C CA    . TYR D 1 77  ? -6.574  39.808  -56.578 1.00 15.48  ? 262  TYR D CA    1 
ATOM   4397 C C     . TYR D 1 77  ? -8.056  39.507  -56.388 1.00 16.10  ? 262  TYR D C     1 
ATOM   4398 O O     . TYR D 1 77  ? -8.823  39.475  -57.353 1.00 16.39  ? 262  TYR D O     1 
ATOM   4399 C CB    . TYR D 1 77  ? -5.814  38.485  -56.700 1.00 14.24  ? 262  TYR D CB    1 
ATOM   4400 C CG    . TYR D 1 77  ? -4.343  38.608  -57.035 1.00 13.65  ? 262  TYR D CG    1 
ATOM   4401 C CD1   . TYR D 1 77  ? -3.851  39.672  -57.794 1.00 13.75  ? 262  TYR D CD1   1 
ATOM   4402 C CD2   . TYR D 1 77  ? -3.443  37.643  -56.611 1.00 13.15  ? 262  TYR D CD2   1 
ATOM   4403 C CE1   . TYR D 1 77  ? -2.492  39.779  -58.095 1.00 12.98  ? 262  TYR D CE1   1 
ATOM   4404 C CE2   . TYR D 1 77  ? -2.093  37.741  -56.911 1.00 11.77  ? 262  TYR D CE2   1 
ATOM   4405 C CZ    . TYR D 1 77  ? -1.626  38.798  -57.659 1.00 13.08  ? 262  TYR D CZ    1 
ATOM   4406 O OH    . TYR D 1 77  ? -0.279  38.870  -57.939 1.00 14.19  ? 262  TYR D OH    1 
ATOM   4407 N N     . ALA D 1 78  ? -8.453  39.278  -55.136 1.00 16.93  ? 263  ALA D N     1 
ATOM   4408 C CA    . ALA D 1 78  ? -9.838  38.946  -54.813 1.00 18.06  ? 263  ALA D CA    1 
ATOM   4409 C C     . ALA D 1 78  ? -10.832 40.030  -55.237 1.00 18.93  ? 263  ALA D C     1 
ATOM   4410 O O     . ALA D 1 78  ? -12.028 39.753  -55.401 1.00 19.63  ? 263  ALA D O     1 
ATOM   4411 C CB    . ALA D 1 78  ? -9.980  38.638  -53.329 1.00 18.18  ? 263  ALA D CB    1 
ATOM   4412 N N     . GLN D 1 79  ? -10.332 41.249  -55.420 1.00 19.42  ? 264  GLN D N     1 
ATOM   4413 C CA    . GLN D 1 79  ? -11.179 42.369  -55.833 1.00 20.92  ? 264  GLN D CA    1 
ATOM   4414 C C     . GLN D 1 79  ? -11.487 42.366  -57.334 1.00 20.97  ? 264  GLN D C     1 
ATOM   4415 O O     . GLN D 1 79  ? -12.382 43.084  -57.782 1.00 21.28  ? 264  GLN D O     1 
ATOM   4416 C CB    . GLN D 1 79  ? -10.542 43.699  -55.425 1.00 20.82  ? 264  GLN D CB    1 
ATOM   4417 C CG    . GLN D 1 79  ? -10.507 43.923  -53.912 1.00 21.66  ? 264  GLN D CG    1 
ATOM   4418 C CD    . GLN D 1 79  ? -9.652  45.120  -53.504 1.00 22.67  ? 264  GLN D CD    1 
ATOM   4419 O OE1   . GLN D 1 79  ? -9.879  46.244  -53.961 1.00 26.11  ? 264  GLN D OE1   1 
ATOM   4420 N NE2   . GLN D 1 79  ? -8.671  44.884  -52.633 1.00 23.18  ? 264  GLN D NE2   1 
ATOM   4421 N N     . ASP D 1 80  ? -10.758 41.551  -58.096 1.00 21.04  ? 265  ASP D N     1 
ATOM   4422 C CA    . ASP D 1 80  ? -10.888 41.489  -59.559 1.00 21.08  ? 265  ASP D CA    1 
ATOM   4423 C C     . ASP D 1 80  ? -11.049 40.033  -60.032 1.00 21.37  ? 265  ASP D C     1 
ATOM   4424 O O     . ASP D 1 80  ? -10.077 39.277  -60.029 1.00 20.64  ? 265  ASP D O     1 
ATOM   4425 C CB    . ASP D 1 80  ? -9.648  42.113  -60.207 1.00 21.20  ? 265  ASP D CB    1 
ATOM   4426 C CG    . ASP D 1 80  ? -9.702  42.123  -61.731 1.00 21.66  ? 265  ASP D CG    1 
ATOM   4427 O OD1   . ASP D 1 80  ? -10.660 41.586  -62.324 1.00 21.55  ? 265  ASP D OD1   1 
ATOM   4428 O OD2   . ASP D 1 80  ? -8.760  42.685  -62.329 1.00 24.95  ? 265  ASP D OD2   1 
ATOM   4429 N N     . PRO D 1 81  ? -12.263 39.652  -60.481 1.00 21.91  ? 266  PRO D N     1 
ATOM   4430 C CA    . PRO D 1 81  ? -12.572 38.278  -60.925 1.00 22.19  ? 266  PRO D CA    1 
ATOM   4431 C C     . PRO D 1 81  ? -11.783 37.837  -62.157 1.00 22.32  ? 266  PRO D C     1 
ATOM   4432 O O     . PRO D 1 81  ? -11.637 36.633  -62.399 1.00 22.48  ? 266  PRO D O     1 
ATOM   4433 C CB    . PRO D 1 81  ? -14.069 38.343  -61.257 1.00 22.66  ? 266  PRO D CB    1 
ATOM   4434 C CG    . PRO D 1 81  ? -14.334 39.778  -61.542 1.00 22.77  ? 266  PRO D CG    1 
ATOM   4435 C CD    . PRO D 1 81  ? -13.432 40.543  -60.623 1.00 22.42  ? 266  PRO D CD    1 
ATOM   4436 N N     . SER D 1 82  ? -11.251 38.790  -62.914 1.00 22.06  ? 267  SER D N     1 
ATOM   4437 C CA    . SER D 1 82  ? -10.492 38.453  -64.124 1.00 21.84  ? 267  SER D CA    1 
ATOM   4438 C C     . SER D 1 82  ? -9.085  37.928  -63.827 1.00 20.79  ? 267  SER D C     1 
ATOM   4439 O O     . SER D 1 82  ? -8.418  37.370  -64.705 1.00 21.28  ? 267  SER D O     1 
ATOM   4440 C CB    . SER D 1 82  ? -10.438 39.646  -65.080 1.00 22.27  ? 267  SER D CB    1 
ATOM   4441 O OG    . SER D 1 82  ? -9.484  40.604  -64.658 1.00 23.39  ? 267  SER D OG    1 
ATOM   4442 N N     . THR D 1 83  ? -8.645  38.090  -62.582 1.00 18.72  ? 268  THR D N     1 
ATOM   4443 C CA    . THR D 1 83  ? -7.289  37.751  -62.204 1.00 17.06  ? 268  THR D CA    1 
ATOM   4444 C C     . THR D 1 83  ? -6.979  36.260  -62.442 1.00 15.75  ? 268  THR D C     1 
ATOM   4445 O O     . THR D 1 83  ? -5.944  35.907  -63.017 1.00 16.10  ? 268  THR D O     1 
ATOM   4446 C CB    . THR D 1 83  ? -7.034  38.097  -60.723 1.00 17.03  ? 268  THR D CB    1 
ATOM   4447 O OG1   . THR D 1 83  ? -7.457  39.449  -60.465 1.00 19.93  ? 268  THR D OG1   1 
ATOM   4448 C CG2   . THR D 1 83  ? -5.587  37.982  -60.445 1.00 16.49  ? 268  THR D CG2   1 
ATOM   4449 N N     . GLY D 1 84  ? -7.857  35.392  -61.960 1.00 13.90  ? 269  GLY D N     1 
ATOM   4450 C CA    . GLY D 1 84  ? -7.582  33.958  -62.000 1.00 12.39  ? 269  GLY D CA    1 
ATOM   4451 C C     . GLY D 1 84  ? -6.646  33.561  -60.876 1.00 11.03  ? 269  GLY D C     1 
ATOM   4452 O O     . GLY D 1 84  ? -6.119  34.426  -60.147 1.00 10.60  ? 269  GLY D O     1 
ATOM   4453 N N     . CYS D 1 85  ? -6.440  32.250  -60.743 1.00 9.38   ? 270  CYS D N     1 
ATOM   4454 C CA    . CYS D 1 85  ? -5.795  31.656  -59.572 1.00 9.22   ? 270  CYS D CA    1 
ATOM   4455 C C     . CYS D 1 85  ? -4.500  30.959  -59.967 1.00 8.81   ? 270  CYS D C     1 
ATOM   4456 O O     . CYS D 1 85  ? -4.514  29.851  -60.509 1.00 8.68   ? 270  CYS D O     1 
ATOM   4457 C CB    . CYS D 1 85  ? -6.756  30.701  -58.882 1.00 9.50   ? 270  CYS D CB    1 
ATOM   4458 S SG    . CYS D 1 85  ? -8.216  31.539  -58.229 1.00 10.60  ? 270  CYS D SG    1 
ATOM   4459 N N     . TYR D 1 86  ? -3.389  31.642  -59.693 1.00 8.71   ? 271  TYR D N     1 
ATOM   4460 C CA    . TYR D 1 86  ? -2.046  31.208  -60.123 1.00 9.01   ? 271  TYR D CA    1 
ATOM   4461 C C     . TYR D 1 86  ? -1.048  31.153  -58.971 1.00 9.30   ? 271  TYR D C     1 
ATOM   4462 O O     . TYR D 1 86  ? 0.155   30.995  -59.196 1.00 10.26  ? 271  TYR D O     1 
ATOM   4463 C CB    . TYR D 1 86  ? -1.509  32.157  -61.219 1.00 8.94   ? 271  TYR D CB    1 
ATOM   4464 C CG    . TYR D 1 86  ? -2.382  32.182  -62.439 1.00 8.41   ? 271  TYR D CG    1 
ATOM   4465 C CD1   . TYR D 1 86  ? -2.154  31.296  -63.491 1.00 9.32   ? 271  TYR D CD1   1 
ATOM   4466 C CD2   . TYR D 1 86  ? -3.467  33.056  -62.527 1.00 8.17   ? 271  TYR D CD2   1 
ATOM   4467 C CE1   . TYR D 1 86  ? -2.981  31.276  -64.594 1.00 8.60   ? 271  TYR D CE1   1 
ATOM   4468 C CE2   . TYR D 1 86  ? -4.309  33.050  -63.656 1.00 9.40   ? 271  TYR D CE2   1 
ATOM   4469 C CZ    . TYR D 1 86  ? -4.054  32.150  -64.676 1.00 9.70   ? 271  TYR D CZ    1 
ATOM   4470 O OH    . TYR D 1 86  ? -4.900  32.125  -65.766 1.00 10.50  ? 271  TYR D OH    1 
ATOM   4471 N N     . MET D 1 87  ? -1.544  31.266  -57.742 1.00 9.36   ? 272  MET D N     1 
ATOM   4472 C CA    . MET D 1 87  ? -0.671  31.306  -56.565 1.00 9.24   ? 272  MET D CA    1 
ATOM   4473 C C     . MET D 1 87  ? -0.463  29.905  -56.033 1.00 9.05   ? 272  MET D C     1 
ATOM   4474 O O     . MET D 1 87  ? -1.445  29.199  -55.749 1.00 9.54   ? 272  MET D O     1 
ATOM   4475 C CB    . MET D 1 87  ? -1.289  32.199  -55.490 1.00 9.25   ? 272  MET D CB    1 
ATOM   4476 C CG    . MET D 1 87  ? -1.493  33.626  -55.965 1.00 9.56   ? 272  MET D CG    1 
ATOM   4477 S SD    . MET D 1 87  ? -2.085  34.740  -54.680 1.00 11.48  ? 272  MET D SD    1 
ATOM   4478 C CE    . MET D 1 87  ? -0.528  35.109  -53.847 1.00 11.40  ? 272  MET D CE    1 
ATOM   4479 N N     . TYR D 1 88  ? 0.804   29.506  -55.887 1.00 8.92   ? 273  TYR D N     1 
ATOM   4480 C CA    . TYR D 1 88  ? 1.144   28.152  -55.506 1.00 7.84   ? 273  TYR D CA    1 
ATOM   4481 C C     . TYR D 1 88  ? 1.936   28.188  -54.199 1.00 8.22   ? 273  TYR D C     1 
ATOM   4482 O O     . TYR D 1 88  ? 3.124   28.556  -54.178 1.00 8.72   ? 273  TYR D O     1 
ATOM   4483 C CB    . TYR D 1 88  ? 1.968   27.483  -56.620 1.00 7.93   ? 273  TYR D CB    1 
ATOM   4484 C CG    . TYR D 1 88  ? 1.872   25.971  -56.715 1.00 7.76   ? 273  TYR D CG    1 
ATOM   4485 C CD1   . TYR D 1 88  ? 1.729   25.167  -55.580 1.00 8.94   ? 273  TYR D CD1   1 
ATOM   4486 C CD2   . TYR D 1 88  ? 1.906   25.341  -57.957 1.00 7.96   ? 273  TYR D CD2   1 
ATOM   4487 C CE1   . TYR D 1 88  ? 1.638   23.772  -55.695 1.00 7.05   ? 273  TYR D CE1   1 
ATOM   4488 C CE2   . TYR D 1 88  ? 1.820   23.967  -58.073 1.00 7.92   ? 273  TYR D CE2   1 
ATOM   4489 C CZ    . TYR D 1 88  ? 1.677   23.182  -56.951 1.00 7.96   ? 273  TYR D CZ    1 
ATOM   4490 O OH    . TYR D 1 88  ? 1.565   21.807  -57.112 1.00 9.63   ? 273  TYR D OH    1 
ATOM   4491 N N     . TYR D 1 89  ? 1.261   27.779  -53.126 1.00 8.09   ? 274  TYR D N     1 
ATOM   4492 C CA    . TYR D 1 89  ? 1.808   27.828  -51.770 1.00 8.81   ? 274  TYR D CA    1 
ATOM   4493 C C     . TYR D 1 89  ? 2.553   26.564  -51.406 1.00 9.23   ? 274  TYR D C     1 
ATOM   4494 O O     . TYR D 1 89  ? 2.182   25.470  -51.812 1.00 10.11  ? 274  TYR D O     1 
ATOM   4495 C CB    . TYR D 1 89  ? 0.672   28.030  -50.773 1.00 9.26   ? 274  TYR D CB    1 
ATOM   4496 C CG    . TYR D 1 89  ? 0.064   29.390  -50.873 1.00 9.76   ? 274  TYR D CG    1 
ATOM   4497 C CD1   . TYR D 1 89  ? 0.543   30.440  -50.077 1.00 10.02  ? 274  TYR D CD1   1 
ATOM   4498 C CD2   . TYR D 1 89  ? -0.998  29.643  -51.749 1.00 9.89   ? 274  TYR D CD2   1 
ATOM   4499 C CE1   . TYR D 1 89  ? -0.013  31.694  -50.149 1.00 11.56  ? 274  TYR D CE1   1 
ATOM   4500 C CE2   . TYR D 1 89  ? -1.568  30.910  -51.837 1.00 11.23  ? 274  TYR D CE2   1 
ATOM   4501 C CZ    . TYR D 1 89  ? -1.071  31.931  -51.039 1.00 11.46  ? 274  TYR D CZ    1 
ATOM   4502 O OH    . TYR D 1 89  ? -1.646  33.164  -51.138 1.00 14.21  ? 274  TYR D OH    1 
ATOM   4503 N N     . PHE D 1 90  ? 3.600   26.708  -50.600 1.00 9.87   ? 275  PHE D N     1 
ATOM   4504 C CA    . PHE D 1 90  ? 4.350   25.547  -50.128 1.00 10.76  ? 275  PHE D CA    1 
ATOM   4505 C C     . PHE D 1 90  ? 5.097   25.904  -48.856 1.00 11.86  ? 275  PHE D C     1 
ATOM   4506 O O     . PHE D 1 90  ? 5.272   27.083  -48.556 1.00 12.04  ? 275  PHE D O     1 
ATOM   4507 C CB    . PHE D 1 90  ? 5.322   25.036  -51.202 1.00 11.06  ? 275  PHE D CB    1 
ATOM   4508 C CG    . PHE D 1 90  ? 6.414   26.020  -51.587 1.00 10.42  ? 275  PHE D CG    1 
ATOM   4509 C CD1   . PHE D 1 90  ? 7.699   25.872  -51.064 1.00 11.19  ? 275  PHE D CD1   1 
ATOM   4510 C CD2   . PHE D 1 90  ? 6.175   27.056  -52.495 1.00 9.83   ? 275  PHE D CD2   1 
ATOM   4511 C CE1   . PHE D 1 90  ? 8.731   26.744  -51.431 1.00 11.51  ? 275  PHE D CE1   1 
ATOM   4512 C CE2   . PHE D 1 90  ? 7.202   27.943  -52.862 1.00 9.54   ? 275  PHE D CE2   1 
ATOM   4513 C CZ    . PHE D 1 90  ? 8.483   27.780  -52.321 1.00 11.25  ? 275  PHE D CZ    1 
ATOM   4514 N N     . GLN D 1 91  ? 5.509   24.887  -48.104 1.00 12.81  ? 276  GLN D N     1 
ATOM   4515 C CA    . GLN D 1 91  ? 6.325   25.131  -46.916 1.00 14.51  ? 276  GLN D CA    1 
ATOM   4516 C C     . GLN D 1 91  ? 7.789   24.790  -47.213 1.00 14.57  ? 276  GLN D C     1 
ATOM   4517 O O     . GLN D 1 91  ? 8.107   23.815  -47.917 1.00 14.69  ? 276  GLN D O     1 
ATOM   4518 C CB    . GLN D 1 91  ? 5.814   24.368  -45.682 1.00 15.67  ? 276  GLN D CB    1 
ATOM   4519 C CG    . GLN D 1 91  ? 4.279   24.400  -45.377 1.00 17.39  ? 276  GLN D CG    1 
ATOM   4520 C CD    . GLN D 1 91  ? 3.577   25.779  -45.431 1.00 19.37  ? 276  GLN D CD    1 
ATOM   4521 O OE1   . GLN D 1 91  ? 3.879   26.677  -44.635 1.00 24.54  ? 276  GLN D OE1   1 
ATOM   4522 N NE2   . GLN D 1 91  ? 2.680   25.949  -46.357 1.00 22.09  ? 276  GLN D NE2   1 
ATOM   4523 N N     . TYR D 1 92  ? 8.681   25.633  -46.699 1.00 14.69  ? 277  TYR D N     1 
ATOM   4524 C CA    . TYR D 1 92  ? 10.112  25.462  -46.922 1.00 15.17  ? 277  TYR D CA    1 
ATOM   4525 C C     . TYR D 1 92  ? 10.827  26.010  -45.704 1.00 15.16  ? 277  TYR D C     1 
ATOM   4526 O O     . TYR D 1 92  ? 10.621  27.163  -45.323 1.00 13.96  ? 277  TYR D O     1 
ATOM   4527 C CB    . TYR D 1 92  ? 10.562  26.190  -48.188 1.00 15.74  ? 277  TYR D CB    1 
ATOM   4528 C CG    . TYR D 1 92  ? 12.059  26.189  -48.436 1.00 16.97  ? 277  TYR D CG    1 
ATOM   4529 C CD1   . TYR D 1 92  ? 12.740  25.018  -48.784 1.00 16.43  ? 277  TYR D CD1   1 
ATOM   4530 C CD2   . TYR D 1 92  ? 12.785  27.377  -48.363 1.00 16.53  ? 277  TYR D CD2   1 
ATOM   4531 C CE1   . TYR D 1 92  ? 14.126  25.029  -49.026 1.00 18.00  ? 277  TYR D CE1   1 
ATOM   4532 C CE2   . TYR D 1 92  ? 14.154  27.401  -48.607 1.00 17.85  ? 277  TYR D CE2   1 
ATOM   4533 C CZ    . TYR D 1 92  ? 14.817  26.226  -48.937 1.00 17.83  ? 277  TYR D CZ    1 
ATOM   4534 O OH    . TYR D 1 92  ? 16.181  26.266  -49.181 1.00 20.21  ? 277  TYR D OH    1 
ATOM   4535 N N     . LEU D 1 93  ? 11.631  25.152  -45.079 1.00 15.94  ? 278  LEU D N     1 
ATOM   4536 C CA    . LEU D 1 93  ? 12.372  25.511  -43.860 1.00 17.18  ? 278  LEU D CA    1 
ATOM   4537 C C     . LEU D 1 93  ? 11.493  26.213  -42.802 1.00 16.71  ? 278  LEU D C     1 
ATOM   4538 O O     . LEU D 1 93  ? 11.828  27.278  -42.285 1.00 17.02  ? 278  LEU D O     1 
ATOM   4539 C CB    . LEU D 1 93  ? 13.657  26.289  -44.190 1.00 17.84  ? 278  LEU D CB    1 
ATOM   4540 C CG    . LEU D 1 93  ? 14.658  25.680  -45.184 1.00 19.88  ? 278  LEU D CG    1 
ATOM   4541 C CD1   . LEU D 1 93  ? 15.800  26.657  -45.395 1.00 22.42  ? 278  LEU D CD1   1 
ATOM   4542 C CD2   . LEU D 1 93  ? 15.198  24.332  -44.724 1.00 21.96  ? 278  LEU D CD2   1 
ATOM   4543 N N     . SER D 1 94  ? 10.338  25.601  -42.526 1.00 16.39  ? 279  SER D N     1 
ATOM   4544 C CA    . SER D 1 94  ? 9.399   26.064  -41.492 1.00 15.98  ? 279  SER D CA    1 
ATOM   4545 C C     . SER D 1 94  ? 8.715   27.394  -41.762 1.00 15.29  ? 279  SER D C     1 
ATOM   4546 O O     . SER D 1 94  ? 8.172   28.004  -40.839 1.00 15.49  ? 279  SER D O     1 
ATOM   4547 C CB    . SER D 1 94  ? 10.045  26.077  -40.093 1.00 16.89  ? 279  SER D CB    1 
ATOM   4548 O OG    . SER D 1 94  ? 10.556  24.804  -39.789 1.00 19.94  ? 279  SER D OG    1 
ATOM   4549 N N     . LYS D 1 95  ? 8.707   27.832  -43.024 1.00 14.13  ? 280  LYS D N     1 
ATOM   4550 C CA    . LYS D 1 95  ? 8.018   29.064  -43.396 1.00 14.30  ? 280  LYS D CA    1 
ATOM   4551 C C     . LYS D 1 95  ? 7.176   28.813  -44.634 1.00 12.85  ? 280  LYS D C     1 
ATOM   4552 O O     . LYS D 1 95  ? 7.458   27.895  -45.403 1.00 12.82  ? 280  LYS D O     1 
ATOM   4553 C CB    . LYS D 1 95  ? 9.003   30.183  -43.719 1.00 14.81  ? 280  LYS D CB    1 
ATOM   4554 C CG    . LYS D 1 95  ? 9.705   30.822  -42.535 1.00 16.08  ? 280  LYS D CG    1 
ATOM   4555 C CD    . LYS D 1 95  ? 10.604  31.980  -43.015 1.00 17.68  ? 280  LYS D CD    1 
ATOM   4556 C CE    . LYS D 1 95  ? 9.806   33.199  -43.494 1.00 21.47  ? 280  LYS D CE    1 
ATOM   4557 N NZ    . LYS D 1 95  ? 9.022   33.856  -42.396 1.00 23.37  ? 280  LYS D NZ    1 
ATOM   4558 N N     . THR D 1 96  ? 6.159   29.649  -44.826 1.00 11.82  ? 281  THR D N     1 
ATOM   4559 C CA    . THR D 1 96  ? 5.293   29.526  -45.999 1.00 11.31  ? 281  THR D CA    1 
ATOM   4560 C C     . THR D 1 96  ? 5.799   30.425  -47.113 1.00 11.14  ? 281  THR D C     1 
ATOM   4561 O O     . THR D 1 96  ? 6.026   31.613  -46.912 1.00 12.15  ? 281  THR D O     1 
ATOM   4562 C CB    . THR D 1 96  ? 3.859   29.929  -45.663 1.00 11.10  ? 281  THR D CB    1 
ATOM   4563 O OG1   . THR D 1 96  ? 3.371   29.111  -44.602 1.00 11.39  ? 281  THR D OG1   1 
ATOM   4564 C CG2   . THR D 1 96  ? 2.946   29.768  -46.869 1.00 12.93  ? 281  THR D CG2   1 
ATOM   4565 N N     . TYR D 1 97  ? 5.963   29.843  -48.298 1.00 10.50  ? 282  TYR D N     1 
ATOM   4566 C CA    . TYR D 1 97  ? 6.276   30.619  -49.487 1.00 11.09  ? 282  TYR D CA    1 
ATOM   4567 C C     . TYR D 1 97  ? 5.206   30.432  -50.545 1.00 10.32  ? 282  TYR D C     1 
ATOM   4568 O O     . TYR D 1 97  ? 4.322   29.574  -50.424 1.00 10.16  ? 282  TYR D O     1 
ATOM   4569 C CB    . TYR D 1 97  ? 7.660   30.239  -50.037 1.00 12.77  ? 282  TYR D CB    1 
ATOM   4570 C CG    . TYR D 1 97  ? 8.764   30.606  -49.074 1.00 13.49  ? 282  TYR D CG    1 
ATOM   4571 C CD1   . TYR D 1 97  ? 9.294   31.895  -49.040 1.00 16.60  ? 282  TYR D CD1   1 
ATOM   4572 C CD2   . TYR D 1 97  ? 9.246   29.673  -48.171 1.00 13.73  ? 282  TYR D CD2   1 
ATOM   4573 C CE1   . TYR D 1 97  ? 10.292  32.230  -48.128 1.00 18.18  ? 282  TYR D CE1   1 
ATOM   4574 C CE2   . TYR D 1 97  ? 10.246  29.986  -47.272 1.00 16.11  ? 282  TYR D CE2   1 
ATOM   4575 C CZ    . TYR D 1 97  ? 10.759  31.261  -47.248 1.00 16.84  ? 282  TYR D CZ    1 
ATOM   4576 O OH    . TYR D 1 97  ? 11.751  31.551  -46.332 1.00 19.52  ? 282  TYR D OH    1 
ATOM   4577 N N     . CYS D 1 98  ? 5.301   31.237  -51.593 1.00 9.81   ? 283  CYS D N     1 
ATOM   4578 C CA    . CYS D 1 98  ? 4.322   31.170  -52.649 1.00 9.48   ? 283  CYS D CA    1 
ATOM   4579 C C     . CYS D 1 98  ? 4.984   31.523  -53.960 1.00 9.07   ? 283  CYS D C     1 
ATOM   4580 O O     . CYS D 1 98  ? 5.711   32.521  -54.037 1.00 9.83   ? 283  CYS D O     1 
ATOM   4581 C CB    . CYS D 1 98  ? 3.196   32.150  -52.361 1.00 9.76   ? 283  CYS D CB    1 
ATOM   4582 S SG    . CYS D 1 98  ? 1.902   32.168  -53.648 1.00 10.73  ? 283  CYS D SG    1 
ATOM   4583 N N     . VAL D 1 99  ? 4.768   30.699  -54.983 1.00 8.61   ? 284  VAL D N     1 
ATOM   4584 C CA    . VAL D 1 99  ? 5.142   31.102  -56.327 1.00 8.81   ? 284  VAL D CA    1 
ATOM   4585 C C     . VAL D 1 99  ? 3.906   31.746  -56.928 1.00 8.92   ? 284  VAL D C     1 
ATOM   4586 O O     . VAL D 1 99  ? 2.920   31.069  -57.257 1.00 9.53   ? 284  VAL D O     1 
ATOM   4587 C CB    . VAL D 1 99  ? 5.630   29.937  -57.221 1.00 8.77   ? 284  VAL D CB    1 
ATOM   4588 C CG1   . VAL D 1 99  ? 6.014   30.486  -58.613 1.00 9.74   ? 284  VAL D CG1   1 
ATOM   4589 C CG2   . VAL D 1 99  ? 6.820   29.212  -56.592 1.00 10.47  ? 284  VAL D CG2   1 
ATOM   4590 N N     . ASP D 1 100 ? 3.931   33.068  -57.013 1.00 9.73   ? 285  ASP D N     1 
ATOM   4591 C CA    . ASP D 1 100 ? 2.790   33.797  -57.533 1.00 9.44   ? 285  ASP D CA    1 
ATOM   4592 C C     . ASP D 1 100 ? 2.968   33.989  -59.040 1.00 10.12  ? 285  ASP D C     1 
ATOM   4593 O O     . ASP D 1 100 ? 3.720   34.865  -59.468 1.00 10.28  ? 285  ASP D O     1 
ATOM   4594 C CB    . ASP D 1 100 ? 2.628   35.136  -56.810 1.00 10.00  ? 285  ASP D CB    1 
ATOM   4595 C CG    . ASP D 1 100 ? 1.487   35.958  -57.366 1.00 11.06  ? 285  ASP D CG    1 
ATOM   4596 O OD1   . ASP D 1 100 ? 0.710   35.425  -58.194 1.00 11.64  ? 285  ASP D OD1   1 
ATOM   4597 O OD2   . ASP D 1 100 ? 1.364   37.139  -56.993 1.00 13.04  ? 285  ASP D OD2   1 
ATOM   4598 N N     . ALA D 1 101 ? 2.303   33.139  -59.834 1.00 9.84   ? 286  ALA D N     1 
ATOM   4599 C CA    . ALA D 1 101 ? 2.391   33.240  -61.295 1.00 9.57   ? 286  ALA D CA    1 
ATOM   4600 C C     . ALA D 1 101 ? 1.195   33.975  -61.907 1.00 9.56   ? 286  ALA D C     1 
ATOM   4601 O O     . ALA D 1 101 ? 0.810   33.719  -63.049 1.00 9.60   ? 286  ALA D O     1 
ATOM   4602 C CB    . ALA D 1 101 ? 2.607   31.856  -61.949 1.00 9.13   ? 286  ALA D CB    1 
ATOM   4603 N N     . THR D 1 102 ? 0.634   34.934  -61.173 1.00 10.05  ? 287  THR D N     1 
ATOM   4604 C CA    . THR D 1 102 ? -0.544  35.650  -61.671 1.00 10.55  ? 287  THR D CA    1 
ATOM   4605 C C     . THR D 1 102 ? -0.256  36.474  -62.927 1.00 10.73  ? 287  THR D C     1 
ATOM   4606 O O     . THR D 1 102 ? -1.056  36.490  -63.854 1.00 11.21  ? 287  THR D O     1 
ATOM   4607 C CB    . THR D 1 102 ? -1.168  36.528  -60.562 1.00 10.34  ? 287  THR D CB    1 
ATOM   4608 O OG1   . THR D 1 102 ? -1.499  35.680  -59.463 1.00 11.42  ? 287  THR D OG1   1 
ATOM   4609 C CG2   . THR D 1 102 ? -2.417  37.250  -61.057 1.00 11.16  ? 287  THR D CG2   1 
ATOM   4610 N N     . ARG D 1 103 ? 0.880   37.164  -62.938 1.00 11.24  ? 288  ARG D N     1 
ATOM   4611 C CA    . ARG D 1 103 ? 1.289   37.954  -64.096 1.00 12.16  ? 288  ARG D CA    1 
ATOM   4612 C C     . ARG D 1 103 ? 1.466   37.073  -65.325 1.00 11.68  ? 288  ARG D C     1 
ATOM   4613 O O     . ARG D 1 103 ? 2.141   36.039  -65.280 1.00 11.09  ? 288  ARG D O     1 
ATOM   4614 C CB    . ARG D 1 103 ? 2.587   38.708  -63.811 1.00 13.23  ? 288  ARG D CB    1 
ATOM   4615 C CG    . ARG D 1 103 ? 3.009   39.649  -64.937 1.00 15.92  ? 288  ARG D CG    1 
ATOM   4616 C CD    . ARG D 1 103 ? 4.200   40.501  -64.547 1.00 19.63  ? 288  ARG D CD    1 
ATOM   4617 N NE    . ARG D 1 103 ? 5.408   39.707  -64.320 1.00 22.46  ? 288  ARG D NE    1 
ATOM   4618 C CZ    . ARG D 1 103 ? 6.253   39.328  -65.276 1.00 23.62  ? 288  ARG D CZ    1 
ATOM   4619 N NH1   . ARG D 1 103 ? 6.027   39.662  -66.541 1.00 24.80  ? 288  ARG D NH1   1 
ATOM   4620 N NH2   . ARG D 1 103 ? 7.326   38.613  -64.967 1.00 25.10  ? 288  ARG D NH2   1 
ATOM   4621 N N     . GLU D 1 104 ? 0.903   37.535  -66.440 1.00 11.40  ? 289  GLU D N     1 
ATOM   4622 C CA    . GLU D 1 104 ? 1.038   36.823  -67.696 1.00 11.34  ? 289  GLU D CA    1 
ATOM   4623 C C     . GLU D 1 104 ? 2.476   36.869  -68.157 1.00 11.46  ? 289  GLU D C     1 
ATOM   4624 O O     . GLU D 1 104 ? 3.100   37.940  -68.174 1.00 13.05  ? 289  GLU D O     1 
ATOM   4625 C CB    . GLU D 1 104 ? 0.123   37.426  -68.752 1.00 11.45  ? 289  GLU D CB    1 
ATOM   4626 C CG    . GLU D 1 104 ? -1.313  37.051  -68.544 1.00 11.53  ? 289  GLU D CG    1 
ATOM   4627 C CD    . GLU D 1 104 ? -1.574  35.616  -68.954 1.00 11.20  ? 289  GLU D CD    1 
ATOM   4628 O OE1   . GLU D 1 104 ? -1.218  35.228  -70.092 1.00 11.73  ? 289  GLU D OE1   1 
ATOM   4629 O OE2   . GLU D 1 104 ? -2.123  34.870  -68.128 1.00 10.34  ? 289  GLU D OE2   1 
ATOM   4630 N N     . THR D 1 105 ? 2.998   35.702  -68.507 1.00 10.98  ? 290  THR D N     1 
ATOM   4631 C CA    . THR D 1 105 ? 4.337   35.544  -69.068 1.00 10.62  ? 290  THR D CA    1 
ATOM   4632 C C     . THR D 1 105 ? 4.225   34.472  -70.150 1.00 10.92  ? 290  THR D C     1 
ATOM   4633 O O     . THR D 1 105 ? 3.121   34.010  -70.434 1.00 10.72  ? 290  THR D O     1 
ATOM   4634 C CB    . THR D 1 105 ? 5.338   35.053  -68.017 1.00 10.48  ? 290  THR D CB    1 
ATOM   4635 O OG1   . THR D 1 105 ? 4.991   33.699  -67.649 1.00 10.57  ? 290  THR D OG1   1 
ATOM   4636 C CG2   . THR D 1 105 ? 5.346   35.978  -66.769 1.00 10.62  ? 290  THR D CG2   1 
ATOM   4637 N N     . ASN D 1 106 ? 5.359   34.077  -70.729 1.00 10.78  ? 291  ASN D N     1 
ATOM   4638 C CA    . ASN D 1 106 ? 5.391   32.983  -71.696 1.00 10.91  ? 291  ASN D CA    1 
ATOM   4639 C C     . ASN D 1 106 ? 5.665   31.619  -71.066 1.00 10.62  ? 291  ASN D C     1 
ATOM   4640 O O     . ASN D 1 106 ? 5.852   30.634  -71.789 1.00 10.86  ? 291  ASN D O     1 
ATOM   4641 C CB    . ASN D 1 106 ? 6.394   33.269  -72.826 1.00 12.16  ? 291  ASN D CB    1 
ATOM   4642 C CG    A ASN D 1 106 ? 7.849   33.230  -72.359 0.50 13.64  ? 291  ASN D CG    1 
ATOM   4643 C CG    B ASN D 1 106 ? 6.203   34.633  -73.416 0.50 11.18  ? 291  ASN D CG    1 
ATOM   4644 O OD1   A ASN D 1 106 ? 8.145   32.935  -71.201 0.50 15.53  ? 291  ASN D OD1   1 
ATOM   4645 O OD1   B ASN D 1 106 ? 5.083   35.140  -73.481 0.50 12.04  ? 291  ASN D OD1   1 
ATOM   4646 N ND2   A ASN D 1 106 ? 8.769   33.539  -73.273 0.50 15.96  ? 291  ASN D ND2   1 
ATOM   4647 N ND2   B ASN D 1 106 ? 7.295   35.245  -73.844 0.50 13.20  ? 291  ASN D ND2   1 
ATOM   4648 N N     . ARG D 1 107 ? 5.706   31.567  -69.735 1.00 10.00  ? 292  ARG D N     1 
ATOM   4649 C CA    . ARG D 1 107 ? 6.040   30.330  -69.032 1.00 9.92   ? 292  ARG D CA    1 
ATOM   4650 C C     . ARG D 1 107 ? 4.856   29.382  -68.972 1.00 9.23   ? 292  ARG D C     1 
ATOM   4651 O O     . ARG D 1 107 ? 3.701   29.823  -68.872 1.00 9.17   ? 292  ARG D O     1 
ATOM   4652 C CB    . ARG D 1 107 ? 6.521   30.648  -67.620 1.00 9.78   ? 292  ARG D CB    1 
ATOM   4653 C CG    . ARG D 1 107 ? 7.856   31.392  -67.561 1.00 11.73  ? 292  ARG D CG    1 
ATOM   4654 C CD    . ARG D 1 107 ? 8.964   30.621  -68.250 1.00 14.42  ? 292  ARG D CD    1 
ATOM   4655 N NE    . ARG D 1 107 ? 10.274  31.116  -67.841 1.00 15.23  ? 292  ARG D NE    1 
ATOM   4656 C CZ    . ARG D 1 107 ? 11.150  30.415  -67.126 1.00 13.03  ? 292  ARG D CZ    1 
ATOM   4657 N NH1   . ARG D 1 107 ? 10.888  29.152  -66.759 1.00 11.88  ? 292  ARG D NH1   1 
ATOM   4658 N NH2   . ARG D 1 107 ? 12.298  30.977  -66.786 1.00 13.26  ? 292  ARG D NH2   1 
ATOM   4659 N N     . LEU D 1 108 ? 5.144   28.082  -69.041 1.00 8.82   ? 293  LEU D N     1 
ATOM   4660 C CA    . LEU D 1 108 ? 4.086   27.100  -69.235 1.00 8.37   ? 293  LEU D CA    1 
ATOM   4661 C C     . LEU D 1 108 ? 3.571   26.434  -67.981 1.00 7.29   ? 293  LEU D C     1 
ATOM   4662 O O     . LEU D 1 108 ? 2.446   25.936  -67.976 1.00 7.82   ? 293  LEU D O     1 
ATOM   4663 C CB    . LEU D 1 108 ? 4.520   26.028  -70.243 1.00 8.85   ? 293  LEU D CB    1 
ATOM   4664 C CG    . LEU D 1 108 ? 4.795   26.626  -71.631 1.00 10.04  ? 293  LEU D CG    1 
ATOM   4665 C CD1   . LEU D 1 108 ? 5.316   25.546  -72.564 1.00 11.25  ? 293  LEU D CD1   1 
ATOM   4666 C CD2   . LEU D 1 108 ? 3.542   27.271  -72.211 1.00 11.68  ? 293  LEU D CD2   1 
ATOM   4667 N N     . GLY D 1 109 ? 4.388   26.385  -66.932 1.00 7.47   ? 294  GLY D N     1 
ATOM   4668 C CA    . GLY D 1 109 ? 3.957   25.699  -65.709 1.00 7.14   ? 294  GLY D CA    1 
ATOM   4669 C C     . GLY D 1 109 ? 2.643   26.257  -65.179 1.00 6.78   ? 294  GLY D C     1 
ATOM   4670 O O     . GLY D 1 109 ? 1.747   25.505  -64.733 1.00 7.05   ? 294  GLY D O     1 
ATOM   4671 N N     . ARG D 1 110 ? 2.538   27.588  -65.202 1.00 6.84   ? 295  ARG D N     1 
ATOM   4672 C CA    . ARG D 1 110 ? 1.351   28.301  -64.731 1.00 7.35   ? 295  ARG D CA    1 
ATOM   4673 C C     . ARG D 1 110 ? 0.092   27.982  -65.550 1.00 7.45   ? 295  ARG D C     1 
ATOM   4674 O O     . ARG D 1 110 ? -1.032  28.243  -65.089 1.00 8.85   ? 295  ARG D O     1 
ATOM   4675 C CB    . ARG D 1 110 ? 1.627   29.809  -64.755 1.00 7.37   ? 295  ARG D CB    1 
ATOM   4676 C CG    . ARG D 1 110 ? 1.872   30.352  -66.167 1.00 8.24   ? 295  ARG D CG    1 
ATOM   4677 C CD    . ARG D 1 110 ? 2.338   31.827  -66.138 1.00 8.90   ? 295  ARG D CD    1 
ATOM   4678 N NE    . ARG D 1 110 ? 1.312   32.734  -65.611 1.00 8.82   ? 295  ARG D NE    1 
ATOM   4679 C CZ    . ARG D 1 110 ? 0.310   33.245  -66.323 1.00 9.41   ? 295  ARG D CZ    1 
ATOM   4680 N NH1   . ARG D 1 110 ? 0.208   32.999  -67.624 1.00 9.79   ? 295  ARG D NH1   1 
ATOM   4681 N NH2   . ARG D 1 110 ? -0.578  34.041  -65.741 1.00 9.21   ? 295  ARG D NH2   1 
ATOM   4682 N N     . LEU D 1 111 ? 0.280   27.423  -66.760 1.00 7.37   ? 296  LEU D N     1 
ATOM   4683 C CA    . LEU D 1 111 ? -0.841  27.102  -67.643 1.00 6.92   ? 296  LEU D CA    1 
ATOM   4684 C C     . LEU D 1 111 ? -1.323  25.659  -67.544 1.00 6.91   ? 296  LEU D C     1 
ATOM   4685 O O     . LEU D 1 111 ? -2.316  25.299  -68.186 1.00 7.45   ? 296  LEU D O     1 
ATOM   4686 C CB    . LEU D 1 111 ? -0.511  27.440  -69.102 1.00 8.03   ? 296  LEU D CB    1 
ATOM   4687 C CG    . LEU D 1 111 ? -0.187  28.893  -69.373 1.00 7.47   ? 296  LEU D CG    1 
ATOM   4688 C CD1   . LEU D 1 111 ? 0.014   29.069  -70.866 1.00 9.32   ? 296  LEU D CD1   1 
ATOM   4689 C CD2   . LEU D 1 111 ? -1.305  29.793  -68.838 1.00 8.50   ? 296  LEU D CD2   1 
ATOM   4690 N N     . ILE D 1 112 ? -0.644  24.839  -66.737 1.00 6.97   ? 297  ILE D N     1 
ATOM   4691 C CA    . ILE D 1 112 ? -1.006  23.428  -66.649 1.00 6.75   ? 297  ILE D CA    1 
ATOM   4692 C C     . ILE D 1 112 ? -2.239  23.252  -65.765 1.00 6.73   ? 297  ILE D C     1 
ATOM   4693 O O     . ILE D 1 112 ? -2.336  23.820  -64.669 1.00 6.76   ? 297  ILE D O     1 
ATOM   4694 C CB    . ILE D 1 112 ? 0.170   22.578  -66.155 1.00 7.21   ? 297  ILE D CB    1 
ATOM   4695 C CG1   . ILE D 1 112 ? 1.243   22.553  -67.247 1.00 7.41   ? 297  ILE D CG1   1 
ATOM   4696 C CG2   . ILE D 1 112 ? -0.277  21.146  -65.826 1.00 7.66   ? 297  ILE D CG2   1 
ATOM   4697 C CD1   . ILE D 1 112 ? 2.552   21.966  -66.869 1.00 7.72   ? 297  ILE D CD1   1 
ATOM   4698 N N     . ASN D 1 113 ? -3.175  22.454  -66.264 1.00 6.80   ? 298  ASN D N     1 
ATOM   4699 C CA    . ASN D 1 113 ? -4.446  22.244  -65.587 1.00 6.26   ? 298  ASN D CA    1 
ATOM   4700 C C     . ASN D 1 113 ? -4.424  21.127  -64.527 1.00 6.73   ? 298  ASN D C     1 
ATOM   4701 O O     . ASN D 1 113 ? -3.425  20.426  -64.378 1.00 7.36   ? 298  ASN D O     1 
ATOM   4702 C CB    . ASN D 1 113 ? -5.570  22.088  -66.634 1.00 7.09   ? 298  ASN D CB    1 
ATOM   4703 C CG    . ASN D 1 113 ? -5.824  23.381  -67.371 1.00 7.20   ? 298  ASN D CG    1 
ATOM   4704 O OD1   . ASN D 1 113 ? -5.912  24.448  -66.744 1.00 7.74   ? 298  ASN D OD1   1 
ATOM   4705 N ND2   . ASN D 1 113 ? -5.901  23.316  -68.710 1.00 8.15   ? 298  ASN D ND2   1 
ATOM   4706 N N     . HIS D 1 114 ? -5.521  21.027  -63.784 1.00 6.89   ? 299  HIS D N     1 
ATOM   4707 C CA    . HIS D 1 114 ? -5.637  20.153  -62.628 1.00 6.84   ? 299  HIS D CA    1 
ATOM   4708 C C     . HIS D 1 114 ? -6.236  18.810  -62.973 1.00 8.05   ? 299  HIS D C     1 
ATOM   4709 O O     . HIS D 1 114 ? -7.206  18.736  -63.718 1.00 8.16   ? 299  HIS D O     1 
ATOM   4710 C CB    . HIS D 1 114 ? -6.554  20.812  -61.577 1.00 7.09   ? 299  HIS D CB    1 
ATOM   4711 C CG    . HIS D 1 114 ? -7.020  19.860  -60.523 1.00 7.36   ? 299  HIS D CG    1 
ATOM   4712 N ND1   . HIS D 1 114 ? -6.269  19.541  -59.409 1.00 8.25   ? 299  HIS D ND1   1 
ATOM   4713 C CD2   . HIS D 1 114 ? -8.163  19.139  -60.430 1.00 7.82   ? 299  HIS D CD2   1 
ATOM   4714 C CE1   . HIS D 1 114 ? -6.927  18.654  -58.681 1.00 8.11   ? 299  HIS D CE1   1 
ATOM   4715 N NE2   . HIS D 1 114 ? -8.083  18.402  -59.272 1.00 8.75   ? 299  HIS D NE2   1 
ATOM   4716 N N     . SER D 1 115 ? -5.703  17.765  -62.355 1.00 8.47   ? 300  SER D N     1 
ATOM   4717 C CA    . SER D 1 115 ? -6.369  16.463  -62.308 1.00 10.32  ? 300  SER D CA    1 
ATOM   4718 C C     . SER D 1 115 ? -5.820  15.749  -61.096 1.00 11.37  ? 300  SER D C     1 
ATOM   4719 O O     . SER D 1 115 ? -4.610  15.752  -60.895 1.00 12.35  ? 300  SER D O     1 
ATOM   4720 C CB    . SER D 1 115 ? -6.033  15.662  -63.560 1.00 11.35  ? 300  SER D CB    1 
ATOM   4721 O OG    . SER D 1 115 ? -6.742  14.435  -63.580 1.00 16.62  ? 300  SER D OG    1 
ATOM   4722 N N     . LYS D 1 116 ? -6.676  15.109  -60.306 1.00 12.02  ? 301  LYS D N     1 
ATOM   4723 C CA    . LYS D 1 116 ? -6.151  14.311  -59.182 1.00 13.18  ? 301  LYS D CA    1 
ATOM   4724 C C     . LYS D 1 116 ? -5.312  13.135  -59.670 1.00 14.56  ? 301  LYS D C     1 
ATOM   4725 O O     . LYS D 1 116 ? -4.351  12.748  -59.001 1.00 16.89  ? 301  LYS D O     1 
ATOM   4726 C CB    . LYS D 1 116 ? -7.265  13.796  -58.277 1.00 14.23  ? 301  LYS D CB    1 
ATOM   4727 C CG    . LYS D 1 116 ? -7.877  14.864  -57.394 1.00 13.77  ? 301  LYS D CG    1 
ATOM   4728 C CD    . LYS D 1 116 ? -9.117  14.318  -56.701 1.00 17.07  ? 301  LYS D CD    1 
ATOM   4729 C CE    . LYS D 1 116 ? -9.747  15.384  -55.837 1.00 18.92  ? 301  LYS D CE    1 
ATOM   4730 N NZ    . LYS D 1 116 ? -10.984 14.907  -55.150 1.00 22.41  ? 301  LYS D NZ    1 
ATOM   4731 N N     . CYS D 1 117 ? -5.667  12.598  -60.837 1.00 14.54  ? 302  CYS D N     1 
ATOM   4732 C CA    . CYS D 1 117 ? -5.008  11.417  -61.409 1.00 15.67  ? 302  CYS D CA    1 
ATOM   4733 C C     . CYS D 1 117 ? -4.251  11.786  -62.672 1.00 14.77  ? 302  CYS D C     1 
ATOM   4734 O O     . CYS D 1 117 ? -4.345  11.123  -63.697 1.00 16.21  ? 302  CYS D O     1 
ATOM   4735 C CB    . CYS D 1 117 ? -6.046  10.339  -61.699 1.00 16.75  ? 302  CYS D CB    1 
ATOM   4736 S SG    . CYS D 1 117 ? -6.927  9.850   -60.227 1.00 23.70  ? 302  CYS D SG    1 
ATOM   4737 N N     . GLY D 1 118 ? -3.490  12.862  -62.567 1.00 13.39  ? 303  GLY D N     1 
ATOM   4738 C CA    . GLY D 1 118 ? -2.747  13.374  -63.709 1.00 12.15  ? 303  GLY D CA    1 
ATOM   4739 C C     . GLY D 1 118 ? -1.462  12.616  -63.976 1.00 11.77  ? 303  GLY D C     1 
ATOM   4740 O O     . GLY D 1 118 ? -1.276  11.477  -63.542 1.00 14.15  ? 303  GLY D O     1 
ATOM   4741 N N     . ASN D 1 119 ? -0.576  13.258  -64.719 1.00 9.25   ? 304  ASN D N     1 
ATOM   4742 C CA    . ASN D 1 119 ? 0.673   12.636  -65.145 1.00 9.02   ? 304  ASN D CA    1 
ATOM   4743 C C     . ASN D 1 119 ? 1.924   13.333  -64.610 1.00 9.12   ? 304  ASN D C     1 
ATOM   4744 O O     . ASN D 1 119 ? 3.034   12.914  -64.907 1.00 9.56   ? 304  ASN D O     1 
ATOM   4745 C CB    . ASN D 1 119 ? 0.733   12.513  -66.678 1.00 9.12   ? 304  ASN D CB    1 
ATOM   4746 C CG    . ASN D 1 119 ? 0.417   13.827  -67.389 1.00 7.79   ? 304  ASN D CG    1 
ATOM   4747 O OD1   . ASN D 1 119 ? 0.560   14.914  -66.804 1.00 8.28   ? 304  ASN D OD1   1 
ATOM   4748 N ND2   . ASN D 1 119 ? -0.027  13.741  -68.655 1.00 9.74   ? 304  ASN D ND2   1 
ATOM   4749 N N     . CYS D 1 120 ? 1.729   14.399  -63.835 1.00 9.21   ? 305  CYS D N     1 
ATOM   4750 C CA    . CYS D 1 120 ? 2.832   15.110  -63.198 1.00 9.70   ? 305  CYS D CA    1 
ATOM   4751 C C     . CYS D 1 120 ? 2.598   15.217  -61.703 1.00 9.44   ? 305  CYS D C     1 
ATOM   4752 O O     . CYS D 1 120 ? 1.446   15.238  -61.234 1.00 10.01  ? 305  CYS D O     1 
ATOM   4753 C CB    . CYS D 1 120 ? 2.967   16.524  -63.760 1.00 10.20  ? 305  CYS D CB    1 
ATOM   4754 S SG    . CYS D 1 120 ? 3.402   16.597  -65.511 1.00 11.06  ? 305  CYS D SG    1 
ATOM   4755 N N     . GLN D 1 121 ? 3.702   15.296  -60.960 1.00 10.91  ? 306  GLN D N     1 
ATOM   4756 C CA    . GLN D 1 121 ? 3.652   15.535  -59.518 1.00 12.16  ? 306  GLN D CA    1 
ATOM   4757 C C     . GLN D 1 121 ? 4.575   16.718  -59.227 1.00 11.58  ? 306  GLN D C     1 
ATOM   4758 O O     . GLN D 1 121 ? 5.697   16.770  -59.714 1.00 11.45  ? 306  GLN D O     1 
ATOM   4759 C CB    . GLN D 1 121 ? 4.100   14.295  -58.731 1.00 13.78  ? 306  GLN D CB    1 
ATOM   4760 C CG    A GLN D 1 121 ? 4.401   14.500  -57.231 0.50 15.69  ? 306  GLN D CG    1 
ATOM   4761 C CG    B GLN D 1 121 ? 3.545   14.272  -57.305 0.50 16.60  ? 306  GLN D CG    1 
ATOM   4762 C CD    A GLN D 1 121 ? 3.274   14.033  -56.306 0.50 19.03  ? 306  GLN D CD    1 
ATOM   4763 C CD    B GLN D 1 121 ? 4.402   13.475  -56.325 0.50 20.27  ? 306  GLN D CD    1 
ATOM   4764 O OE1   A GLN D 1 121 ? 2.326   13.387  -56.738 0.50 20.31  ? 306  GLN D OE1   1 
ATOM   4765 O OE1   B GLN D 1 121 ? 4.715   12.308  -56.557 0.50 22.47  ? 306  GLN D OE1   1 
ATOM   4766 N NE2   A GLN D 1 121 ? 3.386   14.357  -55.023 0.50 20.91  ? 306  GLN D NE2   1 
ATOM   4767 N NE2   B GLN D 1 121 ? 4.775   14.110  -55.213 0.50 22.16  ? 306  GLN D NE2   1 
ATOM   4768 N N     . THR D 1 122 ? 4.092   17.670  -58.445 1.00 11.13  ? 307  THR D N     1 
ATOM   4769 C CA    . THR D 1 122 ? 4.921   18.807  -58.056 1.00 11.44  ? 307  THR D CA    1 
ATOM   4770 C C     . THR D 1 122 ? 5.816   18.418  -56.890 1.00 11.95  ? 307  THR D C     1 
ATOM   4771 O O     . THR D 1 122 ? 5.370   17.760  -55.947 1.00 12.82  ? 307  THR D O     1 
ATOM   4772 C CB    . THR D 1 122 ? 4.048   19.992  -57.678 1.00 11.75  ? 307  THR D CB    1 
ATOM   4773 O OG1   . THR D 1 122 ? 3.149   20.233  -58.756 1.00 11.72  ? 307  THR D OG1   1 
ATOM   4774 C CG2   . THR D 1 122 ? 4.890   21.254  -57.428 1.00 11.74  ? 307  THR D CG2   1 
ATOM   4775 N N     . LYS D 1 123 ? 7.070   18.850  -56.964 1.00 11.52  ? 308  LYS D N     1 
ATOM   4776 C CA    . LYS D 1 123 ? 8.043   18.581  -55.907 1.00 13.18  ? 308  LYS D CA    1 
ATOM   4777 C C     . LYS D 1 123 ? 8.752   19.861  -55.543 1.00 13.37  ? 308  LYS D C     1 
ATOM   4778 O O     . LYS D 1 123 ? 8.972   20.729  -56.394 1.00 12.15  ? 308  LYS D O     1 
ATOM   4779 C CB    . LYS D 1 123 ? 9.086   17.567  -56.395 1.00 14.08  ? 308  LYS D CB    1 
ATOM   4780 C CG    . LYS D 1 123 ? 8.534   16.263  -56.969 1.00 17.82  ? 308  LYS D CG    1 
ATOM   4781 C CD    . LYS D 1 123 ? 8.229   15.242  -55.898 1.00 22.14  ? 308  LYS D CD    1 
ATOM   4782 C CE    . LYS D 1 123 ? 7.950   13.874  -56.526 1.00 24.48  ? 308  LYS D CE    1 
ATOM   4783 N NZ    . LYS D 1 123 ? 9.084   13.370  -57.356 1.00 27.78  ? 308  LYS D NZ    1 
ATOM   4784 N N     . LEU D 1 124 ? 9.096   19.966  -54.265 1.00 14.06  ? 309  LEU D N     1 
ATOM   4785 C CA    . LEU D 1 124 ? 9.948   21.032  -53.769 1.00 15.40  ? 309  LEU D CA    1 
ATOM   4786 C C     . LEU D 1 124 ? 11.395  20.665  -54.054 1.00 15.74  ? 309  LEU D C     1 
ATOM   4787 O O     . LEU D 1 124 ? 11.839  19.575  -53.684 1.00 16.52  ? 309  LEU D O     1 
ATOM   4788 C CB    . LEU D 1 124 ? 9.741   21.191  -52.256 1.00 15.70  ? 309  LEU D CB    1 
ATOM   4789 C CG    . LEU D 1 124 ? 10.648  22.190  -51.519 1.00 17.25  ? 309  LEU D CG    1 
ATOM   4790 C CD1   . LEU D 1 124 ? 10.561  23.599  -52.099 1.00 17.83  ? 309  LEU D CD1   1 
ATOM   4791 C CD2   . LEU D 1 124 ? 10.343  22.188  -50.028 1.00 16.80  ? 309  LEU D CD2   1 
ATOM   4792 N N     . HIS D 1 125 ? 12.114  21.584  -54.688 1.00 15.32  ? 310  HIS D N     1 
ATOM   4793 C CA    . HIS D 1 125 ? 13.491  21.371  -55.107 1.00 16.19  ? 310  HIS D CA    1 
ATOM   4794 C C     . HIS D 1 125 ? 14.372  22.578  -54.803 1.00 16.62  ? 310  HIS D C     1 
ATOM   4795 O O     . HIS D 1 125 ? 14.111  23.692  -55.281 1.00 18.20  ? 310  HIS D O     1 
ATOM   4796 C CB    . HIS D 1 125 ? 13.522  21.101  -56.596 1.00 15.96  ? 310  HIS D CB    1 
ATOM   4797 C CG    . HIS D 1 125 ? 14.877  20.766  -57.116 1.00 16.09  ? 310  HIS D CG    1 
ATOM   4798 N ND1   . HIS D 1 125 ? 15.461  19.532  -56.924 1.00 17.10  ? 310  HIS D ND1   1 
ATOM   4799 C CD2   . HIS D 1 125 ? 15.761  21.497  -57.831 1.00 14.06  ? 310  HIS D CD2   1 
ATOM   4800 C CE1   . HIS D 1 125 ? 16.643  19.517  -57.512 1.00 16.89  ? 310  HIS D CE1   1 
ATOM   4801 N NE2   . HIS D 1 125 ? 16.853  20.696  -58.065 1.00 15.75  ? 310  HIS D NE2   1 
ATOM   4802 N N     . ASP D 1 126 ? 15.437  22.335  -54.045 1.00 16.01  ? 311  ASP D N     1 
ATOM   4803 C CA    . ASP D 1 126 ? 16.317  23.382  -53.534 1.00 16.45  ? 311  ASP D CA    1 
ATOM   4804 C C     . ASP D 1 126 ? 17.564  23.476  -54.411 1.00 16.00  ? 311  ASP D C     1 
ATOM   4805 O O     . ASP D 1 126 ? 18.217  22.462  -54.653 1.00 16.52  ? 311  ASP D O     1 
ATOM   4806 C CB    . ASP D 1 126 ? 16.703  22.998  -52.094 1.00 17.08  ? 311  ASP D CB    1 
ATOM   4807 C CG    . ASP D 1 126 ? 17.553  24.040  -51.387 1.00 19.86  ? 311  ASP D CG    1 
ATOM   4808 O OD1   . ASP D 1 126 ? 17.342  24.207  -50.163 1.00 22.36  ? 311  ASP D OD1   1 
ATOM   4809 O OD2   . ASP D 1 126 ? 18.432  24.662  -52.020 1.00 22.37  ? 311  ASP D OD2   1 
ATOM   4810 N N     . ILE D 1 127 ? 17.884  24.674  -54.903 1.00 14.95  ? 312  ILE D N     1 
ATOM   4811 C CA    . ILE D 1 127 ? 19.201  24.919  -55.520 1.00 14.95  ? 312  ILE D CA    1 
ATOM   4812 C C     . ILE D 1 127 ? 19.922  25.997  -54.744 1.00 14.69  ? 312  ILE D C     1 
ATOM   4813 O O     . ILE D 1 127 ? 19.494  27.155  -54.746 1.00 14.66  ? 312  ILE D O     1 
ATOM   4814 C CB    . ILE D 1 127 ? 19.096  25.389  -56.979 1.00 14.61  ? 312  ILE D CB    1 
ATOM   4815 C CG1   . ILE D 1 127 ? 18.164  24.470  -57.770 1.00 15.50  ? 312  ILE D CG1   1 
ATOM   4816 C CG2   . ILE D 1 127 ? 20.494  25.473  -57.630 1.00 16.25  ? 312  ILE D CG2   1 
ATOM   4817 C CD1   . ILE D 1 127 ? 17.944  24.929  -59.171 1.00 15.85  ? 312  ILE D CD1   1 
ATOM   4818 N N     . ASP D 1 128 ? 21.028  25.615  -54.099 1.00 14.97  ? 313  ASP D N     1 
ATOM   4819 C CA    . ASP D 1 128 ? 21.867  26.577  -53.368 1.00 15.28  ? 313  ASP D CA    1 
ATOM   4820 C C     . ASP D 1 128 ? 21.031  27.483  -52.461 1.00 15.11  ? 313  ASP D C     1 
ATOM   4821 O O     . ASP D 1 128 ? 21.221  28.703  -52.429 1.00 15.45  ? 313  ASP D O     1 
ATOM   4822 C CB    . ASP D 1 128 ? 22.693  27.406  -54.364 1.00 15.48  ? 313  ASP D CB    1 
ATOM   4823 C CG    . ASP D 1 128 ? 23.891  28.119  -53.720 1.00 16.29  ? 313  ASP D CG    1 
ATOM   4824 O OD1   . ASP D 1 128 ? 24.311  27.755  -52.602 1.00 15.67  ? 313  ASP D OD1   1 
ATOM   4825 O OD2   . ASP D 1 128 ? 24.401  29.053  -54.373 1.00 17.49  ? 313  ASP D OD2   1 
ATOM   4826 N N     . GLY D 1 129 ? 20.098  26.871  -51.735 1.00 14.63  ? 314  GLY D N     1 
ATOM   4827 C CA    . GLY D 1 129 ? 19.289  27.592  -50.748 1.00 15.02  ? 314  GLY D CA    1 
ATOM   4828 C C     . GLY D 1 129 ? 18.100  28.383  -51.290 1.00 15.08  ? 314  GLY D C     1 
ATOM   4829 O O     . GLY D 1 129 ? 17.467  29.141  -50.537 1.00 16.27  ? 314  GLY D O     1 
ATOM   4830 N N     . VAL D 1 130 ? 17.802  28.223  -52.583 1.00 13.88  ? 315  VAL D N     1 
ATOM   4831 C CA    . VAL D 1 130 ? 16.628  28.841  -53.190 1.00 13.15  ? 315  VAL D CA    1 
ATOM   4832 C C     . VAL D 1 130 ? 15.641  27.724  -53.545 1.00 12.25  ? 315  VAL D C     1 
ATOM   4833 O O     . VAL D 1 130 ? 16.000  26.797  -54.263 1.00 11.85  ? 315  VAL D O     1 
ATOM   4834 C CB    . VAL D 1 130 ? 16.998  29.645  -54.448 1.00 13.13  ? 315  VAL D CB    1 
ATOM   4835 C CG1   . VAL D 1 130 ? 15.755  30.270  -55.091 1.00 13.84  ? 315  VAL D CG1   1 
ATOM   4836 C CG2   . VAL D 1 130 ? 18.047  30.719  -54.121 1.00 13.94  ? 315  VAL D CG2   1 
ATOM   4837 N N     . PRO D 1 131 ? 14.400  27.801  -53.031 1.00 11.97  ? 316  PRO D N     1 
ATOM   4838 C CA    . PRO D 1 131 ? 13.416  26.773  -53.363 1.00 11.81  ? 316  PRO D CA    1 
ATOM   4839 C C     . PRO D 1 131 ? 12.787  26.985  -54.729 1.00 11.68  ? 316  PRO D C     1 
ATOM   4840 O O     . PRO D 1 131 ? 12.571  28.125  -55.151 1.00 12.51  ? 316  PRO D O     1 
ATOM   4841 C CB    . PRO D 1 131 ? 12.345  26.963  -52.287 1.00 12.47  ? 316  PRO D CB    1 
ATOM   4842 C CG    . PRO D 1 131 ? 12.393  28.452  -52.003 1.00 12.76  ? 316  PRO D CG    1 
ATOM   4843 C CD    . PRO D 1 131 ? 13.853  28.823  -52.114 1.00 11.72  ? 316  PRO D CD    1 
ATOM   4844 N N     . HIS D 1 132 ? 12.471  25.872  -55.380 1.00 11.00  ? 317  HIS D N     1 
ATOM   4845 C CA    . HIS D 1 132 ? 11.765  25.865  -56.665 1.00 11.16  ? 317  HIS D CA    1 
ATOM   4846 C C     . HIS D 1 132 ? 10.696  24.801  -56.614 1.00 11.02  ? 317  HIS D C     1 
ATOM   4847 O O     . HIS D 1 132 ? 10.909  23.731  -56.027 1.00 12.66  ? 317  HIS D O     1 
ATOM   4848 C CB    . HIS D 1 132 ? 12.709  25.513  -57.809 1.00 11.07  ? 317  HIS D CB    1 
ATOM   4849 C CG    . HIS D 1 132 ? 13.819  26.502  -57.990 1.00 11.52  ? 317  HIS D CG    1 
ATOM   4850 N ND1   . HIS D 1 132 ? 13.775  27.505  -58.933 1.00 11.44  ? 317  HIS D ND1   1 
ATOM   4851 C CD2   . HIS D 1 132 ? 14.992  26.659  -57.328 1.00 12.71  ? 317  HIS D CD2   1 
ATOM   4852 C CE1   . HIS D 1 132 ? 14.874  28.238  -58.846 1.00 12.77  ? 317  HIS D CE1   1 
ATOM   4853 N NE2   . HIS D 1 132 ? 15.630  27.741  -57.884 1.00 12.74  ? 317  HIS D NE2   1 
ATOM   4854 N N     . LEU D 1 133 ? 9.555   25.102  -57.230 1.00 10.10  ? 318  LEU D N     1 
ATOM   4855 C CA    . LEU D 1 133 ? 8.515   24.107  -57.449 1.00 9.84   ? 318  LEU D CA    1 
ATOM   4856 C C     . LEU D 1 133 ? 8.653   23.551  -58.839 1.00 9.78   ? 318  LEU D C     1 
ATOM   4857 O O     . LEU D 1 133 ? 8.624   24.300  -59.822 1.00 9.72   ? 318  LEU D O     1 
ATOM   4858 C CB    . LEU D 1 133 ? 7.119   24.722  -57.306 1.00 9.38   ? 318  LEU D CB    1 
ATOM   4859 C CG    . LEU D 1 133 ? 6.741   25.189  -55.901 1.00 10.46  ? 318  LEU D CG    1 
ATOM   4860 C CD1   . LEU D 1 133 ? 5.332   25.752  -55.897 1.00 11.89  ? 318  LEU D CD1   1 
ATOM   4861 C CD2   . LEU D 1 133 ? 6.887   24.065  -54.871 1.00 12.83  ? 318  LEU D CD2   1 
ATOM   4862 N N     . ILE D 1 134 ? 8.855   22.241  -58.928 1.00 9.61   ? 319  ILE D N     1 
ATOM   4863 C CA    . ILE D 1 134 ? 9.040   21.599  -60.225 1.00 10.60  ? 319  ILE D CA    1 
ATOM   4864 C C     . ILE D 1 134 ? 8.043   20.455  -60.429 1.00 9.74   ? 319  ILE D C     1 
ATOM   4865 O O     . ILE D 1 134 ? 7.693   19.744  -59.483 1.00 10.21  ? 319  ILE D O     1 
ATOM   4866 C CB    . ILE D 1 134 ? 10.510  21.123  -60.429 1.00 11.18  ? 319  ILE D CB    1 
ATOM   4867 C CG1   . ILE D 1 134 ? 10.864  20.014  -59.429 1.00 11.56  ? 319  ILE D CG1   1 
ATOM   4868 C CG2   . ILE D 1 134 ? 11.467  22.306  -60.290 1.00 11.42  ? 319  ILE D CG2   1 
ATOM   4869 C CD1   . ILE D 1 134 ? 12.238  19.387  -59.645 1.00 12.17  ? 319  ILE D CD1   1 
ATOM   4870 N N     . LEU D 1 135 ? 7.587   20.309  -61.668 1.00 9.65   ? 320  LEU D N     1 
ATOM   4871 C CA    . LEU D 1 135 ? 6.695   19.231  -62.064 1.00 10.31  ? 320  LEU D CA    1 
ATOM   4872 C C     . LEU D 1 135 ? 7.524   18.119  -62.677 1.00 10.93  ? 320  LEU D C     1 
ATOM   4873 O O     . LEU D 1 135 ? 8.314   18.362  -63.595 1.00 11.21  ? 320  LEU D O     1 
ATOM   4874 C CB    . LEU D 1 135 ? 5.658   19.727  -63.066 1.00 10.23  ? 320  LEU D CB    1 
ATOM   4875 C CG    . LEU D 1 135 ? 4.444   20.440  -62.468 1.00 11.26  ? 320  LEU D CG    1 
ATOM   4876 C CD1   . LEU D 1 135 ? 4.794   21.733  -61.757 1.00 12.90  ? 320  LEU D CD1   1 
ATOM   4877 C CD2   . LEU D 1 135 ? 3.439   20.672  -63.574 1.00 14.11  ? 320  LEU D CD2   1 
ATOM   4878 N N     . ILE D 1 136 ? 7.352   16.923  -62.123 1.00 11.68  ? 321  ILE D N     1 
ATOM   4879 C CA    . ILE D 1 136 ? 8.069   15.705  -62.498 1.00 12.52  ? 321  ILE D CA    1 
ATOM   4880 C C     . ILE D 1 136 ? 7.035   14.728  -63.067 1.00 12.00  ? 321  ILE D C     1 
ATOM   4881 O O     . ILE D 1 136 ? 5.931   14.628  -62.528 1.00 11.95  ? 321  ILE D O     1 
ATOM   4882 C CB    . ILE D 1 136 ? 8.732   15.078  -61.218 1.00 13.41  ? 321  ILE D CB    1 
ATOM   4883 C CG1   . ILE D 1 136 ? 9.719   16.065  -60.565 1.00 14.39  ? 321  ILE D CG1   1 
ATOM   4884 C CG2   . ILE D 1 136 ? 9.390   13.734  -61.490 1.00 15.95  ? 321  ILE D CG2   1 
ATOM   4885 C CD1   . ILE D 1 136 ? 10.756  16.604  -61.495 1.00 16.91  ? 321  ILE D CD1   1 
ATOM   4886 N N     . ALA D 1 137 ? 7.376   14.019  -64.146 1.00 11.16  ? 322  ALA D N     1 
ATOM   4887 C CA    . ALA D 1 137 ? 6.481   13.012  -64.705 1.00 10.94  ? 322  ALA D CA    1 
ATOM   4888 C C     . ALA D 1 137 ? 6.264   11.890  -63.692 1.00 11.32  ? 322  ALA D C     1 
ATOM   4889 O O     . ALA D 1 137 ? 7.236   11.290  -63.196 1.00 11.78  ? 322  ALA D O     1 
ATOM   4890 C CB    . ALA D 1 137 ? 7.059   12.462  -65.999 1.00 10.60  ? 322  ALA D CB    1 
ATOM   4891 N N     . SER D 1 138 ? 4.999   11.586  -63.394 1.00 11.99  ? 323  SER D N     1 
ATOM   4892 C CA    . SER D 1 138 ? 4.702   10.547  -62.410 1.00 12.66  ? 323  SER D CA    1 
ATOM   4893 C C     . SER D 1 138 ? 4.637   9.170   -63.050 1.00 12.64  ? 323  SER D C     1 
ATOM   4894 O O     . SER D 1 138 ? 4.532   8.162   -62.351 1.00 13.87  ? 323  SER D O     1 
ATOM   4895 C CB    . SER D 1 138 ? 3.395   10.856  -61.698 1.00 13.71  ? 323  SER D CB    1 
ATOM   4896 O OG    . SER D 1 138 ? 2.340   10.837  -62.636 1.00 14.48  ? 323  SER D OG    1 
ATOM   4897 N N     . ARG D 1 139 ? 4.682   9.155   -64.378 1.00 12.30  ? 324  ARG D N     1 
ATOM   4898 C CA    . ARG D 1 139 ? 4.657   7.956   -65.214 1.00 11.96  ? 324  ARG D CA    1 
ATOM   4899 C C     . ARG D 1 139 ? 5.164   8.388   -66.588 1.00 12.05  ? 324  ARG D C     1 
ATOM   4900 O O     . ARG D 1 139 ? 5.354   9.591   -66.842 1.00 12.10  ? 324  ARG D O     1 
ATOM   4901 C CB    . ARG D 1 139 ? 3.224   7.416   -65.330 1.00 12.12  ? 324  ARG D CB    1 
ATOM   4902 C CG    . ARG D 1 139 ? 2.227   8.436   -65.903 1.00 11.65  ? 324  ARG D CG    1 
ATOM   4903 C CD    . ARG D 1 139 ? 0.931   7.729   -66.256 1.00 12.00  ? 324  ARG D CD    1 
ATOM   4904 N NE    . ARG D 1 139 ? -0.160  8.643   -66.607 1.00 11.47  ? 324  ARG D NE    1 
ATOM   4905 C CZ    . ARG D 1 139 ? -0.304  9.228   -67.791 1.00 10.19  ? 324  ARG D CZ    1 
ATOM   4906 N NH1   . ARG D 1 139 ? 0.599   9.055   -68.757 1.00 10.58  ? 324  ARG D NH1   1 
ATOM   4907 N NH2   . ARG D 1 139 ? -1.360  10.001  -68.003 1.00 9.87   ? 324  ARG D NH2   1 
ATOM   4908 N N     . ASP D 1 140 ? 5.383   7.438   -67.493 1.00 12.06  ? 325  ASP D N     1 
ATOM   4909 C CA    . ASP D 1 140 ? 5.666   7.797   -68.873 1.00 12.79  ? 325  ASP D CA    1 
ATOM   4910 C C     . ASP D 1 140 ? 4.484   8.583   -69.447 1.00 11.88  ? 325  ASP D C     1 
ATOM   4911 O O     . ASP D 1 140 ? 3.320   8.225   -69.226 1.00 12.23  ? 325  ASP D O     1 
ATOM   4912 C CB    . ASP D 1 140 ? 5.895   6.543   -69.723 1.00 13.17  ? 325  ASP D CB    1 
ATOM   4913 C CG    . ASP D 1 140 ? 7.190   5.807   -69.373 1.00 15.23  ? 325  ASP D CG    1 
ATOM   4914 O OD1   . ASP D 1 140 ? 7.991   6.309   -68.556 1.00 15.60  ? 325  ASP D OD1   1 
ATOM   4915 O OD2   . ASP D 1 140 ? 7.403   4.702   -69.935 1.00 18.14  ? 325  ASP D OD2   1 
ATOM   4916 N N     . ILE D 1 141 ? 4.800   9.664   -70.158 1.00 11.36  ? 326  ILE D N     1 
ATOM   4917 C CA    . ILE D 1 141 ? 3.801   10.528  -70.787 1.00 11.39  ? 326  ILE D CA    1 
ATOM   4918 C C     . ILE D 1 141 ? 3.962   10.457  -72.290 1.00 12.00  ? 326  ILE D C     1 
ATOM   4919 O O     . ILE D 1 141 ? 5.069   10.619  -72.816 1.00 12.17  ? 326  ILE D O     1 
ATOM   4920 C CB    . ILE D 1 141 ? 3.990   11.988  -70.338 1.00 10.97  ? 326  ILE D CB    1 
ATOM   4921 C CG1   . ILE D 1 141 ? 3.893   12.096  -68.813 1.00 10.62  ? 326  ILE D CG1   1 
ATOM   4922 C CG2   . ILE D 1 141 ? 2.947   12.894  -71.003 1.00 11.78  ? 326  ILE D CG2   1 
ATOM   4923 C CD1   . ILE D 1 141 ? 4.146   13.500  -68.241 1.00 10.75  ? 326  ILE D CD1   1 
ATOM   4924 N N     . ALA D 1 142 ? 2.859   10.203  -72.981 1.00 12.05  ? 327  ALA D N     1 
ATOM   4925 C CA    . ALA D 1 142 ? 2.899   10.126  -74.425 1.00 12.23  ? 327  ALA D CA    1 
ATOM   4926 C C     . ALA D 1 142 ? 2.721   11.508  -75.040 1.00 12.02  ? 327  ALA D C     1 
ATOM   4927 O O     . ALA D 1 142 ? 1.972   12.349  -74.510 1.00 11.83  ? 327  ALA D O     1 
ATOM   4928 C CB    . ALA D 1 142 ? 1.829   9.171   -74.934 1.00 12.49  ? 327  ALA D CB    1 
ATOM   4929 N N     . ALA D 1 143 ? 3.387   11.750  -76.167 1.00 11.94  ? 328  ALA D N     1 
ATOM   4930 C CA    . ALA D 1 143 ? 3.120   12.953  -76.933 1.00 12.05  ? 328  ALA D CA    1 
ATOM   4931 C C     . ALA D 1 143 ? 1.622   13.038  -77.220 1.00 11.83  ? 328  ALA D C     1 
ATOM   4932 O O     . ALA D 1 143 ? 0.958   12.034  -77.520 1.00 11.62  ? 328  ALA D O     1 
ATOM   4933 C CB    . ALA D 1 143 ? 3.932   12.969  -78.224 1.00 12.65  ? 328  ALA D CB    1 
ATOM   4934 N N     . GLY D 1 144 ? 1.084   14.249  -77.104 1.00 10.98  ? 329  GLY D N     1 
ATOM   4935 C CA    . GLY D 1 144 ? -0.345  14.468  -77.307 1.00 10.64  ? 329  GLY D CA    1 
ATOM   4936 C C     . GLY D 1 144 ? -1.171  14.560  -76.031 1.00 9.81   ? 329  GLY D C     1 
ATOM   4937 O O     . GLY D 1 144 ? -2.297  15.056  -76.050 1.00 10.18  ? 329  GLY D O     1 
ATOM   4938 N N     . GLU D 1 145 ? -0.626  14.054  -74.927 1.00 9.00   ? 330  GLU D N     1 
ATOM   4939 C CA    . GLU D 1 145 ? -1.301  14.157  -73.644 1.00 8.91   ? 330  GLU D CA    1 
ATOM   4940 C C     . GLU D 1 145 ? -1.367  15.605  -73.171 1.00 8.15   ? 330  GLU D C     1 
ATOM   4941 O O     . GLU D 1 145 ? -0.408  16.359  -73.330 1.00 9.44   ? 330  GLU D O     1 
ATOM   4942 C CB    . GLU D 1 145 ? -0.585  13.357  -72.556 1.00 8.78   ? 330  GLU D CB    1 
ATOM   4943 C CG    . GLU D 1 145 ? -0.709  11.858  -72.693 1.00 9.73   ? 330  GLU D CG    1 
ATOM   4944 C CD    . GLU D 1 145 ? -0.427  11.146  -71.379 1.00 9.82   ? 330  GLU D CD    1 
ATOM   4945 O OE1   . GLU D 1 145 ? 0.375   10.194  -71.388 1.00 10.90  ? 330  GLU D OE1   1 
ATOM   4946 O OE2   . GLU D 1 145 ? -1.008  11.535  -70.339 1.00 10.80  ? 330  GLU D OE2   1 
ATOM   4947 N N     . GLU D 1 146 ? -2.489  15.968  -72.549 1.00 7.85   ? 331  GLU D N     1 
ATOM   4948 C CA    . GLU D 1 146 ? -2.483  17.162  -71.727 1.00 7.52   ? 331  GLU D CA    1 
ATOM   4949 C C     . GLU D 1 146 ? -1.668  16.875  -70.456 1.00 7.06   ? 331  GLU D C     1 
ATOM   4950 O O     . GLU D 1 146 ? -1.851  15.843  -69.799 1.00 8.24   ? 331  GLU D O     1 
ATOM   4951 C CB    . GLU D 1 146 ? -3.893  17.606  -71.359 1.00 7.05   ? 331  GLU D CB    1 
ATOM   4952 C CG    . GLU D 1 146 ? -3.879  18.984  -70.700 1.00 7.28   ? 331  GLU D CG    1 
ATOM   4953 C CD    . GLU D 1 146 ? -5.213  19.548  -70.278 1.00 7.86   ? 331  GLU D CD    1 
ATOM   4954 O OE1   . GLU D 1 146 ? -6.278  18.912  -70.442 1.00 8.25   ? 331  GLU D OE1   1 
ATOM   4955 O OE2   . GLU D 1 146 ? -5.172  20.681  -69.768 1.00 7.97   ? 331  GLU D OE2   1 
ATOM   4956 N N     . LEU D 1 147 ? -0.770  17.786  -70.107 1.00 7.12   ? 332  LEU D N     1 
ATOM   4957 C CA    . LEU D 1 147 ? -0.083  17.718  -68.812 1.00 7.75   ? 332  LEU D CA    1 
ATOM   4958 C C     . LEU D 1 147 ? -1.051  18.129  -67.711 1.00 7.75   ? 332  LEU D C     1 
ATOM   4959 O O     . LEU D 1 147 ? -1.784  19.120  -67.857 1.00 7.70   ? 332  LEU D O     1 
ATOM   4960 C CB    . LEU D 1 147 ? 1.154   18.622  -68.789 1.00 8.71   ? 332  LEU D CB    1 
ATOM   4961 C CG    . LEU D 1 147 ? 2.229   18.279  -69.825 1.00 9.35   ? 332  LEU D CG    1 
ATOM   4962 C CD1   . LEU D 1 147 ? 3.323   19.329  -69.767 1.00 10.28  ? 332  LEU D CD1   1 
ATOM   4963 C CD2   . LEU D 1 147 ? 2.822   16.900  -69.563 1.00 9.62   ? 332  LEU D CD2   1 
ATOM   4964 N N     . LEU D 1 148 ? -1.030  17.387  -66.603 1.00 7.97   ? 333  LEU D N     1 
ATOM   4965 C CA    . LEU D 1 148 ? -2.009  17.561  -65.541 1.00 7.71   ? 333  LEU D CA    1 
ATOM   4966 C C     . LEU D 1 148 ? -1.395  17.170  -64.211 1.00 7.78   ? 333  LEU D C     1 
ATOM   4967 O O     . LEU D 1 148 ? -0.660  16.195  -64.148 1.00 8.01   ? 333  LEU D O     1 
ATOM   4968 C CB    . LEU D 1 148 ? -3.227  16.658  -65.784 1.00 8.55   ? 333  LEU D CB    1 
ATOM   4969 C CG    . LEU D 1 148 ? -4.069  16.940  -67.036 1.00 9.29   ? 333  LEU D CG    1 
ATOM   4970 C CD1   . LEU D 1 148 ? -5.048  15.796  -67.318 1.00 10.75  ? 333  LEU D CD1   1 
ATOM   4971 C CD2   . LEU D 1 148 ? -4.811  18.273  -66.916 1.00 10.41  ? 333  LEU D CD2   1 
ATOM   4972 N N     . TYR D 1 149 ? -1.668  17.944  -63.160 1.00 7.64   ? 334  TYR D N     1 
ATOM   4973 C CA    . TYR D 1 149 ? -1.238  17.551  -61.807 1.00 7.52   ? 334  TYR D CA    1 
ATOM   4974 C C     . TYR D 1 149 ? -2.293  17.924  -60.784 1.00 7.39   ? 334  TYR D C     1 
ATOM   4975 O O     . TYR D 1 149 ? -3.216  18.682  -61.072 1.00 8.01   ? 334  TYR D O     1 
ATOM   4976 C CB    . TYR D 1 149 ? 0.095   18.224  -61.415 1.00 8.05   ? 334  TYR D CB    1 
ATOM   4977 C CG    . TYR D 1 149 ? 0.017   19.731  -61.280 1.00 7.95   ? 334  TYR D CG    1 
ATOM   4978 C CD1   . TYR D 1 149 ? -0.090  20.340  -60.028 1.00 7.76   ? 334  TYR D CD1   1 
ATOM   4979 C CD2   . TYR D 1 149 ? 0.049   20.542  -62.399 1.00 7.95   ? 334  TYR D CD2   1 
ATOM   4980 C CE1   . TYR D 1 149 ? -0.182  21.721  -59.904 1.00 8.40   ? 334  TYR D CE1   1 
ATOM   4981 C CE2   . TYR D 1 149 ? -0.026  21.932  -62.280 1.00 7.16   ? 334  TYR D CE2   1 
ATOM   4982 C CZ    . TYR D 1 149 ? -0.128  22.509  -61.033 1.00 7.56   ? 334  TYR D CZ    1 
ATOM   4983 O OH    . TYR D 1 149 ? -0.210  23.878  -60.886 1.00 8.52   ? 334  TYR D OH    1 
ATOM   4984 N N     . ASP D 1 150 ? -2.145  17.411  -59.567 1.00 7.33   ? 335  ASP D N     1 
ATOM   4985 C CA    . ASP D 1 150 ? -3.109  17.690  -58.512 1.00 7.78   ? 335  ASP D CA    1 
ATOM   4986 C C     . ASP D 1 150 ? -2.808  19.051  -57.889 1.00 7.77   ? 335  ASP D C     1 
ATOM   4987 O O     . ASP D 1 150 ? -1.754  19.223  -57.279 1.00 8.42   ? 335  ASP D O     1 
ATOM   4988 C CB    . ASP D 1 150 ? -3.019  16.577  -57.462 1.00 8.22   ? 335  ASP D CB    1 
ATOM   4989 C CG    . ASP D 1 150 ? -4.001  16.734  -56.330 1.00 10.02  ? 335  ASP D CG    1 
ATOM   4990 O OD1   . ASP D 1 150 ? -4.828  17.662  -56.331 1.00 9.56   ? 335  ASP D OD1   1 
ATOM   4991 O OD2   . ASP D 1 150 ? -3.934  15.879  -55.405 1.00 15.06  ? 335  ASP D OD2   1 
ATOM   4992 N N     . TYR D 1 151 ? -3.721  20.014  -58.071 1.00 7.27   ? 336  TYR D N     1 
ATOM   4993 C CA    . TYR D 1 151 ? -3.556  21.337  -57.480 1.00 7.37   ? 336  TYR D CA    1 
ATOM   4994 C C     . TYR D 1 151 ? -3.498  21.301  -55.945 1.00 7.86   ? 336  TYR D C     1 
ATOM   4995 O O     . TYR D 1 151 ? -2.978  22.237  -55.318 1.00 8.38   ? 336  TYR D O     1 
ATOM   4996 C CB    . TYR D 1 151 ? -4.701  22.245  -57.901 1.00 6.62   ? 336  TYR D CB    1 
ATOM   4997 C CG    . TYR D 1 151 ? -4.599  22.839  -59.285 1.00 7.51   ? 336  TYR D CG    1 
ATOM   4998 C CD1   . TYR D 1 151 ? -3.638  22.410  -60.206 1.00 6.36   ? 336  TYR D CD1   1 
ATOM   4999 C CD2   . TYR D 1 151 ? -5.480  23.844  -59.665 1.00 7.32   ? 336  TYR D CD2   1 
ATOM   5000 C CE1   . TYR D 1 151 ? -3.554  22.982  -61.477 1.00 6.48   ? 336  TYR D CE1   1 
ATOM   5001 C CE2   . TYR D 1 151 ? -5.422  24.410  -60.939 1.00 6.79   ? 336  TYR D CE2   1 
ATOM   5002 C CZ    . TYR D 1 151 ? -4.447  23.990  -61.826 1.00 6.11   ? 336  TYR D CZ    1 
ATOM   5003 O OH    . TYR D 1 151 ? -4.398  24.579  -63.068 1.00 6.81   ? 336  TYR D OH    1 
ATOM   5004 N N     . GLY D 1 152 ? -4.081  20.267  -55.342 1.00 7.93   ? 337  GLY D N     1 
ATOM   5005 C CA    . GLY D 1 152 ? -3.941  20.071  -53.882 1.00 8.17   ? 337  GLY D CA    1 
ATOM   5006 C C     . GLY D 1 152 ? -4.902  20.846  -52.990 1.00 8.39   ? 337  GLY D C     1 
ATOM   5007 O O     . GLY D 1 152 ? -4.923  20.657  -51.766 1.00 9.01   ? 337  GLY D O     1 
ATOM   5008 N N     . ASP D 1 153 ? -5.713  21.716  -53.584 1.00 8.11   ? 338  ASP D N     1 
ATOM   5009 C CA    . ASP D 1 153 ? -6.718  22.452  -52.810 1.00 7.97   ? 338  ASP D CA    1 
ATOM   5010 C C     . ASP D 1 153 ? -7.969  21.596  -52.732 1.00 8.30   ? 338  ASP D C     1 
ATOM   5011 O O     . ASP D 1 153 ? -8.674  21.415  -53.722 1.00 8.48   ? 338  ASP D O     1 
ATOM   5012 C CB    . ASP D 1 153 ? -7.024  23.810  -53.451 1.00 8.01   ? 338  ASP D CB    1 
ATOM   5013 C CG    . ASP D 1 153 ? -7.907  24.696  -52.584 1.00 8.77   ? 338  ASP D CG    1 
ATOM   5014 O OD1   . ASP D 1 153 ? -8.490  24.211  -51.577 1.00 9.44   ? 338  ASP D OD1   1 
ATOM   5015 O OD2   . ASP D 1 153 ? -8.037  25.882  -52.943 1.00 8.84   ? 338  ASP D OD2   1 
ATOM   5016 N N     . ARG D 1 154 ? -8.198  21.030  -51.550 1.00 8.37   ? 339  ARG D N     1 
ATOM   5017 C CA    . ARG D 1 154 ? -9.338  20.154  -51.272 1.00 8.61   ? 339  ARG D CA    1 
ATOM   5018 C C     . ARG D 1 154 ? -10.383 20.853  -50.408 1.00 9.22   ? 339  ARG D C     1 
ATOM   5019 O O     . ARG D 1 154 ? -11.360 20.227  -49.994 1.00 9.34   ? 339  ARG D O     1 
ATOM   5020 C CB    . ARG D 1 154 ? -8.852  18.870  -50.589 1.00 9.23   ? 339  ARG D CB    1 
ATOM   5021 C CG    . ARG D 1 154 ? -7.885  18.121  -51.460 1.00 10.72  ? 339  ARG D CG    1 
ATOM   5022 C CD    . ARG D 1 154 ? -7.263  16.881  -50.885 1.00 12.28  ? 339  ARG D CD    1 
ATOM   5023 N NE    . ARG D 1 154 ? -6.306  16.398  -51.882 1.00 12.31  ? 339  ARG D NE    1 
ATOM   5024 C CZ    . ARG D 1 154 ? -5.329  15.524  -51.663 1.00 14.81  ? 339  ARG D CZ    1 
ATOM   5025 N NH1   . ARG D 1 154 ? -5.170  14.957  -50.464 1.00 16.13  ? 339  ARG D NH1   1 
ATOM   5026 N NH2   . ARG D 1 154 ? -4.518  15.197  -52.661 1.00 15.69  ? 339  ARG D NH2   1 
ATOM   5027 N N     . SER D 1 155 ? -10.182 22.137  -50.115 1.00 9.02   ? 340  SER D N     1 
ATOM   5028 C CA    . SER D 1 155 ? -11.079 22.814  -49.172 1.00 9.93   ? 340  SER D CA    1 
ATOM   5029 C C     . SER D 1 155 ? -12.513 22.846  -49.690 1.00 10.54  ? 340  SER D C     1 
ATOM   5030 O O     . SER D 1 155 ? -12.737 22.966  -50.895 1.00 10.33  ? 340  SER D O     1 
ATOM   5031 C CB    . SER D 1 155 ? -10.579 24.220  -48.867 1.00 9.81   ? 340  SER D CB    1 
ATOM   5032 O OG    . SER D 1 155 ? -10.694 25.066  -50.005 1.00 10.84  ? 340  SER D OG    1 
ATOM   5033 N N     . LYS D 1 156 ? -13.484 22.734  -48.788 1.00 11.44  ? 341  LYS D N     1 
ATOM   5034 C CA    . LYS D 1 156 ? -14.880 22.750  -49.179 1.00 13.03  ? 341  LYS D CA    1 
ATOM   5035 C C     . LYS D 1 156 ? -15.224 23.995  -49.993 1.00 11.56  ? 341  LYS D C     1 
ATOM   5036 O O     . LYS D 1 156 ? -15.903 23.908  -51.017 1.00 11.66  ? 341  LYS D O     1 
ATOM   5037 C CB    . LYS D 1 156 ? -15.785 22.681  -47.945 1.00 13.03  ? 341  LYS D CB    1 
ATOM   5038 C CG    . LYS D 1 156 ? -17.269 22.580  -48.318 1.00 16.09  ? 341  LYS D CG    1 
ATOM   5039 C CD    . LYS D 1 156 ? -18.171 22.364  -47.119 1.00 16.59  ? 341  LYS D CD    1 
ATOM   5040 C CE    . LYS D 1 156 ? -19.644 22.320  -47.543 1.00 22.94  ? 341  LYS D CE    1 
ATOM   5041 N NZ    . LYS D 1 156 ? -20.111 23.669  -47.986 1.00 26.30  ? 341  LYS D NZ    1 
ATOM   5042 N N     . ALA D 1 157 ? -14.770 25.161  -49.536 1.00 11.76  ? 342  ALA D N     1 
ATOM   5043 C CA    . ALA D 1 157 ? -15.119 26.394  -50.223 1.00 11.65  ? 342  ALA D CA    1 
ATOM   5044 C C     . ALA D 1 157 ? -14.550 26.402  -51.634 1.00 11.56  ? 342  ALA D C     1 
ATOM   5045 O O     . ALA D 1 157 ? -15.222 26.814  -52.579 1.00 12.26  ? 342  ALA D O     1 
ATOM   5046 C CB    . ALA D 1 157 ? -14.646 27.595  -49.437 1.00 12.32  ? 342  ALA D CB    1 
ATOM   5047 N N     . SER D 1 158 ? -13.328 25.907  -51.797 1.00 10.25  ? 343  SER D N     1 
ATOM   5048 C CA    . SER D 1 158 ? -12.749 25.871  -53.143 1.00 9.84   ? 343  SER D CA    1 
ATOM   5049 C C     . SER D 1 158 ? -13.456 24.879  -54.059 1.00 9.61   ? 343  SER D C     1 
ATOM   5050 O O     . SER D 1 158 ? -13.742 25.214  -55.219 1.00 10.05  ? 343  SER D O     1 
ATOM   5051 C CB    . SER D 1 158 ? -11.263 25.547  -53.101 1.00 9.33   ? 343  SER D CB    1 
ATOM   5052 O OG    . SER D 1 158 ? -10.569 26.622  -52.490 1.00 9.65   ? 343  SER D OG    1 
ATOM   5053 N N     . ILE D 1 159 ? -13.712 23.669  -53.560 1.00 9.77   ? 344  ILE D N     1 
ATOM   5054 C CA    . ILE D 1 159 ? -14.273 22.617  -54.419 1.00 11.19  ? 344  ILE D CA    1 
ATOM   5055 C C     . ILE D 1 159 ? -15.726 22.908  -54.776 1.00 11.21  ? 344  ILE D C     1 
ATOM   5056 O O     . ILE D 1 159 ? -16.199 22.476  -55.832 1.00 11.72  ? 344  ILE D O     1 
ATOM   5057 C CB    . ILE D 1 159 ? -14.109 21.182  -53.848 1.00 11.46  ? 344  ILE D CB    1 
ATOM   5058 C CG1   . ILE D 1 159 ? -14.955 20.984  -52.585 1.00 12.05  ? 344  ILE D CG1   1 
ATOM   5059 C CG2   . ILE D 1 159 ? -12.625 20.868  -53.607 1.00 11.44  ? 344  ILE D CG2   1 
ATOM   5060 C CD1   . ILE D 1 159 ? -14.814 19.623  -51.927 1.00 14.31  ? 344  ILE D CD1   1 
ATOM   5061 N N     . GLU D 1 160 ? -16.432 23.655  -53.932 1.00 10.84  ? 345  GLU D N     1 
ATOM   5062 C CA    . GLU D 1 160 ? -17.822 24.011  -54.267 1.00 11.26  ? 345  GLU D CA    1 
ATOM   5063 C C     . GLU D 1 160 ? -17.917 25.149  -55.290 1.00 11.03  ? 345  GLU D C     1 
ATOM   5064 O O     . GLU D 1 160 ? -18.859 25.196  -56.091 1.00 11.15  ? 345  GLU D O     1 
ATOM   5065 C CB    . GLU D 1 160 ? -18.616 24.278  -53.001 1.00 12.03  ? 345  GLU D CB    1 
ATOM   5066 C CG    . GLU D 1 160 ? -18.715 22.994  -52.187 1.00 13.94  ? 345  GLU D CG    1 
ATOM   5067 C CD    . GLU D 1 160 ? -19.884 22.942  -51.260 1.00 18.72  ? 345  GLU D CD    1 
ATOM   5068 O OE1   . GLU D 1 160 ? -20.215 21.811  -50.829 1.00 20.91  ? 345  GLU D OE1   1 
ATOM   5069 O OE2   . GLU D 1 160 ? -20.454 24.009  -50.966 1.00 22.24  ? 345  GLU D OE2   1 
ATOM   5070 N N     . ALA D 1 161 ? -16.929 26.040  -55.269 1.00 10.77  ? 346  ALA D N     1 
ATOM   5071 C CA    . ALA D 1 161 ? -16.833 27.133  -56.238 1.00 10.89  ? 346  ALA D CA    1 
ATOM   5072 C C     . ALA D 1 161 ? -16.137 26.720  -57.535 1.00 11.10  ? 346  ALA D C     1 
ATOM   5073 O O     . ALA D 1 161 ? -16.337 27.356  -58.582 1.00 11.84  ? 346  ALA D O     1 
ATOM   5074 C CB    . ALA D 1 161 ? -16.122 28.322  -55.619 1.00 11.70  ? 346  ALA D CB    1 
ATOM   5075 N N     . HIS D 1 162 ? -15.319 25.667  -57.460 1.00 10.58  ? 347  HIS D N     1 
ATOM   5076 C CA    . HIS D 1 162 ? -14.515 25.203  -58.594 1.00 10.05  ? 347  HIS D CA    1 
ATOM   5077 C C     . HIS D 1 162 ? -14.601 23.692  -58.635 1.00 9.62   ? 347  HIS D C     1 
ATOM   5078 O O     . HIS D 1 162 ? -13.667 22.996  -58.234 1.00 9.69   ? 347  HIS D O     1 
ATOM   5079 C CB    . HIS D 1 162 ? -13.062 25.660  -58.436 1.00 10.12  ? 347  HIS D CB    1 
ATOM   5080 C CG    . HIS D 1 162 ? -12.935 27.136  -58.254 1.00 10.25  ? 347  HIS D CG    1 
ATOM   5081 N ND1   . HIS D 1 162 ? -12.888 28.012  -59.317 1.00 12.87  ? 347  HIS D ND1   1 
ATOM   5082 C CD2   . HIS D 1 162 ? -12.866 27.897  -57.135 1.00 10.61  ? 347  HIS D CD2   1 
ATOM   5083 C CE1   . HIS D 1 162 ? -12.808 29.248  -58.862 1.00 13.64  ? 347  HIS D CE1   1 
ATOM   5084 N NE2   . HIS D 1 162 ? -12.801 29.208  -57.542 1.00 12.76  ? 347  HIS D NE2   1 
ATOM   5085 N N     . PRO D 1 163 ? -15.751 23.167  -59.086 1.00 10.39  ? 348  PRO D N     1 
ATOM   5086 C CA    . PRO D 1 163 ? -16.024 21.739  -58.903 1.00 9.78   ? 348  PRO D CA    1 
ATOM   5087 C C     . PRO D 1 163 ? -15.071 20.780  -59.606 1.00 9.77   ? 348  PRO D C     1 
ATOM   5088 O O     . PRO D 1 163 ? -14.971 19.619  -59.213 1.00 9.65   ? 348  PRO D O     1 
ATOM   5089 C CB    . PRO D 1 163 ? -17.463 21.572  -59.445 1.00 10.81  ? 348  PRO D CB    1 
ATOM   5090 C CG    . PRO D 1 163 ? -18.034 22.939  -59.433 1.00 13.58  ? 348  PRO D CG    1 
ATOM   5091 C CD    . PRO D 1 163 ? -16.895 23.882  -59.695 1.00 11.23  ? 348  PRO D CD    1 
ATOM   5092 N N     . TRP D 1 164 ? -14.399 21.266  -60.644 1.00 8.63   ? 349  TRP D N     1 
ATOM   5093 C CA    . TRP D 1 164 ? -13.389 20.482  -61.354 1.00 8.66   ? 349  TRP D CA    1 
ATOM   5094 C C     . TRP D 1 164 ? -12.229 20.060  -60.434 1.00 8.54   ? 349  TRP D C     1 
ATOM   5095 O O     . TRP D 1 164 ? -11.514 19.123  -60.751 1.00 8.97   ? 349  TRP D O     1 
ATOM   5096 C CB    . TRP D 1 164 ? -12.906 21.250  -62.605 1.00 8.59   ? 349  TRP D CB    1 
ATOM   5097 C CG    . TRP D 1 164 ? -12.533 22.667  -62.292 1.00 9.24   ? 349  TRP D CG    1 
ATOM   5098 C CD1   . TRP D 1 164 ? -13.301 23.781  -62.463 1.00 8.73   ? 349  TRP D CD1   1 
ATOM   5099 C CD2   . TRP D 1 164 ? -11.301 23.114  -61.702 1.00 7.66   ? 349  TRP D CD2   1 
ATOM   5100 N NE1   . TRP D 1 164 ? -12.624 24.890  -62.024 1.00 9.47   ? 349  TRP D NE1   1 
ATOM   5101 C CE2   . TRP D 1 164 ? -11.393 24.508  -61.554 1.00 8.04   ? 349  TRP D CE2   1 
ATOM   5102 C CE3   . TRP D 1 164 ? -10.125 22.466  -61.311 1.00 7.06   ? 349  TRP D CE3   1 
ATOM   5103 C CZ2   . TRP D 1 164 ? -10.359 25.268  -61.004 1.00 8.53   ? 349  TRP D CZ2   1 
ATOM   5104 C CZ3   . TRP D 1 164 ? -9.101  23.216  -60.769 1.00 7.52   ? 349  TRP D CZ3   1 
ATOM   5105 C CH2   . TRP D 1 164 ? -9.226  24.599  -60.613 1.00 7.76   ? 349  TRP D CH2   1 
ATOM   5106 N N     . LEU D 1 165 ? -12.083 20.733  -59.285 1.00 8.31   ? 350  LEU D N     1 
ATOM   5107 C CA    . LEU D 1 165 ? -11.081 20.343  -58.277 1.00 8.31   ? 350  LEU D CA    1 
ATOM   5108 C C     . LEU D 1 165 ? -11.350 18.955  -57.693 1.00 9.48   ? 350  LEU D C     1 
ATOM   5109 O O     . LEU D 1 165 ? -10.451 18.340  -57.129 1.00 9.72   ? 350  LEU D O     1 
ATOM   5110 C CB    . LEU D 1 165 ? -11.007 21.361  -57.129 1.00 8.10   ? 350  LEU D CB    1 
ATOM   5111 C CG    . LEU D 1 165 ? -10.178 22.613  -57.391 1.00 7.73   ? 350  LEU D CG    1 
ATOM   5112 C CD1   . LEU D 1 165 ? -10.445 23.624  -56.287 1.00 7.92   ? 350  LEU D CD1   1 
ATOM   5113 C CD2   . LEU D 1 165 ? -8.694  22.273  -57.448 1.00 8.55   ? 350  LEU D CD2   1 
ATOM   5114 N N     . LYS D 1 166 ? -12.587 18.464  -57.839 1.00 10.33  ? 351  LYS D N     1 
ATOM   5115 C CA    . LYS D 1 166 ? -12.953 17.142  -57.307 1.00 12.53  ? 351  LYS D CA    1 
ATOM   5116 C C     . LYS D 1 166 ? -12.469 16.008  -58.209 1.00 13.02  ? 351  LYS D C     1 
ATOM   5117 O O     . LYS D 1 166 ? -12.499 14.837  -57.825 1.00 14.88  ? 351  LYS D O     1 
ATOM   5118 C CB    . LYS D 1 166 ? -14.471 17.030  -57.107 1.00 11.95  ? 351  LYS D CB    1 
ATOM   5119 C CG    . LYS D 1 166 ? -15.064 18.066  -56.148 1.00 13.41  ? 351  LYS D CG    1 
ATOM   5120 C CD    . LYS D 1 166 ? -16.579 17.887  -56.048 1.00 14.72  ? 351  LYS D CD    1 
ATOM   5121 C CE    . LYS D 1 166 ? -17.249 18.077  -57.402 1.00 19.29  ? 351  LYS D CE    1 
ATOM   5122 N NZ    . LYS D 1 166 ? -18.721 18.084  -57.296 1.00 20.54  ? 351  LYS D NZ    1 
ATOM   5123 N N     . HIS D 1 167 ? -12.037 16.360  -59.414 1.00 13.62  ? 352  HIS D N     1 
ATOM   5124 C CA    . HIS D 1 167 ? -11.691 15.383  -60.418 1.00 14.60  ? 352  HIS D CA    1 
ATOM   5125 C C     . HIS D 1 167 ? -10.201 15.034  -60.405 1.00 15.63  ? 352  HIS D C     1 
ATOM   5126 O O     . HIS D 1 167 ? -9.849  13.863  -60.596 1.00 15.69  ? 352  HIS D O     1 
ATOM   5127 C CB    . HIS D 1 167 ? -12.124 15.890  -61.791 1.00 15.55  ? 352  HIS D CB    1 
ATOM   5128 C CG    . HIS D 1 167 ? -11.692 15.013  -62.919 1.00 17.51  ? 352  HIS D CG    1 
ATOM   5129 N ND1   . HIS D 1 167 ? -12.355 13.849  -63.249 1.00 18.33  ? 352  HIS D ND1   1 
ATOM   5130 C CD2   . HIS D 1 167 ? -10.666 15.128  -63.796 1.00 18.49  ? 352  HIS D CD2   1 
ATOM   5131 C CE1   . HIS D 1 167 ? -11.756 13.287  -64.287 1.00 19.66  ? 352  HIS D CE1   1 
ATOM   5132 N NE2   . HIS D 1 167 ? -10.731 14.043  -64.637 1.00 19.29  ? 352  HIS D NE2   1 
ATOM   5133 N N     . LYS E 2 2   ? -9.033  11.690  -6.812  1.00 26.06  ? 16   LYS E N     1 
ATOM   5134 C CA    . LYS E 2 2   ? -9.307  11.426  -8.252  1.00 25.01  ? 16   LYS E CA    1 
ATOM   5135 C C     . LYS E 2 2   ? -8.135  10.688  -8.901  1.00 24.26  ? 16   LYS E C     1 
ATOM   5136 O O     . LYS E 2 2   ? -8.270  10.128  -9.987  1.00 24.45  ? 16   LYS E O     1 
ATOM   5137 C CB    . LYS E 2 2   ? -9.588  12.728  -8.983  1.00 25.16  ? 16   LYS E CB    1 
ATOM   5138 N N     . ARG E 2 3   ? -6.990  10.702  -8.223  1.00 22.90  ? 17   ARG E N     1 
ATOM   5139 C CA    . ARG E 2 3   ? -5.764  10.086  -8.724  1.00 21.46  ? 17   ARG E CA    1 
ATOM   5140 C C     . ARG E 2 3   ? -5.474  8.778   -8.013  1.00 20.25  ? 17   ARG E C     1 
ATOM   5141 O O     . ARG E 2 3   ? -5.705  8.655   -6.796  1.00 21.89  ? 17   ARG E O     1 
ATOM   5142 C CB    . ARG E 2 3   ? -4.583  11.016  -8.487  1.00 21.46  ? 17   ARG E CB    1 
ATOM   5143 C CG    . ARG E 2 3   ? -4.633  12.332  -9.254  1.00 21.42  ? 17   ARG E CG    1 
ATOM   5144 C CD    . ARG E 2 3   ? -3.539  13.277  -8.788  1.00 20.95  ? 17   ARG E CD    1 
ATOM   5145 N NE    . ARG E 2 3   ? -2.234  12.620  -8.767  1.00 20.96  ? 17   ARG E NE    1 
ATOM   5146 C CZ    . ARG E 2 3   ? -1.429  12.475  -9.815  1.00 20.02  ? 17   ARG E CZ    1 
ATOM   5147 N NH1   . ARG E 2 3   ? -1.764  12.953  -11.015 1.00 19.39  ? 17   ARG E NH1   1 
ATOM   5148 N NH2   . ARG E 2 3   ? -0.276  11.840  -9.658  1.00 20.08  ? 17   ARG E NH2   1 
ATOM   5149 N N     . HIS E 2 4   ? -4.933  7.811   -8.753  1.00 16.97  ? 18   HIS E N     1 
ATOM   5150 C CA    . HIS E 2 4   ? -4.424  6.572   -8.155  1.00 15.00  ? 18   HIS E CA    1 
ATOM   5151 C C     . HIS E 2 4   ? -2.901  6.619   -8.147  1.00 14.31  ? 18   HIS E C     1 
ATOM   5152 O O     . HIS E 2 4   ? -2.295  7.549   -8.701  1.00 14.57  ? 18   HIS E O     1 
ATOM   5153 C CB    . HIS E 2 4   ? -4.895  5.328   -8.928  1.00 14.36  ? 18   HIS E CB    1 
ATOM   5154 C CG    . HIS E 2 4   ? -4.278  5.206   -10.285 1.00 13.19  ? 18   HIS E CG    1 
ATOM   5155 N ND1   . HIS E 2 4   ? -3.038  4.637   -10.491 1.00 10.99  ? 18   HIS E ND1   1 
ATOM   5156 C CD2   . HIS E 2 4   ? -4.708  5.626   -11.498 1.00 13.01  ? 18   HIS E CD2   1 
ATOM   5157 C CE1   . HIS E 2 4   ? -2.735  4.708   -11.778 1.00 11.18  ? 18   HIS E CE1   1 
ATOM   5158 N NE2   . HIS E 2 4   ? -3.737  5.297   -12.409 1.00 11.79  ? 18   HIS E NE2   1 
ATOM   5159 N N     . ARG E 2 5   ? -2.287  5.623   -7.510  1.00 13.18  ? 19   ARG E N     1 
ATOM   5160 C CA    . ARG E 2 5   ? -0.834  5.492   -7.484  1.00 13.44  ? 19   ARG E CA    1 
ATOM   5161 C C     . ARG E 2 5   ? -0.408  4.205   -8.165  1.00 12.23  ? 19   ARG E C     1 
ATOM   5162 O O     . ARG E 2 5   ? -1.241  3.365   -8.525  1.00 11.86  ? 19   ARG E O     1 
ATOM   5163 C CB    . ARG E 2 5   ? -0.316  5.488   -6.037  1.00 13.25  ? 19   ARG E CB    1 
ATOM   5164 C CG    . ARG E 2 5   ? -0.357  6.848   -5.369  1.00 15.41  ? 19   ARG E CG    1 
ATOM   5165 C CD    . ARG E 2 5   ? -0.138  6.723   -3.864  1.00 16.67  ? 19   ARG E CD    1 
ATOM   5166 N NE    . ARG E 2 5   ? -0.387  8.009   -3.205  1.00 19.52  ? 19   ARG E NE    1 
ATOM   5167 C CZ    . ARG E 2 5   ? -1.015  8.157   -2.039  1.00 20.46  ? 19   ARG E CZ    1 
ATOM   5168 N NH1   . ARG E 2 5   ? -1.476  7.102   -1.376  1.00 20.32  ? 19   ARG E NH1   1 
ATOM   5169 N NH2   . ARG E 2 5   ? -1.182  9.373   -1.535  1.00 22.41  ? 19   ARG E NH2   1 
ATOM   5170 N N     . LYS E 2 6   ? 0.903   4.059   -8.337  1.00 11.57  ? 20   LYS E N     1 
ATOM   5171 C CA    . LYS E 2 6   ? 1.536   2.775   -8.575  1.00 11.70  ? 20   LYS E CA    1 
ATOM   5172 C C     . LYS E 2 6   ? 2.353   2.527   -7.295  1.00 11.94  ? 20   LYS E C     1 
ATOM   5173 O O     . LYS E 2 6   ? 2.994   3.460   -6.773  1.00 11.72  ? 20   LYS E O     1 
ATOM   5174 C CB    . LYS E 2 6   ? 2.409   2.833   -9.830  1.00 11.49  ? 20   LYS E CB    1 
ATOM   5175 C CG    . LYS E 2 6   ? 1.616   3.128   -11.107 1.00 11.40  ? 20   LYS E CG    1 
ATOM   5176 C CD    . LYS E 2 6   ? 2.528   3.517   -12.281 1.00 10.98  ? 20   LYS E CD    1 
ATOM   5177 C CE    . LYS E 2 6   ? 1.671   3.877   -13.475 1.00 9.93   ? 20   LYS E CE    1 
ATOM   5178 N NZ    . LYS E 2 6   ? 2.494   4.238   -14.666 1.00 9.65   ? 20   LYS E NZ    1 
ATOM   5179 N N     . VAL E 2 7   ? 2.281   1.311   -6.757  1.00 12.01  ? 21   VAL E N     1 
ATOM   5180 C CA    . VAL E 2 7   ? 2.792   1.010   -5.397  1.00 13.22  ? 21   VAL E CA    1 
ATOM   5181 C C     . VAL E 2 7   ? 3.459   -0.352  -5.415  1.00 12.90  ? 21   VAL E C     1 
ATOM   5182 O O     . VAL E 2 7   ? 2.827   -1.327  -5.805  1.00 12.15  ? 21   VAL E O     1 
ATOM   5183 C CB    . VAL E 2 7   ? 1.608   0.946   -4.359  1.00 14.55  ? 21   VAL E CB    1 
ATOM   5184 C CG1   . VAL E 2 7   ? 2.053   0.363   -3.008  1.00 17.30  ? 21   VAL E CG1   1 
ATOM   5185 C CG2   . VAL E 2 7   ? 0.969   2.304   -4.171  1.00 16.79  ? 21   VAL E CG2   1 
ATOM   5186 N N     . LEU E 2 8   ? 4.727   -0.441  -5.010  1.00 12.75  ? 22   LEU E N     1 
ATOM   5187 C CA    . LEU E 2 8   ? 5.384   -1.749  -4.949  1.00 14.33  ? 22   LEU E CA    1 
ATOM   5188 C C     . LEU E 2 8   ? 4.862   -2.552  -3.764  1.00 16.04  ? 22   LEU E C     1 
ATOM   5189 O O     . LEU E 2 8   ? 4.813   -2.028  -2.665  1.00 18.20  ? 22   LEU E O     1 
ATOM   5190 C CB    . LEU E 2 8   ? 6.909   -1.597  -4.852  1.00 13.89  ? 22   LEU E CB    1 
ATOM   5191 C CG    . LEU E 2 8   ? 7.746   -2.872  -5.000  1.00 13.94  ? 22   LEU E CG    1 
ATOM   5192 C CD1   . LEU E 2 8   ? 7.484   -3.531  -6.351  1.00 16.39  ? 22   LEU E CD1   1 
ATOM   5193 C CD2   . LEU E 2 8   ? 9.217   -2.562  -4.858  1.00 14.61  ? 22   LEU E CD2   1 
ATOM   5194 N N     . ARG E 2 9   ? 4.496   -3.815  -4.009  1.00 17.50  ? 23   ARG E N     1 
ATOM   5195 C CA    . ARG E 2 9   ? 3.946   -4.700  -2.975  1.00 19.06  ? 23   ARG E CA    1 
ATOM   5196 C C     . ARG E 2 9   ? 4.781   -5.976  -2.881  1.00 20.68  ? 23   ARG E C     1 
ATOM   5197 O O     . ARG E 2 9   ? 4.390   -6.950  -2.222  1.00 22.99  ? 23   ARG E O     1 
ATOM   5198 C CB    . ARG E 2 9   ? 2.478   -5.057  -3.272  1.00 19.31  ? 23   ARG E CB    1 
ATOM   5199 C CG    . ARG E 2 9   ? 1.507   -3.870  -3.294  1.00 19.27  ? 23   ARG E CG    1 
ATOM   5200 C CD    . ARG E 2 9   ? 0.090   -4.358  -3.553  1.00 17.59  ? 23   ARG E CD    1 
ATOM   5201 N NE    . ARG E 2 9   ? -0.497  -4.920  -2.337  1.00 15.38  ? 23   ARG E NE    1 
ATOM   5202 C CZ    . ARG E 2 9   ? -1.412  -4.306  -1.591  1.00 13.44  ? 23   ARG E CZ    1 
ATOM   5203 N NH1   . ARG E 2 9   ? -1.903  -3.120  -1.942  1.00 11.23  ? 23   ARG E NH1   1 
ATOM   5204 N NH2   . ARG E 2 9   ? -1.869  -4.905  -0.495  1.00 14.31  ? 23   ARG E NH2   1 
ATOM   5205 N N     . LYS F 2 2   ? 8.276   -13.534 5.213   1.00 22.85  ? 16   LYS F N     1 
ATOM   5206 C CA    . LYS F 2 2   ? 6.893   -14.040 5.444   1.00 21.47  ? 16   LYS F CA    1 
ATOM   5207 C C     . LYS F 2 2   ? 6.000   -12.950 6.051   1.00 20.36  ? 16   LYS F C     1 
ATOM   5208 O O     . LYS F 2 2   ? 6.321   -11.760 5.993   1.00 21.57  ? 16   LYS F O     1 
ATOM   5209 N N     . ARG F 2 3   ? 4.879   -13.368 6.624   1.00 18.49  ? 17   ARG F N     1 
ATOM   5210 C CA    . ARG F 2 3   ? 3.887   -12.427 7.152   1.00 16.13  ? 17   ARG F CA    1 
ATOM   5211 C C     . ARG F 2 3   ? 4.158   -12.146 8.616   1.00 15.47  ? 17   ARG F C     1 
ATOM   5212 O O     . ARG F 2 3   ? 4.797   -12.948 9.302   1.00 17.55  ? 17   ARG F O     1 
ATOM   5213 C CB    . ARG F 2 3   ? 2.492   -13.028 7.022   1.00 15.93  ? 17   ARG F CB    1 
ATOM   5214 C CG    . ARG F 2 3   ? 2.029   -13.235 5.576   1.00 14.62  ? 17   ARG F CG    1 
ATOM   5215 C CD    . ARG F 2 3   ? 0.711   -14.019 5.518   1.00 15.01  ? 17   ARG F CD    1 
ATOM   5216 N NE    . ARG F 2 3   ? -0.354  -13.333 6.251   1.00 13.73  ? 17   ARG F NE    1 
ATOM   5217 C CZ    . ARG F 2 3   ? -1.076  -12.319 5.777   1.00 13.81  ? 17   ARG F CZ    1 
ATOM   5218 N NH1   . ARG F 2 3   ? -0.889  -11.862 4.529   1.00 13.64  ? 17   ARG F NH1   1 
ATOM   5219 N NH2   . ARG F 2 3   ? -1.996  -11.752 6.553   1.00 13.28  ? 17   ARG F NH2   1 
ATOM   5220 N N     . HIS F 2 4   ? 3.668   -11.009 9.099   1.00 12.95  ? 18   HIS F N     1 
ATOM   5221 C CA    . HIS F 2 4   ? 3.497   -10.823 10.540  1.00 11.90  ? 18   HIS F CA    1 
ATOM   5222 C C     . HIS F 2 4   ? 2.001   -10.860 10.839  1.00 11.28  ? 18   HIS F C     1 
ATOM   5223 O O     . HIS F 2 4   ? 1.181   -10.894 9.928   1.00 11.34  ? 18   HIS F O     1 
ATOM   5224 C CB    . HIS F 2 4   ? 4.106   -9.496  11.002  1.00 11.78  ? 18   HIS F CB    1 
ATOM   5225 C CG    . HIS F 2 4   ? 3.373   -8.287  10.509  1.00 10.66  ? 18   HIS F CG    1 
ATOM   5226 N ND1   . HIS F 2 4   ? 2.272   -7.760  11.158  1.00 10.06  ? 18   HIS F ND1   1 
ATOM   5227 C CD2   . HIS F 2 4   ? 3.558   -7.523  9.405   1.00 9.74   ? 18   HIS F CD2   1 
ATOM   5228 C CE1   . HIS F 2 4   ? 1.830   -6.709  10.491  1.00 10.52  ? 18   HIS F CE1   1 
ATOM   5229 N NE2   . HIS F 2 4   ? 2.587   -6.547  9.419   1.00 9.92   ? 18   HIS F NE2   1 
ATOM   5230 N N     . ARG F 2 5   ? 1.659   -10.839 12.126  1.00 10.41  ? 19   ARG F N     1 
ATOM   5231 C CA    . ARG F 2 5   ? 0.274   -10.723 12.565  1.00 10.14  ? 19   ARG F CA    1 
ATOM   5232 C C     . ARG F 2 5   ? 0.078   -9.449  13.391  1.00 10.00  ? 19   ARG F C     1 
ATOM   5233 O O     . ARG F 2 5   ? 1.041   -8.729  13.699  1.00 10.22  ? 19   ARG F O     1 
ATOM   5234 C CB    . ARG F 2 5   ? -0.112  -11.962 13.385  1.00 10.72  ? 19   ARG F CB    1 
ATOM   5235 C CG    . ARG F 2 5   ? -0.250  -13.207 12.532  1.00 11.47  ? 19   ARG F CG    1 
ATOM   5236 C CD    . ARG F 2 5   ? -0.479  -14.443 13.390  1.00 12.21  ? 19   ARG F CD    1 
ATOM   5237 N NE    . ARG F 2 5   ? -0.887  -15.563 12.550  1.00 14.71  ? 19   ARG F NE    1 
ATOM   5238 C CZ    . ARG F 2 5   ? -0.678  -16.842 12.839  1.00 15.19  ? 19   ARG F CZ    1 
ATOM   5239 N NH1   . ARG F 2 5   ? -0.024  -17.191 13.947  1.00 16.04  ? 19   ARG F NH1   1 
ATOM   5240 N NH2   . ARG F 2 5   ? -1.117  -17.775 11.994  1.00 15.84  ? 19   ARG F NH2   1 
ATOM   5241 N N     . LYS F 2 6   ? -1.181  -9.167  13.712  1.00 9.85   ? 20   LYS F N     1 
ATOM   5242 C CA    . LYS F 2 6   ? -1.519  -8.217  14.767  1.00 9.55   ? 20   LYS F CA    1 
ATOM   5243 C C     . LYS F 2 6   ? -2.213  -9.129  15.786  1.00 9.86   ? 20   LYS F C     1 
ATOM   5244 O O     . LYS F 2 6   ? -3.091  -9.919  15.414  1.00 9.60   ? 20   LYS F O     1 
ATOM   5245 C CB    . LYS F 2 6   ? -2.463  -7.126  14.233  1.00 9.34   ? 20   LYS F CB    1 
ATOM   5246 C CG    . LYS F 2 6   ? -1.861  -6.278  13.088  1.00 9.07   ? 20   LYS F CG    1 
ATOM   5247 C CD    . LYS F 2 6   ? -2.902  -5.362  12.430  1.00 9.89   ? 20   LYS F CD    1 
ATOM   5248 C CE    . LYS F 2 6   ? -2.325  -4.662  11.175  1.00 9.26   ? 20   LYS F CE    1 
ATOM   5249 N NZ    . LYS F 2 6   ? -3.263  -3.688  10.529  1.00 9.17   ? 20   LYS F NZ    1 
ATOM   5250 N N     . VAL F 2 7   ? -1.772  -9.060  17.048  1.00 9.96   ? 21   VAL F N     1 
ATOM   5251 C CA    . VAL F 2 7   ? -2.213  -10.006 18.092  1.00 10.56  ? 21   VAL F CA    1 
ATOM   5252 C C     . VAL F 2 7   ? -2.533  -9.288  19.406  1.00 10.87  ? 21   VAL F C     1 
ATOM   5253 O O     . VAL F 2 7   ? -1.699  -8.538  19.919  1.00 10.18  ? 21   VAL F O     1 
ATOM   5254 C CB    . VAL F 2 7   ? -1.123  -11.073 18.380  1.00 10.54  ? 21   VAL F CB    1 
ATOM   5255 C CG1   . VAL F 2 7   ? -1.608  -12.088 19.433  1.00 10.50  ? 21   VAL F CG1   1 
ATOM   5256 C CG2   . VAL F 2 7   ? -0.711  -11.791 17.095  1.00 12.05  ? 21   VAL F CG2   1 
ATOM   5257 N N     . LEU F 2 8   ? -3.743  -9.541  19.915  1.00 11.96  ? 22   LEU F N     1 
ATOM   5258 C CA    . LEU F 2 8   ? -4.167  -9.195  21.280  1.00 13.20  ? 22   LEU F CA    1 
ATOM   5259 C C     . LEU F 2 8   ? -4.352  -10.496 22.133  1.00 13.56  ? 22   LEU F C     1 
ATOM   5260 O O     . LEU F 2 8   ? -4.895  -11.502 21.650  1.00 15.47  ? 22   LEU F O     1 
ATOM   5261 C CB    . LEU F 2 8   ? -5.495  -8.401  21.219  1.00 12.52  ? 22   LEU F CB    1 
ATOM   5262 C CG    . LEU F 2 8   ? -5.998  -7.704  22.494  1.00 13.54  ? 22   LEU F CG    1 
ATOM   5263 C CD1   . LEU F 2 8   ? -5.169  -6.478  22.829  1.00 17.36  ? 22   LEU F CD1   1 
ATOM   5264 C CD2   . LEU F 2 8   ? -7.471  -7.317  22.401  1.00 13.78  ? 22   LEU F CD2   1 
ATOM   5265 N N     . ARG F 2 9   ? -3.903  -10.459 23.378  1.00 15.55  ? 23   ARG F N     1 
ATOM   5266 C CA    . ARG F 2 9   ? -4.159  -11.534 24.344  1.00 15.58  ? 23   ARG F CA    1 
ATOM   5267 C C     . ARG F 2 9   ? -4.714  -10.919 25.628  1.00 16.06  ? 23   ARG F C     1 
ATOM   5268 O O     . ARG F 2 9   ? -4.745  -9.679  25.766  1.00 16.83  ? 23   ARG F O     1 
ATOM   5269 C CB    . ARG F 2 9   ? -2.899  -12.405 24.593  1.00 16.08  ? 23   ARG F CB    1 
ATOM   5270 C CG    . ARG F 2 9   ? -1.601  -11.636 24.867  1.00 15.69  ? 23   ARG F CG    1 
ATOM   5271 C CD    . ARG F 2 9   ? -1.647  -10.895 26.203  1.00 15.58  ? 23   ARG F CD    1 
ATOM   5272 N NE    . ARG F 2 9   ? -0.435  -10.133 26.430  1.00 14.38  ? 23   ARG F NE    1 
ATOM   5273 C CZ    . ARG F 2 9   ? -0.189  -9.420  27.522  1.00 14.44  ? 23   ARG F CZ    1 
ATOM   5274 N NH1   . ARG F 2 9   ? -1.094  -9.367  28.497  1.00 15.96  ? 23   ARG F NH1   1 
ATOM   5275 N NH2   . ARG F 2 9   ? 0.958   -8.760  27.633  1.00 16.43  ? 23   ARG F NH2   1 
ATOM   5276 N N     . ASP F 2 10  ? -5.215  -11.774 26.525  1.00 15.72  ? 24   ASP F N     1 
ATOM   5277 C CA    . ASP F 2 10  ? -5.793  -11.323 27.795  1.00 15.92  ? 24   ASP F CA    1 
ATOM   5278 C C     . ASP F 2 10  ? -4.818  -10.453 28.570  1.00 15.80  ? 24   ASP F C     1 
ATOM   5279 O O     . ASP F 2 10  ? -3.650  -10.797 28.709  1.00 15.37  ? 24   ASP F O     1 
ATOM   5280 C CB    . ASP F 2 10  ? -6.222  -12.517 28.665  1.00 16.04  ? 24   ASP F CB    1 
ATOM   5281 C CG    . ASP F 2 10  ? -7.476  -13.206 28.150  1.00 17.57  ? 24   ASP F CG    1 
ATOM   5282 O OD1   . ASP F 2 10  ? -8.008  -12.785 27.098  1.00 20.29  ? 24   ASP F OD1   1 
ATOM   5283 O OD2   . ASP F 2 10  ? -7.937  -14.165 28.819  1.00 18.72  ? 24   ASP F OD2   1 
ATOM   5284 N N     . LYS G 2 2   ? 5.664   9.522   -42.373 1.00 24.66  ? 16   LYS G N     1 
ATOM   5285 C CA    . LYS G 2 2   ? 4.879   9.029   -41.207 1.00 23.69  ? 16   LYS G CA    1 
ATOM   5286 C C     . LYS G 2 2   ? 3.783   10.028  -40.825 1.00 22.58  ? 16   LYS G C     1 
ATOM   5287 O O     . LYS G 2 2   ? 3.936   11.252  -40.995 1.00 23.45  ? 16   LYS G O     1 
ATOM   5288 C CB    . LYS G 2 2   ? 5.805   8.761   -40.021 1.00 24.60  ? 16   LYS G CB    1 
ATOM   5289 N N     . ARG G 2 3   ? 2.676   9.492   -40.322 1.00 20.15  ? 17   ARG G N     1 
ATOM   5290 C CA    . ARG G 2 3   ? 1.558   10.299  -39.849 1.00 17.62  ? 17   ARG G CA    1 
ATOM   5291 C C     . ARG G 2 3   ? 1.682   10.506  -38.354 1.00 17.26  ? 17   ARG G C     1 
ATOM   5292 O O     . ARG G 2 3   ? 2.067   9.592   -37.611 1.00 18.94  ? 17   ARG G O     1 
ATOM   5293 C CB    . ARG G 2 3   ? 0.241   9.571   -40.129 1.00 17.32  ? 17   ARG G CB    1 
ATOM   5294 C CG    . ARG G 2 3   ? -0.117  9.442   -41.604 1.00 16.03  ? 17   ARG G CG    1 
ATOM   5295 C CD    . ARG G 2 3   ? -1.393  8.592   -41.774 1.00 16.27  ? 17   ARG G CD    1 
ATOM   5296 N NE    . ARG G 2 3   ? -2.484  9.117   -40.953 1.00 14.98  ? 17   ARG G NE    1 
ATOM   5297 C CZ    . ARG G 2 3   ? -3.308  10.095  -41.321 1.00 14.93  ? 17   ARG G CZ    1 
ATOM   5298 N NH1   . ARG G 2 3   ? -3.214  10.653  -42.529 1.00 13.95  ? 17   ARG G NH1   1 
ATOM   5299 N NH2   . ARG G 2 3   ? -4.233  10.512  -40.468 1.00 13.79  ? 17   ARG G NH2   1 
ATOM   5300 N N     . HIS G 2 4   ? 1.333   11.701  -37.892 1.00 15.15  ? 18   HIS G N     1 
ATOM   5301 C CA    . HIS G 2 4   ? 1.153   11.909  -36.464 1.00 13.86  ? 18   HIS G CA    1 
ATOM   5302 C C     . HIS G 2 4   ? -0.335  11.784  -36.158 1.00 13.52  ? 18   HIS G C     1 
ATOM   5303 O O     . HIS G 2 4   ? -1.153  11.602  -37.063 1.00 13.38  ? 18   HIS G O     1 
ATOM   5304 C CB    . HIS G 2 4   ? 1.691   13.285  -36.028 1.00 13.53  ? 18   HIS G CB    1 
ATOM   5305 C CG    . HIS G 2 4   ? 0.879   14.448  -36.523 1.00 11.32  ? 18   HIS G CG    1 
ATOM   5306 N ND1   . HIS G 2 4   ? -0.227  14.927  -35.847 1.00 10.90  ? 18   HIS G ND1   1 
ATOM   5307 C CD2   . HIS G 2 4   ? 1.005   15.222  -37.630 1.00 12.34  ? 18   HIS G CD2   1 
ATOM   5308 C CE1   . HIS G 2 4   ? -0.750  15.935  -36.523 1.00 10.67  ? 18   HIS G CE1   1 
ATOM   5309 N NE2   . HIS G 2 4   ? -0.018  16.142  -37.603 1.00 11.44  ? 18   HIS G NE2   1 
ATOM   5310 N N     . ARG G 2 5   ? -0.683  11.899  -34.884 1.00 12.91  ? 19   ARG G N     1 
ATOM   5311 C CA    . ARG G 2 5   ? -2.096  11.972  -34.513 1.00 13.55  ? 19   ARG G CA    1 
ATOM   5312 C C     . ARG G 2 5   ? -2.375  13.202  -33.643 1.00 12.13  ? 19   ARG G C     1 
ATOM   5313 O O     . ARG G 2 5   ? -1.463  13.989  -33.342 1.00 11.40  ? 19   ARG G O     1 
ATOM   5314 C CB    . ARG G 2 5   ? -2.558  10.675  -33.832 1.00 14.15  ? 19   ARG G CB    1 
ATOM   5315 C CG    . ARG G 2 5   ? -1.883  10.386  -32.537 1.00 16.08  ? 19   ARG G CG    1 
ATOM   5316 C CD    . ARG G 2 5   ? -2.263  9.037   -31.932 1.00 16.78  ? 19   ARG G CD    1 
ATOM   5317 N NE    . ARG G 2 5   ? -1.345  8.787   -30.821 1.00 22.98  ? 19   ARG G NE    1 
ATOM   5318 C CZ    . ARG G 2 5   ? -1.693  8.628   -29.547 1.00 24.52  ? 19   ARG G CZ    1 
ATOM   5319 N NH1   . ARG G 2 5   ? -2.974  8.611   -29.201 1.00 27.68  ? 19   ARG G NH1   1 
ATOM   5320 N NH2   . ARG G 2 5   ? -0.746  8.458   -28.615 1.00 20.90  ? 19   ARG G NH2   1 
ATOM   5321 N N     . LYS G 2 6   ? -3.649  13.386  -33.308 1.00 10.99  ? 20   LYS G N     1 
ATOM   5322 C CA    . LYS G 2 6   ? -4.061  14.297  -32.249 1.00 10.39  ? 20   LYS G CA    1 
ATOM   5323 C C     . LYS G 2 6   ? -4.650  13.363  -31.188 1.00 10.67  ? 20   LYS G C     1 
ATOM   5324 O O     . LYS G 2 6   ? -5.345  12.403  -31.527 1.00 10.62  ? 20   LYS G O     1 
ATOM   5325 C CB    . LYS G 2 6   ? -5.099  15.291  -32.773 1.00 10.17  ? 20   LYS G CB    1 
ATOM   5326 C CG    . LYS G 2 6   ? -4.575  16.126  -33.937 1.00 10.42  ? 20   LYS G CG    1 
ATOM   5327 C CD    . LYS G 2 6   ? -5.683  16.913  -34.610 1.00 9.81   ? 20   LYS G CD    1 
ATOM   5328 C CE    . LYS G 2 6   ? -5.153  17.666  -35.833 1.00 9.74   ? 20   LYS G CE    1 
ATOM   5329 N NZ    . LYS G 2 6   ? -6.214  18.477  -36.516 1.00 9.36   ? 20   LYS G NZ    1 
ATOM   5330 N N     . VAL G 2 7   ? -4.341  13.602  -29.918 1.00 11.20  ? 21   VAL G N     1 
ATOM   5331 C CA    . VAL G 2 7   ? -4.784  12.682  -28.863 1.00 12.68  ? 21   VAL G CA    1 
ATOM   5332 C C     . VAL G 2 7   ? -5.034  13.402  -27.548 1.00 13.59  ? 21   VAL G C     1 
ATOM   5333 O O     . VAL G 2 7   ? -4.242  14.262  -27.146 1.00 13.95  ? 21   VAL G O     1 
ATOM   5334 C CB    . VAL G 2 7   ? -3.785  11.511  -28.662 1.00 13.16  ? 21   VAL G CB    1 
ATOM   5335 C CG1   . VAL G 2 7   ? -2.389  12.018  -28.375 1.00 13.81  ? 21   VAL G CG1   1 
ATOM   5336 C CG2   . VAL G 2 7   ? -4.243  10.574  -27.543 1.00 13.14  ? 21   VAL G CG2   1 
ATOM   5337 N N     . LEU G 2 8   ? -6.138  13.054  -26.891 1.00 13.82  ? 22   LEU G N     1 
ATOM   5338 C CA    . LEU G 2 8   ? -6.457  13.597  -25.581 1.00 15.65  ? 22   LEU G CA    1 
ATOM   5339 C C     . LEU G 2 8   ? -6.103  12.551  -24.532 1.00 17.58  ? 22   LEU G C     1 
ATOM   5340 O O     . LEU G 2 8   ? -6.662  11.455  -24.521 1.00 17.10  ? 22   LEU G O     1 
ATOM   5341 C CB    . LEU G 2 8   ? -7.942  13.978  -25.477 1.00 15.04  ? 22   LEU G CB    1 
ATOM   5342 C CG    . LEU G 2 8   ? -8.410  14.536  -24.127 1.00 15.08  ? 22   LEU G CG    1 
ATOM   5343 C CD1   . LEU G 2 8   ? -7.567  15.775  -23.716 1.00 16.28  ? 22   LEU G CD1   1 
ATOM   5344 C CD2   . LEU G 2 8   ? -9.902  14.866  -24.155 1.00 15.84  ? 22   LEU G CD2   1 
ATOM   5345 N N     . ARG G 2 9   ? -5.166  12.917  -23.663 1.00 20.95  ? 23   ARG G N     1 
ATOM   5346 C CA    . ARG G 2 9   ? -4.629  12.023  -22.644 1.00 24.11  ? 23   ARG G CA    1 
ATOM   5347 C C     . ARG G 2 9   ? -5.498  12.066  -21.401 1.00 25.51  ? 23   ARG G C     1 
ATOM   5348 O O     . ARG G 2 9   ? -6.008  13.125  -21.038 1.00 25.68  ? 23   ARG G O     1 
ATOM   5349 C CB    . ARG G 2 9   ? -3.203  12.441  -22.302 1.00 24.78  ? 23   ARG G CB    1 
ATOM   5350 C CG    . ARG G 2 9   ? -2.384  11.387  -21.591 1.00 26.87  ? 23   ARG G CG    1 
ATOM   5351 C CD    . ARG G 2 9   ? -1.103  11.191  -22.361 1.00 28.40  ? 23   ARG G CD    1 
ATOM   5352 N NE    . ARG G 2 9   ? -1.351  10.454  -23.597 1.00 28.97  ? 23   ARG G NE    1 
ATOM   5353 C CZ    . ARG G 2 9   ? -0.805  10.734  -24.775 1.00 28.59  ? 23   ARG G CZ    1 
ATOM   5354 N NH1   . ARG G 2 9   ? 0.024   11.761  -24.909 1.00 29.35  ? 23   ARG G NH1   1 
ATOM   5355 N NH2   . ARG G 2 9   ? -1.104  9.986   -25.823 1.00 28.29  ? 23   ARG G NH2   1 
ATOM   5356 N N     . ASP G 2 10  ? -5.620  10.910  -20.743 1.00 27.31  ? 24   ASP G N     1 
ATOM   5357 C CA    . ASP G 2 10  ? -6.531  10.682  -19.617 1.00 29.10  ? 24   ASP G CA    1 
ATOM   5358 C C     . ASP G 2 10  ? -7.944  10.438  -20.142 1.00 29.73  ? 24   ASP G C     1 
ATOM   5359 O O     . ASP G 2 10  ? -8.279  9.328   -20.561 1.00 30.77  ? 24   ASP G O     1 
ATOM   5360 C CB    . ASP G 2 10  ? -6.542  11.851  -18.613 1.00 29.69  ? 24   ASP G CB    1 
ATOM   5361 C CG    . ASP G 2 10  ? -5.168  12.149  -18.002 1.00 30.98  ? 24   ASP G CG    1 
ATOM   5362 O OD1   . ASP G 2 10  ? -4.119  11.664  -18.492 1.00 31.31  ? 24   ASP G OD1   1 
ATOM   5363 O OD2   . ASP G 2 10  ? -5.145  12.909  -17.012 1.00 33.31  ? 24   ASP G OD2   1 
ATOM   5364 N N     . LYS H 2 2   ? -14.400 34.420  -55.608 1.00 21.27  ? 16   LYS H N     1 
ATOM   5365 C CA    . LYS H 2 2   ? -14.333 33.001  -55.151 1.00 20.30  ? 16   LYS H CA    1 
ATOM   5366 C C     . LYS H 2 2   ? -13.075 32.360  -55.717 1.00 19.20  ? 16   LYS H C     1 
ATOM   5367 O O     . LYS H 2 2   ? -13.073 31.906  -56.873 1.00 20.36  ? 16   LYS H O     1 
ATOM   5368 N N     . ARG H 2 3   ? -12.017 32.337  -54.900 1.00 16.59  ? 17   ARG H N     1 
ATOM   5369 C CA    . ARG H 2 3   ? -10.695 31.905  -55.348 1.00 14.69  ? 17   ARG H CA    1 
ATOM   5370 C C     . ARG H 2 3   ? -10.294 30.572  -54.741 1.00 14.10  ? 17   ARG H C     1 
ATOM   5371 O O     . ARG H 2 3   ? -10.527 30.315  -53.548 1.00 15.90  ? 17   ARG H O     1 
ATOM   5372 C CB    . ARG H 2 3   ? -9.638  32.934  -54.951 1.00 14.57  ? 17   ARG H CB    1 
ATOM   5373 C CG    . ARG H 2 3   ? -9.775  34.270  -55.674 1.00 13.40  ? 17   ARG H CG    1 
ATOM   5374 C CD    . ARG H 2 3   ? -8.761  35.277  -55.169 1.00 13.18  ? 17   ARG H CD    1 
ATOM   5375 N NE    . ARG H 2 3   ? -7.409  34.768  -55.341 1.00 12.61  ? 17   ARG H NE    1 
ATOM   5376 C CZ    . ARG H 2 3   ? -6.711  34.831  -56.468 1.00 10.65  ? 17   ARG H CZ    1 
ATOM   5377 N NH1   . ARG H 2 3   ? -7.221  35.402  -57.566 1.00 10.24  ? 17   ARG H NH1   1 
ATOM   5378 N NH2   . ARG H 2 3   ? -5.494  34.300  -56.493 1.00 11.66  ? 17   ARG H NH2   1 
ATOM   5379 N N     . HIS H 2 4   ? -9.652  29.735  -55.548 1.00 11.08  ? 18   HIS H N     1 
ATOM   5380 C CA    . HIS H 2 4   ? -8.946  28.572  -55.016 1.00 9.91   ? 18   HIS H CA    1 
ATOM   5381 C C     . HIS H 2 4   ? -7.454  28.859  -55.024 1.00 9.40   ? 18   HIS H C     1 
ATOM   5382 O O     . HIS H 2 4   ? -7.013  29.911  -55.506 1.00 10.85  ? 18   HIS H O     1 
ATOM   5383 C CB    . HIS H 2 4   ? -9.264  27.298  -55.832 1.00 8.91   ? 18   HIS H CB    1 
ATOM   5384 C CG    . HIS H 2 4   ? -8.657  27.304  -57.205 1.00 8.22   ? 18   HIS H CG    1 
ATOM   5385 N ND1   . HIS H 2 4   ? -7.365  26.874  -57.443 1.00 6.98   ? 18   HIS H ND1   1 
ATOM   5386 C CD2   . HIS H 2 4   ? -9.141  27.739  -58.399 1.00 8.31   ? 18   HIS H CD2   1 
ATOM   5387 C CE1   . HIS H 2 4   ? -7.077  27.059  -58.722 1.00 7.90   ? 18   HIS H CE1   1 
ATOM   5388 N NE2   . HIS H 2 4   ? -8.141  27.570  -59.326 1.00 7.99   ? 18   HIS H NE2   1 
ATOM   5389 N N     . ARG H 2 5   ? -6.680  27.917  -54.485 1.00 8.32   ? 19   ARG H N     1 
ATOM   5390 C CA    . ARG H 2 5   ? -5.224  27.994  -54.532 1.00 9.73   ? 19   ARG H CA    1 
ATOM   5391 C C     . ARG H 2 5   ? -4.638  26.784  -55.245 1.00 7.93   ? 19   ARG H C     1 
ATOM   5392 O O     . ARG H 2 5   ? -5.357  25.838  -55.603 1.00 7.85   ? 19   ARG H O     1 
ATOM   5393 C CB    . ARG H 2 5   ? -4.619  28.070  -53.117 1.00 10.73  ? 19   ARG H CB    1 
ATOM   5394 C CG    . ARG H 2 5   ? -5.047  29.269  -52.304 1.00 12.77  ? 19   ARG H CG    1 
ATOM   5395 C CD    . ARG H 2 5   ? -4.495  29.226  -50.885 1.00 13.51  ? 19   ARG H CD    1 
ATOM   5396 N NE    . ARG H 2 5   ? -4.860  30.469  -50.197 1.00 17.47  ? 19   ARG H NE    1 
ATOM   5397 C CZ    . ARG H 2 5   ? -5.501  30.526  -49.031 1.00 18.64  ? 19   ARG H CZ    1 
ATOM   5398 N NH1   . ARG H 2 5   ? -5.819  29.417  -48.377 1.00 18.89  ? 19   ARG H NH1   1 
ATOM   5399 N NH2   . ARG H 2 5   ? -5.809  31.709  -48.510 1.00 20.69  ? 19   ARG H NH2   1 
ATOM   5400 N N     . LYS H 2 6   ? -3.318  26.824  -55.436 1.00 7.59   ? 20   LYS H N     1 
ATOM   5401 C CA    . LYS H 2 6   ? -2.543  25.629  -55.723 1.00 7.80   ? 20   LYS H CA    1 
ATOM   5402 C C     . LYS H 2 6   ? -1.668  25.463  -54.479 1.00 8.34   ? 20   LYS H C     1 
ATOM   5403 O O     . LYS H 2 6   ? -1.138  26.456  -53.957 1.00 8.55   ? 20   LYS H O     1 
ATOM   5404 C CB    . LYS H 2 6   ? -1.717  25.844  -56.976 1.00 6.38   ? 20   LYS H CB    1 
ATOM   5405 C CG    . LYS H 2 6   ? -2.568  26.077  -58.232 1.00 7.29   ? 20   LYS H CG    1 
ATOM   5406 C CD    . LYS H 2 6   ? -1.757  26.587  -59.439 1.00 7.30   ? 20   LYS H CD    1 
ATOM   5407 C CE    . LYS H 2 6   ? -2.681  26.950  -60.599 1.00 6.51   ? 20   LYS H CE    1 
ATOM   5408 N NZ    . LYS H 2 6   ? -1.906  27.391  -61.823 1.00 6.66   ? 20   LYS H NZ    1 
ATOM   5409 N N     . VAL H 2 7   ? -1.580  24.238  -53.965 1.00 8.79   ? 21   VAL H N     1 
ATOM   5410 C CA    . VAL H 2 7   ? -0.930  23.998  -52.673 1.00 11.14  ? 21   VAL H CA    1 
ATOM   5411 C C     . VAL H 2 7   ? -0.139  22.710  -52.752 1.00 10.34  ? 21   VAL H C     1 
ATOM   5412 O O     . VAL H 2 7   ? -0.673  21.679  -53.158 1.00 10.15  ? 21   VAL H O     1 
ATOM   5413 C CB    . VAL H 2 7   ? -1.972  23.887  -51.526 1.00 12.78  ? 21   VAL H CB    1 
ATOM   5414 C CG1   . VAL H 2 7   ? -1.268  23.607  -50.197 1.00 15.00  ? 21   VAL H CG1   1 
ATOM   5415 C CG2   . VAL H 2 7   ? -2.820  25.166  -51.413 1.00 15.01  ? 21   VAL H CG2   1 
ATOM   5416 N N     . LEU H 2 8   ? 1.128   22.768  -52.355 1.00 10.72  ? 22   LEU H N     1 
ATOM   5417 C CA    . LEU H 2 8   ? 1.966   21.577  -52.329 1.00 12.21  ? 22   LEU H CA    1 
ATOM   5418 C C     . LEU H 2 8   ? 1.605   20.736  -51.118 1.00 14.60  ? 22   LEU H C     1 
ATOM   5419 O O     . LEU H 2 8   ? 1.611   21.237  -49.996 1.00 15.76  ? 22   LEU H O     1 
ATOM   5420 C CB    . LEU H 2 8   ? 3.447   21.974  -52.256 1.00 11.91  ? 22   LEU H CB    1 
ATOM   5421 C CG    . LEU H 2 8   ? 4.441   20.818  -52.419 1.00 12.46  ? 22   LEU H CG    1 
ATOM   5422 C CD1   . LEU H 2 8   ? 4.316   20.168  -53.785 1.00 14.78  ? 22   LEU H CD1   1 
ATOM   5423 C CD2   . LEU H 2 8   ? 5.873   21.309  -52.171 1.00 12.64  ? 22   LEU H CD2   1 
ATOM   5424 N N     . ARG H 2 9   ? 1.296   19.465  -51.364 1.00 16.56  ? 23   ARG H N     1 
ATOM   5425 C CA    . ARG H 2 9   ? 0.961   18.522  -50.287 1.00 18.71  ? 23   ARG H CA    1 
ATOM   5426 C C     . ARG H 2 9   ? 2.064   17.470  -50.127 1.00 20.39  ? 23   ARG H C     1 
ATOM   5427 O O     . ARG H 2 9   ? 2.779   17.120  -51.092 1.00 22.55  ? 23   ARG H O     1 
ATOM   5428 C CB    . ARG H 2 9   ? -0.403  17.861  -50.531 1.00 18.99  ? 23   ARG H CB    1 
ATOM   5429 C CG    . ARG H 2 9   ? -1.579  18.854  -50.643 1.00 19.11  ? 23   ARG H CG    1 
ATOM   5430 C CD    . ARG H 2 9   ? -2.914  18.132  -50.840 1.00 18.49  ? 23   ARG H CD    1 
ATOM   5431 N NE    . ARG H 2 9   ? -3.421  17.586  -49.575 1.00 18.38  ? 23   ARG H NE    1 
ATOM   5432 C CZ    . ARG H 2 9   ? -4.388  18.134  -48.840 1.00 16.11  ? 23   ARG H CZ    1 
ATOM   5433 N NH1   . ARG H 2 9   ? -5.016  19.248  -49.230 1.00 13.58  ? 23   ARG H NH1   1 
ATOM   5434 N NH2   . ARG H 2 9   ? -4.758  17.542  -47.715 1.00 17.17  ? 23   ARG H NH2   1 
HETATM 5435 N N     . SAH I 3 .   ? -2.030  4.323   -20.565 1.00 9.10   ? 2800 SAH A N     1 
HETATM 5436 C CA    . SAH I 3 .   ? -1.096  5.370   -20.040 1.00 10.15  ? 2800 SAH A CA    1 
HETATM 5437 C CB    . SAH I 3 .   ? 0.228   4.734   -19.610 1.00 9.41   ? 2800 SAH A CB    1 
HETATM 5438 C CG    . SAH I 3 .   ? 0.135   4.091   -18.223 1.00 9.52   ? 2800 SAH A CG    1 
HETATM 5439 S SD    . SAH I 3 .   ? 0.116   5.337   -16.913 1.00 9.71   ? 2800 SAH A SD    1 
HETATM 5440 C C     . SAH I 3 .   ? -0.851  6.472   -21.056 1.00 10.80  ? 2800 SAH A C     1 
HETATM 5441 O O     . SAH I 3 .   ? -0.148  7.437   -20.722 1.00 11.58  ? 2800 SAH A O     1 
HETATM 5442 O OXT   . SAH I 3 .   ? -1.341  6.397   -22.197 1.00 11.23  ? 2800 SAH A OXT   1 
HETATM 5443 C "C5'" . SAH I 3 .   ? -1.380  4.859   -16.000 1.00 9.81   ? 2800 SAH A "C5'" 1 
HETATM 5444 C "C4'" . SAH I 3 .   ? -2.688  5.210   -16.681 1.00 10.60  ? 2800 SAH A "C4'" 1 
HETATM 5445 O "O4'" . SAH I 3 .   ? -2.942  4.273   -17.722 1.00 10.26  ? 2800 SAH A "O4'" 1 
HETATM 5446 C "C3'" . SAH I 3 .   ? -3.901  5.069   -15.777 1.00 10.87  ? 2800 SAH A "C3'" 1 
HETATM 5447 O "O3'" . SAH I 3 .   ? -4.100  6.173   -14.926 1.00 11.56  ? 2800 SAH A "O3'" 1 
HETATM 5448 C "C2'" . SAH I 3 .   ? -5.025  4.857   -16.780 1.00 9.96   ? 2800 SAH A "C2'" 1 
HETATM 5449 O "O2'" . SAH I 3 .   ? -5.347  6.067   -17.450 1.00 11.20  ? 2800 SAH A "O2'" 1 
HETATM 5450 C "C1'" . SAH I 3 .   ? -4.328  3.967   -17.781 1.00 10.20  ? 2800 SAH A "C1'" 1 
HETATM 5451 N N9    . SAH I 3 .   ? -4.464  2.520   -17.499 1.00 9.34   ? 2800 SAH A N9    1 
HETATM 5452 C C8    . SAH I 3 .   ? -3.495  1.669   -17.016 1.00 9.31   ? 2800 SAH A C8    1 
HETATM 5453 N N7    . SAH I 3 .   ? -4.001  0.419   -16.914 1.00 8.93   ? 2800 SAH A N7    1 
HETATM 5454 C C5    . SAH I 3 .   ? -5.291  0.448   -17.356 1.00 8.56   ? 2800 SAH A C5    1 
HETATM 5455 C C6    . SAH I 3 .   ? -6.277  -0.530  -17.478 1.00 9.92   ? 2800 SAH A C6    1 
HETATM 5456 N N6    . SAH I 3 .   ? -6.062  -1.802  -17.156 1.00 9.92   ? 2800 SAH A N6    1 
HETATM 5457 N N1    . SAH I 3 .   ? -7.506  -0.151  -17.950 1.00 10.59  ? 2800 SAH A N1    1 
HETATM 5458 C C2    . SAH I 3 .   ? -7.773  1.151   -18.288 1.00 10.82  ? 2800 SAH A C2    1 
HETATM 5459 N N3    . SAH I 3 .   ? -6.815  2.123   -18.176 1.00 10.32  ? 2800 SAH A N3    1 
HETATM 5460 C C4    . SAH I 3 .   ? -5.586  1.767   -17.714 1.00 9.59   ? 2800 SAH A C4    1 
HETATM 5461 N N     . SAH J 3 .   ? 0.725   1.005   6.257   1.00 8.34   ? 2801 SAH B N     1 
HETATM 5462 C CA    . SAH J 3 .   ? -0.383  0.067   5.910   1.00 8.96   ? 2801 SAH B CA    1 
HETATM 5463 C CB    . SAH J 3 .   ? -1.484  0.098   6.979   1.00 8.79   ? 2801 SAH B CB    1 
HETATM 5464 C CG    . SAH J 3 .   ? -1.181  -0.724  8.231   1.00 9.34   ? 2801 SAH B CG    1 
HETATM 5465 S SD    . SAH J 3 .   ? -1.358  -2.493  7.873   1.00 9.50   ? 2801 SAH B SD    1 
HETATM 5466 C C     . SAH J 3 .   ? -0.918  0.391   4.526   1.00 9.03   ? 2801 SAH B C     1 
HETATM 5467 O O     . SAH J 3 .   ? -1.734  -0.377  4.006   1.00 10.20  ? 2801 SAH B O     1 
HETATM 5468 O OXT   . SAH J 3 .   ? -0.516  1.403   3.923   1.00 9.58   ? 2801 SAH B OXT   1 
HETATM 5469 C "C5'" . SAH J 3 .   ? 0.261   -3.131  8.381   1.00 8.00   ? 2801 SAH B "C5'" 1 
HETATM 5470 C "C4'" . SAH J 3 .   ? 1.417   -2.806  7.458   1.00 7.28   ? 2801 SAH B "C4'" 1 
HETATM 5471 O "O4'" . SAH J 3 .   ? 1.782   -1.433  7.551   1.00 7.79   ? 2801 SAH B "O4'" 1 
HETATM 5472 C "C3'" . SAH J 3 .   ? 2.688   -3.579  7.782   1.00 8.91   ? 2801 SAH B "C3'" 1 
HETATM 5473 O "O3'" . SAH J 3 .   ? 2.715   -4.910  7.291   1.00 10.50  ? 2801 SAH B "O3'" 1 
HETATM 5474 C "C2'" . SAH J 3 .   ? 3.738   -2.698  7.153   1.00 8.44   ? 2801 SAH B "C2'" 1 
HETATM 5475 O "O2'" . SAH J 3 .   ? 3.697   -2.780  5.732   1.00 10.49  ? 2801 SAH B "O2'" 1 
HETATM 5476 C "C1'" . SAH J 3 .   ? 3.196   -1.333  7.525   1.00 8.58   ? 2801 SAH B "C1'" 1 
HETATM 5477 N N9    . SAH J 3 .   ? 3.659   -0.835  8.841   1.00 8.88   ? 2801 SAH B N9    1 
HETATM 5478 C C8    . SAH J 3 .   ? 2.939   -0.731  10.005  1.00 8.67   ? 2801 SAH B C8    1 
HETATM 5479 N N7    . SAH J 3 .   ? 3.703   -0.177  10.974  1.00 8.01   ? 2801 SAH B N7    1 
HETATM 5480 C C5    . SAH J 3 .   ? 4.923   0.101   10.426  1.00 7.26   ? 2801 SAH B C5    1 
HETATM 5481 C C6    . SAH J 3 .   ? 6.095   0.653   10.933  1.00 8.41   ? 2801 SAH B C6    1 
HETATM 5482 N N6    . SAH J 3 .   ? 6.162   1.073   12.205  1.00 9.66   ? 2801 SAH B N6    1 
HETATM 5483 N N1    . SAH J 3 .   ? 7.179   0.776   10.088  1.00 9.57   ? 2801 SAH B N1    1 
HETATM 5484 C C2    . SAH J 3 .   ? 7.104   0.357   8.774   1.00 9.05   ? 2801 SAH B C2    1 
HETATM 5485 N N3    . SAH J 3 .   ? 5.966   -0.221  8.266   1.00 9.42   ? 2801 SAH B N3    1 
HETATM 5486 C C4    . SAH J 3 .   ? 4.888   -0.316  9.084   1.00 7.19   ? 2801 SAH B C4    1 
HETATM 5487 N N     . SAH K 3 .   ? -2.663  23.428  -40.828 1.00 8.15   ? 2802 SAH C N     1 
HETATM 5488 C CA    . SAH K 3 .   ? -3.681  22.388  -41.135 1.00 8.71   ? 2802 SAH C CA    1 
HETATM 5489 C CB    . SAH K 3 .   ? -4.781  22.323  -40.080 1.00 8.29   ? 2802 SAH C CB    1 
HETATM 5490 C CG    . SAH K 3 .   ? -4.391  21.534  -38.826 1.00 9.28   ? 2802 SAH C CG    1 
HETATM 5491 S SD    . SAH K 3 .   ? -4.371  19.757  -39.171 1.00 9.13   ? 2802 SAH C SD    1 
HETATM 5492 C C     . SAH K 3 .   ? -4.257  22.626  -42.524 1.00 8.89   ? 2802 SAH C C     1 
HETATM 5493 O O     . SAH K 3 .   ? -5.067  21.809  -43.002 1.00 9.84   ? 2802 SAH C O     1 
HETATM 5494 O OXT   . SAH K 3 .   ? -3.918  23.630  -43.176 1.00 10.40  ? 2802 SAH C OXT   1 
HETATM 5495 C "C5'" . SAH K 3 .   ? -2.703  19.316  -38.604 1.00 8.97   ? 2802 SAH C "C5'" 1 
HETATM 5496 C "C4'" . SAH K 3 .   ? -1.608  19.721  -39.572 1.00 8.83   ? 2802 SAH C "C4'" 1 
HETATM 5497 O "O4'" . SAH K 3 .   ? -1.349  21.130  -39.500 1.00 9.45   ? 2802 SAH C "O4'" 1 
HETATM 5498 C "C3'" . SAH K 3 .   ? -0.266  19.082  -39.257 1.00 9.79   ? 2802 SAH C "C3'" 1 
HETATM 5499 O "O3'" . SAH K 3 .   ? -0.118  17.752  -39.712 1.00 10.22  ? 2802 SAH C "O3'" 1 
HETATM 5500 C "C2'" . SAH K 3 .   ? 0.699   20.057  -39.913 1.00 9.46   ? 2802 SAH C "C2'" 1 
HETATM 5501 O "O2'" . SAH K 3 .   ? 0.687   19.948  -41.325 1.00 10.58  ? 2802 SAH C "O2'" 1 
HETATM 5502 C "C1'" . SAH K 3 .   ? 0.042   21.375  -39.577 1.00 9.79   ? 2802 SAH C "C1'" 1 
HETATM 5503 N N9    . SAH K 3 .   ? 0.475   21.942  -38.282 1.00 8.99   ? 2802 SAH C N9    1 
HETATM 5504 C C8    . SAH K 3 .   ? -0.248  22.001  -37.112 1.00 9.04   ? 2802 SAH C C8    1 
HETATM 5505 N N7    . SAH K 3 .   ? 0.479   22.635  -36.166 1.00 9.16   ? 2802 SAH C N7    1 
HETATM 5506 C C5    . SAH K 3 .   ? 1.675   22.978  -36.709 1.00 7.89   ? 2802 SAH C C5    1 
HETATM 5507 C C6    . SAH K 3 .   ? 2.796   23.645  -36.211 1.00 8.82   ? 2802 SAH C C6    1 
HETATM 5508 N N6    . SAH K 3 .   ? 2.876   24.090  -34.953 1.00 8.86   ? 2802 SAH C N6    1 
HETATM 5509 N N1    . SAH K 3 .   ? 3.854   23.830  -37.072 1.00 9.47   ? 2802 SAH C N1    1 
HETATM 5510 C C2    . SAH K 3 .   ? 3.832   23.398  -38.378 1.00 10.02  ? 2802 SAH C C2    1 
HETATM 5511 N N3    . SAH K 3 .   ? 2.738   22.739  -38.862 1.00 8.91   ? 2802 SAH C N3    1 
HETATM 5512 C C4    . SAH K 3 .   ? 1.673   22.550  -38.039 1.00 8.26   ? 2802 SAH C C4    1 
HETATM 5513 N N     . SAH L 3 .   ? -6.358  27.206  -67.677 1.00 6.86   ? 2803 SAH D N     1 
HETATM 5514 C CA    . SAH L 3 .   ? -5.517  28.292  -67.076 1.00 7.31   ? 2803 SAH D CA    1 
HETATM 5515 C CB    . SAH L 3 .   ? -4.155  27.741  -66.659 1.00 6.75   ? 2803 SAH D CB    1 
HETATM 5516 C CG    . SAH L 3 .   ? -4.201  27.040  -65.286 1.00 6.68   ? 2803 SAH D CG    1 
HETATM 5517 S SD    . SAH L 3 .   ? -4.390  28.269  -63.947 1.00 7.43   ? 2803 SAH D SD    1 
HETATM 5518 C C     . SAH L 3 .   ? -5.332  29.433  -68.068 1.00 7.74   ? 2803 SAH D C     1 
HETATM 5519 O O     . SAH L 3 .   ? -4.742  30.469  -67.732 1.00 8.96   ? 2803 SAH D O     1 
HETATM 5520 O OXT   . SAH L 3 .   ? -5.740  29.307  -69.227 1.00 8.85   ? 2803 SAH D OXT   1 
HETATM 5521 C "C5'" . SAH L 3 .   ? -5.808  27.569  -63.041 1.00 6.72   ? 2803 SAH D "C5'" 1 
HETATM 5522 C "C4'" . SAH L 3 .   ? -7.149  27.782  -63.711 1.00 6.91   ? 2803 SAH D "C4'" 1 
HETATM 5523 O "O4'" . SAH L 3 .   ? -7.273  26.882  -64.800 1.00 7.97   ? 2803 SAH D "O4'" 1 
HETATM 5524 C "C3'" . SAH L 3 .   ? -8.305  27.379  -62.805 1.00 7.71   ? 2803 SAH D "C3'" 1 
HETATM 5525 O "O3'" . SAH L 3 .   ? -8.663  28.389  -61.887 1.00 8.06   ? 2803 SAH D "O3'" 1 
HETATM 5526 C "C2'" . SAH L 3 .   ? -9.404  27.082  -63.816 1.00 7.57   ? 2803 SAH D "C2'" 1 
HETATM 5527 O "O2'" . SAH L 3 .   ? -9.943  28.284  -64.367 1.00 8.98   ? 2803 SAH D "O2'" 1 
HETATM 5528 C "C1'" . SAH L 3 .   ? -8.597  26.388  -64.886 1.00 7.90   ? 2803 SAH D "C1'" 1 
HETATM 5529 N N9    . SAH L 3 .   ? -8.533  24.929  -64.675 1.00 7.21   ? 2803 SAH D N9    1 
HETATM 5530 C C8    . SAH L 3 .   ? -7.458  24.191  -64.247 1.00 7.88   ? 2803 SAH D C8    1 
HETATM 5531 N N7    . SAH L 3 .   ? -7.787  22.876  -64.212 1.00 6.82   ? 2803 SAH D N7    1 
HETATM 5532 C C5    . SAH L 3 .   ? -9.079  22.767  -64.657 1.00 6.05   ? 2803 SAH D C5    1 
HETATM 5533 C C6    . SAH L 3 .   ? -9.922  21.665  -64.825 1.00 7.21   ? 2803 SAH D C6    1 
HETATM 5534 N N6    . SAH L 3 .   ? -9.507  20.414  -64.553 1.00 8.26   ? 2803 SAH D N6    1 
HETATM 5535 N N1    . SAH L 3 .   ? -11.198 21.919  -65.294 1.00 8.57   ? 2803 SAH D N1    1 
HETATM 5536 C C2    . SAH L 3 .   ? -11.613 23.204  -65.565 1.00 8.49   ? 2803 SAH D C2    1 
HETATM 5537 N N3    . SAH L 3 .   ? -10.800 24.298  -65.393 1.00 7.43   ? 2803 SAH D N3    1 
HETATM 5538 C C4    . SAH L 3 .   ? -9.539  24.059  -64.951 1.00 6.25   ? 2803 SAH D C4    1 
HETATM 5539 O O     . HOH M 4 .   ? 0.816   -1.792  -21.573 1.00 8.00   ? 2801 HOH A O     1 
HETATM 5540 O O     . HOH M 4 .   ? 3.568   1.912   -16.024 1.00 8.97   ? 2802 HOH A O     1 
HETATM 5541 O O     . HOH M 4 .   ? 7.059   7.489   -22.562 1.00 13.89  ? 2803 HOH A O     1 
HETATM 5542 O O     . HOH M 4 .   ? 9.700   4.707   -17.697 1.00 10.14  ? 2804 HOH A O     1 
HETATM 5543 O O     . HOH M 4 .   ? -1.534  -6.174  -27.929 1.00 11.43  ? 2805 HOH A O     1 
HETATM 5544 O O     . HOH M 4 .   ? -4.145  -6.432  -23.778 1.00 11.30  ? 2806 HOH A O     1 
HETATM 5545 O O     . HOH M 4 .   ? -5.281  -4.834  -18.434 1.00 10.59  ? 2807 HOH A O     1 
HETATM 5546 O O     . HOH M 4 .   ? 13.827  3.062   -11.295 1.00 12.32  ? 2808 HOH A O     1 
HETATM 5547 O O     . HOH M 4 .   ? 11.465  2.927   -19.018 1.00 10.27  ? 2809 HOH A O     1 
HETATM 5548 O O     . HOH M 4 .   ? 12.880  -18.687 -18.967 1.00 13.32  ? 2810 HOH A O     1 
HETATM 5549 O O     . HOH M 4 .   ? 3.219   -17.689 -21.230 1.00 15.49  ? 2811 HOH A O     1 
HETATM 5550 O O     . HOH M 4 .   ? -1.066  -9.310  -22.388 1.00 11.08  ? 2812 HOH A O     1 
HETATM 5551 O O     . HOH M 4 .   ? 2.766   -7.661  -11.335 1.00 13.04  ? 2813 HOH A O     1 
HETATM 5552 O O     . HOH M 4 .   ? 6.117   -20.537 -23.776 1.00 14.21  ? 2814 HOH A O     1 
HETATM 5553 O O     . HOH M 4 .   ? -7.050  -2.393  -28.743 1.00 16.03  ? 2815 HOH A O     1 
HETATM 5554 O O     . HOH M 4 .   ? 6.096   -19.120 -18.896 1.00 19.37  ? 2816 HOH A O     1 
HETATM 5555 O O     . HOH M 4 .   ? 1.561   11.423  -11.908 1.00 15.98  ? 2817 HOH A O     1 
HETATM 5556 O O     . HOH M 4 .   ? 11.595  9.503   2.126   1.00 15.95  ? 2818 HOH A O     1 
HETATM 5557 O O     . HOH M 4 .   ? 3.326   -2.673  -8.144  1.00 12.54  ? 2819 HOH A O     1 
HETATM 5558 O O     . HOH M 4 .   ? 7.148   -20.531 -26.390 1.00 14.02  ? 2820 HOH A O     1 
HETATM 5559 O O     . HOH M 4 .   ? 3.789   8.381   -26.873 1.00 14.88  ? 2821 HOH A O     1 
HETATM 5560 O O     . HOH M 4 .   ? 10.455  8.804   -17.711 1.00 15.28  ? 2822 HOH A O     1 
HETATM 5561 O O     . HOH M 4 .   ? 6.096   -14.940 -29.596 1.00 14.35  ? 2823 HOH A O     1 
HETATM 5562 O O     . HOH M 4 .   ? 13.196  9.320   -17.822 1.00 17.66  ? 2824 HOH A O     1 
HETATM 5563 O O     . HOH M 4 .   ? -0.119  -8.800  -12.702 1.00 16.52  ? 2825 HOH A O     1 
HETATM 5564 O O     . HOH M 4 .   ? 4.713   5.909   2.477   1.00 14.58  ? 2826 HOH A O     1 
HETATM 5565 O O     . HOH M 4 .   ? 9.250   10.849  -16.506 1.00 16.81  ? 2827 HOH A O     1 
HETATM 5566 O O     . HOH M 4 .   ? 2.013   -14.018 -30.901 1.00 13.52  ? 2828 HOH A O     1 
HETATM 5567 O O     . HOH M 4 .   ? -3.300  8.635   -15.714 1.00 16.89  ? 2829 HOH A O     1 
HETATM 5568 O O     . HOH M 4 .   ? -3.691  -4.685  -7.075  1.00 18.87  ? 2830 HOH A O     1 
HETATM 5569 O O     . HOH M 4 .   ? -11.065 -3.480  -28.944 1.00 16.00  ? 2831 HOH A O     1 
HETATM 5570 O O     . HOH M 4 .   ? -0.602  -7.484  -31.601 1.00 14.51  ? 2832 HOH A O     1 
HETATM 5571 O O     . HOH M 4 .   ? 4.384   -5.732  -9.987  1.00 15.86  ? 2833 HOH A O     1 
HETATM 5572 O O     . HOH M 4 .   ? 16.980  -0.702  -19.953 1.00 14.60  ? 2834 HOH A O     1 
HETATM 5573 O O     . HOH M 4 .   ? -4.022  6.677   -19.978 1.00 17.89  ? 2835 HOH A O     1 
HETATM 5574 O O     . HOH M 4 .   ? -3.738  -0.485  -1.655  1.00 14.84  ? 2836 HOH A O     1 
HETATM 5575 O O     . HOH M 4 .   ? 11.545  -6.315  -4.912  1.00 19.23  ? 2837 HOH A O     1 
HETATM 5576 O O     . HOH M 4 .   ? -5.711  -2.897  -7.624  1.00 16.38  ? 2838 HOH A O     1 
HETATM 5577 O O     . HOH M 4 .   ? 14.634  0.493   -19.182 1.00 13.67  ? 2839 HOH A O     1 
HETATM 5578 O O     . HOH M 4 .   ? -7.729  -4.560  -6.108  1.00 22.07  ? 2840 HOH A O     1 
HETATM 5579 O O     . HOH M 4 .   ? 21.702  -16.159 -14.366 1.00 14.41  ? 2841 HOH A O     1 
HETATM 5580 O O     . HOH M 4 .   ? 10.571  -18.127 -24.411 1.00 18.77  ? 2842 HOH A O     1 
HETATM 5581 O O     . HOH M 4 .   ? 19.044  -5.564  -5.285  1.00 22.47  ? 2843 HOH A O     1 
HETATM 5582 O O     . HOH M 4 .   ? 10.174  -14.138 -13.161 1.00 18.18  ? 2844 HOH A O     1 
HETATM 5583 O O     . HOH M 4 .   ? -9.249  -3.614  -3.614  1.00 19.61  ? 2845 HOH A O     1 
HETATM 5584 O O     . HOH M 4 .   ? -2.379  -4.239  -29.726 1.00 13.32  ? 2846 HOH A O     1 
HETATM 5585 O O     . HOH M 4 .   ? 14.535  -10.799 -23.563 1.00 21.31  ? 2847 HOH A O     1 
HETATM 5586 O O     . HOH M 4 .   ? -9.162  4.335   0.365   1.00 18.66  ? 2848 HOH A O     1 
HETATM 5587 O O     . HOH M 4 .   ? 7.174   2.701   -29.981 1.00 18.44  ? 2849 HOH A O     1 
HETATM 5588 O O     . HOH M 4 .   ? 17.259  -10.395 -19.130 1.00 19.20  ? 2850 HOH A O     1 
HETATM 5589 O O     . HOH M 4 .   ? 22.510  3.455   -10.310 1.00 19.54  ? 2851 HOH A O     1 
HETATM 5590 O O     . HOH M 4 .   ? 10.900  -19.761 -20.514 1.00 20.18  ? 2852 HOH A O     1 
HETATM 5591 O O     . HOH M 4 .   ? 13.871  -5.211  -23.111 1.00 17.54  ? 2853 HOH A O     1 
HETATM 5592 O O     . HOH M 4 .   ? 8.585   13.326  -13.875 1.00 20.81  ? 2854 HOH A O     1 
HETATM 5593 O O     . HOH M 4 .   ? 17.538  -13.111 -19.483 1.00 15.82  ? 2855 HOH A O     1 
HETATM 5594 O O     . HOH M 4 .   ? 6.555   10.828  -24.408 1.00 18.49  ? 2856 HOH A O     1 
HETATM 5595 O O     . HOH M 4 .   ? 23.484  -16.727 -16.351 1.00 17.65  ? 2857 HOH A O     1 
HETATM 5596 O O     . HOH M 4 .   ? 18.513  4.222   -14.296 1.00 17.95  ? 2858 HOH A O     1 
HETATM 5597 O O     . HOH M 4 .   ? 16.241  -3.949  -23.501 1.00 20.45  ? 2859 HOH A O     1 
HETATM 5598 O O     . HOH M 4 .   ? 22.730  -7.006  -20.105 1.00 21.53  ? 2860 HOH A O     1 
HETATM 5599 O O     . HOH M 4 .   ? 17.726  2.453   -17.323 1.00 18.43  ? 2861 HOH A O     1 
HETATM 5600 O O     . HOH M 4 .   ? 16.975  -21.682 -4.016  1.00 29.65  ? 2862 HOH A O     1 
HETATM 5601 O O     . HOH M 4 .   ? -9.746  -1.353  -18.894 1.00 19.50  ? 2863 HOH A O     1 
HETATM 5602 O O     . HOH M 4 .   ? 22.306  -3.040  -22.980 1.00 22.35  ? 2864 HOH A O     1 
HETATM 5603 O O     . HOH M 4 .   ? 12.673  -0.638  4.196   1.00 24.09  ? 2865 HOH A O     1 
HETATM 5604 O O     . HOH M 4 .   ? 24.771  -13.311 -18.691 1.00 21.24  ? 2866 HOH A O     1 
HETATM 5605 O O     . HOH M 4 .   ? 23.939  0.168   -14.035 1.00 21.52  ? 2867 HOH A O     1 
HETATM 5606 O O     . HOH M 4 .   ? 2.578   -14.747 -14.825 1.00 22.82  ? 2868 HOH A O     1 
HETATM 5607 O O     . HOH M 4 .   ? 15.154  -15.608 -18.242 1.00 22.31  ? 2869 HOH A O     1 
HETATM 5608 O O     . HOH M 4 .   ? 10.072  5.744   -27.125 1.00 23.72  ? 2870 HOH A O     1 
HETATM 5609 O O     . HOH M 4 .   ? 12.542  3.600   -25.061 1.00 19.20  ? 2871 HOH A O     1 
HETATM 5610 O O     . HOH M 4 .   ? 1.650   -6.611  -6.505  1.00 20.04  ? 2872 HOH A O     1 
HETATM 5611 O O     . HOH M 4 .   ? -0.056  9.883   -7.296  1.00 23.80  ? 2873 HOH A O     1 
HETATM 5612 O O     . HOH M 4 .   ? 6.441   -18.959 -29.577 1.00 22.51  ? 2874 HOH A O     1 
HETATM 5613 O O     . HOH M 4 .   ? 13.484  14.287  -3.254  1.00 21.19  ? 2875 HOH A O     1 
HETATM 5614 O O     . HOH M 4 .   ? 8.106   -1.356  -1.377  1.00 21.10  ? 2876 HOH A O     1 
HETATM 5615 O O     . HOH M 4 .   ? 25.630  -1.323  -20.511 1.00 21.53  ? 2877 HOH A O     1 
HETATM 5616 O O     . HOH M 4 .   ? -8.351  -3.655  -25.198 1.00 18.16  ? 2878 HOH A O     1 
HETATM 5617 O O     . HOH M 4 .   ? -7.166  7.583   -16.181 1.00 23.42  ? 2879 HOH A O     1 
HETATM 5618 O O     . HOH M 4 .   ? 24.696  2.916   -8.710  1.00 20.65  ? 2880 HOH A O     1 
HETATM 5619 O O     . HOH M 4 .   ? 14.390  6.324   -12.670 1.00 19.86  ? 2881 HOH A O     1 
HETATM 5620 O O     . HOH M 4 .   ? 5.626   17.691  1.375   1.00 27.44  ? 2882 HOH A O     1 
HETATM 5621 O O     . HOH M 4 .   ? 16.711  -11.090 -15.270 1.00 17.91  ? 2883 HOH A O     1 
HETATM 5622 O O     . HOH M 4 .   ? -1.256  2.250   -32.407 1.00 31.42  ? 2884 HOH A O     1 
HETATM 5623 O O     . HOH M 4 .   ? 18.784  5.217   -17.705 1.00 19.06  ? 2885 HOH A O     1 
HETATM 5624 O O     . HOH M 4 .   ? -16.807 -2.250  -11.419 1.00 21.50  ? 2886 HOH A O     1 
HETATM 5625 O O     . HOH M 4 .   ? -8.597  5.125   -21.290 1.00 38.01  ? 2887 HOH A O     1 
HETATM 5626 O O     . HOH M 4 .   ? 15.809  -9.021  -21.714 1.00 22.54  ? 2888 HOH A O     1 
HETATM 5627 O O     . HOH M 4 .   ? 10.318  -13.561 -30.995 1.00 22.34  ? 2889 HOH A O     1 
HETATM 5628 O O     . HOH M 4 .   ? 18.855  -10.427 -16.892 1.00 21.55  ? 2890 HOH A O     1 
HETATM 5629 O O     . HOH M 4 .   ? -9.896  -1.710  -21.746 1.00 17.59  ? 2891 HOH A O     1 
HETATM 5630 O O     . HOH M 4 .   ? -8.317  -4.391  -15.412 1.00 31.31  ? 2892 HOH A O     1 
HETATM 5631 O O     . HOH M 4 .   ? 24.028  -2.362  -25.101 1.00 31.31  ? 2893 HOH A O     1 
HETATM 5632 O O     . HOH M 4 .   ? 2.712   -10.670 -13.654 1.00 26.18  ? 2894 HOH A O     1 
HETATM 5633 O O     . HOH M 4 .   ? -3.366  5.468   -3.595  1.00 21.10  ? 2895 HOH A O     1 
HETATM 5634 O O     . HOH M 4 .   ? 17.224  5.260   -9.719  1.00 23.24  ? 2896 HOH A O     1 
HETATM 5635 O O     . HOH M 4 .   ? 8.766   -8.055  -6.432  1.00 42.77  ? 2897 HOH A O     1 
HETATM 5636 O O     . HOH M 4 .   ? -18.266 -0.449  -1.060  1.00 33.84  ? 2898 HOH A O     1 
HETATM 5637 O O     . HOH M 4 .   ? -6.915  -7.357  -15.410 1.00 30.02  ? 2899 HOH A O     1 
HETATM 5638 O O     . HOH M 4 .   ? 16.542  8.321   -20.295 1.00 26.89  ? 2900 HOH A O     1 
HETATM 5639 O O     . HOH M 4 .   ? -8.019  -3.808  -18.055 1.00 20.71  ? 2901 HOH A O     1 
HETATM 5640 O O     . HOH M 4 .   ? 16.227  10.102  -10.830 1.00 27.19  ? 2902 HOH A O     1 
HETATM 5641 O O     . HOH M 4 .   ? 26.108  -13.664 -6.198  1.00 32.05  ? 2903 HOH A O     1 
HETATM 5642 O O     . HOH M 4 .   ? 23.696  -23.566 -14.749 1.00 25.10  ? 2904 HOH A O     1 
HETATM 5643 O O     . HOH M 4 .   ? 21.289  4.244   -14.833 1.00 21.07  ? 2905 HOH A O     1 
HETATM 5644 O O     . HOH M 4 .   ? -8.055  4.567   -18.457 1.00 24.32  ? 2906 HOH A O     1 
HETATM 5645 O O     . HOH M 4 .   ? -11.008 1.654   -19.320 1.00 34.79  ? 2907 HOH A O     1 
HETATM 5646 O O     . HOH M 4 .   ? -6.794  -5.775  -24.050 1.00 17.76  ? 2908 HOH A O     1 
HETATM 5647 O O     . HOH M 4 .   ? 30.176  -15.637 -16.333 1.00 29.43  ? 2909 HOH A O     1 
HETATM 5648 O O     . HOH M 4 .   ? 12.192  5.482   8.970   1.00 28.07  ? 2910 HOH A O     1 
HETATM 5649 O O     . HOH M 4 .   ? 15.347  -1.934  1.949   1.00 34.82  ? 2911 HOH A O     1 
HETATM 5650 O O     . HOH M 4 .   ? 1.733   -1.268  -34.077 1.00 33.67  ? 2912 HOH A O     1 
HETATM 5651 O O     . HOH M 4 .   ? 28.562  1.220   -8.952  1.00 26.57  ? 2913 HOH A O     1 
HETATM 5652 O O     . HOH M 4 .   ? -7.900  -10.394 -11.931 1.00 31.50  ? 2914 HOH A O     1 
HETATM 5653 O O     . HOH M 4 .   ? -8.910  5.900   -15.236 1.00 23.31  ? 2915 HOH A O     1 
HETATM 5654 O O     . HOH M 4 .   ? 27.347  -17.340 -18.432 1.00 23.17  ? 2916 HOH A O     1 
HETATM 5655 O O     . HOH M 4 .   ? 20.626  5.008   -19.645 1.00 26.99  ? 2917 HOH A O     1 
HETATM 5656 O O     . HOH M 4 .   ? 16.434  8.762   -12.890 1.00 33.24  ? 2918 HOH A O     1 
HETATM 5657 O O     . HOH M 4 .   ? 9.275   11.733  -28.141 1.00 33.45  ? 2919 HOH A O     1 
HETATM 5658 O O     . HOH M 4 .   ? -8.719  -9.666  -7.616  1.00 33.47  ? 2920 HOH A O     1 
HETATM 5659 O O     . HOH M 4 .   ? 27.090  -6.213  -11.655 1.00 31.49  ? 2921 HOH A O     1 
HETATM 5660 O O     . HOH M 4 .   ? 22.076  -14.020 -21.281 1.00 25.37  ? 2922 HOH A O     1 
HETATM 5661 O O     . HOH M 4 .   ? 2.668   -9.304  -6.986  1.00 35.16  ? 2923 HOH A O     1 
HETATM 5662 O O     . HOH M 4 .   ? -4.044  -9.577  -18.108 1.00 29.41  ? 2924 HOH A O     1 
HETATM 5663 O O     . HOH M 4 .   ? -2.710  12.410  -2.757  1.00 53.61  ? 2925 HOH A O     1 
HETATM 5664 O O     . HOH M 4 .   ? 0.270   15.281  -1.078  1.00 32.57  ? 2926 HOH A O     1 
HETATM 5665 O O     . HOH M 4 .   ? 15.301  -10.933 -11.153 1.00 27.98  ? 2927 HOH A O     1 
HETATM 5666 O O     . HOH M 4 .   ? 21.964  3.715   -0.094  1.00 38.49  ? 2928 HOH A O     1 
HETATM 5667 O O     . HOH M 4 .   ? 14.877  2.423   10.695  1.00 44.35  ? 2929 HOH A O     1 
HETATM 5668 O O     . HOH M 4 .   ? 23.939  -4.233  -8.585  1.00 32.39  ? 2930 HOH A O     1 
HETATM 5669 O O     . HOH M 4 .   ? -17.557 4.897   -8.004  1.00 30.35  ? 2931 HOH A O     1 
HETATM 5670 O O     . HOH M 4 .   ? 26.022  -11.562 -16.972 1.00 33.73  ? 2932 HOH A O     1 
HETATM 5671 O O     . HOH M 4 .   ? -4.037  14.662  -11.750 1.00 28.67  ? 2933 HOH A O     1 
HETATM 5672 O O     . HOH M 4 .   ? -4.194  19.119  -3.896  1.00 30.48  ? 2934 HOH A O     1 
HETATM 5673 O O     . HOH M 4 .   ? -1.633  -13.154 -18.317 1.00 36.06  ? 2935 HOH A O     1 
HETATM 5674 O O     . HOH M 4 .   ? 5.827   3.141   -0.771  1.00 48.20  ? 2936 HOH A O     1 
HETATM 5675 O O     . HOH M 4 .   ? 29.340  -17.262 -12.729 1.00 38.81  ? 2937 HOH A O     1 
HETATM 5676 O O     . HOH M 4 .   ? 17.296  6.200   -12.706 1.00 25.66  ? 2938 HOH A O     1 
HETATM 5677 O O     . HOH M 4 .   ? 18.086  -5.840  -24.624 1.00 29.25  ? 2939 HOH A O     1 
HETATM 5678 O O     . HOH M 4 .   ? -9.007  8.178   -7.291  1.00 49.41  ? 2940 HOH A O     1 
HETATM 5679 O O     . HOH M 4 .   ? 2.345   21.202  -3.273  1.00 31.09  ? 2941 HOH A O     1 
HETATM 5680 O O     . HOH M 4 .   ? 0.169   -12.719 -13.020 1.00 33.34  ? 2942 HOH A O     1 
HETATM 5681 O O     . HOH M 4 .   ? -2.790  3.125   -2.074  1.00 21.67  ? 2943 HOH A O     1 
HETATM 5682 O O     . HOH M 4 .   ? 24.570  -14.565 -4.210  1.00 61.10  ? 2944 HOH A O     1 
HETATM 5683 O O     . HOH M 4 .   ? 16.004  -15.924 -21.005 1.00 19.48  ? 2945 HOH A O     1 
HETATM 5684 O O     . HOH M 4 .   ? 13.139  12.234  3.080   1.00 40.14  ? 2946 HOH A O     1 
HETATM 5685 O O     . HOH M 4 .   ? 19.254  7.490   -16.021 1.00 25.38  ? 2947 HOH A O     1 
HETATM 5686 O O     . HOH M 4 .   ? 5.597   -16.309 -12.113 1.00 30.60  ? 2948 HOH A O     1 
HETATM 5687 O O     . HOH M 4 .   ? 14.091  -13.965 -24.322 1.00 29.70  ? 2949 HOH A O     1 
HETATM 5688 O O     . HOH M 4 .   ? -9.407  -4.100  -20.785 1.00 20.98  ? 2950 HOH A O     1 
HETATM 5689 O O     . HOH M 4 .   ? 16.779  4.649   -23.429 1.00 29.30  ? 2951 HOH A O     1 
HETATM 5690 O O     . HOH M 4 .   ? -5.926  6.008   -2.399  1.00 23.09  ? 2952 HOH A O     1 
HETATM 5691 O O     . HOH M 4 .   ? 16.305  1.229   -26.740 1.00 26.87  ? 2953 HOH A O     1 
HETATM 5692 O O     . HOH M 4 .   ? 11.593  17.216  5.196   1.00 61.04  ? 2954 HOH A O     1 
HETATM 5693 O O     . HOH M 4 .   ? 3.759   4.407   0.227   1.00 18.42  ? 2955 HOH A O     1 
HETATM 5694 O O     . HOH M 4 .   ? 14.519  5.531   -10.139 1.00 21.24  ? 2956 HOH A O     1 
HETATM 5695 O O     . HOH M 4 .   ? 7.905   -14.552 -31.737 1.00 22.22  ? 2957 HOH A O     1 
HETATM 5696 O O     . HOH M 4 .   ? 26.362  -0.039  -12.707 1.00 20.16  ? 2958 HOH A O     1 
HETATM 5697 O O     . HOH M 4 .   ? 1.962   -12.379 -33.302 1.00 19.32  ? 2959 HOH A O     1 
HETATM 5698 O O     . HOH M 4 .   ? 14.602  10.189  -20.048 1.00 20.74  ? 2960 HOH A O     1 
HETATM 5699 O O     . HOH M 4 .   ? -2.530  8.956   -18.509 1.00 26.61  ? 2961 HOH A O     1 
HETATM 5700 O O     . HOH M 4 .   ? 8.537   -20.695 -18.507 1.00 25.85  ? 2962 HOH A O     1 
HETATM 5701 O O     . HOH M 4 .   ? 16.174  -15.133 -23.490 1.00 26.75  ? 2963 HOH A O     1 
HETATM 5702 O O     . HOH M 4 .   ? 23.381  -5.065  -21.785 1.00 28.53  ? 2964 HOH A O     1 
HETATM 5703 O O     . HOH M 4 .   ? 26.712  2.039   -10.669 1.00 22.56  ? 2965 HOH A O     1 
HETATM 5704 O O     . HOH M 4 .   ? 2.620   7.037   -28.814 1.00 25.90  ? 2966 HOH A O     1 
HETATM 5705 O O     . HOH M 4 .   ? 17.747  -13.376 -16.678 1.00 21.03  ? 2967 HOH A O     1 
HETATM 5706 O O     . HOH M 4 .   ? 25.766  -23.869 -16.584 1.00 27.84  ? 2968 HOH A O     1 
HETATM 5707 O O     . HOH M 4 .   ? -2.255  10.010  -5.899  1.00 29.98  ? 2969 HOH A O     1 
HETATM 5708 O O     . HOH M 4 .   ? -7.684  -10.665 -16.757 1.00 27.00  ? 2970 HOH A O     1 
HETATM 5709 O O     . HOH M 4 .   ? 18.873  7.580   -9.205  1.00 29.36  ? 2971 HOH A O     1 
HETATM 5710 O O     . HOH M 4 .   ? -5.675  9.847   -15.036 1.00 32.91  ? 2972 HOH A O     1 
HETATM 5711 O O     . HOH M 4 .   ? 11.376  12.403  -15.544 1.00 24.84  ? 2973 HOH A O     1 
HETATM 5712 O O     . HOH M 4 .   ? 5.279   0.253   -1.185  1.00 22.94  ? 2974 HOH A O     1 
HETATM 5713 O O     . HOH M 4 .   ? 28.861  -5.367  -17.207 1.00 34.29  ? 2975 HOH A O     1 
HETATM 5714 O O     . HOH M 4 .   ? 0.439   12.628  -0.548  1.00 29.96  ? 2976 HOH A O     1 
HETATM 5715 O O     . HOH M 4 .   ? 5.495   16.270  -19.643 1.00 31.38  ? 2977 HOH A O     1 
HETATM 5716 O O     . HOH M 4 .   ? -4.047  -14.901 -12.263 1.00 69.27  ? 2978 HOH A O     1 
HETATM 5717 O O     . HOH M 4 .   ? -1.186  -16.607 -19.872 1.00 29.23  ? 2979 HOH A O     1 
HETATM 5718 O O     . HOH M 4 .   ? 23.095  2.757   -13.176 1.00 28.67  ? 2980 HOH A O     1 
HETATM 5719 O O     . HOH M 4 .   ? 8.550   -6.770  -4.275  1.00 37.27  ? 2981 HOH A O     1 
HETATM 5720 O O     . HOH M 4 .   ? 2.900   18.324  0.872   1.00 36.79  ? 2982 HOH A O     1 
HETATM 5721 O O     . HOH M 4 .   ? -12.547 -3.845  -31.087 1.00 36.80  ? 2983 HOH A O     1 
HETATM 5722 O O     . HOH M 4 .   ? -1.486  -9.269  -8.338  1.00 33.32  ? 2984 HOH A O     1 
HETATM 5723 O O     . HOH M 4 .   ? 22.352  3.433   -24.481 1.00 33.21  ? 2985 HOH A O     1 
HETATM 5724 O O     . HOH M 4 .   ? 8.585   -18.342 -30.564 1.00 33.56  ? 2986 HOH A O     1 
HETATM 5725 O O     . HOH M 4 .   ? -5.522  -9.295  -1.903  1.00 32.54  ? 2987 HOH A O     1 
HETATM 5726 O O     . HOH M 4 .   ? 12.068  -15.395 -25.465 1.00 28.54  ? 2988 HOH A O     1 
HETATM 5727 O O     . HOH M 4 .   ? 22.696  5.213   -17.061 1.00 27.08  ? 2989 HOH A O     1 
HETATM 5728 O O     . HOH M 4 .   ? 13.450  -3.437  -30.483 1.00 30.60  ? 2990 HOH A O     1 
HETATM 5729 O O     . HOH M 4 .   ? 4.098   23.319  -3.617  1.00 41.66  ? 2991 HOH A O     1 
HETATM 5730 O O     . HOH M 4 .   ? 21.199  -8.772  -21.414 1.00 35.93  ? 2992 HOH A O     1 
HETATM 5731 O O     . HOH M 4 .   ? 15.198  13.423  -8.493  1.00 34.11  ? 2993 HOH A O     1 
HETATM 5732 O O     . HOH M 4 .   ? -10.688 -3.526  -16.733 1.00 32.85  ? 2994 HOH A O     1 
HETATM 5733 O O     . HOH M 4 .   ? 20.476  -11.833 -9.337  1.00 31.87  ? 2995 HOH A O     1 
HETATM 5734 O O     . HOH M 4 .   ? 24.831  -11.209 -7.004  1.00 36.10  ? 2996 HOH A O     1 
HETATM 5735 O O     . HOH M 4 .   ? 15.774  11.177  1.042   1.00 38.46  ? 2997 HOH A O     1 
HETATM 5736 O O     . HOH M 4 .   ? 27.633  -1.362  -18.720 1.00 32.91  ? 2998 HOH A O     1 
HETATM 5737 O O     . HOH M 4 .   ? 28.287  -25.494 -11.031 1.00 46.10  ? 2999 HOH A O     1 
HETATM 5738 O O     . HOH M 4 .   ? 29.428  -15.725 -7.666  1.00 41.50  ? 3000 HOH A O     1 
HETATM 5739 O O     . HOH M 4 .   ? 11.989  -15.488 -30.213 1.00 31.29  ? 3001 HOH A O     1 
HETATM 5740 O O     . HOH M 4 .   ? 2.240   -9.338  -9.508  1.00 34.03  ? 3002 HOH A O     1 
HETATM 5741 O O     . HOH M 4 .   ? 12.000  -1.372  -28.439 1.00 26.82  ? 3003 HOH A O     1 
HETATM 5742 O O     . HOH M 4 .   ? 1.589   -6.171  -33.074 1.00 36.08  ? 3004 HOH A O     1 
HETATM 5743 O O     . HOH M 4 .   ? 12.993  -13.159 -28.495 1.00 26.89  ? 3005 HOH A O     1 
HETATM 5744 O O     . HOH M 4 .   ? -6.670  -5.665  -12.784 1.00 18.83  ? 3006 HOH A O     1 
HETATM 5745 O O     . HOH M 4 .   ? 28.598  -12.752 -16.313 1.00 38.06  ? 3007 HOH A O     1 
HETATM 5746 O O     . HOH M 4 .   ? 19.613  -9.296  -9.508  1.00 32.79  ? 3008 HOH A O     1 
HETATM 5747 O O     . HOH M 4 .   ? 16.070  -7.648  -28.492 1.00 31.54  ? 3009 HOH A O     1 
HETATM 5748 O O     . HOH M 4 .   ? 4.184   -6.329  -31.931 1.00 30.28  ? 3010 HOH A O     1 
HETATM 5749 O O     . HOH M 4 .   ? 5.017   -19.587 -16.303 1.00 37.61  ? 3011 HOH A O     1 
HETATM 5750 O O     . HOH M 4 .   ? 24.030  -3.256  -4.605  1.00 45.37  ? 3012 HOH A O     1 
HETATM 5751 O O     . HOH M 4 .   ? -15.600 5.977   -11.258 1.00 35.30  ? 3013 HOH A O     1 
HETATM 5752 O O     . HOH M 4 .   ? -13.955 -0.550  -29.248 1.00 23.87  ? 3014 HOH A O     1 
HETATM 5753 O O     . HOH M 4 .   ? 0.951   3.954   -31.623 1.00 36.28  ? 3015 HOH A O     1 
HETATM 5754 O O     . HOH M 4 .   ? 2.590   20.679  -0.696  1.00 35.70  ? 3016 HOH A O     1 
HETATM 5755 O O     . HOH M 4 .   ? 20.545  -5.813  -27.972 1.00 62.47  ? 3017 HOH A O     1 
HETATM 5756 O O     . HOH M 4 .   ? 20.415  -7.160  -24.131 1.00 39.00  ? 3018 HOH A O     1 
HETATM 5757 O O     . HOH N 4 .   ? -0.880  5.229   11.449  1.00 9.76   ? 2802 HOH B O     1 
HETATM 5758 O O     . HOH N 4 .   ? -3.876  -1.246  11.935  1.00 8.22   ? 2803 HOH B O     1 
HETATM 5759 O O     . HOH N 4 .   ? -10.574 -0.975  10.103  1.00 10.62  ? 2804 HOH B O     1 
HETATM 5760 O O     . HOH N 4 .   ? -3.589  19.593  19.334  1.00 12.07  ? 2805 HOH B O     1 
HETATM 5761 O O     . HOH N 4 .   ? -3.116  -15.187 27.358  1.00 11.52  ? 2806 HOH B O     1 
HETATM 5762 O O     . HOH N 4 .   ? 3.548   -12.165 19.879  1.00 11.25  ? 2807 HOH B O     1 
HETATM 5763 O O     . HOH N 4 .   ? -3.881  -9.739  5.643   1.00 10.52  ? 2808 HOH B O     1 
HETATM 5764 O O     . HOH N 4 .   ? -2.203  11.609  28.806  1.00 13.95  ? 2809 HOH B O     1 
HETATM 5765 O O     . HOH N 4 .   ? -11.969 1.182   11.208  1.00 10.22  ? 2810 HOH B O     1 
HETATM 5766 O O     . HOH N 4 .   ? -11.542 -5.162  5.609   1.00 13.84  ? 2811 HOH B O     1 
HETATM 5767 O O     . HOH N 4 .   ? 3.522   11.925  17.209  1.00 13.21  ? 2812 HOH B O     1 
HETATM 5768 O O     . HOH N 4 .   ? -12.383 -2.904  6.838   1.00 14.88  ? 2813 HOH B O     1 
HETATM 5769 O O     . HOH N 4 .   ? 0.912   -12.699 2.421   1.00 16.98  ? 2814 HOH B O     1 
HETATM 5770 O O     . HOH N 4 .   ? -14.650 2.792   13.898  1.00 13.51  ? 2815 HOH B O     1 
HETATM 5771 O O     . HOH N 4 .   ? 0.326   -9.858  21.649  1.00 13.44  ? 2816 HOH B O     1 
HETATM 5772 O O     . HOH N 4 .   ? -1.981  -9.373  10.009  1.00 13.97  ? 2817 HOH B O     1 
HETATM 5773 O O     . HOH N 4 .   ? -1.331  -11.958 9.333   1.00 13.36  ? 2818 HOH B O     1 
HETATM 5774 O O     . HOH N 4 .   ? -13.021 9.043   16.359  1.00 14.81  ? 2819 HOH B O     1 
HETATM 5775 O O     . HOH N 4 .   ? -13.877 -5.205  15.636  1.00 11.48  ? 2820 HOH B O     1 
HETATM 5776 O O     . HOH N 4 .   ? 7.404   -6.772  18.413  1.00 15.94  ? 2821 HOH B O     1 
HETATM 5777 O O     . HOH N 4 .   ? 3.384   11.703  14.383  1.00 16.01  ? 2822 HOH B O     1 
HETATM 5778 O O     . HOH N 4 .   ? 10.018  -16.292 18.303  1.00 14.98  ? 2823 HOH B O     1 
HETATM 5779 O O     . HOH N 4 .   ? -8.932  1.365   4.697   1.00 12.82  ? 2824 HOH B O     1 
HETATM 5780 O O     . HOH N 4 .   ? 9.614   2.052   10.049  1.00 13.68  ? 2825 HOH B O     1 
HETATM 5781 O O     . HOH N 4 .   ? -15.959 -17.006 22.771  1.00 15.63  ? 2826 HOH B O     1 
HETATM 5782 O O     . HOH N 4 .   ? -21.703 8.242   20.726  1.00 19.38  ? 2827 HOH B O     1 
HETATM 5783 O O     . HOH N 4 .   ? -11.148 -8.821  4.688   1.00 17.63  ? 2828 HOH B O     1 
HETATM 5784 O O     . HOH N 4 .   ? -1.969  -5.762  19.796  1.00 14.02  ? 2829 HOH B O     1 
HETATM 5785 O O     . HOH N 4 .   ? -9.110  1.418   0.998   1.00 15.20  ? 2830 HOH B O     1 
HETATM 5786 O O     . HOH N 4 .   ? -0.135  13.304  26.041  1.00 11.88  ? 2831 HOH B O     1 
HETATM 5787 O O     . HOH N 4 .   ? 2.326   1.226   21.665  1.00 17.23  ? 2832 HOH B O     1 
HETATM 5788 O O     . HOH N 4 .   ? -1.623  20.160  17.550  1.00 17.09  ? 2833 HOH B O     1 
HETATM 5789 O O     . HOH N 4 .   ? -4.346  -7.412  -0.643  1.00 15.16  ? 2834 HOH B O     1 
HETATM 5790 O O     . HOH N 4 .   ? -24.895 8.046   26.618  1.00 16.23  ? 2835 HOH B O     1 
HETATM 5791 O O     . HOH N 4 .   ? -16.817 4.182   14.743  1.00 18.08  ? 2836 HOH B O     1 
HETATM 5792 O O     . HOH N 4 .   ? -13.670 5.973   7.746   1.00 16.52  ? 2837 HOH B O     1 
HETATM 5793 O O     . HOH N 4 .   ? -5.103  -17.271 20.692  1.00 15.99  ? 2838 HOH B O     1 
HETATM 5794 O O     . HOH N 4 .   ? -2.196  16.398  23.317  1.00 12.36  ? 2839 HOH B O     1 
HETATM 5795 O O     . HOH N 4 .   ? -15.654 8.874   15.464  1.00 17.29  ? 2840 HOH B O     1 
HETATM 5796 O O     . HOH N 4 .   ? -8.834  -5.459  -1.542  1.00 16.15  ? 2841 HOH B O     1 
HETATM 5797 O O     . HOH N 4 .   ? -15.141 -18.135 10.831  1.00 19.93  ? 2842 HOH B O     1 
HETATM 5798 O O     . HOH N 4 .   ? 6.009   3.736   14.321  1.00 14.83  ? 2843 HOH B O     1 
HETATM 5799 O O     . HOH N 4 .   ? 1.930   -10.057 2.276   1.00 17.86  ? 2844 HOH B O     1 
HETATM 5800 O O     . HOH N 4 .   ? -6.364  -5.731  0.020   1.00 15.97  ? 2845 HOH B O     1 
HETATM 5801 O O     . HOH N 4 .   ? -18.911 -2.886  14.130  1.00 18.52  ? 2846 HOH B O     1 
HETATM 5802 O O     . HOH N 4 .   ? 2.978   9.265   16.867  1.00 12.03  ? 2847 HOH B O     1 
HETATM 5803 O O     . HOH N 4 .   ? 3.109   -14.034 13.868  1.00 19.10  ? 2848 HOH B O     1 
HETATM 5804 O O     . HOH N 4 .   ? 6.913   7.517   13.837  1.00 18.04  ? 2849 HOH B O     1 
HETATM 5805 O O     . HOH N 4 .   ? 1.240   17.485  16.085  1.00 17.03  ? 2850 HOH B O     1 
HETATM 5806 O O     . HOH N 4 .   ? -9.500  -17.255 24.821  1.00 17.02  ? 2851 HOH B O     1 
HETATM 5807 O O     . HOH N 4 .   ? 4.618   9.624   12.187  1.00 21.39  ? 2852 HOH B O     1 
HETATM 5808 O O     . HOH N 4 .   ? -0.464  -0.113  21.943  1.00 14.26  ? 2853 HOH B O     1 
HETATM 5809 O O     . HOH N 4 .   ? 6.251   11.034  7.144   1.00 18.25  ? 2854 HOH B O     1 
HETATM 5810 O O     . HOH N 4 .   ? 9.550   4.747   9.372   1.00 20.76  ? 2855 HOH B O     1 
HETATM 5811 O O     . HOH N 4 .   ? 2.167   -0.775  4.010   1.00 20.36  ? 2856 HOH B O     1 
HETATM 5812 O O     . HOH N 4 .   ? -2.596  -2.341  21.354  1.00 16.77  ? 2857 HOH B O     1 
HETATM 5813 O O     . HOH N 4 .   ? 10.591  0.845   7.826   1.00 20.77  ? 2858 HOH B O     1 
HETATM 5814 O O     . HOH N 4 .   ? 1.412   -15.606 9.714   1.00 21.89  ? 2859 HOH B O     1 
HETATM 5815 O O     . HOH N 4 .   ? -22.326 -5.730  17.626  1.00 21.93  ? 2860 HOH B O     1 
HETATM 5816 O O     . HOH N 4 .   ? -8.484  11.824  29.800  1.00 20.99  ? 2861 HOH B O     1 
HETATM 5817 O O     . HOH N 4 .   ? 1.436   -5.550  5.007   1.00 16.72  ? 2862 HOH B O     1 
HETATM 5818 O O     . HOH N 4 .   ? -13.624 10.003  20.789  1.00 19.63  ? 2863 HOH B O     1 
HETATM 5819 O O     . HOH N 4 .   ? -8.514  19.616  19.009  1.00 22.23  ? 2864 HOH B O     1 
HETATM 5820 O O     . HOH N 4 .   ? -11.605 6.482   4.377   1.00 21.03  ? 2865 HOH B O     1 
HETATM 5821 O O     . HOH N 4 .   ? -12.303 12.527  21.305  1.00 22.80  ? 2866 HOH B O     1 
HETATM 5822 O O     . HOH N 4 .   ? 8.316   7.918   9.574   1.00 22.56  ? 2867 HOH B O     1 
HETATM 5823 O O     . HOH N 4 .   ? -11.061 15.298  10.069  1.00 24.38  ? 2868 HOH B O     1 
HETATM 5824 O O     . HOH N 4 .   ? 14.987  -7.691  12.094  1.00 25.03  ? 2869 HOH B O     1 
HETATM 5825 O O     . HOH N 4 .   ? -15.092 -3.110  7.015   1.00 18.32  ? 2870 HOH B O     1 
HETATM 5826 O O     . HOH N 4 .   ? 7.310   -4.844  6.303   1.00 18.19  ? 2871 HOH B O     1 
HETATM 5827 O O     . HOH N 4 .   ? -12.868 -12.200 26.968  1.00 21.62  ? 2872 HOH B O     1 
HETATM 5828 O O     . HOH N 4 .   ? -12.142 11.589  10.082  1.00 20.39  ? 2873 HOH B O     1 
HETATM 5829 O O     . HOH N 4 .   ? -8.575  10.722  4.793   1.00 17.61  ? 2874 HOH B O     1 
HETATM 5830 O O     . HOH N 4 .   ? 5.297   -4.502  4.489   1.00 19.51  ? 2875 HOH B O     1 
HETATM 5831 O O     . HOH N 4 .   ? 3.169   -13.560 17.571  1.00 16.33  ? 2876 HOH B O     1 
HETATM 5832 O O     . HOH N 4 .   ? -22.337 10.950  30.989  1.00 19.98  ? 2877 HOH B O     1 
HETATM 5833 O O     . HOH N 4 .   ? -4.295  -3.654  0.075   1.00 18.35  ? 2878 HOH B O     1 
HETATM 5834 O O     . HOH N 4 .   ? -24.167 -6.916  19.151  1.00 24.46  ? 2879 HOH B O     1 
HETATM 5835 O O     . HOH N 4 .   ? -20.208 9.496   31.522  1.00 21.68  ? 2880 HOH B O     1 
HETATM 5836 O O     . HOH N 4 .   ? -4.237  12.243  30.509  1.00 22.19  ? 2881 HOH B O     1 
HETATM 5837 O O     . HOH N 4 .   ? -11.952 -22.245 15.174  1.00 20.32  ? 2882 HOH B O     1 
HETATM 5838 O O     . HOH N 4 .   ? -16.700 -4.850  26.969  1.00 27.99  ? 2883 HOH B O     1 
HETATM 5839 O O     . HOH N 4 .   ? -7.538  -10.614 23.288  1.00 24.50  ? 2884 HOH B O     1 
HETATM 5840 O O     . HOH N 4 .   ? -9.099  -5.894  26.115  1.00 19.67  ? 2885 HOH B O     1 
HETATM 5841 O O     . HOH N 4 .   ? -13.510 14.437  11.242  1.00 23.69  ? 2886 HOH B O     1 
HETATM 5842 O O     . HOH N 4 .   ? -17.574 0.741   13.787  1.00 18.35  ? 2887 HOH B O     1 
HETATM 5843 O O     . HOH N 4 .   ? -21.622 -2.728  25.332  1.00 26.27  ? 2888 HOH B O     1 
HETATM 5844 O O     . HOH N 4 .   ? -17.665 -9.266  10.691  1.00 27.75  ? 2889 HOH B O     1 
HETATM 5845 O O     . HOH N 4 .   ? -6.337  18.603  27.567  1.00 18.91  ? 2890 HOH B O     1 
HETATM 5846 O O     . HOH N 4 .   ? 5.884   -3.937  23.493  1.00 23.86  ? 2891 HOH B O     1 
HETATM 5847 O O     . HOH N 4 .   ? -3.621  4.851   29.254  1.00 25.99  ? 2892 HOH B O     1 
HETATM 5848 O O     . HOH N 4 .   ? -17.415 -7.522  15.503  1.00 21.08  ? 2893 HOH B O     1 
HETATM 5849 O O     . HOH N 4 .   ? -28.732 10.664  34.150  1.00 28.49  ? 2894 HOH B O     1 
HETATM 5850 O O     . HOH N 4 .   ? -15.840 -19.048 24.564  1.00 23.18  ? 2895 HOH B O     1 
HETATM 5851 O O     . HOH N 4 .   ? 14.257  -11.699 14.629  1.00 27.53  ? 2896 HOH B O     1 
HETATM 5852 O O     . HOH N 4 .   ? 5.937   6.148   18.585  1.00 26.00  ? 2897 HOH B O     1 
HETATM 5853 O O     . HOH N 4 .   ? 6.751   -0.386  5.624   1.00 22.35  ? 2898 HOH B O     1 
HETATM 5854 O O     . HOH N 4 .   ? -24.534 1.071   28.969  1.00 34.89  ? 2899 HOH B O     1 
HETATM 5855 O O     . HOH N 4 .   ? -18.599 -0.410  7.351   1.00 27.03  ? 2900 HOH B O     1 
HETATM 5856 O O     . HOH N 4 .   ? 0.070   3.271   23.230  1.00 25.66  ? 2901 HOH B O     1 
HETATM 5857 O O     . HOH N 4 .   ? 8.354   2.855   13.129  1.00 19.04  ? 2902 HOH B O     1 
HETATM 5858 O O     . HOH N 4 .   ? -6.163  4.754   1.018   1.00 18.55  ? 2903 HOH B O     1 
HETATM 5859 O O     . HOH N 4 .   ? 10.152  -17.547 14.667  1.00 24.38  ? 2904 HOH B O     1 
HETATM 5860 O O     . HOH N 4 .   ? 0.864   -21.065 2.646   1.00 30.88  ? 2905 HOH B O     1 
HETATM 5861 O O     . HOH N 4 .   ? -5.601  -22.849 3.608   1.00 24.98  ? 2906 HOH B O     1 
HETATM 5862 O O     . HOH N 4 .   ? 3.420   7.804   19.196  1.00 20.88  ? 2907 HOH B O     1 
HETATM 5863 O O     . HOH N 4 .   ? -16.094 -19.654 18.395  1.00 35.40  ? 2908 HOH B O     1 
HETATM 5864 O O     . HOH N 4 .   ? 9.293   0.883   14.775  1.00 24.87  ? 2909 HOH B O     1 
HETATM 5865 O O     . HOH N 4 .   ? -18.191 2.685   30.797  1.00 27.18  ? 2910 HOH B O     1 
HETATM 5866 O O     . HOH N 4 .   ? -3.942  17.222  11.393  1.00 22.32  ? 2911 HOH B O     1 
HETATM 5867 O O     . HOH N 4 .   ? -10.814 5.781   1.796   1.00 20.64  ? 2912 HOH B O     1 
HETATM 5868 O O     . HOH N 4 .   ? 0.772   15.886  10.662  1.00 27.60  ? 2913 HOH B O     1 
HETATM 5869 O O     . HOH N 4 .   ? -7.263  20.660  21.858  1.00 25.63  ? 2914 HOH B O     1 
HETATM 5870 O O     . HOH N 4 .   ? -12.323 4.447   40.011  1.00 32.59  ? 2915 HOH B O     1 
HETATM 5871 O O     . HOH N 4 .   ? -12.930 -19.524 17.488  1.00 26.72  ? 2916 HOH B O     1 
HETATM 5872 O O     . HOH N 4 .   ? 15.994  -9.568  13.793  1.00 36.09  ? 2917 HOH B O     1 
HETATM 5873 O O     . HOH N 4 .   ? -2.154  -19.960 8.801   1.00 29.26  ? 2918 HOH B O     1 
HETATM 5874 O O     . HOH N 4 .   ? 13.734  -16.149 11.901  1.00 47.77  ? 2919 HOH B O     1 
HETATM 5875 O O     . HOH N 4 .   ? -16.417 -1.873  1.282   1.00 44.37  ? 2920 HOH B O     1 
HETATM 5876 O O     . HOH N 4 .   ? -16.098 0.737   2.926   1.00 33.72  ? 2921 HOH B O     1 
HETATM 5877 O O     . HOH N 4 .   ? -6.243  -4.243  26.079  1.00 25.66  ? 2922 HOH B O     1 
HETATM 5878 O O     . HOH N 4 .   ? -25.531 -0.833  20.970  1.00 45.84  ? 2923 HOH B O     1 
HETATM 5879 O O     . HOH N 4 .   ? -28.052 5.835   30.096  1.00 27.63  ? 2924 HOH B O     1 
HETATM 5880 O O     . HOH N 4 .   ? -28.237 7.020   32.596  1.00 33.19  ? 2925 HOH B O     1 
HETATM 5881 O O     . HOH N 4 .   ? -14.499 -0.036  26.017  1.00 32.21  ? 2926 HOH B O     1 
HETATM 5882 O O     . HOH N 4 .   ? 3.448   14.176  13.557  1.00 27.37  ? 2927 HOH B O     1 
HETATM 5883 O O     . HOH N 4 .   ? -24.231 3.739   41.842  1.00 58.03  ? 2928 HOH B O     1 
HETATM 5884 O O     . HOH N 4 .   ? -13.252 6.509   -0.865  1.00 30.21  ? 2929 HOH B O     1 
HETATM 5885 O O     . HOH N 4 .   ? 0.425   -23.625 -3.558  1.00 46.82  ? 2930 HOH B O     1 
HETATM 5886 O O     . HOH N 4 .   ? 8.565   2.726   17.203  1.00 24.89  ? 2931 HOH B O     1 
HETATM 5887 O O     . HOH N 4 .   ? -1.245  9.056   29.661  1.00 28.68  ? 2932 HOH B O     1 
HETATM 5888 O O     . HOH N 4 .   ? -22.444 8.949   18.140  1.00 35.12  ? 2933 HOH B O     1 
HETATM 5889 O O     . HOH N 4 .   ? -17.866 -9.351  7.456   1.00 36.68  ? 2934 HOH B O     1 
HETATM 5890 O O     . HOH N 4 .   ? 0.790   5.948   25.789  1.00 31.01  ? 2935 HOH B O     1 
HETATM 5891 O O     . HOH N 4 .   ? 10.283  0.480   5.137   1.00 23.88  ? 2936 HOH B O     1 
HETATM 5892 O O     . HOH N 4 .   ? 13.642  -1.448  14.043  1.00 36.82  ? 2937 HOH B O     1 
HETATM 5893 O O     . HOH N 4 .   ? -15.039 14.766  16.101  1.00 35.74  ? 2938 HOH B O     1 
HETATM 5894 O O     . HOH N 4 .   ? -16.383 -13.200 6.739   1.00 43.90  ? 2939 HOH B O     1 
HETATM 5895 O O     . HOH N 4 .   ? -16.119 -5.443  6.085   1.00 29.00  ? 2940 HOH B O     1 
HETATM 5896 O O     . HOH N 4 .   ? -18.092 -15.020 19.226  1.00 29.65  ? 2941 HOH B O     1 
HETATM 5897 O O     . HOH N 4 .   ? 6.905   7.720   22.290  1.00 40.53  ? 2942 HOH B O     1 
HETATM 5898 O O     . HOH N 4 .   ? 1.417   -4.295  1.328   1.00 28.12  ? 2943 HOH B O     1 
HETATM 5899 O O     . HOH N 4 .   ? 0.101   -19.337 7.394   1.00 30.55  ? 2944 HOH B O     1 
HETATM 5900 O O     . HOH N 4 .   ? 10.872  12.239  6.032   1.00 43.41  ? 2945 HOH B O     1 
HETATM 5901 O O     . HOH N 4 .   ? 3.298   4.489   24.602  1.00 31.14  ? 2946 HOH B O     1 
HETATM 5902 O O     . HOH N 4 .   ? -10.917 17.623  13.067  1.00 36.15  ? 2947 HOH B O     1 
HETATM 5903 O O     . HOH N 4 .   ? -13.717 -6.786  5.290   1.00 27.27  ? 2948 HOH B O     1 
HETATM 5904 O O     . HOH N 4 .   ? -2.456  8.459   32.214  1.00 35.61  ? 2949 HOH B O     1 
HETATM 5905 O O     . HOH N 4 .   ? -16.890 10.873  17.029  1.00 30.20  ? 2950 HOH B O     1 
HETATM 5906 O O     . HOH N 4 .   ? -3.684  13.745  4.335   1.00 30.75  ? 2951 HOH B O     1 
HETATM 5907 O O     . HOH N 4 .   ? -13.886 -4.977  -2.176  1.00 54.97  ? 2952 HOH B O     1 
HETATM 5908 O O     . HOH N 4 .   ? 5.875   -16.042 13.165  1.00 28.82  ? 2953 HOH B O     1 
HETATM 5909 O O     . HOH N 4 .   ? -7.058  -24.020 10.262  1.00 29.29  ? 2954 HOH B O     1 
HETATM 5910 O O     . HOH N 4 .   ? 0.437   0.745   0.857   1.00 32.19  ? 2955 HOH B O     1 
HETATM 5911 O O     . HOH N 4 .   ? -24.183 8.753   21.738  1.00 18.57  ? 2956 HOH B O     1 
HETATM 5912 O O     . HOH N 4 .   ? -29.450 -9.499  27.236  1.00 20.94  ? 2957 HOH B O     1 
HETATM 5913 O O     . HOH N 4 .   ? -14.880 -7.406  14.325  1.00 24.04  ? 2958 HOH B O     1 
HETATM 5914 O O     . HOH N 4 .   ? 5.409   8.902   15.655  1.00 18.86  ? 2959 HOH B O     1 
HETATM 5915 O O     . HOH N 4 .   ? -0.135  -1.605  24.109  1.00 23.98  ? 2960 HOH B O     1 
HETATM 5916 O O     . HOH N 4 .   ? 9.787   4.866   12.300  1.00 28.79  ? 2961 HOH B O     1 
HETATM 5917 O O     . HOH N 4 .   ? -13.979 10.934  18.143  1.00 22.68  ? 2962 HOH B O     1 
HETATM 5918 O O     . HOH N 4 .   ? -18.355 -16.026 21.933  1.00 21.44  ? 2963 HOH B O     1 
HETATM 5919 O O     . HOH N 4 .   ? -1.307  1.360   -0.821  1.00 23.27  ? 2964 HOH B O     1 
HETATM 5920 O O     . HOH N 4 .   ? -16.729 -1.489  5.559   1.00 23.14  ? 2965 HOH B O     1 
HETATM 5921 O O     . HOH N 4 .   ? -24.095 10.999  23.169  1.00 25.32  ? 2966 HOH B O     1 
HETATM 5922 O O     . HOH N 4 .   ? 11.724  1.414   11.611  1.00 25.25  ? 2967 HOH B O     1 
HETATM 5923 O O     . HOH N 4 .   ? -25.683 15.622  38.011  1.00 22.88  ? 2968 HOH B O     1 
HETATM 5924 O O     . HOH N 4 .   ? -17.840 -5.388  13.355  1.00 27.22  ? 2969 HOH B O     1 
HETATM 5925 O O     . HOH N 4 .   ? -10.028 8.307   1.058   1.00 31.49  ? 2970 HOH B O     1 
HETATM 5926 O O     . HOH N 4 .   ? -17.350 1.813   28.199  1.00 32.77  ? 2971 HOH B O     1 
HETATM 5927 O O     . HOH N 4 .   ? -23.088 -3.158  17.069  1.00 27.79  ? 2972 HOH B O     1 
HETATM 5928 O O     . HOH N 4 .   ? 1.926   -1.448  0.320   1.00 26.32  ? 2973 HOH B O     1 
HETATM 5929 O O     . HOH N 4 .   ? -15.211 -5.637  12.489  1.00 21.76  ? 2974 HOH B O     1 
HETATM 5930 O O     . HOH N 4 .   ? -10.574 8.889   5.125   1.00 30.73  ? 2975 HOH B O     1 
HETATM 5931 O O     . HOH N 4 .   ? -5.373  -23.164 16.147  1.00 31.12  ? 2976 HOH B O     1 
HETATM 5932 O O     . HOH N 4 .   ? -14.818 7.918   24.151  1.00 25.14  ? 2977 HOH B O     1 
HETATM 5933 O O     . HOH N 4 .   ? 7.075   6.950   16.512  1.00 33.16  ? 2978 HOH B O     1 
HETATM 5934 O O     . HOH N 4 .   ? -14.108 7.672   3.549   1.00 31.48  ? 2979 HOH B O     1 
HETATM 5935 O O     . HOH N 4 .   ? -21.581 3.961   41.380  1.00 34.27  ? 2980 HOH B O     1 
HETATM 5936 O O     . HOH N 4 .   ? -21.607 -2.558  14.901  1.00 27.40  ? 2981 HOH B O     1 
HETATM 5937 O O     . HOH N 4 .   ? 6.935   10.278  9.625   1.00 35.47  ? 2982 HOH B O     1 
HETATM 5938 O O     . HOH N 4 .   ? -1.631  17.252  9.948   1.00 30.38  ? 2983 HOH B O     1 
HETATM 5939 O O     . HOH N 4 .   ? -26.440 -5.414  19.671  1.00 37.91  ? 2984 HOH B O     1 
HETATM 5940 O O     . HOH N 4 .   ? -20.264 0.231   12.065  1.00 31.52  ? 2985 HOH B O     1 
HETATM 5941 O O     . HOH N 4 .   ? -17.693 9.699   26.088  1.00 29.26  ? 2986 HOH B O     1 
HETATM 5942 O O     . HOH N 4 .   ? 1.454   -6.273  23.336  1.00 32.50  ? 2987 HOH B O     1 
HETATM 5943 O O     . HOH N 4 .   ? -14.636 -19.980 31.357  1.00 25.30  ? 2988 HOH B O     1 
HETATM 5944 O O     . HOH N 4 .   ? -4.144  -12.971 -1.263  1.00 28.61  ? 2989 HOH B O     1 
HETATM 5945 O O     . HOH N 4 .   ? 0.512   -3.210  3.584   1.00 31.20  ? 2990 HOH B O     1 
HETATM 5946 O O     . HOH N 4 .   ? -4.626  -24.390 5.528   1.00 31.64  ? 2991 HOH B O     1 
HETATM 5947 O O     . HOH N 4 .   ? 4.863   -0.677  3.768   1.00 25.23  ? 2992 HOH B O     1 
HETATM 5948 O O     . HOH N 4 .   ? 8.803   4.876   25.484  1.00 36.87  ? 2993 HOH B O     1 
HETATM 5949 O O     . HOH N 4 .   ? -6.623  15.062  4.179   1.00 40.36  ? 2994 HOH B O     1 
HETATM 5950 O O     . HOH N 4 .   ? 3.557   7.716   23.214  1.00 24.55  ? 2995 HOH B O     1 
HETATM 5951 O O     . HOH N 4 .   ? -17.561 -6.576  8.041   1.00 37.98  ? 2996 HOH B O     1 
HETATM 5952 O O     . HOH N 4 .   ? -19.377 -8.780  13.980  1.00 32.06  ? 2997 HOH B O     1 
HETATM 5953 O O     . HOH N 4 .   ? -22.363 8.197   15.536  1.00 34.31  ? 2998 HOH B O     1 
HETATM 5954 O O     . HOH N 4 .   ? 3.775   -1.612  23.934  1.00 34.20  ? 2999 HOH B O     1 
HETATM 5955 O O     . HOH N 4 .   ? -24.098 4.119   9.808   1.00 36.86  ? 3000 HOH B O     1 
HETATM 5956 O O     . HOH N 4 .   ? -26.546 -6.750  25.778  1.00 38.27  ? 3001 HOH B O     1 
HETATM 5957 O O     . HOH N 4 .   ? -17.465 -12.693 9.144   1.00 33.29  ? 3002 HOH B O     1 
HETATM 5958 O O     . HOH N 4 .   ? -22.680 -7.148  15.279  1.00 43.04  ? 3003 HOH B O     1 
HETATM 5959 O O     . HOH N 4 .   ? -17.967 -2.998  3.717   1.00 38.60  ? 3004 HOH B O     1 
HETATM 5960 O O     . HOH N 4 .   ? -5.286  18.397  9.094   1.00 36.84  ? 3005 HOH B O     1 
HETATM 5961 O O     . HOH N 4 .   ? -13.244 -17.476 29.426  1.00 48.82  ? 3006 HOH B O     1 
HETATM 5962 O O     . HOH N 4 .   ? -21.722 -8.849  25.987  1.00 60.32  ? 3007 HOH B O     1 
HETATM 5963 O O     . HOH N 4 .   ? -18.456 -19.681 21.824  1.00 29.55  ? 3008 HOH B O     1 
HETATM 5964 O O     . HOH N 4 .   ? 5.047   -6.955  1.290   1.00 45.08  ? 3009 HOH B O     1 
HETATM 5965 O O     . HOH N 4 .   ? 8.859   -1.972  5.039   1.00 30.11  ? 3010 HOH B O     1 
HETATM 5966 O O     . HOH N 4 .   ? -13.457 8.835   8.152   1.00 29.68  ? 3011 HOH B O     1 
HETATM 5967 O O     . HOH N 4 .   ? -7.251  16.111  27.154  1.00 38.09  ? 3012 HOH B O     1 
HETATM 5968 O O     . HOH N 4 .   ? -0.732  11.789  1.774   1.00 32.35  ? 3013 HOH B O     1 
HETATM 5969 O O     . HOH N 4 .   ? -10.706 17.406  20.375  1.00 35.29  ? 3014 HOH B O     1 
HETATM 5970 O O     . HOH N 4 .   ? -21.352 7.026   10.458  1.00 37.76  ? 3015 HOH B O     1 
HETATM 5971 O O     . HOH N 4 .   ? -27.580 13.152  38.651  1.00 58.52  ? 3016 HOH B O     1 
HETATM 5972 O O     . HOH N 4 .   ? -11.025 -23.353 24.750  1.00 34.45  ? 3017 HOH B O     1 
HETATM 5973 O O     . HOH N 4 .   ? -14.471 12.777  9.113   1.00 30.57  ? 3018 HOH B O     1 
HETATM 5974 O O     . HOH N 4 .   ? 11.903  0.989   14.092  1.00 30.26  ? 3019 HOH B O     1 
HETATM 5975 O O     . HOH N 4 .   ? -4.745  9.014   33.572  1.00 36.70  ? 3020 HOH B O     1 
HETATM 5976 O O     . HOH N 4 .   ? -19.954 10.227  21.430  1.00 28.83  ? 3021 HOH B O     1 
HETATM 5977 O O     . HOH N 4 .   ? -15.399 -2.694  28.038  1.00 49.40  ? 3022 HOH B O     1 
HETATM 5978 O O     . HOH N 4 .   ? -16.393 -25.766 22.794  1.00 38.51  ? 3023 HOH B O     1 
HETATM 5979 O O     . HOH N 4 .   ? -0.975  -22.476 10.977  1.00 36.54  ? 3024 HOH B O     1 
HETATM 5980 O O     . HOH N 4 .   ? 2.114   13.250  8.282   1.00 30.90  ? 3025 HOH B O     1 
HETATM 5981 O O     . HOH N 4 .   ? -14.879 8.293   1.144   1.00 48.13  ? 3026 HOH B O     1 
HETATM 5982 O O     . HOH N 4 .   ? -26.302 3.668   13.963  1.00 41.20  ? 3027 HOH B O     1 
HETATM 5983 O O     . HOH O 4 .   ? -4.629  27.523  -35.673 1.00 7.51   ? 2803 HOH C O     1 
HETATM 5984 O O     . HOH O 4 .   ? -6.991  20.829  -35.058 1.00 7.34   ? 2804 HOH C O     1 
HETATM 5985 O O     . HOH O 4 .   ? -0.185  30.615  -24.182 1.00 10.96  ? 2805 HOH C O     1 
HETATM 5986 O O     . HOH O 4 .   ? -15.220 22.432  -35.741 1.00 8.63   ? 2806 HOH C O     1 
HETATM 5987 O O     . HOH O 4 .   ? -13.687 20.460  -36.908 1.00 9.44   ? 2807 HOH C O     1 
HETATM 5988 O O     . HOH O 4 .   ? -16.502 15.954  -31.355 1.00 10.26  ? 2808 HOH C O     1 
HETATM 5989 O O     . HOH O 4 .   ? -6.247  12.401  -41.281 1.00 11.99  ? 2809 HOH C O     1 
HETATM 5990 O O     . HOH O 4 .   ? -3.520  10.285  -37.564 1.00 12.97  ? 2810 HOH C O     1 
HETATM 5991 O O     . HOH O 4 .   ? -15.301 18.293  -39.961 1.00 12.74  ? 2811 HOH C O     1 
HETATM 5992 O O     . HOH O 4 .   ? -0.647  34.423  -29.868 1.00 10.44  ? 2812 HOH C O     1 
HETATM 5993 O O     . HOH O 4 .   ? -29.233 27.362  -20.288 1.00 14.95  ? 2813 HOH C O     1 
HETATM 5994 O O     . HOH O 4 .   ? -14.255 16.188  -41.260 1.00 13.58  ? 2814 HOH C O     1 
HETATM 5995 O O     . HOH O 4 .   ? -1.008  30.530  -27.438 1.00 10.59  ? 2815 HOH C O     1 
HETATM 5996 O O     . HOH O 4 .   ? -3.119  38.132  -25.724 1.00 9.61   ? 2816 HOH C O     1 
HETATM 5997 O O     . HOH O 4 .   ? -12.445 22.882  -42.500 1.00 11.93  ? 2817 HOH C O     1 
HETATM 5998 O O     . HOH O 4 .   ? -0.994  34.517  -32.638 1.00 11.99  ? 2818 HOH C O     1 
HETATM 5999 O O     . HOH O 4 .   ? 2.471   26.715  -32.834 1.00 13.39  ? 2819 HOH C O     1 
HETATM 6000 O O     . HOH O 4 .   ? -3.894  22.168  -25.121 1.00 15.69  ? 2820 HOH C O     1 
HETATM 6001 O O     . HOH O 4 .   ? -0.816  23.965  -25.410 1.00 12.24  ? 2821 HOH C O     1 
HETATM 6002 O O     . HOH O 4 .   ? -5.871  20.040  -25.468 1.00 16.25  ? 2822 HOH C O     1 
HETATM 6003 O O     . HOH O 4 .   ? -18.329 23.921  -32.998 1.00 13.77  ? 2823 HOH C O     1 
HETATM 6004 O O     . HOH O 4 .   ? -3.604  39.799  -31.663 1.00 12.06  ? 2824 HOH C O     1 
HETATM 6005 O O     . HOH O 4 .   ? -25.588 28.153  -25.932 1.00 16.94  ? 2825 HOH C O     1 
HETATM 6006 O O     . HOH O 4 .   ? -6.336  4.153   -26.522 1.00 14.84  ? 2826 HOH C O     1 
HETATM 6007 O O     . HOH O 4 .   ? -20.382 21.930  -33.080 1.00 14.07  ? 2827 HOH C O     1 
HETATM 6008 O O     . HOH O 4 .   ? -9.356  41.306  -27.925 1.00 13.33  ? 2828 HOH C O     1 
HETATM 6009 O O     . HOH O 4 .   ? -1.243  31.749  -30.058 1.00 9.56   ? 2829 HOH C O     1 
HETATM 6010 O O     . HOH O 4 .   ? -24.899 17.008  -22.003 1.00 18.74  ? 2830 HOH C O     1 
HETATM 6011 O O     . HOH O 4 .   ? 6.137   25.371  -37.183 1.00 15.87  ? 2831 HOH C O     1 
HETATM 6012 O O     . HOH O 4 .   ? -17.225 30.178  -30.628 1.00 14.99  ? 2832 HOH C O     1 
HETATM 6013 O O     . HOH O 4 .   ? -17.538 26.883  -39.273 1.00 14.91  ? 2833 HOH C O     1 
HETATM 6014 O O     . HOH O 4 .   ? -12.611 22.601  -46.067 1.00 15.03  ? 2834 HOH C O     1 
HETATM 6015 O O     . HOH O 4 .   ? 4.549   16.521  -28.826 1.00 18.33  ? 2835 HOH C O     1 
HETATM 6016 O O     . HOH O 4 .   ? 1.549   33.929  -39.939 1.00 15.03  ? 2836 HOH C O     1 
HETATM 6017 O O     . HOH O 4 .   ? 0.035   28.638  -22.097 1.00 16.70  ? 2837 HOH C O     1 
HETATM 6018 O O     . HOH O 4 .   ? -1.330  10.120  -44.782 1.00 19.64  ? 2838 HOH C O     1 
HETATM 6019 O O     . HOH O 4 .   ? 4.589   18.244  -40.741 1.00 18.03  ? 2839 HOH C O     1 
HETATM 6020 O O     . HOH O 4 .   ? -4.332  37.052  -22.290 1.00 12.93  ? 2840 HOH C O     1 
HETATM 6021 O O     . HOH O 4 .   ? -1.198  16.884  -41.932 1.00 17.75  ? 2841 HOH C O     1 
HETATM 6022 O O     . HOH O 4 .   ? -18.615 29.020  -22.424 1.00 20.11  ? 2842 HOH C O     1 
HETATM 6023 O O     . HOH O 4 .   ? -5.655  42.329  -30.049 1.00 16.30  ? 2843 HOH C O     1 
HETATM 6024 O O     . HOH O 4 .   ? 3.494   30.420  -33.689 1.00 18.83  ? 2844 HOH C O     1 
HETATM 6025 O O     . HOH O 4 .   ? 4.052   30.982  -37.520 1.00 17.78  ? 2845 HOH C O     1 
HETATM 6026 O O     . HOH O 4 .   ? -7.734  -1.554  -31.559 1.00 20.49  ? 2846 HOH C O     1 
HETATM 6027 O O     . HOH O 4 .   ? -19.977 11.626  -35.961 1.00 19.35  ? 2847 HOH C O     1 
HETATM 6028 O O     . HOH O 4 .   ? -4.882  16.971  -27.092 1.00 17.26  ? 2848 HOH C O     1 
HETATM 6029 O O     . HOH O 4 .   ? 0.499   32.442  -35.648 1.00 15.33  ? 2849 HOH C O     1 
HETATM 6030 O O     . HOH O 4 .   ? -19.844 13.159  -31.659 1.00 15.49  ? 2850 HOH C O     1 
HETATM 6031 O O     . HOH O 4 .   ? -19.989 26.171  -32.359 1.00 18.69  ? 2851 HOH C O     1 
HETATM 6032 O O     . HOH O 4 .   ? -13.060 31.838  -42.131 1.00 18.27  ? 2852 HOH C O     1 
HETATM 6033 O O     . HOH O 4 .   ? -25.085 28.124  -15.041 1.00 18.28  ? 2853 HOH C O     1 
HETATM 6034 O O     . HOH O 4 .   ? -18.236 15.711  -34.398 1.00 18.01  ? 2854 HOH C O     1 
HETATM 6035 O O     . HOH O 4 .   ? -11.513 16.056  -48.294 1.00 17.92  ? 2855 HOH C O     1 
HETATM 6036 O O     . HOH O 4 .   ? -9.851  26.786  -19.081 1.00 21.78  ? 2856 HOH C O     1 
HETATM 6037 O O     . HOH O 4 .   ? -11.722 11.993  -23.026 1.00 21.34  ? 2857 HOH C O     1 
HETATM 6038 O O     . HOH O 4 .   ? -4.361  12.862  -36.931 1.00 16.53  ? 2858 HOH C O     1 
HETATM 6039 O O     . HOH O 4 .   ? -19.472 21.402  -44.087 1.00 25.43  ? 2859 HOH C O     1 
HETATM 6040 O O     . HOH O 4 .   ? -12.243 15.960  -20.572 1.00 16.60  ? 2860 HOH C O     1 
HETATM 6041 O O     . HOH O 4 .   ? -29.942 27.120  -22.933 1.00 21.64  ? 2861 HOH C O     1 
HETATM 6042 O O     . HOH O 4 .   ? -13.645 12.465  -42.126 1.00 17.25  ? 2862 HOH C O     1 
HETATM 6043 O O     . HOH O 4 .   ? -8.027  39.948  -21.258 1.00 16.60  ? 2863 HOH C O     1 
HETATM 6044 O O     . HOH O 4 .   ? -21.813 17.794  -33.039 1.00 18.11  ? 2864 HOH C O     1 
HETATM 6045 O O     . HOH O 4 .   ? 3.624   25.634  -21.821 1.00 18.96  ? 2865 HOH C O     1 
HETATM 6046 O O     . HOH O 4 .   ? -1.111  21.942  -43.101 1.00 20.59  ? 2866 HOH C O     1 
HETATM 6047 O O     . HOH O 4 .   ? -14.927 26.127  -18.506 1.00 22.48  ? 2867 HOH C O     1 
HETATM 6048 O O     . HOH O 4 .   ? -30.280 10.104  -22.709 1.00 21.93  ? 2868 HOH C O     1 
HETATM 6049 O O     . HOH O 4 .   ? 3.531   27.600  -30.520 1.00 15.84  ? 2869 HOH C O     1 
HETATM 6050 O O     . HOH O 4 .   ? -17.734 31.279  -26.074 1.00 18.83  ? 2870 HOH C O     1 
HETATM 6051 O O     . HOH O 4 .   ? -16.446 3.019   -35.972 1.00 20.58  ? 2871 HOH C O     1 
HETATM 6052 O O     . HOH O 4 .   ? -6.892  14.793  -47.878 1.00 17.16  ? 2872 HOH C O     1 
HETATM 6053 O O     . HOH O 4 .   ? -18.421 31.783  -28.730 1.00 19.83  ? 2873 HOH C O     1 
HETATM 6054 O O     . HOH O 4 .   ? -17.891 17.717  -39.836 1.00 19.96  ? 2874 HOH C O     1 
HETATM 6055 O O     . HOH O 4 .   ? -6.153  33.938  -18.322 1.00 19.39  ? 2875 HOH C O     1 
HETATM 6056 O O     . HOH O 4 .   ? -27.000 29.945  -15.731 1.00 19.70  ? 2876 HOH C O     1 
HETATM 6057 O O     . HOH O 4 .   ? -14.447 40.755  -28.216 1.00 19.49  ? 2877 HOH C O     1 
HETATM 6058 O O     . HOH O 4 .   ? -9.084  38.808  -36.187 1.00 22.74  ? 2878 HOH C O     1 
HETATM 6059 O O     . HOH O 4 .   ? -5.884  6.926   -27.197 1.00 19.30  ? 2879 HOH C O     1 
HETATM 6060 O O     . HOH O 4 .   ? 8.823   23.869  -25.699 1.00 25.42  ? 2880 HOH C O     1 
HETATM 6061 O O     . HOH O 4 .   ? -23.196 21.147  -16.261 1.00 26.10  ? 2881 HOH C O     1 
HETATM 6062 O O     . HOH O 4 .   ? -12.610 33.908  -17.291 1.00 23.56  ? 2882 HOH C O     1 
HETATM 6063 O O     . HOH O 4 .   ? -20.692 16.219  -20.439 1.00 26.69  ? 2883 HOH C O     1 
HETATM 6064 O O     . HOH O 4 .   ? -21.646 28.722  -20.553 1.00 19.98  ? 2884 HOH C O     1 
HETATM 6065 O O     . HOH O 4 .   ? -18.119 35.349  -35.832 1.00 22.14  ? 2885 HOH C O     1 
HETATM 6066 O O     . HOH O 4 .   ? -9.572  17.371  -20.861 1.00 22.21  ? 2886 HOH C O     1 
HETATM 6067 O O     . HOH O 4 .   ? -0.900  26.084  -22.666 1.00 20.28  ? 2887 HOH C O     1 
HETATM 6068 O O     . HOH O 4 .   ? -24.858 14.391  -29.877 1.00 22.49  ? 2888 HOH C O     1 
HETATM 6069 O O     . HOH O 4 .   ? 7.198   16.704  -27.582 1.00 25.87  ? 2889 HOH C O     1 
HETATM 6070 O O     . HOH O 4 .   ? -5.110  34.083  -45.132 1.00 24.03  ? 2890 HOH C O     1 
HETATM 6071 O O     . HOH O 4 .   ? -10.730 35.770  -17.614 1.00 26.77  ? 2891 HOH C O     1 
HETATM 6072 O O     . HOH O 4 .   ? 1.400   22.195  -43.457 1.00 26.62  ? 2892 HOH C O     1 
HETATM 6073 O O     . HOH O 4 .   ? -0.507  12.753  -44.851 1.00 21.15  ? 2893 HOH C O     1 
HETATM 6074 O O     . HOH O 4 .   ? -3.085  20.797  -23.135 1.00 26.51  ? 2894 HOH C O     1 
HETATM 6075 O O     . HOH O 4 .   ? -8.227  -2.317  -37.147 1.00 26.23  ? 2895 HOH C O     1 
HETATM 6076 O O     . HOH O 4 .   ? -22.843 5.936   -24.280 1.00 22.88  ? 2896 HOH C O     1 
HETATM 6077 O O     . HOH O 4 .   ? 7.090   24.343  -39.719 1.00 22.61  ? 2897 HOH C O     1 
HETATM 6078 O O     . HOH O 4 .   ? -24.556 11.188  -21.633 1.00 25.40  ? 2898 HOH C O     1 
HETATM 6079 O O     . HOH O 4 .   ? 6.253   24.096  -32.531 1.00 21.65  ? 2899 HOH C O     1 
HETATM 6080 O O     . HOH O 4 .   ? -33.050 29.370  -12.759 1.00 27.43  ? 2900 HOH C O     1 
HETATM 6081 O O     . HOH O 4 .   ? -16.823 25.950  -21.807 1.00 22.80  ? 2901 HOH C O     1 
HETATM 6082 O O     . HOH O 4 .   ? -3.242  28.901  -22.121 1.00 19.33  ? 2902 HOH C O     1 
HETATM 6083 O O     . HOH O 4 .   ? -8.950  37.963  -23.912 1.00 41.09  ? 2903 HOH C O     1 
HETATM 6084 O O     . HOH O 4 .   ? -15.693 8.541   -19.937 1.00 25.83  ? 2904 HOH C O     1 
HETATM 6085 O O     . HOH O 4 .   ? -15.547 30.993  -18.943 1.00 23.15  ? 2905 HOH C O     1 
HETATM 6086 O O     . HOH O 4 .   ? -16.670 33.739  -25.419 1.00 21.15  ? 2906 HOH C O     1 
HETATM 6087 O O     . HOH O 4 .   ? 12.166  11.775  -32.210 1.00 30.08  ? 2907 HOH C O     1 
HETATM 6088 O O     . HOH O 4 .   ? 3.428   22.739  -41.593 1.00 22.71  ? 2908 HOH C O     1 
HETATM 6089 O O     . HOH O 4 .   ? 8.214   7.687   -27.651 1.00 23.89  ? 2909 HOH C O     1 
HETATM 6090 O O     . HOH O 4 .   ? -11.241 4.506   -22.140 1.00 24.78  ? 2910 HOH C O     1 
HETATM 6091 O O     . HOH O 4 .   ? -28.186 28.300  -25.396 1.00 20.32  ? 2911 HOH C O     1 
HETATM 6092 O O     . HOH O 4 .   ? -32.991 26.139  -14.815 1.00 27.80  ? 2912 HOH C O     1 
HETATM 6093 O O     . HOH O 4 .   ? -5.082  23.697  -48.021 1.00 20.35  ? 2913 HOH C O     1 
HETATM 6094 O O     . HOH O 4 .   ? -27.811 18.639  -15.697 1.00 31.88  ? 2914 HOH C O     1 
HETATM 6095 O O     . HOH O 4 .   ? -9.117  16.051  -46.909 1.00 21.14  ? 2915 HOH C O     1 
HETATM 6096 O O     . HOH O 4 .   ? -19.174 23.320  -19.084 1.00 24.21  ? 2916 HOH C O     1 
HETATM 6097 O O     . HOH O 4 .   ? 5.818   27.939  -37.839 1.00 17.38  ? 2917 HOH C O     1 
HETATM 6098 O O     . HOH O 4 .   ? -26.688 12.899  -28.494 1.00 24.91  ? 2918 HOH C O     1 
HETATM 6099 O O     . HOH O 4 .   ? -20.227 14.350  -36.284 1.00 23.38  ? 2919 HOH C O     1 
HETATM 6100 O O     . HOH O 4 .   ? 10.623  21.951  -33.265 1.00 27.46  ? 2920 HOH C O     1 
HETATM 6101 O O     . HOH O 4 .   ? 2.568   18.560  -42.524 1.00 18.14  ? 2921 HOH C O     1 
HETATM 6102 O O     . HOH O 4 .   ? -23.108 20.587  -34.850 1.00 20.79  ? 2922 HOH C O     1 
HETATM 6103 O O     . HOH O 4 .   ? 1.219   21.380  -23.324 1.00 27.57  ? 2923 HOH C O     1 
HETATM 6104 O O     . HOH O 4 .   ? -12.536 -1.658  -22.276 1.00 20.55  ? 2924 HOH C O     1 
HETATM 6105 O O     . HOH O 4 .   ? -5.947  8.667   -24.429 1.00 26.07  ? 2925 HOH C O     1 
HETATM 6106 O O     . HOH O 4 .   ? -22.604 27.565  -31.778 1.00 25.11  ? 2926 HOH C O     1 
HETATM 6107 O O     . HOH O 4 .   ? -6.536  -0.437  -43.556 1.00 23.14  ? 2927 HOH C O     1 
HETATM 6108 O O     . HOH O 4 .   ? 4.974   25.934  -34.081 1.00 17.64  ? 2928 HOH C O     1 
HETATM 6109 O O     . HOH O 4 .   ? 9.146   21.326  -38.198 1.00 25.14  ? 2929 HOH C O     1 
HETATM 6110 O O     . HOH O 4 .   ? -2.846  -1.981  -33.128 1.00 21.38  ? 2930 HOH C O     1 
HETATM 6111 O O     . HOH O 4 .   ? -3.335  20.123  -20.527 1.00 51.51  ? 2931 HOH C O     1 
HETATM 6112 O O     . HOH O 4 .   ? -0.538  5.803   -39.502 1.00 25.72  ? 2932 HOH C O     1 
HETATM 6113 O O     . HOH O 4 .   ? -15.745 36.292  -22.460 1.00 36.25  ? 2933 HOH C O     1 
HETATM 6114 O O     . HOH O 4 .   ? -4.700  31.418  -17.850 1.00 25.52  ? 2934 HOH C O     1 
HETATM 6115 O O     . HOH O 4 .   ? -13.434 1.452   -28.944 1.00 22.97  ? 2935 HOH C O     1 
HETATM 6116 O O     . HOH O 4 .   ? -7.168  18.600  -47.104 1.00 28.81  ? 2936 HOH C O     1 
HETATM 6117 O O     . HOH O 4 .   ? 1.874   8.886   -45.144 1.00 39.62  ? 2937 HOH C O     1 
HETATM 6118 O O     . HOH O 4 .   ? -19.803 35.511  -30.916 1.00 33.12  ? 2938 HOH C O     1 
HETATM 6119 O O     . HOH O 4 .   ? -15.278 27.360  -42.948 1.00 26.70  ? 2939 HOH C O     1 
HETATM 6120 O O     . HOH O 4 .   ? -24.010 6.407   -21.839 1.00 30.30  ? 2940 HOH C O     1 
HETATM 6121 O O     . HOH O 4 .   ? 12.423  16.008  -34.567 1.00 23.57  ? 2941 HOH C O     1 
HETATM 6122 O O     . HOH O 4 .   ? -17.703 3.893   -24.657 1.00 24.84  ? 2942 HOH C O     1 
HETATM 6123 O O     . HOH O 4 .   ? -5.981  27.191  -17.860 1.00 29.35  ? 2943 HOH C O     1 
HETATM 6124 O O     . HOH O 4 .   ? 0.047   23.597  -22.989 1.00 19.91  ? 2944 HOH C O     1 
HETATM 6125 O O     . HOH O 4 .   ? -26.862 14.546  -21.921 1.00 31.51  ? 2945 HOH C O     1 
HETATM 6126 O O     . HOH O 4 .   ? -18.285 1.148   -22.311 1.00 24.00  ? 2946 HOH C O     1 
HETATM 6127 O O     . HOH O 4 .   ? -29.707 18.904  -20.410 1.00 46.50  ? 2947 HOH C O     1 
HETATM 6128 O O     . HOH O 4 .   ? -17.462 7.767   -40.205 1.00 87.17  ? 2948 HOH C O     1 
HETATM 6129 O O     . HOH O 4 .   ? 1.691   10.153  -27.632 1.00 22.70  ? 2949 HOH C O     1 
HETATM 6130 O O     . HOH O 4 .   ? -4.096  38.053  -36.681 1.00 21.87  ? 2950 HOH C O     1 
HETATM 6131 O O     . HOH O 4 .   ? -18.184 20.549  -20.826 1.00 27.23  ? 2951 HOH C O     1 
HETATM 6132 O O     . HOH O 4 .   ? -25.971 16.796  -30.447 1.00 26.30  ? 2952 HOH C O     1 
HETATM 6133 O O     . HOH O 4 .   ? -16.345 14.362  -41.653 1.00 27.50  ? 2953 HOH C O     1 
HETATM 6134 O O     . HOH O 4 .   ? -18.561 27.112  -20.301 1.00 26.28  ? 2954 HOH C O     1 
HETATM 6135 O O     . HOH O 4 .   ? -3.199  26.060  -47.979 1.00 20.74  ? 2955 HOH C O     1 
HETATM 6136 O O     . HOH O 4 .   ? -13.366 -0.647  -31.793 1.00 33.74  ? 2956 HOH C O     1 
HETATM 6137 O O     . HOH O 4 .   ? -2.989  3.293   -52.648 1.00 39.47  ? 2957 HOH C O     1 
HETATM 6138 O O     . HOH O 4 .   ? -4.730  17.650  -22.148 1.00 27.80  ? 2958 HOH C O     1 
HETATM 6139 O O     . HOH O 4 .   ? 7.773   6.663   -29.730 1.00 36.30  ? 2959 HOH C O     1 
HETATM 6140 O O     . HOH O 4 .   ? -3.052  1.611   -38.531 1.00 27.70  ? 2960 HOH C O     1 
HETATM 6141 O O     . HOH O 4 .   ? -32.510 26.740  -26.647 1.00 36.59  ? 2961 HOH C O     1 
HETATM 6142 O O     . HOH O 4 .   ? -15.896 36.394  -36.869 1.00 29.11  ? 2962 HOH C O     1 
HETATM 6143 O O     . HOH O 4 .   ? -30.086 21.940  -30.603 1.00 28.62  ? 2963 HOH C O     1 
HETATM 6144 O O     . HOH O 4 .   ? -22.168 19.963  -39.406 1.00 39.00  ? 2964 HOH C O     1 
HETATM 6145 O O     . HOH O 4 .   ? -26.951 30.445  -6.945  1.00 35.65  ? 2965 HOH C O     1 
HETATM 6146 O O     . HOH O 4 .   ? -20.047 14.157  -38.857 1.00 34.03  ? 2966 HOH C O     1 
HETATM 6147 O O     . HOH O 4 .   ? 7.612   5.982   -32.101 1.00 35.72  ? 2967 HOH C O     1 
HETATM 6148 O O     . HOH O 4 .   ? -20.174 3.124   -30.800 1.00 46.22  ? 2968 HOH C O     1 
HETATM 6149 O O     . HOH O 4 .   ? -19.077 7.989   -38.043 1.00 28.19  ? 2969 HOH C O     1 
HETATM 6150 O O     . HOH O 4 .   ? -30.112 16.202  -24.630 1.00 28.83  ? 2970 HOH C O     1 
HETATM 6151 O O     . HOH O 4 .   ? -25.043 32.935  -21.367 1.00 23.89  ? 2971 HOH C O     1 
HETATM 6152 O O     . HOH O 4 .   ? -12.948 6.146   -19.765 1.00 32.68  ? 2972 HOH C O     1 
HETATM 6153 O O     . HOH O 4 .   ? 5.740   35.546  -40.376 1.00 31.76  ? 2973 HOH C O     1 
HETATM 6154 O O     . HOH O 4 .   ? -10.986 31.729  -14.703 1.00 58.31  ? 2974 HOH C O     1 
HETATM 6155 O O     . HOH O 4 .   ? 6.377   8.314   -25.708 1.00 20.05  ? 2975 HOH C O     1 
HETATM 6156 O O     . HOH O 4 .   ? -29.718 20.151  -23.880 1.00 29.36  ? 2976 HOH C O     1 
HETATM 6157 O O     . HOH O 4 .   ? 5.742   17.284  -22.539 1.00 42.52  ? 2977 HOH C O     1 
HETATM 6158 O O     . HOH O 4 .   ? -21.390 31.708  -30.023 1.00 37.28  ? 2978 HOH C O     1 
HETATM 6159 O O     . HOH O 4 .   ? -3.510  25.490  -23.700 1.00 23.59  ? 2979 HOH C O     1 
HETATM 6160 O O     . HOH O 4 .   ? -2.795  6.630   -34.325 1.00 36.05  ? 2980 HOH C O     1 
HETATM 6161 O O     . HOH O 4 .   ? -19.583 6.176   -34.366 1.00 31.69  ? 2981 HOH C O     1 
HETATM 6162 O O     . HOH O 4 .   ? -17.353 13.671  -32.815 1.00 17.76  ? 2982 HOH C O     1 
HETATM 6163 O O     . HOH O 4 .   ? 3.438   30.261  -31.066 1.00 17.60  ? 2983 HOH C O     1 
HETATM 6164 O O     . HOH O 4 .   ? 5.906   28.318  -34.835 1.00 22.39  ? 2984 HOH C O     1 
HETATM 6165 O O     . HOH O 4 .   ? 2.468   33.157  -37.415 1.00 19.04  ? 2985 HOH C O     1 
HETATM 6166 O O     . HOH O 4 .   ? -26.159 32.054  -23.664 1.00 22.78  ? 2986 HOH C O     1 
HETATM 6167 O O     . HOH O 4 .   ? -24.496 17.940  -32.338 1.00 23.36  ? 2987 HOH C O     1 
HETATM 6168 O O     . HOH O 4 .   ? -11.674 13.204  -20.552 1.00 25.75  ? 2988 HOH C O     1 
HETATM 6169 O O     . HOH O 4 .   ? -16.983 23.520  -20.617 1.00 27.54  ? 2989 HOH C O     1 
HETATM 6170 O O     . HOH O 4 .   ? -21.423 11.535  -33.345 1.00 22.88  ? 2990 HOH C O     1 
HETATM 6171 O O     . HOH O 4 .   ? -6.654  39.692  -37.143 1.00 22.94  ? 2991 HOH C O     1 
HETATM 6172 O O     . HOH O 4 .   ? 8.432   25.010  -35.812 1.00 23.97  ? 2992 HOH C O     1 
HETATM 6173 O O     . HOH O 4 .   ? -24.285 30.246  -24.764 1.00 26.79  ? 2993 HOH C O     1 
HETATM 6174 O O     . HOH O 4 .   ? -19.908 18.977  -41.296 1.00 25.88  ? 2994 HOH C O     1 
HETATM 6175 O O     . HOH O 4 .   ? 5.991   22.566  -22.685 1.00 23.91  ? 2995 HOH C O     1 
HETATM 6176 O O     . HOH O 4 .   ? -18.816 33.562  -38.150 1.00 28.82  ? 2996 HOH C O     1 
HETATM 6177 O O     . HOH O 4 .   ? -3.600  41.092  -33.968 1.00 21.29  ? 2997 HOH C O     1 
HETATM 6178 O O     . HOH O 4 .   ? -7.920  35.680  -42.546 1.00 26.51  ? 2998 HOH C O     1 
HETATM 6179 O O     . HOH O 4 .   ? 3.503   21.194  -22.031 1.00 29.14  ? 2999 HOH C O     1 
HETATM 6180 O O     . HOH O 4 .   ? -20.208 22.109  -5.264  1.00 30.26  ? 3000 HOH C O     1 
HETATM 6181 O O     . HOH O 4 .   ? -0.956  3.002   -39.910 1.00 29.76  ? 3001 HOH C O     1 
HETATM 6182 O O     . HOH O 4 .   ? -5.901  -1.907  -39.026 1.00 28.47  ? 3002 HOH C O     1 
HETATM 6183 O O     . HOH O 4 .   ? -11.708 27.507  -47.340 1.00 23.28  ? 3003 HOH C O     1 
HETATM 6184 O O     . HOH O 4 .   ? -1.111  34.654  -36.599 1.00 24.88  ? 3004 HOH C O     1 
HETATM 6185 O O     . HOH O 4 .   ? -19.700 31.363  -21.203 1.00 30.21  ? 3005 HOH C O     1 
HETATM 6186 O O     . HOH O 4 .   ? 6.921   23.883  -42.398 1.00 34.45  ? 3006 HOH C O     1 
HETATM 6187 O O     . HOH O 4 .   ? -12.374 25.241  -44.192 1.00 25.82  ? 3007 HOH C O     1 
HETATM 6188 O O     . HOH O 4 .   ? -32.577 25.146  -17.228 1.00 30.26  ? 3008 HOH C O     1 
HETATM 6189 O O     . HOH O 4 .   ? -18.504 15.279  -40.720 1.00 35.64  ? 3009 HOH C O     1 
HETATM 6190 O O     . HOH O 4 .   ? -13.276 9.343   -20.473 1.00 32.55  ? 3010 HOH C O     1 
HETATM 6191 O O     . HOH O 4 .   ? -28.786 21.595  -5.932  1.00 27.03  ? 3011 HOH C O     1 
HETATM 6192 O O     . HOH O 4 .   ? -31.806 19.338  -22.035 1.00 40.60  ? 3012 HOH C O     1 
HETATM 6193 O O     . HOH O 4 .   ? 8.883   24.219  -33.342 1.00 30.81  ? 3013 HOH C O     1 
HETATM 6194 O O     . HOH O 4 .   ? -16.009 19.085  -20.133 1.00 43.48  ? 3014 HOH C O     1 
HETATM 6195 O O     . HOH O 4 .   ? -6.403  38.317  -18.511 1.00 22.46  ? 3015 HOH C O     1 
HETATM 6196 O O     . HOH O 4 .   ? 3.192   35.975  -40.769 1.00 29.20  ? 3016 HOH C O     1 
HETATM 6197 O O     . HOH O 4 .   ? 9.976   22.847  -36.029 1.00 29.89  ? 3017 HOH C O     1 
HETATM 6198 O O     . HOH O 4 .   ? -28.604 9.089   -27.316 1.00 31.85  ? 3018 HOH C O     1 
HETATM 6199 O O     . HOH O 4 .   ? -2.497  19.211  -43.334 1.00 27.25  ? 3019 HOH C O     1 
HETATM 6200 O O     . HOH O 4 .   ? -14.851 29.825  -42.126 1.00 29.64  ? 3020 HOH C O     1 
HETATM 6201 O O     . HOH O 4 .   ? -24.999 13.107  -32.159 1.00 39.25  ? 3021 HOH C O     1 
HETATM 6202 O O     . HOH O 4 .   ? -4.470  37.922  -42.567 1.00 41.36  ? 3022 HOH C O     1 
HETATM 6203 O O     . HOH O 4 .   ? -20.650 15.378  -33.611 1.00 29.40  ? 3023 HOH C O     1 
HETATM 6204 O O     . HOH O 4 .   ? 14.663  18.549  -33.381 1.00 43.99  ? 3024 HOH C O     1 
HETATM 6205 O O     . HOH O 4 .   ? -14.497 19.108  -17.767 1.00 37.89  ? 3025 HOH C O     1 
HETATM 6206 O O     . HOH O 4 .   ? -23.142 17.465  -19.768 1.00 34.50  ? 3026 HOH C O     1 
HETATM 6207 O O     . HOH O 4 .   ? -11.830 29.315  -15.972 1.00 36.99  ? 3027 HOH C O     1 
HETATM 6208 O O     . HOH O 4 .   ? -15.883 33.799  -18.921 1.00 30.47  ? 3028 HOH C O     1 
HETATM 6209 O O     . HOH O 4 .   ? 11.380  15.783  -40.660 1.00 32.81  ? 3029 HOH C O     1 
HETATM 6210 O O     . HOH O 4 .   ? -20.302 26.646  -39.130 1.00 33.91  ? 3030 HOH C O     1 
HETATM 6211 O O     . HOH O 4 .   ? -12.507 13.511  -48.397 1.00 33.49  ? 3031 HOH C O     1 
HETATM 6212 O O     . HOH O 4 .   ? -25.766 28.493  -28.646 1.00 31.56  ? 3032 HOH C O     1 
HETATM 6213 O O     . HOH O 4 .   ? -8.179  12.368  -48.367 1.00 34.48  ? 3033 HOH C O     1 
HETATM 6214 O O     . HOH O 4 .   ? -32.056 25.493  -23.102 1.00 59.35  ? 3034 HOH C O     1 
HETATM 6215 O O     . HOH O 4 .   ? -19.867 29.562  -31.596 1.00 22.83  ? 3035 HOH C O     1 
HETATM 6216 O O     . HOH O 4 .   ? -28.623 8.383   -23.454 1.00 33.29  ? 3036 HOH C O     1 
HETATM 6217 O O     . HOH O 4 .   ? -9.820  26.432  -45.890 1.00 28.42  ? 3037 HOH C O     1 
HETATM 6218 O O     . HOH O 4 .   ? -0.154  23.464  -45.745 1.00 32.96  ? 3038 HOH C O     1 
HETATM 6219 O O     . HOH O 4 .   ? -34.186 28.940  -10.251 1.00 34.49  ? 3039 HOH C O     1 
HETATM 6220 O O     . HOH O 4 .   ? -16.668 31.440  -37.953 1.00 29.77  ? 3040 HOH C O     1 
HETATM 6221 O O     . HOH O 4 .   ? -2.274  -1.004  -35.594 1.00 37.08  ? 3041 HOH C O     1 
HETATM 6222 O O     . HOH O 4 .   ? -8.714  -1.727  -44.391 1.00 32.51  ? 3042 HOH C O     1 
HETATM 6223 O O     . HOH O 4 .   ? -15.171 35.215  -39.394 1.00 40.22  ? 3043 HOH C O     1 
HETATM 6224 O O     . HOH O 4 .   ? -12.721 42.615  -24.677 1.00 33.76  ? 3044 HOH C O     1 
HETATM 6225 O O     . HOH O 4 .   ? -7.878  -3.338  -34.284 1.00 31.96  ? 3045 HOH C O     1 
HETATM 6226 O O     . HOH O 4 .   ? -14.037 38.589  -38.874 1.00 52.31  ? 3046 HOH C O     1 
HETATM 6227 O O     . HOH O 4 .   ? -29.270 25.191  -30.306 1.00 41.84  ? 3047 HOH C O     1 
HETATM 6228 O O     . HOH O 4 .   ? -31.305 21.982  -25.046 1.00 44.85  ? 3048 HOH C O     1 
HETATM 6229 O O     . HOH O 4 .   ? -14.388 0.441   -35.019 1.00 48.30  ? 3049 HOH C O     1 
HETATM 6230 O O     . HOH O 4 .   ? -17.225 29.539  -39.681 1.00 37.79  ? 3050 HOH C O     1 
HETATM 6231 O O     . HOH O 4 .   ? -26.527 7.079   -22.467 1.00 29.74  ? 3051 HOH C O     1 
HETATM 6232 O O     . HOH O 4 .   ? -14.780 6.713   -17.631 1.00 36.77  ? 3052 HOH C O     1 
HETATM 6233 O O     . HOH O 4 .   ? -26.477 19.231  -34.280 1.00 33.22  ? 3053 HOH C O     1 
HETATM 6234 O O     . HOH O 4 .   ? 5.551   5.292   -30.701 1.00 35.28  ? 3054 HOH C O     1 
HETATM 6235 O O     . HOH O 4 .   ? -32.803 29.018  -5.625  1.00 64.07  ? 3055 HOH C O     1 
HETATM 6236 O O     . HOH O 4 .   ? -19.639 19.059  -45.464 1.00 48.16  ? 3056 HOH C O     1 
HETATM 6237 O O     . HOH O 4 .   ? -29.107 13.849  -27.825 1.00 27.93  ? 3057 HOH C O     1 
HETATM 6238 O O     . HOH O 4 .   ? -13.940 -2.488  -19.360 1.00 33.61  ? 3058 HOH C O     1 
HETATM 6239 O O     . HOH O 4 .   ? -3.847  0.672   -46.767 1.00 68.78  ? 3059 HOH C O     1 
HETATM 6240 O O     . HOH O 4 .   ? -5.450  -2.166  -41.536 1.00 35.68  ? 3060 HOH C O     1 
HETATM 6241 O O     . HOH O 4 .   ? 6.874   32.842  -38.717 1.00 37.56  ? 3061 HOH C O     1 
HETATM 6242 O O     . HOH O 4 .   ? -19.420 5.530   -31.768 1.00 35.08  ? 3062 HOH C O     1 
HETATM 6243 O O     . HOH O 4 .   ? -18.421 12.675  -43.329 1.00 40.54  ? 3063 HOH C O     1 
HETATM 6244 O O     . HOH O 4 .   ? -28.371 19.635  -12.778 1.00 36.28  ? 3064 HOH C O     1 
HETATM 6245 O O     . HOH O 4 .   ? -18.820 3.141   -34.968 1.00 41.32  ? 3065 HOH C O     1 
HETATM 6246 O O     . HOH O 4 .   ? 2.463   6.317   -48.771 1.00 44.97  ? 3066 HOH C O     1 
HETATM 6247 O O     . HOH O 4 .   ? 9.185   8.870   -38.044 1.00 36.66  ? 3067 HOH C O     1 
HETATM 6248 O O     . HOH P 4 .   ? -2.704  21.449  -68.939 1.00 7.59   ? 2804 HOH D O     1 
HETATM 6249 O O     . HOH P 4 .   ? -0.591  25.284  -63.274 1.00 7.24   ? 2805 HOH D O     1 
HETATM 6250 O O     . HOH P 4 .   ? 5.062   28.968  -64.902 1.00 9.48   ? 2806 HOH D O     1 
HETATM 6251 O O     . HOH P 4 .   ? 9.476   27.632  -58.669 1.00 10.83  ? 2807 HOH D O     1 
HETATM 6252 O O     . HOH P 4 .   ? 7.011   27.453  -66.279 1.00 9.18   ? 2808 HOH D O     1 
HETATM 6253 O O     . HOH P 4 .   ? -3.723  34.349  -58.796 1.00 9.86   ? 2809 HOH D O     1 
HETATM 6254 O O     . HOH P 4 .   ? -8.283  30.967  -62.482 1.00 10.17  ? 2810 HOH D O     1 
HETATM 6255 O O     . HOH P 4 .   ? 1.844   31.723  -69.555 1.00 9.88   ? 2811 HOH D O     1 
HETATM 6256 O O     . HOH P 4 .   ? -0.072  20.438  -55.513 1.00 10.41  ? 2812 HOH D O     1 
HETATM 6257 O O     . HOH P 4 .   ? -0.129  15.455  -59.074 1.00 13.65  ? 2813 HOH D O     1 
HETATM 6258 O O     . HOH P 4 .   ? -8.967  18.911  -54.920 1.00 11.98  ? 2814 HOH D O     1 
HETATM 6259 O O     . HOH P 4 .   ? -10.592 20.031  -75.682 1.00 13.38  ? 2815 HOH D O     1 
HETATM 6260 O O     . HOH P 4 .   ? 0.619   28.835  -44.657 1.00 12.70  ? 2816 HOH D O     1 
HETATM 6261 O O     . HOH P 4 .   ? 5.278   33.169  -64.883 1.00 11.76  ? 2817 HOH D O     1 
HETATM 6262 O O     . HOH P 4 .   ? 13.101  16.290  -69.207 1.00 11.65  ? 2818 HOH D O     1 
HETATM 6263 O O     . HOH P 4 .   ? 10.767  25.447  -66.587 1.00 12.28  ? 2819 HOH D O     1 
HETATM 6264 O O     . HOH P 4 .   ? -7.061  21.651  -48.879 1.00 15.12  ? 2820 HOH D O     1 
HETATM 6265 O O     . HOH P 4 .   ? 2.745   26.946  -77.460 1.00 13.36  ? 2821 HOH D O     1 
HETATM 6266 O O     . HOH P 4 .   ? 3.823   34.975  -63.513 1.00 12.32  ? 2822 HOH D O     1 
HETATM 6267 O O     . HOH P 4 .   ? 7.909   28.703  -72.117 1.00 13.95  ? 2823 HOH D O     1 
HETATM 6268 O O     . HOH P 4 .   ? -8.394  17.579  -65.914 1.00 14.62  ? 2824 HOH D O     1 
HETATM 6269 O O     . HOH P 4 .   ? 2.942   37.226  -60.773 1.00 14.05  ? 2825 HOH D O     1 
HETATM 6270 O O     . HOH P 4 .   ? -12.139 26.823  -65.675 1.00 13.19  ? 2826 HOH D O     1 
HETATM 6271 O O     . HOH P 4 .   ? -3.045  13.283  -69.749 1.00 10.76  ? 2827 HOH D O     1 
HETATM 6272 O O     . HOH P 4 .   ? 6.887   33.361  -45.100 1.00 14.42  ? 2828 HOH D O     1 
HETATM 6273 O O     . HOH P 4 .   ? 7.876   33.943  -64.871 1.00 12.93  ? 2829 HOH D O     1 
HETATM 6274 O O     . HOH P 4 .   ? -4.571  13.954  -71.915 1.00 9.52   ? 2830 HOH D O     1 
HETATM 6275 O O     . HOH P 4 .   ? -0.236  27.076  -46.899 1.00 16.02  ? 2831 HOH D O     1 
HETATM 6276 O O     . HOH P 4 .   ? -3.697  36.969  -64.225 1.00 16.17  ? 2832 HOH D O     1 
HETATM 6277 O O     . HOH P 4 .   ? -0.816  40.008  -66.373 1.00 17.81  ? 2833 HOH D O     1 
HETATM 6278 O O     . HOH P 4 .   ? 4.866   30.075  -74.240 1.00 17.95  ? 2834 HOH D O     1 
HETATM 6279 O O     . HOH P 4 .   ? -13.548 27.559  -61.924 1.00 15.00  ? 2835 HOH D O     1 
HETATM 6280 O O     . HOH P 4 .   ? -4.080  30.646  -56.582 1.00 13.50  ? 2836 HOH D O     1 
HETATM 6281 O O     . HOH P 4 .   ? -19.917 26.403  -58.411 1.00 15.43  ? 2837 HOH D O     1 
HETATM 6282 O O     . HOH P 4 .   ? 12.578  27.273  -65.187 1.00 12.54  ? 2838 HOH D O     1 
HETATM 6283 O O     . HOH P 4 .   ? -9.660  36.823  -57.995 1.00 15.30  ? 2839 HOH D O     1 
HETATM 6284 O O     . HOH P 4 .   ? 9.713   30.908  -60.083 1.00 18.47  ? 2840 HOH D O     1 
HETATM 6285 O O     . HOH P 4 .   ? -6.735  17.399  -54.457 1.00 13.37  ? 2841 HOH D O     1 
HETATM 6286 O O     . HOH P 4 .   ? 14.885  15.102  -65.664 1.00 14.47  ? 2842 HOH D O     1 
HETATM 6287 O O     . HOH P 4 .   ? -3.560  10.606  -66.316 1.00 16.21  ? 2843 HOH D O     1 
HETATM 6288 O O     . HOH P 4 .   ? 19.097  19.065  -68.480 1.00 16.73  ? 2844 HOH D O     1 
HETATM 6289 O O     . HOH P 4 .   ? 14.694  30.073  -65.810 1.00 17.18  ? 2845 HOH D O     1 
HETATM 6290 O O     . HOH P 4 .   ? -19.196 18.308  -60.046 1.00 15.11  ? 2846 HOH D O     1 
HETATM 6291 O O     . HOH P 4 .   ? 20.195  29.162  -56.473 1.00 17.90  ? 2847 HOH D O     1 
HETATM 6292 O O     . HOH P 4 .   ? 26.768  28.669  -51.909 1.00 16.44  ? 2848 HOH D O     1 
HETATM 6293 O O     . HOH P 4 .   ? -12.258 17.728  -50.567 1.00 17.21  ? 2849 HOH D O     1 
HETATM 6294 O O     . HOH P 4 .   ? 13.846  22.637  -72.110 1.00 18.42  ? 2850 HOH D O     1 
HETATM 6295 O O     . HOH P 4 .   ? 7.829   38.494  -50.386 1.00 19.93  ? 2851 HOH D O     1 
HETATM 6296 O O     . HOH P 4 .   ? -7.789  17.512  -72.308 1.00 11.34  ? 2852 HOH D O     1 
HETATM 6297 O O     . HOH P 4 .   ? -16.118 19.729  -63.229 1.00 20.70  ? 2853 HOH D O     1 
HETATM 6298 O O     . HOH P 4 .   ? -5.936  12.897  -65.644 1.00 16.99  ? 2854 HOH D O     1 
HETATM 6299 O O     . HOH P 4 .   ? 11.227  21.874  -69.442 1.00 17.68  ? 2855 HOH D O     1 
HETATM 6300 O O     . HOH P 4 .   ? -8.178  12.948  -62.274 1.00 17.34  ? 2856 HOH D O     1 
HETATM 6301 O O     . HOH P 4 .   ? 22.728  25.650  -65.591 1.00 18.52  ? 2857 HOH D O     1 
HETATM 6302 O O     . HOH P 4 .   ? 13.983  29.404  -61.764 1.00 15.82  ? 2858 HOH D O     1 
HETATM 6303 O O     . HOH P 4 .   ? -13.514 25.570  -46.854 1.00 16.90  ? 2859 HOH D O     1 
HETATM 6304 O O     . HOH P 4 .   ? 9.470   22.388  -78.045 1.00 21.16  ? 2860 HOH D O     1 
HETATM 6305 O O     . HOH P 4 .   ? 12.195  20.462  -71.570 1.00 15.25  ? 2861 HOH D O     1 
HETATM 6306 O O     . HOH P 4 .   ? -0.074  40.920  -45.443 1.00 20.97  ? 2862 HOH D O     1 
HETATM 6307 O O     . HOH P 4 .   ? 24.837  22.031  -63.235 1.00 18.81  ? 2863 HOH D O     1 
HETATM 6308 O O     . HOH P 4 .   ? 1.178   17.724  -57.591 1.00 15.46  ? 2864 HOH D O     1 
HETATM 6309 O O     . HOH P 4 .   ? 13.104  18.041  -71.346 1.00 16.23  ? 2865 HOH D O     1 
HETATM 6310 O O     . HOH P 4 .   ? 5.228   4.688   -66.721 1.00 22.12  ? 2866 HOH D O     1 
HETATM 6311 O O     . HOH P 4 .   ? -16.707 18.154  -61.030 1.00 20.00  ? 2867 HOH D O     1 
HETATM 6312 O O     . HOH P 4 .   ? 21.862  18.772  -68.552 1.00 21.08  ? 2868 HOH D O     1 
HETATM 6313 O O     . HOH P 4 .   ? -8.437  15.977  -68.692 1.00 17.29  ? 2869 HOH D O     1 
HETATM 6314 O O     . HOH P 4 .   ? 14.850  9.391   -68.359 1.00 17.96  ? 2870 HOH D O     1 
HETATM 6315 O O     . HOH P 4 .   ? 11.924  6.379   -66.272 1.00 15.36  ? 2871 HOH D O     1 
HETATM 6316 O O     . HOH P 4 .   ? 12.488  24.216  -68.712 1.00 20.84  ? 2872 HOH D O     1 
HETATM 6317 O O     . HOH P 4 .   ? 20.435  25.859  -61.331 1.00 26.09  ? 2873 HOH D O     1 
HETATM 6318 O O     . HOH P 4 .   ? 1.990   9.849   -78.859 1.00 17.40  ? 2874 HOH D O     1 
HETATM 6319 O O     . HOH P 4 .   ? 18.129  29.872  -71.547 1.00 21.52  ? 2875 HOH D O     1 
HETATM 6320 O O     . HOH P 4 .   ? -4.676  35.100  -47.557 1.00 23.20  ? 2876 HOH D O     1 
HETATM 6321 O O     . HOH P 4 .   ? -10.968 17.168  -53.521 1.00 27.01  ? 2877 HOH D O     1 
HETATM 6322 O O     . HOH P 4 .   ? -12.073 29.534  -63.253 1.00 15.48  ? 2878 HOH D O     1 
HETATM 6323 O O     . HOH P 4 .   ? 4.658   22.164  -48.674 1.00 20.67  ? 2879 HOH D O     1 
HETATM 6324 O O     . HOH P 4 .   ? 4.458   9.520   -77.674 1.00 18.36  ? 2880 HOH D O     1 
HETATM 6325 O O     . HOH P 4 .   ? 12.433  14.293  -70.943 1.00 17.72  ? 2881 HOH D O     1 
HETATM 6326 O O     . HOH P 4 .   ? 12.609  30.210  -57.030 1.00 17.33  ? 2882 HOH D O     1 
HETATM 6327 O O     . HOH P 4 .   ? -17.897 22.337  -76.447 1.00 19.67  ? 2883 HOH D O     1 
HETATM 6328 O O     . HOH P 4 .   ? 15.422  31.584  -68.131 1.00 21.78  ? 2884 HOH D O     1 
HETATM 6329 O O     . HOH P 4 .   ? -18.455 20.801  -56.313 1.00 18.99  ? 2885 HOH D O     1 
HETATM 6330 O O     . HOH P 4 .   ? 16.458  19.668  -53.431 1.00 20.17  ? 2886 HOH D O     1 
HETATM 6331 O O     . HOH P 4 .   ? 2.668   38.816  -70.913 1.00 24.20  ? 2887 HOH D O     1 
HETATM 6332 O O     . HOH P 4 .   ? 18.015  29.101  -58.066 1.00 18.40  ? 2888 HOH D O     1 
HETATM 6333 O O     . HOH P 4 .   ? -12.883 20.058  -66.484 1.00 18.74  ? 2889 HOH D O     1 
HETATM 6334 O O     . HOH P 4 .   ? -19.693 15.858  -55.882 1.00 20.39  ? 2890 HOH D O     1 
HETATM 6335 O O     . HOH P 4 .   ? 31.101  8.061   -63.440 1.00 86.41  ? 2891 HOH D O     1 
HETATM 6336 O O     . HOH P 4 .   ? -11.352 18.424  -63.528 1.00 21.18  ? 2892 HOH D O     1 
HETATM 6337 O O     . HOH P 4 .   ? 14.225  10.567  -65.093 1.00 23.14  ? 2893 HOH D O     1 
HETATM 6338 O O     . HOH P 4 .   ? 6.330   25.992  -76.327 1.00 16.97  ? 2894 HOH D O     1 
HETATM 6339 O O     . HOH P 4 .   ? 6.823   8.051   -72.744 1.00 20.87  ? 2895 HOH D O     1 
HETATM 6340 O O     . HOH P 4 .   ? -20.284 22.790  -56.747 1.00 17.73  ? 2896 HOH D O     1 
HETATM 6341 O O     . HOH P 4 .   ? 14.395  31.944  -63.588 1.00 27.02  ? 2897 HOH D O     1 
HETATM 6342 O O     . HOH P 4 .   ? -16.442 22.318  -63.039 1.00 18.20  ? 2898 HOH D O     1 
HETATM 6343 O O     . HOH P 4 .   ? 12.610  30.998  -60.009 1.00 22.39  ? 2899 HOH D O     1 
HETATM 6344 O O     . HOH P 4 .   ? -10.256 35.356  -60.203 1.00 20.29  ? 2900 HOH D O     1 
HETATM 6345 O O     . HOH P 4 .   ? 20.848  9.769   -62.421 1.00 21.17  ? 2901 HOH D O     1 
HETATM 6346 O O     . HOH P 4 .   ? 24.320  29.993  -56.658 1.00 23.16  ? 2902 HOH D O     1 
HETATM 6347 O O     . HOH P 4 .   ? 17.788  28.776  -47.944 1.00 32.36  ? 2903 HOH D O     1 
HETATM 6348 O O     . HOH P 4 .   ? 9.158   11.897  -78.295 1.00 25.59  ? 2904 HOH D O     1 
HETATM 6349 O O     . HOH P 4 .   ? 20.061  14.701  -56.806 1.00 22.26  ? 2905 HOH D O     1 
HETATM 6350 O O     . HOH P 4 .   ? 23.310  14.620  -66.084 1.00 22.79  ? 2906 HOH D O     1 
HETATM 6351 O O     . HOH P 4 .   ? 0.901   8.532   -62.413 1.00 23.38  ? 2907 HOH D O     1 
HETATM 6352 O O     . HOH P 4 .   ? -7.673  27.449  -50.625 1.00 21.81  ? 2908 HOH D O     1 
HETATM 6353 O O     . HOH P 4 .   ? -5.985  43.279  -47.126 1.00 36.73  ? 2909 HOH D O     1 
HETATM 6354 O O     . HOH P 4 .   ? -9.965  41.767  -50.727 1.00 29.79  ? 2910 HOH D O     1 
HETATM 6355 O O     . HOH P 4 .   ? 22.092  22.927  -54.495 1.00 18.44  ? 2911 HOH D O     1 
HETATM 6356 O O     . HOH P 4 .   ? -5.988  34.418  -52.912 1.00 22.54  ? 2912 HOH D O     1 
HETATM 6357 O O     . HOH P 4 .   ? 2.504   5.718   -69.535 1.00 25.74  ? 2913 HOH D O     1 
HETATM 6358 O O     . HOH P 4 .   ? 9.833   37.864  -55.699 1.00 28.11  ? 2914 HOH D O     1 
HETATM 6359 O O     . HOH P 4 .   ? 30.586  2.479   -65.029 1.00 45.85  ? 2915 HOH D O     1 
HETATM 6360 O O     . HOH P 4 .   ? 17.482  12.312  -56.737 1.00 24.58  ? 2916 HOH D O     1 
HETATM 6361 O O     . HOH P 4 .   ? 25.589  13.474  -55.069 1.00 33.65  ? 2917 HOH D O     1 
HETATM 6362 O O     . HOH P 4 .   ? 10.986  34.968  -58.073 1.00 25.77  ? 2918 HOH D O     1 
HETATM 6363 O O     . HOH P 4 .   ? 12.472  29.413  -44.860 1.00 25.72  ? 2919 HOH D O     1 
HETATM 6364 O O     . HOH P 4 .   ? -20.282 20.631  -61.052 1.00 14.39  ? 2920 HOH D O     1 
HETATM 6365 O O     . HOH P 4 .   ? 22.843  22.505  -59.360 1.00 17.56  ? 2921 HOH D O     1 
HETATM 6366 O O     . HOH P 4 .   ? 13.316  14.590  -61.425 1.00 25.39  ? 2922 HOH D O     1 
HETATM 6367 O O     . HOH P 4 .   ? -5.415  37.722  -47.988 1.00 25.22  ? 2923 HOH D O     1 
HETATM 6368 O O     . HOH P 4 .   ? 31.080  4.651   -60.629 1.00 53.83  ? 2924 HOH D O     1 
HETATM 6369 O O     . HOH P 4 .   ? -4.130  43.770  -49.868 1.00 24.48  ? 2925 HOH D O     1 
HETATM 6370 O O     . HOH P 4 .   ? 22.370  22.274  -69.998 1.00 30.30  ? 2926 HOH D O     1 
HETATM 6371 O O     . HOH P 4 .   ? 14.151  17.689  -55.429 1.00 26.95  ? 2927 HOH D O     1 
HETATM 6372 O O     . HOH P 4 .   ? 7.985   17.913  -52.379 1.00 22.53  ? 2928 HOH D O     1 
HETATM 6373 O O     . HOH P 4 .   ? -14.481 12.984  -58.927 1.00 25.59  ? 2929 HOH D O     1 
HETATM 6374 O O     . HOH P 4 .   ? 1.539   16.790  -79.502 1.00 28.35  ? 2930 HOH D O     1 
HETATM 6375 O O     . HOH P 4 .   ? 19.668  24.582  -48.697 1.00 28.10  ? 2931 HOH D O     1 
HETATM 6376 O O     . HOH P 4 .   ? 7.954   10.123  -60.834 1.00 21.47  ? 2932 HOH D O     1 
HETATM 6377 O O     . HOH P 4 .   ? 21.095  25.701  -67.706 1.00 23.17  ? 2933 HOH D O     1 
HETATM 6378 O O     . HOH P 4 .   ? 4.616   7.138   -76.449 1.00 23.19  ? 2934 HOH D O     1 
HETATM 6379 O O     . HOH P 4 .   ? 15.743  14.252  -58.063 1.00 23.08  ? 2935 HOH D O     1 
HETATM 6380 O O     . HOH P 4 .   ? 8.340   36.023  -63.232 1.00 27.29  ? 2936 HOH D O     1 
HETATM 6381 O O     . HOH P 4 .   ? 10.594  29.631  -72.239 1.00 23.73  ? 2937 HOH D O     1 
HETATM 6382 O O     . HOH P 4 .   ? -13.254 20.371  -69.318 1.00 23.78  ? 2938 HOH D O     1 
HETATM 6383 O O     . HOH P 4 .   ? -17.357 30.062  -58.469 1.00 26.07  ? 2939 HOH D O     1 
HETATM 6384 O O     . HOH P 4 .   ? -2.607  40.657  -45.446 1.00 36.03  ? 2940 HOH D O     1 
HETATM 6385 O O     . HOH P 4 .   ? 15.903  12.826  -64.512 1.00 18.03  ? 2941 HOH D O     1 
HETATM 6386 O O     . HOH P 4 .   ? 13.016  18.949  -75.602 1.00 27.12  ? 2942 HOH D O     1 
HETATM 6387 O O     . HOH P 4 .   ? 12.187  22.518  -46.220 1.00 26.17  ? 2943 HOH D O     1 
HETATM 6388 O O     . HOH P 4 .   ? 19.004  32.475  -50.672 1.00 45.71  ? 2944 HOH D O     1 
HETATM 6389 O O     . HOH P 4 .   ? 28.606  11.718  -63.627 1.00 29.45  ? 2945 HOH D O     1 
HETATM 6390 O O     . HOH P 4 .   ? -1.113  16.245  -53.656 1.00 26.60  ? 2946 HOH D O     1 
HETATM 6391 O O     . HOH P 4 .   ? -21.829 20.333  -52.966 1.00 27.08  ? 2947 HOH D O     1 
HETATM 6392 O O     . HOH P 4 .   ? 7.656   35.926  -70.675 1.00 31.76  ? 2948 HOH D O     1 
HETATM 6393 O O     . HOH P 4 .   ? 18.012  23.399  -71.368 1.00 25.57  ? 2949 HOH D O     1 
HETATM 6394 O O     . HOH P 4 .   ? 1.176   36.829  -42.396 1.00 41.89  ? 2950 HOH D O     1 
HETATM 6395 O O     . HOH P 4 .   ? 4.711   6.596   -73.446 1.00 27.46  ? 2951 HOH D O     1 
HETATM 6396 O O     . HOH P 4 .   ? 13.198  24.242  -40.791 1.00 40.37  ? 2952 HOH D O     1 
HETATM 6397 O O     . HOH P 4 .   ? -14.488 12.860  -61.694 1.00 25.53  ? 2953 HOH D O     1 
HETATM 6398 O O     . HOH P 4 .   ? -5.998  41.617  -60.090 1.00 26.27  ? 2954 HOH D O     1 
HETATM 6399 O O     . HOH P 4 .   ? -6.205  40.658  -64.422 1.00 43.31  ? 2955 HOH D O     1 
HETATM 6400 O O     . HOH P 4 .   ? 3.349   40.483  -68.150 1.00 34.67  ? 2956 HOH D O     1 
HETATM 6401 O O     . HOH P 4 .   ? -18.713 19.568  -50.170 1.00 32.02  ? 2957 HOH D O     1 
HETATM 6402 O O     . HOH P 4 .   ? 14.602  24.339  -70.062 1.00 27.84  ? 2958 HOH D O     1 
HETATM 6403 O O     . HOH P 4 .   ? 9.249   36.362  -76.472 1.00 47.68  ? 2959 HOH D O     1 
HETATM 6404 O O     . HOH P 4 .   ? 2.050   11.433  -58.723 1.00 33.40  ? 2960 HOH D O     1 
HETATM 6405 O O     . HOH P 4 .   ? 16.849  29.437  -62.062 1.00 23.89  ? 2961 HOH D O     1 
HETATM 6406 O O     . HOH P 4 .   ? 13.624  6.228   -70.338 1.00 24.80  ? 2962 HOH D O     1 
HETATM 6407 O O     . HOH P 4 .   ? 18.762  28.140  -60.527 1.00 25.93  ? 2963 HOH D O     1 
HETATM 6408 O O     . HOH P 4 .   ? 7.303   40.252  -52.213 1.00 31.90  ? 2964 HOH D O     1 
HETATM 6409 O O     . HOH P 4 .   ? 4.530   39.653  -61.408 1.00 36.54  ? 2965 HOH D O     1 
HETATM 6410 O O     . HOH P 4 .   ? -5.697  23.871  -81.756 1.00 30.17  ? 2966 HOH D O     1 
HETATM 6411 O O     . HOH P 4 .   ? 5.792   8.484   -59.451 1.00 50.33  ? 2967 HOH D O     1 
HETATM 6412 O O     . HOH P 4 .   ? 1.163   39.492  -60.169 1.00 25.66  ? 2968 HOH D O     1 
HETATM 6413 O O     . HOH P 4 .   ? 13.053  13.853  -73.978 1.00 42.67  ? 2969 HOH D O     1 
HETATM 6414 O O     . HOH P 4 .   ? 22.170  9.419   -64.744 1.00 22.50  ? 2970 HOH D O     1 
HETATM 6415 O O     . HOH P 4 .   ? 4.799   16.085  -81.353 1.00 35.63  ? 2971 HOH D O     1 
HETATM 6416 O O     . HOH P 4 .   ? 9.235   23.172  -43.621 1.00 28.86  ? 2972 HOH D O     1 
HETATM 6417 O O     . HOH P 4 .   ? 17.898  31.546  -68.463 1.00 33.34  ? 2973 HOH D O     1 
HETATM 6418 O O     . HOH P 4 .   ? 21.687  16.332  -55.094 1.00 30.48  ? 2974 HOH D O     1 
HETATM 6419 O O     . HOH P 4 .   ? 9.813   30.224  -57.473 1.00 16.30  ? 2975 HOH D O     1 
HETATM 6420 O O     . HOH P 4 .   ? -21.112 24.923  -60.403 1.00 16.17  ? 2976 HOH D O     1 
HETATM 6421 O O     . HOH P 4 .   ? 15.634  15.557  -68.275 1.00 15.40  ? 2977 HOH D O     1 
HETATM 6422 O O     . HOH P 4 .   ? 17.769  16.915  -69.590 1.00 18.70  ? 2978 HOH D O     1 
HETATM 6423 O O     . HOH P 4 .   ? -6.632  25.370  -49.284 1.00 19.85  ? 2979 HOH D O     1 
HETATM 6424 O O     . HOH P 4 .   ? 5.755   36.857  -62.600 1.00 22.48  ? 2980 HOH D O     1 
HETATM 6425 O O     . HOH P 4 .   ? -11.007 28.003  -49.920 1.00 22.51  ? 2981 HOH D O     1 
HETATM 6426 O O     . HOH P 4 .   ? 22.451  28.635  -57.897 1.00 21.74  ? 2982 HOH D O     1 
HETATM 6427 O O     . HOH P 4 .   ? 16.197  17.705  -71.893 1.00 23.22  ? 2983 HOH D O     1 
HETATM 6428 O O     . HOH P 4 .   ? -13.904 18.202  -64.424 1.00 21.97  ? 2984 HOH D O     1 
HETATM 6429 O O     . HOH P 4 .   ? 17.546  16.230  -57.178 1.00 23.83  ? 2985 HOH D O     1 
HETATM 6430 O O     . HOH P 4 .   ? 30.399  2.945   -58.554 1.00 20.80  ? 2986 HOH D O     1 
HETATM 6431 O O     . HOH P 4 .   ? -14.499 16.569  -50.441 1.00 25.78  ? 2987 HOH D O     1 
HETATM 6432 O O     . HOH P 4 .   ? 6.766   21.977  -78.614 1.00 26.49  ? 2988 HOH D O     1 
HETATM 6433 O O     . HOH P 4 .   ? 19.351  21.325  -70.188 1.00 27.88  ? 2989 HOH D O     1 
HETATM 6434 O O     . HOH P 4 .   ? 2.695   16.975  -55.437 1.00 26.05  ? 2990 HOH D O     1 
HETATM 6435 O O     . HOH P 4 .   ? -15.012 23.226  -67.069 1.00 27.15  ? 2991 HOH D O     1 
HETATM 6436 O O     . HOH P 4 .   ? 12.581  14.808  -58.823 1.00 30.78  ? 2992 HOH D O     1 
HETATM 6437 O O     . HOH P 4 .   ? 11.283  33.451  -60.398 1.00 27.93  ? 2993 HOH D O     1 
HETATM 6438 O O     . HOH P 4 .   ? -0.178  5.233   -68.749 1.00 30.52  ? 2994 HOH D O     1 
HETATM 6439 O O     . HOH P 4 .   ? -15.713 26.313  -45.702 1.00 26.55  ? 2995 HOH D O     1 
HETATM 6440 O O     . HOH P 4 .   ? 13.945  32.545  -56.886 1.00 32.78  ? 2996 HOH D O     1 
HETATM 6441 O O     . HOH P 4 .   ? 3.011   25.406  -81.079 1.00 28.88  ? 2997 HOH D O     1 
HETATM 6442 O O     . HOH P 4 .   ? 0.162   39.606  -42.848 1.00 28.46  ? 2998 HOH D O     1 
HETATM 6443 O O     . HOH P 4 .   ? 27.731  15.638  -61.979 1.00 25.58  ? 2999 HOH D O     1 
HETATM 6444 O O     . HOH P 4 .   ? -2.429  14.061  -60.339 1.00 22.75  ? 3000 HOH D O     1 
HETATM 6445 O O     . HOH P 4 .   ? 20.991  31.796  -55.532 1.00 28.51  ? 3001 HOH D O     1 
HETATM 6446 O O     . HOH P 4 .   ? 22.925  16.399  -68.114 1.00 26.78  ? 3002 HOH D O     1 
HETATM 6447 O O     . HOH P 4 .   ? 10.785  15.290  -53.481 1.00 29.11  ? 3003 HOH D O     1 
HETATM 6448 O O     . HOH P 4 .   ? 16.259  22.378  -73.279 1.00 24.38  ? 3004 HOH D O     1 
HETATM 6449 O O     . HOH P 4 .   ? 10.074  4.767   -67.872 1.00 24.91  ? 3005 HOH D O     1 
HETATM 6450 O O     . HOH P 4 .   ? -3.038  39.618  -64.024 1.00 24.97  ? 3006 HOH D O     1 
HETATM 6451 O O     . HOH P 4 .   ? 16.958  31.584  -58.330 1.00 32.84  ? 3007 HOH D O     1 
HETATM 6452 O O     . HOH P 4 .   ? 16.497  31.690  -50.527 1.00 33.33  ? 3008 HOH D O     1 
HETATM 6453 O O     . HOH P 4 .   ? 15.108  13.727  -71.757 1.00 30.92  ? 3009 HOH D O     1 
HETATM 6454 O O     . HOH P 4 .   ? -8.042  37.260  -49.553 1.00 33.37  ? 3010 HOH D O     1 
HETATM 6455 O O     . HOH P 4 .   ? 28.341  7.122   -54.034 1.00 30.19  ? 3011 HOH D O     1 
HETATM 6456 O O     . HOH P 4 .   ? -14.902 19.547  -76.843 1.00 25.30  ? 3012 HOH D O     1 
HETATM 6457 O O     . HOH P 4 .   ? -3.491  19.204  -78.759 1.00 30.43  ? 3013 HOH D O     1 
HETATM 6458 O O     . HOH P 4 .   ? 4.472   37.297  -74.770 1.00 30.79  ? 3014 HOH D O     1 
HETATM 6459 O O     . HOH P 4 .   ? -9.045  44.085  -49.206 1.00 34.13  ? 3015 HOH D O     1 
HETATM 6460 O O     . HOH P 4 .   ? -19.344 19.151  -54.543 1.00 39.05  ? 3016 HOH D O     1 
HETATM 6461 O O     . HOH P 4 .   ? 6.599   10.034  -79.357 1.00 33.35  ? 3017 HOH D O     1 
HETATM 6462 O O     . HOH P 4 .   ? 12.281  16.851  -54.196 1.00 38.47  ? 3018 HOH D O     1 
HETATM 6463 O O     . HOH P 4 .   ? 0.600   12.474  -61.199 1.00 27.67  ? 3019 HOH D O     1 
HETATM 6464 O O     . HOH P 4 .   ? 2.664   10.771  -81.346 1.00 28.92  ? 3020 HOH D O     1 
HETATM 6465 O O     . HOH P 4 .   ? 31.185  8.471   -56.836 1.00 34.28  ? 3021 HOH D O     1 
HETATM 6466 O O     . HOH P 4 .   ? 12.766  10.829  -71.553 1.00 28.80  ? 3022 HOH D O     1 
HETATM 6467 O O     . HOH P 4 .   ? 26.023  13.844  -66.703 1.00 33.38  ? 3023 HOH D O     1 
HETATM 6468 O O     . HOH P 4 .   ? -2.252  6.141   -67.219 1.00 30.47  ? 3024 HOH D O     1 
HETATM 6469 O O     . HOH P 4 .   ? 9.640   21.824  -46.728 1.00 30.16  ? 3025 HOH D O     1 
HETATM 6470 O O     . HOH P 4 .   ? 18.271  31.429  -65.161 1.00 29.74  ? 3026 HOH D O     1 
HETATM 6471 O O     . HOH P 4 .   ? 8.120   39.412  -56.943 1.00 52.06  ? 3027 HOH D O     1 
HETATM 6472 O O     . HOH P 4 .   ? 8.637   26.186  -75.130 1.00 28.83  ? 3028 HOH D O     1 
HETATM 6473 O O     . HOH P 4 .   ? -11.426 10.219  -62.687 1.00 27.01  ? 3029 HOH D O     1 
HETATM 6474 O O     . HOH P 4 .   ? -12.410 41.286  -52.133 1.00 43.53  ? 3030 HOH D O     1 
HETATM 6475 O O     . HOH P 4 .   ? 14.326  31.776  -73.267 1.00 32.30  ? 3031 HOH D O     1 
HETATM 6476 O O     . HOH P 4 .   ? -1.820  14.388  -55.030 1.00 28.94  ? 3032 HOH D O     1 
HETATM 6477 O O     . HOH P 4 .   ? 1.294   43.602  -45.348 1.00 40.63  ? 3033 HOH D O     1 
HETATM 6478 O O     . HOH P 4 .   ? -8.264  35.155  -51.467 1.00 31.33  ? 3034 HOH D O     1 
HETATM 6479 O O     . HOH P 4 .   ? -13.509 38.219  -65.207 1.00 45.93  ? 3035 HOH D O     1 
HETATM 6480 O O     . HOH P 4 .   ? -11.263 34.760  -52.191 1.00 34.42  ? 3036 HOH D O     1 
HETATM 6481 O O     . HOH P 4 .   ? 9.805   33.608  -69.325 1.00 35.65  ? 3037 HOH D O     1 
HETATM 6482 O O     . HOH P 4 .   ? 24.428  2.125   -60.556 1.00 32.68  ? 3038 HOH D O     1 
HETATM 6483 O O     . HOH P 4 .   ? 18.174  30.923  -75.274 1.00 33.67  ? 3039 HOH D O     1 
HETATM 6484 O O     . HOH P 4 .   ? 20.825  11.520  -69.252 1.00 33.16  ? 3040 HOH D O     1 
HETATM 6485 O O     . HOH P 4 .   ? -0.137  13.760  -57.049 1.00 31.86  ? 3041 HOH D O     1 
HETATM 6486 O O     . HOH P 4 .   ? 7.121   21.267  -48.060 1.00 49.77  ? 3042 HOH D O     1 
HETATM 6487 O O     . HOH P 4 .   ? 24.360  27.988  -62.459 1.00 44.71  ? 3043 HOH D O     1 
HETATM 6488 O O     . HOH P 4 .   ? 12.375  34.062  -45.581 1.00 34.97  ? 3044 HOH D O     1 
HETATM 6489 O O     . HOH P 4 .   ? 20.504  31.397  -63.579 1.00 35.35  ? 3045 HOH D O     1 
HETATM 6490 O O     . HOH P 4 .   ? 13.655  31.227  -70.252 1.00 32.86  ? 3046 HOH D O     1 
HETATM 6491 O O     . HOH P 4 .   ? -3.053  40.232  -68.102 1.00 38.25  ? 3047 HOH D O     1 
HETATM 6492 O O     . HOH P 4 .   ? 20.877  30.652  -49.868 1.00 52.07  ? 3048 HOH D O     1 
HETATM 6493 O O     . HOH P 4 .   ? 5.214   19.100  -48.796 1.00 37.39  ? 3049 HOH D O     1 
HETATM 6494 O O     . HOH P 4 .   ? 13.839  19.115  -51.914 1.00 29.91  ? 3050 HOH D O     1 
HETATM 6495 O O     . HOH P 4 .   ? -20.331 26.513  -50.221 1.00 34.10  ? 3051 HOH D O     1 
HETATM 6496 O O     . HOH P 4 .   ? 9.273   6.167   -59.487 1.00 34.55  ? 3052 HOH D O     1 
HETATM 6497 O O     . HOH P 4 .   ? -7.150  32.186  -52.608 1.00 33.90  ? 3053 HOH D O     1 
HETATM 6498 O O     . HOH P 4 .   ? 20.047  21.959  -52.345 1.00 40.83  ? 3054 HOH D O     1 
HETATM 6499 O O     . HOH P 4 .   ? 6.017   5.476   -78.020 1.00 29.81  ? 3055 HOH D O     1 
HETATM 6500 O O     . HOH P 4 .   ? 30.103  -2.385  -62.303 1.00 34.66  ? 3056 HOH D O     1 
HETATM 6501 O O     . HOH Q 4 .   ? 0.459   8.286   -9.611  1.00 19.82  ? 233  HOH E O     1 
HETATM 6502 O O     . HOH Q 4 .   ? 3.924   -5.032  -6.565  1.00 23.10  ? 714  HOH E O     1 
HETATM 6503 O O     . HOH Q 4 .   ? -3.693  8.150   -4.629  1.00 29.08  ? 764  HOH E O     1 
HETATM 6504 O O     . HOH Q 4 .   ? 1.058   3.064   -0.181  1.00 29.21  ? 777  HOH E O     1 
HETATM 6505 O O     . HOH Q 4 .   ? -0.697  4.094   -1.230  1.00 29.35  ? 871  HOH E O     1 
HETATM 6506 O O     . HOH Q 4 .   ? -2.447  9.921   1.119   1.00 26.20  ? 892  HOH E O     1 
HETATM 6507 O O     . HOH Q 4 .   ? -3.073  7.290   0.888   1.00 33.50  ? 1001 HOH E O     1 
HETATM 6508 O O     . HOH R 4 .   ? 1.804   -15.791 16.023  1.00 9.45   ? 10   HOH F O     1 
HETATM 6509 O O     . HOH R 4 .   ? -2.257  -13.015 29.105  1.00 13.40  ? 41   HOH F O     1 
HETATM 6510 O O     . HOH R 4 .   ? -4.778  -14.593 20.432  1.00 26.32  ? 280  HOH F O     1 
HETATM 6511 O O     . HOH R 4 .   ? -2.261  -8.232  24.060  1.00 18.47  ? 305  HOH F O     1 
HETATM 6512 O O     . HOH R 4 .   ? 0.655   -8.735  23.969  1.00 22.36  ? 343  HOH F O     1 
HETATM 6513 O O     . HOH R 4 .   ? 1.506   -16.930 7.306   1.00 23.11  ? 499  HOH F O     1 
HETATM 6514 O O     . HOH R 4 .   ? 5.057   -15.729 3.255   1.00 64.92  ? 520  HOH F O     1 
HETATM 6515 O O     . HOH R 4 .   ? 3.148   -14.324 11.220  1.00 23.09  ? 551  HOH F O     1 
HETATM 6516 O O     . HOH R 4 .   ? -3.393  -13.595 21.915  1.00 42.48  ? 564  HOH F O     1 
HETATM 6517 O O     . HOH R 4 .   ? 10.969  -12.726 4.559   1.00 49.70  ? 601  HOH F O     1 
HETATM 6518 O O     . HOH R 4 .   ? 6.855   -15.268 8.710   1.00 48.45  ? 605  HOH F O     1 
HETATM 6519 O O     . HOH R 4 .   ? 3.937   -16.251 6.372   1.00 29.62  ? 676  HOH F O     1 
HETATM 6520 O O     . HOH R 4 .   ? -8.686  -10.762 25.294  1.00 26.04  ? 682  HOH F O     1 
HETATM 6521 O O     . HOH R 4 .   ? -5.516  -12.673 32.385  1.00 19.99  ? 702  HOH F O     1 
HETATM 6522 O O     . HOH R 4 .   ? -1.529  -6.150  22.659  1.00 25.84  ? 795  HOH F O     1 
HETATM 6523 O O     . HOH R 4 .   ? 3.853   -13.600 2.072   1.00 32.54  ? 896  HOH F O     1 
HETATM 6524 O O     . HOH R 4 .   ? -10.423 -11.872 26.561  1.00 35.21  ? 919  HOH F O     1 
HETATM 6525 O O     . HOH R 4 .   ? -9.337  -17.752 29.464  1.00 27.94  ? 942  HOH F O     1 
HETATM 6526 O O     . HOH R 4 .   ? -10.354 -15.299 28.812  1.00 35.07  ? 950  HOH F O     1 
HETATM 6527 O O     . HOH R 4 .   ? -7.662  -8.470  25.656  1.00 31.81  ? 984  HOH F O     1 
HETATM 6528 O O     . HOH S 4 .   ? -9.144  10.917  -23.516 1.00 15.47  ? 125  HOH G O     1 
HETATM 6529 O O     . HOH S 4 .   ? -2.950  8.222   -23.733 1.00 20.50  ? 186  HOH G O     1 
HETATM 6530 O O     . HOH S 4 .   ? 1.661   12.781  -42.359 1.00 31.59  ? 573  HOH G O     1 
HETATM 6531 O O     . HOH S 4 .   ? 1.888   6.593   -40.652 1.00 27.81  ? 628  HOH G O     1 
HETATM 6532 O O     . HOH S 4 .   ? 1.013   14.115  -24.229 1.00 45.28  ? 644  HOH G O     1 
HETATM 6533 O O     . HOH S 4 .   ? -3.381  7.558   -25.933 1.00 24.34  ? 788  HOH G O     1 
HETATM 6534 O O     . HOH S 4 .   ? -3.892  15.581  -24.335 1.00 27.00  ? 964  HOH G O     1 
HETATM 6535 O O     . HOH S 4 .   ? -6.764  7.061   -20.724 1.00 67.18  ? 1002 HOH G O     1 
HETATM 6536 O O     . HOH T 4 .   ? -5.003  32.125  -54.515 1.00 17.26  ? 206  HOH H O     1 
HETATM 6537 O O     . HOH T 4 .   ? 1.561   23.416  -48.388 1.00 19.81  ? 302  HOH H O     1 
HETATM 6538 O O     . HOH T 4 .   ? 0.794   18.400  -53.918 1.00 19.62  ? 304  HOH H O     1 
HETATM 6539 O O     . HOH T 4 .   ? -11.178 32.801  -59.275 1.00 20.43  ? 308  HOH H O     1 
HETATM 6540 O O     . HOH T 4 .   ? -8.475  30.202  -51.635 1.00 25.32  ? 333  HOH H O     1 
HETATM 6541 O O     . HOH T 4 .   ? -8.294  27.055  -48.015 1.00 249.38 ? 415  HOH H O     1 
HETATM 6542 O O     . HOH T 4 .   ? 2.776   14.738  -49.710 1.00 36.97  ? 545  HOH H O     1 
HETATM 6543 O O     . HOH T 4 .   ? -6.977  32.059  -45.837 1.00 26.42  ? 750  HOH H O     1 
HETATM 6544 O O     . HOH T 4 .   ? -8.118  29.435  -46.776 1.00 29.18  ? 753  HOH H O     1 
HETATM 6545 O O     . HOH T 4 .   ? -12.579 36.743  -57.362 1.00 34.81  ? 855  HOH H O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . LYS A 8   ? 0.2791 0.2621 0.2569 -0.0004 0.0043  0.0089  193  LYS A N     
2    C CA    . LYS A 8   ? 0.2755 0.2580 0.2546 0.0023  0.0040  0.0084  193  LYS A CA    
3    C C     . LYS A 8   ? 0.2776 0.2611 0.2556 0.0018  0.0029  0.0082  193  LYS A C     
4    O O     . LYS A 8   ? 0.2807 0.2581 0.2514 0.0034  0.0019  0.0112  193  LYS A O     
5    C CB    . LYS A 8   ? 0.2721 0.2541 0.2570 0.0020  0.0035  0.0077  193  LYS A CB    
6    C CG    . LYS A 8   ? 0.2734 0.2602 0.2608 0.0042  0.0040  0.0040  193  LYS A CG    
7    C CD    . LYS A 8   ? 0.2914 0.2645 0.2685 0.0058  0.0021  0.0036  193  LYS A CD    
8    C CE    . LYS A 8   ? 0.3106 0.2918 0.2805 0.0048  0.0038  0.0018  193  LYS A CE    
9    N NZ    . LYS A 8   ? 0.3243 0.3019 0.3076 0.0079  -0.0023 0.0024  193  LYS A NZ    
10   N N     . SER A 9   ? 0.2801 0.2640 0.2591 0.0014  0.0034  0.0083  194  SER A N     
11   C CA    . SER A 9   ? 0.2823 0.2683 0.2642 0.0026  0.0045  0.0049  194  SER A CA    
12   C C     . SER A 9   ? 0.2811 0.2696 0.2640 0.0033  0.0050  0.0060  194  SER A C     
13   O O     . SER A 9   ? 0.2772 0.2636 0.2575 0.0084  0.0032  0.0130  194  SER A O     
14   C CB    . SER A 9   ? 0.2839 0.2716 0.2655 0.0020  0.0033  0.0049  194  SER A CB    
15   O OG    . SER A 9   ? 0.2898 0.2712 0.2762 0.0090  0.0016  0.0024  194  SER A OG    
16   N N     . LYS A 10  ? 0.2835 0.2688 0.2638 0.0040  0.0061  0.0058  195  LYS A N     
17   C CA    . LYS A 10  ? 0.2819 0.2737 0.2639 0.0012  0.0064  0.0036  195  LYS A CA    
18   C C     . LYS A 10  ? 0.2815 0.2703 0.2635 0.0029  0.0035  0.0026  195  LYS A C     
19   O O     . LYS A 10  ? 0.2857 0.2703 0.2576 0.0033  0.0041  0.0056  195  LYS A O     
20   C CB    . LYS A 10  ? 0.2826 0.2732 0.2627 -0.0007 0.0073  0.0032  195  LYS A CB    
21   C CG    . LYS A 10  ? 0.2840 0.2828 0.2668 -0.0038 0.0079  0.0018  195  LYS A CG    
22   C CD    . LYS A 10  ? 0.2891 0.2859 0.2697 -0.0007 0.0105  0.0029  195  LYS A CD    
23   C CE    . LYS A 10  ? 0.3038 0.3021 0.2955 0.0028  0.0075  0.0049  195  LYS A CE    
24   N NZ    . LYS A 10  ? 0.3163 0.3173 0.2955 0.0015  0.0157  0.0039  195  LYS A NZ    
25   N N     . ALA A 11  ? 0.2797 0.2655 0.2586 -0.0005 0.0033  0.0008  196  ALA A N     
26   C CA    . ALA A 11  ? 0.2786 0.2609 0.2582 0.0013  0.0026  0.0016  196  ALA A CA    
27   C C     . ALA A 11  ? 0.2757 0.2577 0.2570 0.0013  0.0032  0.0015  196  ALA A C     
28   O O     . ALA A 11  ? 0.2831 0.2561 0.2541 0.0020  0.0020  0.0013  196  ALA A O     
29   C CB    . ALA A 11  ? 0.2800 0.2613 0.2601 0.0008  0.0006  0.0025  196  ALA A CB    
30   N N     . GLU A 12  ? 0.2710 0.2532 0.2538 0.0028  0.0027  0.0017  197  GLU A N     
31   C CA    . GLU A 12  ? 0.2627 0.2551 0.2568 0.0029  0.0030  0.0017  197  GLU A CA    
32   C C     . GLU A 12  ? 0.2539 0.2459 0.2451 0.0012  0.0034  0.0022  197  GLU A C     
33   O O     . GLU A 12  ? 0.2530 0.2460 0.2381 0.0007  0.0032  0.0065  197  GLU A O     
34   C CB    . GLU A 12  ? 0.2676 0.2578 0.2628 0.0036  0.0046  -0.0014 197  GLU A CB    
35   C CG    . GLU A 12  ? 0.2725 0.2647 0.2709 0.0047  -0.0022 0.0011  197  GLU A CG    
36   C CD    . GLU A 12  ? 0.2674 0.2659 0.2734 0.0047  0.0019  -0.0030 197  GLU A CD    
37   O OE1   . GLU A 12  ? 0.2643 0.2727 0.2942 0.0069  -0.0012 -0.0037 197  GLU A OE1   
38   O OE2   . GLU A 12  ? 0.2671 0.2617 0.2856 0.0060  0.0022  -0.0030 197  GLU A OE2   
39   N N     . LEU A 13  ? 0.2448 0.2370 0.2359 0.0020  0.0024  0.0036  198  LEU A N     
40   C CA    . LEU A 13  ? 0.2364 0.2323 0.2265 0.0014  0.0016  0.0012  198  LEU A CA    
41   C C     . LEU A 13  ? 0.2374 0.2311 0.2270 0.0024  0.0003  0.0010  198  LEU A C     
42   O O     . LEU A 13  ? 0.2332 0.2227 0.2159 0.0025  -0.0022 0.0007  198  LEU A O     
43   C CB    . LEU A 13  ? 0.2364 0.2253 0.2243 0.0023  0.0021  0.0013  198  LEU A CB    
44   C CG    . LEU A 13  ? 0.2323 0.2207 0.2151 0.0059  0.0021  0.0024  198  LEU A CG    
45   C CD1   . LEU A 13  ? 0.2299 0.2128 0.2240 0.0049  0.0032  -0.0002 198  LEU A CD1   
46   C CD2   . LEU A 13  ? 0.2345 0.2087 0.2038 0.0102  0.0064  -0.0007 198  LEU A CD2   
47   N N     . GLN A 14  ? 0.2405 0.2331 0.2281 0.0038  -0.0002 -0.0002 199  GLN A N     
48   C CA    . GLN A 14  ? 0.2418 0.2377 0.2356 0.0042  -0.0001 0.0014  199  GLN A CA    
49   C C     . GLN A 14  ? 0.2361 0.2331 0.2345 0.0052  -0.0009 0.0009  199  GLN A C     
50   O O     . GLN A 14  ? 0.2335 0.2285 0.2289 0.0059  -0.0023 0.0055  199  GLN A O     
51   C CB    . GLN A 14  ? 0.2472 0.2457 0.2383 0.0030  0.0032  -0.0011 199  GLN A CB    
52   C CG    . GLN A 14  ? 0.2486 0.2534 0.2424 0.0029  -0.0020 0.0005  199  GLN A CG    
53   C CD    . GLN A 14  ? 0.2627 0.2584 0.2543 0.0002  0.0048  0.0002  199  GLN A CD    
54   O OE1   . GLN A 14  ? 0.3069 0.2810 0.2783 0.0075  -0.0055 -0.0031 199  GLN A OE1   
55   N NE2   . GLN A 14  ? 0.2876 0.2949 0.2895 0.0071  0.0160  -0.0044 199  GLN A NE2   
56   N N     . SER A 15  ? 0.2229 0.2227 0.2301 0.0042  -0.0014 0.0043  200  SER A N     
57   C CA    . SER A 15  ? 0.2246 0.2171 0.2334 0.0048  -0.0034 0.0016  200  SER A CA    
58   C C     . SER A 15  ? 0.2146 0.2109 0.2300 0.0037  -0.0024 -0.0001 200  SER A C     
59   O O     . SER A 15  ? 0.2121 0.2021 0.2365 0.0061  -0.0071 -0.0007 200  SER A O     
60   C CB    . SER A 15  ? 0.2305 0.2202 0.2368 0.0090  -0.0034 0.0007  200  SER A CB    
61   O OG    A SER A 15  ? 0.2544 0.2341 0.2468 0.0053  -0.0035 -0.0034 200  SER A OG    
62   O OG    B SER A 15  ? 6.3324 6.3324 6.3324 0.0000  0.0000  0.0000  200  SER A OG    
63   N N     . GLU A 16  ? 0.2047 0.2029 0.2216 0.0034  -0.0021 0.0009  201  GLU A N     
64   C CA    . GLU A 16  ? 0.1963 0.1986 0.2174 0.0059  0.0010  0.0025  201  GLU A CA    
65   C C     . GLU A 16  ? 0.1970 0.1995 0.2198 0.0075  0.0041  0.0047  201  GLU A C     
66   O O     . GLU A 16  ? 0.1988 0.1903 0.2269 0.0092  0.0077  0.0080  201  GLU A O     
67   C CB    . GLU A 16  ? 0.1927 0.2018 0.2179 0.0061  0.0001  -0.0011 201  GLU A CB    
68   C CG    . GLU A 16  ? 0.1863 0.2033 0.2131 0.0083  0.0036  -0.0008 201  GLU A CG    
69   C CD    . GLU A 16  ? 0.1942 0.2009 0.2092 0.0015  0.0002  0.0034  201  GLU A CD    
70   O OE1   . GLU A 16  ? 0.1768 0.1992 0.1971 0.0042  -0.0009 0.0060  201  GLU A OE1   
71   O OE2   . GLU A 16  ? 0.2042 0.2195 0.2324 0.0159  0.0009  -0.0037 201  GLU A OE2   
72   N N     . GLU A 17  ? 0.1980 0.1997 0.2185 0.0089  0.0023  0.0037  202  GLU A N     
73   C CA    . GLU A 17  ? 0.2001 0.2054 0.2233 0.0054  0.0053  0.0009  202  GLU A CA    
74   C C     . GLU A 17  ? 0.2050 0.2067 0.2240 0.0049  0.0053  0.0021  202  GLU A C     
75   O O     . GLU A 17  ? 0.2006 0.2008 0.2210 0.0018  0.0091  0.0055  202  GLU A O     
76   C CB    . GLU A 17  ? 0.2011 0.2084 0.2223 0.0071  0.0055  0.0027  202  GLU A CB    
77   C CG    . GLU A 17  ? 0.2052 0.2226 0.2362 0.0031  -0.0017 -0.0020 202  GLU A CG    
78   C CD    . GLU A 17  ? 0.2335 0.2637 0.2506 0.0055  0.0047  -0.0017 202  GLU A CD    
79   O OE1   . GLU A 17  ? 0.2641 0.2844 0.2551 -0.0029 0.0033  -0.0075 202  GLU A OE1   
80   O OE2   . GLU A 17  ? 0.2374 0.2876 0.2469 -0.0014 -0.0072 0.0003  202  GLU A OE2   
81   N N     . ARG A 18  ? 0.2033 0.2102 0.2294 0.0070  0.0024  0.0021  203  ARG A N     
82   C CA    . ARG A 18  ? 0.2128 0.2135 0.2390 0.0057  0.0023  -0.0015 203  ARG A CA    
83   C C     . ARG A 18  ? 0.2155 0.2141 0.2446 0.0080  0.0048  0.0016  203  ARG A C     
84   O O     . ARG A 18  ? 0.2113 0.2125 0.2536 0.0090  0.0023  0.0056  203  ARG A O     
85   C CB    . ARG A 18  ? 0.2142 0.2159 0.2379 0.0061  0.0006  0.0000  203  ARG A CB    
86   C CG    . ARG A 18  ? 0.2505 0.2339 0.2478 0.0060  0.0031  -0.0054 203  ARG A CG    
87   C CD    . ARG A 18  ? 0.2699 0.2736 0.2643 0.0082  -0.0091 -0.0013 203  ARG A CD    
88   N NE    . ARG A 18  ? 0.3000 0.3055 0.2946 0.0000  0.0019  -0.0042 203  ARG A NE    
89   C CZ    . ARG A 18  ? 0.3112 0.3162 0.3082 0.0034  -0.0038 -0.0040 203  ARG A CZ    
90   N NH1   . ARG A 18  ? 0.3160 0.3137 0.2985 0.0114  -0.0119 -0.0078 203  ARG A NH1   
91   N NH2   . ARG A 18  ? 0.3239 0.3427 0.3298 0.0043  0.0040  -0.0021 203  ARG A NH2   
92   N N     . LYS A 19  ? 0.2131 0.2144 0.2488 0.0075  0.0071  0.0021  204  LYS A N     
93   C CA    . LYS A 19  ? 0.2205 0.2127 0.2503 0.0048  0.0077  0.0026  204  LYS A CA    
94   C C     . LYS A 19  ? 0.2117 0.2007 0.2435 0.0047  0.0084  0.0016  204  LYS A C     
95   O O     . LYS A 19  ? 0.2197 0.1982 0.2592 0.0045  0.0103  0.0021  204  LYS A O     
96   C CB    . LYS A 19  ? 0.2214 0.2192 0.2565 0.0046  0.0089  0.0018  204  LYS A CB    
97   C CG    . LYS A 19  ? 0.2620 0.2526 0.2788 -0.0038 0.0114  0.0069  204  LYS A CG    
98   C CD    . LYS A 19  ? 0.3214 0.3027 0.2997 -0.0101 0.0042  0.0000  204  LYS A CD    
99   C CE    . LYS A 19  ? 0.3178 0.3273 0.3367 0.0043  -0.0027 -0.0019 204  LYS A CE    
100  N NZ    . LYS A 19  ? 0.3256 0.3302 0.3440 0.0008  0.0042  -0.0030 204  LYS A NZ    
101  N N     . ARG A 20  ? 0.2031 0.1902 0.2314 0.0091  0.0088  -0.0021 205  ARG A N     
102  C CA    . ARG A 20  ? 0.1997 0.1842 0.2194 0.0047  0.0085  -0.0011 205  ARG A CA    
103  C C     . ARG A 20  ? 0.1893 0.1759 0.2150 0.0043  0.0104  -0.0003 205  ARG A C     
104  O O     . ARG A 20  ? 0.1958 0.1752 0.2217 -0.0018 0.0193  0.0037  205  ARG A O     
105  C CB    . ARG A 20  ? 0.2025 0.1775 0.2185 0.0044  0.0084  0.0003  205  ARG A CB    
106  C CG    . ARG A 20  ? 0.2068 0.1914 0.2048 0.0038  0.0066  0.0000  205  ARG A CG    
107  C CD    . ARG A 20  ? 0.2088 0.1953 0.2028 -0.0001 0.0049  0.0037  205  ARG A CD    
108  N NE    . ARG A 20  ? 0.2048 0.2033 0.2035 -0.0044 -0.0018 0.0101  205  ARG A NE    
109  C CZ    . ARG A 20  ? 0.2043 0.2030 0.1910 0.0022  -0.0013 0.0067  205  ARG A CZ    
110  N NH1   . ARG A 20  ? 0.2210 0.1827 0.1924 0.0083  0.0071  0.0208  205  ARG A NH1   
111  N NH2   . ARG A 20  ? 0.2163 0.2040 0.1747 0.0068  0.0000  0.0066  205  ARG A NH2   
112  N N     . ILE A 21  ? 0.1758 0.1635 0.2107 0.0017  0.0086  -0.0049 206  ILE A N     
113  C CA    . ILE A 21  ? 0.1606 0.1600 0.2017 0.0024  0.0035  -0.0055 206  ILE A CA    
114  C C     . ILE A 21  ? 0.1652 0.1707 0.2122 0.0017  -0.0027 -0.0035 206  ILE A C     
115  O O     . ILE A 21  ? 0.1662 0.1714 0.2309 0.0070  -0.0041 0.0001  206  ILE A O     
116  C CB    . ILE A 21  ? 0.1657 0.1494 0.1938 0.0022  0.0041  -0.0083 206  ILE A CB    
117  C CG1   . ILE A 21  ? 0.1678 0.1565 0.1833 -0.0030 -0.0023 -0.0096 206  ILE A CG1   
118  C CG2   . ILE A 21  ? 0.1479 0.1556 0.1936 0.0189  -0.0107 -0.0113 206  ILE A CG2   
119  C CD1   . ILE A 21  ? 0.1617 0.1591 0.1955 0.0039  0.0079  -0.0080 206  ILE A CD1   
120  N N     . ASP A 22  ? 0.1584 0.1819 0.2225 0.0002  -0.0039 -0.0011 207  ASP A N     
121  C CA    . ASP A 22  ? 0.1728 0.1874 0.2263 -0.0009 -0.0061 -0.0041 207  ASP A CA    
122  C C     . ASP A 22  ? 0.1654 0.1885 0.2251 -0.0037 -0.0080 -0.0037 207  ASP A C     
123  O O     . ASP A 22  ? 0.1624 0.1860 0.2379 -0.0053 -0.0067 -0.0026 207  ASP A O     
124  C CB    . ASP A 22  ? 0.1667 0.1972 0.2254 0.0013  -0.0071 -0.0048 207  ASP A CB    
125  C CG    . ASP A 22  ? 0.1983 0.2158 0.2429 0.0006  0.0048  -0.0014 207  ASP A CG    
126  O OD1   . ASP A 22  ? 0.2303 0.2523 0.2834 -0.0068 0.0258  -0.0008 207  ASP A OD1   
127  O OD2   . ASP A 22  ? 0.2368 0.2440 0.2566 -0.0042 0.0000  -0.0010 207  ASP A OD2   
128  N N     . GLU A 23  ? 0.1730 0.1900 0.2235 -0.0023 -0.0035 -0.0024 208  GLU A N     
129  C CA    . GLU A 23  ? 0.1984 0.1981 0.2305 -0.0031 0.0022  -0.0013 208  GLU A CA    
130  C C     . GLU A 23  ? 0.1794 0.1867 0.2163 -0.0051 0.0043  0.0008  208  GLU A C     
131  O O     . GLU A 23  ? 0.1767 0.1778 0.2233 -0.0103 0.0062  0.0018  208  GLU A O     
132  C CB    . GLU A 23  ? 0.2109 0.2063 0.2334 -0.0018 0.0034  -0.0042 208  GLU A CB    
133  C CG    . GLU A 23  ? 0.2360 0.2227 0.2633 -0.0030 0.0007  -0.0043 208  GLU A CG    
134  C CD    . GLU A 23  ? 0.2441 0.2334 0.2659 0.0055  0.0040  -0.0085 208  GLU A CD    
135  O OE1   . GLU A 23  ? 0.2742 0.3010 0.3036 0.0062  -0.0071 -0.0128 208  GLU A OE1   
136  O OE2   . GLU A 23  ? 0.2732 0.2879 0.3105 0.0049  -0.0149 -0.0199 208  GLU A OE2   
137  N N     . LEU A 24  ? 0.1674 0.1765 0.2062 -0.0017 0.0052  -0.0001 209  LEU A N     
138  C CA    . LEU A 24  ? 0.1680 0.1713 0.2015 -0.0041 0.0042  -0.0036 209  LEU A CA    
139  C C     . LEU A 24  ? 0.1640 0.1699 0.1980 -0.0039 0.0018  -0.0044 209  LEU A C     
140  O O     . LEU A 24  ? 0.1578 0.1642 0.1973 -0.0132 0.0008  -0.0003 209  LEU A O     
141  C CB    . LEU A 24  ? 0.1667 0.1751 0.2075 -0.0035 0.0042  -0.0093 209  LEU A CB    
142  C CG    . LEU A 24  ? 0.1882 0.1770 0.2114 -0.0042 0.0148  -0.0112 209  LEU A CG    
143  C CD1   . LEU A 24  ? 0.1727 0.1650 0.2295 0.0022  0.0261  -0.0192 209  LEU A CD1   
144  C CD2   . LEU A 24  ? 0.2172 0.2077 0.2291 0.0026  0.0079  -0.0109 209  LEU A CD2   
145  N N     . ILE A 25  ? 0.1550 0.1569 0.1955 -0.0035 -0.0004 -0.0008 210  ILE A N     
146  C CA    . ILE A 25  ? 0.1662 0.1628 0.1986 -0.0030 0.0030  -0.0052 210  ILE A CA    
147  C C     . ILE A 25  ? 0.1695 0.1637 0.2091 -0.0010 0.0008  0.0010  210  ILE A C     
148  O O     . ILE A 25  ? 0.1721 0.1582 0.2136 -0.0017 0.0065  0.0090  210  ILE A O     
149  C CB    . ILE A 25  ? 0.1565 0.1524 0.1963 -0.0058 -0.0026 -0.0023 210  ILE A CB    
150  C CG1   . ILE A 25  ? 0.1556 0.1500 0.1856 -0.0049 0.0025  -0.0042 210  ILE A CG1   
151  C CG2   . ILE A 25  ? 0.1840 0.1690 0.2017 -0.0014 0.0054  -0.0172 210  ILE A CG2   
152  C CD1   . ILE A 25  ? 0.1692 0.1667 0.1850 -0.0090 0.0109  -0.0005 210  ILE A CD1   
153  N N     . GLU A 26  ? 0.1710 0.1727 0.2222 -0.0014 0.0027  -0.0006 211  GLU A N     
154  C CA    . GLU A 26  ? 0.1848 0.1896 0.2369 -0.0042 0.0014  -0.0012 211  GLU A CA    
155  C C     . GLU A 26  ? 0.1839 0.1858 0.2370 -0.0043 0.0041  0.0016  211  GLU A C     
156  O O     . GLU A 26  ? 0.1971 0.1828 0.2586 -0.0117 0.0004  -0.0023 211  GLU A O     
157  C CB    . GLU A 26  ? 0.1865 0.1955 0.2350 -0.0030 -0.0010 -0.0004 211  GLU A CB    
158  C CG    . GLU A 26  ? 0.2116 0.2317 0.2441 -0.0082 0.0003  0.0035  211  GLU A CG    
159  C CD    . GLU A 26  ? 0.2821 0.2718 0.2739 -0.0004 -0.0017 0.0019  211  GLU A CD    
160  O OE1   . GLU A 26  ? 0.2245 0.2667 0.2402 -0.0240 0.0184  0.0056  211  GLU A OE1   
161  O OE2   . GLU A 26  ? 0.2829 0.3095 0.2879 0.0056  0.0220  -0.0056 211  GLU A OE2   
162  N N     . SER A 27  ? 0.1777 0.1872 0.2353 -0.0060 0.0016  0.0024  212  SER A N     
163  C CA    . SER A 27  ? 0.1921 0.1959 0.2371 -0.0034 0.0050  0.0038  212  SER A CA    
164  C C     . SER A 27  ? 0.1920 0.1970 0.2343 -0.0014 0.0062  0.0067  212  SER A C     
165  O O     . SER A 27  ? 0.2022 0.1967 0.2392 -0.0061 0.0089  0.0072  212  SER A O     
166  C CB    . SER A 27  ? 0.1946 0.1916 0.2327 -0.0053 0.0011  0.0054  212  SER A CB    
167  O OG    . SER A 27  ? 0.1784 0.1958 0.2447 -0.0048 0.0170  0.0087  212  SER A OG    
168  N N     . GLY A 28  ? 0.1912 0.1977 0.2366 -0.0024 0.0092  0.0060  213  GLY A N     
169  C CA    . GLY A 28  ? 0.1917 0.2057 0.2250 0.0020  0.0042  0.0048  213  GLY A CA    
170  C C     . GLY A 28  ? 0.1964 0.2056 0.2294 -0.0015 0.0051  0.0024  213  GLY A C     
171  O O     . GLY A 28  ? 0.1919 0.2100 0.2228 -0.0040 0.0014  -0.0044 213  GLY A O     
172  N N     . LYS A 29  ? 0.2024 0.2136 0.2341 -0.0030 0.0061  0.0025  214  LYS A N     
173  C CA    . LYS A 29  ? 0.2107 0.2205 0.2384 -0.0009 0.0079  0.0010  214  LYS A CA    
174  C C     . LYS A 29  ? 0.2047 0.2121 0.2274 -0.0028 0.0084  0.0022  214  LYS A C     
175  O O     . LYS A 29  ? 0.2057 0.2130 0.2278 0.0041  0.0061  0.0042  214  LYS A O     
176  C CB    . LYS A 29  ? 0.2232 0.2354 0.2539 0.0008  0.0138  0.0015  214  LYS A CB    
177  C CG    . LYS A 29  ? 0.2746 0.2820 0.2802 0.0002  -0.0021 -0.0033 214  LYS A CG    
178  C CD    . LYS A 29  ? 0.2992 0.3200 0.3280 0.0041  0.0048  -0.0029 214  LYS A CD    
179  C CE    . LYS A 29  ? 0.3540 0.3327 0.3479 0.0038  -0.0068 0.0035  214  LYS A CE    
180  N NZ    . LYS A 29  ? 0.3483 0.3646 0.3706 0.0007  0.0066  0.0006  214  LYS A NZ    
181  N N     . GLU A 30  ? 0.1997 0.2068 0.2234 -0.0018 0.0084  0.0006  215  GLU A N     
182  C CA    . GLU A 30  ? 0.1981 0.2115 0.2162 0.0056  0.0049  -0.0004 215  GLU A CA    
183  C C     . GLU A 30  ? 0.1999 0.2177 0.2234 0.0043  0.0020  -0.0025 215  GLU A C     
184  O O     . GLU A 30  ? 0.2271 0.2357 0.2281 0.0186  -0.0038 -0.0065 215  GLU A O     
185  C CB    . GLU A 30  ? 0.1987 0.2155 0.2070 0.0081  0.0025  -0.0016 215  GLU A CB    
186  C CG    . GLU A 30  ? 0.1801 0.1816 0.1869 0.0069  0.0034  0.0016  215  GLU A CG    
187  C CD    . GLU A 30  ? 0.1664 0.1810 0.1787 -0.0011 0.0032  0.0031  215  GLU A CD    
188  O OE1   . GLU A 30  ? 0.1645 0.1676 0.1896 0.0064  0.0112  0.0025  215  GLU A OE1   
189  O OE2   . GLU A 30  ? 0.1515 0.1586 0.1621 0.0104  0.0181  0.0104  215  GLU A OE2   
190  N N     . GLU A 31  ? 0.1988 0.2162 0.2302 -0.0015 0.0063  -0.0025 216  GLU A N     
191  C CA    . GLU A 31  ? 0.2102 0.2269 0.2431 -0.0032 0.0040  -0.0051 216  GLU A CA    
192  C C     . GLU A 31  ? 0.1931 0.2079 0.2231 -0.0017 0.0045  -0.0018 216  GLU A C     
193  O O     . GLU A 31  ? 0.2033 0.2175 0.2325 -0.0032 0.0018  -0.0022 216  GLU A O     
194  C CB    . GLU A 31  ? 0.2092 0.2311 0.2430 0.0000  0.0028  -0.0070 216  GLU A CB    
195  C CG    . GLU A 31  ? 0.2377 0.2583 0.2778 -0.0067 0.0091  -0.0062 216  GLU A CG    
196  C CD    . GLU A 31  ? 0.2488 0.2764 0.2852 0.0026  0.0061  -0.0022 216  GLU A CD    
197  O OE1   . GLU A 31  ? 0.3319 0.3146 0.3654 0.0083  -0.0021 -0.0157 216  GLU A OE1   
198  O OE2   . GLU A 31  ? 0.3095 0.3282 0.3498 -0.0135 0.0045  0.0029  216  GLU A OE2   
199  N N     . GLY A 32  ? 0.1766 0.1969 0.2174 -0.0033 0.0015  0.0007  217  GLY A N     
200  C CA    . GLY A 32  ? 0.1583 0.1839 0.1960 -0.0002 -0.0010 0.0026  217  GLY A CA    
201  C C     . GLY A 32  ? 0.1550 0.1841 0.1787 0.0004  -0.0017 0.0068  217  GLY A C     
202  O O     . GLY A 32  ? 0.1486 0.1829 0.1775 -0.0065 -0.0097 0.0072  217  GLY A O     
203  N N     . MET A 33  ? 0.1491 0.1807 0.1749 0.0046  0.0034  0.0003  218  MET A N     
204  C CA    . MET A 33  ? 0.1513 0.1921 0.1797 0.0065  0.0013  -0.0029 218  MET A CA    
205  C C     . MET A 33  ? 0.1372 0.1686 0.1664 0.0077  0.0056  -0.0026 218  MET A C     
206  O O     . MET A 33  ? 0.1400 0.1802 0.1775 0.0018  0.0142  -0.0029 218  MET A O     
207  C CB    . MET A 33  ? 0.1619 0.2109 0.1831 0.0177  0.0026  -0.0034 218  MET A CB    
208  C CG    . MET A 33  ? 0.1714 0.2194 0.2116 0.0007  0.0027  -0.0033 218  MET A CG    
209  S SD    . MET A 33  ? 0.1662 0.2844 0.2191 0.0013  -0.0189 -0.0374 218  MET A SD    
210  C CE    . MET A 33  ? 0.1861 0.2700 0.2476 0.0050  0.0012  -0.0050 218  MET A CE    
211  N N     . LYS A 34  ? 0.1310 0.1510 0.1440 0.0067  0.0018  0.0004  219  LYS A N     
212  C CA    . LYS A 34  ? 0.1370 0.1500 0.1410 0.0048  0.0070  0.0015  219  LYS A CA    
213  C C     . LYS A 34  ? 0.1206 0.1398 0.1327 -0.0026 0.0091  0.0080  219  LYS A C     
214  O O     . LYS A 34  ? 0.1346 0.1405 0.1390 -0.0081 0.0189  0.0146  219  LYS A O     
215  C CB    . LYS A 34  ? 0.1452 0.1581 0.1349 0.0107  0.0106  0.0092  219  LYS A CB    
216  C CG    . LYS A 34  ? 0.1750 0.1629 0.1501 0.0182  -0.0085 0.0065  219  LYS A CG    
217  C CD    . LYS A 34  ? 0.2328 0.2045 0.1619 0.0146  -0.0014 -0.0056 219  LYS A CD    
218  C CE    . LYS A 34  ? 0.2490 0.2494 0.2220 0.0012  -0.0084 0.0005  219  LYS A CE    
219  N NZ    . LYS A 34  ? 0.2983 0.2909 0.2466 -0.0013 -0.0088 -0.0143 219  LYS A NZ    
220  N N     . ILE A 35  ? 0.1241 0.1376 0.1340 -0.0032 0.0047  0.0053  220  ILE A N     
221  C CA    . ILE A 35  ? 0.1289 0.1428 0.1391 -0.0027 0.0047  0.0073  220  ILE A CA    
222  C C     . ILE A 35  ? 0.1379 0.1585 0.1430 -0.0069 0.0030  0.0050  220  ILE A C     
223  O O     . ILE A 35  ? 0.1542 0.1981 0.1581 0.0004  0.0050  0.0105  220  ILE A O     
224  C CB    . ILE A 35  ? 0.1336 0.1375 0.1414 -0.0003 0.0070  0.0084  220  ILE A CB    
225  C CG1   . ILE A 35  ? 0.1502 0.1446 0.1521 -0.0026 0.0053  0.0057  220  ILE A CG1   
226  C CG2   . ILE A 35  ? 0.1520 0.1599 0.1788 0.0042  0.0270  0.0080  220  ILE A CG2   
227  C CD1   . ILE A 35  ? 0.1806 0.1439 0.1870 -0.0125 0.0096  0.0038  220  ILE A CD1   
228  N N     . ASP A 36  ? 0.1406 0.1754 0.1529 -0.0041 0.0014  0.0064  221  ASP A N     
229  C CA    . ASP A 36  ? 0.1539 0.1837 0.1658 -0.0073 -0.0013 0.0011  221  ASP A CA    
230  C C     . ASP A 36  ? 0.1498 0.1764 0.1580 -0.0052 -0.0028 0.0027  221  ASP A C     
231  O O     . ASP A 36  ? 0.1431 0.2037 0.1481 -0.0048 -0.0025 0.0032  221  ASP A O     
232  C CB    . ASP A 36  ? 0.1804 0.1903 0.1852 -0.0013 0.0001  0.0007  221  ASP A CB    
233  C CG    . ASP A 36  ? 0.2148 0.2197 0.2185 -0.0067 -0.0042 -0.0053 221  ASP A CG    
234  O OD1   . ASP A 36  ? 0.2624 0.2636 0.2394 -0.0071 -0.0196 0.0005  221  ASP A OD1   
235  O OD2   . ASP A 36  ? 0.2427 0.2271 0.2348 -0.0178 -0.0011 -0.0058 221  ASP A OD2   
236  N N     . LEU A 37  ? 0.1378 0.1665 0.1542 -0.0065 -0.0020 0.0038  222  LEU A N     
237  C CA    . LEU A 37  ? 0.1423 0.1478 0.1542 -0.0025 -0.0014 0.0076  222  LEU A CA    
238  C C     . LEU A 37  ? 0.1332 0.1391 0.1437 -0.0012 -0.0036 0.0056  222  LEU A C     
239  O O     . LEU A 37  ? 0.1474 0.1451 0.1369 -0.0041 0.0043  0.0030  222  LEU A O     
240  C CB    . LEU A 37  ? 0.1557 0.1512 0.1663 -0.0036 -0.0047 0.0117  222  LEU A CB    
241  C CG    . LEU A 37  ? 0.1806 0.1709 0.1935 -0.0124 0.0043  0.0218  222  LEU A CG    
242  C CD1   . LEU A 37  ? 0.2010 0.1973 0.2288 -0.0042 -0.0063 0.0207  222  LEU A CD1   
243  C CD2   . LEU A 37  ? 0.2148 0.1788 0.2133 -0.0160 -0.0013 0.0216  222  LEU A CD2   
244  N N     . ILE A 38  ? 0.1216 0.1140 0.1345 -0.0074 0.0003  0.0107  223  ILE A N     
245  C CA    . ILE A 38  ? 0.1107 0.1157 0.1366 -0.0054 -0.0012 0.0120  223  ILE A CA    
246  C C     . ILE A 38  ? 0.1078 0.1079 0.1291 -0.0010 -0.0041 0.0039  223  ILE A C     
247  O O     . ILE A 38  ? 0.1007 0.1082 0.1277 -0.0012 -0.0015 0.0033  223  ILE A O     
248  C CB    . ILE A 38  ? 0.1112 0.1239 0.1439 -0.0019 -0.0039 0.0136  223  ILE A CB    
249  C CG1   . ILE A 38  ? 0.1292 0.1433 0.1673 0.0053  0.0050  0.0082  223  ILE A CG1   
250  C CG2   . ILE A 38  ? 0.1192 0.1246 0.1493 -0.0019 -0.0036 0.0237  223  ILE A CG2   
251  C CD1   . ILE A 38  ? 0.2074 0.1775 0.1631 0.0127  0.0042  -0.0079 223  ILE A CD1   
252  N N     . ASP A 39  ? 0.0997 0.0978 0.1343 0.0039  -0.0034 0.0060  224  ASP A N     
253  C CA    . ASP A 39  ? 0.0971 0.0914 0.1227 -0.0008 -0.0003 0.0007  224  ASP A CA    
254  C C     . ASP A 39  ? 0.1153 0.0979 0.1222 0.0056  -0.0031 0.0058  224  ASP A C     
255  O O     . ASP A 39  ? 0.1291 0.1065 0.1415 0.0003  0.0034  0.0239  224  ASP A O     
256  C CB    . ASP A 39  ? 0.0944 0.0901 0.1443 0.0007  -0.0058 -0.0079 224  ASP A CB    
257  C CG    . ASP A 39  ? 0.1043 0.0781 0.1374 0.0016  -0.0010 -0.0027 224  ASP A CG    
258  O OD1   . ASP A 39  ? 0.1332 0.0679 0.1641 0.0050  0.0094  0.0045  224  ASP A OD1   
259  O OD2   . ASP A 39  ? 0.1252 0.0841 0.2210 0.0000  -0.0007 -0.0130 224  ASP A OD2   
260  N N     . GLY A 40  ? 0.1174 0.0984 0.1145 -0.0011 0.0014  0.0026  225  GLY A N     
261  C CA    . GLY A 40  ? 0.1210 0.1258 0.1195 0.0028  0.0024  -0.0047 225  GLY A CA    
262  C C     . GLY A 40  ? 0.1316 0.1242 0.1226 -0.0016 0.0030  -0.0087 225  GLY A C     
263  O O     . GLY A 40  ? 0.1515 0.1644 0.1350 0.0031  0.0042  -0.0127 225  GLY A O     
264  N N     . LYS A 41  ? 0.1185 0.1167 0.1200 0.0023  -0.0010 -0.0069 226  LYS A N     
265  C CA    . LYS A 41  ? 0.1170 0.1151 0.1329 0.0000  0.0003  -0.0039 226  LYS A CA    
266  C C     . LYS A 41  ? 0.1232 0.1235 0.1334 -0.0008 0.0015  -0.0011 226  LYS A C     
267  O O     . LYS A 41  ? 0.1322 0.1421 0.1485 -0.0143 -0.0124 0.0145  226  LYS A O     
268  C CB    . LYS A 41  ? 0.1185 0.1115 0.1289 0.0045  -0.0012 -0.0103 226  LYS A CB    
269  C CG    . LYS A 41  ? 0.1143 0.1311 0.1422 0.0074  -0.0007 0.0093  226  LYS A CG    
270  C CD    . LYS A 41  ? 0.1255 0.1102 0.1499 0.0109  0.0098  0.0078  226  LYS A CD    
271  C CE    . LYS A 41  ? 0.1292 0.0885 0.1460 0.0105  0.0168  0.0007  226  LYS A CE    
272  N NZ    . LYS A 41  ? 0.1282 0.0962 0.1367 0.0162  0.0332  0.0173  226  LYS A NZ    
273  N N     . GLY A 42  ? 0.1106 0.1108 0.1322 0.0006  -0.0012 0.0050  227  GLY A N     
274  C CA    . GLY A 42  ? 0.1168 0.1167 0.1334 -0.0029 -0.0011 0.0038  227  GLY A CA    
275  C C     . GLY A 42  ? 0.1135 0.1145 0.1281 0.0021  -0.0054 0.0008  227  GLY A C     
276  O O     . GLY A 42  ? 0.1114 0.1168 0.1575 -0.0048 -0.0057 -0.0072 227  GLY A O     
277  N N     . ARG A 43  ? 0.1120 0.1011 0.1230 0.0052  -0.0036 0.0092  228  ARG A N     
278  C CA    . ARG A 43  ? 0.1109 0.1139 0.1318 -0.0023 -0.0032 0.0025  228  ARG A CA    
279  C C     . ARG A 43  ? 0.1097 0.1148 0.1254 0.0018  -0.0025 0.0027  228  ARG A C     
280  O O     . ARG A 43  ? 0.1224 0.1152 0.1393 0.0001  0.0039  0.0014  228  ARG A O     
281  C CB    . ARG A 43  ? 0.1099 0.1172 0.1276 -0.0084 0.0033  0.0062  228  ARG A CB    
282  C CG    . ARG A 43  ? 0.1188 0.1029 0.1393 -0.0100 -0.0112 0.0046  228  ARG A CG    
283  C CD    . ARG A 43  ? 0.1213 0.1228 0.1424 -0.0148 -0.0075 0.0007  228  ARG A CD    
284  N NE    . ARG A 43  ? 0.1174 0.0936 0.1466 -0.0087 -0.0089 -0.0077 228  ARG A NE    
285  C CZ    . ARG A 43  ? 0.1274 0.1169 0.1532 -0.0115 -0.0115 0.0067  228  ARG A CZ    
286  N NH1   . ARG A 43  ? 0.1450 0.1535 0.1670 -0.0002 -0.0044 0.0259  228  ARG A NH1   
287  N NH2   . ARG A 43  ? 0.1597 0.1354 0.1521 0.0072  -0.0003 0.0156  228  ARG A NH2   
288  N N     . GLY A 44  ? 0.1157 0.1136 0.1252 0.0110  -0.0046 0.0008  229  GLY A N     
289  C CA    . GLY A 44  ? 0.1092 0.1093 0.1345 0.0051  0.0014  0.0044  229  GLY A CA    
290  C C     . GLY A 44  ? 0.1123 0.1176 0.1250 0.0077  0.0002  0.0089  229  GLY A C     
291  O O     . GLY A 44  ? 0.1116 0.1203 0.1313 0.0177  0.0053  0.0224  229  GLY A O     
292  N N     . VAL A 45  ? 0.1097 0.1023 0.1297 0.0074  -0.0006 0.0039  230  VAL A N     
293  C CA    . VAL A 45  ? 0.1209 0.1177 0.1325 0.0041  0.0018  0.0032  230  VAL A CA    
294  C C     . VAL A 45  ? 0.1251 0.1210 0.1306 0.0041  0.0018  0.0027  230  VAL A C     
295  O O     . VAL A 45  ? 0.1335 0.1073 0.1394 0.0006  0.0108  0.0090  230  VAL A O     
296  C CB    . VAL A 45  ? 0.1185 0.1198 0.1320 0.0095  0.0006  0.0030  230  VAL A CB    
297  C CG1   . VAL A 45  ? 0.1288 0.1538 0.1536 0.0058  0.0102  0.0037  230  VAL A CG1   
298  C CG2   . VAL A 45  ? 0.1411 0.1239 0.1439 0.0087  -0.0069 -0.0032 230  VAL A CG2   
299  N N     . ILE A 46  ? 0.1242 0.1296 0.1417 0.0045  0.0011  -0.0016 231  ILE A N     
300  C CA    . ILE A 46  ? 0.1298 0.1404 0.1433 0.0125  0.0012  -0.0014 231  ILE A CA    
301  C C     . ILE A 46  ? 0.1240 0.1314 0.1330 0.0072  -0.0001 0.0006  231  ILE A C     
302  O O     . ILE A 46  ? 0.1188 0.1316 0.1406 0.0110  0.0046  0.0057  231  ILE A O     
303  C CB    . ILE A 46  ? 0.1409 0.1563 0.1633 0.0167  -0.0035 -0.0058 231  ILE A CB    
304  C CG1   . ILE A 46  ? 0.1672 0.1813 0.1822 0.0125  -0.0106 0.0058  231  ILE A CG1   
305  C CG2   . ILE A 46  ? 0.1433 0.2060 0.1800 0.0135  -0.0045 -0.0028 231  ILE A CG2   
306  C CD1   . ILE A 46  ? 0.2108 0.1811 0.1674 -0.0034 -0.0183 0.0000  231  ILE A CD1   
307  N N     . ALA A 47  ? 0.1210 0.1267 0.1259 0.0083  0.0023  0.0024  232  ALA A N     
308  C CA    . ALA A 47  ? 0.1232 0.1317 0.1304 0.0074  0.0004  0.0083  232  ALA A CA    
309  C C     . ALA A 47  ? 0.1333 0.1363 0.1312 0.0064  -0.0014 0.0050  232  ALA A C     
310  O O     . ALA A 47  ? 0.1149 0.1408 0.1304 -0.0015 -0.0017 0.0094  232  ALA A O     
311  C CB    . ALA A 47  ? 0.1229 0.1208 0.1329 0.0049  0.0041  0.0089  232  ALA A CB    
312  N N     . THR A 48  ? 0.1337 0.1409 0.1320 0.0039  -0.0033 0.0064  233  THR A N     
313  C CA    . THR A 48  ? 0.1471 0.1497 0.1451 0.0017  0.0057  0.0060  233  THR A CA    
314  C C     . THR A 48  ? 0.1554 0.1494 0.1487 -0.0022 0.0049  0.0022  233  THR A C     
315  O O     . THR A 48  ? 0.1768 0.1648 0.1465 -0.0035 0.0177  0.0036  233  THR A O     
316  C CB    . THR A 48  ? 0.1539 0.1477 0.1600 0.0041  0.0044  0.0097  233  THR A CB    
317  O OG1   . THR A 48  ? 0.1568 0.1869 0.1877 -0.0129 0.0129  0.0042  233  THR A OG1   
318  C CG2   . THR A 48  ? 0.1698 0.1632 0.1808 0.0094  0.0144  0.0005  233  THR A CG2   
319  N N     . LYS A 49  ? 0.1556 0.1486 0.1487 0.0017  0.0072  0.0088  234  LYS A N     
320  C CA    . LYS A 49  ? 0.1516 0.1533 0.1578 0.0000  0.0067  0.0100  234  LYS A CA    
321  C C     . LYS A 49  ? 0.1482 0.1486 0.1430 0.0042  0.0046  0.0105  234  LYS A C     
322  O O     . LYS A 49  ? 0.1615 0.1367 0.1391 0.0032  0.0084  0.0126  234  LYS A O     
323  C CB    . LYS A 49  ? 0.1540 0.1564 0.1601 0.0027  0.0119  0.0161  234  LYS A CB    
324  C CG    . LYS A 49  ? 0.1734 0.1905 0.1958 -0.0048 0.0017  -0.0037 234  LYS A CG    
325  C CD    . LYS A 49  ? 0.1872 0.2132 0.2296 -0.0104 -0.0067 0.0060  234  LYS A CD    
326  C CE    . LYS A 49  ? 0.2429 0.2566 0.2486 -0.0032 -0.0041 -0.0065 234  LYS A CE    
327  N NZ    . LYS A 49  ? 0.2629 0.3074 0.3028 -0.0011 -0.0097 -0.0098 234  LYS A NZ    
328  N N     . GLN A 50  ? 0.1344 0.1435 0.1286 -0.0056 -0.0023 0.0159  235  GLN A N     
329  C CA    . GLN A 50  ? 0.1281 0.1424 0.1238 -0.0047 -0.0029 0.0095  235  GLN A CA    
330  C C     . GLN A 50  ? 0.1300 0.1515 0.1318 -0.0056 -0.0031 0.0058  235  GLN A C     
331  O O     . GLN A 50  ? 0.1276 0.1959 0.1395 -0.0036 0.0034  -0.0013 235  GLN A O     
332  C CB    . GLN A 50  ? 0.1326 0.1406 0.1265 -0.0057 -0.0062 0.0079  235  GLN A CB    
333  C CG    . GLN A 50  ? 0.1376 0.1410 0.1284 0.0046  -0.0081 0.0067  235  GLN A CG    
334  C CD    . GLN A 50  ? 0.1408 0.1333 0.1261 0.0118  -0.0097 0.0034  235  GLN A CD    
335  O OE1   . GLN A 50  ? 0.1419 0.1575 0.1504 0.0111  -0.0295 0.0060  235  GLN A OE1   
336  N NE2   . GLN A 50  ? 0.1256 0.1167 0.1363 0.0072  -0.0016 0.0130  235  GLN A NE2   
337  N N     . PHE A 51  ? 0.1225 0.1452 0.1313 -0.0067 -0.0010 0.0044  236  PHE A N     
338  C CA    . PHE A 51  ? 0.1241 0.1357 0.1295 -0.0029 -0.0027 0.0066  236  PHE A CA    
339  C C     . PHE A 51  ? 0.1251 0.1399 0.1344 -0.0045 0.0017  0.0085  236  PHE A C     
340  O O     . PHE A 51  ? 0.1065 0.1335 0.1470 -0.0044 -0.0022 0.0137  236  PHE A O     
341  C CB    . PHE A 51  ? 0.1376 0.1282 0.1318 -0.0040 0.0057  0.0086  236  PHE A CB    
342  C CG    . PHE A 51  ? 0.1295 0.1264 0.1393 -0.0094 0.0025  0.0042  236  PHE A CG    
343  C CD1   . PHE A 51  ? 0.1431 0.1382 0.1586 -0.0143 -0.0100 -0.0108 236  PHE A CD1   
344  C CD2   . PHE A 51  ? 0.1579 0.1481 0.1686 -0.0030 -0.0040 0.0035  236  PHE A CD2   
345  C CE1   . PHE A 51  ? 0.1577 0.1584 0.1744 -0.0152 -0.0004 0.0096  236  PHE A CE1   
346  C CE2   . PHE A 51  ? 0.1708 0.1562 0.1735 -0.0020 0.0034  0.0085  236  PHE A CE2   
347  C CZ    . PHE A 51  ? 0.1657 0.1500 0.1862 -0.0035 0.0028  0.0143  236  PHE A CZ    
348  N N     . SER A 52  ? 0.1201 0.1402 0.1305 -0.0056 -0.0082 0.0086  237  SER A N     
349  C CA    . SER A 52  ? 0.1238 0.1351 0.1290 -0.0019 -0.0041 0.0053  237  SER A CA    
350  C C     . SER A 52  ? 0.1242 0.1341 0.1314 -0.0044 -0.0056 0.0067  237  SER A C     
351  O O     . SER A 52  ? 0.1146 0.1267 0.1281 -0.0160 -0.0085 0.0035  237  SER A O     
352  C CB    . SER A 52  ? 0.1317 0.1380 0.1320 0.0069  -0.0084 0.0067  237  SER A CB    
353  O OG    . SER A 52  ? 0.1574 0.1649 0.1290 0.0179  -0.0073 0.0068  237  SER A OG    
354  N N     . ARG A 53  ? 0.1171 0.1265 0.1375 -0.0085 -0.0048 0.0059  238  ARG A N     
355  C CA    . ARG A 53  ? 0.1310 0.1382 0.1413 -0.0063 -0.0064 0.0034  238  ARG A CA    
356  C C     . ARG A 53  ? 0.1213 0.1318 0.1317 0.0013  -0.0053 0.0026  238  ARG A C     
357  O O     . ARG A 53  ? 0.1118 0.1312 0.1229 0.0028  -0.0001 -0.0041 238  ARG A O     
358  C CB    . ARG A 53  ? 0.1417 0.1361 0.1465 -0.0086 -0.0042 0.0021  238  ARG A CB    
359  C CG    . ARG A 53  ? 0.1540 0.1581 0.1471 -0.0078 -0.0038 0.0106  238  ARG A CG    
360  C CD    . ARG A 53  ? 0.1916 0.1828 0.1943 -0.0170 0.0015  0.0131  238  ARG A CD    
361  N NE    . ARG A 53  ? 0.3187 0.3023 0.2718 -0.0094 0.0019  -0.0031 238  ARG A NE    
362  C CZ    . ARG A 53  ? 0.3469 0.3414 0.3248 -0.0123 0.0056  0.0053  238  ARG A CZ    
363  N NH1   . ARG A 53  ? 0.3678 0.3522 0.3570 -0.0160 -0.0029 -0.0025 238  ARG A NH1   
364  N NH2   . ARG A 53  ? 0.3674 0.3658 0.3324 -0.0107 0.0056  -0.0019 238  ARG A NH2   
365  N N     . GLY A 54  ? 0.1089 0.1238 0.1210 -0.0030 -0.0129 0.0038  239  GLY A N     
366  C CA    . GLY A 54  ? 0.1149 0.1275 0.1293 -0.0056 -0.0089 0.0050  239  GLY A CA    
367  C C     . GLY A 54  ? 0.1286 0.1334 0.1382 -0.0021 -0.0051 0.0054  239  GLY A C     
368  O O     . GLY A 54  ? 0.1313 0.1312 0.1517 -0.0027 -0.0102 -0.0007 239  GLY A O     
369  N N     . ASP A 55  ? 0.1249 0.1285 0.1377 -0.0048 -0.0028 0.0088  240  ASP A N     
370  C CA    . ASP A 55  ? 0.1284 0.1306 0.1365 -0.0066 -0.0035 0.0107  240  ASP A CA    
371  C C     . ASP A 55  ? 0.1223 0.1364 0.1326 -0.0077 -0.0028 0.0049  240  ASP A C     
372  O O     . ASP A 55  ? 0.1231 0.1460 0.1496 -0.0048 0.0011  0.0041  240  ASP A O     
373  C CB    . ASP A 55  ? 0.1449 0.1493 0.1394 -0.0071 -0.0064 0.0031  240  ASP A CB    
374  C CG    . ASP A 55  ? 0.1399 0.1474 0.1540 -0.0103 -0.0059 0.0072  240  ASP A CG    
375  O OD1   . ASP A 55  ? 0.1336 0.1675 0.1567 -0.0201 -0.0188 -0.0033 240  ASP A OD1   
376  O OD2   . ASP A 55  ? 0.1562 0.1515 0.1806 0.0022  -0.0213 -0.0016 240  ASP A OD2   
377  N N     . PHE A 56  ? 0.1288 0.1358 0.1419 -0.0083 -0.0046 0.0066  241  PHE A N     
378  C CA    . PHE A 56  ? 0.1219 0.1356 0.1403 -0.0039 -0.0118 0.0044  241  PHE A CA    
379  C C     . PHE A 56  ? 0.1302 0.1448 0.1416 0.0024  -0.0078 0.0025  241  PHE A C     
380  O O     . PHE A 56  ? 0.1374 0.1623 0.1406 0.0143  -0.0053 0.0000  241  PHE A O     
381  C CB    . PHE A 56  ? 0.1210 0.1325 0.1539 -0.0085 -0.0091 0.0047  241  PHE A CB    
382  C CG    . PHE A 56  ? 0.1305 0.1442 0.1658 0.0066  -0.0036 0.0016  241  PHE A CG    
383  C CD1   . PHE A 56  ? 0.1402 0.1482 0.1783 0.0009  0.0007  -0.0059 241  PHE A CD1   
384  C CD2   . PHE A 56  ? 0.1278 0.1454 0.1628 0.0089  -0.0068 -0.0006 241  PHE A CD2   
385  C CE1   . PHE A 56  ? 0.1548 0.1543 0.1853 0.0044  -0.0050 -0.0083 241  PHE A CE1   
386  C CE2   . PHE A 56  ? 0.1347 0.1464 0.1735 0.0002  0.0009  -0.0001 241  PHE A CE2   
387  C CZ    . PHE A 56  ? 0.1238 0.1504 0.1855 -0.0070 0.0014  -0.0030 241  PHE A CZ    
388  N N     . VAL A 57  ? 0.1135 0.1448 0.1397 0.0032  -0.0134 0.0047  242  VAL A N     
389  C CA    . VAL A 57  ? 0.1272 0.1367 0.1397 0.0005  -0.0064 0.0068  242  VAL A CA    
390  C C     . VAL A 57  ? 0.1201 0.1278 0.1328 0.0054  -0.0051 0.0052  242  VAL A C     
391  O O     . VAL A 57  ? 0.1256 0.1322 0.1388 -0.0018 -0.0088 0.0075  242  VAL A O     
392  C CB    . VAL A 57  ? 0.1278 0.1395 0.1451 0.0026  0.0019  0.0079  242  VAL A CB    
393  C CG1   . VAL A 57  ? 0.1422 0.1568 0.1417 0.0020  -0.0106 0.0029  242  VAL A CG1   
394  C CG2   . VAL A 57  ? 0.1484 0.1337 0.1459 -0.0036 -0.0064 0.0031  242  VAL A CG2   
395  N N     . VAL A 58  ? 0.1254 0.1327 0.1353 0.0060  -0.0009 0.0079  243  VAL A N     
396  C CA    . VAL A 58  ? 0.1353 0.1408 0.1379 0.0103  -0.0002 0.0043  243  VAL A CA    
397  C C     . VAL A 58  ? 0.1416 0.1359 0.1358 0.0064  0.0023  0.0021  243  VAL A C     
398  O O     . VAL A 58  ? 0.1637 0.1304 0.1319 0.0078  0.0046  0.0113  243  VAL A O     
399  C CB    . VAL A 58  ? 0.1383 0.1568 0.1494 0.0190  0.0078  0.0083  243  VAL A CB    
400  C CG1   . VAL A 58  ? 0.1183 0.1718 0.1682 0.0043  0.0130  0.0063  243  VAL A CG1   
401  C CG2   . VAL A 58  ? 0.1682 0.1760 0.1803 0.0119  0.0066  0.0082  243  VAL A CG2   
402  N N     . GLU A 59  ? 0.1462 0.1259 0.1343 0.0105  -0.0040 -0.0052 244  GLU A N     
403  C CA    . GLU A 59  ? 0.1363 0.1318 0.1372 0.0105  -0.0033 -0.0088 244  GLU A CA    
404  C C     . GLU A 59  ? 0.1336 0.1299 0.1304 0.0085  -0.0059 -0.0061 244  GLU A C     
405  O O     . GLU A 59  ? 0.1563 0.1386 0.1268 0.0105  0.0055  -0.0069 244  GLU A O     
406  C CB    . GLU A 59  ? 0.1336 0.1337 0.1390 0.0058  -0.0006 -0.0085 244  GLU A CB    
407  C CG    . GLU A 59  ? 0.1411 0.1364 0.1502 -0.0009 -0.0064 -0.0057 244  GLU A CG    
408  C CD    . GLU A 59  ? 0.1431 0.1363 0.1564 0.0097  -0.0048 -0.0073 244  GLU A CD    
409  O OE1   . GLU A 59  ? 0.1413 0.1738 0.1945 -0.0073 0.0006  0.0004  244  GLU A OE1   
410  O OE2   . GLU A 59  ? 0.1494 0.1481 0.1607 -0.0091 -0.0111 0.0007  244  GLU A OE2   
411  N N     . TYR A 60  ? 0.1328 0.1326 0.1426 0.0075  -0.0032 -0.0082 245  TYR A N     
412  C CA    . TYR A 60  ? 0.1318 0.1289 0.1294 0.0054  -0.0047 -0.0019 245  TYR A CA    
413  C C     . TYR A 60  ? 0.1407 0.1314 0.1323 0.0031  -0.0064 0.0016  245  TYR A C     
414  O O     . TYR A 60  ? 0.1521 0.1458 0.1421 0.0081  -0.0090 -0.0025 245  TYR A O     
415  C CB    . TYR A 60  ? 0.1348 0.1379 0.1297 0.0082  -0.0050 0.0010  245  TYR A CB    
416  C CG    . TYR A 60  ? 0.1138 0.1190 0.0990 -0.0012 -0.0052 0.0059  245  TYR A CG    
417  C CD1   . TYR A 60  ? 0.1171 0.1384 0.1031 0.0032  -0.0092 0.0138  245  TYR A CD1   
418  C CD2   . TYR A 60  ? 0.1350 0.1325 0.1232 0.0101  0.0016  -0.0005 245  TYR A CD2   
419  C CE1   . TYR A 60  ? 0.1258 0.1218 0.1256 0.0127  0.0007  -0.0011 245  TYR A CE1   
420  C CE2   . TYR A 60  ? 0.0976 0.1387 0.1179 -0.0049 -0.0085 -0.0099 245  TYR A CE2   
421  C CZ    . TYR A 60  ? 0.1093 0.1341 0.1235 0.0008  -0.0102 -0.0037 245  TYR A CZ    
422  O OH    . TYR A 60  ? 0.1104 0.1384 0.1298 0.0036  -0.0035 -0.0029 245  TYR A OH    
423  N N     . HIS A 61  ? 0.1382 0.1333 0.1335 -0.0028 -0.0028 0.0034  246  HIS A N     
424  C CA    . HIS A 61  ? 0.1465 0.1400 0.1391 -0.0014 -0.0019 0.0046  246  HIS A CA    
425  C C     . HIS A 61  ? 0.1499 0.1410 0.1431 -0.0036 0.0002  0.0025  246  HIS A C     
426  O O     . HIS A 61  ? 0.1438 0.1486 0.1514 -0.0082 -0.0011 0.0029  246  HIS A O     
427  C CB    . HIS A 61  ? 0.1444 0.1400 0.1494 -0.0042 0.0039  0.0051  246  HIS A CB    
428  C CG    . HIS A 61  ? 0.1544 0.1353 0.1732 -0.0088 0.0040  -0.0012 246  HIS A CG    
429  N ND1   . HIS A 61  ? 0.1645 0.1656 0.1792 -0.0069 0.0125  0.0097  246  HIS A ND1   
430  C CD2   . HIS A 61  ? 0.1603 0.1540 0.1840 -0.0025 0.0063  -0.0023 246  HIS A CD2   
431  C CE1   . HIS A 61  ? 0.1646 0.1667 0.1916 -0.0059 -0.0009 0.0045  246  HIS A CE1   
432  N NE2   . HIS A 61  ? 0.1715 0.1657 0.2173 -0.0063 0.0057  0.0095  246  HIS A NE2   
433  N N     . GLY A 62  ? 0.1608 0.1512 0.1439 -0.0014 0.0002  -0.0015 247  GLY A N     
434  C CA    . GLY A 62  ? 0.1747 0.1580 0.1491 -0.0005 -0.0052 -0.0020 247  GLY A CA    
435  C C     . GLY A 62  ? 0.1827 0.1693 0.1625 -0.0062 -0.0005 -0.0050 247  GLY A C     
436  O O     . GLY A 62  ? 0.1954 0.1812 0.1716 -0.0004 -0.0007 -0.0175 247  GLY A O     
437  N N     . ASP A 63  ? 0.1915 0.1745 0.1625 -0.0072 0.0031  -0.0055 248  ASP A N     
438  C CA    . ASP A 63  ? 0.2020 0.1929 0.1739 -0.0054 0.0003  -0.0034 248  ASP A CA    
439  C C     . ASP A 63  ? 0.1936 0.1885 0.1682 -0.0095 0.0022  -0.0047 248  ASP A C     
440  O O     . ASP A 63  ? 0.1935 0.2106 0.1711 -0.0122 -0.0009 -0.0038 248  ASP A O     
441  C CB    . ASP A 63  ? 0.2168 0.1969 0.1946 -0.0033 0.0043  -0.0055 248  ASP A CB    
442  C CG    . ASP A 63  ? 0.2525 0.2467 0.2274 -0.0011 -0.0005 0.0017  248  ASP A CG    
443  O OD1   . ASP A 63  ? 0.2962 0.2982 0.2881 0.0026  0.0226  0.0052  248  ASP A OD1   
444  O OD2   . ASP A 63  ? 0.3010 0.2721 0.2820 0.0108  0.0061  0.0021  248  ASP A OD2   
445  N N     . LEU A 64  ? 0.1920 0.1840 0.1630 -0.0120 0.0030  -0.0008 249  LEU A N     
446  C CA    . LEU A 64  ? 0.1846 0.1813 0.1591 -0.0111 0.0006  -0.0061 249  LEU A CA    
447  C C     . LEU A 64  ? 0.1831 0.1823 0.1632 -0.0109 0.0054  -0.0059 249  LEU A C     
448  O O     . LEU A 64  ? 0.1727 0.1867 0.1679 -0.0162 0.0053  -0.0114 249  LEU A O     
449  C CB    . LEU A 64  ? 0.1861 0.1816 0.1559 -0.0077 0.0024  0.0020  249  LEU A CB    
450  C CG    . LEU A 64  ? 0.1821 0.1860 0.1510 -0.0098 -0.0006 -0.0073 249  LEU A CG    
451  C CD1   . LEU A 64  ? 0.1951 0.1896 0.1754 -0.0125 0.0060  -0.0160 249  LEU A CD1   
452  C CD2   . LEU A 64  ? 0.1985 0.1973 0.1704 -0.0005 0.0009  -0.0054 249  LEU A CD2   
453  N N     . ILE A 65  ? 0.1802 0.1796 0.1622 -0.0105 0.0055  -0.0097 250  ILE A N     
454  C CA    . ILE A 65  ? 0.1789 0.1728 0.1588 -0.0098 0.0054  -0.0048 250  ILE A CA    
455  C C     . ILE A 65  ? 0.1721 0.1675 0.1548 -0.0114 0.0037  -0.0085 250  ILE A C     
456  O O     . ILE A 65  ? 0.1761 0.1732 0.1566 -0.0136 0.0027  -0.0123 250  ILE A O     
457  C CB    . ILE A 65  ? 0.1757 0.1720 0.1556 -0.0086 0.0044  -0.0049 250  ILE A CB    
458  C CG1   . ILE A 65  ? 0.1679 0.1839 0.1672 -0.0098 0.0068  -0.0037 250  ILE A CG1   
459  C CG2   . ILE A 65  ? 0.1944 0.1737 0.1577 -0.0132 0.0103  0.0004  250  ILE A CG2   
460  C CD1   . ILE A 65  ? 0.1781 0.1807 0.1657 -0.0096 0.0015  -0.0045 250  ILE A CD1   
461  N N     . GLU A 66  ? 0.1763 0.1643 0.1490 -0.0098 0.0023  -0.0080 251  GLU A N     
462  C CA    . GLU A 66  ? 0.1806 0.1693 0.1630 -0.0127 0.0049  -0.0083 251  GLU A CA    
463  C C     . GLU A 66  ? 0.1722 0.1587 0.1592 -0.0156 0.0024  -0.0085 251  GLU A C     
464  O O     . GLU A 66  ? 0.1749 0.1462 0.1594 -0.0170 0.0090  -0.0148 251  GLU A O     
465  C CB    . GLU A 66  ? 0.1824 0.1817 0.1646 -0.0143 0.0000  -0.0055 251  GLU A CB    
466  C CG    . GLU A 66  ? 0.2261 0.2118 0.2226 -0.0059 0.0078  -0.0058 251  GLU A CG    
467  C CD    . GLU A 66  ? 0.2451 0.2502 0.2621 0.0081  0.0059  -0.0005 251  GLU A CD    
468  O OE1   . GLU A 66  ? 0.2497 0.2635 0.2478 0.0092  0.0035  0.0055  251  GLU A OE1   
469  O OE2   . GLU A 66  ? 0.2553 0.2736 0.2773 -0.0021 0.0111  -0.0055 251  GLU A OE2   
470  N N     . ILE A 67  ? 0.1714 0.1546 0.1636 -0.0124 0.0072  -0.0065 252  ILE A N     
471  C CA    . ILE A 67  ? 0.1771 0.1641 0.1711 -0.0070 0.0095  0.0056  252  ILE A CA    
472  C C     . ILE A 67  ? 0.1796 0.1610 0.1705 -0.0105 0.0066  0.0035  252  ILE A C     
473  O O     . ILE A 67  ? 0.1732 0.1456 0.1780 -0.0128 0.0144  0.0152  252  ILE A O     
474  C CB    . ILE A 67  ? 0.1823 0.1648 0.1728 -0.0063 0.0138  0.0081  252  ILE A CB    
475  C CG1   . ILE A 67  ? 0.1839 0.1794 0.1848 0.0020  0.0087  0.0125  252  ILE A CG1   
476  C CG2   . ILE A 67  ? 0.1849 0.1664 0.1712 -0.0003 0.0136  0.0077  252  ILE A CG2   
477  C CD1   . ILE A 67  ? 0.1771 0.1776 0.1773 -0.0037 0.0092  0.0167  252  ILE A CD1   
478  N N     . THR A 68  ? 0.1858 0.1577 0.1726 -0.0124 0.0043  0.0040  253  THR A N     
479  C CA    . THR A 68  ? 0.2004 0.1636 0.1838 -0.0105 0.0017  -0.0025 253  THR A CA    
480  C C     . THR A 68  ? 0.1991 0.1571 0.1868 -0.0130 0.0003  -0.0014 253  THR A C     
481  O O     . THR A 68  ? 0.2038 0.1476 0.1922 -0.0162 0.0038  0.0006  253  THR A O     
482  C CB    . THR A 68  ? 0.2001 0.1660 0.1773 -0.0102 -0.0041 -0.0044 253  THR A CB    
483  O OG1   . THR A 68  ? 0.2199 0.1886 0.1799 -0.0065 0.0054  0.0030  253  THR A OG1   
484  C CG2   . THR A 68  ? 0.2144 0.1845 0.2183 -0.0036 0.0075  0.0061  253  THR A CG2   
485  N N     . ASP A 69  ? 0.2056 0.1618 0.1898 -0.0124 0.0004  -0.0020 254  ASP A N     
486  C CA    . ASP A 69  ? 0.2125 0.1807 0.1949 -0.0092 -0.0018 -0.0033 254  ASP A CA    
487  C C     . ASP A 69  ? 0.2103 0.1828 0.1945 -0.0081 -0.0014 -0.0043 254  ASP A C     
488  O O     . ASP A 69  ? 0.2143 0.1743 0.1964 -0.0094 -0.0040 -0.0040 254  ASP A O     
489  C CB    . ASP A 69  ? 0.2160 0.1917 0.2010 -0.0091 0.0003  -0.0035 254  ASP A CB    
490  C CG    . ASP A 69  ? 0.2639 0.2459 0.2436 0.0002  0.0080  0.0094  254  ASP A CG    
491  O OD1   . ASP A 69  ? 0.2892 0.2861 0.2980 0.0082  0.0164  0.0173  254  ASP A OD1   
492  O OD2   . ASP A 69  ? 0.2954 0.2788 0.2687 -0.0005 0.0276  -0.0016 254  ASP A OD2   
493  N N     . ALA A 70  ? 0.2091 0.1857 0.1919 -0.0081 -0.0008 -0.0035 255  ALA A N     
494  C CA    . ALA A 70  ? 0.2075 0.1908 0.1947 -0.0069 -0.0011 -0.0073 255  ALA A CA    
495  C C     . ALA A 70  ? 0.2162 0.1971 0.2053 -0.0055 0.0012  -0.0077 255  ALA A C     
496  O O     . ALA A 70  ? 0.2140 0.1968 0.2054 -0.0055 0.0034  -0.0152 255  ALA A O     
497  C CB    . ALA A 70  ? 0.2093 0.1897 0.1944 -0.0065 0.0009  -0.0049 255  ALA A CB    
498  N N     . LYS A 71  ? 0.2226 0.2076 0.2128 -0.0065 0.0018  -0.0106 256  LYS A N     
499  C CA    . LYS A 71  ? 0.2359 0.2214 0.2323 -0.0011 0.0013  -0.0083 256  LYS A CA    
500  C C     . LYS A 71  ? 0.2426 0.2229 0.2399 -0.0014 0.0006  -0.0104 256  LYS A C     
501  O O     . LYS A 71  ? 0.2513 0.2215 0.2493 0.0012  0.0001  -0.0139 256  LYS A O     
502  C CB    . LYS A 71  ? 0.2388 0.2228 0.2290 -0.0025 0.0021  -0.0100 256  LYS A CB    
503  C CG    . LYS A 71  ? 0.2537 0.2495 0.2495 -0.0035 0.0042  -0.0027 256  LYS A CG    
504  C CD    . LYS A 71  ? 0.2781 0.2718 0.2593 -0.0011 0.0036  -0.0014 256  LYS A CD    
505  C CE    . LYS A 71  ? 0.2751 0.2630 0.2782 -0.0010 0.0010  0.0038  256  LYS A CE    
506  N NZ    . LYS A 71  ? 0.2771 0.2616 0.2796 0.0010  0.0049  0.0085  256  LYS A NZ    
507  N N     . LYS A 72  ? 0.2529 0.2287 0.2542 -0.0013 0.0000  -0.0090 257  LYS A N     
508  C CA    . LYS A 72  ? 0.2644 0.2417 0.2639 -0.0004 0.0000  -0.0056 257  LYS A CA    
509  C C     . LYS A 72  ? 0.2653 0.2413 0.2633 0.0000  -0.0003 -0.0070 257  LYS A C     
510  O O     . LYS A 72  ? 0.2706 0.2288 0.2638 0.0021  0.0025  -0.0129 257  LYS A O     
511  C CB    . LYS A 72  ? 0.2660 0.2458 0.2701 -0.0016 -0.0003 -0.0048 257  LYS A CB    
512  C CG    . LYS A 72  ? 0.2861 0.2608 0.2821 0.0016  0.0005  -0.0002 257  LYS A CG    
513  C CD    . LYS A 72  ? 0.2950 0.2988 0.3159 -0.0020 0.0000  -0.0037 257  LYS A CD    
514  C CE    . LYS A 72  ? 0.3370 0.3290 0.3297 0.0011  0.0020  0.0052  257  LYS A CE    
515  N NZ    . LYS A 72  ? 0.3468 0.3433 0.3270 0.0004  0.0077  -0.0022 257  LYS A NZ    
516  N N     . ARG A 73  ? 0.2690 0.2438 0.2644 0.0007  -0.0008 -0.0093 258  ARG A N     
517  C CA    . ARG A 73  ? 0.2752 0.2561 0.2711 0.0015  -0.0011 -0.0056 258  ARG A CA    
518  C C     . ARG A 73  ? 0.2815 0.2599 0.2746 -0.0007 -0.0020 -0.0097 258  ARG A C     
519  O O     . ARG A 73  ? 0.2862 0.2540 0.2880 -0.0007 -0.0030 -0.0088 258  ARG A O     
520  C CB    . ARG A 73  ? 0.2735 0.2584 0.2686 -0.0001 -0.0004 -0.0071 258  ARG A CB    
521  C CG    . ARG A 73  ? 0.2650 0.2526 0.2643 0.0034  -0.0020 -0.0023 258  ARG A CG    
522  C CD    . ARG A 73  ? 0.2582 0.2615 0.2606 -0.0021 -0.0019 -0.0044 258  ARG A CD    
523  N NE    . ARG A 73  ? 0.2569 0.2508 0.2558 0.0001  -0.0025 -0.0024 258  ARG A NE    
524  C CZ    . ARG A 73  ? 0.2667 0.2516 0.2529 -0.0012 -0.0028 0.0011  258  ARG A CZ    
525  N NH1   . ARG A 73  ? 0.2639 0.2443 0.2486 -0.0075 0.0029  -0.0027 258  ARG A NH1   
526  N NH2   . ARG A 73  ? 0.2652 0.2620 0.2649 0.0078  0.0006  0.0110  258  ARG A NH2   
527  N N     . GLU A 74  ? 0.2903 0.2713 0.2869 0.0002  -0.0031 -0.0066 259  GLU A N     
528  C CA    . GLU A 74  ? 0.3032 0.2898 0.3025 -0.0002 -0.0015 -0.0059 259  GLU A CA    
529  C C     . GLU A 74  ? 0.3063 0.2967 0.3063 0.0011  -0.0017 -0.0047 259  GLU A C     
530  O O     . GLU A 74  ? 0.3076 0.2981 0.3125 0.0000  -0.0024 -0.0079 259  GLU A O     
531  C CB    . GLU A 74  ? 0.3079 0.2963 0.3089 -0.0007 0.0006  -0.0023 259  GLU A CB    
532  C CG    . GLU A 74  ? 0.3282 0.3047 0.3238 0.0015  0.0027  -0.0076 259  GLU A CG    
533  C CD    . GLU A 74  ? 0.3443 0.3275 0.3426 -0.0034 0.0065  -0.0028 259  GLU A CD    
534  O OE1   . GLU A 74  ? 0.3455 0.3287 0.3529 0.0024  0.0061  0.0001  259  GLU A OE1   
535  O OE2   . GLU A 74  ? 0.3562 0.3318 0.3745 0.0046  0.0178  -0.0085 259  GLU A OE2   
536  N N     . ALA A 75  ? 0.3118 0.3005 0.3134 0.0000  -0.0003 -0.0048 260  ALA A N     
537  C CA    . ALA A 75  ? 0.3154 0.3075 0.3182 0.0006  0.0006  -0.0034 260  ALA A CA    
538  C C     . ALA A 75  ? 0.3170 0.3097 0.3196 0.0001  -0.0002 -0.0027 260  ALA A C     
539  O O     . ALA A 75  ? 0.3224 0.3179 0.3247 0.0013  0.0002  -0.0008 260  ALA A O     
540  C CB    . ALA A 75  ? 0.3136 0.3090 0.3156 -0.0001 0.0006  -0.0028 260  ALA A CB    
541  N N     . LEU A 76  ? 0.3178 0.3062 0.3207 -0.0009 -0.0008 -0.0057 261  LEU A N     
542  C CA    . LEU A 76  ? 0.3177 0.3055 0.3212 0.0002  -0.0037 -0.0036 261  LEU A CA    
543  C C     . LEU A 76  ? 0.3199 0.3054 0.3221 0.0018  -0.0037 -0.0035 261  LEU A C     
544  O O     . LEU A 76  ? 0.3248 0.3058 0.3274 0.0025  -0.0056 -0.0019 261  LEU A O     
545  C CB    . LEU A 76  ? 0.3194 0.3091 0.3254 0.0016  -0.0006 -0.0030 261  LEU A CB    
546  C CG    . LEU A 76  ? 0.3230 0.3152 0.3282 0.0001  -0.0025 -0.0003 261  LEU A CG    
547  C CD1   . LEU A 76  ? 0.3207 0.3075 0.3286 -0.0021 0.0000  -0.0003 261  LEU A CD1   
548  C CD2   . LEU A 76  ? 0.3258 0.3229 0.3312 0.0051  -0.0022 -0.0022 261  LEU A CD2   
549  N N     . TYR A 77  ? 0.3154 0.3004 0.3186 0.0034  -0.0035 -0.0035 262  TYR A N     
550  C CA    . TYR A 77  ? 0.3150 0.2988 0.3210 0.0027  -0.0042 -0.0044 262  TYR A CA    
551  C C     . TYR A 77  ? 0.3230 0.3074 0.3299 0.0034  -0.0037 -0.0052 262  TYR A C     
552  O O     . TYR A 77  ? 0.3276 0.3083 0.3306 0.0066  -0.0069 -0.0051 262  TYR A O     
553  C CB    . TYR A 77  ? 0.3016 0.2905 0.3114 0.0027  -0.0037 -0.0047 262  TYR A CB    
554  C CG    . TYR A 77  ? 0.2958 0.2788 0.2958 -0.0016 -0.0027 -0.0059 262  TYR A CG    
555  C CD1   . TYR A 77  ? 0.2886 0.2764 0.2842 0.0047  -0.0044 0.0005  262  TYR A CD1   
556  C CD2   . TYR A 77  ? 0.2756 0.2571 0.2711 -0.0094 -0.0073 -0.0114 262  TYR A CD2   
557  C CE1   . TYR A 77  ? 0.2878 0.2630 0.2930 -0.0007 -0.0054 -0.0011 262  TYR A CE1   
558  C CE2   . TYR A 77  ? 0.2796 0.2572 0.2750 0.0011  -0.0062 -0.0157 262  TYR A CE2   
559  C CZ    . TYR A 77  ? 0.2895 0.2710 0.2874 0.0022  -0.0067 -0.0044 262  TYR A CZ    
560  O OH    . TYR A 77  ? 0.2907 0.2550 0.2954 0.0027  -0.0037 0.0005  262  TYR A OH    
561  N N     . ALA A 78  ? 0.3354 0.3189 0.3409 0.0019  -0.0031 -0.0036 263  ALA A N     
562  C CA    . ALA A 78  ? 0.3441 0.3342 0.3536 0.0011  -0.0012 -0.0031 263  ALA A CA    
563  C C     . ALA A 78  ? 0.3533 0.3471 0.3635 0.0026  -0.0019 -0.0015 263  ALA A C     
564  O O     . ALA A 78  ? 0.3541 0.3489 0.3687 0.0005  -0.0011 -0.0022 263  ALA A O     
565  C CB    . ALA A 78  ? 0.3445 0.3343 0.3548 0.0013  -0.0013 -0.0012 263  ALA A CB    
566  N N     . GLN A 79  ? 0.3635 0.3562 0.3712 0.0005  -0.0008 -0.0027 264  GLN A N     
567  C CA    . GLN A 79  ? 0.3771 0.3673 0.3804 0.0010  -0.0013 -0.0008 264  GLN A CA    
568  C C     . GLN A 79  ? 0.3826 0.3747 0.3861 0.0008  -0.0008 -0.0006 264  GLN A C     
569  O O     . GLN A 79  ? 0.3864 0.3706 0.3907 -0.0003 -0.0001 -0.0005 264  GLN A O     
570  C CB    . GLN A 79  ? 0.3771 0.3663 0.3792 0.0012  -0.0008 -0.0009 264  GLN A CB    
571  C CG    . GLN A 79  ? 0.3839 0.3771 0.3828 0.0012  -0.0011 0.0002  264  GLN A CG    
572  C CD    . GLN A 79  ? 0.3833 0.3758 0.3849 0.0000  -0.0007 -0.0012 264  GLN A CD    
573  O OE1   . GLN A 79  ? 0.4015 0.3948 0.4104 0.0043  0.0001  0.0056  264  GLN A OE1   
574  N NE2   . GLN A 79  ? 0.3856 0.3755 0.3821 0.0006  -0.0033 0.0006  264  GLN A NE2   
575  N N     . ASP A 80  ? 0.3900 0.3810 0.3938 0.0014  -0.0007 -0.0020 265  ASP A N     
576  C CA    . ASP A 80  ? 0.3991 0.3911 0.3987 0.0015  -0.0005 -0.0003 265  ASP A CA    
577  C C     . ASP A 80  ? 0.4003 0.3934 0.4015 0.0013  -0.0005 -0.0006 265  ASP A C     
578  O O     . ASP A 80  ? 0.4010 0.3916 0.4021 0.0034  -0.0010 -0.0006 265  ASP A O     
579  C CB    . ASP A 80  ? 0.4009 0.3943 0.4034 0.0020  0.0002  -0.0006 265  ASP A CB    
580  C CG    . ASP A 80  ? 0.4143 0.4053 0.4103 0.0022  -0.0003 -0.0003 265  ASP A CG    
581  O OD1   . ASP A 80  ? 0.4307 0.4259 0.4313 0.0029  -0.0043 0.0011  265  ASP A OD1   
582  O OD2   . ASP A 80  ? 0.4276 0.4186 0.4277 0.0048  0.0084  0.0006  265  ASP A OD2   
583  N N     . PRO A 81  ? 0.4028 0.3958 0.4046 0.0013  -0.0013 -0.0003 266  PRO A N     
584  C CA    . PRO A 81  ? 0.4010 0.3972 0.4032 0.0008  -0.0014 -0.0008 266  PRO A CA    
585  C C     . PRO A 81  ? 0.3960 0.3911 0.3981 0.0012  -0.0009 -0.0003 266  PRO A C     
586  O O     . PRO A 81  ? 0.3972 0.3928 0.3996 0.0010  -0.0022 -0.0020 266  PRO A O     
587  C CB    . PRO A 81  ? 0.4016 0.3985 0.4059 0.0009  -0.0009 -0.0004 266  PRO A CB    
588  C CG    . PRO A 81  ? 0.4061 0.3987 0.4059 0.0007  -0.0011 -0.0004 266  PRO A CG    
589  C CD    . PRO A 81  ? 0.4031 0.3983 0.4073 0.0027  -0.0009 -0.0012 266  PRO A CD    
590  N N     . SER A 82  ? 0.3915 0.3859 0.3923 0.0018  -0.0008 -0.0005 267  SER A N     
591  C CA    . SER A 82  ? 0.3850 0.3759 0.3839 0.0017  -0.0023 -0.0005 267  SER A CA    
592  C C     . SER A 82  ? 0.3749 0.3632 0.3684 0.0009  -0.0025 -0.0012 267  SER A C     
593  O O     . SER A 82  ? 0.3830 0.3672 0.3743 0.0039  -0.0026 0.0003  267  SER A O     
594  C CB    . SER A 82  ? 0.3880 0.3790 0.3879 0.0000  -0.0015 0.0000  267  SER A CB    
595  O OG    . SER A 82  ? 0.3968 0.3935 0.4063 -0.0025 -0.0067 -0.0022 267  SER A OG    
596  N N     . THR A 83  ? 0.3566 0.3406 0.3540 0.0015  -0.0028 0.0007  268  THR A N     
597  C CA    . THR A 83  ? 0.3389 0.3173 0.3328 -0.0017 -0.0019 -0.0006 268  THR A CA    
598  C C     . THR A 83  ? 0.3194 0.2990 0.3114 0.0025  -0.0042 -0.0011 268  THR A C     
599  O O     . THR A 83  ? 0.3262 0.2968 0.3147 -0.0010 -0.0041 0.0009  268  THR A O     
600  C CB    . THR A 83  ? 0.3396 0.3208 0.3370 -0.0018 -0.0026 -0.0019 268  THR A CB    
601  O OG1   . THR A 83  ? 0.3490 0.3278 0.3515 -0.0074 -0.0008 0.0019  268  THR A OG1   
602  C CG2   . THR A 83  ? 0.3340 0.3190 0.3373 -0.0053 -0.0037 -0.0021 268  THR A CG2   
603  N N     . GLY A 84  ? 0.3008 0.2697 0.2834 0.0025  -0.0088 0.0005  269  GLY A N     
604  C CA    . GLY A 84  ? 0.2613 0.2356 0.2485 0.0044  -0.0119 0.0010  269  GLY A CA    
605  C C     . GLY A 84  ? 0.2415 0.2111 0.2329 0.0031  -0.0142 -0.0018 269  GLY A C     
606  O O     . GLY A 84  ? 0.2434 0.2030 0.2282 0.0061  -0.0179 0.0007  269  GLY A O     
607  N N     . CYS A 85  ? 0.2076 0.1897 0.2045 0.0088  -0.0110 0.0013  270  CYS A N     
608  C CA    . CYS A 85  ? 0.1922 0.1753 0.1921 0.0120  -0.0102 -0.0039 270  CYS A CA    
609  C C     . CYS A 85  ? 0.1832 0.1748 0.1919 0.0078  -0.0122 -0.0038 270  CYS A C     
610  O O     . CYS A 85  ? 0.1800 0.1599 0.1906 0.0102  -0.0109 -0.0042 270  CYS A O     
611  C CB    . CYS A 85  ? 0.1856 0.1753 0.1902 0.0173  -0.0043 0.0017  270  CYS A CB    
612  S SG    . CYS A 85  ? 0.1968 0.1663 0.2044 0.0266  -0.0093 0.0051  270  CYS A SG    
613  N N     . TYR A 86  ? 0.1709 0.1741 0.1841 0.0075  -0.0157 -0.0101 271  TYR A N     
614  C CA    . TYR A 86  ? 0.1712 0.1749 0.1801 0.0072  -0.0131 -0.0135 271  TYR A CA    
615  C C     . TYR A 86  ? 0.1685 0.1736 0.1735 0.0036  -0.0119 -0.0207 271  TYR A C     
616  O O     . TYR A 86  ? 0.1660 0.1741 0.1758 0.0012  -0.0177 -0.0313 271  TYR A O     
617  C CB    . TYR A 86  ? 0.1711 0.1789 0.1834 0.0068  -0.0142 -0.0104 271  TYR A CB    
618  C CG    . TYR A 86  ? 0.1675 0.1701 0.1680 0.0040  -0.0099 -0.0080 271  TYR A CG    
619  C CD1   . TYR A 86  ? 0.1622 0.1578 0.1648 -0.0004 -0.0051 -0.0069 271  TYR A CD1   
620  C CD2   . TYR A 86  ? 0.1724 0.1770 0.1773 0.0054  -0.0090 0.0023  271  TYR A CD2   
621  C CE1   . TYR A 86  ? 0.1738 0.1792 0.1621 0.0043  -0.0053 -0.0067 271  TYR A CE1   
622  C CE2   . TYR A 86  ? 0.1753 0.1659 0.1570 0.0049  -0.0046 -0.0090 271  TYR A CE2   
623  C CZ    . TYR A 86  ? 0.1829 0.1735 0.1726 -0.0010 -0.0095 -0.0026 271  TYR A CZ    
624  O OH    . TYR A 86  ? 0.2104 0.1706 0.1724 -0.0078 -0.0136 -0.0130 271  TYR A OH    
625  N N     . MET A 87  ? 0.1758 0.1759 0.1778 0.0053  -0.0120 -0.0186 272  MET A N     
626  C CA    . MET A 87  ? 0.1818 0.1696 0.1794 0.0036  -0.0111 -0.0263 272  MET A CA    
627  C C     . MET A 87  ? 0.1693 0.1594 0.1667 0.0018  -0.0046 -0.0219 272  MET A C     
628  O O     . MET A 87  ? 0.1749 0.1724 0.1911 0.0032  0.0025  -0.0220 272  MET A O     
629  C CB    . MET A 87  ? 0.1764 0.1616 0.1674 0.0054  -0.0079 -0.0221 272  MET A CB    
630  C CG    . MET A 87  ? 0.1961 0.1595 0.1899 0.0020  -0.0104 -0.0236 272  MET A CG    
631  S SD    . MET A 87  ? 0.2106 0.1816 0.2326 0.0011  -0.0240 -0.0521 272  MET A SD    
632  C CE    . MET A 87  ? 0.1807 0.1803 0.1877 -0.0148 -0.0107 -0.0323 272  MET A CE    
633  N N     . TYR A 88  ? 0.1593 0.1449 0.1424 0.0029  -0.0085 -0.0219 273  TYR A N     
634  C CA    . TYR A 88  ? 0.1535 0.1422 0.1336 -0.0038 0.0000  -0.0192 273  TYR A CA    
635  C C     . TYR A 88  ? 0.1494 0.1475 0.1365 -0.0078 -0.0037 -0.0196 273  TYR A C     
636  O O     . TYR A 88  ? 0.1478 0.1503 0.1413 -0.0127 0.0040  -0.0178 273  TYR A O     
637  C CB    . TYR A 88  ? 0.1481 0.1398 0.1235 0.0007  0.0026  -0.0128 273  TYR A CB    
638  C CG    . TYR A 88  ? 0.1437 0.1389 0.1199 -0.0094 0.0081  -0.0048 273  TYR A CG    
639  C CD1   . TYR A 88  ? 0.1472 0.1377 0.1067 -0.0062 0.0008  -0.0080 273  TYR A CD1   
640  C CD2   . TYR A 88  ? 0.1538 0.1169 0.1207 0.0050  0.0075  -0.0096 273  TYR A CD2   
641  C CE1   . TYR A 88  ? 0.1401 0.1278 0.1203 0.0009  0.0043  -0.0086 273  TYR A CE1   
642  C CE2   . TYR A 88  ? 0.1261 0.1257 0.1423 -0.0100 0.0097  -0.0068 273  TYR A CE2   
643  C CZ    . TYR A 88  ? 0.1326 0.1250 0.1118 0.0012  -0.0056 -0.0053 273  TYR A CZ    
644  O OH    . TYR A 88  ? 0.1665 0.1452 0.1191 -0.0126 0.0016  -0.0195 273  TYR A OH    
645  N N     . TYR A 89  ? 0.1490 0.1475 0.1193 -0.0102 -0.0082 -0.0128 274  TYR A N     
646  C CA    . TYR A 89  ? 0.1476 0.1576 0.1307 -0.0102 -0.0058 -0.0135 274  TYR A CA    
647  C C     . TYR A 89  ? 0.1539 0.1595 0.1394 -0.0085 -0.0120 -0.0116 274  TYR A C     
648  O O     . TYR A 89  ? 0.1536 0.1577 0.1488 -0.0172 -0.0142 -0.0129 274  TYR A O     
649  C CB    . TYR A 89  ? 0.1496 0.1629 0.1369 -0.0076 -0.0007 -0.0061 274  TYR A CB    
650  C CG    . TYR A 89  ? 0.1607 0.1629 0.1575 -0.0042 0.0086  -0.0113 274  TYR A CG    
651  C CD1   . TYR A 89  ? 0.1761 0.1581 0.1520 -0.0037 0.0143  -0.0083 274  TYR A CD1   
652  C CD2   . TYR A 89  ? 0.1776 0.1583 0.1734 -0.0040 0.0078  -0.0077 274  TYR A CD2   
653  C CE1   . TYR A 89  ? 0.1905 0.1757 0.1701 -0.0018 0.0198  0.0031  274  TYR A CE1   
654  C CE2   . TYR A 89  ? 0.1607 0.1704 0.1863 0.0068  0.0116  0.0039  274  TYR A CE2   
655  C CZ    . TYR A 89  ? 0.1807 0.1726 0.1919 0.0031  0.0133  0.0035  274  TYR A CZ    
656  O OH    . TYR A 89  ? 0.2245 0.1859 0.2363 0.0050  0.0253  -0.0017 274  TYR A OH    
657  N N     . PHE A 90  ? 0.1517 0.1573 0.1476 -0.0065 -0.0112 -0.0120 275  PHE A N     
658  C CA    . PHE A 90  ? 0.1550 0.1678 0.1394 -0.0064 -0.0092 -0.0032 275  PHE A CA    
659  C C     . PHE A 90  ? 0.1648 0.1770 0.1538 -0.0100 -0.0112 -0.0064 275  PHE A C     
660  O O     . PHE A 90  ? 0.1652 0.1779 0.1471 -0.0190 -0.0112 0.0017  275  PHE A O     
661  C CB    . PHE A 90  ? 0.1620 0.1623 0.1581 -0.0091 -0.0026 -0.0149 275  PHE A CB    
662  C CG    . PHE A 90  ? 0.1588 0.1474 0.1333 -0.0027 0.0005  -0.0067 275  PHE A CG    
663  C CD1   . PHE A 90  ? 0.1615 0.1554 0.1490 -0.0073 -0.0012 -0.0028 275  PHE A CD1   
664  C CD2   . PHE A 90  ? 0.1755 0.1502 0.1185 -0.0038 0.0051  -0.0096 275  PHE A CD2   
665  C CE1   . PHE A 90  ? 0.1658 0.1600 0.1542 -0.0030 -0.0024 -0.0034 275  PHE A CE1   
666  C CE2   . PHE A 90  ? 0.1576 0.1664 0.1388 -0.0040 -0.0137 -0.0175 275  PHE A CE2   
667  C CZ    . PHE A 90  ? 0.1497 0.1637 0.1527 0.0021  -0.0003 -0.0018 275  PHE A CZ    
668  N N     . GLN A 91  ? 0.1661 0.1922 0.1623 -0.0087 -0.0132 0.0002  276  GLN A N     
669  C CA    . GLN A 91  ? 0.1865 0.2073 0.1715 -0.0044 -0.0113 -0.0010 276  GLN A CA    
670  C C     . GLN A 91  ? 0.1915 0.2057 0.1780 -0.0025 -0.0102 -0.0028 276  GLN A C     
671  O O     . GLN A 91  ? 0.1996 0.2082 0.1826 0.0008  -0.0147 -0.0079 276  GLN A O     
672  C CB    . GLN A 91  ? 0.1923 0.2136 0.1726 -0.0068 -0.0119 0.0015  276  GLN A CB    
673  C CG    . GLN A 91  ? 0.2273 0.2578 0.2223 0.0073  0.0048  0.0002  276  GLN A CG    
674  C CD    . GLN A 91  ? 0.2645 0.2788 0.2485 0.0065  0.0052  0.0079  276  GLN A CD    
675  O OE1   . GLN A 91  ? 0.3403 0.3409 0.3032 -0.0021 -0.0078 -0.0048 276  GLN A OE1   
676  N NE2   . GLN A 91  ? 0.2308 0.2355 0.1784 0.0054  0.0009  0.0251  276  GLN A NE2   
677  N N     . TYR A 92  ? 0.1899 0.2014 0.1795 -0.0021 -0.0097 -0.0046 277  TYR A N     
678  C CA    . TYR A 92  ? 0.1989 0.2105 0.1877 -0.0004 -0.0049 -0.0032 277  TYR A CA    
679  C C     . TYR A 92  ? 0.1918 0.2087 0.1864 -0.0021 -0.0032 0.0009  277  TYR A C     
680  O O     . TYR A 92  ? 0.1910 0.2000 0.1622 -0.0034 -0.0032 -0.0058 277  TYR A O     
681  C CB    . TYR A 92  ? 0.2040 0.2234 0.1941 0.0008  -0.0038 -0.0029 277  TYR A CB    
682  C CG    . TYR A 92  ? 0.2088 0.2212 0.1935 0.0019  -0.0027 -0.0081 277  TYR A CG    
683  C CD1   . TYR A 92  ? 0.2020 0.2277 0.2045 0.0037  -0.0127 -0.0116 277  TYR A CD1   
684  C CD2   . TYR A 92  ? 0.2100 0.2264 0.1869 0.0000  0.0021  0.0018  277  TYR A CD2   
685  C CE1   . TYR A 92  ? 0.2066 0.2289 0.2103 0.0008  0.0013  -0.0076 277  TYR A CE1   
686  C CE2   . TYR A 92  ? 0.2150 0.2310 0.2110 -0.0021 0.0032  0.0028  277  TYR A CE2   
687  C CZ    . TYR A 92  ? 0.2122 0.2365 0.2144 0.0010  0.0029  -0.0048 277  TYR A CZ    
688  O OH    . TYR A 92  ? 0.2239 0.2585 0.2295 0.0049  0.0154  -0.0093 277  TYR A OH    
689  N N     . LEU A 93  ? 0.1997 0.2151 0.1901 0.0022  -0.0012 0.0030  278  LEU A N     
690  C CA    . LEU A 93  ? 0.2020 0.2172 0.1963 0.0001  -0.0016 0.0027  278  LEU A CA    
691  C C     . LEU A 93  ? 0.1920 0.2063 0.1904 0.0018  -0.0038 0.0056  278  LEU A C     
692  O O     . LEU A 93  ? 0.1859 0.2081 0.2022 -0.0022 -0.0036 0.0099  278  LEU A O     
693  C CB    . LEU A 93  ? 0.2098 0.2260 0.2106 -0.0010 -0.0007 0.0004  278  LEU A CB    
694  C CG    . LEU A 93  ? 0.2436 0.2500 0.2322 0.0028  0.0065  -0.0032 278  LEU A CG    
695  C CD1   . LEU A 93  ? 0.2464 0.2644 0.2646 0.0004  0.0032  -0.0051 278  LEU A CD1   
696  C CD2   . LEU A 93  ? 0.2784 0.2635 0.2679 0.0132  0.0065  0.0005  278  LEU A CD2   
697  N N     . SER A 94  ? 0.1878 0.2008 0.1817 0.0001  -0.0008 0.0080  279  SER A N     
698  C CA    . SER A 94  ? 0.1818 0.1993 0.1790 -0.0009 0.0005  0.0067  279  SER A CA    
699  C C     . SER A 94  ? 0.1611 0.1919 0.1624 -0.0041 -0.0037 0.0047  279  SER A C     
700  O O     . SER A 94  ? 0.1510 0.2042 0.1678 0.0021  -0.0013 0.0123  279  SER A O     
701  C CB    . SER A 94  ? 0.1850 0.2039 0.1836 0.0016  -0.0025 0.0078  279  SER A CB    
702  O OG    . SER A 94  ? 0.2430 0.2194 0.2273 0.0067  0.0105  0.0203  279  SER A OG    
703  N N     . LYS A 95  ? 0.1436 0.1808 0.1469 -0.0088 -0.0025 0.0061  280  LYS A N     
704  C CA    . LYS A 95  ? 0.1450 0.1787 0.1485 -0.0073 0.0005  0.0012  280  LYS A CA    
705  C C     . LYS A 95  ? 0.1350 0.1618 0.1348 -0.0070 0.0043  0.0042  280  LYS A C     
706  O O     . LYS A 95  ? 0.1164 0.1559 0.1390 -0.0092 0.0090  0.0076  280  LYS A O     
707  C CB    . LYS A 95  ? 0.1538 0.1736 0.1498 -0.0073 0.0029  0.0022  280  LYS A CB    
708  C CG    . LYS A 95  ? 0.1602 0.1931 0.1804 -0.0091 0.0016  -0.0046 280  LYS A CG    
709  C CD    . LYS A 95  ? 0.1724 0.2041 0.1999 -0.0140 0.0029  0.0030  280  LYS A CD    
710  C CE    . LYS A 95  ? 0.2309 0.2283 0.2549 -0.0023 0.0066  0.0060  280  LYS A CE    
711  N NZ    . LYS A 95  ? 0.2481 0.2617 0.2835 0.0054  0.0192  0.0032  280  LYS A NZ    
712  N N     . THR A 96  ? 0.1268 0.1609 0.1173 -0.0016 0.0066  0.0081  281  THR A N     
713  C CA    . THR A 96  ? 0.1330 0.1514 0.1189 -0.0032 0.0086  0.0045  281  THR A CA    
714  C C     . THR A 96  ? 0.1356 0.1576 0.1244 -0.0077 0.0127  -0.0013 281  THR A C     
715  O O     . THR A 96  ? 0.1550 0.1619 0.1262 -0.0053 0.0160  -0.0057 281  THR A O     
716  C CB    . THR A 96  ? 0.1323 0.1530 0.1172 -0.0011 0.0100  0.0046  281  THR A CB    
717  O OG1   . THR A 96  ? 0.1277 0.1339 0.1200 -0.0054 0.0150  0.0182  281  THR A OG1   
718  C CG2   . THR A 96  ? 0.1391 0.1476 0.1183 0.0109  0.0023  0.0129  281  THR A CG2   
719  N N     . TYR A 97  ? 0.1361 0.1629 0.1174 -0.0099 0.0037  -0.0047 282  TYR A N     
720  C CA    . TYR A 97  ? 0.1397 0.1682 0.1312 -0.0092 0.0037  -0.0035 282  TYR A CA    
721  C C     . TYR A 97  ? 0.1446 0.1658 0.1296 -0.0140 0.0018  -0.0086 282  TYR A C     
722  O O     . TYR A 97  ? 0.1342 0.1580 0.1142 -0.0252 0.0078  -0.0092 282  TYR A O     
723  C CB    . TYR A 97  ? 0.1594 0.1845 0.1583 -0.0018 0.0083  -0.0052 282  TYR A CB    
724  C CG    . TYR A 97  ? 0.1763 0.2024 0.1736 -0.0026 0.0021  0.0000  282  TYR A CG    
725  C CD1   . TYR A 97  ? 0.1956 0.2224 0.2132 -0.0021 -0.0064 0.0033  282  TYR A CD1   
726  C CD2   . TYR A 97  ? 0.1795 0.2039 0.1839 0.0068  0.0036  0.0048  282  TYR A CD2   
727  C CE1   . TYR A 97  ? 0.2082 0.2305 0.2126 -0.0031 -0.0103 0.0129  282  TYR A CE1   
728  C CE2   . TYR A 97  ? 0.1815 0.2112 0.2009 -0.0051 -0.0074 0.0056  282  TYR A CE2   
729  C CZ    . TYR A 97  ? 0.1918 0.2122 0.2024 -0.0068 -0.0082 0.0047  282  TYR A CZ    
730  O OH    . TYR A 97  ? 0.2232 0.2609 0.2493 -0.0046 -0.0144 0.0059  282  TYR A OH    
731  N N     . CYS A 98  ? 0.1532 0.1657 0.1272 -0.0179 0.0000  -0.0104 283  CYS A N     
732  C CA    . CYS A 98  ? 0.1609 0.1711 0.1325 -0.0132 -0.0002 -0.0066 283  CYS A CA    
733  C C     . CYS A 98  ? 0.1620 0.1639 0.1313 -0.0169 0.0043  -0.0107 283  CYS A C     
734  O O     . CYS A 98  ? 0.1769 0.1775 0.1390 -0.0263 0.0065  -0.0120 283  CYS A O     
735  C CB    . CYS A 98  ? 0.1689 0.1694 0.1470 -0.0125 0.0037  -0.0104 283  CYS A CB    
736  S SG    . CYS A 98  ? 0.1801 0.1803 0.1447 -0.0123 -0.0022 -0.0157 283  CYS A SG    
737  N N     . VAL A 99  ? 0.1612 0.1656 0.1222 -0.0118 -0.0010 -0.0077 284  VAL A N     
738  C CA    . VAL A 99  ? 0.1634 0.1663 0.1328 -0.0069 0.0042  -0.0057 284  VAL A CA    
739  C C     . VAL A 99  ? 0.1687 0.1663 0.1341 -0.0063 0.0027  -0.0084 284  VAL A C     
740  O O     . VAL A 99  ? 0.1756 0.1782 0.1475 -0.0090 0.0034  -0.0070 284  VAL A O     
741  C CB    . VAL A 99  ? 0.1598 0.1587 0.1274 -0.0093 0.0033  -0.0071 284  VAL A CB    
742  C CG1   . VAL A 99  ? 0.1685 0.1613 0.1330 -0.0126 0.0067  -0.0029 284  VAL A CG1   
743  C CG2   . VAL A 99  ? 0.1726 0.1686 0.1467 -0.0003 0.0073  -0.0052 284  VAL A CG2   
744  N N     . ASP A 100 ? 0.1787 0.1690 0.1483 -0.0026 -0.0002 -0.0077 285  ASP A N     
745  C CA    . ASP A 100 ? 0.1873 0.1722 0.1580 0.0000  0.0001  -0.0107 285  ASP A CA    
746  C C     . ASP A 100 ? 0.1835 0.1718 0.1536 -0.0022 -0.0055 -0.0131 285  ASP A C     
747  O O     . ASP A 100 ? 0.1829 0.1706 0.1513 -0.0034 -0.0069 -0.0226 285  ASP A O     
748  C CB    . ASP A 100 ? 0.1929 0.1809 0.1714 -0.0021 0.0019  -0.0146 285  ASP A CB    
749  C CG    . ASP A 100 ? 0.2097 0.2043 0.1947 0.0008  -0.0075 -0.0065 285  ASP A CG    
750  O OD1   . ASP A 100 ? 0.2249 0.2147 0.2163 0.0069  -0.0197 -0.0129 285  ASP A OD1   
751  O OD2   . ASP A 100 ? 0.2284 0.2208 0.2407 -0.0055 -0.0229 -0.0144 285  ASP A OD2   
752  N N     . ALA A 101 ? 0.1822 0.1595 0.1537 -0.0043 -0.0058 -0.0167 286  ALA A N     
753  C CA    . ALA A 101 ? 0.1918 0.1601 0.1595 -0.0005 -0.0070 -0.0144 286  ALA A CA    
754  C C     . ALA A 101 ? 0.2004 0.1622 0.1682 0.0000  -0.0083 -0.0105 286  ALA A C     
755  O O     . ALA A 101 ? 0.2026 0.1650 0.1705 -0.0033 -0.0116 -0.0181 286  ALA A O     
756  C CB    . ALA A 101 ? 0.1922 0.1450 0.1482 -0.0042 -0.0088 -0.0111 286  ALA A CB    
757  N N     . THR A 102 ? 0.2106 0.1773 0.1906 0.0036  -0.0060 -0.0112 287  THR A N     
758  C CA    . THR A 102 ? 0.2192 0.1947 0.2085 0.0042  -0.0085 -0.0103 287  THR A CA    
759  C C     . THR A 102 ? 0.2295 0.2042 0.2204 0.0025  -0.0068 -0.0081 287  THR A C     
760  O O     . THR A 102 ? 0.2383 0.2034 0.2272 0.0059  -0.0107 -0.0071 287  THR A O     
761  C CB    . THR A 102 ? 0.2174 0.1972 0.2142 0.0046  -0.0073 -0.0117 287  THR A CB    
762  O OG1   . THR A 102 ? 0.2214 0.2034 0.2018 0.0093  -0.0161 -0.0176 287  THR A OG1   
763  C CG2   . THR A 102 ? 0.2156 0.1984 0.2101 0.0067  -0.0158 -0.0081 287  THR A CG2   
764  N N     . ARG A 103 ? 0.2399 0.2185 0.2361 -0.0006 -0.0040 -0.0039 288  ARG A N     
765  C CA    . ARG A 103 ? 0.2522 0.2357 0.2446 -0.0030 -0.0019 -0.0015 288  ARG A CA    
766  C C     . ARG A 103 ? 0.2422 0.2234 0.2338 0.0000  -0.0029 0.0033  288  ARG A C     
767  O O     . ARG A 103 ? 0.2379 0.2119 0.2254 0.0022  -0.0052 0.0053  288  ARG A O     
768  C CB    . ARG A 103 ? 0.2531 0.2406 0.2520 -0.0049 -0.0006 -0.0015 288  ARG A CB    
769  C CG    . ARG A 103 ? 0.2677 0.2610 0.2652 -0.0034 0.0016  0.0020  288  ARG A CG    
770  C CD    . ARG A 103 ? 0.2715 0.2684 0.2766 -0.0073 -0.0027 -0.0040 288  ARG A CD    
771  N NE    . ARG A 103 ? 0.3070 0.3045 0.3291 0.0044  0.0008  0.0000  288  ARG A NE    
772  C CZ    . ARG A 103 ? 0.3335 0.3319 0.3403 -0.0003 0.0035  -0.0016 288  ARG A CZ    
773  N NH1   . ARG A 103 ? 0.3477 0.3359 0.3468 -0.0078 -0.0012 -0.0005 288  ARG A NH1   
774  N NH2   . ARG A 103 ? 0.3506 0.3480 0.3628 0.0046  0.0007  0.0001  288  ARG A NH2   
775  N N     . GLU A 104 ? 0.2365 0.2091 0.2291 -0.0015 -0.0023 0.0111  289  GLU A N     
776  C CA    . GLU A 104 ? 0.2248 0.2045 0.2206 0.0019  -0.0048 0.0121  289  GLU A CA    
777  C C     . GLU A 104 ? 0.2203 0.1974 0.2186 -0.0003 -0.0036 0.0141  289  GLU A C     
778  O O     . GLU A 104 ? 0.2251 0.2097 0.2448 -0.0011 0.0011  0.0118  289  GLU A O     
779  C CB    . GLU A 104 ? 0.2278 0.1962 0.2217 0.0053  -0.0036 0.0159  289  GLU A CB    
780  C CG    . GLU A 104 ? 0.2279 0.2080 0.2338 -0.0037 -0.0040 0.0069  289  GLU A CG    
781  C CD    . GLU A 104 ? 0.2150 0.2100 0.2258 0.0001  -0.0079 0.0006  289  GLU A CD    
782  O OE1   . GLU A 104 ? 0.1698 0.1864 0.1993 0.0062  -0.0271 0.0042  289  GLU A OE1   
783  O OE2   . GLU A 104 ? 0.2137 0.2133 0.2265 0.0018  -0.0257 0.0074  289  GLU A OE2   
784  N N     . THR A 105 ? 0.2124 0.1921 0.2046 0.0016  -0.0015 0.0207  290  THR A N     
785  C CA    . THR A 105 ? 0.1970 0.1810 0.1823 -0.0010 -0.0071 0.0225  290  THR A CA    
786  C C     . THR A 105 ? 0.1968 0.1807 0.1768 0.0012  -0.0041 0.0252  290  THR A C     
787  O O     . THR A 105 ? 0.1898 0.1817 0.1731 -0.0017 0.0000  0.0189  290  THR A O     
788  C CB    . THR A 105 ? 0.2050 0.1850 0.1793 -0.0019 -0.0120 0.0199  290  THR A CB    
789  O OG1   . THR A 105 ? 0.1970 0.1737 0.1985 -0.0169 -0.0095 0.0056  290  THR A OG1   
790  C CG2   . THR A 105 ? 0.1938 0.1739 0.1902 -0.0102 -0.0050 0.0149  290  THR A CG2   
791  N N     . ASN A 106 ? 0.1862 0.1747 0.1685 0.0021  -0.0049 0.0222  291  ASN A N     
792  C CA    . ASN A 106 ? 0.1829 0.1834 0.1695 -0.0031 -0.0034 0.0160  291  ASN A CA    
793  C C     . ASN A 106 ? 0.1740 0.1725 0.1579 -0.0053 -0.0040 0.0114  291  ASN A C     
794  O O     . ASN A 106 ? 0.1821 0.1781 0.1531 -0.0034 -0.0055 0.0112  291  ASN A O     
795  C CB    . ASN A 106 ? 0.1883 0.1979 0.1761 -0.0027 0.0025  0.0134  291  ASN A CB    
796  C CG    . ASN A 106 ? 0.2109 0.2203 0.2201 0.0013  -0.0025 0.0155  291  ASN A CG    
797  O OD1   . ASN A 106 ? 0.2316 0.2398 0.2664 -0.0138 0.0073  0.0145  291  ASN A OD1   
798  N ND2   . ASN A 106 ? 0.2300 0.2575 0.2562 0.0078  -0.0005 0.0157  291  ASN A ND2   
799  N N     . ARG A 107 ? 0.1602 0.1628 0.1516 -0.0078 -0.0062 0.0119  292  ARG A N     
800  C CA    . ARG A 107 ? 0.1531 0.1555 0.1526 -0.0077 -0.0030 0.0106  292  ARG A CA    
801  C C     . ARG A 107 ? 0.1466 0.1446 0.1490 -0.0038 -0.0017 0.0077  292  ARG A C     
802  O O     . ARG A 107 ? 0.1540 0.1327 0.1575 -0.0062 0.0048  0.0118  292  ARG A O     
803  C CB    . ARG A 107 ? 0.1580 0.1648 0.1539 -0.0084 -0.0043 0.0069  292  ARG A CB    
804  C CG    . ARG A 107 ? 0.1486 0.1832 0.1622 -0.0021 -0.0015 0.0178  292  ARG A CG    
805  C CD    . ARG A 107 ? 0.1822 0.2122 0.1809 -0.0027 0.0046  0.0053  292  ARG A CD    
806  N NE    . ARG A 107 ? 0.1772 0.2304 0.1956 -0.0018 -0.0037 0.0155  292  ARG A NE    
807  C CZ    . ARG A 107 ? 0.1748 0.2236 0.1741 -0.0009 0.0003  0.0081  292  ARG A CZ    
808  N NH1   . ARG A 107 ? 0.2051 0.2081 0.1795 -0.0055 0.0113  0.0052  292  ARG A NH1   
809  N NH2   . ARG A 107 ? 0.1768 0.2079 0.1810 -0.0056 0.0085  -0.0039 292  ARG A NH2   
810  N N     . LEU A 108 ? 0.1418 0.1329 0.1323 -0.0028 0.0040  0.0041  293  LEU A N     
811  C CA    . LEU A 108 ? 0.1433 0.1363 0.1357 -0.0010 0.0082  -0.0012 293  LEU A CA    
812  C C     . LEU A 108 ? 0.1288 0.1305 0.1278 -0.0017 0.0041  -0.0001 293  LEU A C     
813  O O     . LEU A 108 ? 0.1145 0.1261 0.1301 -0.0031 0.0116  -0.0031 293  LEU A O     
814  C CB    . LEU A 108 ? 0.1563 0.1365 0.1372 -0.0042 0.0107  -0.0051 293  LEU A CB    
815  C CG    . LEU A 108 ? 0.1755 0.1629 0.1363 0.0032  0.0117  -0.0100 293  LEU A CG    
816  C CD1   . LEU A 108 ? 0.2081 0.1616 0.1604 -0.0071 0.0216  -0.0209 293  LEU A CD1   
817  C CD2   . LEU A 108 ? 0.1821 0.2001 0.1558 0.0077  0.0067  -0.0066 293  LEU A CD2   
818  N N     . GLY A 109 ? 0.1238 0.1334 0.1294 0.0056  0.0087  0.0045  294  GLY A N     
819  C CA    . GLY A 109 ? 0.1177 0.1284 0.1204 0.0064  0.0019  0.0042  294  GLY A CA    
820  C C     . GLY A 109 ? 0.1135 0.1246 0.1137 0.0006  0.0012  0.0023  294  GLY A C     
821  O O     . GLY A 109 ? 0.1225 0.1263 0.1249 -0.0053 -0.0016 0.0041  294  GLY A O     
822  N N     . ARG A 110 ? 0.1216 0.1274 0.1156 0.0013  0.0003  -0.0005 295  ARG A N     
823  C CA    . ARG A 110 ? 0.1258 0.1206 0.1215 -0.0024 -0.0026 -0.0009 295  ARG A CA    
824  C C     . ARG A 110 ? 0.1254 0.1227 0.1156 0.0024  -0.0003 0.0014  295  ARG A C     
825  O O     . ARG A 110 ? 0.1315 0.1309 0.1223 -0.0055 -0.0004 -0.0067 295  ARG A O     
826  C CB    . ARG A 110 ? 0.1311 0.1142 0.1202 0.0033  -0.0037 0.0035  295  ARG A CB    
827  C CG    . ARG A 110 ? 0.1324 0.1247 0.1172 -0.0073 -0.0001 0.0049  295  ARG A CG    
828  C CD    . ARG A 110 ? 0.1384 0.1255 0.1354 -0.0004 -0.0112 -0.0016 295  ARG A CD    
829  N NE    . ARG A 110 ? 0.1462 0.1285 0.1680 0.0050  -0.0212 -0.0016 295  ARG A NE    
830  C CZ    . ARG A 110 ? 0.1629 0.1268 0.1638 0.0059  -0.0114 0.0068  295  ARG A CZ    
831  N NH1   . ARG A 110 ? 0.1692 0.1226 0.1753 0.0092  0.0046  0.0047  295  ARG A NH1   
832  N NH2   . ARG A 110 ? 0.1680 0.1432 0.1784 0.0069  0.0059  0.0071  295  ARG A NH2   
833  N N     . LEU A 111 ? 0.1304 0.1245 0.1223 -0.0005 -0.0076 -0.0029 296  LEU A N     
834  C CA    . LEU A 111 ? 0.1265 0.1209 0.1142 -0.0014 0.0009  -0.0014 296  LEU A CA    
835  C C     . LEU A 111 ? 0.1227 0.1185 0.1142 0.0009  -0.0027 -0.0018 296  LEU A C     
836  O O     . LEU A 111 ? 0.1141 0.1155 0.1125 0.0038  -0.0052 -0.0082 296  LEU A O     
837  C CB    . LEU A 111 ? 0.1266 0.1213 0.1132 0.0002  -0.0028 0.0043  296  LEU A CB    
838  C CG    . LEU A 111 ? 0.1478 0.1303 0.1277 -0.0013 0.0032  -0.0019 296  LEU A CG    
839  C CD1   . LEU A 111 ? 0.1474 0.1289 0.1268 0.0048  0.0027  0.0053  296  LEU A CD1   
840  C CD2   . LEU A 111 ? 0.1499 0.1336 0.1477 -0.0040 0.0124  -0.0023 296  LEU A CD2   
841  N N     . ILE A 112 ? 0.1278 0.1154 0.1068 -0.0009 0.0035  0.0028  297  ILE A N     
842  C CA    . ILE A 112 ? 0.1278 0.1204 0.1163 0.0017  -0.0017 0.0089  297  ILE A CA    
843  C C     . ILE A 112 ? 0.1170 0.1177 0.1078 -0.0024 -0.0038 0.0016  297  ILE A C     
844  O O     . ILE A 112 ? 0.1103 0.1292 0.1104 -0.0075 -0.0138 -0.0036 297  ILE A O     
845  C CB    . ILE A 112 ? 0.1182 0.1138 0.1268 0.0005  -0.0013 0.0042  297  ILE A CB    
846  C CG1   . ILE A 112 ? 0.1350 0.1267 0.1231 0.0039  0.0047  0.0082  297  ILE A CG1   
847  C CG2   . ILE A 112 ? 0.1515 0.1083 0.1405 -0.0036 -0.0060 0.0190  297  ILE A CG2   
848  C CD1   . ILE A 112 ? 0.1469 0.1355 0.1369 0.0126  -0.0017 -0.0018 297  ILE A CD1   
849  N N     . ASN A 113 ? 0.1090 0.1177 0.1092 -0.0031 -0.0006 0.0056  298  ASN A N     
850  C CA    . ASN A 113 ? 0.1066 0.1112 0.0961 -0.0046 -0.0013 0.0093  298  ASN A CA    
851  C C     . ASN A 113 ? 0.1159 0.1123 0.1082 -0.0052 0.0002  0.0087  298  ASN A C     
852  O O     . ASN A 113 ? 0.1125 0.1147 0.1090 -0.0106 -0.0029 0.0052  298  ASN A O     
853  C CB    . ASN A 113 ? 0.1151 0.1167 0.1051 -0.0048 -0.0046 0.0024  298  ASN A CB    
854  C CG    . ASN A 113 ? 0.1025 0.1039 0.1057 -0.0062 0.0026  -0.0024 298  ASN A CG    
855  O OD1   . ASN A 113 ? 0.1415 0.0944 0.1009 -0.0026 -0.0106 -0.0022 298  ASN A OD1   
856  N ND2   . ASN A 113 ? 0.1154 0.1401 0.0972 0.0246  -0.0243 0.0091  298  ASN A ND2   
857  N N     . HIS A 114 ? 0.1162 0.1236 0.0944 -0.0066 0.0049  0.0110  299  HIS A N     
858  C CA    . HIS A 114 ? 0.1265 0.1146 0.1093 -0.0087 0.0082  0.0095  299  HIS A CA    
859  C C     . HIS A 114 ? 0.1331 0.1201 0.1094 -0.0082 0.0100  0.0054  299  HIS A C     
860  O O     . HIS A 114 ? 0.1327 0.1243 0.1215 -0.0123 0.0032  0.0130  299  HIS A O     
861  C CB    . HIS A 114 ? 0.1336 0.1347 0.1164 -0.0010 0.0084  0.0082  299  HIS A CB    
862  C CG    . HIS A 114 ? 0.1289 0.1195 0.1091 -0.0082 0.0106  -0.0020 299  HIS A CG    
863  N ND1   . HIS A 114 ? 0.1130 0.1215 0.1227 -0.0002 0.0100  -0.0108 299  HIS A ND1   
864  C CD2   . HIS A 114 ? 0.1150 0.1201 0.0917 -0.0011 0.0149  0.0009  299  HIS A CD2   
865  C CE1   . HIS A 114 ? 0.1509 0.1349 0.1174 0.0026  0.0119  -0.0114 299  HIS A CE1   
866  N NE2   . HIS A 114 ? 0.1513 0.1364 0.1014 0.0087  0.0141  -0.0013 299  HIS A NE2   
867  N N     . SER A 115 ? 0.1360 0.1239 0.1075 -0.0031 0.0041  0.0059  300  SER A N     
868  C CA    . SER A 115 ? 0.1502 0.1263 0.1209 -0.0070 0.0000  0.0045  300  SER A CA    
869  C C     . SER A 115 ? 0.1582 0.1379 0.1218 -0.0055 0.0054  0.0048  300  SER A C     
870  O O     . SER A 115 ? 0.1653 0.1436 0.1238 0.0017  0.0030  0.0153  300  SER A O     
871  C CB    . SER A 115 ? 0.1566 0.1235 0.1300 -0.0148 0.0064  0.0002  300  SER A CB    
872  O OG    . SER A 115 ? 0.1829 0.1176 0.1458 -0.0316 0.0029  -0.0040 300  SER A OG    
873  N N     . LYS A 116 ? 0.1723 0.1583 0.1516 -0.0022 0.0101  0.0081  301  LYS A N     
874  C CA    . LYS A 116 ? 0.1884 0.1719 0.1616 0.0016  0.0124  0.0066  301  LYS A CA    
875  C C     . LYS A 116 ? 0.1924 0.1827 0.1733 0.0097  0.0192  0.0073  301  LYS A C     
876  O O     . LYS A 116 ? 0.2183 0.1976 0.1762 0.0192  0.0189  0.0092  301  LYS A O     
877  C CB    . LYS A 116 ? 0.2003 0.1840 0.1751 0.0048  0.0178  0.0069  301  LYS A CB    
878  C CG    . LYS A 116 ? 0.2105 0.2060 0.1965 0.0033  0.0048  -0.0019 301  LYS A CG    
879  C CD    . LYS A 116 ? 0.2382 0.2573 0.2235 0.0016  0.0102  0.0062  301  LYS A CD    
880  C CE    . LYS A 116 ? 0.2935 0.2765 0.2850 0.0066  0.0023  -0.0058 301  LYS A CE    
881  N NZ    . LYS A 116 ? 0.3263 0.3304 0.3011 0.0008  -0.0128 -0.0031 301  LYS A NZ    
882  N N     . CYS A 117 ? 0.1817 0.1791 0.1784 -0.0030 0.0242  0.0086  302  CYS A N     
883  C CA    . CYS A 117 ? 0.1885 0.1948 0.1893 -0.0032 0.0282  0.0065  302  CYS A CA    
884  C C     . CYS A 117 ? 0.1842 0.1858 0.1814 -0.0020 0.0210  0.0053  302  CYS A C     
885  O O     . CYS A 117 ? 0.1816 0.1958 0.1864 -0.0070 0.0204  -0.0017 302  CYS A O     
886  C CB    . CYS A 117 ? 0.2050 0.1989 0.2113 -0.0076 0.0317  0.0029  302  CYS A CB    
887  S SG    A CYS A 117 ? 0.2380 0.2486 0.2645 -0.0280 0.0566  0.0094  302  CYS A SG    
888  S SG    B CYS A 117 ? 0.7628 0.7579 0.7565 0.0013  -0.0020 0.0001  302  CYS A SG    
889  N N     . GLY A 118 ? 0.1680 0.1736 0.1776 0.0001  0.0229  0.0097  303  GLY A N     
890  C CA    . GLY A 118 ? 0.1521 0.1580 0.1706 0.0007  0.0224  0.0056  303  GLY A CA    
891  C C     . GLY A 118 ? 0.1484 0.1528 0.1729 -0.0007 0.0128  0.0079  303  GLY A C     
892  O O     . GLY A 118 ? 0.1454 0.1571 0.2017 -0.0003 0.0173  0.0020  303  GLY A O     
893  N N     . ASN A 119 ? 0.1175 0.1372 0.1341 -0.0019 0.0040  -0.0010 304  ASN A N     
894  C CA    . ASN A 119 ? 0.1148 0.1246 0.1185 -0.0032 0.0028  -0.0057 304  ASN A CA    
895  C C     . ASN A 119 ? 0.1236 0.1259 0.1134 -0.0021 0.0030  -0.0060 304  ASN A C     
896  O O     . ASN A 119 ? 0.1285 0.1342 0.1148 0.0122  0.0092  -0.0109 304  ASN A O     
897  C CB    . ASN A 119 ? 0.1294 0.1183 0.1212 -0.0059 -0.0024 -0.0007 304  ASN A CB    
898  C CG    . ASN A 119 ? 0.1093 0.1108 0.1192 0.0040  -0.0039 -0.0009 304  ASN A CG    
899  O OD1   . ASN A 119 ? 0.1300 0.1043 0.1357 0.0009  -0.0081 -0.0080 304  ASN A OD1   
900  N ND2   . ASN A 119 ? 0.1336 0.1321 0.1069 -0.0053 -0.0057 -0.0037 304  ASN A ND2   
901  N N     . CYS A 120 ? 0.1293 0.1241 0.1054 -0.0078 0.0054  -0.0051 305  CYS A N     
902  C CA    . CYS A 120 ? 0.1404 0.1427 0.1179 -0.0053 0.0044  -0.0073 305  CYS A CA    
903  C C     . CYS A 120 ? 0.1380 0.1388 0.1147 -0.0079 0.0016  -0.0067 305  CYS A C     
904  O O     . CYS A 120 ? 0.1418 0.1376 0.1227 0.0025  0.0029  -0.0038 305  CYS A O     
905  C CB    . CYS A 120 ? 0.1400 0.1475 0.1218 -0.0111 0.0019  -0.0062 305  CYS A CB    
906  S SG    . CYS A 120 ? 0.1516 0.1695 0.1308 -0.0100 0.0149  -0.0111 305  CYS A SG    
907  N N     . GLN A 121 ? 0.1523 0.1654 0.1295 -0.0043 0.0014  -0.0093 306  GLN A N     
908  C CA    . GLN A 121 ? 0.1666 0.1684 0.1363 -0.0101 -0.0047 -0.0123 306  GLN A CA    
909  C C     . GLN A 121 ? 0.1609 0.1558 0.1384 -0.0078 -0.0015 -0.0050 306  GLN A C     
910  O O     . GLN A 121 ? 0.1668 0.1510 0.1464 -0.0003 -0.0028 -0.0108 306  GLN A O     
911  C CB    . GLN A 121 ? 0.1916 0.1851 0.1582 -0.0106 -0.0050 -0.0077 306  GLN A CB    
912  C CG    . GLN A 121 ? 0.2571 0.2496 0.2046 -0.0098 -0.0028 -0.0045 306  GLN A CG    
913  C CD    . GLN A 121 ? 0.3010 0.3191 0.3067 0.0024  0.0073  -0.0086 306  GLN A CD    
914  O OE1   . GLN A 121 ? 0.3301 0.3649 0.3342 -0.0047 0.0143  0.0024  306  GLN A OE1   
915  N NE2   . GLN A 121 ? 0.3271 0.3300 0.3292 -0.0081 0.0006  0.0032  306  GLN A NE2   
916  N N     . THR A 122 ? 0.1625 0.1496 0.1353 -0.0077 -0.0043 -0.0084 307  THR A N     
917  C CA    . THR A 122 ? 0.1562 0.1449 0.1395 0.0001  -0.0161 -0.0061 307  THR A CA    
918  C C     . THR A 122 ? 0.1678 0.1482 0.1415 -0.0034 -0.0151 -0.0026 307  THR A C     
919  O O     . THR A 122 ? 0.1740 0.1604 0.1490 -0.0100 -0.0095 -0.0084 307  THR A O     
920  C CB    . THR A 122 ? 0.1565 0.1454 0.1465 0.0026  -0.0164 -0.0137 307  THR A CB    
921  O OG1   . THR A 122 ? 0.1739 0.1757 0.1657 0.0047  -0.0312 -0.0224 307  THR A OG1   
922  C CG2   . THR A 122 ? 0.1441 0.1468 0.1671 0.0017  -0.0129 -0.0147 307  THR A CG2   
923  N N     . LYS A 123 ? 0.1605 0.1472 0.1414 -0.0009 -0.0159 -0.0012 308  LYS A N     
924  C CA    . LYS A 123 ? 0.1698 0.1624 0.1548 -0.0052 -0.0185 -0.0061 308  LYS A CA    
925  C C     . LYS A 123 ? 0.1575 0.1612 0.1440 -0.0063 -0.0137 -0.0020 308  LYS A C     
926  O O     . LYS A 123 ? 0.1662 0.1672 0.1316 -0.0010 -0.0162 -0.0060 308  LYS A O     
927  C CB    . LYS A 123 ? 0.1821 0.1682 0.1678 -0.0016 -0.0180 -0.0029 308  LYS A CB    
928  C CG    . LYS A 123 ? 0.2437 0.2220 0.2446 -0.0079 -0.0170 -0.0190 308  LYS A CG    
929  C CD    . LYS A 123 ? 0.3165 0.2859 0.2980 -0.0065 -0.0014 0.0031  308  LYS A CD    
930  C CE    . LYS A 123 ? 0.3545 0.3201 0.3534 -0.0093 -0.0029 -0.0117 308  LYS A CE    
931  N NZ    . LYS A 123 ? 0.3879 0.3759 0.3724 -0.0044 0.0042  0.0053  308  LYS A NZ    
932  N N     . LEU A 124 ? 0.1531 0.1714 0.1307 -0.0059 -0.0120 -0.0031 309  LEU A N     
933  C CA    . LEU A 124 ? 0.1599 0.1747 0.1458 -0.0020 -0.0093 -0.0030 309  LEU A CA    
934  C C     . LEU A 124 ? 0.1581 0.1703 0.1490 0.0000  -0.0061 -0.0025 309  LEU A C     
935  O O     . LEU A 124 ? 0.1603 0.1833 0.1804 0.0036  -0.0007 -0.0012 309  LEU A O     
936  C CB    . LEU A 124 ? 0.1793 0.1915 0.1562 -0.0018 -0.0046 -0.0073 309  LEU A CB    
937  C CG    . LEU A 124 ? 0.2137 0.2241 0.2052 -0.0058 -0.0116 -0.0110 309  LEU A CG    
938  C CD1   . LEU A 124 ? 0.2456 0.2587 0.2418 0.0098  0.0025  -0.0012 309  LEU A CD1   
939  C CD2   . LEU A 124 ? 0.2493 0.2354 0.2289 -0.0061 0.0012  -0.0068 309  LEU A CD2   
940  N N     . HIS A 125 ? 0.1537 0.1687 0.1585 0.0053  -0.0017 -0.0036 310  HIS A N     
941  C CA    . HIS A 125 ? 0.1592 0.1725 0.1628 0.0048  -0.0028 0.0020  310  HIS A CA    
942  C C     . HIS A 125 ? 0.1555 0.1776 0.1685 0.0043  -0.0022 0.0007  310  HIS A C     
943  O O     . HIS A 125 ? 0.1550 0.1823 0.1886 0.0091  -0.0043 0.0028  310  HIS A O     
944  C CB    . HIS A 125 ? 0.1622 0.1725 0.1589 0.0067  0.0014  -0.0028 310  HIS A CB    
945  C CG    . HIS A 125 ? 0.1665 0.1696 0.1704 0.0096  -0.0042 -0.0003 310  HIS A CG    
946  N ND1   . HIS A 125 ? 0.1887 0.1835 0.1744 0.0144  -0.0007 -0.0003 310  HIS A ND1   
947  C CD2   . HIS A 125 ? 0.1769 0.1858 0.1797 0.0168  -0.0017 -0.0081 310  HIS A CD2   
948  C CE1   . HIS A 125 ? 0.1772 0.1825 0.1921 0.0172  -0.0015 -0.0026 310  HIS A CE1   
949  N NE2   . HIS A 125 ? 0.1628 0.1883 0.1556 0.0151  -0.0102 -0.0087 310  HIS A NE2   
950  N N     . ASP A 126 ? 0.1636 0.1873 0.1701 -0.0009 -0.0052 0.0005  311  ASP A N     
951  C CA    . ASP A 126 ? 0.1730 0.2037 0.1741 -0.0016 -0.0014 -0.0012 311  ASP A CA    
952  C C     . ASP A 126 ? 0.1687 0.1957 0.1733 0.0005  -0.0032 -0.0015 311  ASP A C     
953  O O     . ASP A 126 ? 0.1845 0.1980 0.1924 0.0040  0.0064  0.0014  311  ASP A O     
954  C CB    . ASP A 126 ? 0.1951 0.2138 0.1760 -0.0021 0.0008  -0.0017 311  ASP A CB    
955  C CG    . ASP A 126 ? 0.2193 0.2399 0.2092 -0.0041 -0.0002 -0.0031 311  ASP A CG    
956  O OD1   . ASP A 126 ? 0.2738 0.2712 0.2206 0.0051  0.0085  -0.0039 311  ASP A OD1   
957  O OD2   . ASP A 126 ? 0.2421 0.2551 0.2415 -0.0237 0.0068  -0.0093 311  ASP A OD2   
958  N N     . ILE A 127 ? 0.1508 0.1909 0.1635 -0.0035 -0.0067 -0.0035 312  ILE A N     
959  C CA    . ILE A 127 ? 0.1612 0.1906 0.1661 -0.0034 -0.0002 -0.0026 312  ILE A CA    
960  C C     . ILE A 127 ? 0.1717 0.1998 0.1732 -0.0033 -0.0009 -0.0014 312  ILE A C     
961  O O     . ILE A 127 ? 0.1714 0.1976 0.1673 -0.0043 -0.0077 -0.0045 312  ILE A O     
962  C CB    . ILE A 127 ? 0.1494 0.1924 0.1647 -0.0076 -0.0002 -0.0067 312  ILE A CB    
963  C CG1   . ILE A 127 ? 0.1613 0.1965 0.1549 -0.0048 -0.0034 -0.0078 312  ILE A CG1   
964  C CG2   . ILE A 127 ? 0.1531 0.1872 0.1741 -0.0098 0.0078  -0.0018 312  ILE A CG2   
965  C CD1   . ILE A 127 ? 0.1796 0.1854 0.1584 -0.0001 -0.0037 -0.0033 312  ILE A CD1   
966  N N     . ASP A 128 ? 0.1704 0.2059 0.1813 -0.0006 -0.0066 -0.0016 313  ASP A N     
967  C CA    . ASP A 128 ? 0.2007 0.2214 0.2009 -0.0010 -0.0042 -0.0037 313  ASP A CA    
968  C C     . ASP A 128 ? 0.2035 0.2170 0.2015 0.0000  -0.0059 -0.0034 313  ASP A C     
969  O O     . ASP A 128 ? 0.2228 0.2315 0.2089 -0.0035 -0.0058 -0.0025 313  ASP A O     
970  C CB    . ASP A 128 ? 0.2107 0.2325 0.2119 0.0003  -0.0013 -0.0037 313  ASP A CB    
971  C CG    . ASP A 128 ? 0.2303 0.2645 0.2425 0.0088  0.0067  -0.0009 313  ASP A CG    
972  O OD1   . ASP A 128 ? 0.2372 0.3018 0.2536 -0.0017 0.0048  -0.0118 313  ASP A OD1   
973  O OD2   . ASP A 128 ? 0.2445 0.3014 0.2654 0.0190  0.0045  0.0055  313  ASP A OD2   
974  N N     . GLY A 129 ? 0.1993 0.2147 0.2019 0.0024  -0.0073 -0.0060 314  GLY A N     
975  C CA    . GLY A 129 ? 0.2035 0.2150 0.2090 0.0042  -0.0074 -0.0065 314  GLY A CA    
976  C C     . GLY A 129 ? 0.2050 0.2134 0.2060 0.0052  -0.0091 -0.0076 314  GLY A C     
977  O O     . GLY A 129 ? 0.2142 0.2310 0.2192 0.0107  -0.0068 -0.0112 314  GLY A O     
978  N N     . VAL A 130 ? 0.1908 0.2028 0.1989 0.0039  -0.0112 -0.0037 315  VAL A N     
979  C CA    . VAL A 130 ? 0.1840 0.1966 0.1973 -0.0054 -0.0137 -0.0059 315  VAL A CA    
980  C C     . VAL A 130 ? 0.1767 0.1851 0.1833 -0.0038 -0.0120 -0.0053 315  VAL A C     
981  O O     . VAL A 130 ? 0.1814 0.1893 0.1871 0.0027  -0.0112 -0.0051 315  VAL A O     
982  C CB    . VAL A 130 ? 0.1785 0.1971 0.1977 -0.0064 -0.0145 -0.0040 315  VAL A CB    
983  C CG1   . VAL A 130 ? 0.2016 0.1928 0.2117 -0.0035 -0.0115 0.0063  315  VAL A CG1   
984  C CG2   . VAL A 130 ? 0.1894 0.2044 0.2166 -0.0083 -0.0108 -0.0097 315  VAL A CG2   
985  N N     . PRO A 131 ? 0.1769 0.1831 0.1809 -0.0038 -0.0125 -0.0066 316  PRO A N     
986  C CA    . PRO A 131 ? 0.1689 0.1744 0.1690 -0.0032 -0.0140 -0.0029 316  PRO A CA    
987  C C     . PRO A 131 ? 0.1736 0.1692 0.1639 -0.0019 -0.0088 -0.0013 316  PRO A C     
988  O O     . PRO A 131 ? 0.1799 0.1609 0.1774 -0.0019 -0.0050 -0.0093 316  PRO A O     
989  C CB    . PRO A 131 ? 0.1813 0.1795 0.1845 -0.0003 -0.0065 -0.0019 316  PRO A CB    
990  C CG    . PRO A 131 ? 0.1865 0.1819 0.1972 -0.0013 -0.0076 -0.0050 316  PRO A CG    
991  C CD    . PRO A 131 ? 0.1789 0.1797 0.1827 -0.0014 -0.0115 -0.0046 316  PRO A CD    
992  N N     . HIS A 132 ? 0.1481 0.1545 0.1416 -0.0090 -0.0139 -0.0017 317  HIS A N     
993  C CA    . HIS A 132 ? 0.1477 0.1573 0.1490 -0.0060 -0.0097 0.0001  317  HIS A CA    
994  C C     . HIS A 132 ? 0.1462 0.1512 0.1481 -0.0054 -0.0048 0.0026  317  HIS A C     
995  O O     . HIS A 132 ? 0.1598 0.1629 0.1569 -0.0012 -0.0048 0.0140  317  HIS A O     
996  C CB    . HIS A 132 ? 0.1515 0.1607 0.1580 -0.0040 -0.0074 -0.0021 317  HIS A CB    
997  C CG    . HIS A 132 ? 0.1416 0.1623 0.1534 -0.0032 -0.0010 -0.0041 317  HIS A CG    
998  N ND1   . HIS A 132 ? 0.1524 0.1596 0.1607 -0.0101 -0.0147 -0.0063 317  HIS A ND1   
999  C CD2   . HIS A 132 ? 0.1482 0.1687 0.1743 -0.0010 -0.0096 0.0006  317  HIS A CD2   
1000 C CE1   . HIS A 132 ? 0.1433 0.1894 0.1854 -0.0019 -0.0031 0.0035  317  HIS A CE1   
1001 N NE2   . HIS A 132 ? 0.1543 0.1811 0.1787 -0.0027 -0.0013 -0.0043 317  HIS A NE2   
1002 N N     . LEU A 133 ? 0.1410 0.1469 0.1475 -0.0053 -0.0029 -0.0016 318  LEU A N     
1003 C CA    . LEU A 133 ? 0.1407 0.1390 0.1371 -0.0034 -0.0028 -0.0051 318  LEU A CA    
1004 C C     . LEU A 133 ? 0.1503 0.1387 0.1361 -0.0044 -0.0059 -0.0003 318  LEU A C     
1005 O O     . LEU A 133 ? 0.1555 0.1386 0.1238 -0.0106 -0.0108 0.0081  318  LEU A O     
1006 C CB    . LEU A 133 ? 0.1360 0.1334 0.1370 -0.0023 -0.0049 -0.0095 318  LEU A CB    
1007 C CG    . LEU A 133 ? 0.1603 0.1604 0.1365 0.0112  0.0039  -0.0014 318  LEU A CG    
1008 C CD1   . LEU A 133 ? 0.1606 0.1615 0.1467 0.0192  0.0000  -0.0138 318  LEU A CD1   
1009 C CD2   . LEU A 133 ? 0.1790 0.1652 0.1172 0.0011  0.0095  0.0000  318  LEU A CD2   
1010 N N     . ILE A 134 ? 0.1410 0.1343 0.1305 -0.0084 -0.0082 -0.0037 319  ILE A N     
1011 C CA    . ILE A 134 ? 0.1466 0.1517 0.1412 -0.0044 -0.0040 -0.0056 319  ILE A CA    
1012 C C     . ILE A 134 ? 0.1420 0.1416 0.1272 -0.0036 -0.0083 -0.0023 319  ILE A C     
1013 O O     . ILE A 134 ? 0.1494 0.1585 0.1226 -0.0158 -0.0108 -0.0023 319  ILE A O     
1014 C CB    . ILE A 134 ? 0.1423 0.1485 0.1466 -0.0038 -0.0078 -0.0022 319  ILE A CB    
1015 C CG1   . ILE A 134 ? 0.1435 0.1666 0.1481 -0.0002 -0.0057 0.0103  319  ILE A CG1   
1016 C CG2   . ILE A 134 ? 0.1492 0.1570 0.1627 -0.0174 -0.0054 -0.0161 319  ILE A CG2   
1017 C CD1   . ILE A 134 ? 0.1690 0.1818 0.1676 0.0091  0.0046  -0.0072 319  ILE A CD1   
1018 N N     . LEU A 135 ? 0.1291 0.1302 0.1174 -0.0038 -0.0142 -0.0143 320  LEU A N     
1019 C CA    . LEU A 135 ? 0.1353 0.1290 0.1239 -0.0016 -0.0118 -0.0086 320  LEU A CA    
1020 C C     . LEU A 135 ? 0.1366 0.1368 0.1250 -0.0008 -0.0103 -0.0088 320  LEU A C     
1021 O O     . LEU A 135 ? 0.1468 0.1463 0.1275 0.0040  0.0001  -0.0112 320  LEU A O     
1022 C CB    . LEU A 135 ? 0.1425 0.1381 0.1368 -0.0018 -0.0093 -0.0003 320  LEU A CB    
1023 C CG    . LEU A 135 ? 0.1562 0.1558 0.1399 0.0094  -0.0112 -0.0011 320  LEU A CG    
1024 C CD1   . LEU A 135 ? 0.1964 0.1800 0.1560 0.0095  -0.0021 -0.0150 320  LEU A CD1   
1025 C CD2   . LEU A 135 ? 0.1822 0.1864 0.1611 0.0152  -0.0147 0.0119  320  LEU A CD2   
1026 N N     . ILE A 136 ? 0.1446 0.1320 0.1397 -0.0055 -0.0111 -0.0129 321  ILE A N     
1027 C CA    . ILE A 136 ? 0.1570 0.1558 0.1615 -0.0018 -0.0110 -0.0110 321  ILE A CA    
1028 C C     . ILE A 136 ? 0.1447 0.1454 0.1495 -0.0048 -0.0055 -0.0062 321  ILE A C     
1029 O O     . ILE A 136 ? 0.1473 0.1580 0.1509 -0.0044 -0.0048 -0.0132 321  ILE A O     
1030 C CB    . ILE A 136 ? 0.1677 0.1552 0.1680 -0.0021 -0.0192 -0.0124 321  ILE A CB    
1031 C CG1   . ILE A 136 ? 0.1685 0.1900 0.1961 -0.0065 -0.0214 -0.0067 321  ILE A CG1   
1032 C CG2   . ILE A 136 ? 0.1955 0.1742 0.1885 0.0000  -0.0110 -0.0109 321  ILE A CG2   
1033 C CD1   . ILE A 136 ? 0.2078 0.2024 0.2015 0.0001  -0.0040 -0.0027 321  ILE A CD1   
1034 N N     . ALA A 137 ? 0.1315 0.1435 0.1352 -0.0117 -0.0076 -0.0047 322  ALA A N     
1035 C CA    . ALA A 137 ? 0.1368 0.1333 0.1156 -0.0112 -0.0086 -0.0095 322  ALA A CA    
1036 C C     . ALA A 137 ? 0.1285 0.1418 0.1163 -0.0044 -0.0030 -0.0045 322  ALA A C     
1037 O O     . ALA A 137 ? 0.1262 0.1400 0.1277 0.0040  -0.0004 0.0033  322  ALA A O     
1038 C CB    . ALA A 137 ? 0.1359 0.1463 0.1163 -0.0015 0.0032  -0.0100 322  ALA A CB    
1039 N N     . SER A 138 ? 0.1269 0.1371 0.1014 -0.0060 0.0018  -0.0002 323  SER A N     
1040 C CA    . SER A 138 ? 0.1414 0.1466 0.1199 -0.0044 0.0046  0.0020  323  SER A CA    
1041 C C     . SER A 138 ? 0.1416 0.1403 0.1154 -0.0017 0.0025  0.0051  323  SER A C     
1042 O O     . SER A 138 ? 0.1758 0.1443 0.1235 -0.0088 -0.0013 0.0136  323  SER A O     
1043 C CB    . SER A 138 ? 0.1453 0.1661 0.1321 0.0044  0.0079  -0.0009 323  SER A CB    
1044 O OG    . SER A 138 ? 0.1677 0.1813 0.1569 0.0057  0.0029  0.0028  323  SER A OG    
1045 N N     . ARG A 139 ? 0.1262 0.1430 0.1041 -0.0025 -0.0036 0.0028  324  ARG A N     
1046 C CA    . ARG A 139 ? 0.1238 0.1343 0.1108 -0.0068 0.0035  0.0038  324  ARG A CA    
1047 C C     . ARG A 139 ? 0.1252 0.1252 0.1021 -0.0008 -0.0014 0.0046  324  ARG A C     
1048 O O     . ARG A 139 ? 0.1355 0.1288 0.1048 -0.0091 -0.0042 0.0038  324  ARG A O     
1049 C CB    . ARG A 139 ? 0.1186 0.1350 0.1110 -0.0041 -0.0012 0.0094  324  ARG A CB    
1050 C CG    . ARG A 139 ? 0.1254 0.1357 0.1290 0.0028  0.0008  0.0075  324  ARG A CG    
1051 C CD    . ARG A 139 ? 0.1311 0.1507 0.1411 0.0000  -0.0065 0.0088  324  ARG A CD    
1052 N NE    . ARG A 139 ? 0.1348 0.1419 0.1446 -0.0034 -0.0033 0.0034  324  ARG A NE    
1053 C CZ    . ARG A 139 ? 0.1266 0.1259 0.1358 -0.0068 0.0036  -0.0028 324  ARG A CZ    
1054 N NH1   . ARG A 139 ? 0.1158 0.1396 0.1516 -0.0164 0.0106  0.0057  324  ARG A NH1   
1055 N NH2   . ARG A 139 ? 0.1443 0.1197 0.1396 0.0023  -0.0115 0.0097  324  ARG A NH2   
1056 N N     . ASP A 140 ? 0.1251 0.1272 0.1036 0.0022  -0.0012 0.0070  325  ASP A N     
1057 C CA    . ASP A 140 ? 0.1209 0.1238 0.1090 0.0052  -0.0057 -0.0006 325  ASP A CA    
1058 C C     . ASP A 140 ? 0.1151 0.1280 0.1132 0.0063  -0.0022 0.0034  325  ASP A C     
1059 O O     . ASP A 140 ? 0.1207 0.1402 0.1226 0.0044  0.0080  0.0129  325  ASP A O     
1060 C CB    . ASP A 140 ? 0.1150 0.1127 0.1029 0.0051  -0.0063 -0.0029 325  ASP A CB    
1061 C CG    . ASP A 140 ? 0.1222 0.1243 0.1130 0.0084  -0.0075 0.0044  325  ASP A CG    
1062 O OD1   . ASP A 140 ? 0.1059 0.1386 0.1568 -0.0100 -0.0090 0.0079  325  ASP A OD1   
1063 O OD2   . ASP A 140 ? 0.1407 0.1463 0.1574 0.0108  -0.0269 -0.0177 325  ASP A OD2   
1064 N N     . ILE A 141 ? 0.1117 0.1288 0.1125 0.0089  -0.0044 0.0087  326  ILE A N     
1065 C CA    . ILE A 141 ? 0.1179 0.1227 0.1097 0.0086  0.0010  0.0063  326  ILE A CA    
1066 C C     . ILE A 141 ? 0.1098 0.1272 0.1077 0.0060  -0.0011 0.0043  326  ILE A C     
1067 O O     . ILE A 141 ? 0.1122 0.1418 0.1205 0.0018  -0.0012 0.0063  326  ILE A O     
1068 C CB    . ILE A 141 ? 0.1207 0.1219 0.1069 0.0098  -0.0011 0.0035  326  ILE A CB    
1069 C CG1   . ILE A 141 ? 0.1410 0.1151 0.1151 0.0000  0.0032  -0.0060 326  ILE A CG1   
1070 C CG2   . ILE A 141 ? 0.1277 0.1296 0.1210 0.0151  0.0000  0.0032  326  ILE A CG2   
1071 C CD1   . ILE A 141 ? 0.1517 0.1251 0.1177 -0.0040 -0.0099 -0.0325 326  ILE A CD1   
1072 N N     . ALA A 142 ? 0.1090 0.1276 0.0962 0.0063  -0.0069 0.0052  327  ALA A N     
1073 C CA    . ALA A 142 ? 0.1039 0.1302 0.0981 0.0034  -0.0051 0.0039  327  ALA A CA    
1074 C C     . ALA A 142 ? 0.1107 0.1299 0.1078 0.0018  0.0018  -0.0034 327  ALA A C     
1075 O O     . ALA A 142 ? 0.1127 0.1230 0.1146 0.0061  0.0015  -0.0094 327  ALA A O     
1076 C CB    . ALA A 142 ? 0.1003 0.1268 0.1083 -0.0020 -0.0067 0.0011  327  ALA A CB    
1077 N N     . ALA A 143 ? 0.1041 0.1403 0.1132 0.0024  0.0052  0.0017  328  ALA A N     
1078 C CA    . ALA A 143 ? 0.1042 0.1291 0.1119 0.0041  0.0080  -0.0008 328  ALA A CA    
1079 C C     . ALA A 143 ? 0.1015 0.1219 0.1162 0.0001  0.0039  0.0031  328  ALA A C     
1080 O O     . ALA A 143 ? 0.1039 0.1220 0.1240 -0.0039 0.0035  0.0058  328  ALA A O     
1081 C CB    . ALA A 143 ? 0.1091 0.1361 0.1078 0.0064  0.0144  0.0020  328  ALA A CB    
1082 N N     . GLY A 144 ? 0.0953 0.1170 0.1029 0.0007  0.0055  -0.0034 329  GLY A N     
1083 C CA    . GLY A 144 ? 0.1034 0.1263 0.1109 0.0000  0.0111  0.0064  329  GLY A CA    
1084 C C     . GLY A 144 ? 0.0997 0.1210 0.1060 -0.0036 0.0055  0.0057  329  GLY A C     
1085 O O     . GLY A 144 ? 0.1203 0.1342 0.1178 0.0068  0.0093  0.0143  329  GLY A O     
1086 N N     . GLU A 145 ? 0.0952 0.1156 0.0903 -0.0074 0.0063  0.0028  330  GLU A N     
1087 C CA    . GLU A 145 ? 0.1157 0.1185 0.1050 0.0000  0.0029  0.0008  330  GLU A CA    
1088 C C     . GLU A 145 ? 0.1075 0.1185 0.1036 0.0006  0.0031  -0.0011 330  GLU A C     
1089 O O     . GLU A 145 ? 0.1069 0.1217 0.1168 -0.0008 -0.0019 0.0024  330  GLU A O     
1090 C CB    . GLU A 145 ? 0.1368 0.1331 0.1298 0.0035  0.0030  0.0051  330  GLU A CB    
1091 C CG    . GLU A 145 ? 0.1507 0.1332 0.1266 -0.0016 -0.0038 0.0032  330  GLU A CG    
1092 C CD    . GLU A 145 ? 0.1316 0.1236 0.1240 0.0042  0.0030  0.0058  330  GLU A CD    
1093 O OE1   . GLU A 145 ? 0.1093 0.1103 0.1508 0.0173  0.0069  0.0126  330  GLU A OE1   
1094 O OE2   . GLU A 145 ? 0.1168 0.1100 0.1370 -0.0040 0.0065  0.0155  330  GLU A OE2   
1095 N N     . GLU A 146 ? 0.1057 0.1100 0.0938 0.0049  0.0036  -0.0010 331  GLU A N     
1096 C CA    . GLU A 146 ? 0.1126 0.1054 0.0943 0.0035  0.0008  -0.0046 331  GLU A CA    
1097 C C     . GLU A 146 ? 0.1130 0.1043 0.0929 0.0016  0.0043  -0.0083 331  GLU A C     
1098 O O     . GLU A 146 ? 0.1254 0.1036 0.1014 -0.0044 0.0012  -0.0028 331  GLU A O     
1099 C CB    . GLU A 146 ? 0.1137 0.0987 0.0982 0.0048  0.0034  -0.0132 331  GLU A CB    
1100 C CG    . GLU A 146 ? 0.1237 0.0944 0.1025 0.0041  -0.0044 -0.0105 331  GLU A CG    
1101 C CD    . GLU A 146 ? 0.1186 0.1034 0.1077 0.0012  -0.0007 -0.0009 331  GLU A CD    
1102 O OE1   . GLU A 146 ? 0.1231 0.0941 0.1237 0.0057  0.0053  0.0116  331  GLU A OE1   
1103 O OE2   . GLU A 146 ? 0.1195 0.0942 0.1338 0.0078  -0.0137 -0.0031 331  GLU A OE2   
1104 N N     . LEU A 147 ? 0.1129 0.1090 0.0950 -0.0045 0.0056  -0.0058 332  LEU A N     
1105 C CA    . LEU A 147 ? 0.1109 0.0960 0.0973 -0.0041 0.0006  -0.0033 332  LEU A CA    
1106 C C     . LEU A 147 ? 0.1105 0.0969 0.0942 -0.0040 -0.0010 0.0031  332  LEU A C     
1107 O O     . LEU A 147 ? 0.1117 0.0915 0.0895 -0.0061 -0.0062 0.0125  332  LEU A O     
1108 C CB    . LEU A 147 ? 0.1082 0.1037 0.1138 -0.0046 0.0097  0.0032  332  LEU A CB    
1109 C CG    . LEU A 147 ? 0.1204 0.1175 0.1328 -0.0006 0.0169  0.0098  332  LEU A CG    
1110 C CD1   . LEU A 147 ? 0.1174 0.1290 0.1651 -0.0029 0.0085  0.0023  332  LEU A CD1   
1111 C CD2   . LEU A 147 ? 0.1363 0.1250 0.1642 -0.0035 0.0082  -0.0011 332  LEU A CD2   
1112 N N     . LEU A 148 ? 0.1232 0.1067 0.0909 -0.0040 0.0035  0.0012  333  LEU A N     
1113 C CA    . LEU A 148 ? 0.1204 0.1178 0.0983 0.0003  0.0000  0.0019  333  LEU A CA    
1114 C C     . LEU A 148 ? 0.1209 0.1152 0.0992 -0.0016 -0.0006 -0.0028 333  LEU A C     
1115 O O     . LEU A 148 ? 0.1355 0.1155 0.1004 0.0058  -0.0037 0.0039  333  LEU A O     
1116 C CB    . LEU A 148 ? 0.1262 0.1224 0.1130 -0.0022 -0.0038 0.0084  333  LEU A CB    
1117 C CG    . LEU A 148 ? 0.1382 0.1199 0.1039 -0.0090 -0.0088 0.0005  333  LEU A CG    
1118 C CD1   . LEU A 148 ? 0.1030 0.1321 0.1497 -0.0078 0.0021  -0.0099 333  LEU A CD1   
1119 C CD2   . LEU A 148 ? 0.1481 0.1348 0.1266 0.0086  0.0105  -0.0008 333  LEU A CD2   
1120 N N     . TYR A 149 ? 0.1249 0.1206 0.0928 0.0009  0.0075  -0.0037 334  TYR A N     
1121 C CA    . TYR A 149 ? 0.1229 0.1177 0.0921 0.0050  0.0030  -0.0012 334  TYR A CA    
1122 C C     . TYR A 149 ? 0.1279 0.1144 0.0974 0.0076  0.0070  -0.0008 334  TYR A C     
1123 O O     . TYR A 149 ? 0.1345 0.1193 0.0988 0.0053  0.0031  -0.0044 334  TYR A O     
1124 C CB    . TYR A 149 ? 0.1280 0.1197 0.1066 0.0000  0.0030  0.0010  334  TYR A CB    
1125 C CG    . TYR A 149 ? 0.1276 0.1164 0.1072 -0.0013 -0.0034 0.0008  334  TYR A CG    
1126 C CD1   . TYR A 149 ? 0.1316 0.1265 0.1098 0.0032  0.0029  -0.0007 334  TYR A CD1   
1127 C CD2   . TYR A 149 ? 0.1134 0.1322 0.1131 -0.0002 0.0057  0.0146  334  TYR A CD2   
1128 C CE1   . TYR A 149 ? 0.1296 0.1151 0.1047 -0.0032 0.0007  0.0118  334  TYR A CE1   
1129 C CE2   . TYR A 149 ? 0.1236 0.1306 0.1269 -0.0145 0.0005  -0.0024 334  TYR A CE2   
1130 C CZ    . TYR A 149 ? 0.1343 0.1197 0.1198 -0.0057 0.0075  0.0049  334  TYR A CZ    
1131 O OH    . TYR A 149 ? 0.1400 0.1214 0.1282 -0.0073 0.0077  0.0080  334  TYR A OH    
1132 N N     . ASP A 150 ? 0.1313 0.1188 0.1026 0.0097  0.0033  0.0021  335  ASP A N     
1133 C CA    . ASP A 150 ? 0.1415 0.1199 0.1012 0.0093  0.0046  0.0021  335  ASP A CA    
1134 C C     . ASP A 150 ? 0.1396 0.1291 0.1088 0.0042  -0.0001 0.0000  335  ASP A C     
1135 O O     . ASP A 150 ? 0.1462 0.1390 0.1091 0.0095  -0.0113 0.0024  335  ASP A O     
1136 C CB    . ASP A 150 ? 0.1397 0.1311 0.1077 0.0086  0.0162  0.0103  335  ASP A CB    
1137 C CG    . ASP A 150 ? 0.1658 0.1530 0.1127 0.0242  0.0148  0.0072  335  ASP A CG    
1138 O OD1   . ASP A 150 ? 0.1658 0.1513 0.1263 0.0170  0.0055  -0.0007 335  ASP A OD1   
1139 O OD2   . ASP A 150 ? 0.2484 0.1809 0.1629 0.0320  0.0325  0.0406  335  ASP A OD2   
1140 N N     . TYR A 151 ? 0.1434 0.1346 0.1025 0.0055  0.0000  -0.0041 336  TYR A N     
1141 C CA    . TYR A 151 ? 0.1474 0.1384 0.1048 0.0043  0.0018  0.0004  336  TYR A CA    
1142 C C     . TYR A 151 ? 0.1481 0.1399 0.1069 0.0048  -0.0035 0.0049  336  TYR A C     
1143 O O     . TYR A 151 ? 0.1606 0.1486 0.1049 0.0000  -0.0098 -0.0017 336  TYR A O     
1144 C CB    . TYR A 151 ? 0.1436 0.1312 0.1029 0.0038  0.0024  0.0030  336  TYR A CB    
1145 C CG    . TYR A 151 ? 0.1316 0.1290 0.1063 0.0001  0.0069  0.0043  336  TYR A CG    
1146 C CD1   . TYR A 151 ? 0.1233 0.1362 0.1022 -0.0011 0.0013  -0.0049 336  TYR A CD1   
1147 C CD2   . TYR A 151 ? 0.1232 0.1431 0.1192 0.0040  -0.0019 0.0009  336  TYR A CD2   
1148 C CE1   . TYR A 151 ? 0.1152 0.1191 0.0955 0.0000  -0.0089 -0.0003 336  TYR A CE1   
1149 C CE2   . TYR A 151 ? 0.1173 0.1365 0.1257 -0.0017 0.0098  -0.0003 336  TYR A CE2   
1150 C CZ    . TYR A 151 ? 0.1135 0.1141 0.1007 0.0002  -0.0034 -0.0040 336  TYR A CZ    
1151 O OH    . TYR A 151 ? 0.1161 0.1247 0.1049 0.0016  -0.0034 0.0000  336  TYR A OH    
1152 N N     . GLY A 152 ? 0.1496 0.1376 0.0989 0.0059  -0.0084 0.0032  337  GLY A N     
1153 C CA    . GLY A 152 ? 0.1651 0.1444 0.1096 0.0121  0.0032  0.0000  337  GLY A CA    
1154 C C     . GLY A 152 ? 0.1689 0.1349 0.1220 0.0044  -0.0021 -0.0017 337  GLY A C     
1155 O O     . GLY A 152 ? 0.1798 0.1297 0.1140 0.0088  0.0053  -0.0027 337  GLY A O     
1156 N N     . ASP A 153 ? 0.1600 0.1391 0.1309 0.0041  -0.0035 -0.0066 338  ASP A N     
1157 C CA    . ASP A 153 ? 0.1552 0.1396 0.1302 -0.0002 -0.0011 -0.0040 338  ASP A CA    
1158 C C     . ASP A 153 ? 0.1549 0.1413 0.1253 -0.0005 0.0054  0.0021  338  ASP A C     
1159 O O     . ASP A 153 ? 0.1537 0.1452 0.1256 -0.0047 0.0046  -0.0006 338  ASP A O     
1160 C CB    . ASP A 153 ? 0.1674 0.1394 0.1399 -0.0004 0.0102  -0.0054 338  ASP A CB    
1161 C CG    . ASP A 153 ? 0.1571 0.1455 0.1427 0.0016  -0.0007 -0.0075 338  ASP A CG    
1162 O OD1   . ASP A 153 ? 0.1630 0.1445 0.1565 0.0089  0.0054  -0.0061 338  ASP A OD1   
1163 O OD2   . ASP A 153 ? 0.1511 0.1439 0.1761 -0.0078 0.0177  -0.0136 338  ASP A OD2   
1164 N N     . ARG A 154 ? 0.1508 0.1464 0.1288 0.0000  0.0106  0.0052  339  ARG A N     
1165 C CA    . ARG A 154 ? 0.1583 0.1494 0.1452 0.0050  0.0079  0.0055  339  ARG A CA    
1166 C C     . ARG A 154 ? 0.1587 0.1590 0.1422 0.0024  0.0059  0.0012  339  ARG A C     
1167 O O     . ARG A 154 ? 0.1697 0.1649 0.1437 0.0005  0.0134  0.0029  339  ARG A O     
1168 C CB    . ARG A 154 ? 0.1638 0.1479 0.1525 0.0018  0.0130  0.0091  339  ARG A CB    
1169 C CG    . ARG A 154 ? 0.1767 0.1583 0.1622 0.0067  0.0061  0.0016  339  ARG A CG    
1170 C CD    . ARG A 154 ? 0.1879 0.1585 0.1708 -0.0022 0.0094  0.0060  339  ARG A CD    
1171 N NE    . ARG A 154 ? 0.1909 0.1738 0.1552 -0.0016 0.0030  -0.0016 339  ARG A NE    
1172 C CZ    . ARG A 154 ? 0.2207 0.1807 0.1657 0.0043  0.0107  0.0027  339  ARG A CZ    
1173 N NH1   . ARG A 154 ? 0.2637 0.2051 0.1543 0.0101  0.0114  0.0098  339  ARG A NH1   
1174 N NH2   . ARG A 154 ? 0.2444 0.2131 0.1867 0.0097  0.0212  -0.0048 339  ARG A NH2   
1175 N N     . SER A 155 ? 0.1555 0.1532 0.1328 0.0046  0.0068  0.0039  340  SER A N     
1176 C CA    . SER A 155 ? 0.1522 0.1510 0.1393 0.0034  0.0004  0.0010  340  SER A CA    
1177 C C     . SER A 155 ? 0.1515 0.1605 0.1342 0.0028  -0.0009 0.0014  340  SER A C     
1178 O O     . SER A 155 ? 0.1536 0.1596 0.1229 0.0010  -0.0060 0.0042  340  SER A O     
1179 C CB    . SER A 155 ? 0.1569 0.1476 0.1367 0.0007  -0.0022 -0.0024 340  SER A CB    
1180 O OG    . SER A 155 ? 0.1556 0.1582 0.1354 0.0002  0.0004  -0.0069 340  SER A OG    
1181 N N     . LYS A 156 ? 0.1583 0.1695 0.1518 0.0019  0.0023  0.0088  341  LYS A N     
1182 C CA    . LYS A 156 ? 0.1694 0.1858 0.1655 0.0008  0.0000  0.0027  341  LYS A CA    
1183 C C     . LYS A 156 ? 0.1726 0.1850 0.1644 0.0012  0.0031  0.0007  341  LYS A C     
1184 O O     . LYS A 156 ? 0.1697 0.1872 0.1626 0.0096  0.0025  0.0011  341  LYS A O     
1185 C CB    . LYS A 156 ? 0.1817 0.1912 0.1658 0.0012  0.0027  0.0048  341  LYS A CB    
1186 C CG    . LYS A 156 ? 0.1991 0.2271 0.2079 -0.0039 -0.0085 -0.0027 341  LYS A CG    
1187 C CD    . LYS A 156 ? 0.2604 0.2577 0.2754 -0.0081 -0.0035 -0.0080 341  LYS A CD    
1188 C CE    . LYS A 156 ? 0.2867 0.3027 0.2973 0.0017  -0.0077 -0.0010 341  LYS A CE    
1189 N NZ    . LYS A 156 ? 0.3014 0.3007 0.3054 0.0019  -0.0052 -0.0026 341  LYS A NZ    
1190 N N     . ALA A 157 ? 0.1849 0.1876 0.1747 0.0034  0.0023  0.0027  342  ALA A N     
1191 C CA    . ALA A 157 ? 0.1925 0.1913 0.1797 0.0044  0.0070  0.0056  342  ALA A CA    
1192 C C     . ALA A 157 ? 0.1933 0.1953 0.1799 0.0088  0.0041  0.0050  342  ALA A C     
1193 O O     . ALA A 157 ? 0.2086 0.2110 0.1949 0.0137  0.0113  0.0154  342  ALA A O     
1194 C CB    . ALA A 157 ? 0.2013 0.1945 0.1830 0.0059  0.0049  0.0045  342  ALA A CB    
1195 N N     . SER A 158 ? 0.1872 0.1919 0.1717 0.0075  0.0065  0.0033  343  SER A N     
1196 C CA    . SER A 158 ? 0.1735 0.1897 0.1639 0.0043  -0.0010 0.0019  343  SER A CA    
1197 C C     . SER A 158 ? 0.1853 0.1992 0.1676 0.0062  -0.0049 0.0042  343  SER A C     
1198 O O     . SER A 158 ? 0.1889 0.2084 0.1550 0.0110  -0.0064 0.0086  343  SER A O     
1199 C CB    . SER A 158 ? 0.1627 0.1839 0.1489 0.0048  -0.0014 -0.0001 343  SER A CB    
1200 O OG    . SER A 158 ? 0.1549 0.1754 0.1570 -0.0051 -0.0031 0.0024  343  SER A OG    
1201 N N     . ILE A 159 ? 0.1839 0.1989 0.1769 0.0049  -0.0055 0.0055  344  ILE A N     
1202 C CA    . ILE A 159 ? 0.1997 0.2058 0.1888 0.0046  -0.0055 0.0048  344  ILE A CA    
1203 C C     . ILE A 159 ? 0.2000 0.2160 0.1965 0.0034  -0.0067 0.0071  344  ILE A C     
1204 O O     . ILE A 159 ? 0.1985 0.2267 0.1840 0.0089  -0.0128 0.0106  344  ILE A O     
1205 C CB    . ILE A 159 ? 0.2043 0.2083 0.1934 0.0018  -0.0067 0.0049  344  ILE A CB    
1206 C CG1   . ILE A 159 ? 0.2202 0.2170 0.2123 0.0096  -0.0024 0.0071  344  ILE A CG1   
1207 C CG2   . ILE A 159 ? 0.2089 0.2082 0.1806 0.0105  -0.0030 -0.0005 344  ILE A CG2   
1208 C CD1   . ILE A 159 ? 0.2279 0.2104 0.2128 -0.0005 0.0007  0.0058  344  ILE A CD1   
1209 N N     . GLU A 160 ? 0.2011 0.2237 0.1989 0.0060  -0.0073 0.0098  345  GLU A N     
1210 C CA    . GLU A 160 ? 0.2148 0.2351 0.2244 0.0053  -0.0036 0.0094  345  GLU A CA    
1211 C C     . GLU A 160 ? 0.2026 0.2271 0.2111 0.0044  -0.0030 0.0065  345  GLU A C     
1212 O O     . GLU A 160 ? 0.2072 0.2410 0.2256 0.0049  -0.0077 0.0120  345  GLU A O     
1213 C CB    . GLU A 160 ? 0.2174 0.2374 0.2241 0.0066  0.0005  0.0104  345  GLU A CB    
1214 C CG    . GLU A 160 ? 0.2552 0.2551 0.2533 -0.0009 0.0052  0.0116  345  GLU A CG    
1215 C CD    . GLU A 160 ? 0.2530 0.2577 0.2524 0.0060  0.0062  0.0065  345  GLU A CD    
1216 O OE1   . GLU A 160 ? 0.2881 0.2734 0.2962 0.0031  0.0073  0.0073  345  GLU A OE1   
1217 O OE2   . GLU A 160 ? 0.2988 0.2969 0.2940 0.0026  0.0152  0.0113  345  GLU A OE2   
1218 N N     . ALA A 161 ? 0.2012 0.2176 0.2044 0.0068  0.0018  0.0092  346  ALA A N     
1219 C CA    . ALA A 161 ? 0.1954 0.2138 0.2003 0.0095  -0.0010 0.0081  346  ALA A CA    
1220 C C     . ALA A 161 ? 0.1867 0.2122 0.1983 0.0101  -0.0030 0.0086  346  ALA A C     
1221 O O     . ALA A 161 ? 0.1942 0.2195 0.1995 0.0164  0.0037  0.0147  346  ALA A O     
1222 C CB    . ALA A 161 ? 0.1972 0.2192 0.2079 0.0094  0.0006  0.0029  346  ALA A CB    
1223 N N     . HIS A 162 ? 0.1831 0.1971 0.1938 0.0082  -0.0018 0.0067  347  HIS A N     
1224 C CA    . HIS A 162 ? 0.1725 0.1951 0.1739 0.0053  -0.0042 0.0077  347  HIS A CA    
1225 C C     . HIS A 162 ? 0.1726 0.1942 0.1789 0.0053  -0.0034 0.0010  347  HIS A C     
1226 O O     . HIS A 162 ? 0.1746 0.1912 0.1713 0.0121  -0.0049 -0.0021 347  HIS A O     
1227 C CB    . HIS A 162 ? 0.1695 0.1931 0.1872 0.0079  -0.0022 0.0076  347  HIS A CB    
1228 C CG    . HIS A 162 ? 0.1803 0.2028 0.1791 0.0081  0.0004  0.0045  347  HIS A CG    
1229 N ND1   . HIS A 162 ? 0.2181 0.2084 0.2121 0.0056  0.0099  0.0133  347  HIS A ND1   
1230 C CD2   . HIS A 162 ? 0.1851 0.2037 0.2057 -0.0040 -0.0071 -0.0027 347  HIS A CD2   
1231 C CE1   . HIS A 162 ? 0.2029 0.2086 0.2096 0.0022  -0.0008 0.0038  347  HIS A CE1   
1232 N NE2   . HIS A 162 ? 0.2077 0.2182 0.2233 0.0013  -0.0049 0.0035  347  HIS A NE2   
1233 N N     . PRO A 163 ? 0.1636 0.1912 0.1733 0.0047  -0.0031 0.0041  348  PRO A N     
1234 C CA    . PRO A 163 ? 0.1603 0.1871 0.1790 0.0043  -0.0019 0.0025  348  PRO A CA    
1235 C C     . PRO A 163 ? 0.1599 0.1840 0.1713 0.0029  0.0025  0.0056  348  PRO A C     
1236 O O     . PRO A 163 ? 0.1500 0.1856 0.1900 0.0021  0.0050  0.0072  348  PRO A O     
1237 C CB    . PRO A 163 ? 0.1586 0.1913 0.1877 0.0051  -0.0045 -0.0001 348  PRO A CB    
1238 C CG    . PRO A 163 ? 0.1819 0.1981 0.1863 0.0035  -0.0019 0.0104  348  PRO A CG    
1239 C CD    . PRO A 163 ? 0.1766 0.1905 0.1773 0.0058  -0.0029 0.0047  348  PRO A CD    
1240 N N     . TRP A 164 ? 0.1460 0.1806 0.1706 -0.0027 0.0028  0.0051  349  TRP A N     
1241 C CA    . TRP A 164 ? 0.1509 0.1604 0.1526 -0.0010 0.0017  0.0019  349  TRP A CA    
1242 C C     . TRP A 164 ? 0.1514 0.1628 0.1579 0.0014  0.0031  0.0020  349  TRP A C     
1243 O O     . TRP A 164 ? 0.1620 0.1542 0.1700 -0.0005 0.0044  -0.0069 349  TRP A O     
1244 C CB    . TRP A 164 ? 0.1479 0.1650 0.1530 -0.0041 0.0063  0.0047  349  TRP A CB    
1245 C CG    . TRP A 164 ? 0.1530 0.1556 0.1346 0.0031  0.0108  0.0033  349  TRP A CG    
1246 C CD1   . TRP A 164 ? 0.1547 0.1571 0.1448 0.0060  0.0093  0.0096  349  TRP A CD1   
1247 C CD2   . TRP A 164 ? 0.1489 0.1635 0.1299 0.0047  0.0151  0.0100  349  TRP A CD2   
1248 N NE1   . TRP A 164 ? 0.1447 0.1880 0.1691 0.0031  0.0048  0.0064  349  TRP A NE1   
1249 C CE2   . TRP A 164 ? 0.1430 0.1657 0.1391 -0.0003 0.0042  0.0114  349  TRP A CE2   
1250 C CE3   . TRP A 164 ? 0.1394 0.1636 0.1138 0.0071  0.0035  0.0087  349  TRP A CE3   
1251 C CZ2   . TRP A 164 ? 0.1405 0.1622 0.1491 0.0017  0.0016  0.0042  349  TRP A CZ2   
1252 C CZ3   . TRP A 164 ? 0.1465 0.1509 0.1358 0.0025  0.0063  0.0009  349  TRP A CZ3   
1253 C CH2   . TRP A 164 ? 0.1486 0.1562 0.1320 -0.0001 0.0102  0.0093  349  TRP A CH2   
1254 N N     . LEU A 165 ? 0.1454 0.1612 0.1589 -0.0008 0.0038  0.0009  350  LEU A N     
1255 C CA    . LEU A 165 ? 0.1497 0.1569 0.1592 0.0000  0.0033  -0.0004 350  LEU A CA    
1256 C C     . LEU A 165 ? 0.1660 0.1749 0.1746 0.0002  0.0053  0.0053  350  LEU A C     
1257 O O     . LEU A 165 ? 0.1657 0.1682 0.1818 -0.0014 0.0034  0.0106  350  LEU A O     
1258 C CB    . LEU A 165 ? 0.1484 0.1550 0.1356 -0.0008 0.0054  -0.0026 350  LEU A CB    
1259 C CG    . LEU A 165 ? 0.1507 0.1431 0.1314 0.0031  0.0111  -0.0055 350  LEU A CG    
1260 C CD1   . LEU A 165 ? 0.1605 0.1203 0.1288 -0.0128 -0.0003 -0.0054 350  LEU A CD1   
1261 C CD2   . LEU A 165 ? 0.1458 0.1411 0.1310 0.0107  0.0081  -0.0019 350  LEU A CD2   
1262 N N     . LYS A 166 ? 0.1801 0.1912 0.2011 -0.0026 0.0039  0.0057  351  LYS A N     
1263 C CA    . LYS A 166 ? 0.2039 0.2162 0.2373 -0.0045 0.0057  0.0087  351  LYS A CA    
1264 C C     . LYS A 166 ? 0.2242 0.2333 0.2589 0.0005  0.0054  0.0068  351  LYS A C     
1265 O O     . LYS A 166 ? 0.2425 0.2350 0.2772 -0.0030 0.0115  0.0125  351  LYS A O     
1266 C CB    . LYS A 166 ? 0.1975 0.2156 0.2353 -0.0066 0.0090  0.0093  351  LYS A CB    
1267 C CG    . LYS A 166 ? 0.2241 0.2330 0.2421 -0.0053 0.0026  0.0034  351  LYS A CG    
1268 C CD    . LYS A 166 ? 0.2263 0.2591 0.2644 -0.0046 0.0032  0.0082  351  LYS A CD    
1269 C CE    . LYS A 166 ? 0.1961 0.2518 0.2483 -0.0050 0.0036  0.0169  351  LYS A CE    
1270 N NZ    . LYS A 166 ? 0.1686 0.2526 0.2496 -0.0087 -0.0076 0.0125  351  LYS A NZ    
1271 N N     . HIS A 167 ? 0.2402 0.2524 0.2646 -0.0022 0.0004  0.0036  352  HIS A N     
1272 C CA    . HIS A 167 ? 0.2571 0.2709 0.2817 0.0035  0.0025  -0.0001 352  HIS A CA    
1273 C C     . HIS A 167 ? 0.2576 0.2731 0.2736 0.0028  -0.0005 0.0005  352  HIS A C     
1274 O O     . HIS A 167 ? 0.2562 0.2657 0.2819 -0.0009 -0.0026 0.0012  352  HIS A O     
1275 C CB    . HIS A 167 ? 0.2691 0.2816 0.2837 0.0015  0.0004  -0.0019 352  HIS A CB    
1276 C CG    . HIS A 167 ? 0.2864 0.3001 0.3052 0.0015  0.0028  -0.0021 352  HIS A CG    
1277 N ND1   . HIS A 167 ? 0.3064 0.3117 0.3213 -0.0038 0.0054  0.0031  352  HIS A ND1   
1278 C CD2   . HIS A 167 ? 0.2997 0.3091 0.3164 0.0022  -0.0005 -0.0023 352  HIS A CD2   
1279 C CE1   . HIS A 167 ? 0.3113 0.3164 0.3183 0.0002  0.0046  0.0011  352  HIS A CE1   
1280 N NE2   . HIS A 167 ? 0.3138 0.3167 0.3176 0.0012  0.0037  -0.0001 352  HIS A NE2   
1281 N N     . ARG B 7   ? 0.3259 0.3224 0.3177 0.0062  -0.0052 -0.0002 192  ARG B N     
1282 C CA    . ARG B 7   ? 0.3164 0.3131 0.3149 0.0050  -0.0021 -0.0002 192  ARG B CA    
1283 C C     . ARG B 7   ? 0.3030 0.3055 0.3028 0.0044  -0.0027 -0.0001 192  ARG B C     
1284 O O     . ARG B 7   ? 0.3122 0.3168 0.3175 0.0072  -0.0027 0.0009  192  ARG B O     
1285 C CB    . ARG B 7   ? 0.3221 0.3234 0.3225 0.0037  -0.0004 -0.0007 192  ARG B CB    
1286 N N     . LYS B 8   ? 0.2866 0.2793 0.2879 0.0052  -0.0071 0.0020  193  LYS B N     
1287 C CA    . LYS B 8   ? 0.2707 0.2652 0.2670 0.0035  -0.0074 0.0008  193  LYS B CA    
1288 C C     . LYS B 8   ? 0.2720 0.2644 0.2699 0.0023  -0.0072 0.0007  193  LYS B C     
1289 O O     . LYS B 8   ? 0.2755 0.2638 0.2746 0.0025  -0.0085 -0.0005 193  LYS B O     
1290 C CB    . LYS B 8   ? 0.2596 0.2525 0.2619 0.0054  -0.0098 0.0029  193  LYS B CB    
1291 C CG    . LYS B 8   ? 0.2364 0.2262 0.2323 -0.0012 -0.0081 0.0004  193  LYS B CG    
1292 C CD    . LYS B 8   ? 0.1811 0.1554 0.1984 0.0039  -0.0169 0.0027  193  LYS B CD    
1293 C CE    . LYS B 8   ? 0.1606 0.1618 0.1725 -0.0011 -0.0170 -0.0009 193  LYS B CE    
1294 N NZ    . LYS B 8   ? 0.1454 0.1657 0.1566 -0.0059 -0.0312 -0.0037 193  LYS B NZ    
1295 N N     . SER B 9   ? 0.2728 0.2605 0.2648 0.0026  -0.0058 0.0008  194  SER B N     
1296 C CA    . SER B 9   ? 0.2762 0.2644 0.2653 0.0003  -0.0072 0.0021  194  SER B CA    
1297 C C     . SER B 9   ? 0.2760 0.2634 0.2674 0.0015  -0.0071 0.0035  194  SER B C     
1298 O O     . SER B 9   ? 0.2788 0.2611 0.2596 0.0011  -0.0100 0.0025  194  SER B O     
1299 C CB    . SER B 9   ? 0.2757 0.2676 0.2680 -0.0003 -0.0058 0.0012  194  SER B CB    
1300 O OG    . SER B 9   ? 0.2906 0.2773 0.2674 -0.0057 -0.0077 0.0016  194  SER B OG    
1301 N N     . LYS B 10  ? 0.2762 0.2706 0.2707 0.0024  -0.0077 0.0046  195  LYS B N     
1302 C CA    . LYS B 10  ? 0.2818 0.2750 0.2799 0.0038  -0.0078 0.0055  195  LYS B CA    
1303 C C     . LYS B 10  ? 0.2781 0.2649 0.2774 0.0051  -0.0068 0.0054  195  LYS B C     
1304 O O     . LYS B 10  ? 0.2749 0.2482 0.2726 0.0057  -0.0068 0.0125  195  LYS B O     
1305 C CB    . LYS B 10  ? 0.2820 0.2790 0.2815 0.0047  -0.0092 0.0065  195  LYS B CB    
1306 C CG    . LYS B 10  ? 0.2900 0.2882 0.2936 0.0056  -0.0069 0.0044  195  LYS B CG    
1307 C CD    . LYS B 10  ? 0.2925 0.2955 0.2960 0.0043  -0.0088 0.0076  195  LYS B CD    
1308 C CE    . LYS B 10  ? 0.3177 0.3257 0.3216 0.0058  -0.0006 0.0016  195  LYS B CE    
1309 N NZ    . LYS B 10  ? 0.3309 0.3505 0.3311 0.0045  -0.0076 0.0096  195  LYS B NZ    
1310 N N     . ALA B 11  ? 0.2773 0.2652 0.2752 0.0043  -0.0075 0.0058  196  ALA B N     
1311 C CA    . ALA B 11  ? 0.2775 0.2655 0.2778 0.0013  -0.0072 0.0063  196  ALA B CA    
1312 C C     . ALA B 11  ? 0.2736 0.2586 0.2714 0.0005  -0.0049 0.0038  196  ALA B C     
1313 O O     . ALA B 11  ? 0.2831 0.2585 0.2760 -0.0013 -0.0048 0.0058  196  ALA B O     
1314 C CB    . ALA B 11  ? 0.2809 0.2742 0.2827 -0.0004 -0.0058 0.0058  196  ALA B CB    
1315 N N     . GLU B 12  ? 0.2675 0.2523 0.2677 -0.0002 -0.0065 0.0046  197  GLU B N     
1316 C CA    . GLU B 12  ? 0.2619 0.2443 0.2625 0.0017  -0.0060 -0.0002 197  GLU B CA    
1317 C C     . GLU B 12  ? 0.2474 0.2255 0.2510 0.0041  -0.0093 -0.0024 197  GLU B C     
1318 O O     . GLU B 12  ? 0.2553 0.2220 0.2561 0.0032  -0.0186 -0.0036 197  GLU B O     
1319 C CB    . GLU B 12  ? 0.2595 0.2467 0.2635 0.0026  -0.0037 -0.0019 197  GLU B CB    
1320 C CG    . GLU B 12  ? 0.2699 0.2694 0.2771 -0.0022 -0.0015 -0.0036 197  GLU B CG    
1321 C CD    . GLU B 12  ? 0.2786 0.2742 0.2804 0.0011  0.0000  -0.0029 197  GLU B CD    
1322 O OE1   . GLU B 12  ? 0.2985 0.3035 0.3016 -0.0124 -0.0051 -0.0064 197  GLU B OE1   
1323 O OE2   . GLU B 12  ? 0.2958 0.3188 0.3241 -0.0006 -0.0050 -0.0098 197  GLU B OE2   
1324 N N     . LEU B 13  ? 0.2381 0.2110 0.2415 0.0087  -0.0147 -0.0024 198  LEU B N     
1325 C CA    . LEU B 13  ? 0.2214 0.1968 0.2301 0.0089  -0.0137 -0.0072 198  LEU B CA    
1326 C C     . LEU B 13  ? 0.2174 0.1893 0.2261 0.0066  -0.0122 -0.0041 198  LEU B C     
1327 O O     . LEU B 13  ? 0.2151 0.1741 0.2278 0.0072  -0.0224 -0.0083 198  LEU B O     
1328 C CB    . LEU B 13  ? 0.2202 0.1981 0.2250 0.0098  -0.0129 -0.0060 198  LEU B CB    
1329 C CG    . LEU B 13  ? 0.2199 0.2117 0.2238 0.0070  -0.0084 -0.0074 198  LEU B CG    
1330 C CD1   . LEU B 13  ? 0.2271 0.2421 0.2395 -0.0050 -0.0091 -0.0083 198  LEU B CD1   
1331 C CD2   . LEU B 13  ? 0.2188 0.2097 0.2255 0.0031  -0.0028 -0.0017 198  LEU B CD2   
1332 N N     . GLN B 14  ? 0.2231 0.1957 0.2316 0.0042  -0.0147 0.0001  199  GLN B N     
1333 C CA    . GLN B 14  ? 0.2311 0.2018 0.2294 0.0031  -0.0119 0.0010  199  GLN B CA    
1334 C C     . GLN B 14  ? 0.2310 0.1963 0.2302 0.0032  -0.0110 0.0024  199  GLN B C     
1335 O O     . GLN B 14  ? 0.2320 0.1942 0.2320 0.0062  -0.0083 -0.0021 199  GLN B O     
1336 C CB    . GLN B 14  ? 0.2371 0.2033 0.2441 0.0025  -0.0124 0.0035  199  GLN B CB    
1337 C CG    . GLN B 14  ? 0.2535 0.2391 0.2558 0.0018  -0.0133 0.0052  199  GLN B CG    
1338 C CD    . GLN B 14  ? 0.2927 0.2707 0.2884 0.0056  -0.0075 0.0130  199  GLN B CD    
1339 O OE1   . GLN B 14  ? 0.3057 0.2799 0.3111 0.0000  -0.0066 0.0161  199  GLN B OE1   
1340 N NE2   . GLN B 14  ? 0.3031 0.3069 0.3150 0.0042  -0.0084 0.0070  199  GLN B NE2   
1341 N N     . SER B 15  ? 0.2336 0.1924 0.2266 -0.0023 -0.0086 0.0041  200  SER B N     
1342 C CA    . SER B 15  ? 0.2355 0.2020 0.2294 -0.0042 -0.0100 0.0016  200  SER B CA    
1343 C C     . SER B 15  ? 0.2262 0.1914 0.2186 -0.0038 -0.0077 -0.0022 200  SER B C     
1344 O O     . SER B 15  ? 0.2336 0.1932 0.2189 -0.0050 -0.0076 -0.0004 200  SER B O     
1345 C CB    . SER B 15  ? 0.2391 0.2100 0.2324 -0.0048 -0.0107 0.0024  200  SER B CB    
1346 O OG    . SER B 15  ? 0.2742 0.2619 0.2650 -0.0222 -0.0156 -0.0046 200  SER B OG    
1347 N N     . GLU B 16  ? 0.2194 0.1836 0.2105 -0.0022 -0.0097 -0.0039 201  GLU B N     
1348 C CA    . GLU B 16  ? 0.2063 0.1705 0.1971 -0.0021 -0.0113 -0.0085 201  GLU B CA    
1349 C C     . GLU B 16  ? 0.2040 0.1659 0.2015 -0.0032 -0.0124 -0.0091 201  GLU B C     
1350 O O     . GLU B 16  ? 0.1967 0.1483 0.1925 -0.0057 -0.0184 -0.0133 201  GLU B O     
1351 C CB    . GLU B 16  ? 0.2071 0.1659 0.1881 0.0016  -0.0152 -0.0082 201  GLU B CB    
1352 C CG    . GLU B 16  ? 0.2029 0.1702 0.1876 0.0005  -0.0174 -0.0059 201  GLU B CG    
1353 C CD    . GLU B 16  ? 0.1962 0.1719 0.1846 0.0003  -0.0123 -0.0027 201  GLU B CD    
1354 O OE1   . GLU B 16  ? 0.1754 0.1415 0.1788 -0.0003 -0.0276 -0.0052 201  GLU B OE1   
1355 O OE2   . GLU B 16  ? 0.2203 0.1553 0.1972 -0.0069 -0.0234 -0.0220 201  GLU B OE2   
1356 N N     . GLU B 17  ? 0.2048 0.1665 0.2110 -0.0003 -0.0150 -0.0094 202  GLU B N     
1357 C CA    . GLU B 17  ? 0.2144 0.1835 0.2219 -0.0020 -0.0125 -0.0065 202  GLU B CA    
1358 C C     . GLU B 17  ? 0.2095 0.1820 0.2195 -0.0034 -0.0119 -0.0052 202  GLU B C     
1359 O O     . GLU B 17  ? 0.2025 0.1712 0.2229 -0.0058 -0.0149 -0.0065 202  GLU B O     
1360 C CB    . GLU B 17  ? 0.2207 0.1963 0.2326 -0.0035 -0.0141 -0.0073 202  GLU B CB    
1361 C CG    . GLU B 17  ? 0.2383 0.2219 0.2554 0.0007  -0.0073 -0.0089 202  GLU B CG    
1362 C CD    . GLU B 17  ? 0.2733 0.2623 0.2954 -0.0041 -0.0006 -0.0021 202  GLU B CD    
1363 O OE1   . GLU B 17  ? 0.2811 0.2617 0.3245 -0.0039 -0.0034 -0.0052 202  GLU B OE1   
1364 O OE2   . GLU B 17  ? 0.3099 0.2891 0.3108 -0.0038 0.0038  -0.0104 202  GLU B OE2   
1365 N N     . ARG B 18  ? 0.2171 0.1868 0.2195 -0.0062 -0.0092 -0.0045 203  ARG B N     
1366 C CA    . ARG B 18  ? 0.2194 0.1865 0.2194 -0.0049 -0.0064 -0.0036 203  ARG B CA    
1367 C C     . ARG B 18  ? 0.2106 0.1764 0.2116 -0.0078 -0.0020 -0.0014 203  ARG B C     
1368 O O     . ARG B 18  ? 0.2112 0.1595 0.2061 -0.0100 0.0046  -0.0009 203  ARG B O     
1369 C CB    . ARG B 18  ? 0.2285 0.1952 0.2212 -0.0070 -0.0024 -0.0018 203  ARG B CB    
1370 C CG    . ARG B 18  ? 0.2602 0.2258 0.2469 -0.0024 -0.0015 -0.0111 203  ARG B CG    
1371 C CD    . ARG B 18  ? 0.2964 0.2725 0.2823 -0.0057 0.0019  0.0100  203  ARG B CD    
1372 N NE    . ARG B 18  ? 0.3405 0.3089 0.3209 -0.0053 0.0021  -0.0034 203  ARG B NE    
1373 C CZ    . ARG B 18  ? 0.3496 0.3355 0.3476 -0.0006 0.0003  0.0039  203  ARG B CZ    
1374 N NH1   . ARG B 18  ? 0.3804 0.3631 0.3728 -0.0071 -0.0034 -0.0002 203  ARG B NH1   
1375 N NH2   . ARG B 18  ? 0.3766 0.3533 0.3686 -0.0034 0.0001  -0.0041 203  ARG B NH2   
1376 N N     . LYS B 19  ? 0.2011 0.1662 0.2090 -0.0105 0.0016  -0.0016 204  LYS B N     
1377 C CA    . LYS B 19  ? 0.1977 0.1779 0.2076 -0.0085 0.0020  -0.0051 204  LYS B CA    
1378 C C     . LYS B 19  ? 0.1834 0.1670 0.2038 -0.0059 0.0028  -0.0059 204  LYS B C     
1379 O O     . LYS B 19  ? 0.1741 0.1593 0.2027 -0.0089 0.0075  -0.0056 204  LYS B O     
1380 C CB    . LYS B 19  ? 0.1989 0.1862 0.2170 -0.0091 0.0031  -0.0059 204  LYS B CB    
1381 C CG    . LYS B 19  ? 0.2390 0.2235 0.2284 -0.0143 0.0020  0.0019  204  LYS B CG    
1382 C CD    . LYS B 19  ? 0.2671 0.2652 0.2708 -0.0039 0.0101  -0.0043 204  LYS B CD    
1383 C CE    . LYS B 19  ? 0.2922 0.2846 0.2804 -0.0136 -0.0010 0.0016  204  LYS B CE    
1384 N NZ    . LYS B 19  ? 0.3106 0.3214 0.3146 -0.0039 0.0038  -0.0066 204  LYS B NZ    
1385 N N     . ARG B 20  ? 0.1640 0.1605 0.1969 -0.0044 0.0041  -0.0042 205  ARG B N     
1386 C CA    . ARG B 20  ? 0.1638 0.1544 0.1942 -0.0031 0.0045  -0.0061 205  ARG B CA    
1387 C C     . ARG B 20  ? 0.1609 0.1539 0.1956 -0.0023 0.0037  -0.0039 205  ARG B C     
1388 O O     . ARG B 20  ? 0.1588 0.1466 0.2032 -0.0011 0.0082  -0.0036 205  ARG B O     
1389 C CB    . ARG B 20  ? 0.1640 0.1510 0.2007 -0.0004 -0.0006 -0.0045 205  ARG B CB    
1390 C CG    . ARG B 20  ? 0.1717 0.1540 0.1994 -0.0026 0.0016  -0.0087 205  ARG B CG    
1391 C CD    . ARG B 20  ? 0.1765 0.1584 0.2017 -0.0123 0.0022  -0.0047 205  ARG B CD    
1392 N NE    . ARG B 20  ? 0.2157 0.1753 0.2077 -0.0308 -0.0047 0.0000  205  ARG B NE    
1393 C CZ    . ARG B 20  ? 0.1954 0.1627 0.2061 -0.0127 -0.0035 -0.0119 205  ARG B CZ    
1394 N NH1   . ARG B 20  ? 0.2056 0.1694 0.2310 -0.0119 -0.0110 0.0007  205  ARG B NH1   
1395 N NH2   . ARG B 20  ? 0.2282 0.1682 0.2040 -0.0158 -0.0135 0.0014  205  ARG B NH2   
1396 N N     . ILE B 21  ? 0.1594 0.1589 0.1968 -0.0044 0.0023  -0.0016 206  ILE B N     
1397 C CA    . ILE B 21  ? 0.1742 0.1762 0.2025 0.0019  0.0009  0.0002  206  ILE B CA    
1398 C C     . ILE B 21  ? 0.1710 0.1742 0.1980 0.0041  0.0045  -0.0003 206  ILE B C     
1399 O O     . ILE B 21  ? 0.1733 0.1771 0.2039 -0.0002 0.0100  0.0038  206  ILE B O     
1400 C CB    . ILE B 21  ? 0.1778 0.1772 0.2032 0.0041  0.0010  0.0025  206  ILE B CB    
1401 C CG1   . ILE B 21  ? 0.1977 0.1996 0.2267 0.0049  -0.0106 -0.0011 206  ILE B CG1   
1402 C CG2   . ILE B 21  ? 0.1837 0.1853 0.2152 0.0102  0.0048  0.0001  206  ILE B CG2   
1403 C CD1   . ILE B 21  ? 0.2138 0.2098 0.2274 -0.0031 -0.0126 0.0009  206  ILE B CD1   
1404 N N     . ASP B 22  ? 0.1698 0.1728 0.2000 0.0037  0.0049  0.0011  207  ASP B N     
1405 C CA    . ASP B 22  ? 0.1733 0.1800 0.2071 0.0040  0.0070  -0.0029 207  ASP B CA    
1406 C C     . ASP B 22  ? 0.1744 0.1796 0.2048 0.0011  0.0101  0.0005  207  ASP B C     
1407 O O     . ASP B 22  ? 0.1740 0.1780 0.2143 0.0114  0.0141  -0.0009 207  ASP B O     
1408 C CB    . ASP B 22  ? 0.1800 0.1821 0.2079 0.0016  0.0088  -0.0004 207  ASP B CB    
1409 C CG    . ASP B 22  ? 0.2167 0.2066 0.2166 -0.0090 0.0053  -0.0001 207  ASP B CG    
1410 O OD1   . ASP B 22  ? 0.2669 0.1892 0.2473 0.0105  0.0026  -0.0054 207  ASP B OD1   
1411 O OD2   . ASP B 22  ? 0.2626 0.2475 0.2567 -0.0216 0.0217  0.0075  207  ASP B OD2   
1412 N N     . GLU B 23  ? 0.1767 0.1814 0.2095 0.0038  0.0092  -0.0014 208  GLU B N     
1413 C CA    . GLU B 23  ? 0.1937 0.1960 0.2142 0.0050  0.0072  0.0006  208  GLU B CA    
1414 C C     . GLU B 23  ? 0.1932 0.1952 0.2154 0.0092  0.0069  0.0014  208  GLU B C     
1415 O O     . GLU B 23  ? 0.1957 0.2050 0.2225 0.0128  0.0085  0.0026  208  GLU B O     
1416 C CB    . GLU B 23  ? 0.1973 0.2002 0.2222 0.0041  0.0100  -0.0024 208  GLU B CB    
1417 C CG    . GLU B 23  ? 0.2491 0.2503 0.2535 0.0026  0.0036  0.0033  208  GLU B CG    
1418 C CD    . GLU B 23  ? 0.3011 0.3076 0.3052 -0.0094 -0.0063 -0.0034 208  GLU B CD    
1419 O OE1   . GLU B 23  ? 0.3213 0.3304 0.3292 -0.0112 0.0064  0.0022  208  GLU B OE1   
1420 O OE2   . GLU B 23  ? 0.3397 0.3512 0.3128 -0.0078 0.0007  -0.0085 208  GLU B OE2   
1421 N N     . LEU B 24  ? 0.1916 0.1901 0.2147 0.0083  0.0130  0.0022  209  LEU B N     
1422 C CA    . LEU B 24  ? 0.2051 0.1956 0.2161 0.0081  0.0127  0.0034  209  LEU B CA    
1423 C C     . LEU B 24  ? 0.2027 0.1983 0.2134 0.0099  0.0110  0.0032  209  LEU B C     
1424 O O     . LEU B 24  ? 0.2018 0.2027 0.2073 0.0172  0.0069  0.0094  209  LEU B O     
1425 C CB    . LEU B 24  ? 0.2127 0.1963 0.2286 0.0061  0.0103  0.0033  209  LEU B CB    
1426 C CG    . LEU B 24  ? 0.2218 0.2010 0.2347 0.0091  0.0161  -0.0021 209  LEU B CG    
1427 C CD1   . LEU B 24  ? 0.2312 0.2118 0.2525 0.0045  0.0135  0.0004  209  LEU B CD1   
1428 C CD2   . LEU B 24  ? 0.2618 0.2363 0.2548 -0.0009 0.0121  0.0050  209  LEU B CD2   
1429 N N     . ILE B 25  ? 0.2050 0.2006 0.2067 0.0098  0.0087  0.0032  210  ILE B N     
1430 C CA    . ILE B 25  ? 0.2083 0.2042 0.2083 0.0105  0.0071  0.0032  210  ILE B CA    
1431 C C     . ILE B 25  ? 0.2129 0.2195 0.2171 0.0135  0.0045  0.0028  210  ILE B C     
1432 O O     . ILE B 25  ? 0.2095 0.2212 0.2167 0.0262  -0.0010 0.0027  210  ILE B O     
1433 C CB    . ILE B 25  ? 0.2094 0.2033 0.1972 0.0113  0.0000  0.0001  210  ILE B CB    
1434 C CG1   . ILE B 25  ? 0.1903 0.1919 0.1935 0.0103  0.0054  0.0046  210  ILE B CG1   
1435 C CG2   . ILE B 25  ? 0.2200 0.1996 0.2213 0.0011  0.0044  0.0015  210  ILE B CG2   
1436 C CD1   . ILE B 25  ? 0.2012 0.1935 0.1888 0.0096  0.0098  0.0052  210  ILE B CD1   
1437 N N     . GLU B 26  ? 0.2186 0.2328 0.2331 0.0099  0.0040  0.0009  211  GLU B N     
1438 C CA    . GLU B 26  ? 0.2350 0.2424 0.2376 0.0059  0.0002  0.0001  211  GLU B CA    
1439 C C     . GLU B 26  ? 0.2281 0.2383 0.2366 0.0068  0.0013  0.0011  211  GLU B C     
1440 O O     . GLU B 26  ? 0.2323 0.2387 0.2341 0.0073  -0.0027 0.0006  211  GLU B O     
1441 C CB    . GLU B 26  ? 0.2330 0.2471 0.2441 0.0031  0.0014  0.0009  211  GLU B CB    
1442 C CG    . GLU B 26  ? 0.2952 0.2830 0.2778 0.0016  -0.0011 0.0057  211  GLU B CG    
1443 C CD    . GLU B 26  ? 0.3251 0.3325 0.3288 -0.0057 0.0030  0.0030  211  GLU B CD    
1444 O OE1   . GLU B 26  ? 0.3355 0.3536 0.3491 0.0025  0.0010  0.0056  211  GLU B OE1   
1445 O OE2   . GLU B 26  ? 0.3740 0.3465 0.3503 -0.0017 -0.0037 0.0105  211  GLU B OE2   
1446 N N     . SER B 27  ? 0.2170 0.2374 0.2324 0.0057  0.0011  0.0039  212  SER B N     
1447 C CA    . SER B 27  ? 0.2200 0.2322 0.2374 0.0069  0.0029  0.0061  212  SER B CA    
1448 C C     . SER B 27  ? 0.2163 0.2313 0.2320 0.0086  -0.0003 0.0029  212  SER B C     
1449 O O     . SER B 27  ? 0.2180 0.2331 0.2346 0.0066  0.0009  0.0069  212  SER B O     
1450 C CB    . SER B 27  ? 0.2253 0.2322 0.2410 0.0072  0.0042  0.0041  212  SER B CB    
1451 O OG    . SER B 27  ? 0.2418 0.2383 0.2597 0.0110  0.0014  0.0061  212  SER B OG    
1452 N N     . GLY B 28  ? 0.2064 0.2185 0.2251 0.0117  -0.0007 0.0023  213  GLY B N     
1453 C CA    . GLY B 28  ? 0.2081 0.2155 0.2259 0.0053  0.0022  0.0029  213  GLY B CA    
1454 C C     . GLY B 28  ? 0.2067 0.2092 0.2243 0.0068  0.0028  -0.0014 213  GLY B C     
1455 O O     . GLY B 28  ? 0.2059 0.2060 0.2282 0.0056  0.0073  0.0012  213  GLY B O     
1456 N N     . LYS B 29  ? 0.2027 0.2123 0.2324 0.0052  0.0033  -0.0026 214  LYS B N     
1457 C CA    . LYS B 29  ? 0.2057 0.2065 0.2293 0.0075  0.0040  -0.0015 214  LYS B CA    
1458 C C     . LYS B 29  ? 0.2002 0.1989 0.2161 0.0055  0.0029  -0.0036 214  LYS B C     
1459 O O     . LYS B 29  ? 0.2044 0.2005 0.2214 0.0052  0.0063  -0.0042 214  LYS B O     
1460 C CB    . LYS B 29  ? 0.2194 0.2229 0.2404 0.0093  0.0056  -0.0071 214  LYS B CB    
1461 C CG    . LYS B 29  ? 0.2451 0.2388 0.2687 0.0025  0.0041  -0.0006 214  LYS B CG    
1462 C CD    . LYS B 29  ? 0.2931 0.2932 0.3144 0.0160  0.0111  -0.0072 214  LYS B CD    
1463 C CE    . LYS B 29  ? 0.3272 0.3233 0.3244 0.0029  0.0013  -0.0006 214  LYS B CE    
1464 N NZ    . LYS B 29  ? 0.3506 0.3365 0.3616 0.0063  0.0105  -0.0068 214  LYS B NZ    
1465 N N     . GLU B 30  ? 0.1811 0.1797 0.2026 0.0048  0.0056  -0.0030 215  GLU B N     
1466 C CA    . GLU B 30  ? 0.1789 0.1758 0.1837 0.0018  0.0037  -0.0046 215  GLU B CA    
1467 C C     . GLU B 30  ? 0.1867 0.1831 0.1925 0.0027  0.0069  -0.0019 215  GLU B C     
1468 O O     . GLU B 30  ? 0.2067 0.1894 0.2022 -0.0006 0.0147  -0.0046 215  GLU B O     
1469 C CB    . GLU B 30  ? 0.1722 0.1721 0.1840 0.0009  0.0050  -0.0071 215  GLU B CB    
1470 C CG    . GLU B 30  ? 0.1671 0.1664 0.1646 0.0019  -0.0015 0.0003  215  GLU B CG    
1471 C CD    . GLU B 30  ? 0.1689 0.1784 0.1635 -0.0018 -0.0024 -0.0040 215  GLU B CD    
1472 O OE1   . GLU B 30  ? 0.1647 0.1730 0.1554 -0.0088 -0.0051 -0.0004 215  GLU B OE1   
1473 O OE2   . GLU B 30  ? 0.1646 0.1784 0.1517 0.0076  -0.0041 -0.0107 215  GLU B OE2   
1474 N N     . GLU B 31  ? 0.1899 0.1849 0.1920 0.0026  0.0013  -0.0051 216  GLU B N     
1475 C CA    . GLU B 31  ? 0.2007 0.2011 0.2122 0.0010  0.0031  -0.0056 216  GLU B CA    
1476 C C     . GLU B 31  ? 0.1896 0.1853 0.1950 0.0031  0.0002  -0.0052 216  GLU B C     
1477 O O     . GLU B 31  ? 0.2008 0.1837 0.1929 -0.0041 -0.0038 0.0000  216  GLU B O     
1478 C CB    . GLU B 31  ? 0.2083 0.2056 0.2256 0.0022  0.0075  -0.0064 216  GLU B CB    
1479 C CG    . GLU B 31  ? 0.2329 0.2435 0.2574 0.0017  0.0027  -0.0057 216  GLU B CG    
1480 C CD    . GLU B 31  ? 0.2367 0.2469 0.2631 0.0039  0.0069  -0.0075 216  GLU B CD    
1481 O OE1   . GLU B 31  ? 0.2987 0.3077 0.3017 0.0048  0.0057  -0.0032 216  GLU B OE1   
1482 O OE2   . GLU B 31  ? 0.3019 0.3137 0.3227 0.0085  -0.0024 0.0057  216  GLU B OE2   
1483 N N     . GLY B 32  ? 0.1700 0.1818 0.1766 0.0015  0.0036  -0.0068 217  GLY B N     
1484 C CA    . GLY B 32  ? 0.1573 0.1681 0.1559 0.0113  -0.0020 -0.0054 217  GLY B CA    
1485 C C     . GLY B 32  ? 0.1622 0.1790 0.1548 0.0076  -0.0005 -0.0071 217  GLY B C     
1486 O O     . GLY B 32  ? 0.1596 0.1777 0.1608 0.0078  -0.0052 -0.0055 217  GLY B O     
1487 N N     . MET B 33  ? 0.1587 0.1741 0.1470 0.0066  0.0049  -0.0044 218  MET B N     
1488 C CA    . MET B 33  ? 0.1581 0.1684 0.1477 0.0111  0.0018  0.0004  218  MET B CA    
1489 C C     . MET B 33  ? 0.1556 0.1751 0.1425 0.0099  0.0044  -0.0015 218  MET B C     
1490 O O     . MET B 33  ? 0.1501 0.1867 0.1428 0.0213  0.0036  -0.0025 218  MET B O     
1491 C CB    . MET B 33  ? 0.1651 0.1669 0.1532 0.0056  0.0051  -0.0031 218  MET B CB    
1492 C CG    . MET B 33  ? 0.1692 0.1780 0.1584 0.0008  0.0023  0.0012  218  MET B CG    
1493 S SD    . MET B 33  ? 0.1651 0.1822 0.1786 0.0162  0.0021  0.0168  218  MET B SD    
1494 C CE    . MET B 33  ? 0.1754 0.2135 0.2246 0.0081  -0.0051 0.0075  218  MET B CE    
1495 N N     . LYS B 34  ? 0.1535 0.1666 0.1348 0.0105  0.0021  -0.0040 219  LYS B N     
1496 C CA    . LYS B 34  ? 0.1622 0.1700 0.1485 0.0108  0.0000  -0.0038 219  LYS B CA    
1497 C C     . LYS B 34  ? 0.1533 0.1626 0.1378 0.0110  -0.0023 -0.0077 219  LYS B C     
1498 O O     . LYS B 34  ? 0.1493 0.1612 0.1385 0.0152  -0.0041 -0.0100 219  LYS B O     
1499 C CB    . LYS B 34  ? 0.1643 0.1647 0.1540 0.0130  -0.0034 -0.0027 219  LYS B CB    
1500 C CG    . LYS B 34  ? 0.1891 0.1915 0.1854 0.0068  -0.0023 -0.0033 219  LYS B CG    
1501 C CD    . LYS B 34  ? 0.2035 0.1921 0.1985 0.0005  0.0031  -0.0003 219  LYS B CD    
1502 C CE    . LYS B 34  ? 0.2336 0.2487 0.2695 -0.0057 -0.0053 -0.0013 219  LYS B CE    
1503 N NZ    . LYS B 34  ? 0.2928 0.2672 0.3090 -0.0042 -0.0002 0.0014  219  LYS B NZ    
1504 N N     . ILE B 35  ? 0.1483 0.1573 0.1336 0.0145  -0.0008 -0.0057 220  ILE B N     
1505 C CA    . ILE B 35  ? 0.1505 0.1650 0.1494 0.0059  -0.0001 -0.0058 220  ILE B CA    
1506 C C     . ILE B 35  ? 0.1539 0.1619 0.1583 0.0024  -0.0028 -0.0018 220  ILE B C     
1507 O O     . ILE B 35  ? 0.1620 0.1805 0.1848 0.0030  -0.0020 0.0144  220  ILE B O     
1508 C CB    . ILE B 35  ? 0.1459 0.1584 0.1501 0.0050  0.0011  -0.0074 220  ILE B CB    
1509 C CG1   . ILE B 35  ? 0.1523 0.1645 0.1510 -0.0036 -0.0005 -0.0090 220  ILE B CG1   
1510 C CG2   . ILE B 35  ? 0.1622 0.1645 0.1492 0.0090  0.0121  -0.0060 220  ILE B CG2   
1511 C CD1   . ILE B 35  ? 0.1662 0.1817 0.1564 -0.0019 -0.0057 -0.0140 220  ILE B CD1   
1512 N N     . ASP B 36  ? 0.1516 0.1630 0.1566 0.0063  -0.0020 0.0018  221  ASP B N     
1513 C CA    . ASP B 36  ? 0.1612 0.1681 0.1708 0.0004  0.0000  -0.0014 221  ASP B CA    
1514 C C     . ASP B 36  ? 0.1539 0.1594 0.1543 -0.0019 0.0009  0.0003  221  ASP B C     
1515 O O     . ASP B 36  ? 0.1587 0.1597 0.1733 0.0067  0.0138  0.0070  221  ASP B O     
1516 C CB    . ASP B 36  ? 0.1757 0.1828 0.1907 -0.0010 -0.0014 -0.0053 221  ASP B CB    
1517 C CG    . ASP B 36  ? 0.2110 0.2184 0.2341 -0.0082 0.0003  -0.0054 221  ASP B CG    
1518 O OD1   . ASP B 36  ? 0.2375 0.2444 0.2671 -0.0030 -0.0045 0.0199  221  ASP B OD1   
1519 O OD2   . ASP B 36  ? 0.2688 0.2732 0.2650 -0.0172 -0.0167 -0.0210 221  ASP B OD2   
1520 N N     . LEU B 37  ? 0.1478 0.1610 0.1489 -0.0023 0.0006  -0.0041 222  LEU B N     
1521 C CA    . LEU B 37  ? 0.1553 0.1557 0.1436 -0.0033 -0.0023 0.0009  222  LEU B CA    
1522 C C     . LEU B 37  ? 0.1567 0.1536 0.1453 -0.0029 -0.0049 -0.0011 222  LEU B C     
1523 O O     . LEU B 37  ? 0.1693 0.1484 0.1642 0.0038  -0.0117 0.0079  222  LEU B O     
1524 C CB    . LEU B 37  ? 0.1623 0.1724 0.1455 -0.0102 -0.0010 -0.0020 222  LEU B CB    
1525 C CG    . LEU B 37  ? 0.1806 0.1756 0.1351 -0.0161 -0.0057 0.0013  222  LEU B CG    
1526 C CD1   . LEU B 37  ? 0.1982 0.2002 0.1604 -0.0088 0.0124  0.0169  222  LEU B CD1   
1527 C CD2   . LEU B 37  ? 0.2194 0.1834 0.1883 -0.0140 -0.0041 -0.0018 222  LEU B CD2   
1528 N N     . ILE B 38  ? 0.1498 0.1476 0.1352 0.0011  -0.0015 0.0001  223  ILE B N     
1529 C CA    . ILE B 38  ? 0.1473 0.1548 0.1369 -0.0024 0.0006  -0.0016 223  ILE B CA    
1530 C C     . ILE B 38  ? 0.1430 0.1506 0.1342 -0.0061 0.0000  -0.0022 223  ILE B C     
1531 O O     . ILE B 38  ? 0.1396 0.1403 0.1172 -0.0079 -0.0005 -0.0053 223  ILE B O     
1532 C CB    . ILE B 38  ? 0.1506 0.1592 0.1405 0.0039  0.0022  0.0004  223  ILE B CB    
1533 C CG1   . ILE B 38  ? 0.1610 0.1838 0.1749 0.0007  0.0015  0.0003  223  ILE B CG1   
1534 C CG2   . ILE B 38  ? 0.1690 0.1889 0.1419 0.0042  -0.0050 0.0001  223  ILE B CG2   
1535 C CD1   . ILE B 38  ? 0.1928 0.1861 0.1871 0.0029  0.0072  -0.0018 223  ILE B CD1   
1536 N N     . ASP B 39  ? 0.1447 0.1489 0.1311 -0.0091 -0.0048 -0.0063 224  ASP B N     
1537 C CA    . ASP B 39  ? 0.1362 0.1399 0.1304 -0.0144 -0.0074 -0.0089 224  ASP B CA    
1538 C C     . ASP B 39  ? 0.1390 0.1372 0.1242 -0.0114 -0.0057 -0.0094 224  ASP B C     
1539 O O     . ASP B 39  ? 0.1496 0.1446 0.1221 -0.0156 0.0046  -0.0163 224  ASP B O     
1540 C CB    . ASP B 39  ? 0.1299 0.1459 0.1290 -0.0193 -0.0098 -0.0193 224  ASP B CB    
1541 C CG    . ASP B 39  ? 0.1475 0.1677 0.1471 -0.0205 -0.0036 -0.0197 224  ASP B CG    
1542 O OD1   . ASP B 39  ? 0.1584 0.2031 0.1411 -0.0279 0.0102  -0.0259 224  ASP B OD1   
1543 O OD2   . ASP B 39  ? 0.1625 0.2317 0.1721 -0.0446 -0.0122 -0.0305 224  ASP B OD2   
1544 N N     . GLY B 40  ? 0.1367 0.1268 0.1243 -0.0084 -0.0035 -0.0082 225  GLY B N     
1545 C CA    . GLY B 40  ? 0.1335 0.1376 0.1389 -0.0100 -0.0068 -0.0049 225  GLY B CA    
1546 C C     . GLY B 40  ? 0.1289 0.1367 0.1396 -0.0051 -0.0090 -0.0015 225  GLY B C     
1547 O O     . GLY B 40  ? 0.1395 0.1363 0.1721 -0.0045 -0.0065 -0.0081 225  GLY B O     
1548 N N     . LYS B 41  ? 0.1216 0.1266 0.1300 -0.0071 -0.0045 -0.0048 226  LYS B N     
1549 C CA    . LYS B 41  ? 0.1228 0.1409 0.1312 -0.0071 -0.0110 -0.0041 226  LYS B CA    
1550 C C     . LYS B 41  ? 0.1215 0.1350 0.1355 -0.0125 -0.0094 -0.0066 226  LYS B C     
1551 O O     . LYS B 41  ? 0.1337 0.1519 0.1521 -0.0208 -0.0014 0.0027  226  LYS B O     
1552 C CB    . LYS B 41  ? 0.1227 0.1342 0.1318 -0.0003 -0.0106 -0.0052 226  LYS B CB    
1553 C CG    . LYS B 41  ? 0.1365 0.1401 0.1237 -0.0037 -0.0105 -0.0148 226  LYS B CG    
1554 C CD    . LYS B 41  ? 0.1483 0.1691 0.1361 -0.0037 0.0078  -0.0006 226  LYS B CD    
1555 C CE    . LYS B 41  ? 0.1641 0.2006 0.1482 0.0109  -0.0147 -0.0065 226  LYS B CE    
1556 N NZ    . LYS B 41  ? 0.1813 0.1704 0.1865 0.0042  -0.0055 -0.0207 226  LYS B NZ    
1557 N N     . GLY B 42  ? 0.1142 0.1315 0.1226 -0.0099 -0.0096 -0.0096 227  GLY B N     
1558 C CA    . GLY B 42  ? 0.1222 0.1243 0.1189 -0.0048 -0.0044 -0.0119 227  GLY B CA    
1559 C C     . GLY B 42  ? 0.1253 0.1339 0.1265 -0.0044 -0.0033 -0.0058 227  GLY B C     
1560 O O     . GLY B 42  ? 0.1418 0.1249 0.1431 -0.0041 -0.0012 -0.0097 227  GLY B O     
1561 N N     . ARG B 43  ? 0.1292 0.1353 0.1070 -0.0050 0.0015  -0.0024 228  ARG B N     
1562 C CA    . ARG B 43  ? 0.1316 0.1431 0.1050 -0.0003 0.0001  -0.0031 228  ARG B CA    
1563 C C     . ARG B 43  ? 0.1354 0.1379 0.1057 0.0061  0.0013  -0.0061 228  ARG B C     
1564 O O     . ARG B 43  ? 0.1490 0.1388 0.1060 0.0075  -0.0017 -0.0106 228  ARG B O     
1565 C CB    . ARG B 43  ? 0.1354 0.1486 0.1147 -0.0019 -0.0008 -0.0066 228  ARG B CB    
1566 C CG    . ARG B 43  ? 0.1441 0.1646 0.1155 -0.0086 -0.0029 -0.0067 228  ARG B CG    
1567 C CD    . ARG B 43  ? 0.1555 0.1427 0.1429 -0.0167 0.0050  -0.0127 228  ARG B CD    
1568 N NE    . ARG B 43  ? 0.1579 0.1534 0.1658 -0.0240 -0.0038 -0.0183 228  ARG B NE    
1569 C CZ    . ARG B 43  ? 0.1533 0.1554 0.1568 -0.0185 -0.0145 -0.0071 228  ARG B CZ    
1570 N NH1   . ARG B 43  ? 0.1647 0.1779 0.1527 0.0088  -0.0106 -0.0006 228  ARG B NH1   
1571 N NH2   . ARG B 43  ? 0.1698 0.1605 0.1456 0.0106  -0.0055 0.0011  228  ARG B NH2   
1572 N N     . GLY B 44  ? 0.1355 0.1377 0.1052 0.0074  0.0061  -0.0099 229  GLY B N     
1573 C CA    . GLY B 44  ? 0.1402 0.1358 0.1111 0.0172  0.0041  -0.0039 229  GLY B CA    
1574 C C     . GLY B 44  ? 0.1377 0.1340 0.1125 0.0165  0.0048  -0.0038 229  GLY B C     
1575 O O     . GLY B 44  ? 0.1497 0.1397 0.1182 0.0222  0.0058  -0.0018 229  GLY B O     
1576 N N     . VAL B 45  ? 0.1266 0.1188 0.1128 0.0119  0.0093  -0.0064 230  VAL B N     
1577 C CA    . VAL B 45  ? 0.1290 0.1201 0.1138 0.0150  0.0006  -0.0078 230  VAL B CA    
1578 C C     . VAL B 45  ? 0.1381 0.1278 0.1163 0.0111  -0.0021 -0.0092 230  VAL B C     
1579 O O     . VAL B 45  ? 0.1423 0.1272 0.1095 0.0279  0.0005  0.0002  230  VAL B O     
1580 C CB    . VAL B 45  ? 0.1319 0.1184 0.1201 0.0162  -0.0019 0.0003  230  VAL B CB    
1581 C CG1   . VAL B 45  ? 0.1404 0.1376 0.1671 0.0164  0.0124  -0.0090 230  VAL B CG1   
1582 C CG2   . VAL B 45  ? 0.1234 0.1308 0.1377 0.0126  -0.0105 -0.0032 230  VAL B CG2   
1583 N N     . ILE B 46  ? 0.1487 0.1353 0.1290 0.0116  -0.0023 -0.0133 231  ILE B N     
1584 C CA    . ILE B 46  ? 0.1607 0.1492 0.1385 0.0089  0.0022  -0.0143 231  ILE B CA    
1585 C C     . ILE B 46  ? 0.1584 0.1548 0.1373 0.0114  -0.0031 -0.0159 231  ILE B C     
1586 O O     . ILE B 46  ? 0.1573 0.1685 0.1418 0.0138  -0.0025 -0.0179 231  ILE B O     
1587 C CB    . ILE B 46  ? 0.1715 0.1479 0.1569 0.0041  0.0104  -0.0154 231  ILE B CB    
1588 C CG1   . ILE B 46  ? 0.1961 0.1825 0.1887 0.0148  0.0214  -0.0117 231  ILE B CG1   
1589 C CG2   . ILE B 46  ? 0.2015 0.1651 0.1832 -0.0025 0.0020  -0.0163 231  ILE B CG2   
1590 C CD1   . ILE B 46  ? 0.2360 0.2186 0.2096 0.0114  0.0015  -0.0058 231  ILE B CD1   
1591 N N     . ALA B 47  ? 0.1521 0.1431 0.1163 0.0155  -0.0017 -0.0115 232  ALA B N     
1592 C CA    . ALA B 47  ? 0.1573 0.1607 0.1309 0.0121  -0.0027 -0.0090 232  ALA B CA    
1593 C C     . ALA B 47  ? 0.1650 0.1671 0.1435 0.0065  -0.0028 -0.0045 232  ALA B C     
1594 O O     . ALA B 47  ? 0.1596 0.1675 0.1478 -0.0004 -0.0034 -0.0042 232  ALA B O     
1595 C CB    . ALA B 47  ? 0.1544 0.1687 0.1283 0.0064  -0.0068 -0.0086 232  ALA B CB    
1596 N N     . THR B 48  ? 0.1654 0.1654 0.1435 0.0114  -0.0038 -0.0004 233  THR B N     
1597 C CA    . THR B 48  ? 0.1787 0.1648 0.1611 0.0125  -0.0092 0.0014  233  THR B CA    
1598 C C     . THR B 48  ? 0.1863 0.1728 0.1625 0.0119  -0.0100 0.0007  233  THR B C     
1599 O O     . THR B 48  ? 0.2085 0.1768 0.1744 0.0156  -0.0127 0.0094  233  THR B O     
1600 C CB    . THR B 48  ? 0.1771 0.1678 0.1619 0.0148  -0.0104 0.0032  233  THR B CB    
1601 O OG1   . THR B 48  ? 0.1902 0.1852 0.1968 0.0166  -0.0043 -0.0052 233  THR B OG1   
1602 C CG2   . THR B 48  ? 0.1941 0.1765 0.1764 0.0095  -0.0070 -0.0020 233  THR B CG2   
1603 N N     . LYS B 49  ? 0.1854 0.1811 0.1726 0.0107  -0.0063 0.0021  234  LYS B N     
1604 C CA    . LYS B 49  ? 0.1868 0.1908 0.1829 0.0120  -0.0085 -0.0021 234  LYS B CA    
1605 C C     . LYS B 49  ? 0.1807 0.1844 0.1738 0.0100  -0.0097 -0.0029 234  LYS B C     
1606 O O     . LYS B 49  ? 0.1661 0.1710 0.1600 0.0171  -0.0160 -0.0037 234  LYS B O     
1607 C CB    . LYS B 49  ? 0.1882 0.1993 0.1883 0.0099  -0.0062 -0.0010 234  LYS B CB    
1608 C CG    . LYS B 49  ? 0.1982 0.2163 0.2050 0.0039  -0.0029 0.0011  234  LYS B CG    
1609 C CD    . LYS B 49  ? 0.1990 0.2266 0.2174 0.0070  0.0006  0.0000  234  LYS B CD    
1610 C CE    . LYS B 49  ? 0.2466 0.2555 0.2667 -0.0009 0.0032  0.0068  234  LYS B CE    
1611 N NZ    . LYS B 49  ? 0.2771 0.2850 0.2826 -0.0051 0.0047  0.0057  234  LYS B NZ    
1612 N N     . GLN B 50  ? 0.1811 0.1736 0.1666 0.0115  -0.0103 -0.0014 235  GLN B N     
1613 C CA    . GLN B 50  ? 0.1842 0.1762 0.1751 0.0108  -0.0075 -0.0018 235  GLN B CA    
1614 C C     . GLN B 50  ? 0.1753 0.1690 0.1672 0.0117  -0.0088 -0.0047 235  GLN B C     
1615 O O     . GLN B 50  ? 0.1728 0.1731 0.1864 0.0169  -0.0087 -0.0016 235  GLN B O     
1616 C CB    . GLN B 50  ? 0.1828 0.1778 0.1700 0.0082  -0.0032 -0.0059 235  GLN B CB    
1617 C CG    . GLN B 50  ? 0.2146 0.2201 0.2135 0.0057  -0.0065 -0.0044 235  GLN B CG    
1618 C CD    . GLN B 50  ? 0.2138 0.1997 0.2101 0.0045  -0.0031 -0.0046 235  GLN B CD    
1619 O OE1   . GLN B 50  ? 0.2130 0.2079 0.2628 -0.0263 0.0013  -0.0238 235  GLN B OE1   
1620 N NE2   . GLN B 50  ? 0.2466 0.2391 0.2464 0.0018  0.0085  -0.0085 235  GLN B NE2   
1621 N N     . PHE B 51  ? 0.1686 0.1643 0.1573 0.0098  -0.0099 -0.0020 236  PHE B N     
1622 C CA    . PHE B 51  ? 0.1659 0.1666 0.1597 0.0066  -0.0065 -0.0030 236  PHE B CA    
1623 C C     . PHE B 51  ? 0.1648 0.1669 0.1599 0.0064  -0.0087 0.0048  236  PHE B C     
1624 O O     . PHE B 51  ? 0.1625 0.2004 0.1621 0.0055  -0.0071 0.0081  236  PHE B O     
1625 C CB    . PHE B 51  ? 0.1625 0.1506 0.1472 0.0054  -0.0119 0.0010  236  PHE B CB    
1626 C CG    . PHE B 51  ? 0.1571 0.1426 0.1454 0.0115  -0.0036 -0.0122 236  PHE B CG    
1627 C CD1   . PHE B 51  ? 0.1558 0.1513 0.1582 0.0157  -0.0157 -0.0147 236  PHE B CD1   
1628 C CD2   . PHE B 51  ? 0.1655 0.1350 0.1472 0.0088  -0.0040 -0.0115 236  PHE B CD2   
1629 C CE1   . PHE B 51  ? 0.1524 0.1548 0.1560 0.0041  -0.0080 -0.0193 236  PHE B CE1   
1630 C CE2   . PHE B 51  ? 0.1691 0.1527 0.1708 0.0034  -0.0162 -0.0135 236  PHE B CE2   
1631 C CZ    . PHE B 51  ? 0.1587 0.1500 0.1555 0.0108  -0.0110 -0.0163 236  PHE B CZ    
1632 N N     . SER B 52  ? 0.1610 0.1660 0.1577 0.0083  -0.0076 0.0015  237  SER B N     
1633 C CA    . SER B 52  ? 0.1695 0.1748 0.1613 0.0059  -0.0049 0.0002  237  SER B CA    
1634 C C     . SER B 52  ? 0.1617 0.1630 0.1498 0.0048  -0.0028 -0.0081 237  SER B C     
1635 O O     . SER B 52  ? 0.1634 0.1783 0.1436 -0.0069 -0.0090 -0.0050 237  SER B O     
1636 C CB    . SER B 52  ? 0.1758 0.1804 0.1642 0.0067  -0.0021 0.0023  237  SER B CB    
1637 O OG    . SER B 52  ? 0.2134 0.1994 0.2178 0.0102  -0.0105 -0.0148 237  SER B OG    
1638 N N     . ARG B 53  ? 0.1485 0.1609 0.1478 0.0027  -0.0018 -0.0056 238  ARG B N     
1639 C CA    . ARG B 53  ? 0.1509 0.1597 0.1512 0.0012  -0.0065 -0.0056 238  ARG B CA    
1640 C C     . ARG B 53  ? 0.1405 0.1538 0.1439 0.0022  -0.0071 -0.0065 238  ARG B C     
1641 O O     . ARG B 53  ? 0.1480 0.1655 0.1627 -0.0029 -0.0119 -0.0128 238  ARG B O     
1642 C CB    . ARG B 53  ? 0.1518 0.1728 0.1654 0.0038  -0.0088 -0.0069 238  ARG B CB    
1643 C CG    . ARG B 53  ? 0.2002 0.1933 0.2211 -0.0004 -0.0029 0.0063  238  ARG B CG    
1644 C CD    . ARG B 53  ? 0.2559 0.2805 0.2647 0.0048  -0.0119 0.0005  238  ARG B CD    
1645 N NE    . ARG B 53  ? 0.3430 0.3318 0.3621 -0.0002 -0.0019 0.0114  238  ARG B NE    
1646 C CZ    . ARG B 53  ? 0.3710 0.3761 0.3982 -0.0093 0.0002  0.0090  238  ARG B CZ    
1647 N NH1   . ARG B 53  ? 0.3943 0.3887 0.4018 0.0043  -0.0063 0.0092  238  ARG B NH1   
1648 N NH2   . ARG B 53  ? 0.3949 0.3868 0.4173 -0.0030 -0.0032 0.0075  238  ARG B NH2   
1649 N N     . GLY B 54  ? 0.1438 0.1552 0.1531 -0.0016 -0.0032 -0.0054 239  GLY B N     
1650 C CA    . GLY B 54  ? 0.1489 0.1548 0.1587 -0.0044 0.0032  -0.0085 239  GLY B CA    
1651 C C     . GLY B 54  ? 0.1532 0.1610 0.1693 0.0008  0.0060  -0.0126 239  GLY B C     
1652 O O     . GLY B 54  ? 0.1634 0.1662 0.1823 -0.0092 0.0026  -0.0136 239  GLY B O     
1653 N N     . ASP B 55  ? 0.1540 0.1594 0.1576 0.0027  0.0005  -0.0152 240  ASP B N     
1654 C CA    . ASP B 55  ? 0.1508 0.1667 0.1680 0.0062  0.0000  -0.0143 240  ASP B CA    
1655 C C     . ASP B 55  ? 0.1494 0.1743 0.1661 0.0067  0.0018  -0.0150 240  ASP B C     
1656 O O     . ASP B 55  ? 0.1500 0.1712 0.1753 0.0130  -0.0017 -0.0110 240  ASP B O     
1657 C CB    . ASP B 55  ? 0.1606 0.1707 0.1718 0.0096  -0.0021 -0.0094 240  ASP B CB    
1658 C CG    . ASP B 55  ? 0.1529 0.1757 0.1870 0.0069  0.0029  -0.0077 240  ASP B CG    
1659 O OD1   . ASP B 55  ? 0.1469 0.1950 0.1892 0.0099  0.0142  -0.0059 240  ASP B OD1   
1660 O OD2   . ASP B 55  ? 0.1448 0.1861 0.2458 0.0143  -0.0019 0.0100  240  ASP B OD2   
1661 N N     . PHE B 56  ? 0.1523 0.1809 0.1596 -0.0008 -0.0024 -0.0212 241  PHE B N     
1662 C CA    . PHE B 56  ? 0.1471 0.1733 0.1618 0.0006  0.0021  -0.0179 241  PHE B CA    
1663 C C     . PHE B 56  ? 0.1525 0.1655 0.1547 0.0029  -0.0036 -0.0126 241  PHE B C     
1664 O O     . PHE B 56  ? 0.1686 0.1688 0.1617 0.0092  -0.0022 -0.0125 241  PHE B O     
1665 C CB    . PHE B 56  ? 0.1490 0.1841 0.1667 -0.0003 0.0003  -0.0179 241  PHE B CB    
1666 C CG    . PHE B 56  ? 0.1376 0.1764 0.1641 -0.0060 0.0054  -0.0143 241  PHE B CG    
1667 C CD1   . PHE B 56  ? 0.1699 0.1827 0.1865 -0.0094 0.0063  -0.0081 241  PHE B CD1   
1668 C CD2   . PHE B 56  ? 0.1522 0.1756 0.1811 -0.0020 -0.0048 -0.0138 241  PHE B CD2   
1669 C CE1   . PHE B 56  ? 0.1740 0.1931 0.1743 -0.0044 0.0061  -0.0065 241  PHE B CE1   
1670 C CE2   . PHE B 56  ? 0.1626 0.1624 0.1870 0.0023  -0.0012 -0.0154 241  PHE B CE2   
1671 C CZ    . PHE B 56  ? 0.1581 0.1644 0.1715 0.0018  0.0077  -0.0069 241  PHE B CZ    
1672 N N     . VAL B 57  ? 0.1314 0.1554 0.1436 0.0034  -0.0033 -0.0116 242  VAL B N     
1673 C CA    . VAL B 57  ? 0.1426 0.1548 0.1474 -0.0009 -0.0055 -0.0070 242  VAL B CA    
1674 C C     . VAL B 57  ? 0.1355 0.1427 0.1444 -0.0017 -0.0009 -0.0064 242  VAL B C     
1675 O O     . VAL B 57  ? 0.1353 0.1364 0.1449 -0.0108 -0.0069 -0.0098 242  VAL B O     
1676 C CB    . VAL B 57  ? 0.1371 0.1579 0.1430 -0.0013 -0.0052 -0.0067 242  VAL B CB    
1677 C CG1   . VAL B 57  ? 0.1493 0.1609 0.1354 -0.0150 -0.0035 -0.0118 242  VAL B CG1   
1678 C CG2   . VAL B 57  ? 0.1413 0.1537 0.1448 0.0014  -0.0206 0.0009  242  VAL B CG2   
1679 N N     . VAL B 58  ? 0.1357 0.1385 0.1383 -0.0047 -0.0048 -0.0061 243  VAL B N     
1680 C CA    . VAL B 58  ? 0.1324 0.1417 0.1356 0.0008  0.0006  -0.0077 243  VAL B CA    
1681 C C     . VAL B 58  ? 0.1259 0.1370 0.1283 0.0023  -0.0042 -0.0011 243  VAL B C     
1682 O O     . VAL B 58  ? 0.1421 0.1319 0.1292 0.0092  -0.0113 -0.0048 243  VAL B O     
1683 C CB    . VAL B 58  ? 0.1328 0.1430 0.1314 -0.0003 0.0016  0.0026  243  VAL B CB    
1684 C CG1   . VAL B 58  ? 0.1421 0.1669 0.1702 0.0115  0.0052  -0.0005 243  VAL B CG1   
1685 C CG2   . VAL B 58  ? 0.1473 0.1471 0.1262 0.0006  0.0040  -0.0086 243  VAL B CG2   
1686 N N     . GLU B 59  ? 0.1311 0.1355 0.1253 0.0017  0.0005  -0.0115 244  GLU B N     
1687 C CA    . GLU B 59  ? 0.1272 0.1337 0.1295 0.0020  -0.0001 -0.0036 244  GLU B CA    
1688 C C     . GLU B 59  ? 0.1279 0.1323 0.1238 0.0022  0.0020  0.0009  244  GLU B C     
1689 O O     . GLU B 59  ? 0.1434 0.1436 0.1283 0.0106  0.0085  0.0045  244  GLU B O     
1690 C CB    . GLU B 59  ? 0.1305 0.1364 0.1398 0.0010  0.0045  0.0000  244  GLU B CB    
1691 C CG    . GLU B 59  ? 0.1316 0.1230 0.1356 -0.0033 0.0019  -0.0017 244  GLU B CG    
1692 C CD    . GLU B 59  ? 0.1318 0.1328 0.1445 0.0017  -0.0029 -0.0017 244  GLU B CD    
1693 O OE1   . GLU B 59  ? 0.1280 0.1541 0.1911 0.0121  -0.0023 -0.0056 244  GLU B OE1   
1694 O OE2   . GLU B 59  ? 0.1626 0.1494 0.1881 -0.0009 -0.0010 0.0014  244  GLU B OE2   
1695 N N     . TYR B 60  ? 0.1363 0.1267 0.1187 0.0058  0.0047  -0.0014 245  TYR B N     
1696 C CA    . TYR B 60  ? 0.1338 0.1280 0.1329 0.0040  0.0010  -0.0016 245  TYR B CA    
1697 C C     . TYR B 60  ? 0.1333 0.1347 0.1289 0.0027  0.0032  -0.0021 245  TYR B C     
1698 O O     . TYR B 60  ? 0.1362 0.1260 0.1423 -0.0092 0.0000  -0.0012 245  TYR B O     
1699 C CB    . TYR B 60  ? 0.1293 0.1177 0.1210 0.0053  -0.0003 -0.0041 245  TYR B CB    
1700 C CG    . TYR B 60  ? 0.1215 0.1113 0.1102 0.0038  0.0046  -0.0032 245  TYR B CG    
1701 C CD1   . TYR B 60  ? 0.1307 0.1253 0.1175 -0.0060 0.0145  0.0124  245  TYR B CD1   
1702 C CD2   . TYR B 60  ? 0.1216 0.1094 0.1209 -0.0010 0.0047  0.0019  245  TYR B CD2   
1703 C CE1   . TYR B 60  ? 0.1443 0.1199 0.1143 0.0008  0.0034  -0.0122 245  TYR B CE1   
1704 C CE2   . TYR B 60  ? 0.1111 0.1093 0.1123 -0.0075 0.0077  -0.0027 245  TYR B CE2   
1705 C CZ    . TYR B 60  ? 0.1241 0.1136 0.1297 -0.0008 0.0106  -0.0035 245  TYR B CZ    
1706 O OH    . TYR B 60  ? 0.1526 0.1394 0.1098 0.0088  0.0006  -0.0012 245  TYR B OH    
1707 N N     . HIS B 61  ? 0.1321 0.1413 0.1312 -0.0017 -0.0002 0.0010  246  HIS B N     
1708 C CA    . HIS B 61  ? 0.1396 0.1531 0.1376 0.0004  -0.0023 -0.0032 246  HIS B CA    
1709 C C     . HIS B 61  ? 0.1438 0.1575 0.1344 -0.0031 0.0021  -0.0040 246  HIS B C     
1710 O O     . HIS B 61  ? 0.1292 0.1569 0.1431 -0.0061 0.0077  -0.0049 246  HIS B O     
1711 C CB    . HIS B 61  ? 0.1357 0.1614 0.1432 0.0012  -0.0018 -0.0006 246  HIS B CB    
1712 C CG    . HIS B 61  ? 0.1497 0.1750 0.1632 -0.0053 -0.0081 -0.0048 246  HIS B CG    
1713 N ND1   . HIS B 61  ? 0.1666 0.1722 0.1702 0.0026  -0.0036 -0.0003 246  HIS B ND1   
1714 C CD2   . HIS B 61  ? 0.1735 0.2075 0.1860 -0.0006 0.0042  -0.0003 246  HIS B CD2   
1715 C CE1   . HIS B 61  ? 0.1665 0.1946 0.1684 -0.0045 -0.0072 -0.0105 246  HIS B CE1   
1716 N NE2   . HIS B 61  ? 0.1825 0.2163 0.1895 -0.0061 0.0038  -0.0058 246  HIS B NE2   
1717 N N     . GLY B 62  ? 0.1531 0.1566 0.1343 0.0027  0.0039  -0.0087 247  GLY B N     
1718 C CA    . GLY B 62  ? 0.1533 0.1530 0.1419 -0.0013 -0.0006 -0.0084 247  GLY B CA    
1719 C C     . GLY B 62  ? 0.1592 0.1635 0.1622 -0.0047 0.0011  -0.0049 247  GLY B C     
1720 O O     . GLY B 62  ? 0.1725 0.1678 0.1992 -0.0094 0.0142  -0.0080 247  GLY B O     
1721 N N     . ASP B 63  ? 0.1587 0.1608 0.1657 -0.0044 -0.0039 0.0008  248  ASP B N     
1722 C CA    . ASP B 63  ? 0.1595 0.1781 0.1757 -0.0073 -0.0040 0.0069  248  ASP B CA    
1723 C C     . ASP B 63  ? 0.1584 0.1750 0.1761 -0.0064 -0.0046 0.0077  248  ASP B C     
1724 O O     . ASP B 63  ? 0.1467 0.1789 0.1852 -0.0114 0.0009  0.0219  248  ASP B O     
1725 C CB    . ASP B 63  ? 0.1750 0.1914 0.1872 -0.0032 -0.0037 0.0035  248  ASP B CB    
1726 C CG    . ASP B 63  ? 0.2309 0.2381 0.2157 0.0016  -0.0035 0.0069  248  ASP B CG    
1727 O OD1   . ASP B 63  ? 0.2702 0.2773 0.2653 0.0131  -0.0050 -0.0019 248  ASP B OD1   
1728 O OD2   . ASP B 63  ? 0.2817 0.2906 0.2677 0.0092  0.0075  -0.0059 248  ASP B OD2   
1729 N N     . LEU B 64  ? 0.1513 0.1765 0.1646 -0.0094 -0.0075 0.0055  249  LEU B N     
1730 C CA    . LEU B 64  ? 0.1624 0.1775 0.1753 -0.0050 -0.0072 0.0053  249  LEU B CA    
1731 C C     . LEU B 64  ? 0.1586 0.1701 0.1689 -0.0088 -0.0084 0.0053  249  LEU B C     
1732 O O     . LEU B 64  ? 0.1645 0.1743 0.2014 -0.0095 -0.0093 0.0019  249  LEU B O     
1733 C CB    . LEU B 64  ? 0.1568 0.1762 0.1660 -0.0069 -0.0099 0.0053  249  LEU B CB    
1734 C CG    . LEU B 64  ? 0.1604 0.1834 0.1708 -0.0090 -0.0081 0.0029  249  LEU B CG    
1735 C CD1   . LEU B 64  ? 0.1654 0.1767 0.1961 0.0028  -0.0182 -0.0004 249  LEU B CD1   
1736 C CD2   . LEU B 64  ? 0.1669 0.1892 0.1832 -0.0038 -0.0024 0.0023  249  LEU B CD2   
1737 N N     . ILE B 65  ? 0.1681 0.1688 0.1726 -0.0058 -0.0036 0.0071  250  ILE B N     
1738 C CA    . ILE B 65  ? 0.1721 0.1675 0.1717 -0.0091 -0.0064 0.0069  250  ILE B CA    
1739 C C     . ILE B 65  ? 0.1780 0.1697 0.1781 -0.0094 -0.0050 0.0061  250  ILE B C     
1740 O O     . ILE B 65  ? 0.1802 0.1586 0.1716 -0.0172 -0.0054 0.0124  250  ILE B O     
1741 C CB    . ILE B 65  ? 0.1720 0.1783 0.1717 -0.0049 -0.0071 0.0067  250  ILE B CB    
1742 C CG1   . ILE B 65  ? 0.1779 0.1651 0.1745 -0.0142 -0.0018 0.0139  250  ILE B CG1   
1743 C CG2   . ILE B 65  ? 0.1658 0.1783 0.1639 -0.0059 -0.0102 0.0112  250  ILE B CG2   
1744 C CD1   . ILE B 65  ? 0.1769 0.1798 0.1817 -0.0117 -0.0002 0.0061  250  ILE B CD1   
1745 N N     . GLU B 66  ? 0.1895 0.1734 0.1894 -0.0068 -0.0042 0.0124  251  GLU B N     
1746 C CA    . GLU B 66  ? 0.1974 0.1862 0.1971 -0.0037 -0.0042 0.0085  251  GLU B CA    
1747 C C     . GLU B 66  ? 0.1862 0.1741 0.1844 -0.0087 -0.0067 0.0038  251  GLU B C     
1748 O O     . GLU B 66  ? 0.1793 0.1683 0.1791 -0.0103 -0.0093 0.0060  251  GLU B O     
1749 C CB    . GLU B 66  ? 0.2128 0.2024 0.2255 -0.0046 -0.0032 0.0136  251  GLU B CB    
1750 C CG    . GLU B 66  ? 0.2593 0.2662 0.2585 0.0129  0.0080  0.0031  251  GLU B CG    
1751 C CD    . GLU B 66  ? 0.3011 0.3124 0.3258 -0.0044 0.0088  0.0047  251  GLU B CD    
1752 O OE1   . GLU B 66  ? 0.3355 0.3371 0.3718 0.0087  0.0055  0.0064  251  GLU B OE1   
1753 O OE2   . GLU B 66  ? 0.3292 0.3611 0.3587 0.0131  0.0102  -0.0033 251  GLU B OE2   
1754 N N     . ILE B 67  ? 0.1848 0.1668 0.1808 -0.0052 -0.0048 0.0057  252  ILE B N     
1755 C CA    . ILE B 67  ? 0.1852 0.1786 0.1720 0.0002  -0.0028 0.0011  252  ILE B CA    
1756 C C     . ILE B 67  ? 0.1905 0.1756 0.1806 -0.0042 -0.0006 -0.0040 252  ILE B C     
1757 O O     . ILE B 67  ? 0.1911 0.1791 0.1616 -0.0033 -0.0003 -0.0120 252  ILE B O     
1758 C CB    . ILE B 67  ? 0.1772 0.1773 0.1726 -0.0012 -0.0055 0.0015  252  ILE B CB    
1759 C CG1   . ILE B 67  ? 0.1796 0.1860 0.1575 0.0059  0.0055  0.0034  252  ILE B CG1   
1760 C CG2   . ILE B 67  ? 0.1847 0.1830 0.1875 0.0098  0.0003  0.0104  252  ILE B CG2   
1761 C CD1   . ILE B 67  ? 0.1832 0.1914 0.1719 0.0016  -0.0074 0.0016  252  ILE B CD1   
1762 N N     . THR B 68  ? 0.2019 0.1793 0.1856 -0.0012 -0.0017 -0.0034 253  THR B N     
1763 C CA    . THR B 68  ? 0.2142 0.1857 0.1998 -0.0033 -0.0013 -0.0029 253  THR B CA    
1764 C C     . THR B 68  ? 0.2121 0.1839 0.1988 -0.0075 -0.0007 -0.0045 253  THR B C     
1765 O O     . THR B 68  ? 0.2199 0.1876 0.2062 -0.0028 -0.0041 -0.0055 253  THR B O     
1766 C CB    . THR B 68  ? 0.2151 0.1881 0.1994 -0.0052 -0.0026 -0.0017 253  THR B CB    
1767 O OG1   . THR B 68  ? 0.2361 0.1950 0.2210 0.0045  -0.0011 0.0028  253  THR B OG1   
1768 C CG2   . THR B 68  ? 0.2261 0.1991 0.2144 -0.0036 -0.0021 -0.0018 253  THR B CG2   
1769 N N     . ASP B 69  ? 0.2160 0.1920 0.2035 -0.0084 -0.0021 -0.0024 254  ASP B N     
1770 C CA    . ASP B 69  ? 0.2242 0.2038 0.2036 -0.0103 0.0005  -0.0006 254  ASP B CA    
1771 C C     . ASP B 69  ? 0.2180 0.1982 0.1947 -0.0097 0.0017  -0.0005 254  ASP B C     
1772 O O     . ASP B 69  ? 0.2230 0.1972 0.1998 -0.0102 0.0109  -0.0012 254  ASP B O     
1773 C CB    . ASP B 69  ? 0.2314 0.2123 0.2186 -0.0093 0.0013  0.0002  254  ASP B CB    
1774 C CG    . ASP B 69  ? 0.2716 0.2632 0.2570 -0.0007 -0.0072 -0.0012 254  ASP B CG    
1775 O OD1   . ASP B 69  ? 0.3099 0.3307 0.2979 -0.0004 0.0087  -0.0046 254  ASP B OD1   
1776 O OD2   . ASP B 69  ? 0.3065 0.2857 0.2966 0.0127  -0.0077 -0.0142 254  ASP B OD2   
1777 N N     . ALA B 70  ? 0.2084 0.1784 0.1888 -0.0135 0.0017  -0.0006 255  ALA B N     
1778 C CA    . ALA B 70  ? 0.2025 0.1817 0.1787 -0.0146 -0.0009 -0.0044 255  ALA B CA    
1779 C C     . ALA B 70  ? 0.2056 0.1831 0.1786 -0.0126 -0.0034 -0.0083 255  ALA B C     
1780 O O     . ALA B 70  ? 0.2153 0.1803 0.1823 -0.0143 -0.0009 -0.0067 255  ALA B O     
1781 C CB    . ALA B 70  ? 0.2009 0.1721 0.1708 -0.0128 -0.0041 -0.0040 255  ALA B CB    
1782 N N     . LYS B 71  ? 0.2032 0.1873 0.1822 -0.0097 -0.0056 -0.0124 256  LYS B N     
1783 C CA    . LYS B 71  ? 0.2052 0.1942 0.1780 -0.0074 -0.0053 -0.0132 256  LYS B CA    
1784 C C     . LYS B 71  ? 0.2065 0.2021 0.1819 -0.0060 -0.0048 -0.0116 256  LYS B C     
1785 O O     . LYS B 71  ? 0.2102 0.2012 0.1739 -0.0091 -0.0056 -0.0100 256  LYS B O     
1786 C CB    . LYS B 71  ? 0.2042 0.1978 0.1749 -0.0063 -0.0104 -0.0169 256  LYS B CB    
1787 C CG    . LYS B 71  ? 0.2010 0.1970 0.1705 -0.0109 -0.0143 -0.0214 256  LYS B CG    
1788 C CD    . LYS B 71  ? 0.2072 0.2022 0.1775 -0.0066 -0.0077 -0.0166 256  LYS B CD    
1789 C CE    . LYS B 71  ? 0.2056 0.1986 0.1883 0.0017  -0.0100 -0.0198 256  LYS B CE    
1790 N NZ    A LYS B 71  ? 0.2368 0.2271 0.2415 -0.0026 -0.0057 -0.0011 256  LYS B NZ    
1791 N NZ    B LYS B 71  ? 0.1899 0.1932 0.1492 -0.0035 -0.0072 -0.0111 256  LYS B NZ    
1792 N N     . LYS B 72  ? 0.2140 0.2089 0.1874 -0.0046 -0.0026 -0.0094 257  LYS B N     
1793 C CA    . LYS B 72  ? 0.2213 0.2192 0.2015 -0.0027 -0.0036 -0.0066 257  LYS B CA    
1794 C C     . LYS B 72  ? 0.2179 0.2138 0.2036 -0.0002 -0.0005 -0.0066 257  LYS B C     
1795 O O     . LYS B 72  ? 0.2138 0.2076 0.1955 -0.0004 -0.0015 -0.0122 257  LYS B O     
1796 C CB    . LYS B 72  ? 0.2191 0.2179 0.1979 -0.0016 0.0009  -0.0054 257  LYS B CB    
1797 C CG    . LYS B 72  ? 0.2362 0.2216 0.2230 -0.0030 -0.0057 -0.0071 257  LYS B CG    
1798 C CD    . LYS B 72  ? 0.2364 0.2559 0.2512 -0.0054 -0.0017 0.0020  257  LYS B CD    
1799 C CE    . LYS B 72  ? 0.2928 0.2962 0.2955 -0.0009 -0.0040 -0.0042 257  LYS B CE    
1800 N NZ    . LYS B 72  ? 0.3024 0.3205 0.3291 -0.0053 -0.0045 0.0054  257  LYS B NZ    
1801 N N     . ARG B 73  ? 0.2127 0.1977 0.1985 -0.0041 -0.0026 -0.0076 258  ARG B N     
1802 C CA    . ARG B 73  ? 0.2156 0.2100 0.1911 -0.0026 -0.0005 -0.0040 258  ARG B CA    
1803 C C     . ARG B 73  ? 0.2149 0.2067 0.1901 -0.0026 -0.0004 -0.0018 258  ARG B C     
1804 O O     . ARG B 73  ? 0.2224 0.2089 0.1838 -0.0054 0.0033  -0.0045 258  ARG B O     
1805 C CB    . ARG B 73  ? 0.2146 0.1994 0.1950 -0.0046 0.0008  -0.0025 258  ARG B CB    
1806 C CG    . ARG B 73  ? 0.2154 0.2176 0.2111 0.0009  -0.0019 -0.0043 258  ARG B CG    
1807 C CD    . ARG B 73  ? 0.2125 0.2276 0.2299 0.0005  0.0032  -0.0095 258  ARG B CD    
1808 N NE    . ARG B 73  ? 0.2122 0.2335 0.2172 -0.0053 0.0000  -0.0065 258  ARG B NE    
1809 C CZ    . ARG B 73  ? 0.2186 0.2399 0.2186 -0.0034 0.0010  -0.0018 258  ARG B CZ    
1810 N NH1   . ARG B 73  ? 0.2178 0.2412 0.1993 -0.0041 -0.0115 0.0056  258  ARG B NH1   
1811 N NH2   . ARG B 73  ? 0.2253 0.2575 0.2254 -0.0128 -0.0022 -0.0010 258  ARG B NH2   
1812 N N     . GLU B 74  ? 0.2123 0.2070 0.1835 -0.0046 -0.0015 -0.0048 259  GLU B N     
1813 C CA    . GLU B 74  ? 0.2150 0.2096 0.1882 -0.0044 -0.0041 0.0008  259  GLU B CA    
1814 C C     . GLU B 74  ? 0.2164 0.2105 0.1949 -0.0052 -0.0029 0.0000  259  GLU B C     
1815 O O     . GLU B 74  ? 0.2178 0.2191 0.1961 -0.0052 0.0020  0.0027  259  GLU B O     
1816 C CB    . GLU B 74  ? 0.2130 0.2100 0.1897 -0.0070 -0.0084 0.0060  259  GLU B CB    
1817 C CG    . GLU B 74  ? 0.2194 0.2104 0.2139 -0.0046 -0.0188 -0.0010 259  GLU B CG    
1818 C CD    . GLU B 74  ? 0.2175 0.2246 0.2122 0.0086  -0.0071 0.0000  259  GLU B CD    
1819 O OE1   . GLU B 74  ? 0.1955 0.2421 0.2181 0.0023  -0.0073 0.0098  259  GLU B OE1   
1820 O OE2   . GLU B 74  ? 0.2229 0.2053 0.2307 0.0034  -0.0064 0.0022  259  GLU B OE2   
1821 N N     . ALA B 75  ? 0.2219 0.2142 0.2027 -0.0021 -0.0031 0.0005  260  ALA B N     
1822 C CA    . ALA B 75  ? 0.2191 0.2113 0.1997 -0.0042 0.0000  -0.0005 260  ALA B CA    
1823 C C     . ALA B 75  ? 0.2227 0.2115 0.2026 -0.0020 -0.0006 -0.0044 260  ALA B C     
1824 O O     . ALA B 75  ? 0.2248 0.2268 0.2232 -0.0060 -0.0001 -0.0012 260  ALA B O     
1825 C CB    . ALA B 75  ? 0.2184 0.2047 0.2073 0.0023  0.0005  -0.0059 260  ALA B CB    
1826 N N     . LEU B 76  ? 0.2234 0.2121 0.2060 -0.0040 -0.0001 -0.0087 261  LEU B N     
1827 C CA    . LEU B 76  ? 0.2239 0.2167 0.2110 -0.0032 0.0004  -0.0040 261  LEU B CA    
1828 C C     . LEU B 76  ? 0.2197 0.2110 0.2069 -0.0005 0.0027  -0.0070 261  LEU B C     
1829 O O     . LEU B 76  ? 0.2307 0.2177 0.2218 0.0053  0.0065  -0.0121 261  LEU B O     
1830 C CB    . LEU B 76  ? 0.2270 0.2299 0.2173 -0.0020 0.0014  -0.0028 261  LEU B CB    
1831 C CG    . LEU B 76  ? 0.2380 0.2405 0.2413 -0.0031 0.0024  -0.0078 261  LEU B CG    
1832 C CD1   . LEU B 76  ? 0.2443 0.2627 0.2753 -0.0009 -0.0005 -0.0060 261  LEU B CD1   
1833 C CD2   . LEU B 76  ? 0.2473 0.2464 0.2474 -0.0075 -0.0040 -0.0143 261  LEU B CD2   
1834 N N     . TYR B 77  ? 0.2112 0.2105 0.1960 -0.0001 0.0012  -0.0100 262  TYR B N     
1835 C CA    . TYR B 77  ? 0.2041 0.2051 0.1918 0.0010  0.0035  -0.0087 262  TYR B CA    
1836 C C     . TYR B 77  ? 0.2067 0.2073 0.1979 0.0031  0.0027  -0.0078 262  TYR B C     
1837 O O     . TYR B 77  ? 0.1968 0.2045 0.1978 0.0031  0.0071  -0.0068 262  TYR B O     
1838 C CB    . TYR B 77  ? 0.1924 0.1996 0.1819 0.0023  0.0039  -0.0090 262  TYR B CB    
1839 C CG    . TYR B 77  ? 0.1784 0.1832 0.1757 -0.0072 0.0004  -0.0060 262  TYR B CG    
1840 C CD1   . TYR B 77  ? 0.1587 0.1575 0.1537 -0.0076 0.0134  -0.0017 262  TYR B CD1   
1841 C CD2   . TYR B 77  ? 0.1772 0.1690 0.1651 -0.0005 0.0016  -0.0063 262  TYR B CD2   
1842 C CE1   . TYR B 77  ? 0.1603 0.1727 0.1445 -0.0052 0.0030  -0.0035 262  TYR B CE1   
1843 C CE2   . TYR B 77  ? 0.1625 0.1648 0.1744 -0.0075 -0.0019 -0.0104 262  TYR B CE2   
1844 C CZ    . TYR B 77  ? 0.1816 0.1853 0.1606 -0.0021 0.0035  -0.0070 262  TYR B CZ    
1845 O OH    . TYR B 77  ? 0.1791 0.1981 0.1638 -0.0044 0.0006  -0.0046 262  TYR B OH    
1846 N N     . ALA B 78  ? 0.2189 0.2162 0.2107 0.0023  0.0030  -0.0064 263  ALA B N     
1847 C CA    . ALA B 78  ? 0.2274 0.2284 0.2276 0.0050  -0.0001 -0.0021 263  ALA B CA    
1848 C C     . ALA B 78  ? 0.2329 0.2356 0.2395 0.0055  0.0032  0.0002  263  ALA B C     
1849 O O     . ALA B 78  ? 0.2366 0.2508 0.2574 0.0113  0.0053  0.0029  263  ALA B O     
1850 C CB    . ALA B 78  ? 0.2264 0.2219 0.2247 0.0023  -0.0002 -0.0010 263  ALA B CB    
1851 N N     . GLN B 79  ? 0.2431 0.2420 0.2415 0.0055  0.0028  -0.0027 264  GLN B N     
1852 C CA    . GLN B 79  ? 0.2534 0.2529 0.2482 0.0051  0.0033  -0.0010 264  GLN B CA    
1853 C C     . GLN B 79  ? 0.2464 0.2414 0.2407 0.0034  0.0042  -0.0015 264  GLN B C     
1854 O O     . GLN B 79  ? 0.2492 0.2436 0.2433 0.0068  0.0057  -0.0014 264  GLN B O     
1855 C CB    . GLN B 79  ? 0.2503 0.2497 0.2473 0.0020  0.0034  -0.0022 264  GLN B CB    
1856 C CG    . GLN B 79  ? 0.2803 0.2706 0.2783 -0.0004 -0.0002 0.0029  264  GLN B CG    
1857 C CD    . GLN B 79  ? 0.2813 0.2869 0.2873 -0.0008 -0.0032 0.0001  264  GLN B CD    
1858 O OE1   . GLN B 79  ? 0.3339 0.3453 0.3103 0.0017  -0.0091 -0.0046 264  GLN B OE1   
1859 N NE2   . GLN B 79  ? 0.3025 0.3148 0.3095 -0.0034 0.0006  0.0039  264  GLN B NE2   
1860 N N     . ASP B 80  ? 0.2386 0.2302 0.2260 0.0033  0.0042  0.0001  265  ASP B N     
1861 C CA    . ASP B 80  ? 0.2276 0.2210 0.2171 0.0022  0.0035  0.0013  265  ASP B CA    
1862 C C     . ASP B 80  ? 0.2177 0.2123 0.2145 0.0033  0.0034  0.0042  265  ASP B C     
1863 O O     . ASP B 80  ? 0.2099 0.2050 0.1988 0.0053  0.0070  0.0071  265  ASP B O     
1864 C CB    . ASP B 80  ? 0.2317 0.2260 0.2172 -0.0021 0.0005  0.0018  265  ASP B CB    
1865 C CG    . ASP B 80  ? 0.2432 0.2329 0.2327 0.0012  -0.0045 -0.0001 265  ASP B CG    
1866 O OD1   . ASP B 80  ? 0.2397 0.2495 0.2290 0.0080  0.0125  0.0151  265  ASP B OD1   
1867 O OD2   . ASP B 80  ? 0.2608 0.2514 0.2431 0.0035  -0.0112 0.0083  265  ASP B OD2   
1868 N N     . PRO B 81  ? 0.2092 0.2110 0.2092 0.0084  0.0059  0.0026  266  PRO B N     
1869 C CA    . PRO B 81  ? 0.2052 0.2143 0.2143 0.0075  0.0060  0.0051  266  PRO B CA    
1870 C C     . PRO B 81  ? 0.1957 0.2069 0.1970 0.0078  0.0055  0.0015  266  PRO B C     
1871 O O     . PRO B 81  ? 0.1989 0.2050 0.2143 0.0080  0.0032  0.0002  266  PRO B O     
1872 C CB    . PRO B 81  ? 0.2064 0.2232 0.2296 0.0063  0.0022  0.0025  266  PRO B CB    
1873 C CG    . PRO B 81  ? 0.2125 0.2280 0.2364 0.0062  0.0008  -0.0020 266  PRO B CG    
1874 C CD    . PRO B 81  ? 0.2116 0.2225 0.2255 0.0103  0.0015  -0.0026 266  PRO B CD    
1875 N N     . SER B 82  ? 0.1855 0.2001 0.1783 0.0082  0.0112  0.0045  267  SER B N     
1876 C CA    . SER B 82  ? 0.1795 0.1937 0.1652 0.0069  0.0090  0.0071  267  SER B CA    
1877 C C     . SER B 82  ? 0.1704 0.1789 0.1587 0.0023  0.0097  0.0047  267  SER B C     
1878 O O     . SER B 82  ? 0.1662 0.1710 0.1516 0.0042  0.0111  0.0087  267  SER B O     
1879 C CB    . SER B 82  ? 0.1802 0.1913 0.1562 0.0031  0.0095  0.0040  267  SER B CB    
1880 O OG    . SER B 82  ? 0.1935 0.2163 0.1613 0.0051  -0.0039 0.0169  267  SER B OG    
1881 N N     . THR B 83  ? 0.1652 0.1668 0.1573 0.0034  0.0084  0.0050  268  THR B N     
1882 C CA    . THR B 83  ? 0.1620 0.1656 0.1543 0.0029  0.0079  -0.0020 268  THR B CA    
1883 C C     . THR B 83  ? 0.1571 0.1653 0.1550 0.0001  0.0053  0.0007  268  THR B C     
1884 O O     . THR B 83  ? 0.1522 0.1687 0.1573 0.0010  0.0070  0.0000  268  THR B O     
1885 C CB    . THR B 83  ? 0.1670 0.1655 0.1724 0.0018  0.0064  -0.0019 268  THR B CB    
1886 O OG1   . THR B 83  ? 0.1874 0.1960 0.1821 0.0048  0.0004  -0.0211 268  THR B OG1   
1887 C CG2   . THR B 83  ? 0.1644 0.1728 0.1602 0.0061  0.0050  -0.0046 268  THR B CG2   
1888 N N     . GLY B 84  ? 0.1525 0.1685 0.1418 -0.0033 0.0058  -0.0038 269  GLY B N     
1889 C CA    . GLY B 84  ? 0.1521 0.1588 0.1318 -0.0043 0.0068  -0.0022 269  GLY B CA    
1890 C C     . GLY B 84  ? 0.1413 0.1544 0.1362 -0.0033 0.0040  0.0033  269  GLY B C     
1891 O O     . GLY B 84  ? 0.1439 0.1619 0.1371 -0.0008 -0.0011 -0.0032 269  GLY B O     
1892 N N     . CYS B 85  ? 0.1369 0.1534 0.1295 0.0010  0.0110  0.0033  270  CYS B N     
1893 C CA    . CYS B 85  ? 0.1322 0.1346 0.1259 0.0017  0.0056  0.0085  270  CYS B CA    
1894 C C     . CYS B 85  ? 0.1307 0.1315 0.1225 0.0016  0.0012  0.0068  270  CYS B C     
1895 O O     . CYS B 85  ? 0.1254 0.1265 0.1469 -0.0094 0.0020  0.0091  270  CYS B O     
1896 C CB    . CYS B 85  ? 0.1340 0.1412 0.1347 0.0048  0.0049  0.0071  270  CYS B CB    
1897 S SG    . CYS B 85  ? 0.1553 0.1617 0.1471 0.0091  0.0055  -0.0047 270  CYS B SG    
1898 N N     . TYR B 86  ? 0.1274 0.1279 0.1316 -0.0028 0.0083  0.0010  271  TYR B N     
1899 C CA    . TYR B 86  ? 0.1270 0.1292 0.1361 -0.0029 0.0093  0.0060  271  TYR B CA    
1900 C C     . TYR B 86  ? 0.1246 0.1314 0.1324 -0.0031 0.0081  0.0070  271  TYR B C     
1901 O O     . TYR B 86  ? 0.1270 0.1351 0.1472 -0.0012 0.0158  0.0093  271  TYR B O     
1902 C CB    . TYR B 86  ? 0.1324 0.1190 0.1387 -0.0069 0.0094  0.0070  271  TYR B CB    
1903 C CG    . TYR B 86  ? 0.1283 0.1128 0.1269 -0.0092 0.0004  0.0079  271  TYR B CG    
1904 C CD1   . TYR B 86  ? 0.1284 0.1168 0.1435 -0.0136 -0.0021 -0.0057 271  TYR B CD1   
1905 C CD2   . TYR B 86  ? 0.1211 0.1222 0.1326 -0.0063 0.0084  0.0100  271  TYR B CD2   
1906 C CE1   . TYR B 86  ? 0.1278 0.1192 0.1316 -0.0155 -0.0032 0.0045  271  TYR B CE1   
1907 C CE2   . TYR B 86  ? 0.1281 0.1079 0.1489 -0.0097 0.0088  0.0158  271  TYR B CE2   
1908 C CZ    . TYR B 86  ? 0.1328 0.1184 0.1273 -0.0191 0.0003  0.0045  271  TYR B CZ    
1909 O OH    . TYR B 86  ? 0.1417 0.1191 0.1488 -0.0283 0.0073  0.0019  271  TYR B OH    
1910 N N     . MET B 87  ? 0.1209 0.1246 0.1307 -0.0051 0.0114  0.0036  272  MET B N     
1911 C CA    . MET B 87  ? 0.1367 0.1280 0.1234 -0.0036 0.0115  0.0001  272  MET B CA    
1912 C C     . MET B 87  ? 0.1280 0.1260 0.1262 -0.0003 0.0079  -0.0006 272  MET B C     
1913 O O     . MET B 87  ? 0.1279 0.1529 0.1357 -0.0025 0.0145  -0.0086 272  MET B O     
1914 C CB    . MET B 87  ? 0.1384 0.1276 0.1279 -0.0006 0.0147  -0.0039 272  MET B CB    
1915 C CG    . MET B 87  ? 0.1615 0.1419 0.1355 -0.0021 -0.0032 -0.0038 272  MET B CG    
1916 S SD    . MET B 87  ? 0.1615 0.1510 0.1536 -0.0056 0.0042  -0.0073 272  MET B SD    
1917 C CE    . MET B 87  ? 0.1623 0.1442 0.1674 -0.0045 0.0035  0.0070  272  MET B CE    
1918 N N     . TYR B 88  ? 0.1285 0.1259 0.1295 -0.0015 0.0087  0.0022  273  TYR B N     
1919 C CA    . TYR B 88  ? 0.1227 0.1249 0.1311 -0.0013 0.0057  0.0017  273  TYR B CA    
1920 C C     . TYR B 88  ? 0.1228 0.1240 0.1222 -0.0014 0.0026  0.0051  273  TYR B C     
1921 O O     . TYR B 88  ? 0.1156 0.1245 0.1239 0.0012  -0.0029 0.0078  273  TYR B O     
1922 C CB    . TYR B 88  ? 0.1316 0.1170 0.1209 0.0007  0.0004  -0.0026 273  TYR B CB    
1923 C CG    . TYR B 88  ? 0.1254 0.1224 0.1177 -0.0003 0.0014  -0.0020 273  TYR B CG    
1924 C CD1   . TYR B 88  ? 0.1123 0.1358 0.1206 0.0042  0.0046  0.0028  273  TYR B CD1   
1925 C CD2   . TYR B 88  ? 0.1389 0.1385 0.1518 0.0019  -0.0033 -0.0019 273  TYR B CD2   
1926 C CE1   . TYR B 88  ? 0.1297 0.1395 0.1358 -0.0048 0.0057  -0.0019 273  TYR B CE1   
1927 C CE2   . TYR B 88  ? 0.1372 0.1490 0.1266 0.0009  0.0006  -0.0007 273  TYR B CE2   
1928 C CZ    . TYR B 88  ? 0.1399 0.1354 0.1316 -0.0102 -0.0006 -0.0030 273  TYR B CZ    
1929 O OH    . TYR B 88  ? 0.1556 0.1494 0.1383 0.0042  -0.0140 -0.0142 273  TYR B OH    
1930 N N     . TYR B 89  ? 0.1167 0.1209 0.1284 -0.0034 -0.0004 0.0114  274  TYR B N     
1931 C CA    . TYR B 89  ? 0.1263 0.1225 0.1329 -0.0042 0.0007  0.0083  274  TYR B CA    
1932 C C     . TYR B 89  ? 0.1189 0.1234 0.1330 -0.0100 0.0016  0.0096  274  TYR B C     
1933 O O     . TYR B 89  ? 0.1284 0.1360 0.1429 -0.0149 0.0005  0.0037  274  TYR B O     
1934 C CB    . TYR B 89  ? 0.1319 0.1390 0.1554 -0.0006 0.0027  0.0042  274  TYR B CB    
1935 C CG    . TYR B 89  ? 0.1373 0.1525 0.1489 0.0000  -0.0011 0.0070  274  TYR B CG    
1936 C CD1   . TYR B 89  ? 0.1559 0.1605 0.1635 0.0038  0.0043  0.0020  274  TYR B CD1   
1937 C CD2   . TYR B 89  ? 0.1595 0.1825 0.1641 -0.0019 -0.0020 0.0061  274  TYR B CD2   
1938 C CE1   . TYR B 89  ? 0.1480 0.1491 0.1682 0.0062  0.0016  -0.0035 274  TYR B CE1   
1939 C CE2   . TYR B 89  ? 0.1651 0.1809 0.1828 0.0071  0.0011  0.0006  274  TYR B CE2   
1940 C CZ    . TYR B 89  ? 0.1561 0.1697 0.1670 0.0147  -0.0031 -0.0013 274  TYR B CZ    
1941 O OH    . TYR B 89  ? 0.1818 0.1980 0.1735 0.0063  -0.0055 -0.0096 274  TYR B OH    
1942 N N     . PHE B 90  ? 0.1149 0.1276 0.1255 -0.0025 0.0023  0.0178  275  PHE B N     
1943 C CA    . PHE B 90  ? 0.1281 0.1181 0.1370 -0.0054 0.0049  0.0124  275  PHE B CA    
1944 C C     . PHE B 90  ? 0.1245 0.1306 0.1403 -0.0109 0.0009  0.0129  275  PHE B C     
1945 O O     . PHE B 90  ? 0.1395 0.1289 0.1524 -0.0077 -0.0097 0.0150  275  PHE B O     
1946 C CB    . PHE B 90  ? 0.1284 0.1246 0.1373 -0.0001 0.0004  0.0094  275  PHE B CB    
1947 C CG    . PHE B 90  ? 0.1394 0.1332 0.1523 -0.0019 0.0017  0.0113  275  PHE B CG    
1948 C CD1   . PHE B 90  ? 0.1309 0.1428 0.1543 -0.0002 -0.0008 0.0038  275  PHE B CD1   
1949 C CD2   . PHE B 90  ? 0.1266 0.1271 0.1476 -0.0047 -0.0109 0.0110  275  PHE B CD2   
1950 C CE1   . PHE B 90  ? 0.1246 0.1490 0.1571 -0.0110 0.0053  0.0124  275  PHE B CE1   
1951 C CE2   . PHE B 90  ? 0.1372 0.1291 0.1377 0.0054  -0.0022 0.0231  275  PHE B CE2   
1952 C CZ    . PHE B 90  ? 0.1236 0.1547 0.1689 -0.0020 -0.0038 0.0155  275  PHE B CZ    
1953 N N     . GLN B 91  ? 0.1326 0.1480 0.1494 -0.0130 -0.0019 0.0125  276  GLN B N     
1954 C CA    . GLN B 91  ? 0.1481 0.1582 0.1576 -0.0113 -0.0009 0.0143  276  GLN B CA    
1955 C C     . GLN B 91  ? 0.1522 0.1553 0.1543 -0.0103 -0.0024 0.0093  276  GLN B C     
1956 O O     . GLN B 91  ? 0.1553 0.1507 0.1445 -0.0130 -0.0036 0.0091  276  GLN B O     
1957 C CB    . GLN B 91  ? 0.1579 0.1692 0.1499 -0.0026 0.0006  0.0089  276  GLN B CB    
1958 C CG    . GLN B 91  ? 0.1706 0.1871 0.1908 -0.0012 -0.0049 0.0106  276  GLN B CG    
1959 C CD    . GLN B 91  ? 0.1660 0.1893 0.1883 -0.0134 -0.0074 0.0187  276  GLN B CD    
1960 O OE1   . GLN B 91  ? 0.1843 0.1814 0.2239 -0.0044 0.0044  0.0227  276  GLN B OE1   
1961 N NE2   . GLN B 91  ? 0.1362 0.1564 0.1641 0.0030  -0.0285 0.0059  276  GLN B NE2   
1962 N N     . TYR B 92  ? 0.1461 0.1645 0.1564 -0.0083 -0.0047 0.0122  277  TYR B N     
1963 C CA    . TYR B 92  ? 0.1553 0.1746 0.1703 -0.0041 -0.0037 0.0145  277  TYR B CA    
1964 C C     . TYR B 92  ? 0.1503 0.1700 0.1711 -0.0061 -0.0067 0.0106  277  TYR B C     
1965 O O     . TYR B 92  ? 0.1469 0.1682 0.1608 -0.0064 -0.0090 0.0088  277  TYR B O     
1966 C CB    . TYR B 92  ? 0.1627 0.1839 0.1805 -0.0023 -0.0069 0.0128  277  TYR B CB    
1967 C CG    . TYR B 92  ? 0.1764 0.1842 0.1982 0.0013  -0.0023 0.0119  277  TYR B CG    
1968 C CD1   . TYR B 92  ? 0.1782 0.1854 0.1895 0.0031  0.0021  0.0147  277  TYR B CD1   
1969 C CD2   . TYR B 92  ? 0.1831 0.1892 0.2070 -0.0033 -0.0045 0.0071  277  TYR B CD2   
1970 C CE1   . TYR B 92  ? 0.1917 0.2136 0.2236 0.0029  0.0006  0.0152  277  TYR B CE1   
1971 C CE2   . TYR B 92  ? 0.1796 0.2073 0.2360 0.0002  -0.0049 0.0073  277  TYR B CE2   
1972 C CZ    . TYR B 92  ? 0.1778 0.2101 0.2146 0.0071  0.0071  0.0144  277  TYR B CZ    
1973 O OH    . TYR B 92  ? 0.1874 0.2228 0.2518 0.0143  0.0105  0.0149  277  TYR B OH    
1974 N N     . LEU B 93  ? 0.1549 0.1835 0.1766 -0.0048 -0.0018 0.0159  278  LEU B N     
1975 C CA    . LEU B 93  ? 0.1628 0.1883 0.1787 -0.0068 -0.0060 0.0131  278  LEU B CA    
1976 C C     . LEU B 93  ? 0.1580 0.1908 0.1676 -0.0063 -0.0059 0.0114  278  LEU B C     
1977 O O     . LEU B 93  ? 0.1551 0.2023 0.1749 -0.0033 -0.0091 0.0123  278  LEU B O     
1978 C CB    . LEU B 93  ? 0.1663 0.1950 0.1918 -0.0030 -0.0048 0.0088  278  LEU B CB    
1979 C CG    . LEU B 93  ? 0.1787 0.2057 0.2182 -0.0023 -0.0082 0.0134  278  LEU B CG    
1980 C CD1   . LEU B 93  ? 0.1754 0.2295 0.2209 -0.0043 -0.0023 0.0120  278  LEU B CD1   
1981 C CD2   . LEU B 93  ? 0.2196 0.2210 0.2393 0.0008  -0.0062 0.0051  278  LEU B CD2   
1982 N N     . SER B 94  ? 0.1456 0.1931 0.1578 -0.0050 -0.0087 0.0063  279  SER B N     
1983 C CA    . SER B 94  ? 0.1378 0.1880 0.1607 -0.0110 -0.0132 0.0024  279  SER B CA    
1984 C C     . SER B 94  ? 0.1254 0.1808 0.1581 -0.0127 -0.0155 0.0042  279  SER B C     
1985 O O     . SER B 94  ? 0.1317 0.1859 0.1632 -0.0116 -0.0269 0.0046  279  SER B O     
1986 C CB    . SER B 94  ? 0.1418 0.1949 0.1631 -0.0020 -0.0125 0.0075  279  SER B CB    
1987 O OG    . SER B 94  ? 0.1899 0.2408 0.1944 -0.0046 -0.0089 0.0030  279  SER B OG    
1988 N N     . LYS B 95  ? 0.1172 0.1764 0.1549 -0.0160 -0.0145 0.0014  280  LYS B N     
1989 C CA    . LYS B 95  ? 0.1379 0.1680 0.1566 -0.0159 -0.0096 0.0042  280  LYS B CA    
1990 C C     . LYS B 95  ? 0.1374 0.1548 0.1493 -0.0129 -0.0102 0.0037  280  LYS B C     
1991 O O     . LYS B 95  ? 0.1465 0.1477 0.1543 -0.0187 0.0013  -0.0006 280  LYS B O     
1992 C CB    . LYS B 95  ? 0.1452 0.1731 0.1615 -0.0163 -0.0120 0.0009  280  LYS B CB    
1993 C CG    . LYS B 95  ? 0.1782 0.1995 0.1921 -0.0214 0.0076  0.0085  280  LYS B CG    
1994 C CD    . LYS B 95  ? 0.2356 0.2686 0.2320 -0.0092 -0.0123 0.0044  280  LYS B CD    
1995 C CE    . LYS B 95  ? 0.2967 0.2853 0.2864 -0.0063 -0.0067 -0.0011 280  LYS B CE    
1996 N NZ    . LYS B 95  ? 0.3283 0.3211 0.3095 0.0023  -0.0001 0.0090  280  LYS B NZ    
1997 N N     . THR B 96  ? 0.1308 0.1414 0.1377 -0.0159 -0.0109 0.0114  281  THR B N     
1998 C CA    . THR B 96  ? 0.1229 0.1395 0.1316 -0.0094 -0.0105 0.0132  281  THR B CA    
1999 C C     . THR B 96  ? 0.1272 0.1336 0.1322 -0.0108 -0.0135 0.0095  281  THR B C     
2000 O O     . THR B 96  ? 0.1331 0.1348 0.1400 -0.0063 -0.0157 0.0116  281  THR B O     
2001 C CB    . THR B 96  ? 0.1278 0.1436 0.1349 -0.0090 -0.0159 0.0141  281  THR B CB    
2002 O OG1   . THR B 96  ? 0.1294 0.1534 0.1324 0.0023  -0.0306 0.0100  281  THR B OG1   
2003 C CG2   . THR B 96  ? 0.1279 0.1584 0.1314 -0.0081 -0.0041 0.0172  281  THR B CG2   
2004 N N     . TYR B 97  ? 0.1297 0.1341 0.1336 -0.0110 -0.0115 0.0185  282  TYR B N     
2005 C CA    . TYR B 97  ? 0.1315 0.1328 0.1377 -0.0075 -0.0075 0.0142  282  TYR B CA    
2006 C C     . TYR B 97  ? 0.1301 0.1276 0.1343 -0.0075 -0.0060 0.0106  282  TYR B C     
2007 O O     . TYR B 97  ? 0.1281 0.1217 0.1274 -0.0030 -0.0101 0.0060  282  TYR B O     
2008 C CB    . TYR B 97  ? 0.1465 0.1545 0.1534 -0.0007 -0.0012 0.0163  282  TYR B CB    
2009 C CG    . TYR B 97  ? 0.1396 0.1531 0.1535 -0.0071 0.0007  0.0035  282  TYR B CG    
2010 C CD1   . TYR B 97  ? 0.1389 0.1815 0.1632 -0.0097 0.0021  0.0032  282  TYR B CD1   
2011 C CD2   . TYR B 97  ? 0.1625 0.1618 0.1611 -0.0012 -0.0001 0.0075  282  TYR B CD2   
2012 C CE1   . TYR B 97  ? 0.1390 0.1847 0.1625 -0.0116 -0.0025 0.0065  282  TYR B CE1   
2013 C CE2   . TYR B 97  ? 0.1622 0.1749 0.1614 -0.0056 0.0101  -0.0014 282  TYR B CE2   
2014 C CZ    . TYR B 97  ? 0.1541 0.1943 0.1647 -0.0107 0.0016  0.0085  282  TYR B CZ    
2015 O OH    . TYR B 97  ? 0.1457 0.2060 0.1853 -0.0146 -0.0011 0.0153  282  TYR B OH    
2016 N N     . CYS B 98  ? 0.1353 0.1263 0.1341 -0.0060 -0.0014 0.0068  283  CYS B N     
2017 C CA    . CYS B 98  ? 0.1338 0.1277 0.1353 -0.0051 0.0026  0.0080  283  CYS B CA    
2018 C C     . CYS B 98  ? 0.1400 0.1370 0.1400 -0.0063 -0.0022 0.0109  283  CYS B C     
2019 O O     . CYS B 98  ? 0.1421 0.1385 0.1585 -0.0188 -0.0060 0.0130  283  CYS B O     
2020 C CB    . CYS B 98  ? 0.1354 0.1388 0.1443 -0.0065 0.0050  -0.0013 283  CYS B CB    
2021 S SG    . CYS B 98  ? 0.1574 0.1393 0.1517 -0.0128 0.0017  0.0003  283  CYS B SG    
2022 N N     . VAL B 99  ? 0.1360 0.1405 0.1307 -0.0032 0.0018  0.0069  284  VAL B N     
2023 C CA    . VAL B 99  ? 0.1317 0.1212 0.1250 -0.0016 0.0018  0.0065  284  VAL B CA    
2024 C C     . VAL B 99  ? 0.1262 0.1213 0.1338 -0.0045 0.0002  0.0084  284  VAL B C     
2025 O O     . VAL B 99  ? 0.1161 0.1368 0.1391 -0.0058 -0.0053 0.0068  284  VAL B O     
2026 C CB    . VAL B 99  ? 0.1301 0.1140 0.1198 0.0010  0.0005  0.0083  284  VAL B CB    
2027 C CG1   . VAL B 99  ? 0.1432 0.1283 0.1369 0.0056  -0.0037 0.0123  284  VAL B CG1   
2028 C CG2   . VAL B 99  ? 0.1557 0.1325 0.1322 0.0063  0.0117  0.0107  284  VAL B CG2   
2029 N N     . ASP B 100 ? 0.1249 0.1319 0.1365 -0.0019 -0.0021 0.0103  285  ASP B N     
2030 C CA    . ASP B 100 ? 0.1399 0.1401 0.1363 -0.0009 -0.0040 0.0007  285  ASP B CA    
2031 C C     . ASP B 100 ? 0.1406 0.1421 0.1451 -0.0010 -0.0038 0.0025  285  ASP B C     
2032 O O     . ASP B 100 ? 0.1353 0.1473 0.1521 -0.0034 -0.0072 0.0039  285  ASP B O     
2033 C CB    . ASP B 100 ? 0.1444 0.1464 0.1592 -0.0010 -0.0008 -0.0012 285  ASP B CB    
2034 C CG    . ASP B 100 ? 0.1528 0.1528 0.1444 -0.0072 -0.0065 0.0040  285  ASP B CG    
2035 O OD1   . ASP B 100 ? 0.1712 0.1695 0.1740 -0.0147 0.0029  -0.0094 285  ASP B OD1   
2036 O OD2   . ASP B 100 ? 0.1691 0.1738 0.1706 -0.0077 0.0139  -0.0074 285  ASP B OD2   
2037 N N     . ALA B 101 ? 0.1408 0.1307 0.1389 -0.0023 -0.0021 0.0023  286  ALA B N     
2038 C CA    . ALA B 101 ? 0.1476 0.1345 0.1339 -0.0019 0.0018  0.0002  286  ALA B CA    
2039 C C     . ALA B 101 ? 0.1451 0.1390 0.1378 -0.0020 0.0021  -0.0014 286  ALA B C     
2040 O O     . ALA B 101 ? 0.1410 0.1390 0.1374 -0.0004 0.0035  0.0048  286  ALA B O     
2041 C CB    . ALA B 101 ? 0.1447 0.1355 0.1426 -0.0086 0.0006  -0.0028 286  ALA B CB    
2042 N N     . THR B 102 ? 0.1514 0.1508 0.1272 -0.0007 0.0029  -0.0040 287  THR B N     
2043 C CA    . THR B 102 ? 0.1526 0.1560 0.1286 0.0041  0.0064  0.0012  287  THR B CA    
2044 C C     . THR B 102 ? 0.1581 0.1590 0.1395 0.0041  0.0005  -0.0035 287  THR B C     
2045 O O     . THR B 102 ? 0.1679 0.1659 0.1418 0.0023  0.0043  0.0024  287  THR B O     
2046 C CB    . THR B 102 ? 0.1480 0.1478 0.1204 0.0018  0.0033  -0.0003 287  THR B CB    
2047 O OG1   . THR B 102 ? 0.1316 0.1643 0.1269 0.0145  0.0019  0.0111  287  THR B OG1   
2048 C CG2   . THR B 102 ? 0.1691 0.1616 0.1296 0.0056  0.0100  -0.0062 287  THR B CG2   
2049 N N     . ARG B 103 ? 0.1650 0.1737 0.1441 0.0024  -0.0047 -0.0045 288  ARG B N     
2050 C CA    . ARG B 103 ? 0.1655 0.1795 0.1472 -0.0030 -0.0054 0.0031  288  ARG B CA    
2051 C C     . ARG B 103 ? 0.1612 0.1795 0.1423 0.0006  -0.0020 0.0012  288  ARG B C     
2052 O O     . ARG B 103 ? 0.1676 0.1828 0.1468 -0.0003 0.0075  -0.0033 288  ARG B O     
2053 C CB    . ARG B 103 ? 0.1643 0.1948 0.1590 0.0002  -0.0109 -0.0017 288  ARG B CB    
2054 C CG    . ARG B 103 ? 0.1905 0.2092 0.1745 0.0020  -0.0114 0.0058  288  ARG B CG    
2055 C CD    . ARG B 103 ? 0.2150 0.2380 0.2421 -0.0065 -0.0066 -0.0026 288  ARG B CD    
2056 N NE    . ARG B 103 ? 0.2492 0.2778 0.2588 0.0026  0.0031  0.0001  288  ARG B NE    
2057 C CZ    . ARG B 103 ? 0.2694 0.2739 0.2673 0.0019  -0.0027 -0.0018 288  ARG B CZ    
2058 N NH1   . ARG B 103 ? 0.2719 0.2878 0.2611 -0.0064 -0.0103 -0.0013 288  ARG B NH1   
2059 N NH2   . ARG B 103 ? 0.2761 0.2911 0.2729 -0.0031 0.0045  -0.0008 288  ARG B NH2   
2060 N N     . GLU B 104 ? 0.1642 0.1849 0.1397 0.0004  0.0027  0.0032  289  GLU B N     
2061 C CA    . GLU B 104 ? 0.1652 0.1841 0.1395 0.0024  0.0057  0.0028  289  GLU B CA    
2062 C C     . GLU B 104 ? 0.1643 0.1844 0.1433 0.0036  0.0022  0.0010  289  GLU B C     
2063 O O     . GLU B 104 ? 0.1722 0.1945 0.1676 0.0117  0.0030  -0.0006 289  GLU B O     
2064 C CB    . GLU B 104 ? 0.1653 0.1860 0.1446 -0.0046 0.0094  0.0033  289  GLU B CB    
2065 C CG    . GLU B 104 ? 0.1597 0.1918 0.1658 -0.0046 0.0060  -0.0005 289  GLU B CG    
2066 C CD    . GLU B 104 ? 0.1727 0.1969 0.1538 -0.0033 0.0075  0.0063  289  GLU B CD    
2067 O OE1   . GLU B 104 ? 0.1423 0.2125 0.1462 -0.0058 0.0101  -0.0060 289  GLU B OE1   
2068 O OE2   . GLU B 104 ? 0.1626 0.2168 0.1975 -0.0106 -0.0003 0.0034  289  GLU B OE2   
2069 N N     . THR B 105 ? 0.1594 0.1820 0.1491 0.0056  0.0018  0.0007  290  THR B N     
2070 C CA    . THR B 105 ? 0.1557 0.1793 0.1390 0.0019  0.0008  0.0031  290  THR B CA    
2071 C C     . THR B 105 ? 0.1576 0.1784 0.1338 0.0006  -0.0015 0.0051  290  THR B C     
2072 O O     . THR B 105 ? 0.1392 0.1758 0.1240 0.0000  0.0035  0.0105  290  THR B O     
2073 C CB    . THR B 105 ? 0.1618 0.1761 0.1412 -0.0002 -0.0010 -0.0001 290  THR B CB    
2074 O OG1   . THR B 105 ? 0.1473 0.1929 0.1392 -0.0016 -0.0060 -0.0051 290  THR B OG1   
2075 C CG2   . THR B 105 ? 0.1646 0.1823 0.1413 -0.0053 0.0032  0.0047  290  THR B CG2   
2076 N N     . ASN B 106 ? 0.1583 0.1819 0.1426 0.0038  -0.0044 0.0074  291  ASN B N     
2077 C CA    . ASN B 106 ? 0.1625 0.1779 0.1472 0.0035  -0.0050 0.0040  291  ASN B CA    
2078 C C     . ASN B 106 ? 0.1567 0.1750 0.1458 0.0052  -0.0058 0.0026  291  ASN B C     
2079 O O     . ASN B 106 ? 0.1663 0.1860 0.1536 0.0073  -0.0027 0.0084  291  ASN B O     
2080 C CB    . ASN B 106 ? 0.1748 0.1859 0.1648 0.0059  -0.0069 0.0042  291  ASN B CB    
2081 C CG    . ASN B 106 ? 0.1912 0.2032 0.1823 0.0021  -0.0103 0.0058  291  ASN B CG    
2082 O OD1   . ASN B 106 ? 0.2261 0.2415 0.1869 0.0008  -0.0050 0.0201  291  ASN B OD1   
2083 N ND2   . ASN B 106 ? 0.2214 0.2632 0.2461 0.0051  -0.0286 0.0067  291  ASN B ND2   
2084 N N     . ARG B 107 ? 0.1543 0.1726 0.1393 0.0020  -0.0003 0.0018  292  ARG B N     
2085 C CA    . ARG B 107 ? 0.1539 0.1659 0.1377 0.0012  -0.0016 -0.0069 292  ARG B CA    
2086 C C     . ARG B 107 ? 0.1432 0.1652 0.1373 0.0039  -0.0026 -0.0088 292  ARG B C     
2087 O O     . ARG B 107 ? 0.1553 0.1752 0.1455 0.0083  -0.0036 -0.0271 292  ARG B O     
2088 C CB    . ARG B 107 ? 0.1672 0.1749 0.1485 -0.0017 0.0034  -0.0017 292  ARG B CB    
2089 C CG    . ARG B 107 ? 0.1759 0.1970 0.1712 -0.0025 0.0039  0.0010  292  ARG B CG    
2090 C CD    . ARG B 107 ? 0.2196 0.2289 0.2609 0.0077  0.0113  -0.0092 292  ARG B CD    
2091 N NE    . ARG B 107 ? 0.2496 0.2647 0.2766 -0.0038 0.0157  -0.0011 292  ARG B NE    
2092 C CZ    . ARG B 107 ? 0.2285 0.2287 0.2380 0.0037  0.0070  -0.0100 292  ARG B CZ    
2093 N NH1   . ARG B 107 ? 0.1720 0.1860 0.2425 0.0018  0.0014  -0.0007 292  ARG B NH1   
2094 N NH2   . ARG B 107 ? 0.2222 0.2198 0.2498 0.0061  -0.0047 -0.0154 292  ARG B NH2   
2095 N N     . LEU B 108 ? 0.1290 0.1412 0.1306 0.0066  -0.0012 -0.0062 293  LEU B N     
2096 C CA    . LEU B 108 ? 0.1321 0.1373 0.1280 0.0044  -0.0063 -0.0037 293  LEU B CA    
2097 C C     . LEU B 108 ? 0.1224 0.1279 0.1182 0.0008  0.0014  -0.0006 293  LEU B C     
2098 O O     . LEU B 108 ? 0.1138 0.1426 0.1235 0.0032  0.0037  -0.0029 293  LEU B O     
2099 C CB    . LEU B 108 ? 0.1361 0.1363 0.1378 0.0084  -0.0027 0.0018  293  LEU B CB    
2100 C CG    . LEU B 108 ? 0.1644 0.1486 0.1526 0.0052  -0.0091 0.0013  293  LEU B CG    
2101 C CD1   . LEU B 108 ? 0.2007 0.1618 0.1510 0.0077  0.0032  -0.0123 293  LEU B CD1   
2102 C CD2   . LEU B 108 ? 0.1895 0.1748 0.1809 0.0204  0.0044  0.0149  293  LEU B CD2   
2103 N N     . GLY B 109 ? 0.1236 0.1257 0.1030 0.0054  0.0067  -0.0008 294  GLY B N     
2104 C CA    . GLY B 109 ? 0.1203 0.1306 0.1065 0.0026  0.0001  -0.0027 294  GLY B CA    
2105 C C     . GLY B 109 ? 0.1076 0.1291 0.1064 -0.0008 0.0008  0.0015  294  GLY B C     
2106 O O     . GLY B 109 ? 0.1125 0.1370 0.1065 0.0000  0.0008  -0.0022 294  GLY B O     
2107 N N     . ARG B 110 ? 0.1109 0.1393 0.1149 0.0003  0.0032  -0.0090 295  ARG B N     
2108 C CA    . ARG B 110 ? 0.1250 0.1423 0.1269 -0.0020 -0.0004 -0.0114 295  ARG B CA    
2109 C C     . ARG B 110 ? 0.1264 0.1398 0.1184 -0.0011 0.0011  -0.0079 295  ARG B C     
2110 O O     . ARG B 110 ? 0.1320 0.1479 0.1429 0.0000  -0.0049 -0.0101 295  ARG B O     
2111 C CB    . ARG B 110 ? 0.1221 0.1411 0.1195 0.0007  -0.0048 -0.0105 295  ARG B CB    
2112 C CG    . ARG B 110 ? 0.1290 0.1539 0.1243 -0.0043 0.0000  -0.0019 295  ARG B CG    
2113 C CD    . ARG B 110 ? 0.1318 0.1574 0.1324 -0.0006 0.0013  -0.0121 295  ARG B CD    
2114 N NE    . ARG B 110 ? 0.1215 0.1362 0.1215 -0.0100 0.0014  -0.0061 295  ARG B NE    
2115 C CZ    . ARG B 110 ? 0.1455 0.1463 0.1066 0.0069  -0.0030 0.0009  295  ARG B CZ    
2116 N NH1   . ARG B 110 ? 0.1504 0.1462 0.1162 0.0099  -0.0040 -0.0125 295  ARG B NH1   
2117 N NH2   . ARG B 110 ? 0.1564 0.1453 0.1174 0.0070  -0.0108 -0.0073 295  ARG B NH2   
2118 N N     . LEU B 111 ? 0.1281 0.1429 0.1086 -0.0064 -0.0007 -0.0086 296  LEU B N     
2119 C CA    . LEU B 111 ? 0.1305 0.1373 0.1144 -0.0070 -0.0003 -0.0070 296  LEU B CA    
2120 C C     . LEU B 111 ? 0.1306 0.1383 0.1213 -0.0034 -0.0004 -0.0078 296  LEU B C     
2121 O O     . LEU B 111 ? 0.1301 0.1368 0.1233 -0.0046 0.0061  -0.0170 296  LEU B O     
2122 C CB    . LEU B 111 ? 0.1333 0.1463 0.1259 -0.0017 -0.0051 -0.0047 296  LEU B CB    
2123 C CG    . LEU B 111 ? 0.1369 0.1385 0.1148 0.0006  -0.0004 0.0037  296  LEU B CG    
2124 C CD1   . LEU B 111 ? 0.1642 0.1377 0.1483 -0.0053 -0.0075 0.0094  296  LEU B CD1   
2125 C CD2   . LEU B 111 ? 0.1554 0.1854 0.1391 0.0128  -0.0024 -0.0074 296  LEU B CD2   
2126 N N     . ILE B 112 ? 0.1207 0.1240 0.1049 0.0042  -0.0055 -0.0102 297  ILE B N     
2127 C CA    . ILE B 112 ? 0.1135 0.1289 0.1059 0.0070  -0.0102 -0.0026 297  ILE B CA    
2128 C C     . ILE B 112 ? 0.1063 0.1224 0.1063 0.0036  0.0006  -0.0016 297  ILE B C     
2129 O O     . ILE B 112 ? 0.1186 0.1255 0.1144 -0.0038 0.0024  0.0031  297  ILE B O     
2130 C CB    . ILE B 112 ? 0.1136 0.1458 0.1051 0.0050  -0.0114 -0.0010 297  ILE B CB    
2131 C CG1   . ILE B 112 ? 0.1262 0.1649 0.1276 0.0190  -0.0030 -0.0018 297  ILE B CG1   
2132 C CG2   . ILE B 112 ? 0.1253 0.1331 0.0904 -0.0006 -0.0141 -0.0082 297  ILE B CG2   
2133 C CD1   . ILE B 112 ? 0.1348 0.1911 0.1129 -0.0022 0.0013  -0.0189 297  ILE B CD1   
2134 N N     . ASN B 113 ? 0.1004 0.1185 0.0913 0.0049  -0.0090 0.0011  298  ASN B N     
2135 C CA    . ASN B 113 ? 0.0989 0.1096 0.0891 0.0036  0.0021  0.0039  298  ASN B CA    
2136 C C     . ASN B 113 ? 0.1054 0.1125 0.0973 0.0093  0.0010  0.0046  298  ASN B C     
2137 O O     . ASN B 113 ? 0.1150 0.1080 0.1078 0.0038  -0.0010 0.0007  298  ASN B O     
2138 C CB    . ASN B 113 ? 0.1018 0.1043 0.0896 -0.0044 -0.0040 0.0040  298  ASN B CB    
2139 C CG    . ASN B 113 ? 0.1148 0.1151 0.0949 -0.0021 0.0009  0.0049  298  ASN B CG    
2140 O OD1   . ASN B 113 ? 0.1190 0.1082 0.1211 -0.0020 -0.0091 0.0069  298  ASN B OD1   
2141 N ND2   . ASN B 113 ? 0.1254 0.1152 0.1048 0.0084  0.0028  0.0090  298  ASN B ND2   
2142 N N     . HIS B 114 ? 0.1119 0.1115 0.0989 0.0139  -0.0043 0.0027  299  HIS B N     
2143 C CA    . HIS B 114 ? 0.1166 0.1084 0.1094 0.0080  -0.0038 0.0038  299  HIS B CA    
2144 C C     . HIS B 114 ? 0.1237 0.1117 0.1055 0.0093  -0.0033 0.0025  299  HIS B C     
2145 O O     . HIS B 114 ? 0.1299 0.1283 0.1105 0.0057  0.0016  0.0006  299  HIS B O     
2146 C CB    . HIS B 114 ? 0.1116 0.1065 0.1097 0.0097  -0.0018 0.0053  299  HIS B CB    
2147 C CG    . HIS B 114 ? 0.1148 0.1220 0.1085 -0.0020 0.0015  0.0162  299  HIS B CG    
2148 N ND1   . HIS B 114 ? 0.1145 0.1148 0.1159 -0.0076 0.0008  0.0106  299  HIS B ND1   
2149 C CD2   . HIS B 114 ? 0.1121 0.1184 0.1025 0.0023  -0.0078 0.0045  299  HIS B CD2   
2150 C CE1   . HIS B 114 ? 0.1024 0.1091 0.1461 0.0150  0.0047  -0.0132 299  HIS B CE1   
2151 N NE2   . HIS B 114 ? 0.1403 0.1266 0.1180 0.0112  0.0105  0.0223  299  HIS B NE2   
2152 N N     . SER B 115 ? 0.1313 0.1207 0.1087 0.0062  -0.0082 -0.0016 300  SER B N     
2153 C CA    . SER B 115 ? 0.1370 0.1211 0.1235 -0.0016 -0.0094 -0.0006 300  SER B CA    
2154 C C     . SER B 115 ? 0.1430 0.1330 0.1329 -0.0023 -0.0050 0.0015  300  SER B C     
2155 O O     . SER B 115 ? 0.1518 0.1595 0.1443 -0.0020 -0.0004 0.0014  300  SER B O     
2156 C CB    . SER B 115 ? 0.1418 0.1220 0.1339 -0.0013 -0.0073 -0.0060 300  SER B CB    
2157 O OG    . SER B 115 ? 0.1558 0.1469 0.1513 -0.0045 -0.0231 -0.0038 300  SER B OG    
2158 N N     . LYS B 116 ? 0.1615 0.1619 0.1454 0.0041  -0.0042 0.0071  301  LYS B N     
2159 C CA    . LYS B 116 ? 0.1769 0.1887 0.1568 0.0105  -0.0080 0.0130  301  LYS B CA    
2160 C C     . LYS B 116 ? 0.1929 0.2014 0.1767 0.0119  -0.0047 0.0084  301  LYS B C     
2161 O O     . LYS B 116 ? 0.2248 0.2289 0.1865 0.0173  -0.0001 0.0126  301  LYS B O     
2162 C CB    . LYS B 116 ? 0.1750 0.1953 0.1740 0.0121  -0.0059 0.0105  301  LYS B CB    
2163 C CG    . LYS B 116 ? 0.1832 0.2050 0.1588 0.0171  -0.0077 0.0120  301  LYS B CG    
2164 C CD    . LYS B 116 ? 0.2077 0.2301 0.1953 0.0200  -0.0131 0.0159  301  LYS B CD    
2165 C CE    . LYS B 116 ? 0.2371 0.2419 0.2224 0.0153  -0.0088 0.0097  301  LYS B CE    
2166 N NZ    . LYS B 116 ? 0.2378 0.2618 0.2740 0.0128  -0.0179 0.0066  301  LYS B NZ    
2167 N N     . CYS B 117 ? 0.1918 0.1930 0.1832 0.0101  -0.0113 -0.0031 302  CYS B N     
2168 C CA    . CYS B 117 ? 0.2076 0.2056 0.2072 0.0061  -0.0122 -0.0077 302  CYS B CA    
2169 C C     . CYS B 117 ? 0.2000 0.1940 0.1922 0.0030  -0.0091 -0.0075 302  CYS B C     
2170 O O     . CYS B 117 ? 0.2045 0.2027 0.2000 -0.0014 -0.0113 -0.0059 302  CYS B O     
2171 C CB    . CYS B 117 ? 0.2187 0.2184 0.2308 0.0066  -0.0190 -0.0101 302  CYS B CB    
2172 S SG    . CYS B 117 ? 0.2786 0.2909 0.3260 0.0036  -0.0048 -0.0121 302  CYS B SG    
2173 N N     . GLY B 118 ? 0.1922 0.1889 0.1650 0.0059  -0.0130 -0.0125 303  GLY B N     
2174 C CA    . GLY B 118 ? 0.1799 0.1794 0.1617 0.0090  -0.0067 -0.0142 303  GLY B CA    
2175 C C     . GLY B 118 ? 0.1758 0.1673 0.1472 0.0087  -0.0081 -0.0154 303  GLY B C     
2176 O O     . GLY B 118 ? 0.1811 0.1937 0.1507 0.0132  -0.0072 -0.0226 303  GLY B O     
2177 N N     . ASN B 119 ? 0.1548 0.1490 0.1340 -0.0040 0.0010  -0.0170 304  ASN B N     
2178 C CA    . ASN B 119 ? 0.1516 0.1382 0.1404 -0.0004 0.0040  -0.0079 304  ASN B CA    
2179 C C     . ASN B 119 ? 0.1499 0.1292 0.1394 -0.0036 0.0017  -0.0086 304  ASN B C     
2180 O O     . ASN B 119 ? 0.1558 0.1300 0.1486 -0.0079 0.0096  -0.0074 304  ASN B O     
2181 C CB    . ASN B 119 ? 0.1599 0.1464 0.1230 -0.0034 0.0047  -0.0054 304  ASN B CB    
2182 C CG    . ASN B 119 ? 0.1423 0.1307 0.1198 0.0023  0.0040  -0.0117 304  ASN B CG    
2183 O OD1   . ASN B 119 ? 0.1480 0.1199 0.1290 0.0060  0.0031  -0.0189 304  ASN B OD1   
2184 N ND2   . ASN B 119 ? 0.1352 0.1366 0.1443 0.0120  0.0123  0.0053  304  ASN B ND2   
2185 N N     . CYS B 120 ? 0.1492 0.1323 0.1445 -0.0045 0.0003  -0.0109 305  CYS B N     
2186 C CA    . CYS B 120 ? 0.1502 0.1308 0.1488 -0.0034 -0.0026 -0.0101 305  CYS B CA    
2187 C C     . CYS B 120 ? 0.1477 0.1311 0.1473 -0.0015 -0.0046 -0.0087 305  CYS B C     
2188 O O     . CYS B 120 ? 0.1516 0.1334 0.1441 0.0009  0.0010  -0.0188 305  CYS B O     
2189 C CB    . CYS B 120 ? 0.1526 0.1369 0.1501 -0.0016 -0.0063 -0.0004 305  CYS B CB    
2190 S SG    . CYS B 120 ? 0.1662 0.1376 0.1660 0.0119  -0.0030 -0.0049 305  CYS B SG    
2191 N N     . GLN B 121 ? 0.1600 0.1413 0.1627 -0.0029 -0.0047 -0.0071 306  GLN B N     
2192 C CA    . GLN B 121 ? 0.1834 0.1631 0.1797 -0.0078 -0.0047 -0.0031 306  GLN B CA    
2193 C C     . GLN B 121 ? 0.1620 0.1502 0.1702 -0.0043 -0.0033 -0.0044 306  GLN B C     
2194 O O     . GLN B 121 ? 0.1554 0.1561 0.1845 -0.0036 0.0038  -0.0056 306  GLN B O     
2195 C CB    . GLN B 121 ? 0.1915 0.1710 0.1774 -0.0092 -0.0060 0.0015  306  GLN B CB    
2196 C CG    . GLN B 121 ? 0.2473 0.2116 0.2216 -0.0114 -0.0019 0.0110  306  GLN B CG    
2197 C CD    . GLN B 121 ? 0.2593 0.2374 0.2330 -0.0076 -0.0017 0.0067  306  GLN B CD    
2198 O OE1   . GLN B 121 ? 0.3413 0.3007 0.3019 -0.0094 0.0004  -0.0180 306  GLN B OE1   
2199 N NE2   . GLN B 121 ? 0.3248 0.2953 0.2960 -0.0056 -0.0036 0.0284  306  GLN B NE2   
2200 N N     . THR B 122 ? 0.1603 0.1558 0.1692 -0.0084 -0.0075 -0.0067 307  THR B N     
2201 C CA    . THR B 122 ? 0.1683 0.1637 0.1731 -0.0095 -0.0013 -0.0095 307  THR B CA    
2202 C C     . THR B 122 ? 0.1779 0.1728 0.1707 -0.0070 -0.0023 -0.0049 307  THR B C     
2203 O O     . THR B 122 ? 0.1827 0.1803 0.1847 -0.0102 -0.0070 -0.0015 307  THR B O     
2204 C CB    . THR B 122 ? 0.1678 0.1605 0.1808 -0.0091 -0.0037 -0.0130 307  THR B CB    
2205 O OG1   . THR B 122 ? 0.1812 0.1667 0.1849 -0.0003 0.0153  -0.0142 307  THR B OG1   
2206 C CG2   . THR B 122 ? 0.1595 0.1606 0.1767 -0.0180 -0.0095 0.0007  307  THR B CG2   
2207 N N     . LYS B 123 ? 0.1850 0.1837 0.1761 -0.0125 -0.0047 0.0018  308  LYS B N     
2208 C CA    . LYS B 123 ? 0.2130 0.2126 0.1963 -0.0155 -0.0024 0.0031  308  LYS B CA    
2209 C C     . LYS B 123 ? 0.2067 0.2079 0.1909 -0.0169 -0.0040 0.0078  308  LYS B C     
2210 O O     . LYS B 123 ? 0.1832 0.1950 0.1658 -0.0199 -0.0031 0.0165  308  LYS B O     
2211 C CB    . LYS B 123 ? 0.2274 0.2232 0.2099 -0.0157 0.0016  -0.0013 308  LYS B CB    
2212 C CG    . LYS B 123 ? 0.2497 0.2354 0.2393 -0.0115 0.0029  -0.0013 308  LYS B CG    
2213 C CD    . LYS B 123 ? 0.2622 0.2489 0.2447 -0.0044 0.0019  -0.0047 308  LYS B CD    
2214 C CE    . LYS B 123 ? 0.3190 0.3050 0.3050 -0.0025 0.0092  0.0143  308  LYS B CE    
2215 N NZ    . LYS B 123 ? 0.3509 0.3472 0.3417 0.0037  0.0038  -0.0032 308  LYS B NZ    
2216 N N     . LEU B 124 ? 0.2250 0.2142 0.1939 -0.0118 -0.0022 0.0082  309  LEU B N     
2217 C CA    . LEU B 124 ? 0.2427 0.2329 0.2132 -0.0115 -0.0012 0.0038  309  LEU B CA    
2218 C C     . LEU B 124 ? 0.2378 0.2322 0.2091 -0.0124 0.0030  0.0011  309  LEU B C     
2219 O O     . LEU B 124 ? 0.2501 0.2618 0.2111 -0.0145 0.0007  -0.0055 309  LEU B O     
2220 C CB    . LEU B 124 ? 0.2604 0.2402 0.2277 -0.0085 -0.0027 0.0074  309  LEU B CB    
2221 C CG    . LEU B 124 ? 0.2969 0.2724 0.2655 -0.0017 0.0034  0.0010  309  LEU B CG    
2222 C CD1   . LEU B 124 ? 0.3213 0.2844 0.3211 -0.0007 -0.0010 0.0080  309  LEU B CD1   
2223 C CD2   . LEU B 124 ? 0.2868 0.2800 0.2853 0.0047  -0.0012 0.0053  309  LEU B CD2   
2224 N N     . HIS B 125 ? 0.2341 0.2233 0.2052 -0.0122 0.0063  -0.0021 310  HIS B N     
2225 C CA    . HIS B 125 ? 0.2341 0.2265 0.2133 -0.0116 0.0048  0.0006  310  HIS B CA    
2226 C C     . HIS B 125 ? 0.2394 0.2354 0.2259 -0.0130 0.0062  -0.0002 310  HIS B C     
2227 O O     . HIS B 125 ? 0.2404 0.2371 0.2258 -0.0215 0.0043  -0.0055 310  HIS B O     
2228 C CB    . HIS B 125 ? 0.2399 0.2282 0.2209 -0.0079 0.0087  0.0019  310  HIS B CB    
2229 C CG    . HIS B 125 ? 0.2327 0.2218 0.1947 -0.0115 0.0092  0.0105  310  HIS B CG    
2230 N ND1   . HIS B 125 ? 0.2436 0.2197 0.2173 -0.0031 -0.0031 0.0032  310  HIS B ND1   
2231 C CD2   . HIS B 125 ? 0.2390 0.2272 0.1987 -0.0093 0.0074  0.0158  310  HIS B CD2   
2232 C CE1   . HIS B 125 ? 0.2320 0.2274 0.2130 -0.0100 0.0003  0.0067  310  HIS B CE1   
2233 N NE2   . HIS B 125 ? 0.2173 0.2124 0.1951 -0.0067 0.0005  0.0162  310  HIS B NE2   
2234 N N     . ASP B 126 ? 0.2466 0.2394 0.2386 -0.0112 0.0090  -0.0025 311  ASP B N     
2235 C CA    . ASP B 126 ? 0.2494 0.2517 0.2577 -0.0071 0.0077  -0.0018 311  ASP B CA    
2236 C C     . ASP B 126 ? 0.2448 0.2460 0.2551 -0.0067 0.0116  -0.0027 311  ASP B C     
2237 O O     . ASP B 126 ? 0.2529 0.2510 0.2716 -0.0076 0.0105  -0.0082 311  ASP B O     
2238 C CB    . ASP B 126 ? 0.2619 0.2615 0.2676 -0.0100 0.0103  0.0013  311  ASP B CB    
2239 C CG    . ASP B 126 ? 0.3001 0.2928 0.2796 -0.0028 0.0067  -0.0011 311  ASP B CG    
2240 O OD1   . ASP B 126 ? 0.3349 0.2985 0.3096 -0.0026 0.0068  -0.0064 311  ASP B OD1   
2241 O OD2   . ASP B 126 ? 0.3091 0.3015 0.3135 -0.0129 0.0143  -0.0043 311  ASP B OD2   
2242 N N     . ILE B 127 ? 0.2311 0.2336 0.2572 -0.0071 0.0128  -0.0015 312  ILE B N     
2243 C CA    . ILE B 127 ? 0.2288 0.2321 0.2582 -0.0076 0.0116  -0.0027 312  ILE B CA    
2244 C C     . ILE B 127 ? 0.2228 0.2260 0.2498 -0.0120 0.0157  0.0003  312  ILE B C     
2245 O O     . ILE B 127 ? 0.2118 0.2158 0.2543 -0.0155 0.0204  0.0059  312  ILE B O     
2246 C CB    . ILE B 127 ? 0.2270 0.2256 0.2573 -0.0085 0.0124  -0.0030 312  ILE B CB    
2247 C CG1   . ILE B 127 ? 0.2293 0.2309 0.2672 -0.0109 0.0073  -0.0070 312  ILE B CG1   
2248 C CG2   . ILE B 127 ? 0.2360 0.2301 0.2634 -0.0006 0.0090  0.0002  312  ILE B CG2   
2249 C CD1   . ILE B 127 ? 0.2389 0.2408 0.2636 -0.0068 0.0089  -0.0042 312  ILE B CD1   
2250 N N     . ASP B 128 ? 0.2236 0.2239 0.2508 -0.0088 0.0162  -0.0008 313  ASP B N     
2251 C CA    . ASP B 128 ? 0.2207 0.2243 0.2501 -0.0070 0.0096  0.0004  313  ASP B CA    
2252 C C     . ASP B 128 ? 0.2089 0.2143 0.2352 -0.0039 0.0065  0.0024  313  ASP B C     
2253 O O     . ASP B 128 ? 0.1977 0.2110 0.2437 -0.0024 0.0029  0.0022  313  ASP B O     
2254 C CB    . ASP B 128 ? 0.2232 0.2314 0.2528 -0.0101 0.0086  0.0014  313  ASP B CB    
2255 C CG    . ASP B 128 ? 0.2510 0.2573 0.2788 -0.0153 0.0083  0.0033  313  ASP B CG    
2256 O OD1   . ASP B 128 ? 0.3016 0.2978 0.3078 -0.0087 -0.0005 0.0024  313  ASP B OD1   
2257 O OD2   . ASP B 128 ? 0.2853 0.2820 0.3027 -0.0135 0.0030  0.0099  313  ASP B OD2   
2258 N N     . GLY B 129 ? 0.1928 0.1992 0.2197 -0.0060 0.0146  0.0065  314  GLY B N     
2259 C CA    . GLY B 129 ? 0.1868 0.1931 0.2049 -0.0040 0.0136  0.0094  314  GLY B CA    
2260 C C     . GLY B 129 ? 0.1753 0.1763 0.1895 -0.0039 0.0110  0.0122  314  GLY B C     
2261 O O     . GLY B 129 ? 0.1679 0.1713 0.1809 -0.0033 0.0122  0.0161  314  GLY B O     
2262 N N     . VAL B 130 ? 0.1697 0.1762 0.1821 -0.0002 0.0080  0.0113  315  VAL B N     
2263 C CA    . VAL B 130 ? 0.1610 0.1644 0.1749 -0.0030 0.0041  0.0102  315  VAL B CA    
2264 C C     . VAL B 130 ? 0.1538 0.1531 0.1661 -0.0041 0.0092  0.0088  315  VAL B C     
2265 O O     . VAL B 130 ? 0.1567 0.1502 0.1806 -0.0078 0.0142  0.0110  315  VAL B O     
2266 C CB    . VAL B 130 ? 0.1618 0.1736 0.1745 -0.0034 0.0011  0.0118  315  VAL B CB    
2267 C CG1   . VAL B 130 ? 0.1880 0.1913 0.1848 -0.0034 0.0062  0.0047  315  VAL B CG1   
2268 C CG2   . VAL B 130 ? 0.1547 0.1796 0.1716 -0.0043 -0.0103 0.0128  315  VAL B CG2   
2269 N N     . PRO B 131 ? 0.1474 0.1457 0.1549 -0.0058 0.0109  0.0098  316  PRO B N     
2270 C CA    . PRO B 131 ? 0.1522 0.1487 0.1568 -0.0032 0.0086  0.0091  316  PRO B CA    
2271 C C     . PRO B 131 ? 0.1617 0.1521 0.1603 -0.0071 0.0066  0.0059  316  PRO B C     
2272 O O     . PRO B 131 ? 0.1741 0.1620 0.1735 -0.0117 0.0114  -0.0004 316  PRO B O     
2273 C CB    . PRO B 131 ? 0.1563 0.1587 0.1712 0.0006  0.0087  0.0118  316  PRO B CB    
2274 C CG    . PRO B 131 ? 0.1547 0.1602 0.1817 -0.0036 0.0134  0.0096  316  PRO B CG    
2275 C CD    . PRO B 131 ? 0.1513 0.1564 0.1657 -0.0018 0.0085  0.0096  316  PRO B CD    
2276 N N     . HIS B 132 ? 0.1632 0.1436 0.1655 -0.0090 0.0071  0.0094  317  HIS B N     
2277 C CA    . HIS B 132 ? 0.1659 0.1497 0.1604 -0.0081 0.0045  0.0100  317  HIS B CA    
2278 C C     . HIS B 132 ? 0.1634 0.1485 0.1552 -0.0068 0.0032  0.0054  317  HIS B C     
2279 O O     . HIS B 132 ? 0.1696 0.1831 0.1492 -0.0147 -0.0029 0.0122  317  HIS B O     
2280 C CB    . HIS B 132 ? 0.1649 0.1512 0.1698 -0.0041 0.0007  0.0084  317  HIS B CB    
2281 C CG    . HIS B 132 ? 0.1641 0.1500 0.1795 -0.0011 0.0020  0.0067  317  HIS B CG    
2282 N ND1   . HIS B 132 ? 0.1495 0.1398 0.1709 -0.0120 0.0032  -0.0032 317  HIS B ND1   
2283 C CD2   . HIS B 132 ? 0.1752 0.1557 0.1966 -0.0023 0.0091  0.0049  317  HIS B CD2   
2284 C CE1   . HIS B 132 ? 0.1505 0.1588 0.1985 -0.0013 0.0108  -0.0008 317  HIS B CE1   
2285 N NE2   . HIS B 132 ? 0.1758 0.1600 0.1978 -0.0087 0.0040  0.0121  317  HIS B NE2   
2286 N N     . LEU B 133 ? 0.1601 0.1391 0.1419 -0.0066 0.0066  0.0015  318  LEU B N     
2287 C CA    . LEU B 133 ? 0.1608 0.1469 0.1451 -0.0035 0.0083  0.0000  318  LEU B CA    
2288 C C     . LEU B 133 ? 0.1542 0.1429 0.1455 -0.0048 0.0068  0.0019  318  LEU B C     
2289 O O     . LEU B 133 ? 0.1472 0.1447 0.1406 -0.0047 0.0078  -0.0021 318  LEU B O     
2290 C CB    . LEU B 133 ? 0.1735 0.1439 0.1521 0.0048  0.0116  -0.0015 318  LEU B CB    
2291 C CG    . LEU B 133 ? 0.1789 0.1434 0.1692 0.0096  0.0111  -0.0015 318  LEU B CG    
2292 C CD1   . LEU B 133 ? 0.1734 0.1569 0.2020 0.0164  0.0152  -0.0075 318  LEU B CD1   
2293 C CD2   . LEU B 133 ? 0.1979 0.1587 0.1801 0.0050  0.0025  0.0020  318  LEU B CD2   
2294 N N     . ILE B 134 ? 0.1450 0.1391 0.1325 -0.0079 0.0075  0.0040  319  ILE B N     
2295 C CA    . ILE B 134 ? 0.1478 0.1461 0.1480 -0.0057 0.0009  0.0018  319  ILE B CA    
2296 C C     . ILE B 134 ? 0.1426 0.1464 0.1408 -0.0117 0.0019  0.0040  319  ILE B C     
2297 O O     . ILE B 134 ? 0.1539 0.1618 0.1576 -0.0156 -0.0049 0.0189  319  ILE B O     
2298 C CB    . ILE B 134 ? 0.1477 0.1426 0.1433 -0.0052 0.0034  -0.0004 319  ILE B CB    
2299 C CG1   . ILE B 134 ? 0.1570 0.1632 0.1548 -0.0056 0.0123  0.0021  319  ILE B CG1   
2300 C CG2   . ILE B 134 ? 0.1374 0.1485 0.1658 -0.0050 0.0011  0.0041  319  ILE B CG2   
2301 C CD1   . ILE B 134 ? 0.1765 0.1590 0.1546 0.0000  0.0031  -0.0013 319  ILE B CD1   
2302 N N     . LEU B 135 ? 0.1449 0.1405 0.1382 -0.0094 -0.0020 0.0001  320  LEU B N     
2303 C CA    . LEU B 135 ? 0.1437 0.1429 0.1427 -0.0063 0.0047  -0.0008 320  LEU B CA    
2304 C C     . LEU B 135 ? 0.1417 0.1498 0.1528 -0.0038 0.0068  -0.0014 320  LEU B C     
2305 O O     . LEU B 135 ? 0.1430 0.1499 0.1405 0.0013  0.0098  0.0051  320  LEU B O     
2306 C CB    . LEU B 135 ? 0.1516 0.1536 0.1485 -0.0039 0.0118  0.0027  320  LEU B CB    
2307 C CG    . LEU B 135 ? 0.1770 0.1754 0.1831 0.0020  0.0210  -0.0071 320  LEU B CG    
2308 C CD1   . LEU B 135 ? 0.2060 0.2060 0.2277 -0.0037 0.0034  -0.0089 320  LEU B CD1   
2309 C CD2   . LEU B 135 ? 0.2038 0.2083 0.2047 0.0107  0.0208  0.0164  320  LEU B CD2   
2310 N N     . ILE B 136 ? 0.1478 0.1461 0.1552 -0.0109 0.0075  -0.0086 321  ILE B N     
2311 C CA    . ILE B 136 ? 0.1574 0.1598 0.1757 -0.0137 0.0039  -0.0093 321  ILE B CA    
2312 C C     . ILE B 136 ? 0.1429 0.1461 0.1766 -0.0073 0.0044  -0.0104 321  ILE B C     
2313 O O     . ILE B 136 ? 0.1415 0.1491 0.1957 -0.0083 0.0002  -0.0144 321  ILE B O     
2314 C CB    . ILE B 136 ? 0.1739 0.1824 0.1942 -0.0263 0.0112  -0.0095 321  ILE B CB    
2315 C CG1   . ILE B 136 ? 0.1925 0.2162 0.2123 -0.0276 -0.0013 -0.0073 321  ILE B CG1   
2316 C CG2   . ILE B 136 ? 0.2021 0.2102 0.2214 -0.0101 0.0041  -0.0069 321  ILE B CG2   
2317 C CD1   . ILE B 136 ? 0.2413 0.2251 0.2433 -0.0064 -0.0050 0.0019  321  ILE B CD1   
2318 N N     . ALA B 137 ? 0.1303 0.1354 0.1525 -0.0062 0.0038  -0.0107 322  ALA B N     
2319 C CA    . ALA B 137 ? 0.1324 0.1355 0.1530 -0.0027 0.0014  -0.0057 322  ALA B CA    
2320 C C     . ALA B 137 ? 0.1333 0.1379 0.1459 -0.0006 0.0010  -0.0053 322  ALA B C     
2321 O O     . ALA B 137 ? 0.1282 0.1378 0.1506 0.0040  0.0114  -0.0045 322  ALA B O     
2322 C CB    . ALA B 137 ? 0.1268 0.1328 0.1623 0.0011  0.0048  0.0006  322  ALA B CB    
2323 N N     . SER B 138 ? 0.1284 0.1211 0.1447 0.0012  -0.0003 -0.0037 323  SER B N     
2324 C CA    . SER B 138 ? 0.1359 0.1343 0.1484 0.0018  -0.0019 -0.0024 323  SER B CA    
2325 C C     . SER B 138 ? 0.1396 0.1336 0.1527 -0.0033 0.0042  0.0035  323  SER B C     
2326 O O     . SER B 138 ? 0.1475 0.1472 0.1602 -0.0004 0.0048  0.0138  323  SER B O     
2327 C CB    . SER B 138 ? 0.1428 0.1391 0.1611 0.0109  0.0055  0.0028  323  SER B CB    
2328 O OG    . SER B 138 ? 0.1674 0.1874 0.1975 -0.0036 0.0055  0.0021  323  SER B OG    
2329 N N     . ARG B 139 ? 0.1378 0.1237 0.1440 -0.0038 0.0046  0.0030  324  ARG B N     
2330 C CA    . ARG B 139 ? 0.1311 0.1240 0.1379 -0.0064 -0.0005 0.0000  324  ARG B CA    
2331 C C     . ARG B 139 ? 0.1421 0.1185 0.1305 -0.0072 0.0003  -0.0027 324  ARG B C     
2332 O O     . ARG B 139 ? 0.1423 0.1221 0.1296 -0.0101 -0.0080 0.0041  324  ARG B O     
2333 C CB    . ARG B 139 ? 0.1256 0.1285 0.1278 -0.0059 -0.0082 -0.0004 324  ARG B CB    
2334 C CG    . ARG B 139 ? 0.1274 0.1306 0.1485 -0.0118 0.0081  -0.0010 324  ARG B CG    
2335 C CD    . ARG B 139 ? 0.1331 0.1468 0.1543 -0.0123 0.0052  0.0110  324  ARG B CD    
2336 N NE    . ARG B 139 ? 0.1263 0.1424 0.1571 -0.0141 0.0087  -0.0012 324  ARG B NE    
2337 C CZ    . ARG B 139 ? 0.1250 0.1119 0.1321 -0.0085 0.0083  -0.0128 324  ARG B CZ    
2338 N NH1   . ARG B 139 ? 0.1218 0.1109 0.1523 -0.0097 -0.0122 -0.0174 324  ARG B NH1   
2339 N NH2   . ARG B 139 ? 0.1373 0.1208 0.1439 -0.0122 0.0230  -0.0144 324  ARG B NH2   
2340 N N     . ASP B 140 ? 0.1444 0.1208 0.1427 -0.0008 0.0069  0.0009  325  ASP B N     
2341 C CA    . ASP B 140 ? 0.1499 0.1214 0.1372 0.0026  0.0071  -0.0019 325  ASP B CA    
2342 C C     . ASP B 140 ? 0.1395 0.1143 0.1364 0.0004  0.0056  0.0020  325  ASP B C     
2343 O O     . ASP B 140 ? 0.1343 0.1183 0.1239 0.0119  0.0055  0.0076  325  ASP B O     
2344 C CB    . ASP B 140 ? 0.1579 0.1231 0.1489 -0.0024 0.0118  -0.0103 325  ASP B CB    
2345 C CG    . ASP B 140 ? 0.1726 0.1430 0.1435 0.0008  0.0111  0.0017  325  ASP B CG    
2346 O OD1   . ASP B 140 ? 0.1614 0.1435 0.1594 -0.0038 0.0076  -0.0182 325  ASP B OD1   
2347 O OD2   . ASP B 140 ? 0.2111 0.1627 0.1882 -0.0083 0.0207  -0.0027 325  ASP B OD2   
2348 N N     . ILE B 141 ? 0.1410 0.1143 0.1238 0.0050  0.0055  0.0030  326  ILE B N     
2349 C CA    . ILE B 141 ? 0.1388 0.1160 0.1258 -0.0018 0.0012  0.0004  326  ILE B CA    
2350 C C     . ILE B 141 ? 0.1339 0.1206 0.1274 -0.0009 0.0038  0.0048  326  ILE B C     
2351 O O     . ILE B 141 ? 0.1261 0.1240 0.1297 -0.0026 0.0063  0.0032  326  ILE B O     
2352 C CB    . ILE B 141 ? 0.1367 0.1217 0.1208 -0.0072 -0.0019 -0.0012 326  ILE B CB    
2353 C CG1   . ILE B 141 ? 0.1557 0.1186 0.1314 -0.0081 -0.0031 -0.0115 326  ILE B CG1   
2354 C CG2   . ILE B 141 ? 0.1456 0.1545 0.1475 -0.0120 0.0091  -0.0046 326  ILE B CG2   
2355 C CD1   . ILE B 141 ? 0.1618 0.1129 0.1095 -0.0215 0.0072  -0.0161 326  ILE B CD1   
2356 N N     . ALA B 142 ? 0.1297 0.1120 0.1346 -0.0060 -0.0018 0.0073  327  ALA B N     
2357 C CA    . ALA B 142 ? 0.1210 0.1145 0.1172 0.0002  -0.0020 0.0081  327  ALA B CA    
2358 C C     . ALA B 142 ? 0.1334 0.1270 0.1284 0.0003  0.0031  0.0023  327  ALA B C     
2359 O O     . ALA B 142 ? 0.1356 0.1300 0.1210 0.0004  0.0103  -0.0015 327  ALA B O     
2360 C CB    . ALA B 142 ? 0.1211 0.1153 0.1397 0.0024  -0.0027 0.0070  327  ALA B CB    
2361 N N     . ALA B 143 ? 0.1270 0.1281 0.1167 0.0033  -0.0019 0.0020  328  ALA B N     
2362 C CA    . ALA B 143 ? 0.1370 0.1367 0.1276 0.0092  -0.0027 -0.0005 328  ALA B CA    
2363 C C     . ALA B 143 ? 0.1352 0.1314 0.1256 0.0087  -0.0030 -0.0032 328  ALA B C     
2364 O O     . ALA B 143 ? 0.1336 0.1330 0.1222 0.0111  0.0016  -0.0117 328  ALA B O     
2365 C CB    . ALA B 143 ? 0.1352 0.1436 0.1318 0.0124  -0.0063 -0.0014 328  ALA B CB    
2366 N N     . GLY B 144 ? 0.1424 0.1355 0.1321 0.0149  0.0009  -0.0051 329  GLY B N     
2367 C CA    . GLY B 144 ? 0.1485 0.1323 0.1343 0.0129  0.0038  0.0029  329  GLY B CA    
2368 C C     . GLY B 144 ? 0.1505 0.1393 0.1395 0.0142  0.0000  -0.0008 329  GLY B C     
2369 O O     . GLY B 144 ? 0.1655 0.1473 0.1540 0.0282  0.0081  0.0035  329  GLY B O     
2370 N N     . GLU B 145 ? 0.1432 0.1278 0.1326 0.0137  -0.0037 -0.0037 330  GLU B N     
2371 C CA    . GLU B 145 ? 0.1335 0.1194 0.1213 0.0087  -0.0075 -0.0050 330  GLU B CA    
2372 C C     . GLU B 145 ? 0.1339 0.1259 0.1222 0.0038  -0.0039 -0.0044 330  GLU B C     
2373 O O     . GLU B 145 ? 0.1251 0.1252 0.1149 0.0090  -0.0146 -0.0083 330  GLU B O     
2374 C CB    . GLU B 145 ? 0.1435 0.1226 0.1233 0.0017  -0.0042 -0.0064 330  GLU B CB    
2375 C CG    . GLU B 145 ? 0.1185 0.1336 0.1315 -0.0042 -0.0122 -0.0098 330  GLU B CG    
2376 C CD    . GLU B 145 ? 0.1296 0.1275 0.1428 -0.0058 -0.0063 -0.0065 330  GLU B CD    
2377 O OE1   . GLU B 145 ? 0.1512 0.1717 0.1480 0.0254  -0.0107 -0.0069 330  GLU B OE1   
2378 O OE2   . GLU B 145 ? 0.1241 0.1287 0.1433 0.0079  -0.0047 -0.0036 330  GLU B OE2   
2379 N N     . GLU B 146 ? 0.1316 0.1023 0.1089 0.0063  -0.0091 0.0000  331  GLU B N     
2380 C CA    . GLU B 146 ? 0.1288 0.1101 0.1112 0.0076  -0.0008 -0.0063 331  GLU B CA    
2381 C C     . GLU B 146 ? 0.1235 0.1142 0.1151 0.0028  -0.0054 -0.0040 331  GLU B C     
2382 O O     . GLU B 146 ? 0.1332 0.1173 0.1086 0.0011  -0.0045 -0.0043 331  GLU B O     
2383 C CB    . GLU B 146 ? 0.1211 0.1056 0.1017 0.0118  -0.0025 -0.0068 331  GLU B CB    
2384 C CG    . GLU B 146 ? 0.1244 0.1095 0.1119 0.0090  -0.0113 -0.0139 331  GLU B CG    
2385 C CD    . GLU B 146 ? 0.1271 0.1166 0.1083 0.0000  0.0011  -0.0030 331  GLU B CD    
2386 O OE1   . GLU B 146 ? 0.1388 0.1419 0.1183 0.0044  0.0075  -0.0130 331  GLU B OE1   
2387 O OE2   . GLU B 146 ? 0.1202 0.1174 0.1113 -0.0072 0.0071  -0.0190 331  GLU B OE2   
2388 N N     . LEU B 147 ? 0.1277 0.1187 0.1154 -0.0004 0.0005  -0.0060 332  LEU B N     
2389 C CA    . LEU B 147 ? 0.1249 0.1144 0.1204 -0.0011 -0.0019 -0.0065 332  LEU B CA    
2390 C C     . LEU B 147 ? 0.1205 0.1195 0.1118 0.0055  0.0004  -0.0027 332  LEU B C     
2391 O O     . LEU B 147 ? 0.1225 0.1131 0.1081 0.0081  0.0046  -0.0032 332  LEU B O     
2392 C CB    . LEU B 147 ? 0.1230 0.1318 0.1365 -0.0004 0.0076  -0.0092 332  LEU B CB    
2393 C CG    . LEU B 147 ? 0.1248 0.1318 0.1218 0.0018  -0.0004 -0.0158 332  LEU B CG    
2394 C CD1   . LEU B 147 ? 0.1288 0.1844 0.1330 0.0035  -0.0013 0.0000  332  LEU B CD1   
2395 C CD2   . LEU B 147 ? 0.1429 0.1257 0.1375 0.0129  0.0017  -0.0216 332  LEU B CD2   
2396 N N     . LEU B 148 ? 0.1206 0.0993 0.1086 0.0070  0.0000  0.0003  333  LEU B N     
2397 C CA    . LEU B 148 ? 0.1259 0.1135 0.1090 0.0035  0.0012  0.0047  333  LEU B CA    
2398 C C     . LEU B 148 ? 0.1394 0.1165 0.1114 0.0062  0.0063  0.0021  333  LEU B C     
2399 O O     . LEU B 148 ? 0.1499 0.1174 0.1044 0.0101  0.0102  -0.0029 333  LEU B O     
2400 C CB    . LEU B 148 ? 0.1187 0.1235 0.1053 0.0015  0.0028  0.0086  333  LEU B CB    
2401 C CG    . LEU B 148 ? 0.1217 0.1186 0.1018 -0.0110 0.0033  -0.0007 333  LEU B CG    
2402 C CD1   . LEU B 148 ? 0.1010 0.1306 0.0987 -0.0154 -0.0021 0.0052  333  LEU B CD1   
2403 C CD2   . LEU B 148 ? 0.1312 0.1079 0.1127 -0.0085 0.0001  -0.0191 333  LEU B CD2   
2404 N N     . TYR B 149 ? 0.1302 0.1093 0.1056 0.0093  0.0017  0.0046  334  TYR B N     
2405 C CA    . TYR B 149 ? 0.1309 0.1121 0.1141 0.0080  0.0014  0.0046  334  TYR B CA    
2406 C C     . TYR B 149 ? 0.1263 0.1133 0.1119 0.0053  -0.0031 0.0065  334  TYR B C     
2407 O O     . TYR B 149 ? 0.1209 0.1141 0.1104 0.0007  0.0020  0.0048  334  TYR B O     
2408 C CB    . TYR B 149 ? 0.1333 0.1140 0.1104 0.0073  0.0021  -0.0031 334  TYR B CB    
2409 C CG    . TYR B 149 ? 0.1091 0.1124 0.1104 0.0016  -0.0016 -0.0036 334  TYR B CG    
2410 C CD1   . TYR B 149 ? 0.1035 0.1112 0.1136 -0.0067 0.0123  -0.0069 334  TYR B CD1   
2411 C CD2   . TYR B 149 ? 0.1278 0.1397 0.1229 -0.0027 -0.0144 -0.0004 334  TYR B CD2   
2412 C CE1   . TYR B 149 ? 0.1085 0.1410 0.1160 -0.0039 0.0045  0.0022  334  TYR B CE1   
2413 C CE2   . TYR B 149 ? 0.1509 0.1256 0.1202 -0.0045 -0.0002 -0.0067 334  TYR B CE2   
2414 C CZ    . TYR B 149 ? 0.1318 0.1166 0.1113 -0.0061 -0.0069 -0.0071 334  TYR B CZ    
2415 O OH    . TYR B 149 ? 0.1443 0.1294 0.1437 -0.0173 -0.0067 -0.0207 334  TYR B OH    
2416 N N     . ASP B 150 ? 0.1352 0.1106 0.1099 0.0024  0.0034  0.0124  335  ASP B N     
2417 C CA    . ASP B 150 ? 0.1237 0.1212 0.1115 0.0068  -0.0039 0.0102  335  ASP B CA    
2418 C C     . ASP B 150 ? 0.1266 0.1200 0.1120 0.0078  -0.0014 0.0096  335  ASP B C     
2419 O O     . ASP B 150 ? 0.1228 0.1358 0.1277 0.0042  0.0063  0.0062  335  ASP B O     
2420 C CB    . ASP B 150 ? 0.1430 0.1217 0.1025 0.0167  -0.0066 0.0108  335  ASP B CB    
2421 C CG    . ASP B 150 ? 0.1674 0.1466 0.1376 0.0134  0.0020  0.0008  335  ASP B CG    
2422 O OD1   . ASP B 150 ? 0.1470 0.1295 0.1174 0.0095  0.0065  0.0082  335  ASP B OD1   
2423 O OD2   . ASP B 150 ? 0.2134 0.2150 0.1498 0.0435  -0.0235 0.0174  335  ASP B OD2   
2424 N N     . TYR B 151 ? 0.1288 0.1194 0.1096 0.0051  -0.0031 0.0085  336  TYR B N     
2425 C CA    . TYR B 151 ? 0.1424 0.1180 0.1020 0.0052  0.0005  0.0069  336  TYR B CA    
2426 C C     . TYR B 151 ? 0.1364 0.1196 0.1008 0.0034  -0.0070 0.0106  336  TYR B C     
2427 O O     . TYR B 151 ? 0.1541 0.1261 0.1160 -0.0007 -0.0081 0.0107  336  TYR B O     
2428 C CB    . TYR B 151 ? 0.1379 0.1218 0.0988 0.0046  -0.0007 0.0093  336  TYR B CB    
2429 C CG    . TYR B 151 ? 0.1178 0.1142 0.1015 0.0061  -0.0053 0.0072  336  TYR B CG    
2430 C CD1   . TYR B 151 ? 0.1156 0.1080 0.1173 -0.0018 -0.0123 0.0032  336  TYR B CD1   
2431 C CD2   . TYR B 151 ? 0.1132 0.1128 0.0979 0.0031  -0.0003 0.0019  336  TYR B CD2   
2432 C CE1   . TYR B 151 ? 0.1148 0.0963 0.1080 -0.0025 0.0092  0.0010  336  TYR B CE1   
2433 C CE2   . TYR B 151 ? 0.1077 0.0975 0.1083 0.0070  0.0054  0.0124  336  TYR B CE2   
2434 C CZ    . TYR B 151 ? 0.1162 0.1066 0.0961 -0.0025 0.0005  0.0065  336  TYR B CZ    
2435 O OH    . TYR B 151 ? 0.1170 0.1118 0.1130 -0.0054 -0.0092 0.0062  336  TYR B OH    
2436 N N     . GLY B 152 ? 0.1317 0.1114 0.0980 0.0100  -0.0069 0.0189  337  GLY B N     
2437 C CA    . GLY B 152 ? 0.1379 0.1156 0.1160 0.0044  0.0014  0.0221  337  GLY B CA    
2438 C C     . GLY B 152 ? 0.1314 0.1244 0.1276 0.0080  0.0052  0.0211  337  GLY B C     
2439 O O     . GLY B 152 ? 0.1395 0.1195 0.1374 0.0048  0.0081  0.0300  337  GLY B O     
2440 N N     . ASP B 153 ? 0.1390 0.1188 0.1117 0.0066  0.0055  0.0147  338  ASP B N     
2441 C CA    . ASP B 153 ? 0.1388 0.1247 0.1159 0.0062  0.0045  0.0108  338  ASP B CA    
2442 C C     . ASP B 153 ? 0.1433 0.1328 0.1185 -0.0018 0.0004  0.0094  338  ASP B C     
2443 O O     . ASP B 153 ? 0.1482 0.1225 0.1362 -0.0019 -0.0009 0.0144  338  ASP B O     
2444 C CB    . ASP B 153 ? 0.1463 0.1227 0.1196 0.0030  0.0034  0.0059  338  ASP B CB    
2445 C CG    . ASP B 153 ? 0.1447 0.1389 0.1266 0.0086  0.0071  0.0054  338  ASP B CG    
2446 O OD1   . ASP B 153 ? 0.1669 0.1468 0.1356 0.0081  -0.0057 0.0085  338  ASP B OD1   
2447 O OD2   . ASP B 153 ? 0.1467 0.1466 0.1229 0.0062  0.0034  -0.0037 338  ASP B OD2   
2448 N N     . ARG B 154 ? 0.1349 0.1199 0.1212 -0.0020 -0.0065 0.0062  339  ARG B N     
2449 C CA    . ARG B 154 ? 0.1445 0.1324 0.1199 0.0069  -0.0062 0.0039  339  ARG B CA    
2450 C C     . ARG B 154 ? 0.1463 0.1318 0.1332 0.0058  -0.0091 0.0025  339  ARG B C     
2451 O O     . ARG B 154 ? 0.1474 0.1453 0.1251 0.0098  -0.0191 -0.0006 339  ARG B O     
2452 C CB    . ARG B 154 ? 0.1566 0.1377 0.1226 0.0050  -0.0057 0.0037  339  ARG B CB    
2453 C CG    . ARG B 154 ? 0.1744 0.1579 0.1580 0.0089  0.0102  0.0031  339  ARG B CG    
2454 C CD    . ARG B 154 ? 0.1927 0.1713 0.1908 0.0020  0.0148  -0.0083 339  ARG B CD    
2455 N NE    . ARG B 154 ? 0.1932 0.1710 0.1747 -0.0014 0.0018  -0.0055 339  ARG B NE    
2456 C CZ    . ARG B 154 ? 0.1834 0.1589 0.1743 0.0102  -0.0014 0.0005  339  ARG B CZ    
2457 N NH1   . ARG B 154 ? 0.1518 0.1617 0.1606 0.0051  -0.0050 -0.0128 339  ARG B NH1   
2458 N NH2   . ARG B 154 ? 0.1934 0.2151 0.2072 0.0024  0.0045  -0.0015 339  ARG B NH2   
2459 N N     . SER B 155 ? 0.1452 0.1280 0.1307 0.0050  -0.0026 0.0027  340  SER B N     
2460 C CA    . SER B 155 ? 0.1502 0.1413 0.1448 0.0082  -0.0005 -0.0014 340  SER B CA    
2461 C C     . SER B 155 ? 0.1569 0.1494 0.1547 0.0081  0.0019  0.0003  340  SER B C     
2462 O O     . SER B 155 ? 0.1597 0.1446 0.1589 0.0064  0.0039  0.0078  340  SER B O     
2463 C CB    . SER B 155 ? 0.1493 0.1470 0.1582 0.0049  -0.0009 -0.0117 340  SER B CB    
2464 O OG    . SER B 155 ? 0.1826 0.1808 0.1780 0.0177  -0.0036 -0.0145 340  SER B OG    
2465 N N     . LYS B 156 ? 0.1604 0.1626 0.1674 0.0090  0.0025  0.0084  341  LYS B N     
2466 C CA    . LYS B 156 ? 0.1773 0.1753 0.1821 0.0079  0.0043  0.0076  341  LYS B CA    
2467 C C     . LYS B 156 ? 0.1728 0.1675 0.1818 0.0114  0.0007  0.0091  341  LYS B C     
2468 O O     . LYS B 156 ? 0.1782 0.1720 0.1996 0.0131  0.0037  0.0125  341  LYS B O     
2469 C CB    . LYS B 156 ? 0.1927 0.1853 0.1939 0.0117  -0.0059 0.0104  341  LYS B CB    
2470 C CG    . LYS B 156 ? 0.2403 0.2473 0.2457 0.0021  0.0035  0.0011  341  LYS B CG    
2471 C CD    . LYS B 156 ? 0.2882 0.3018 0.3051 -0.0135 -0.0060 -0.0060 341  LYS B CD    
2472 C CE    . LYS B 156 ? 0.3170 0.3291 0.3180 -0.0097 0.0065  0.0000  341  LYS B CE    
2473 N NZ    . LYS B 156 ? 0.3354 0.3370 0.3504 -0.0130 -0.0012 0.0040  341  LYS B NZ    
2474 N N     . ALA B 157 ? 0.1779 0.1611 0.1738 0.0078  0.0050  0.0066  342  ALA B N     
2475 C CA    . ALA B 157 ? 0.1810 0.1666 0.1709 0.0032  0.0020  0.0066  342  ALA B CA    
2476 C C     . ALA B 157 ? 0.1702 0.1646 0.1711 0.0031  0.0070  0.0039  342  ALA B C     
2477 O O     . ALA B 157 ? 0.1858 0.1739 0.1658 0.0040  0.0030  0.0038  342  ALA B O     
2478 C CB    . ALA B 157 ? 0.1862 0.1662 0.1770 0.0049  0.0004  0.0041  342  ALA B CB    
2479 N N     . SER B 158 ? 0.1647 0.1575 0.1692 0.0042  0.0038  0.0006  343  SER B N     
2480 C CA    . SER B 158 ? 0.1585 0.1618 0.1635 0.0026  0.0036  0.0067  343  SER B CA    
2481 C C     . SER B 158 ? 0.1515 0.1608 0.1645 0.0010  0.0052  0.0059  343  SER B C     
2482 O O     . SER B 158 ? 0.1584 0.1666 0.1666 0.0059  0.0017  0.0154  343  SER B O     
2483 C CB    . SER B 158 ? 0.1460 0.1638 0.1642 0.0061  0.0013  -0.0016 343  SER B CB    
2484 O OG    . SER B 158 ? 0.1726 0.1740 0.1609 -0.0189 0.0011  -0.0053 343  SER B OG    
2485 N N     . ILE B 159 ? 0.1539 0.1644 0.1626 0.0064  0.0081  0.0097  344  ILE B N     
2486 C CA    . ILE B 159 ? 0.1649 0.1656 0.1714 0.0024  0.0051  0.0058  344  ILE B CA    
2487 C C     . ILE B 159 ? 0.1728 0.1737 0.1834 0.0037  0.0074  0.0063  344  ILE B C     
2488 O O     . ILE B 159 ? 0.1665 0.1674 0.1930 0.0047  0.0062  0.0119  344  ILE B O     
2489 C CB    . ILE B 159 ? 0.1578 0.1689 0.1766 0.0014  0.0005  0.0018  344  ILE B CB    
2490 C CG1   . ILE B 159 ? 0.1910 0.1854 0.1748 0.0023  0.0055  -0.0008 344  ILE B CG1   
2491 C CG2   . ILE B 159 ? 0.1851 0.1821 0.2042 -0.0114 0.0036  0.0042  344  ILE B CG2   
2492 C CD1   . ILE B 159 ? 0.1828 0.1831 0.1770 -0.0044 0.0018  0.0001  344  ILE B CD1   
2493 N N     . GLU B 160 ? 0.1708 0.1778 0.1848 0.0077  0.0098  0.0039  345  GLU B N     
2494 C CA    . GLU B 160 ? 0.1861 0.1980 0.1992 0.0102  0.0101  0.0033  345  GLU B CA    
2495 C C     . GLU B 160 ? 0.1835 0.1927 0.1965 0.0116  0.0089  0.0020  345  GLU B C     
2496 O O     . GLU B 160 ? 0.1894 0.2016 0.2127 0.0121  0.0085  0.0074  345  GLU B O     
2497 C CB    . GLU B 160 ? 0.1971 0.2063 0.2092 0.0101  0.0083  0.0033  345  GLU B CB    
2498 C CG    . GLU B 160 ? 0.2403 0.2544 0.2417 0.0092  0.0137  -0.0004 345  GLU B CG    
2499 C CD    . GLU B 160 ? 0.3258 0.3300 0.3508 -0.0046 0.0007  -0.0136 345  GLU B CD    
2500 O OE1   . GLU B 160 ? 0.3555 0.3497 0.3209 0.0029  -0.0185 0.0072  345  GLU B OE1   
2501 O OE2   . GLU B 160 ? 0.3753 0.3520 0.3243 -0.0075 0.0000  0.0178  345  GLU B OE2   
2502 N N     . ALA B 161 ? 0.1842 0.1940 0.1895 0.0105  0.0074  0.0022  346  ALA B N     
2503 C CA    . ALA B 161 ? 0.1755 0.1841 0.1753 0.0107  0.0082  0.0058  346  ALA B CA    
2504 C C     . ALA B 161 ? 0.1834 0.1897 0.1791 0.0071  0.0064  0.0049  346  ALA B C     
2505 O O     . ALA B 161 ? 0.1907 0.2025 0.1728 0.0054  0.0070  0.0094  346  ALA B O     
2506 C CB    . ALA B 161 ? 0.1873 0.1869 0.1828 0.0062  0.0027  0.0026  346  ALA B CB    
2507 N N     . HIS B 162 ? 0.1696 0.1785 0.1710 0.0094  0.0123  0.0043  347  HIS B N     
2508 C CA    . HIS B 162 ? 0.1601 0.1653 0.1673 0.0026  0.0116  0.0082  347  HIS B CA    
2509 C C     . HIS B 162 ? 0.1599 0.1597 0.1740 0.0016  0.0089  0.0056  347  HIS B C     
2510 O O     . HIS B 162 ? 0.1643 0.1522 0.1741 0.0042  0.0097  0.0018  347  HIS B O     
2511 C CB    . HIS B 162 ? 0.1590 0.1753 0.1603 -0.0015 0.0104  0.0078  347  HIS B CB    
2512 C CG    . HIS B 162 ? 0.1624 0.1831 0.1591 -0.0023 0.0137  0.0002  347  HIS B CG    
2513 N ND1   . HIS B 162 ? 0.1717 0.2001 0.1748 -0.0025 0.0001  -0.0056 347  HIS B ND1   
2514 C CD2   . HIS B 162 ? 0.1556 0.1871 0.1496 -0.0083 0.0075  0.0004  347  HIS B CD2   
2515 C CE1   . HIS B 162 ? 0.1609 0.1847 0.1673 -0.0065 0.0029  -0.0006 347  HIS B CE1   
2516 N NE2   . HIS B 162 ? 0.1662 0.2053 0.1617 -0.0009 -0.0058 0.0050  347  HIS B NE2   
2517 N N     . PRO B 163 ? 0.1681 0.1772 0.1831 -0.0007 0.0097  0.0039  348  PRO B N     
2518 C CA    . PRO B 163 ? 0.1633 0.1735 0.1829 -0.0051 0.0084  0.0051  348  PRO B CA    
2519 C C     . PRO B 163 ? 0.1632 0.1683 0.1811 -0.0037 0.0024  0.0072  348  PRO B C     
2520 O O     . PRO B 163 ? 0.1737 0.1746 0.1928 0.0041  -0.0047 0.0076  348  PRO B O     
2521 C CB    . PRO B 163 ? 0.1547 0.1811 0.1823 -0.0052 0.0140  0.0029  348  PRO B CB    
2522 C CG    . PRO B 163 ? 0.1759 0.1999 0.1930 -0.0123 0.0124  0.0004  348  PRO B CG    
2523 C CD    . PRO B 163 ? 0.1778 0.1869 0.1866 0.0013  0.0078  0.0004  348  PRO B CD    
2524 N N     . TRP B 164 ? 0.1531 0.1513 0.1827 -0.0016 0.0056  0.0108  349  TRP B N     
2525 C CA    . TRP B 164 ? 0.1539 0.1537 0.1709 -0.0034 0.0019  0.0059  349  TRP B CA    
2526 C C     . TRP B 164 ? 0.1499 0.1584 0.1737 -0.0029 0.0024  0.0034  349  TRP B C     
2527 O O     . TRP B 164 ? 0.1466 0.1633 0.1809 -0.0002 0.0024  0.0008  349  TRP B O     
2528 C CB    . TRP B 164 ? 0.1467 0.1496 0.1714 -0.0052 -0.0029 0.0094  349  TRP B CB    
2529 C CG    . TRP B 164 ? 0.1400 0.1372 0.1513 0.0046  -0.0060 0.0025  349  TRP B CG    
2530 C CD1   . TRP B 164 ? 0.1311 0.1311 0.1382 -0.0054 0.0061  0.0108  349  TRP B CD1   
2531 C CD2   . TRP B 164 ? 0.1511 0.1169 0.1377 0.0008  -0.0008 0.0075  349  TRP B CD2   
2532 N NE1   . TRP B 164 ? 0.1437 0.1383 0.1473 0.0059  -0.0085 0.0111  349  TRP B NE1   
2533 C CE2   . TRP B 164 ? 0.1461 0.1412 0.1403 0.0050  -0.0045 0.0060  349  TRP B CE2   
2534 C CE3   . TRP B 164 ? 0.1466 0.1308 0.1526 -0.0025 0.0045  0.0092  349  TRP B CE3   
2535 C CZ2   . TRP B 164 ? 0.1441 0.1189 0.1453 0.0056  -0.0011 0.0115  349  TRP B CZ2   
2536 C CZ3   . TRP B 164 ? 0.1206 0.1297 0.1447 0.0102  -0.0075 0.0059  349  TRP B CZ3   
2537 C CH2   . TRP B 164 ? 0.1387 0.1329 0.1358 0.0038  -0.0036 0.0095  349  TRP B CH2   
2538 N N     . LEU B 165 ? 0.1550 0.1599 0.1756 -0.0012 0.0004  0.0051  350  LEU B N     
2539 C CA    . LEU B 165 ? 0.1729 0.1658 0.1714 -0.0026 0.0011  0.0021  350  LEU B CA    
2540 C C     . LEU B 165 ? 0.1977 0.1930 0.1855 -0.0041 0.0005  0.0007  350  LEU B C     
2541 O O     . LEU B 165 ? 0.2100 0.1998 0.1817 -0.0036 -0.0008 0.0035  350  LEU B O     
2542 C CB    . LEU B 165 ? 0.1730 0.1515 0.1569 0.0007  -0.0001 0.0024  350  LEU B CB    
2543 C CG    . LEU B 165 ? 0.1486 0.1322 0.1613 0.0068  0.0121  -0.0016 350  LEU B CG    
2544 C CD1   . LEU B 165 ? 0.1601 0.1345 0.1612 -0.0007 0.0051  -0.0097 350  LEU B CD1   
2545 C CD2   . LEU B 165 ? 0.1504 0.1534 0.1578 0.0198  0.0067  -0.0012 350  LEU B CD2   
2546 N N     . LYS B 166 ? 0.2095 0.2217 0.2106 -0.0008 -0.0016 -0.0021 351  LYS B N     
2547 C CA    . LYS B 166 ? 0.2327 0.2470 0.2349 0.0010  -0.0035 -0.0036 351  LYS B CA    
2548 C C     . LYS B 166 ? 0.2382 0.2566 0.2460 -0.0003 -0.0006 -0.0038 351  LYS B C     
2549 O O     . LYS B 166 ? 0.2339 0.2596 0.2348 0.0000  -0.0042 -0.0072 351  LYS B O     
2550 C CB    . LYS B 166 ? 0.2394 0.2586 0.2474 0.0023  -0.0009 -0.0041 351  LYS B CB    
2551 C CG    . LYS B 166 ? 0.2811 0.2835 0.2794 0.0061  -0.0008 -0.0072 351  LYS B CG    
2552 C CD    . LYS B 166 ? 0.2972 0.3329 0.3282 0.0026  -0.0024 -0.0047 351  LYS B CD    
2553 C CE    . LYS B 166 ? 0.3521 0.3523 0.3536 0.0024  -0.0011 -0.0078 351  LYS B CE    
2554 N NZ    . LYS B 166 ? 0.3546 0.3927 0.3767 -0.0017 -0.0042 -0.0052 351  LYS B NZ    
2555 N N     . HIS B 167 ? 0.2427 0.2576 0.2627 0.0034  0.0035  -0.0038 352  HIS B N     
2556 C CA    . HIS B 167 ? 0.2575 0.2662 0.2761 0.0035  0.0049  -0.0051 352  HIS B CA    
2557 C C     . HIS B 167 ? 0.2616 0.2642 0.2780 0.0078  0.0167  0.0013  352  HIS B C     
2558 O O     . HIS B 167 ? 0.2564 0.2700 0.2834 0.0056  0.0129  -0.0010 352  HIS B O     
2559 C CB    . HIS B 167 ? 0.2709 0.2730 0.2844 0.0034  0.0083  -0.0034 352  HIS B CB    
2560 C CG    . HIS B 167 ? 0.2958 0.3035 0.3128 0.0035  -0.0021 -0.0066 352  HIS B CG    
2561 N ND1   . HIS B 167 ? 0.3240 0.3404 0.3338 0.0038  -0.0030 -0.0014 352  HIS B ND1   
2562 C CD2   . HIS B 167 ? 0.3090 0.3239 0.3251 0.0010  0.0034  -0.0027 352  HIS B CD2   
2563 C CE1   . HIS B 167 ? 0.3163 0.3322 0.3323 0.0051  -0.0021 -0.0022 352  HIS B CE1   
2564 N NE2   . HIS B 167 ? 0.3215 0.3285 0.3320 0.0025  -0.0019 -0.0028 352  HIS B NE2   
2565 N N     . LYS C 8   ? 0.3355 0.3297 0.3086 0.0057  -0.0007 0.0079  193  LYS C N     
2566 C CA    . LYS C 8   ? 0.3314 0.3308 0.3095 0.0051  0.0029  0.0079  193  LYS C CA    
2567 C C     . LYS C 8   ? 0.3322 0.3320 0.3097 0.0048  0.0032  0.0071  193  LYS C C     
2568 O O     . LYS C 8   ? 0.3394 0.3440 0.3141 0.0036  0.0016  0.0093  193  LYS C O     
2569 C CB    . LYS C 8   ? 0.3271 0.3250 0.3021 0.0064  0.0014  0.0084  193  LYS C CB    
2570 C CG    . LYS C 8   ? 0.3055 0.3163 0.2852 0.0069  0.0078  0.0077  193  LYS C CG    
2571 C CD    . LYS C 8   ? 0.2601 0.2822 0.2628 0.0077  0.0013  0.0188  193  LYS C CD    
2572 C CE    . LYS C 8   ? 0.2569 0.2712 0.2318 0.0037  0.0072  0.0141  193  LYS C CE    
2573 N NZ    . LYS C 8   ? 0.1860 0.2512 0.1849 0.0174  -0.0087 0.0177  193  LYS C NZ    
2574 N N     . SER C 9   ? 0.3301 0.3346 0.3128 0.0041  0.0043  0.0088  194  SER C N     
2575 C CA    . SER C 9   ? 0.3267 0.3337 0.3127 0.0065  0.0045  0.0076  194  SER C CA    
2576 C C     . SER C 9   ? 0.3248 0.3341 0.3116 0.0073  0.0032  0.0111  194  SER C C     
2577 O O     . SER C 9   ? 0.3237 0.3371 0.3011 0.0077  0.0049  0.0136  194  SER C O     
2578 C CB    . SER C 9   ? 0.3309 0.3346 0.3163 0.0033  0.0027  0.0055  194  SER C CB    
2579 O OG    . SER C 9   ? 0.3232 0.3496 0.3062 0.0093  0.0089  0.0067  194  SER C OG    
2580 N N     . LYS C 10  ? 0.3209 0.3261 0.3027 0.0104  0.0016  0.0142  195  LYS C N     
2581 C CA    . LYS C 10  ? 0.3158 0.3226 0.3014 0.0096  0.0007  0.0149  195  LYS C CA    
2582 C C     . LYS C 10  ? 0.3072 0.3133 0.2975 0.0074  0.0037  0.0157  195  LYS C C     
2583 O O     . LYS C 10  ? 0.3099 0.3168 0.2860 0.0080  0.0046  0.0207  195  LYS C O     
2584 C CB    . LYS C 10  ? 0.3155 0.3203 0.3016 0.0097  -0.0020 0.0155  195  LYS C CB    
2585 C CG    . LYS C 10  ? 0.3192 0.3251 0.3084 0.0103  -0.0014 0.0117  195  LYS C CG    
2586 C CD    . LYS C 10  ? 0.3283 0.3310 0.3171 0.0088  -0.0025 0.0120  195  LYS C CD    
2587 C CE    . LYS C 10  ? 0.3433 0.3471 0.3436 0.0120  0.0011  0.0036  195  LYS C CE    
2588 N NZ    . LYS C 10  ? 0.3559 0.3678 0.3541 0.0132  -0.0065 0.0081  195  LYS C NZ    
2589 N N     . ALA C 11  ? 0.3013 0.3101 0.2911 0.0069  0.0038  0.0160  196  ALA C N     
2590 C CA    . ALA C 11  ? 0.2939 0.3016 0.2895 0.0044  0.0050  0.0186  196  ALA C CA    
2591 C C     . ALA C 11  ? 0.2906 0.2982 0.2833 0.0054  0.0041  0.0170  196  ALA C C     
2592 O O     . ALA C 11  ? 0.2822 0.2916 0.2772 0.0077  0.0060  0.0247  196  ALA C O     
2593 C CB    . ALA C 11  ? 0.3006 0.3058 0.2946 0.0000  0.0075  0.0174  196  ALA C CB    
2594 N N     . GLU C 12  ? 0.2930 0.2957 0.2740 0.0058  0.0045  0.0179  197  GLU C N     
2595 C CA    . GLU C 12  ? 0.2909 0.2976 0.2770 0.0076  0.0029  0.0138  197  GLU C CA    
2596 C C     . GLU C 12  ? 0.2778 0.2846 0.2598 0.0094  0.0041  0.0101  197  GLU C C     
2597 O O     . GLU C 12  ? 0.2701 0.2807 0.2453 0.0140  0.0034  0.0161  197  GLU C O     
2598 C CB    . GLU C 12  ? 0.2917 0.2988 0.2711 0.0086  0.0026  0.0114  197  GLU C CB    
2599 C CG    . GLU C 12  ? 0.3076 0.3264 0.3076 0.0036  0.0055  0.0066  197  GLU C CG    
2600 C CD    . GLU C 12  ? 0.3143 0.3327 0.3080 0.0074  0.0044  0.0046  197  GLU C CD    
2601 O OE1   . GLU C 12  ? 0.3414 0.3982 0.3605 0.0089  0.0024  -0.0008 197  GLU C OE1   
2602 O OE2   . GLU C 12  ? 0.3376 0.3537 0.3170 0.0091  -0.0015 -0.0041 197  GLU C OE2   
2603 N N     . LEU C 13  ? 0.2640 0.2677 0.2500 0.0075  0.0079  0.0118  198  LEU C N     
2604 C CA    . LEU C 13  ? 0.2612 0.2607 0.2443 0.0077  0.0062  0.0118  198  LEU C CA    
2605 C C     . LEU C 13  ? 0.2618 0.2563 0.2431 0.0077  0.0068  0.0147  198  LEU C C     
2606 O O     . LEU C 13  ? 0.2532 0.2490 0.2189 0.0106  0.0102  0.0247  198  LEU C O     
2607 C CB    . LEU C 13  ? 0.2623 0.2627 0.2529 0.0042  0.0040  0.0111  198  LEU C CB    
2608 C CG    . LEU C 13  ? 0.2793 0.2816 0.2660 0.0044  0.0053  0.0080  198  LEU C CG    
2609 C CD1   . LEU C 13  ? 0.2921 0.3019 0.2746 0.0037  -0.0014 0.0012  198  LEU C CD1   
2610 C CD2   . LEU C 13  ? 0.2774 0.2701 0.2757 0.0062  0.0089  0.0055  198  LEU C CD2   
2611 N N     . GLN C 14  ? 0.2597 0.2517 0.2433 0.0038  0.0058  0.0186  199  GLN C N     
2612 C CA    . GLN C 14  ? 0.2640 0.2590 0.2562 0.0049  0.0052  0.0157  199  GLN C CA    
2613 C C     . GLN C 14  ? 0.2453 0.2473 0.2485 0.0068  0.0058  0.0168  199  GLN C C     
2614 O O     . GLN C 14  ? 0.2396 0.2415 0.2381 0.0064  0.0006  0.0253  199  GLN C O     
2615 C CB    . GLN C 14  ? 0.2641 0.2601 0.2545 0.0023  0.0034  0.0201  199  GLN C CB    
2616 C CG    . GLN C 14  ? 0.2903 0.2962 0.2870 0.0058  -0.0009 0.0117  199  GLN C CG    
2617 C CD    . GLN C 14  ? 0.3036 0.2947 0.2978 0.0084  0.0002  0.0156  199  GLN C CD    
2618 O OE1   . GLN C 14  ? 0.3638 0.3542 0.3757 0.0219  0.0074  0.0049  199  GLN C OE1   
2619 N NE2   . GLN C 14  ? 0.3395 0.3370 0.3298 0.0100  0.0081  0.0137  199  GLN C NE2   
2620 N N     . SER C 15  ? 0.2364 0.2427 0.2441 0.0005  0.0068  0.0180  200  SER C N     
2621 C CA    . SER C 15  ? 0.2302 0.2398 0.2388 0.0043  0.0076  0.0150  200  SER C CA    
2622 C C     . SER C 15  ? 0.2166 0.2252 0.2245 0.0054  0.0056  0.0123  200  SER C C     
2623 O O     . SER C 15  ? 0.2084 0.2203 0.2124 0.0054  0.0122  0.0189  200  SER C O     
2624 C CB    . SER C 15  ? 0.2471 0.2496 0.2517 -0.0005 0.0122  0.0110  200  SER C CB    
2625 O OG    . SER C 15  ? 0.2867 0.2837 0.2938 0.0095  0.0083  0.0011  200  SER C OG    
2626 N N     . GLU C 16  ? 0.1869 0.2108 0.2025 0.0080  0.0058  0.0193  201  GLU C N     
2627 C CA    . GLU C 16  ? 0.1747 0.2061 0.1934 0.0057  0.0084  0.0183  201  GLU C CA    
2628 C C     . GLU C 16  ? 0.1662 0.2030 0.1790 0.0090  0.0074  0.0201  201  GLU C C     
2629 O O     . GLU C 16  ? 0.1516 0.1877 0.1639 0.0103  0.0124  0.0281  201  GLU C O     
2630 C CB    . GLU C 16  ? 0.1795 0.2039 0.1882 0.0088  0.0052  0.0207  201  GLU C CB    
2631 C CG    . GLU C 16  ? 0.1864 0.2276 0.2110 0.0049  0.0064  0.0096  201  GLU C CG    
2632 C CD    . GLU C 16  ? 0.1956 0.2246 0.2143 0.0096  0.0035  0.0130  201  GLU C CD    
2633 O OE1   . GLU C 16  ? 0.1723 0.2129 0.2246 0.0161  0.0033  0.0082  201  GLU C OE1   
2634 O OE2   . GLU C 16  ? 0.2137 0.2629 0.2333 0.0258  0.0083  0.0126  201  GLU C OE2   
2635 N N     . GLU C 17  ? 0.1587 0.2051 0.1820 0.0071  0.0114  0.0239  202  GLU C N     
2636 C CA    . GLU C 17  ? 0.1656 0.2091 0.1884 0.0035  0.0090  0.0226  202  GLU C CA    
2637 C C     . GLU C 17  ? 0.1751 0.2129 0.1921 0.0090  0.0084  0.0224  202  GLU C C     
2638 O O     . GLU C 17  ? 0.1763 0.2256 0.1936 0.0069  0.0094  0.0299  202  GLU C O     
2639 C CB    . GLU C 17  ? 0.1716 0.2200 0.1910 0.0073  0.0116  0.0237  202  GLU C CB    
2640 C CG    . GLU C 17  ? 0.1719 0.2354 0.2199 0.0084  0.0106  0.0154  202  GLU C CG    
2641 C CD    . GLU C 17  ? 0.2333 0.2582 0.2625 0.0020  0.0172  0.0141  202  GLU C CD    
2642 O OE1   . GLU C 17  ? 0.2363 0.2692 0.2974 -0.0029 0.0087  0.0180  202  GLU C OE1   
2643 O OE2   . GLU C 17  ? 0.2258 0.2861 0.2763 0.0097  0.0137  0.0072  202  GLU C OE2   
2644 N N     . ARG C 18  ? 0.1845 0.2095 0.1987 0.0076  0.0041  0.0248  203  ARG C N     
2645 C CA    . ARG C 18  ? 0.2167 0.2158 0.2193 0.0052  0.0068  0.0191  203  ARG C CA    
2646 C C     . ARG C 18  ? 0.2012 0.1940 0.2063 0.0043  0.0101  0.0172  203  ARG C C     
2647 O O     . ARG C 18  ? 0.1984 0.1810 0.2006 0.0062  0.0238  0.0277  203  ARG C O     
2648 C CB    . ARG C 18  ? 0.2237 0.2094 0.2212 0.0009  0.0035  0.0206  203  ARG C CB    
2649 C CG    . ARG C 18  ? 0.2809 0.2490 0.2591 0.0012  0.0026  0.0108  203  ARG C CG    
2650 C CD    . ARG C 18  ? 0.2764 0.2532 0.2688 -0.0039 0.0040  0.0106  203  ARG C CD    
2651 N NE    . ARG C 18  ? 0.3409 0.3367 0.3507 0.0139  -0.0150 0.0138  203  ARG C NE    
2652 C CZ    . ARG C 18  ? 0.3783 0.3606 0.3690 0.0021  0.0029  0.0052  203  ARG C CZ    
2653 N NH1   . ARG C 18  ? 0.3683 0.3812 0.3877 -0.0072 0.0026  0.0017  203  ARG C NH1   
2654 N NH2   . ARG C 18  ? 0.3662 0.3619 0.3667 0.0154  -0.0074 0.0078  203  ARG C NH2   
2655 N N     . LYS C 19  ? 0.1827 0.1822 0.2014 0.0048  0.0155  0.0179  204  LYS C N     
2656 C CA    . LYS C 19  ? 0.1755 0.1850 0.1995 0.0034  0.0117  0.0119  204  LYS C CA    
2657 C C     . LYS C 19  ? 0.1577 0.1768 0.1834 0.0081  0.0107  0.0117  204  LYS C C     
2658 O O     . LYS C 19  ? 0.1575 0.1826 0.1827 0.0014  0.0158  0.0136  204  LYS C O     
2659 C CB    . LYS C 19  ? 0.1772 0.1947 0.2047 0.0073  0.0122  0.0095  204  LYS C CB    
2660 C CG    . LYS C 19  ? 0.2266 0.2275 0.2551 -0.0032 0.0074  0.0066  204  LYS C CG    
2661 C CD    . LYS C 19  ? 0.2566 0.2843 0.3025 0.0089  0.0104  0.0006  204  LYS C CD    
2662 C CE    . LYS C 19  ? 0.3115 0.2948 0.3213 -0.0036 0.0054  0.0077  204  LYS C CE    
2663 N NZ    . LYS C 19  ? 0.3543 0.3262 0.3337 0.0003  -0.0021 0.0033  204  LYS C NZ    
2664 N N     . ARG C 20  ? 0.1494 0.1694 0.1715 0.0147  0.0139  0.0128  205  ARG C N     
2665 C CA    . ARG C 20  ? 0.1419 0.1681 0.1712 0.0122  0.0103  0.0121  205  ARG C CA    
2666 C C     . ARG C 20  ? 0.1440 0.1715 0.1604 0.0137  0.0095  0.0135  205  ARG C C     
2667 O O     . ARG C 20  ? 0.1439 0.1781 0.1480 0.0141  0.0051  0.0227  205  ARG C O     
2668 C CB    . ARG C 20  ? 0.1511 0.1689 0.1807 0.0108  0.0126  0.0088  205  ARG C CB    
2669 C CG    . ARG C 20  ? 0.1635 0.1653 0.1791 0.0150  0.0105  0.0158  205  ARG C CG    
2670 C CD    . ARG C 20  ? 0.1784 0.1739 0.1971 0.0106  0.0032  0.0020  205  ARG C CD    
2671 N NE    . ARG C 20  ? 0.1993 0.2009 0.1849 -0.0039 0.0047  0.0040  205  ARG C NE    
2672 C CZ    . ARG C 20  ? 0.1824 0.2001 0.1868 0.0051  0.0048  0.0088  205  ARG C CZ    
2673 N NH1   . ARG C 20  ? 0.1832 0.1949 0.1963 -0.0017 0.0136  0.0054  205  ARG C NH1   
2674 N NH2   . ARG C 20  ? 0.2038 0.2144 0.1907 -0.0095 -0.0041 0.0052  205  ARG C NH2   
2675 N N     . ILE C 21  ? 0.1463 0.1736 0.1652 0.0095  0.0075  0.0138  206  ILE C N     
2676 C CA    . ILE C 21  ? 0.1456 0.1763 0.1668 0.0085  0.0060  0.0140  206  ILE C CA    
2677 C C     . ILE C 21  ? 0.1405 0.1716 0.1658 0.0105  0.0050  0.0126  206  ILE C C     
2678 O O     . ILE C 21  ? 0.1323 0.1894 0.1698 0.0044  0.0020  0.0236  206  ILE C O     
2679 C CB    . ILE C 21  ? 0.1467 0.1760 0.1585 0.0107  0.0080  0.0176  206  ILE C CB    
2680 C CG1   . ILE C 21  ? 0.1639 0.1777 0.1618 -0.0040 0.0152  0.0180  206  ILE C CG1   
2681 C CG2   . ILE C 21  ? 0.1657 0.1730 0.1746 0.0183  0.0138  0.0209  206  ILE C CG2   
2682 C CD1   . ILE C 21  ? 0.1694 0.1885 0.1626 -0.0235 0.0084  0.0115  206  ILE C CD1   
2683 N N     . ASP C 22  ? 0.1408 0.1827 0.1800 0.0092  0.0102  0.0102  207  ASP C N     
2684 C CA    . ASP C 22  ? 0.1508 0.1954 0.1871 0.0037  0.0101  0.0110  207  ASP C CA    
2685 C C     . ASP C 22  ? 0.1577 0.1992 0.1879 0.0033  0.0052  0.0075  207  ASP C C     
2686 O O     . ASP C 22  ? 0.1616 0.2102 0.1891 0.0074  0.0055  0.0072  207  ASP C O     
2687 C CB    . ASP C 22  ? 0.1475 0.1963 0.1909 -0.0047 0.0110  0.0166  207  ASP C CB    
2688 C CG    . ASP C 22  ? 0.1927 0.2228 0.2223 0.0025  0.0044  0.0162  207  ASP C CG    
2689 O OD1   . ASP C 22  ? 0.2123 0.2370 0.2357 0.0228  0.0104  0.0068  207  ASP C OD1   
2690 O OD2   . ASP C 22  ? 0.2393 0.2662 0.2614 -0.0061 0.0270  0.0258  207  ASP C OD2   
2691 N N     . GLU C 23  ? 0.1643 0.2031 0.1918 0.0052  0.0023  0.0078  208  GLU C N     
2692 C CA    . GLU C 23  ? 0.1916 0.2180 0.2101 0.0067  0.0020  0.0085  208  GLU C CA    
2693 C C     . GLU C 23  ? 0.1813 0.2090 0.1936 0.0056  -0.0026 0.0085  208  GLU C C     
2694 O O     . GLU C 23  ? 0.1768 0.2114 0.1886 0.0128  -0.0011 0.0099  208  GLU C O     
2695 C CB    . GLU C 23  ? 0.1862 0.2147 0.2129 0.0099  0.0000  0.0095  208  GLU C CB    
2696 C CG    . GLU C 23  ? 0.2298 0.2570 0.2586 0.0006  0.0107  0.0035  208  GLU C CG    
2697 C CD    . GLU C 23  ? 0.2428 0.2683 0.2581 0.0034  0.0101  0.0011  208  GLU C CD    
2698 O OE1   . GLU C 23  ? 0.2873 0.3369 0.3430 -0.0087 0.0089  0.0101  208  GLU C OE1   
2699 O OE2   . GLU C 23  ? 0.3248 0.3005 0.3323 -0.0008 0.0079  -0.0054 208  GLU C OE2   
2700 N N     . LEU C 24  ? 0.1547 0.1964 0.1801 0.0081  0.0015  0.0165  209  LEU C N     
2701 C CA    . LEU C 24  ? 0.1668 0.1929 0.1750 0.0013  0.0039  0.0133  209  LEU C CA    
2702 C C     . LEU C 24  ? 0.1659 0.1944 0.1713 0.0034  0.0032  0.0141  209  LEU C C     
2703 O O     . LEU C 24  ? 0.1785 0.2063 0.1733 0.0081  0.0158  0.0110  209  LEU C O     
2704 C CB    . LEU C 24  ? 0.1693 0.1937 0.1820 0.0007  0.0050  0.0065  209  LEU C CB    
2705 C CG    . LEU C 24  ? 0.1708 0.1844 0.1730 0.0015  0.0030  0.0105  209  LEU C CG    
2706 C CD1   . LEU C 24  ? 0.1596 0.2101 0.1968 -0.0062 -0.0044 0.0100  209  LEU C CD1   
2707 C CD2   . LEU C 24  ? 0.1999 0.1918 0.2088 -0.0025 0.0084  0.0181  209  LEU C CD2   
2708 N N     . ILE C 25  ? 0.1643 0.1866 0.1755 0.0024  0.0066  0.0082  210  ILE C N     
2709 C CA    . ILE C 25  ? 0.1699 0.1899 0.1777 0.0028  -0.0009 0.0102  210  ILE C CA    
2710 C C     . ILE C 25  ? 0.1747 0.2067 0.1885 0.0031  -0.0001 0.0046  210  ILE C C     
2711 O O     . ILE C 25  ? 0.1651 0.2089 0.1806 0.0141  -0.0050 0.0120  210  ILE C O     
2712 C CB    . ILE C 25  ? 0.1716 0.1848 0.1722 -0.0003 -0.0040 0.0085  210  ILE C CB    
2713 C CG1   . ILE C 25  ? 0.1620 0.1851 0.1764 -0.0080 -0.0001 0.0133  210  ILE C CG1   
2714 C CG2   . ILE C 25  ? 0.1685 0.1867 0.1837 0.0047  -0.0026 0.0025  210  ILE C CG2   
2715 C CD1   . ILE C 25  ? 0.1758 0.1914 0.1832 0.0038  0.0075  0.0190  210  ILE C CD1   
2716 N N     . GLU C 26  ? 0.1733 0.2128 0.1936 0.0027  -0.0034 0.0070  211  GLU C N     
2717 C CA    . GLU C 26  ? 0.1936 0.2302 0.2096 0.0007  -0.0021 0.0063  211  GLU C CA    
2718 C C     . GLU C 26  ? 0.1892 0.2275 0.2102 0.0021  -0.0027 0.0051  211  GLU C C     
2719 O O     . GLU C 26  ? 0.2054 0.2435 0.2151 0.0051  -0.0098 0.0056  211  GLU C O     
2720 C CB    . GLU C 26  ? 0.1968 0.2358 0.2212 -0.0041 -0.0019 0.0066  211  GLU C CB    
2721 C CG    . GLU C 26  ? 0.2675 0.2656 0.2631 -0.0004 -0.0036 0.0117  211  GLU C CG    
2722 C CD    . GLU C 26  ? 0.3023 0.3211 0.3137 -0.0049 0.0093  0.0101  211  GLU C CD    
2723 O OE1   . GLU C 26  ? 0.3466 0.3220 0.3660 0.0041  -0.0029 0.0159  211  GLU C OE1   
2724 O OE2   . GLU C 26  ? 0.3401 0.3390 0.3618 0.0063  0.0089  0.0077  211  GLU C OE2   
2725 N N     . SER C 27  ? 0.1798 0.2238 0.2077 0.0037  -0.0038 0.0082  212  SER C N     
2726 C CA    . SER C 27  ? 0.1920 0.2316 0.2082 -0.0024 -0.0056 0.0087  212  SER C CA    
2727 C C     . SER C 27  ? 0.1906 0.2363 0.2093 0.0001  -0.0052 0.0069  212  SER C C     
2728 O O     . SER C 27  ? 0.2024 0.2416 0.2033 -0.0091 -0.0014 0.0096  212  SER C O     
2729 C CB    . SER C 27  ? 0.1954 0.2283 0.2128 -0.0016 -0.0028 0.0065  212  SER C CB    
2730 O OG    . SER C 27  ? 0.2278 0.2546 0.2442 0.0029  -0.0154 0.0070  212  SER C OG    
2731 N N     . GLY C 28  ? 0.1859 0.2353 0.2133 -0.0004 -0.0030 0.0074  213  GLY C N     
2732 C CA    . GLY C 28  ? 0.1941 0.2270 0.2177 0.0016  0.0047  0.0007  213  GLY C CA    
2733 C C     . GLY C 28  ? 0.1940 0.2228 0.2150 0.0012  -0.0007 0.0019  213  GLY C C     
2734 O O     . GLY C 28  ? 0.2051 0.2205 0.2185 -0.0025 0.0051  0.0024  213  GLY C O     
2735 N N     . LYS C 29  ? 0.1980 0.2250 0.2182 0.0017  -0.0008 0.0025  214  LYS C N     
2736 C CA    . LYS C 29  ? 0.1968 0.2231 0.2253 -0.0016 0.0016  0.0048  214  LYS C CA    
2737 C C     . LYS C 29  ? 0.1944 0.2077 0.2082 -0.0009 0.0062  0.0083  214  LYS C C     
2738 O O     . LYS C 29  ? 0.2053 0.2252 0.2121 -0.0058 0.0160  0.0097  214  LYS C O     
2739 C CB    . LYS C 29  ? 0.2091 0.2362 0.2393 0.0012  0.0053  0.0027  214  LYS C CB    
2740 C CG    . LYS C 29  ? 0.2327 0.2782 0.2788 -0.0051 -0.0007 0.0030  214  LYS C CG    
2741 C CD    . LYS C 29  ? 0.3069 0.3149 0.3270 0.0063  0.0114  -0.0059 214  LYS C CD    
2742 C CE    . LYS C 29  ? 0.3426 0.3440 0.3403 0.0057  0.0039  -0.0044 214  LYS C CE    
2743 N NZ    . LYS C 29  ? 0.3585 0.3706 0.3723 -0.0001 0.0013  -0.0073 214  LYS C NZ    
2744 N N     . GLU C 30  ? 0.1679 0.1844 0.1844 0.0006  0.0065  0.0004  215  GLU C N     
2745 C CA    . GLU C 30  ? 0.1589 0.1638 0.1748 0.0008  0.0052  0.0034  215  GLU C CA    
2746 C C     . GLU C 30  ? 0.1635 0.1748 0.1825 -0.0007 0.0056  0.0014  215  GLU C C     
2747 O O     . GLU C 30  ? 0.1880 0.1833 0.2034 0.0024  0.0183  0.0086  215  GLU C O     
2748 C CB    . GLU C 30  ? 0.1473 0.1650 0.1680 -0.0014 0.0072  0.0063  215  GLU C CB    
2749 C CG    . GLU C 30  ? 0.1414 0.1442 0.1426 0.0071  -0.0061 0.0055  215  GLU C CG    
2750 C CD    . GLU C 30  ? 0.1276 0.1578 0.1276 -0.0046 -0.0069 -0.0018 215  GLU C CD    
2751 O OE1   . GLU C 30  ? 0.1139 0.1793 0.1508 -0.0019 -0.0012 0.0040  215  GLU C OE1   
2752 O OE2   . GLU C 30  ? 0.1154 0.1598 0.1147 0.0052  0.0020  0.0065  215  GLU C OE2   
2753 N N     . GLU C 31  ? 0.1577 0.1769 0.1860 0.0060  0.0038  0.0040  216  GLU C N     
2754 C CA    . GLU C 31  ? 0.1649 0.1807 0.1896 0.0015  0.0044  0.0024  216  GLU C CA    
2755 C C     . GLU C 31  ? 0.1599 0.1740 0.1779 0.0043  0.0041  0.0049  216  GLU C C     
2756 O O     . GLU C 31  ? 0.1592 0.1713 0.1714 -0.0031 -0.0011 0.0176  216  GLU C O     
2757 C CB    . GLU C 31  ? 0.1782 0.1966 0.2050 0.0029  0.0098  0.0022  216  GLU C CB    
2758 C CG    . GLU C 31  ? 0.2307 0.2598 0.2577 0.0005  -0.0059 -0.0020 216  GLU C CG    
2759 C CD    . GLU C 31  ? 0.2895 0.3276 0.3136 0.0161  0.0111  -0.0071 216  GLU C CD    
2760 O OE1   . GLU C 31  ? 0.3377 0.3657 0.3403 0.0111  0.0093  0.0052  216  GLU C OE1   
2761 O OE2   . GLU C 31  ? 0.3332 0.3673 0.3512 0.0163  -0.0041 0.0026  216  GLU C OE2   
2762 N N     . GLY C 32  ? 0.1461 0.1599 0.1659 0.0025  0.0077  -0.0002 217  GLY C N     
2763 C CA    . GLY C 32  ? 0.1369 0.1585 0.1531 0.0048  0.0043  0.0003  217  GLY C CA    
2764 C C     . GLY C 32  ? 0.1412 0.1519 0.1448 0.0012  0.0045  0.0025  217  GLY C C     
2765 O O     . GLY C 32  ? 0.1307 0.1450 0.1313 -0.0037 -0.0001 0.0020  217  GLY C O     
2766 N N     . MET C 33  ? 0.1334 0.1428 0.1321 0.0004  0.0018  0.0039  218  MET C N     
2767 C CA    . MET C 33  ? 0.1345 0.1457 0.1389 0.0079  -0.0017 0.0090  218  MET C CA    
2768 C C     . MET C 33  ? 0.1305 0.1468 0.1308 0.0071  -0.0022 -0.0020 218  MET C C     
2769 O O     . MET C 33  ? 0.1275 0.1674 0.1520 0.0097  -0.0082 0.0013  218  MET C O     
2770 C CB    . MET C 33  ? 0.1490 0.1528 0.1468 0.0101  0.0004  0.0098  218  MET C CB    
2771 C CG    . MET C 33  ? 0.1616 0.1635 0.1446 0.0045  -0.0050 0.0053  218  MET C CG    
2772 S SD    . MET C 33  ? 0.1223 0.1497 0.1734 0.0034  0.0172  0.0243  218  MET C SD    
2773 C CE    . MET C 33  ? 0.1549 0.1989 0.2208 -0.0066 0.0096  0.0163  218  MET C CE    
2774 N N     . LYS C 34  ? 0.1307 0.1482 0.1156 0.0089  0.0029  0.0018  219  LYS C N     
2775 C CA    . LYS C 34  ? 0.1540 0.1670 0.1282 0.0079  0.0022  0.0012  219  LYS C CA    
2776 C C     . LYS C 34  ? 0.1394 0.1593 0.1177 0.0049  -0.0045 -0.0032 219  LYS C C     
2777 O O     . LYS C 34  ? 0.1300 0.1523 0.1224 0.0043  -0.0159 -0.0020 219  LYS C O     
2778 C CB    . LYS C 34  ? 0.1784 0.1718 0.1368 0.0142  0.0024  -0.0011 219  LYS C CB    
2779 C CG    . LYS C 34  ? 0.2151 0.2007 0.1793 0.0064  0.0013  0.0141  219  LYS C CG    
2780 C CD    . LYS C 34  ? 0.2366 0.2055 0.2014 0.0002  0.0085  0.0154  219  LYS C CD    
2781 C CE    . LYS C 34  ? 0.3001 0.2909 0.2874 0.0163  0.0147  -0.0033 219  LYS C CE    
2782 N NZ    . LYS C 34  ? 0.3622 0.3308 0.3606 -0.0054 0.0069  0.0081  219  LYS C NZ    
2783 N N     . ILE C 35  ? 0.1343 0.1598 0.1078 0.0035  0.0000  -0.0038 220  ILE C N     
2784 C CA    . ILE C 35  ? 0.1452 0.1562 0.1215 -0.0022 0.0034  -0.0001 220  ILE C CA    
2785 C C     . ILE C 35  ? 0.1430 0.1586 0.1301 -0.0045 0.0046  0.0047  220  ILE C C     
2786 O O     . ILE C 35  ? 0.1475 0.1723 0.1373 0.0014  0.0066  0.0124  220  ILE C O     
2787 C CB    . ILE C 35  ? 0.1409 0.1580 0.1159 -0.0015 -0.0021 -0.0044 220  ILE C CB    
2788 C CG1   . ILE C 35  ? 0.1665 0.1591 0.1147 -0.0066 -0.0076 -0.0034 220  ILE C CG1   
2789 C CG2   . ILE C 35  ? 0.1609 0.1787 0.1329 0.0038  0.0063  -0.0125 220  ILE C CG2   
2790 C CD1   . ILE C 35  ? 0.1853 0.1847 0.1256 -0.0009 -0.0177 -0.0181 220  ILE C CD1   
2791 N N     . ASP C 36  ? 0.1415 0.1544 0.1252 0.0002  0.0064  0.0112  221  ASP C N     
2792 C CA    . ASP C 36  ? 0.1541 0.1576 0.1427 -0.0044 0.0045  0.0080  221  ASP C CA    
2793 C C     . ASP C 36  ? 0.1524 0.1541 0.1338 -0.0012 0.0044  0.0142  221  ASP C C     
2794 O O     . ASP C 36  ? 0.1573 0.1558 0.1608 -0.0041 0.0260  0.0250  221  ASP C O     
2795 C CB    . ASP C 36  ? 0.1684 0.1616 0.1609 -0.0030 -0.0033 0.0036  221  ASP C CB    
2796 C CG    . ASP C 36  ? 0.2098 0.2000 0.1814 -0.0127 -0.0007 0.0113  221  ASP C CG    
2797 O OD1   . ASP C 36  ? 0.2561 0.2396 0.1980 -0.0242 -0.0185 0.0252  221  ASP C OD1   
2798 O OD2   . ASP C 36  ? 0.2602 0.2486 0.2398 -0.0178 -0.0103 -0.0063 221  ASP C OD2   
2799 N N     . LEU C 37  ? 0.1412 0.1548 0.1339 -0.0081 0.0040  0.0092  222  LEU C N     
2800 C CA    . LEU C 37  ? 0.1503 0.1557 0.1241 -0.0032 0.0040  0.0100  222  LEU C CA    
2801 C C     . LEU C 37  ? 0.1467 0.1407 0.1184 -0.0064 0.0040  0.0029  222  LEU C C     
2802 O O     . LEU C 37  ? 0.1724 0.1472 0.1306 -0.0010 -0.0030 0.0053  222  LEU C O     
2803 C CB    . LEU C 37  ? 0.1660 0.1746 0.1274 -0.0066 0.0049  0.0053  222  LEU C CB    
2804 C CG    . LEU C 37  ? 0.1934 0.2029 0.1428 0.0008  0.0000  0.0062  222  LEU C CG    
2805 C CD1   . LEU C 37  ? 0.2159 0.2310 0.1759 -0.0043 0.0171  0.0159  222  LEU C CD1   
2806 C CD2   . LEU C 37  ? 0.2352 0.2263 0.1741 -0.0058 0.0007  -0.0170 222  LEU C CD2   
2807 N N     . ILE C 38  ? 0.1318 0.1396 0.1019 -0.0078 0.0022  0.0093  223  ILE C N     
2808 C CA    . ILE C 38  ? 0.1235 0.1254 0.1014 -0.0138 0.0039  0.0093  223  ILE C CA    
2809 C C     . ILE C 38  ? 0.1266 0.1326 0.1077 -0.0142 -0.0018 0.0063  223  ILE C C     
2810 O O     . ILE C 38  ? 0.1242 0.1326 0.1016 -0.0143 0.0033  0.0056  223  ILE C O     
2811 C CB    . ILE C 38  ? 0.1231 0.1326 0.0961 -0.0089 0.0102  0.0159  223  ILE C CB    
2812 C CG1   . ILE C 38  ? 0.1336 0.1400 0.1359 -0.0133 0.0087  0.0056  223  ILE C CG1   
2813 C CG2   . ILE C 38  ? 0.1326 0.1517 0.1122 -0.0102 0.0026  0.0009  223  ILE C CG2   
2814 C CD1   . ILE C 38  ? 0.1670 0.1497 0.1222 0.0087  0.0052  0.0049  223  ILE C CD1   
2815 N N     . ASP C 39  ? 0.1261 0.1450 0.1086 -0.0178 -0.0013 0.0072  224  ASP C N     
2816 C CA    . ASP C 39  ? 0.1312 0.1450 0.1210 -0.0194 -0.0022 0.0010  224  ASP C CA    
2817 C C     . ASP C 39  ? 0.1331 0.1387 0.1130 -0.0197 -0.0016 0.0000  224  ASP C C     
2818 O O     . ASP C 39  ? 0.1511 0.1548 0.1067 -0.0233 0.0052  -0.0011 224  ASP C O     
2819 C CB    . ASP C 39  ? 0.1329 0.1498 0.1224 -0.0262 -0.0047 -0.0024 224  ASP C CB    
2820 C CG    . ASP C 39  ? 0.1567 0.1860 0.1422 -0.0240 0.0036  -0.0017 224  ASP C CG    
2821 O OD1   . ASP C 39  ? 0.1618 0.2063 0.1450 -0.0572 0.0132  -0.0153 224  ASP C OD1   
2822 O OD2   . ASP C 39  ? 0.1829 0.2361 0.1845 -0.0533 -0.0035 -0.0037 224  ASP C OD2   
2823 N N     . GLY C 40  ? 0.1327 0.1383 0.1224 -0.0220 0.0023  0.0025  225  GLY C N     
2824 C CA    . GLY C 40  ? 0.1290 0.1429 0.1470 -0.0188 -0.0008 0.0017  225  GLY C CA    
2825 C C     . GLY C 40  ? 0.1205 0.1393 0.1450 -0.0158 -0.0036 0.0025  225  GLY C C     
2826 O O     . GLY C 40  ? 0.1245 0.1502 0.1783 -0.0062 0.0069  0.0008  225  GLY C O     
2827 N N     . LYS C 41  ? 0.1156 0.1331 0.1304 -0.0168 -0.0004 -0.0008 226  LYS C N     
2828 C CA    . LYS C 41  ? 0.1205 0.1428 0.1191 -0.0186 -0.0046 -0.0034 226  LYS C CA    
2829 C C     . LYS C 41  ? 0.1168 0.1399 0.1231 -0.0157 -0.0048 0.0021  226  LYS C C     
2830 O O     . LYS C 41  ? 0.1396 0.1562 0.1337 -0.0285 -0.0028 0.0053  226  LYS C O     
2831 C CB    . LYS C 41  ? 0.1246 0.1454 0.1135 -0.0110 -0.0032 -0.0054 226  LYS C CB    
2832 C CG    . LYS C 41  ? 0.1279 0.1423 0.1247 -0.0188 -0.0106 -0.0018 226  LYS C CG    
2833 C CD    . LYS C 41  ? 0.1082 0.1382 0.1215 -0.0148 -0.0062 0.0021  226  LYS C CD    
2834 C CE    . LYS C 41  ? 0.1123 0.1703 0.1192 -0.0035 -0.0209 -0.0058 226  LYS C CE    
2835 N NZ    . LYS C 41  ? 0.1232 0.1564 0.1318 -0.0046 -0.0112 -0.0245 226  LYS C NZ    
2836 N N     . GLY C 42  ? 0.1135 0.1390 0.1103 -0.0077 -0.0086 -0.0064 227  GLY C N     
2837 C CA    . GLY C 42  ? 0.1220 0.1381 0.1098 -0.0065 -0.0065 -0.0086 227  GLY C CA    
2838 C C     . GLY C 42  ? 0.1130 0.1332 0.1022 -0.0104 0.0024  -0.0045 227  GLY C C     
2839 O O     . GLY C 42  ? 0.1206 0.1428 0.1209 -0.0110 0.0030  -0.0124 227  GLY C O     
2840 N N     . ARG C 43  ? 0.1123 0.1349 0.0849 -0.0082 0.0003  -0.0015 228  ARG C N     
2841 C CA    . ARG C 43  ? 0.1175 0.1401 0.0838 -0.0064 0.0028  -0.0001 228  ARG C CA    
2842 C C     . ARG C 43  ? 0.1171 0.1344 0.0871 -0.0012 0.0091  0.0022  228  ARG C C     
2843 O O     . ARG C 43  ? 0.1226 0.1292 0.0755 -0.0031 0.0104  0.0063  228  ARG C O     
2844 C CB    . ARG C 43  ? 0.1244 0.1519 0.0989 -0.0048 -0.0019 -0.0065 228  ARG C CB    
2845 C CG    . ARG C 43  ? 0.1631 0.1725 0.1149 -0.0059 -0.0082 -0.0100 228  ARG C CG    
2846 C CD    . ARG C 43  ? 0.1928 0.1945 0.1699 -0.0156 0.0109  -0.0138 228  ARG C CD    
2847 N NE    . ARG C 43  ? 0.1920 0.2109 0.1553 -0.0049 0.0016  -0.0183 228  ARG C NE    
2848 C CZ    . ARG C 43  ? 0.1916 0.1923 0.1374 -0.0091 -0.0029 -0.0142 228  ARG C CZ    
2849 N NH1   . ARG C 43  ? 0.2127 0.2349 0.1594 -0.0029 -0.0137 -0.0199 228  ARG C NH1   
2850 N NH2   . ARG C 43  ? 0.1864 0.2105 0.1328 0.0161  -0.0213 -0.0212 228  ARG C NH2   
2851 N N     . GLY C 44  ? 0.1146 0.1374 0.0882 -0.0013 0.0117  0.0003  229  GLY C N     
2852 C CA    . GLY C 44  ? 0.1163 0.1297 0.0816 0.0070  0.0056  0.0013  229  GLY C CA    
2853 C C     . GLY C 44  ? 0.1072 0.1295 0.0829 -0.0019 0.0085  0.0011  229  GLY C C     
2854 O O     . GLY C 44  ? 0.1212 0.1349 0.0786 0.0024  0.0128  0.0081  229  GLY C O     
2855 N N     . VAL C 45  ? 0.1042 0.1180 0.0826 -0.0070 0.0097  -0.0062 230  VAL C N     
2856 C CA    . VAL C 45  ? 0.0993 0.1095 0.0749 -0.0052 0.0026  -0.0055 230  VAL C CA    
2857 C C     . VAL C 45  ? 0.1059 0.1186 0.0877 0.0007  0.0019  -0.0058 230  VAL C C     
2858 O O     . VAL C 45  ? 0.1132 0.1398 0.0761 0.0082  -0.0033 0.0064  230  VAL C O     
2859 C CB    . VAL C 45  ? 0.1000 0.1151 0.0842 -0.0027 0.0050  -0.0022 230  VAL C CB    
2860 C CG1   . VAL C 45  ? 0.1029 0.1269 0.1050 0.0028  0.0095  -0.0155 230  VAL C CG1   
2861 C CG2   . VAL C 45  ? 0.1203 0.1223 0.0905 -0.0013 -0.0122 -0.0057 230  VAL C CG2   
2862 N N     . ILE C 46  ? 0.1171 0.1172 0.1003 -0.0009 0.0079  -0.0093 231  ILE C N     
2863 C CA    . ILE C 46  ? 0.1382 0.1305 0.1165 0.0006  0.0078  -0.0075 231  ILE C CA    
2864 C C     . ILE C 46  ? 0.1273 0.1284 0.1161 -0.0024 0.0020  -0.0042 231  ILE C C     
2865 O O     . ILE C 46  ? 0.1366 0.1480 0.1158 0.0018  -0.0030 -0.0062 231  ILE C O     
2866 C CB    . ILE C 46  ? 0.1483 0.1316 0.1583 -0.0149 0.0142  -0.0101 231  ILE C CB    
2867 C CG1   . ILE C 46  ? 0.2004 0.1840 0.1768 0.0021  0.0326  -0.0093 231  ILE C CG1   
2868 C CG2   . ILE C 46  ? 0.2063 0.1907 0.1786 0.0039  0.0104  -0.0132 231  ILE C CG2   
2869 C CD1   . ILE C 46  ? 0.2705 0.2298 0.2373 -0.0113 0.0088  -0.0174 231  ILE C CD1   
2870 N N     . ALA C 47  ? 0.1323 0.1365 0.1126 0.0053  0.0032  -0.0089 232  ALA C N     
2871 C CA    . ALA C 47  ? 0.1326 0.1425 0.1128 0.0051  -0.0021 -0.0034 232  ALA C CA    
2872 C C     . ALA C 47  ? 0.1394 0.1464 0.1288 0.0022  -0.0052 -0.0025 232  ALA C C     
2873 O O     . ALA C 47  ? 0.1295 0.1490 0.1286 -0.0027 -0.0037 0.0025  232  ALA C O     
2874 C CB    . ALA C 47  ? 0.1321 0.1570 0.1129 0.0021  -0.0042 -0.0077 232  ALA C CB    
2875 N N     . THR C 48  ? 0.1432 0.1481 0.1363 0.0010  -0.0078 0.0004  233  THR C N     
2876 C CA    . THR C 48  ? 0.1616 0.1528 0.1619 0.0030  -0.0090 0.0058  233  THR C CA    
2877 C C     . THR C 48  ? 0.1669 0.1544 0.1673 0.0076  -0.0081 0.0030  233  THR C C     
2878 O O     . THR C 48  ? 0.2064 0.1666 0.1966 0.0163  -0.0049 0.0061  233  THR C O     
2879 C CB    . THR C 48  ? 0.1653 0.1550 0.1557 0.0006  -0.0089 0.0087  233  THR C CB    
2880 O OG1   . THR C 48  ? 0.1753 0.1648 0.1994 -0.0018 -0.0040 0.0149  233  THR C OG1   
2881 C CG2   . THR C 48  ? 0.1835 0.1735 0.1564 0.0037  -0.0102 0.0110  233  THR C CG2   
2882 N N     . LYS C 49  ? 0.1614 0.1511 0.1669 0.0046  -0.0053 0.0006  234  LYS C N     
2883 C CA    . LYS C 49  ? 0.1635 0.1623 0.1769 0.0041  -0.0063 -0.0020 234  LYS C CA    
2884 C C     . LYS C 49  ? 0.1672 0.1587 0.1727 0.0078  -0.0037 -0.0007 234  LYS C C     
2885 O O     . LYS C 49  ? 0.1558 0.1611 0.1707 0.0229  -0.0074 0.0076  234  LYS C O     
2886 C CB    . LYS C 49  ? 0.1688 0.1632 0.1848 0.0064  -0.0029 0.0048  234  LYS C CB    
2887 C CG    . LYS C 49  ? 0.1692 0.1608 0.2050 -0.0040 -0.0066 -0.0088 234  LYS C CG    
2888 C CD    . LYS C 49  ? 0.1711 0.1779 0.2003 -0.0016 -0.0051 -0.0129 234  LYS C CD    
2889 C CE    . LYS C 49  ? 0.2168 0.2186 0.2343 -0.0063 0.0046  0.0054  234  LYS C CE    
2890 N NZ    . LYS C 49  ? 0.2287 0.2435 0.2742 0.0010  0.0046  -0.0081 234  LYS C NZ    
2891 N N     . GLN C 50  ? 0.1579 0.1574 0.1626 0.0029  0.0043  0.0002  235  GLN C N     
2892 C CA    . GLN C 50  ? 0.1699 0.1687 0.1683 0.0014  -0.0008 -0.0050 235  GLN C CA    
2893 C C     . GLN C 50  ? 0.1574 0.1619 0.1567 0.0021  0.0020  -0.0019 235  GLN C C     
2894 O O     . GLN C 50  ? 0.1592 0.1774 0.1697 0.0093  0.0002  -0.0043 235  GLN C O     
2895 C CB    . GLN C 50  ? 0.1936 0.1882 0.1771 0.0072  0.0039  -0.0092 235  GLN C CB    
2896 C CG    . GLN C 50  ? 0.2416 0.2398 0.2320 0.0003  -0.0090 0.0032  235  GLN C CG    
2897 C CD    . GLN C 50  ? 0.3075 0.2944 0.2748 0.0071  0.0051  -0.0074 235  GLN C CD    
2898 O OE1   . GLN C 50  ? 0.3612 0.3217 0.3303 0.0001  0.0019  -0.0015 235  GLN C OE1   
2899 N NE2   . GLN C 50  ? 0.2990 0.2964 0.2749 0.0020  0.0065  -0.0049 235  GLN C NE2   
2900 N N     . PHE C 51  ? 0.1414 0.1573 0.1568 0.0008  0.0022  -0.0029 236  PHE C N     
2901 C CA    . PHE C 51  ? 0.1331 0.1600 0.1543 -0.0011 0.0079  -0.0016 236  PHE C CA    
2902 C C     . PHE C 51  ? 0.1418 0.1733 0.1585 -0.0045 0.0058  -0.0011 236  PHE C C     
2903 O O     . PHE C 51  ? 0.1365 0.2115 0.1673 -0.0069 0.0073  0.0042  236  PHE C O     
2904 C CB    . PHE C 51  ? 0.1291 0.1519 0.1527 0.0028  0.0074  -0.0012 236  PHE C CB    
2905 C CG    . PHE C 51  ? 0.1281 0.1489 0.1501 0.0025  0.0053  0.0025  236  PHE C CG    
2906 C CD1   . PHE C 51  ? 0.1214 0.1436 0.1563 0.0069  0.0008  0.0063  236  PHE C CD1   
2907 C CD2   . PHE C 51  ? 0.1477 0.1557 0.1442 0.0021  0.0022  0.0055  236  PHE C CD2   
2908 C CE1   . PHE C 51  ? 0.1499 0.1488 0.1596 0.0119  0.0004  -0.0067 236  PHE C CE1   
2909 C CE2   . PHE C 51  ? 0.1523 0.1676 0.1668 -0.0031 -0.0056 0.0013  236  PHE C CE2   
2910 C CZ    . PHE C 51  ? 0.1440 0.1461 0.1609 0.0021  -0.0022 -0.0028 236  PHE C CZ    
2911 N N     . SER C 52  ? 0.1400 0.1669 0.1657 -0.0025 0.0124  -0.0071 237  SER C N     
2912 C CA    . SER C 52  ? 0.1545 0.1745 0.1618 -0.0029 0.0124  -0.0080 237  SER C CA    
2913 C C     . SER C 52  ? 0.1454 0.1687 0.1508 -0.0028 0.0082  -0.0108 237  SER C C     
2914 O O     . SER C 52  ? 0.1362 0.1591 0.1387 -0.0108 0.0114  -0.0160 237  SER C O     
2915 C CB    . SER C 52  ? 0.1593 0.1899 0.1807 0.0019  0.0188  -0.0064 237  SER C CB    
2916 O OG    . SER C 52  ? 0.2196 0.2086 0.2195 0.0044  0.0080  -0.0150 237  SER C OG    
2917 N N     . ARG C 53  ? 0.1498 0.1754 0.1392 -0.0076 0.0052  -0.0173 238  ARG C N     
2918 C CA    . ARG C 53  ? 0.1586 0.1856 0.1368 -0.0157 -0.0012 -0.0104 238  ARG C CA    
2919 C C     . ARG C 53  ? 0.1613 0.1894 0.1394 -0.0133 0.0043  -0.0058 238  ARG C C     
2920 O O     . ARG C 53  ? 0.1780 0.1998 0.1462 -0.0143 0.0063  -0.0112 238  ARG C O     
2921 C CB    . ARG C 53  ? 0.1661 0.1886 0.1454 -0.0183 -0.0048 -0.0186 238  ARG C CB    
2922 C CG    . ARG C 53  ? 0.2037 0.2224 0.1895 -0.0075 -0.0030 -0.0050 238  ARG C CG    
2923 C CD    . ARG C 53  ? 0.2738 0.2970 0.2455 -0.0103 -0.0202 -0.0113 238  ARG C CD    
2924 N NE    . ARG C 53  ? 0.3516 0.3339 0.3257 0.0019  -0.0102 0.0046  238  ARG C NE    
2925 C CZ    . ARG C 53  ? 0.3801 0.3972 0.3634 -0.0025 -0.0068 -0.0021 238  ARG C CZ    
2926 N NH1   . ARG C 53  ? 0.3987 0.3557 0.3741 -0.0040 -0.0048 -0.0080 238  ARG C NH1   
2927 N NH2   . ARG C 53  ? 0.4020 0.3670 0.3839 0.0058  -0.0086 0.0148  238  ARG C NH2   
2928 N N     . GLY C 54  ? 0.1495 0.1886 0.1272 -0.0227 0.0021  -0.0088 239  GLY C N     
2929 C CA    . GLY C 54  ? 0.1549 0.1861 0.1382 -0.0199 0.0038  -0.0034 239  GLY C CA    
2930 C C     . GLY C 54  ? 0.1503 0.1800 0.1412 -0.0159 0.0029  -0.0038 239  GLY C C     
2931 O O     . GLY C 54  ? 0.1713 0.2000 0.1581 -0.0277 0.0097  0.0050  239  GLY C O     
2932 N N     . ASP C 55  ? 0.1321 0.1676 0.1339 -0.0059 0.0055  -0.0100 240  ASP C N     
2933 C CA    . ASP C 55  ? 0.1302 0.1563 0.1303 -0.0057 0.0029  -0.0117 240  ASP C CA    
2934 C C     . ASP C 55  ? 0.1164 0.1506 0.1196 0.0008  0.0061  -0.0115 240  ASP C C     
2935 O O     . ASP C 55  ? 0.1065 0.1543 0.1112 -0.0039 0.0045  -0.0092 240  ASP C O     
2936 C CB    . ASP C 55  ? 0.1365 0.1583 0.1439 0.0009  0.0102  -0.0107 240  ASP C CB    
2937 C CG    . ASP C 55  ? 0.1618 0.1759 0.1842 -0.0068 0.0084  -0.0173 240  ASP C CG    
2938 O OD1   . ASP C 55  ? 0.1765 0.2140 0.2149 -0.0194 0.0246  -0.0253 240  ASP C OD1   
2939 O OD2   . ASP C 55  ? 0.1562 0.1861 0.2294 0.0045  0.0126  -0.0201 240  ASP C OD2   
2940 N N     . PHE C 56  ? 0.1195 0.1476 0.1145 -0.0034 0.0039  -0.0114 241  PHE C N     
2941 C CA    . PHE C 56  ? 0.1079 0.1359 0.1131 -0.0039 0.0081  -0.0076 241  PHE C CA    
2942 C C     . PHE C 56  ? 0.1154 0.1355 0.1123 0.0006  0.0070  -0.0056 241  PHE C C     
2943 O O     . PHE C 56  ? 0.1157 0.1429 0.1113 0.0066  0.0127  -0.0108 241  PHE C O     
2944 C CB    . PHE C 56  ? 0.1130 0.1458 0.1241 0.0000  0.0005  -0.0139 241  PHE C CB    
2945 C CG    . PHE C 56  ? 0.1061 0.1449 0.1375 -0.0032 0.0052  -0.0101 241  PHE C CG    
2946 C CD1   . PHE C 56  ? 0.1210 0.1505 0.1693 0.0044  0.0066  -0.0100 241  PHE C CD1   
2947 C CD2   . PHE C 56  ? 0.0811 0.1467 0.1352 -0.0003 0.0123  -0.0057 241  PHE C CD2   
2948 C CE1   . PHE C 56  ? 0.1216 0.1469 0.1660 -0.0012 -0.0091 -0.0151 241  PHE C CE1   
2949 C CE2   . PHE C 56  ? 0.0862 0.1621 0.1226 0.0004  0.0073  -0.0093 241  PHE C CE2   
2950 C CZ    . PHE C 56  ? 0.1128 0.1699 0.1518 0.0042  0.0036  -0.0233 241  PHE C CZ    
2951 N N     . VAL C 57  ? 0.0997 0.1225 0.0983 0.0022  0.0082  -0.0009 242  VAL C N     
2952 C CA    . VAL C 57  ? 0.0976 0.1238 0.0978 0.0055  0.0005  -0.0003 242  VAL C CA    
2953 C C     . VAL C 57  ? 0.1046 0.1084 0.0994 0.0040  0.0018  -0.0015 242  VAL C C     
2954 O O     . VAL C 57  ? 0.1222 0.1059 0.1068 0.0049  0.0010  -0.0014 242  VAL C O     
2955 C CB    . VAL C 57  ? 0.0978 0.1224 0.0856 0.0017  0.0026  -0.0018 242  VAL C CB    
2956 C CG1   . VAL C 57  ? 0.1004 0.1358 0.0885 -0.0173 0.0073  -0.0047 242  VAL C CG1   
2957 C CG2   . VAL C 57  ? 0.0976 0.1341 0.1085 -0.0076 -0.0033 -0.0174 242  VAL C CG2   
2958 N N     . VAL C 58  ? 0.1001 0.1031 0.0887 -0.0006 -0.0009 -0.0064 243  VAL C N     
2959 C CA    . VAL C 58  ? 0.1008 0.1121 0.0886 -0.0025 -0.0011 -0.0012 243  VAL C CA    
2960 C C     . VAL C 58  ? 0.0939 0.1072 0.0950 -0.0026 -0.0067 -0.0045 243  VAL C C     
2961 O O     . VAL C 58  ? 0.1151 0.1124 0.0900 -0.0019 -0.0100 0.0083  243  VAL C O     
2962 C CB    . VAL C 58  ? 0.1072 0.1218 0.0961 -0.0064 0.0010  0.0049  243  VAL C CB    
2963 C CG1   . VAL C 58  ? 0.1064 0.1492 0.1066 0.0013  0.0005  0.0093  243  VAL C CG1   
2964 C CG2   . VAL C 58  ? 0.1393 0.1340 0.0871 0.0001  -0.0047 0.0003  243  VAL C CG2   
2965 N N     . GLU C 59  ? 0.0930 0.1009 0.0925 -0.0007 -0.0042 -0.0094 244  GLU C N     
2966 C CA    . GLU C 59  ? 0.0992 0.1029 0.0995 -0.0055 0.0009  0.0013  244  GLU C CA    
2967 C C     . GLU C 59  ? 0.0930 0.0924 0.0920 -0.0062 -0.0029 -0.0034 244  GLU C C     
2968 O O     . GLU C 59  ? 0.1030 0.1017 0.0979 0.0022  -0.0061 0.0051  244  GLU C O     
2969 C CB    . GLU C 59  ? 0.1039 0.1117 0.1028 -0.0021 0.0019  -0.0079 244  GLU C CB    
2970 C CG    . GLU C 59  ? 0.1104 0.1113 0.1049 -0.0194 -0.0067 -0.0066 244  GLU C CG    
2971 C CD    . GLU C 59  ? 0.1182 0.1262 0.1325 -0.0103 -0.0029 0.0015  244  GLU C CD    
2972 O OE1   . GLU C 59  ? 0.1228 0.1737 0.2034 -0.0071 -0.0203 0.0005  244  GLU C OE1   
2973 O OE2   . GLU C 59  ? 0.1278 0.1264 0.1594 -0.0081 -0.0047 0.0269  244  GLU C OE2   
2974 N N     . TYR C 60  ? 0.0936 0.1028 0.0909 -0.0037 -0.0062 -0.0040 245  TYR C N     
2975 C CA    . TYR C 60  ? 0.0972 0.1015 0.0954 -0.0049 -0.0076 0.0006  245  TYR C CA    
2976 C C     . TYR C 60  ? 0.1094 0.1111 0.1043 -0.0053 -0.0104 0.0043  245  TYR C C     
2977 O O     . TYR C 60  ? 0.1092 0.1132 0.1254 -0.0056 -0.0124 0.0093  245  TYR C O     
2978 C CB    . TYR C 60  ? 0.0969 0.0984 0.0967 0.0045  -0.0056 -0.0031 245  TYR C CB    
2979 C CG    . TYR C 60  ? 0.0919 0.0991 0.0900 0.0016  -0.0054 -0.0016 245  TYR C CG    
2980 C CD1   . TYR C 60  ? 0.0974 0.1044 0.0875 -0.0072 -0.0101 0.0092  245  TYR C CD1   
2981 C CD2   . TYR C 60  ? 0.1020 0.0977 0.1036 0.0111  -0.0214 0.0001  245  TYR C CD2   
2982 C CE1   . TYR C 60  ? 0.0994 0.1237 0.0970 -0.0004 -0.0099 -0.0124 245  TYR C CE1   
2983 C CE2   . TYR C 60  ? 0.1173 0.1168 0.1049 -0.0110 -0.0047 0.0021  245  TYR C CE2   
2984 C CZ    . TYR C 60  ? 0.0936 0.1064 0.1046 0.0058  0.0003  0.0026  245  TYR C CZ    
2985 O OH    . TYR C 60  ? 0.1051 0.1164 0.1146 0.0018  0.0042  -0.0164 245  TYR C OH    
2986 N N     . HIS C 61  ? 0.1138 0.1304 0.1119 -0.0109 -0.0177 0.0016  246  HIS C N     
2987 C CA    . HIS C 61  ? 0.1175 0.1314 0.1157 -0.0109 -0.0116 0.0024  246  HIS C CA    
2988 C C     . HIS C 61  ? 0.1234 0.1298 0.1159 -0.0164 -0.0050 0.0014  246  HIS C C     
2989 O O     . HIS C 61  ? 0.1259 0.1338 0.1097 -0.0150 0.0011  0.0075  246  HIS C O     
2990 C CB    . HIS C 61  ? 0.1210 0.1413 0.1282 -0.0026 -0.0068 0.0024  246  HIS C CB    
2991 C CG    . HIS C 61  ? 0.1564 0.1743 0.1701 -0.0100 -0.0092 -0.0091 246  HIS C CG    
2992 N ND1   . HIS C 61  ? 0.2096 0.2118 0.2047 0.0082  -0.0092 -0.0109 246  HIS C ND1   
2993 C CD2   . HIS C 61  ? 0.1825 0.2143 0.2063 0.0049  0.0020  -0.0077 246  HIS C CD2   
2994 C CE1   . HIS C 61  ? 0.1874 0.2116 0.1923 0.0022  -0.0099 -0.0103 246  HIS C CE1   
2995 N NE2   . HIS C 61  ? 0.2080 0.2356 0.2264 0.0032  -0.0015 -0.0139 246  HIS C NE2   
2996 N N     . GLY C 62  ? 0.1280 0.1268 0.1148 -0.0096 -0.0076 0.0072  247  GLY C N     
2997 C CA    . GLY C 62  ? 0.1326 0.1189 0.1202 -0.0131 -0.0029 0.0067  247  GLY C CA    
2998 C C     . GLY C 62  ? 0.1544 0.1368 0.1356 -0.0115 -0.0056 0.0061  247  GLY C C     
2999 O O     . GLY C 62  ? 0.1734 0.1535 0.1766 -0.0097 -0.0026 0.0002  247  GLY C O     
3000 N N     . ASP C 63  ? 0.1474 0.1351 0.1323 -0.0066 -0.0169 0.0091  248  ASP C N     
3001 C CA    . ASP C 63  ? 0.1606 0.1491 0.1534 -0.0110 -0.0118 0.0083  248  ASP C CA    
3002 C C     . ASP C 63  ? 0.1508 0.1465 0.1500 -0.0117 -0.0131 0.0062  248  ASP C C     
3003 O O     . ASP C 63  ? 0.1567 0.1404 0.1715 -0.0133 -0.0172 0.0224  248  ASP C O     
3004 C CB    . ASP C 63  ? 0.1783 0.1690 0.1671 -0.0089 -0.0091 0.0006  248  ASP C CB    
3005 C CG    . ASP C 63  ? 0.2235 0.2185 0.2073 -0.0060 -0.0117 0.0054  248  ASP C CG    
3006 O OD1   . ASP C 63  ? 0.2881 0.2868 0.2669 0.0105  -0.0172 -0.0049 248  ASP C OD1   
3007 O OD2   . ASP C 63  ? 0.3273 0.3139 0.2711 0.0037  0.0077  -0.0069 248  ASP C OD2   
3008 N N     . LEU C 64  ? 0.1449 0.1351 0.1393 -0.0197 -0.0190 0.0089  249  LEU C N     
3009 C CA    . LEU C 64  ? 0.1498 0.1415 0.1445 -0.0125 -0.0168 0.0064  249  LEU C CA    
3010 C C     . LEU C 64  ? 0.1470 0.1385 0.1480 -0.0162 -0.0155 0.0059  249  LEU C C     
3011 O O     . LEU C 64  ? 0.1532 0.1661 0.1670 -0.0231 -0.0257 -0.0001 249  LEU C O     
3012 C CB    . LEU C 64  ? 0.1424 0.1427 0.1430 -0.0040 -0.0193 0.0112  249  LEU C CB    
3013 C CG    . LEU C 64  ? 0.1460 0.1546 0.1462 -0.0168 -0.0164 0.0093  249  LEU C CG    
3014 C CD1   . LEU C 64  ? 0.1478 0.1374 0.1603 -0.0018 -0.0269 -0.0034 249  LEU C CD1   
3015 C CD2   . LEU C 64  ? 0.1660 0.1959 0.1792 0.0084  -0.0029 0.0089  249  LEU C CD2   
3016 N N     . ILE C 65  ? 0.1557 0.1277 0.1477 -0.0079 -0.0127 0.0038  250  ILE C N     
3017 C CA    . ILE C 65  ? 0.1581 0.1323 0.1606 -0.0137 -0.0113 0.0033  250  ILE C CA    
3018 C C     . ILE C 65  ? 0.1692 0.1420 0.1631 -0.0127 -0.0092 0.0015  250  ILE C C     
3019 O O     . ILE C 65  ? 0.1694 0.1401 0.1671 -0.0216 -0.0156 0.0044  250  ILE C O     
3020 C CB    . ILE C 65  ? 0.1448 0.1338 0.1576 -0.0135 -0.0150 0.0020  250  ILE C CB    
3021 C CG1   . ILE C 65  ? 0.1387 0.1351 0.1676 -0.0234 -0.0068 0.0007  250  ILE C CG1   
3022 C CG2   . ILE C 65  ? 0.1631 0.1544 0.1457 -0.0061 -0.0159 0.0049  250  ILE C CG2   
3023 C CD1   . ILE C 65  ? 0.1725 0.1377 0.1660 -0.0060 -0.0048 0.0086  250  ILE C CD1   
3024 N N     . GLU C 66  ? 0.1882 0.1469 0.1796 -0.0093 -0.0064 0.0041  251  GLU C N     
3025 C CA    . GLU C 66  ? 0.2059 0.1706 0.1984 -0.0054 -0.0046 0.0075  251  GLU C CA    
3026 C C     . GLU C 66  ? 0.1997 0.1520 0.1773 -0.0087 -0.0046 0.0043  251  GLU C C     
3027 O O     . GLU C 66  ? 0.1944 0.1242 0.1690 -0.0105 -0.0067 0.0102  251  GLU C O     
3028 C CB    . GLU C 66  ? 0.2090 0.1747 0.2043 -0.0062 0.0000  0.0099  251  GLU C CB    
3029 C CG    . GLU C 66  ? 0.2545 0.2449 0.2567 0.0008  0.0099  0.0093  251  GLU C CG    
3030 C CD    . GLU C 66  ? 0.2584 0.2524 0.2652 -0.0108 0.0040  0.0081  251  GLU C CD    
3031 O OE1   . GLU C 66  ? 0.3358 0.3019 0.3454 0.0020  0.0106  0.0021  251  GLU C OE1   
3032 O OE2   . GLU C 66  ? 0.3126 0.3477 0.3434 -0.0067 0.0208  -0.0008 251  GLU C OE2   
3033 N N     . ILE C 67  ? 0.2013 0.1480 0.1813 -0.0016 -0.0088 0.0082  252  ILE C N     
3034 C CA    . ILE C 67  ? 0.2151 0.1718 0.1837 -0.0006 -0.0015 0.0011  252  ILE C CA    
3035 C C     . ILE C 67  ? 0.2216 0.1703 0.1926 0.0001  -0.0018 0.0002  252  ILE C C     
3036 O O     . ILE C 67  ? 0.2250 0.1612 0.1770 0.0101  0.0024  -0.0022 252  ILE C O     
3037 C CB    . ILE C 67  ? 0.2065 0.1658 0.1832 -0.0052 -0.0054 0.0010  252  ILE C CB    
3038 C CG1   . ILE C 67  ? 0.2045 0.1857 0.1873 -0.0050 -0.0056 0.0021  252  ILE C CG1   
3039 C CG2   . ILE C 67  ? 0.2166 0.1703 0.1827 -0.0052 -0.0005 0.0196  252  ILE C CG2   
3040 C CD1   . ILE C 67  ? 0.2264 0.1907 0.1824 0.0035  -0.0052 -0.0001 252  ILE C CD1   
3041 N N     . THR C 68  ? 0.2496 0.1851 0.2063 -0.0001 -0.0006 0.0027  253  THR C N     
3042 C CA    . THR C 68  ? 0.2631 0.1946 0.2263 -0.0079 0.0009  -0.0009 253  THR C CA    
3043 C C     . THR C 68  ? 0.2565 0.1861 0.2235 -0.0141 -0.0001 -0.0028 253  THR C C     
3044 O O     . THR C 68  ? 0.2644 0.1746 0.2255 -0.0166 0.0042  -0.0005 253  THR C O     
3045 C CB    . THR C 68  ? 0.2698 0.2103 0.2452 -0.0066 0.0037  0.0039  253  THR C CB    
3046 O OG1   . THR C 68  ? 0.2823 0.2531 0.2957 -0.0115 -0.0042 0.0111  253  THR C OG1   
3047 C CG2   . THR C 68  ? 0.2838 0.2158 0.2401 0.0012  0.0091  -0.0022 253  THR C CG2   
3048 N N     . ASP C 69  ? 0.2517 0.1916 0.2227 -0.0196 -0.0020 -0.0083 254  ASP C N     
3049 C CA    . ASP C 69  ? 0.2482 0.1993 0.2198 -0.0161 -0.0015 -0.0072 254  ASP C CA    
3050 C C     . ASP C 69  ? 0.2365 0.1854 0.2026 -0.0141 -0.0003 -0.0074 254  ASP C C     
3051 O O     . ASP C 69  ? 0.2428 0.1974 0.1914 -0.0110 -0.0067 -0.0071 254  ASP C O     
3052 C CB    . ASP C 69  ? 0.2573 0.2176 0.2457 -0.0146 -0.0019 -0.0102 254  ASP C CB    
3053 C CG    . ASP C 69  ? 0.2989 0.2796 0.2767 -0.0059 -0.0092 -0.0049 254  ASP C CG    
3054 O OD1   . ASP C 69  ? 0.3429 0.3126 0.3432 0.0056  -0.0031 -0.0046 254  ASP C OD1   
3055 O OD2   . ASP C 69  ? 0.3384 0.3209 0.3429 0.0072  0.0013  -0.0119 254  ASP C OD2   
3056 N N     . ALA C 70  ? 0.2179 0.1606 0.1903 -0.0146 -0.0003 -0.0078 255  ALA C N     
3057 C CA    . ALA C 70  ? 0.2079 0.1507 0.1736 -0.0122 0.0018  -0.0055 255  ALA C CA    
3058 C C     . ALA C 70  ? 0.2153 0.1506 0.1712 -0.0062 -0.0017 -0.0059 255  ALA C C     
3059 O O     . ALA C 70  ? 0.2300 0.1409 0.1657 -0.0059 -0.0005 -0.0132 255  ALA C O     
3060 C CB    . ALA C 70  ? 0.2038 0.1385 0.1743 -0.0119 0.0025  -0.0069 255  ALA C CB    
3061 N N     . LYS C 71  ? 0.2236 0.1552 0.1741 -0.0028 -0.0039 -0.0044 256  LYS C N     
3062 C CA    . LYS C 71  ? 0.2303 0.1628 0.1744 0.0030  -0.0032 -0.0006 256  LYS C CA    
3063 C C     . LYS C 71  ? 0.2292 0.1575 0.1765 0.0022  -0.0031 -0.0032 256  LYS C C     
3064 O O     . LYS C 71  ? 0.2465 0.1590 0.1711 0.0086  -0.0045 -0.0048 256  LYS C O     
3065 C CB    . LYS C 71  ? 0.2261 0.1680 0.1776 0.0023  -0.0052 0.0003  256  LYS C CB    
3066 C CG    . LYS C 71  ? 0.2391 0.1960 0.1891 0.0105  -0.0029 -0.0048 256  LYS C CG    
3067 C CD    . LYS C 71  ? 0.2723 0.2207 0.1981 0.0009  -0.0138 0.0028  256  LYS C CD    
3068 C CE    . LYS C 71  ? 0.2593 0.2256 0.2023 0.0020  -0.0078 -0.0099 256  LYS C CE    
3069 N NZ    . LYS C 71  ? 0.2793 0.2449 0.2082 -0.0021 -0.0037 0.0019  256  LYS C NZ    
3070 N N     . LYS C 72  ? 0.2439 0.1698 0.1788 0.0024  -0.0050 -0.0015 257  LYS C N     
3071 C CA    . LYS C 72  ? 0.2547 0.1871 0.1911 -0.0020 -0.0015 0.0023  257  LYS C CA    
3072 C C     . LYS C 72  ? 0.2523 0.1850 0.1940 0.0018  0.0032  0.0008  257  LYS C C     
3073 O O     . LYS C 72  ? 0.2712 0.1800 0.1955 -0.0023 0.0037  -0.0008 257  LYS C O     
3074 C CB    . LYS C 72  ? 0.2547 0.2058 0.1997 -0.0024 -0.0040 -0.0006 257  LYS C CB    
3075 C CG    . LYS C 72  ? 0.2876 0.2381 0.2352 0.0016  0.0007  0.0055  257  LYS C CG    
3076 C CD    . LYS C 72  ? 0.3053 0.3063 0.2990 -0.0074 -0.0029 -0.0010 257  LYS C CD    
3077 C CE    . LYS C 72  ? 0.3584 0.3454 0.3209 -0.0009 0.0021  -0.0061 257  LYS C CE    
3078 N NZ    . LYS C 72  ? 0.3612 0.3816 0.3706 0.0030  -0.0037 0.0005  257  LYS C NZ    
3079 N N     . ARG C 73  ? 0.2507 0.1723 0.1891 0.0015  0.0017  0.0019  258  ARG C N     
3080 C CA    . ARG C 73  ? 0.2437 0.1789 0.1889 0.0000  0.0064  0.0025  258  ARG C CA    
3081 C C     . ARG C 73  ? 0.2451 0.1829 0.1986 0.0021  0.0047  0.0011  258  ARG C C     
3082 O O     . ARG C 73  ? 0.2600 0.1875 0.1907 0.0000  0.0128  0.0015  258  ARG C O     
3083 C CB    . ARG C 73  ? 0.2330 0.1729 0.1907 -0.0009 0.0037  0.0008  258  ARG C CB    
3084 C CG    . ARG C 73  ? 0.2153 0.1691 0.1735 0.0052  0.0089  0.0011  258  ARG C CG    
3085 C CD    . ARG C 73  ? 0.1949 0.1776 0.1717 0.0034  0.0026  0.0074  258  ARG C CD    
3086 N NE    . ARG C 73  ? 0.2160 0.2007 0.1774 -0.0164 -0.0127 -0.0157 258  ARG C NE    
3087 C CZ    . ARG C 73  ? 0.2263 0.2213 0.1987 -0.0081 -0.0092 -0.0055 258  ARG C CZ    
3088 N NH1   . ARG C 73  ? 0.2285 0.2085 0.1670 -0.0165 -0.0215 -0.0133 258  ARG C NH1   
3089 N NH2   . ARG C 73  ? 0.2409 0.2490 0.2165 -0.0269 -0.0146 -0.0108 258  ARG C NH2   
3090 N N     . GLU C 74  ? 0.2425 0.1865 0.1979 0.0036  0.0024  -0.0065 259  GLU C N     
3091 C CA    . GLU C 74  ? 0.2504 0.2052 0.2158 -0.0008 0.0022  -0.0025 259  GLU C CA    
3092 C C     . GLU C 74  ? 0.2529 0.2139 0.2210 0.0009  0.0018  -0.0010 259  GLU C C     
3093 O O     . GLU C 74  ? 0.2569 0.2123 0.2124 0.0012  0.0038  0.0028  259  GLU C O     
3094 C CB    . GLU C 74  ? 0.2550 0.2124 0.2174 0.0029  0.0027  -0.0029 259  GLU C CB    
3095 C CG    . GLU C 74  ? 0.2435 0.2050 0.2306 0.0003  0.0078  -0.0053 259  GLU C CG    
3096 C CD    . GLU C 74  ? 0.2328 0.2060 0.2209 -0.0025 0.0110  -0.0005 259  GLU C CD    
3097 O OE1   . GLU C 74  ? 0.2446 0.1992 0.2593 -0.0024 0.0227  0.0020  259  GLU C OE1   
3098 O OE2   . GLU C 74  ? 0.2288 0.2189 0.2158 -0.0110 0.0197  0.0017  259  GLU C OE2   
3099 N N     . ALA C 75  ? 0.2634 0.2151 0.2212 0.0010  0.0016  -0.0055 260  ALA C N     
3100 C CA    . ALA C 75  ? 0.2722 0.2239 0.2327 0.0025  0.0026  -0.0079 260  ALA C CA    
3101 C C     . ALA C 75  ? 0.2731 0.2226 0.2314 -0.0005 0.0036  -0.0095 260  ALA C C     
3102 O O     . ALA C 75  ? 0.2884 0.2421 0.2485 0.0025  0.0076  -0.0131 260  ALA C O     
3103 C CB    . ALA C 75  ? 0.2783 0.2210 0.2382 0.0015  0.0002  -0.0108 260  ALA C CB    
3104 N N     . LEU C 76  ? 0.2756 0.2128 0.2265 -0.0026 0.0019  -0.0126 261  LEU C N     
3105 C CA    . LEU C 76  ? 0.2778 0.2134 0.2316 -0.0077 0.0024  -0.0054 261  LEU C CA    
3106 C C     . LEU C 76  ? 0.2706 0.2084 0.2225 -0.0090 0.0068  -0.0073 261  LEU C C     
3107 O O     . LEU C 76  ? 0.2858 0.2212 0.2305 -0.0096 0.0090  -0.0152 261  LEU C O     
3108 C CB    . LEU C 76  ? 0.2780 0.2174 0.2311 -0.0076 0.0027  -0.0033 261  LEU C CB    
3109 C CG    . LEU C 76  ? 0.3067 0.2488 0.2726 -0.0160 0.0012  -0.0004 261  LEU C CG    
3110 C CD1   . LEU C 76  ? 0.3160 0.3013 0.2988 0.0002  -0.0032 -0.0007 261  LEU C CD1   
3111 C CD2   . LEU C 76  ? 0.3218 0.2869 0.2864 -0.0083 0.0041  -0.0078 261  LEU C CD2   
3112 N N     . TYR C 77  ? 0.2580 0.2032 0.2132 -0.0068 0.0038  -0.0073 262  TYR C N     
3113 C CA    . TYR C 77  ? 0.2465 0.1995 0.2144 -0.0041 0.0044  -0.0087 262  TYR C CA    
3114 C C     . TYR C 77  ? 0.2532 0.2120 0.2235 0.0022  0.0075  -0.0101 262  TYR C C     
3115 O O     . TYR C 77  ? 0.2599 0.1977 0.2284 0.0038  0.0115  -0.0176 262  TYR C O     
3116 C CB    . TYR C 77  ? 0.2278 0.1883 0.1986 -0.0040 0.0050  -0.0070 262  TYR C CB    
3117 C CG    . TYR C 77  ? 0.2169 0.1580 0.1872 -0.0062 -0.0011 -0.0033 262  TYR C CG    
3118 C CD1   . TYR C 77  ? 0.2209 0.1653 0.1861 -0.0127 0.0008  0.0002  262  TYR C CD1   
3119 C CD2   . TYR C 77  ? 0.2050 0.1281 0.1814 -0.0033 0.0050  -0.0034 262  TYR C CD2   
3120 C CE1   . TYR C 77  ? 0.2151 0.1767 0.1722 -0.0087 -0.0010 -0.0109 262  TYR C CE1   
3121 C CE2   . TYR C 77  ? 0.1883 0.1190 0.1631 -0.0157 0.0020  -0.0053 262  TYR C CE2   
3122 C CZ    . TYR C 77  ? 0.2081 0.1400 0.1697 0.0020  0.0016  -0.0038 262  TYR C CZ    
3123 O OH    . TYR C 77  ? 0.2185 0.1715 0.1749 -0.0132 -0.0029 -0.0091 262  TYR C OH    
3124 N N     . ALA C 78  ? 0.2628 0.2250 0.2503 0.0050  0.0063  -0.0084 263  ALA C N     
3125 C CA    . ALA C 78  ? 0.2669 0.2414 0.2598 0.0056  0.0080  -0.0056 263  ALA C CA    
3126 C C     . ALA C 78  ? 0.2765 0.2522 0.2684 0.0048  0.0099  -0.0087 263  ALA C C     
3127 O O     . ALA C 78  ? 0.2792 0.2555 0.2759 0.0081  0.0153  -0.0130 263  ALA C O     
3128 C CB    . ALA C 78  ? 0.2709 0.2431 0.2610 0.0071  0.0065  -0.0049 263  ALA C CB    
3129 N N     . GLN C 79  ? 0.2839 0.2594 0.2726 0.0059  0.0097  -0.0068 264  GLN C N     
3130 C CA    . GLN C 79  ? 0.3000 0.2709 0.2809 0.0037  0.0099  -0.0057 264  GLN C CA    
3131 C C     . GLN C 79  ? 0.2921 0.2606 0.2780 0.0057  0.0113  -0.0058 264  GLN C C     
3132 O O     . GLN C 79  ? 0.3074 0.2531 0.2827 0.0056  0.0169  -0.0013 264  GLN C O     
3133 C CB    . GLN C 79  ? 0.3058 0.2877 0.2912 0.0003  0.0059  -0.0075 264  GLN C CB    
3134 C CG    . GLN C 79  ? 0.3449 0.3134 0.3273 0.0001  0.0082  0.0001  264  GLN C CG    
3135 C CD    . GLN C 79  ? 0.3754 0.3641 0.3847 -0.0080 -0.0032 -0.0081 264  GLN C CD    
3136 O OE1   . GLN C 79  ? 0.4111 0.3993 0.4180 0.0058  0.0052  -0.0109 264  GLN C OE1   
3137 N NE2   . GLN C 79  ? 0.3861 0.3834 0.4064 0.0009  -0.0036 -0.0011 264  GLN C NE2   
3138 N N     . ASP C 80  ? 0.2811 0.2477 0.2666 0.0047  0.0120  -0.0049 265  ASP C N     
3139 C CA    . ASP C 80  ? 0.2691 0.2444 0.2550 0.0057  0.0066  -0.0037 265  ASP C CA    
3140 C C     . ASP C 80  ? 0.2565 0.2355 0.2495 0.0054  0.0068  0.0003  265  ASP C C     
3141 O O     . ASP C 80  ? 0.2521 0.2222 0.2396 0.0056  0.0107  0.0042  265  ASP C O     
3142 C CB    . ASP C 80  ? 0.2751 0.2480 0.2582 0.0038  0.0065  -0.0042 265  ASP C CB    
3143 C CG    . ASP C 80  ? 0.2845 0.2627 0.2632 0.0124  0.0031  -0.0024 265  ASP C CG    
3144 O OD1   . ASP C 80  ? 0.2957 0.2706 0.2639 0.0168  0.0027  0.0007  265  ASP C OD1   
3145 O OD2   . ASP C 80  ? 0.3161 0.3003 0.3000 0.0158  -0.0084 -0.0008 265  ASP C OD2   
3146 N N     . PRO C 81  ? 0.2487 0.2378 0.2417 0.0091  0.0093  0.0002  266  PRO C N     
3147 C CA    . PRO C 81  ? 0.2426 0.2317 0.2387 0.0099  0.0082  0.0031  266  PRO C CA    
3148 C C     . PRO C 81  ? 0.2338 0.2218 0.2242 0.0073  0.0102  0.0029  266  PRO C C     
3149 O O     . PRO C 81  ? 0.2321 0.2080 0.2300 0.0121  0.0087  0.0067  266  PRO C O     
3150 C CB    . PRO C 81  ? 0.2459 0.2370 0.2463 0.0077  0.0096  -0.0006 266  PRO C CB    
3151 C CG    . PRO C 81  ? 0.2566 0.2575 0.2534 0.0060  0.0075  -0.0063 266  PRO C CG    
3152 C CD    . PRO C 81  ? 0.2539 0.2423 0.2453 0.0114  0.0075  -0.0025 266  PRO C CD    
3153 N N     . SER C 82  ? 0.2251 0.2131 0.2114 0.0081  0.0145  0.0014  267  SER C N     
3154 C CA    . SER C 82  ? 0.2212 0.2108 0.1964 0.0086  0.0103  0.0076  267  SER C CA    
3155 C C     . SER C 82  ? 0.2212 0.2019 0.1905 0.0039  0.0109  0.0035  267  SER C C     
3156 O O     . SER C 82  ? 0.2162 0.1904 0.1851 0.0082  0.0079  0.0061  267  SER C O     
3157 C CB    . SER C 82  ? 0.2300 0.2115 0.1921 0.0067  0.0086  -0.0027 267  SER C CB    
3158 O OG    . SER C 82  ? 0.2326 0.2477 0.1737 0.0189  0.0037  0.0093  267  SER C OG    
3159 N N     . THR C 83  ? 0.2154 0.1897 0.1890 -0.0005 0.0112  0.0001  268  THR C N     
3160 C CA    . THR C 83  ? 0.2114 0.1888 0.1911 -0.0019 0.0121  -0.0008 268  THR C CA    
3161 C C     . THR C 83  ? 0.2016 0.1960 0.1801 -0.0035 0.0091  0.0001  268  THR C C     
3162 O O     . THR C 83  ? 0.2116 0.2099 0.1785 0.0001  0.0072  -0.0025 268  THR C O     
3163 C CB    . THR C 83  ? 0.2099 0.1923 0.1927 -0.0069 0.0134  -0.0017 268  THR C CB    
3164 O OG1   . THR C 83  ? 0.2394 0.2035 0.2157 -0.0052 0.0243  -0.0096 268  THR C OG1   
3165 C CG2   . THR C 83  ? 0.1999 0.1859 0.1852 0.0009  0.0157  -0.0077 268  THR C CG2   
3166 N N     . GLY C 84  ? 0.1972 0.1902 0.1657 0.0013  0.0073  0.0052  269  GLY C N     
3167 C CA    . GLY C 84  ? 0.1829 0.1562 0.1593 -0.0057 0.0040  0.0033  269  GLY C CA    
3168 C C     . GLY C 84  ? 0.1726 0.1586 0.1622 -0.0031 0.0036  0.0004  269  GLY C C     
3169 O O     . GLY C 84  ? 0.1790 0.1476 0.1613 -0.0049 -0.0004 -0.0060 269  GLY C O     
3170 N N     . CYS C 85  ? 0.1709 0.1571 0.1609 0.0003  0.0078  -0.0039 270  CYS C N     
3171 C CA    . CYS C 85  ? 0.1563 0.1487 0.1618 0.0026  0.0090  -0.0072 270  CYS C CA    
3172 C C     . CYS C 85  ? 0.1494 0.1423 0.1562 -0.0001 0.0080  -0.0109 270  CYS C C     
3173 O O     . CYS C 85  ? 0.1383 0.1434 0.1504 0.0058  0.0089  -0.0119 270  CYS C O     
3174 C CB    . CYS C 85  ? 0.1583 0.1548 0.1667 0.0046  0.0097  -0.0095 270  CYS C CB    
3175 S SG    . CYS C 85  ? 0.1715 0.1443 0.1867 0.0176  0.0177  -0.0281 270  CYS C SG    
3176 N N     . TYR C 86  ? 0.1327 0.1287 0.1546 -0.0001 0.0050  -0.0184 271  TYR C N     
3177 C CA    . TYR C 86  ? 0.1360 0.1261 0.1499 -0.0010 0.0046  -0.0118 271  TYR C CA    
3178 C C     . TYR C 86  ? 0.1343 0.1266 0.1453 -0.0065 0.0016  -0.0172 271  TYR C C     
3179 O O     . TYR C 86  ? 0.1275 0.1228 0.1494 -0.0087 0.0003  -0.0136 271  TYR C O     
3180 C CB    . TYR C 86  ? 0.1481 0.1249 0.1482 -0.0094 -0.0007 -0.0100 271  TYR C CB    
3181 C CG    . TYR C 86  ? 0.1489 0.1296 0.1440 -0.0013 -0.0011 -0.0054 271  TYR C CG    
3182 C CD1   . TYR C 86  ? 0.1591 0.1416 0.1537 -0.0086 -0.0120 -0.0152 271  TYR C CD1   
3183 C CD2   . TYR C 86  ? 0.1740 0.1416 0.1510 -0.0019 0.0076  -0.0083 271  TYR C CD2   
3184 C CE1   . TYR C 86  ? 0.1453 0.1323 0.1385 -0.0017 -0.0084 -0.0074 271  TYR C CE1   
3185 C CE2   . TYR C 86  ? 0.1671 0.1237 0.1708 -0.0035 0.0092  -0.0160 271  TYR C CE2   
3186 C CZ    . TYR C 86  ? 0.1743 0.1195 0.1344 -0.0066 -0.0075 -0.0086 271  TYR C CZ    
3187 O OH    . TYR C 86  ? 0.1706 0.1480 0.1423 -0.0188 -0.0026 -0.0169 271  TYR C OH    
3188 N N     . MET C 87  ? 0.1342 0.1236 0.1345 -0.0082 0.0016  -0.0168 272  MET C N     
3189 C CA    . MET C 87  ? 0.1385 0.1208 0.1287 0.0002  -0.0021 -0.0137 272  MET C CA    
3190 C C     . MET C 87  ? 0.1201 0.1301 0.1306 -0.0019 -0.0011 -0.0257 272  MET C C     
3191 O O     . MET C 87  ? 0.1164 0.1424 0.1368 0.0014  -0.0046 -0.0229 272  MET C O     
3192 C CB    . MET C 87  ? 0.1468 0.1304 0.1332 0.0014  -0.0013 -0.0154 272  MET C CB    
3193 C CG    . MET C 87  ? 0.1732 0.1286 0.1251 0.0019  0.0022  -0.0151 272  MET C CG    
3194 S SD    . MET C 87  ? 0.1915 0.1246 0.1751 0.0022  -0.0065 -0.0216 272  MET C SD    
3195 C CE    . MET C 87  ? 0.2097 0.1067 0.1702 -0.0080 -0.0071 -0.0038 272  MET C CE    
3196 N N     . TYR C 88  ? 0.1125 0.1145 0.1083 -0.0054 -0.0042 -0.0192 273  TYR C N     
3197 C CA    . TYR C 88  ? 0.1103 0.1083 0.1174 -0.0006 -0.0101 -0.0100 273  TYR C CA    
3198 C C     . TYR C 88  ? 0.1055 0.1111 0.1305 -0.0018 -0.0113 -0.0015 273  TYR C C     
3199 O O     . TYR C 88  ? 0.1033 0.1071 0.1325 -0.0087 -0.0116 0.0024  273  TYR C O     
3200 C CB    . TYR C 88  ? 0.1132 0.1010 0.1162 0.0005  -0.0104 -0.0138 273  TYR C CB    
3201 C CG    . TYR C 88  ? 0.1075 0.1129 0.1066 -0.0022 -0.0112 -0.0088 273  TYR C CG    
3202 C CD1   . TYR C 88  ? 0.1253 0.1102 0.1145 -0.0009 -0.0051 0.0002  273  TYR C CD1   
3203 C CD2   . TYR C 88  ? 0.1140 0.1124 0.1178 -0.0108 -0.0038 -0.0106 273  TYR C CD2   
3204 C CE1   . TYR C 88  ? 0.1216 0.1150 0.1062 -0.0213 -0.0056 0.0005  273  TYR C CE1   
3205 C CE2   . TYR C 88  ? 0.1081 0.1305 0.0911 -0.0146 0.0043  -0.0111 273  TYR C CE2   
3206 C CZ    . TYR C 88  ? 0.1299 0.1175 0.1087 -0.0022 0.0000  -0.0138 273  TYR C CZ    
3207 O OH    . TYR C 88  ? 0.1462 0.1285 0.1294 -0.0222 -0.0089 -0.0244 273  TYR C OH    
3208 N N     . TYR C 89  ? 0.1205 0.1075 0.1276 -0.0022 -0.0136 0.0074  274  TYR C N     
3209 C CA    . TYR C 89  ? 0.1202 0.1166 0.1426 0.0026  -0.0066 0.0114  274  TYR C CA    
3210 C C     . TYR C 89  ? 0.1213 0.1234 0.1451 -0.0062 -0.0052 0.0107  274  TYR C C     
3211 O O     . TYR C 89  ? 0.1197 0.1355 0.1567 -0.0109 -0.0096 0.0111  274  TYR C O     
3212 C CB    . TYR C 89  ? 0.1265 0.1374 0.1572 0.0093  -0.0058 0.0058  274  TYR C CB    
3213 C CG    . TYR C 89  ? 0.1305 0.1476 0.1510 0.0139  -0.0142 0.0121  274  TYR C CG    
3214 C CD1   . TYR C 89  ? 0.1592 0.1686 0.1651 0.0141  -0.0048 0.0017  274  TYR C CD1   
3215 C CD2   . TYR C 89  ? 0.1575 0.1789 0.1705 0.0127  -0.0079 0.0085  274  TYR C CD2   
3216 C CE1   . TYR C 89  ? 0.1784 0.1850 0.1663 0.0120  -0.0055 -0.0050 274  TYR C CE1   
3217 C CE2   . TYR C 89  ? 0.1696 0.1808 0.1922 0.0133  -0.0022 -0.0022 274  TYR C CE2   
3218 C CZ    . TYR C 89  ? 0.1672 0.1729 0.1785 0.0107  0.0000  -0.0055 274  TYR C CZ    
3219 O OH    . TYR C 89  ? 0.2151 0.1957 0.1902 0.0072  0.0044  -0.0109 274  TYR C OH    
3220 N N     . PHE C 90  ? 0.1193 0.1326 0.1448 -0.0028 -0.0013 0.0143  275  PHE C N     
3221 C CA    . PHE C 90  ? 0.1262 0.1277 0.1418 -0.0070 -0.0075 0.0083  275  PHE C CA    
3222 C C     . PHE C 90  ? 0.1404 0.1340 0.1498 -0.0068 -0.0065 0.0083  275  PHE C C     
3223 O O     . PHE C 90  ? 0.1351 0.1354 0.1521 -0.0110 -0.0117 0.0064  275  PHE C O     
3224 C CB    . PHE C 90  ? 0.1204 0.1290 0.1482 -0.0031 -0.0075 -0.0003 275  PHE C CB    
3225 C CG    . PHE C 90  ? 0.1277 0.1260 0.1354 -0.0159 -0.0116 -0.0032 275  PHE C CG    
3226 C CD1   . PHE C 90  ? 0.1317 0.1505 0.1489 -0.0043 -0.0103 -0.0122 275  PHE C CD1   
3227 C CD2   . PHE C 90  ? 0.1187 0.0955 0.1316 -0.0074 -0.0089 0.0047  275  PHE C CD2   
3228 C CE1   . PHE C 90  ? 0.1266 0.1372 0.1506 -0.0118 -0.0056 0.0029  275  PHE C CE1   
3229 C CE2   . PHE C 90  ? 0.1316 0.1226 0.1356 -0.0012 -0.0129 0.0081  275  PHE C CE2   
3230 C CZ    . PHE C 90  ? 0.1308 0.1447 0.1496 -0.0026 -0.0122 0.0082  275  PHE C CZ    
3231 N N     . GLN C 91  ? 0.1485 0.1439 0.1516 -0.0086 -0.0030 0.0064  276  GLN C N     
3232 C CA    . GLN C 91  ? 0.1611 0.1562 0.1586 -0.0082 -0.0056 0.0105  276  GLN C CA    
3233 C C     . GLN C 91  ? 0.1619 0.1483 0.1560 -0.0063 -0.0052 0.0080  276  GLN C C     
3234 O O     . GLN C 91  ? 0.1731 0.1503 0.1616 -0.0083 -0.0088 0.0022  276  GLN C O     
3235 C CB    . GLN C 91  ? 0.1692 0.1658 0.1586 -0.0068 -0.0063 0.0129  276  GLN C CB    
3236 C CG    . GLN C 91  ? 0.2092 0.2516 0.2281 -0.0052 -0.0103 0.0110  276  GLN C CG    
3237 C CD    . GLN C 91  ? 0.2722 0.2804 0.2695 0.0004  -0.0127 -0.0021 276  GLN C CD    
3238 O OE1   . GLN C 91  ? 0.2955 0.3265 0.3143 0.0017  -0.0015 -0.0009 276  GLN C OE1   
3239 N NE2   . GLN C 91  ? 0.3297 0.2993 0.3087 -0.0079 -0.0127 0.0094  276  GLN C NE2   
3240 N N     . TYR C 92  ? 0.1513 0.1393 0.1543 -0.0066 -0.0002 0.0103  277  TYR C N     
3241 C CA    . TYR C 92  ? 0.1658 0.1532 0.1666 -0.0038 0.0046  0.0110  277  TYR C CA    
3242 C C     . TYR C 92  ? 0.1717 0.1563 0.1635 -0.0014 0.0084  0.0117  277  TYR C C     
3243 O O     . TYR C 92  ? 0.1501 0.1332 0.1515 -0.0035 0.0046  0.0134  277  TYR C O     
3244 C CB    . TYR C 92  ? 0.1678 0.1640 0.1760 -0.0032 0.0072  0.0146  277  TYR C CB    
3245 C CG    . TYR C 92  ? 0.1724 0.1620 0.1768 -0.0012 0.0093  0.0167  277  TYR C CG    
3246 C CD1   . TYR C 92  ? 0.1802 0.1856 0.1966 0.0016  0.0097  0.0099  277  TYR C CD1   
3247 C CD2   . TYR C 92  ? 0.1629 0.1757 0.2161 0.0077  0.0022  0.0174  277  TYR C CD2   
3248 C CE1   . TYR C 92  ? 0.1741 0.1826 0.2036 -0.0010 0.0122  0.0080  277  TYR C CE1   
3249 C CE2   . TYR C 92  ? 0.1689 0.1900 0.2198 -0.0033 0.0152  0.0087  277  TYR C CE2   
3250 C CZ    . TYR C 92  ? 0.1670 0.1975 0.2135 -0.0010 0.0106  0.0057  277  TYR C CZ    
3251 O OH    . TYR C 92  ? 0.1750 0.2036 0.2518 -0.0028 0.0282  0.0211  277  TYR C OH    
3252 N N     . LEU C 93  ? 0.1924 0.1717 0.1764 0.0040  0.0142  0.0142  278  LEU C N     
3253 C CA    . LEU C 93  ? 0.2040 0.1860 0.1855 0.0053  0.0132  0.0162  278  LEU C CA    
3254 C C     . LEU C 93  ? 0.2159 0.1948 0.1808 0.0027  0.0147  0.0128  278  LEU C C     
3255 O O     . LEU C 93  ? 0.2156 0.2020 0.1911 0.0035  0.0092  0.0121  278  LEU C O     
3256 C CB    . LEU C 93  ? 0.2099 0.2023 0.1975 -0.0012 0.0193  0.0172  278  LEU C CB    
3257 C CG    . LEU C 93  ? 0.2398 0.1949 0.2264 0.0010  0.0095  0.0170  278  LEU C CG    
3258 C CD1   . LEU C 93  ? 0.2384 0.2505 0.2482 -0.0084 0.0171  0.0144  278  LEU C CD1   
3259 C CD2   . LEU C 93  ? 0.2609 0.2185 0.2416 -0.0018 0.0211  0.0005  278  LEU C CD2   
3260 N N     . SER C 94  ? 0.2151 0.2040 0.1766 0.0058  0.0127  0.0206  279  SER C N     
3261 C CA    . SER C 94  ? 0.2060 0.1853 0.1796 0.0009  0.0096  0.0220  279  SER C CA    
3262 C C     . SER C 94  ? 0.1872 0.1705 0.1863 -0.0021 0.0090  0.0183  279  SER C C     
3263 O O     . SER C 94  ? 0.1819 0.1630 0.1915 -0.0046 0.0135  0.0254  279  SER C O     
3264 C CB    . SER C 94  ? 0.2181 0.1986 0.1908 0.0021  0.0125  0.0227  279  SER C CB    
3265 O OG    . SER C 94  ? 0.2772 0.2543 0.2149 0.0027  -0.0048 0.0143  279  SER C OG    
3266 N N     . LYS C 95  ? 0.1601 0.1443 0.1598 -0.0096 0.0096  0.0205  280  LYS C N     
3267 C CA    . LYS C 95  ? 0.1555 0.1343 0.1606 -0.0146 0.0101  0.0150  280  LYS C CA    
3268 C C     . LYS C 95  ? 0.1398 0.1177 0.1461 -0.0063 0.0059  0.0147  280  LYS C C     
3269 O O     . LYS C 95  ? 0.1430 0.1142 0.1551 -0.0148 0.0154  0.0048  280  LYS C O     
3270 C CB    . LYS C 95  ? 0.1597 0.1540 0.1700 -0.0132 0.0076  0.0157  280  LYS C CB    
3271 C CG    . LYS C 95  ? 0.1908 0.1745 0.2131 -0.0239 0.0187  0.0171  280  LYS C CG    
3272 C CD    . LYS C 95  ? 0.2265 0.2248 0.2616 -0.0031 0.0118  0.0083  280  LYS C CD    
3273 C CE    . LYS C 95  ? 0.2855 0.2611 0.2835 -0.0088 0.0194  0.0122  280  LYS C CE    
3274 N NZ    . LYS C 95  ? 0.3188 0.2993 0.3264 0.0071  0.0110  0.0069  280  LYS C NZ    
3275 N N     . THR C 96  ? 0.1266 0.1017 0.1280 -0.0108 0.0008  0.0140  281  THR C N     
3276 C CA    . THR C 96  ? 0.1282 0.1117 0.1248 -0.0049 -0.0045 0.0173  281  THR C CA    
3277 C C     . THR C 96  ? 0.1289 0.1169 0.1247 -0.0054 -0.0069 0.0120  281  THR C C     
3278 O O     . THR C 96  ? 0.1478 0.1079 0.1212 0.0036  -0.0157 0.0138  281  THR C O     
3279 C CB    . THR C 96  ? 0.1216 0.1160 0.1153 -0.0087 0.0000  0.0107  281  THR C CB    
3280 O OG1   . THR C 96  ? 0.1361 0.1196 0.1355 -0.0022 -0.0205 0.0258  281  THR C OG1   
3281 C CG2   . THR C 96  ? 0.1403 0.1292 0.1308 -0.0086 -0.0003 0.0180  281  THR C CG2   
3282 N N     . TYR C 97  ? 0.1487 0.1269 0.1373 -0.0068 -0.0135 0.0141  282  TYR C N     
3283 C CA    . TYR C 97  ? 0.1360 0.1340 0.1434 -0.0021 -0.0143 0.0110  282  TYR C CA    
3284 C C     . TYR C 97  ? 0.1358 0.1166 0.1387 -0.0034 -0.0175 0.0089  282  TYR C C     
3285 O O     . TYR C 97  ? 0.1333 0.1150 0.1427 0.0023  -0.0188 0.0130  282  TYR C O     
3286 C CB    . TYR C 97  ? 0.1521 0.1597 0.1619 0.0016  -0.0131 0.0075  282  TYR C CB    
3287 C CG    . TYR C 97  ? 0.1640 0.1906 0.1678 -0.0031 -0.0002 0.0063  282  TYR C CG    
3288 C CD1   . TYR C 97  ? 0.2032 0.2329 0.1858 -0.0153 -0.0081 0.0087  282  TYR C CD1   
3289 C CD2   . TYR C 97  ? 0.1812 0.1855 0.1677 0.0060  -0.0018 0.0036  282  TYR C CD2   
3290 C CE1   . TYR C 97  ? 0.2184 0.2470 0.2024 -0.0283 -0.0062 0.0144  282  TYR C CE1   
3291 C CE2   . TYR C 97  ? 0.2076 0.2142 0.2025 -0.0143 -0.0008 0.0001  282  TYR C CE2   
3292 C CZ    . TYR C 97  ? 0.2155 0.2323 0.2051 -0.0289 -0.0005 0.0092  282  TYR C CZ    
3293 O OH    . TYR C 97  ? 0.2296 0.2601 0.2319 -0.0475 0.0104  0.0124  282  TYR C OH    
3294 N N     . CYS C 98  ? 0.1276 0.1132 0.1402 -0.0022 -0.0154 0.0098  283  CYS C N     
3295 C CA    . CYS C 98  ? 0.1233 0.1059 0.1259 0.0010  -0.0168 0.0103  283  CYS C CA    
3296 C C     . CYS C 98  ? 0.1237 0.0950 0.1328 -0.0035 -0.0175 0.0125  283  CYS C C     
3297 O O     . CYS C 98  ? 0.1291 0.0989 0.1288 -0.0101 -0.0252 0.0132  283  CYS C O     
3298 C CB    . CYS C 98  ? 0.1388 0.1084 0.1387 0.0032  -0.0090 0.0023  283  CYS C CB    
3299 S SG    . CYS C 98  ? 0.1532 0.1220 0.1584 -0.0115 -0.0185 -0.0058 283  CYS C SG    
3300 N N     . VAL C 99  ? 0.1135 0.0876 0.1169 0.0000  -0.0150 0.0089  284  VAL C N     
3301 C CA    . VAL C 99  ? 0.1166 0.0860 0.1133 0.0034  -0.0104 0.0047  284  VAL C CA    
3302 C C     . VAL C 99  ? 0.1235 0.0986 0.1105 -0.0054 -0.0114 0.0032  284  VAL C C     
3303 O O     . VAL C 99  ? 0.1310 0.1074 0.1186 -0.0076 -0.0134 0.0121  284  VAL C O     
3304 C CB    . VAL C 99  ? 0.1198 0.0857 0.1069 0.0125  -0.0098 0.0039  284  VAL C CB    
3305 C CG1   . VAL C 99  ? 0.1178 0.1127 0.0992 0.0072  -0.0282 0.0103  284  VAL C CG1   
3306 C CG2   . VAL C 99  ? 0.1446 0.1074 0.1246 0.0147  0.0004  -0.0053 284  VAL C CG2   
3307 N N     . ASP C 100 ? 0.1359 0.1076 0.1169 -0.0062 -0.0139 -0.0002 285  ASP C N     
3308 C CA    . ASP C 100 ? 0.1456 0.1012 0.1134 -0.0050 -0.0124 -0.0082 285  ASP C CA    
3309 C C     . ASP C 100 ? 0.1404 0.1179 0.1205 -0.0022 -0.0120 -0.0044 285  ASP C C     
3310 O O     . ASP C 100 ? 0.1515 0.1262 0.1355 -0.0090 -0.0257 -0.0064 285  ASP C O     
3311 C CB    . ASP C 100 ? 0.1535 0.1034 0.1228 -0.0061 -0.0151 -0.0096 285  ASP C CB    
3312 C CG    . ASP C 100 ? 0.1517 0.1214 0.1312 -0.0152 -0.0114 -0.0016 285  ASP C CG    
3313 O OD1   . ASP C 100 ? 0.1647 0.1445 0.1328 -0.0271 0.0083  -0.0037 285  ASP C OD1   
3314 O OD2   . ASP C 100 ? 0.1875 0.1532 0.1627 -0.0206 0.0013  -0.0186 285  ASP C OD2   
3315 N N     . ALA C 101 ? 0.1398 0.1191 0.1120 -0.0055 -0.0112 -0.0096 286  ALA C N     
3316 C CA    . ALA C 101 ? 0.1444 0.1153 0.1192 -0.0092 -0.0007 -0.0079 286  ALA C CA    
3317 C C     . ALA C 101 ? 0.1507 0.1251 0.1194 -0.0054 -0.0027 -0.0087 286  ALA C C     
3318 O O     . ALA C 101 ? 0.1659 0.1213 0.1312 -0.0119 -0.0023 -0.0156 286  ALA C O     
3319 C CB    . ALA C 101 ? 0.1296 0.1132 0.1109 -0.0125 -0.0062 -0.0053 286  ALA C CB    
3320 N N     . THR C 102 ? 0.1700 0.1406 0.1390 -0.0071 0.0023  -0.0104 287  THR C N     
3321 C CA    . THR C 102 ? 0.1931 0.1529 0.1475 -0.0003 0.0060  -0.0083 287  THR C CA    
3322 C C     . THR C 102 ? 0.2035 0.1665 0.1511 0.0019  0.0068  -0.0088 287  THR C C     
3323 O O     . THR C 102 ? 0.2222 0.1664 0.1458 0.0000  0.0134  -0.0061 287  THR C O     
3324 C CB    . THR C 102 ? 0.1892 0.1531 0.1511 0.0009  0.0109  -0.0075 287  THR C CB    
3325 O OG1   . THR C 102 ? 0.1766 0.1431 0.1637 0.0011  -0.0016 -0.0077 287  THR C OG1   
3326 C CG2   . THR C 102 ? 0.2163 0.1680 0.1611 0.0063  0.0190  -0.0124 287  THR C CG2   
3327 N N     . ARG C 103 ? 0.2148 0.1766 0.1442 0.0039  -0.0065 -0.0072 288  ARG C N     
3328 C CA    . ARG C 103 ? 0.2215 0.1969 0.1554 0.0059  -0.0093 -0.0001 288  ARG C CA    
3329 C C     . ARG C 103 ? 0.2135 0.1889 0.1488 0.0024  -0.0051 0.0063  288  ARG C C     
3330 O O     . ARG C 103 ? 0.1985 0.1788 0.1392 0.0047  -0.0087 0.0021  288  ARG C O     
3331 C CB    . ARG C 103 ? 0.2252 0.2032 0.1732 0.0026  -0.0105 -0.0013 288  ARG C CB    
3332 C CG    . ARG C 103 ? 0.2603 0.2420 0.2080 0.0081  -0.0155 0.0088  288  ARG C CG    
3333 C CD    . ARG C 103 ? 0.2804 0.2928 0.2925 -0.0024 -0.0092 -0.0004 288  ARG C CD    
3334 N NE    . ARG C 103 ? 0.3111 0.3324 0.3072 0.0045  -0.0086 -0.0036 288  ARG C NE    
3335 C CZ    . ARG C 103 ? 0.3404 0.3356 0.3371 0.0036  -0.0036 -0.0018 288  ARG C CZ    
3336 N NH1   . ARG C 103 ? 0.3461 0.3526 0.3341 0.0045  -0.0139 0.0014  288  ARG C NH1   
3337 N NH2   . ARG C 103 ? 0.3440 0.3600 0.3307 -0.0019 -0.0046 0.0005  288  ARG C NH2   
3338 N N     . GLU C 104 ? 0.2242 0.1921 0.1370 -0.0009 -0.0029 0.0063  289  GLU C N     
3339 C CA    . GLU C 104 ? 0.2105 0.1956 0.1418 0.0007  0.0036  0.0074  289  GLU C CA    
3340 C C     . GLU C 104 ? 0.1984 0.1947 0.1388 -0.0048 0.0007  0.0083  289  GLU C C     
3341 O O     . GLU C 104 ? 0.2118 0.2277 0.1499 -0.0141 0.0044  -0.0014 289  GLU C O     
3342 C CB    . GLU C 104 ? 0.2185 0.2115 0.1538 -0.0004 0.0068  0.0106  289  GLU C CB    
3343 C CG    . GLU C 104 ? 0.2019 0.2193 0.1559 -0.0083 0.0155  0.0180  289  GLU C CG    
3344 C CD    . GLU C 104 ? 0.2336 0.2387 0.1437 0.0027  0.0154  0.0140  289  GLU C CD    
3345 O OE1   . GLU C 104 ? 0.2406 0.2727 0.1673 0.0073  0.0161  0.0008  289  GLU C OE1   
3346 O OE2   . GLU C 104 ? 0.2261 0.2766 0.1988 -0.0066 0.0101  0.0097  289  GLU C OE2   
3347 N N     . THR C 105 ? 0.1876 0.1916 0.1244 -0.0019 -0.0028 0.0071  290  THR C N     
3348 C CA    . THR C 105 ? 0.1653 0.1699 0.1088 -0.0017 -0.0122 0.0098  290  THR C CA    
3349 C C     . THR C 105 ? 0.1555 0.1665 0.0962 -0.0005 -0.0121 0.0106  290  THR C C     
3350 O O     . THR C 105 ? 0.1531 0.1826 0.0926 0.0014  -0.0020 0.0149  290  THR C O     
3351 C CB    . THR C 105 ? 0.1698 0.1716 0.1168 -0.0035 -0.0130 0.0088  290  THR C CB    
3352 O OG1   . THR C 105 ? 0.1447 0.1523 0.1003 -0.0112 -0.0243 0.0139  290  THR C OG1   
3353 C CG2   . THR C 105 ? 0.1750 0.1793 0.1365 -0.0035 -0.0142 0.0045  290  THR C CG2   
3354 N N     . ASN C 106 ? 0.1451 0.1552 0.0943 0.0058  -0.0146 0.0162  291  ASN C N     
3355 C CA    . ASN C 106 ? 0.1485 0.1697 0.1200 0.0070  -0.0103 0.0049  291  ASN C CA    
3356 C C     . ASN C 106 ? 0.1327 0.1562 0.1108 0.0030  -0.0098 0.0096  291  ASN C C     
3357 O O     . ASN C 106 ? 0.1499 0.1587 0.1118 0.0096  -0.0111 0.0157  291  ASN C O     
3358 C CB    . ASN C 106 ? 0.1644 0.1790 0.1361 0.0106  -0.0096 0.0093  291  ASN C CB    
3359 C CG    . ASN C 106 ? 0.2132 0.2312 0.2072 0.0043  0.0055  0.0108  291  ASN C CG    
3360 O OD1   . ASN C 106 ? 0.2637 0.2699 0.2379 0.0082  0.0054  0.0217  291  ASN C OD1   
3361 N ND2   . ASN C 106 ? 0.2683 0.2877 0.2940 0.0161  0.0067  0.0089  291  ASN C ND2   
3362 N N     . ARG C 107 ? 0.1211 0.1465 0.0988 -0.0003 -0.0084 0.0064  292  ARG C N     
3363 C CA    . ARG C 107 ? 0.1122 0.1416 0.0982 -0.0081 -0.0101 0.0060  292  ARG C CA    
3364 C C     . ARG C 107 ? 0.1088 0.1363 0.1004 -0.0045 -0.0077 0.0003  292  ARG C C     
3365 O O     . ARG C 107 ? 0.1206 0.1561 0.1058 0.0012  -0.0052 -0.0166 292  ARG C O     
3366 C CB    . ARG C 107 ? 0.1208 0.1484 0.1023 -0.0145 -0.0115 0.0082  292  ARG C CB    
3367 C CG    . ARG C 107 ? 0.1208 0.1680 0.1383 -0.0156 -0.0132 0.0108  292  ARG C CG    
3368 C CD    . ARG C 107 ? 0.1661 0.2245 0.2016 -0.0106 0.0084  -0.0050 292  ARG C CD    
3369 N NE    . ARG C 107 ? 0.2027 0.2729 0.2381 -0.0229 0.0135  -0.0037 292  ARG C NE    
3370 C CZ    . ARG C 107 ? 0.2010 0.2479 0.2054 -0.0109 0.0028  -0.0042 292  ARG C CZ    
3371 N NH1   . ARG C 107 ? 0.1673 0.1877 0.2023 -0.0143 0.0000  -0.0047 292  ARG C NH1   
3372 N NH2   . ARG C 107 ? 0.2201 0.2462 0.2425 -0.0298 -0.0018 -0.0183 292  ARG C NH2   
3373 N N     . LEU C 108 ? 0.0943 0.1101 0.0897 -0.0022 -0.0057 0.0031  293  LEU C N     
3374 C CA    . LEU C 108 ? 0.1015 0.1082 0.0995 0.0021  -0.0111 -0.0026 293  LEU C CA    
3375 C C     . LEU C 108 ? 0.0938 0.0976 0.0862 -0.0011 -0.0041 0.0036  293  LEU C C     
3376 O O     . LEU C 108 ? 0.0895 0.1088 0.0956 -0.0026 -0.0085 -0.0015 293  LEU C O     
3377 C CB    . LEU C 108 ? 0.1191 0.1025 0.1016 0.0041  -0.0103 0.0012  293  LEU C CB    
3378 C CG    . LEU C 108 ? 0.1474 0.1258 0.1277 0.0120  -0.0120 0.0155  293  LEU C CG    
3379 C CD1   . LEU C 108 ? 0.1769 0.1507 0.1590 0.0185  -0.0076 -0.0036 293  LEU C CD1   
3380 C CD2   . LEU C 108 ? 0.1801 0.1746 0.1569 0.0204  0.0085  0.0029  293  LEU C CD2   
3381 N N     . GLY C 109 ? 0.0868 0.0936 0.0740 0.0048  0.0009  0.0034  294  GLY C N     
3382 C CA    . GLY C 109 ? 0.0888 0.1018 0.0793 0.0000  0.0023  0.0099  294  GLY C CA    
3383 C C     . GLY C 109 ? 0.0847 0.0817 0.0770 -0.0058 -0.0009 0.0129  294  GLY C C     
3384 O O     . GLY C 109 ? 0.0847 0.1002 0.0831 0.0007  -0.0003 0.0071  294  GLY C O     
3385 N N     . ARG C 110 ? 0.0939 0.0944 0.0745 -0.0021 0.0046  0.0097  295  ARG C N     
3386 C CA    . ARG C 110 ? 0.0953 0.1009 0.0790 -0.0067 -0.0057 -0.0009 295  ARG C CA    
3387 C C     . ARG C 110 ? 0.0945 0.0976 0.0680 -0.0014 -0.0020 -0.0006 295  ARG C C     
3388 O O     . ARG C 110 ? 0.1053 0.1113 0.0897 0.0000  -0.0021 0.0007  295  ARG C O     
3389 C CB    . ARG C 110 ? 0.1071 0.1094 0.0653 -0.0059 -0.0080 -0.0006 295  ARG C CB    
3390 C CG    . ARG C 110 ? 0.1185 0.1080 0.0767 -0.0094 -0.0064 -0.0023 295  ARG C CG    
3391 C CD    . ARG C 110 ? 0.0942 0.1190 0.0855 -0.0089 -0.0062 -0.0055 295  ARG C CD    
3392 N NE    . ARG C 110 ? 0.1288 0.1133 0.0889 -0.0059 -0.0052 -0.0015 295  ARG C NE    
3393 C CZ    . ARG C 110 ? 0.1160 0.1165 0.1079 0.0043  0.0132  -0.0044 295  ARG C CZ    
3394 N NH1   . ARG C 110 ? 0.1389 0.1308 0.1004 0.0067  -0.0046 0.0036  295  ARG C NH1   
3395 N NH2   . ARG C 110 ? 0.1467 0.1311 0.1212 0.0239  -0.0037 -0.0126 295  ARG C NH2   
3396 N N     . LEU C 111 ? 0.0954 0.0946 0.0679 -0.0126 0.0010  0.0021  296  LEU C N     
3397 C CA    . LEU C 111 ? 0.0956 0.0976 0.0640 -0.0153 -0.0022 -0.0007 296  LEU C CA    
3398 C C     . LEU C 111 ? 0.0940 0.1015 0.0708 -0.0120 -0.0023 -0.0040 296  LEU C C     
3399 O O     . LEU C 111 ? 0.1143 0.1192 0.0788 -0.0260 -0.0024 -0.0067 296  LEU C O     
3400 C CB    . LEU C 111 ? 0.1178 0.0947 0.0691 -0.0116 -0.0021 0.0009  296  LEU C CB    
3401 C CG    . LEU C 111 ? 0.1277 0.1234 0.0731 -0.0100 -0.0102 0.0019  296  LEU C CG    
3402 C CD1   . LEU C 111 ? 0.1576 0.1429 0.1124 -0.0008 -0.0208 0.0113  296  LEU C CD1   
3403 C CD2   . LEU C 111 ? 0.1487 0.1431 0.1238 0.0013  -0.0099 -0.0049 296  LEU C CD2   
3404 N N     . ILE C 112 ? 0.0844 0.1030 0.0686 -0.0079 -0.0009 -0.0011 297  ILE C N     
3405 C CA    . ILE C 112 ? 0.0883 0.1043 0.0704 -0.0093 -0.0035 0.0000  297  ILE C CA    
3406 C C     . ILE C 112 ? 0.0891 0.1027 0.0772 -0.0121 0.0026  0.0002  297  ILE C C     
3407 O O     . ILE C 112 ? 0.0968 0.1060 0.0915 -0.0119 0.0116  -0.0026 297  ILE C O     
3408 C CB    . ILE C 112 ? 0.0825 0.1029 0.0773 -0.0063 -0.0055 -0.0057 297  ILE C CB    
3409 C CG1   . ILE C 112 ? 0.0733 0.1131 0.0750 0.0002  0.0080  -0.0023 297  ILE C CG1   
3410 C CG2   . ILE C 112 ? 0.0979 0.1169 0.0603 -0.0040 -0.0107 0.0000  297  ILE C CG2   
3411 C CD1   . ILE C 112 ? 0.0851 0.1279 0.0733 -0.0189 0.0163  -0.0176 297  ILE C CD1   
3412 N N     . ASN C 113 ? 0.0758 0.1057 0.0731 -0.0123 -0.0006 0.0002  298  ASN C N     
3413 C CA    . ASN C 113 ? 0.0832 0.1056 0.0696 -0.0050 -0.0012 0.0067  298  ASN C CA    
3414 C C     . ASN C 113 ? 0.0782 0.1110 0.0790 0.0009  -0.0031 0.0067  298  ASN C C     
3415 O O     . ASN C 113 ? 0.0716 0.1032 0.0967 -0.0069 -0.0065 0.0057  298  ASN C O     
3416 C CB    . ASN C 113 ? 0.0938 0.1116 0.0813 -0.0089 -0.0005 0.0000  298  ASN C CB    
3417 C CG    . ASN C 113 ? 0.0930 0.0986 0.0869 -0.0020 0.0023  -0.0035 298  ASN C CG    
3418 O OD1   . ASN C 113 ? 0.1299 0.0909 0.1140 -0.0233 -0.0108 0.0032  298  ASN C OD1   
3419 N ND2   . ASN C 113 ? 0.0922 0.1040 0.0926 -0.0192 0.0170  0.0153  298  ASN C ND2   
3420 N N     . HIS C 114 ? 0.0726 0.1105 0.0792 0.0028  -0.0153 0.0063  299  HIS C N     
3421 C CA    . HIS C 114 ? 0.0859 0.1005 0.0809 0.0042  -0.0099 0.0094  299  HIS C CA    
3422 C C     . HIS C 114 ? 0.0993 0.1089 0.0894 0.0006  -0.0067 0.0062  299  HIS C C     
3423 O O     . HIS C 114 ? 0.0985 0.1218 0.0807 -0.0109 0.0014  0.0054  299  HIS C O     
3424 C CB    . HIS C 114 ? 0.0806 0.1054 0.0900 0.0084  -0.0067 0.0085  299  HIS C CB    
3425 C CG    . HIS C 114 ? 0.1101 0.1181 0.0995 -0.0010 -0.0086 0.0144  299  HIS C CG    
3426 N ND1   . HIS C 114 ? 0.1016 0.1271 0.1179 -0.0154 -0.0127 0.0088  299  HIS C ND1   
3427 C CD2   . HIS C 114 ? 0.0969 0.1195 0.1038 -0.0085 -0.0179 -0.0060 299  HIS C CD2   
3428 C CE1   . HIS C 114 ? 0.1091 0.1302 0.1367 -0.0046 -0.0157 0.0137  299  HIS C CE1   
3429 N NE2   . HIS C 114 ? 0.1061 0.1030 0.1279 0.0061  -0.0126 0.0133  299  HIS C NE2   
3430 N N     . SER C 115 ? 0.0956 0.1195 0.0878 0.0016  -0.0211 0.0014  300  SER C N     
3431 C CA    . SER C 115 ? 0.1124 0.1174 0.1024 -0.0126 -0.0171 0.0021  300  SER C CA    
3432 C C     . SER C 115 ? 0.1165 0.1245 0.1049 -0.0066 -0.0126 0.0062  300  SER C C     
3433 O O     . SER C 115 ? 0.1148 0.1408 0.1001 -0.0128 -0.0074 0.0114  300  SER C O     
3434 C CB    . SER C 115 ? 0.1218 0.1129 0.1050 -0.0112 -0.0196 -0.0086 300  SER C CB    
3435 O OG    . SER C 115 ? 0.1460 0.1405 0.1088 -0.0149 -0.0422 -0.0010 300  SER C OG    
3436 N N     . LYS C 116 ? 0.1221 0.1304 0.1095 -0.0068 -0.0144 0.0062  301  LYS C N     
3437 C CA    . LYS C 116 ? 0.1178 0.1392 0.1151 0.0010  -0.0099 0.0141  301  LYS C CA    
3438 C C     . LYS C 116 ? 0.1387 0.1487 0.1301 0.0026  -0.0053 0.0103  301  LYS C C     
3439 O O     . LYS C 116 ? 0.1678 0.1585 0.1289 0.0087  -0.0056 0.0064  301  LYS C O     
3440 C CB    . LYS C 116 ? 0.1232 0.1521 0.1245 0.0057  -0.0105 0.0110  301  LYS C CB    
3441 C CG    . LYS C 116 ? 0.1110 0.1459 0.1373 -0.0085 -0.0171 0.0128  301  LYS C CG    
3442 C CD    . LYS C 116 ? 0.1519 0.1934 0.2113 0.0244  -0.0166 0.0175  301  LYS C CD    
3443 C CE    . LYS C 116 ? 0.1849 0.2352 0.2213 0.0172  -0.0106 0.0043  301  LYS C CE    
3444 N NZ    . LYS C 116 ? 0.2080 0.2588 0.2638 0.0261  -0.0239 0.0158  301  LYS C NZ    
3445 N N     . CYS C 117 ? 0.1140 0.1315 0.1224 0.0030  -0.0111 0.0089  302  CYS C N     
3446 C CA    . CYS C 117 ? 0.1181 0.1419 0.1456 -0.0019 -0.0129 0.0009  302  CYS C CA    
3447 C C     . CYS C 117 ? 0.1119 0.1226 0.1344 -0.0081 -0.0107 0.0051  302  CYS C C     
3448 O O     . CYS C 117 ? 0.1191 0.1273 0.1499 -0.0029 -0.0145 0.0037  302  CYS C O     
3449 C CB    . CYS C 117 ? 0.1357 0.1532 0.1604 -0.0021 -0.0085 0.0033  302  CYS C CB    
3450 S SG    . CYS C 117 ? 0.1344 0.1766 0.1995 -0.0195 -0.0039 -0.0115 302  CYS C SG    
3451 N N     . GLY C 118 ? 0.0937 0.1190 0.1167 -0.0130 -0.0086 -0.0059 303  GLY C N     
3452 C CA    . GLY C 118 ? 0.0943 0.1277 0.1044 -0.0067 -0.0076 -0.0035 303  GLY C CA    
3453 C C     . GLY C 118 ? 0.1033 0.1351 0.0911 -0.0061 -0.0086 -0.0030 303  GLY C C     
3454 O O     . GLY C 118 ? 0.1169 0.1562 0.0939 -0.0179 -0.0097 -0.0024 303  GLY C O     
3455 N N     . ASN C 119 ? 0.0878 0.1235 0.0844 -0.0119 -0.0083 0.0008  304  ASN C N     
3456 C CA    . ASN C 119 ? 0.1008 0.1190 0.0790 -0.0120 -0.0067 -0.0073 304  ASN C CA    
3457 C C     . ASN C 119 ? 0.1048 0.1176 0.0875 -0.0090 -0.0063 -0.0095 304  ASN C C     
3458 O O     . ASN C 119 ? 0.1056 0.1219 0.0846 -0.0076 -0.0004 -0.0156 304  ASN C O     
3459 C CB    . ASN C 119 ? 0.1000 0.1207 0.0795 -0.0151 -0.0042 0.0000  304  ASN C CB    
3460 C CG    . ASN C 119 ? 0.0915 0.0826 0.0814 -0.0069 -0.0008 -0.0102 304  ASN C CG    
3461 O OD1   . ASN C 119 ? 0.1050 0.0858 0.0819 -0.0186 0.0005  -0.0163 304  ASN C OD1   
3462 N ND2   . ASN C 119 ? 0.1035 0.1155 0.1148 -0.0011 0.0054  0.0196  304  ASN C ND2   
3463 N N     . CYS C 120 ? 0.1049 0.1042 0.0779 -0.0083 -0.0094 -0.0057 305  CYS C N     
3464 C CA    . CYS C 120 ? 0.1183 0.1104 0.0947 -0.0101 -0.0136 -0.0033 305  CYS C CA    
3465 C C     . CYS C 120 ? 0.1106 0.1082 0.0917 -0.0118 -0.0081 -0.0029 305  CYS C C     
3466 O O     . CYS C 120 ? 0.1184 0.1049 0.1043 -0.0084 -0.0011 -0.0006 305  CYS C O     
3467 C CB    . CYS C 120 ? 0.1272 0.1240 0.1066 -0.0089 -0.0187 -0.0037 305  CYS C CB    
3468 S SG    . CYS C 120 ? 0.1162 0.1369 0.1110 -0.0077 -0.0083 0.0034  305  CYS C SG    
3469 N N     . GLN C 121 ? 0.1142 0.1152 0.0928 -0.0174 -0.0051 0.0022  306  GLN C N     
3470 C CA    . GLN C 121 ? 0.1284 0.1242 0.1031 -0.0147 -0.0045 0.0021  306  GLN C CA    
3471 C C     . GLN C 121 ? 0.1183 0.1153 0.1047 -0.0126 -0.0017 0.0049  306  GLN C C     
3472 O O     . GLN C 121 ? 0.1189 0.1209 0.1201 -0.0093 0.0047  0.0075  306  GLN C O     
3473 C CB    . GLN C 121 ? 0.1513 0.1413 0.1074 -0.0114 -0.0137 0.0066  306  GLN C CB    
3474 C CG    . GLN C 121 ? 0.1756 0.1708 0.1306 -0.0098 -0.0085 0.0125  306  GLN C CG    
3475 C CD    . GLN C 121 ? 0.1980 0.2036 0.1997 0.0000  -0.0062 0.0083  306  GLN C CD    
3476 O OE1   . GLN C 121 ? 0.2174 0.2270 0.2264 -0.0143 -0.0141 0.0021  306  GLN C OE1   
3477 N NE2   . GLN C 121 ? 0.2133 0.2079 0.2043 0.0054  -0.0187 0.0067  306  GLN C NE2   
3478 N N     . THR C 122 ? 0.1189 0.1153 0.1018 -0.0154 -0.0025 0.0003  307  THR C N     
3479 C CA    . THR C 122 ? 0.1296 0.1250 0.1142 -0.0184 0.0010  -0.0024 307  THR C CA    
3480 C C     . THR C 122 ? 0.1330 0.1267 0.1166 -0.0184 -0.0003 0.0015  307  THR C C     
3481 O O     . THR C 122 ? 0.1319 0.1380 0.1279 -0.0190 -0.0034 0.0140  307  THR C O     
3482 C CB    . THR C 122 ? 0.1306 0.1259 0.1223 -0.0218 0.0038  -0.0082 307  THR C CB    
3483 O OG1   . THR C 122 ? 0.1530 0.1526 0.1238 -0.0425 0.0225  -0.0214 307  THR C OG1   
3484 C CG2   . THR C 122 ? 0.1464 0.1332 0.1291 -0.0248 -0.0138 -0.0256 307  THR C CG2   
3485 N N     . LYS C 123 ? 0.1355 0.1332 0.1166 -0.0221 -0.0018 0.0052  308  LYS C N     
3486 C CA    . LYS C 123 ? 0.1528 0.1454 0.1371 -0.0220 0.0031  0.0077  308  LYS C CA    
3487 C C     . LYS C 123 ? 0.1519 0.1399 0.1211 -0.0178 -0.0009 0.0085  308  LYS C C     
3488 O O     . LYS C 123 ? 0.1517 0.1467 0.1087 -0.0313 0.0020  0.0150  308  LYS C O     
3489 C CB    . LYS C 123 ? 0.1678 0.1634 0.1463 -0.0239 0.0062  -0.0005 308  LYS C CB    
3490 C CG    . LYS C 123 ? 0.2293 0.2082 0.2341 -0.0262 0.0002  0.0011  308  LYS C CG    
3491 C CD    . LYS C 123 ? 0.3110 0.3057 0.2824 -0.0140 -0.0051 0.0088  308  LYS C CD    
3492 C CE    . LYS C 123 ? 0.3305 0.3405 0.3386 -0.0040 -0.0006 0.0103  308  LYS C CE    
3493 N NZ    . LYS C 123 ? 0.3613 0.3658 0.3497 -0.0057 -0.0083 0.0041  308  LYS C NZ    
3494 N N     . LEU C 124 ? 0.1557 0.1383 0.1221 -0.0166 0.0044  0.0105  309  LEU C N     
3495 C CA    . LEU C 124 ? 0.1633 0.1498 0.1361 -0.0087 -0.0008 0.0093  309  LEU C CA    
3496 C C     . LEU C 124 ? 0.1577 0.1482 0.1351 -0.0132 0.0054  0.0099  309  LEU C C     
3497 O O     . LEU C 124 ? 0.1687 0.1863 0.1404 -0.0113 0.0026  -0.0033 309  LEU C O     
3498 C CB    . LEU C 124 ? 0.1734 0.1442 0.1529 -0.0067 0.0007  0.0182  309  LEU C CB    
3499 C CG    . LEU C 124 ? 0.2161 0.1692 0.1872 -0.0076 -0.0066 0.0083  309  LEU C CG    
3500 C CD1   . LEU C 124 ? 0.2341 0.2056 0.1827 -0.0182 0.0006  0.0088  309  LEU C CD1   
3501 C CD2   . LEU C 124 ? 0.2095 0.1759 0.1755 -0.0005 -0.0026 0.0123  309  LEU C CD2   
3502 N N     . HIS C 125 ? 0.1473 0.1445 0.1381 -0.0080 0.0085  0.0114  310  HIS C N     
3503 C CA    . HIS C 125 ? 0.1529 0.1571 0.1576 -0.0058 0.0039  0.0121  310  HIS C CA    
3504 C C     . HIS C 125 ? 0.1585 0.1738 0.1719 -0.0060 0.0041  0.0077  310  HIS C C     
3505 O O     . HIS C 125 ? 0.1549 0.1950 0.1775 -0.0181 0.0000  0.0053  310  HIS C O     
3506 C CB    . HIS C 125 ? 0.1567 0.1504 0.1665 0.0000  0.0104  0.0105  310  HIS C CB    
3507 C CG    . HIS C 125 ? 0.1679 0.1625 0.1716 0.0034  0.0116  0.0098  310  HIS C CG    
3508 N ND1   . HIS C 125 ? 0.1700 0.1747 0.1796 0.0045  0.0133  0.0146  310  HIS C ND1   
3509 C CD2   . HIS C 125 ? 0.1814 0.1574 0.1760 -0.0002 0.0115  0.0105  310  HIS C CD2   
3510 C CE1   . HIS C 125 ? 0.1697 0.1806 0.1951 0.0077  0.0124  0.0143  310  HIS C CE1   
3511 N NE2   . HIS C 125 ? 0.1714 0.1431 0.1936 0.0035  0.0167  0.0253  310  HIS C NE2   
3512 N N     . ASP C 126 ? 0.1678 0.1787 0.1904 -0.0096 0.0012  0.0087  311  ASP C N     
3513 C CA    . ASP C 126 ? 0.1809 0.1869 0.2144 -0.0049 0.0004  0.0052  311  ASP C CA    
3514 C C     . ASP C 126 ? 0.1808 0.1896 0.2154 -0.0019 -0.0006 0.0043  311  ASP C C     
3515 O O     . ASP C 126 ? 0.1863 0.1934 0.2345 -0.0024 -0.0029 -0.0018 311  ASP C O     
3516 C CB    . ASP C 126 ? 0.2079 0.2041 0.2294 -0.0061 -0.0001 0.0082  311  ASP C CB    
3517 C CG    . ASP C 126 ? 0.2297 0.2327 0.2469 -0.0005 0.0133  0.0065  311  ASP C CG    
3518 O OD1   . ASP C 126 ? 0.2757 0.2490 0.2740 0.0004  0.0082  0.0125  311  ASP C OD1   
3519 O OD2   . ASP C 126 ? 0.2579 0.2476 0.2864 -0.0009 0.0291  0.0126  311  ASP C OD2   
3520 N N     . ILE C 127 ? 0.1690 0.1918 0.2196 0.0012  -0.0015 0.0072  312  ILE C N     
3521 C CA    . ILE C 127 ? 0.1696 0.1939 0.2266 -0.0061 -0.0023 0.0101  312  ILE C CA    
3522 C C     . ILE C 127 ? 0.1780 0.1977 0.2288 -0.0047 -0.0027 0.0098  312  ILE C C     
3523 O O     . ILE C 127 ? 0.1791 0.1896 0.2351 -0.0109 -0.0042 0.0154  312  ILE C O     
3524 C CB    . ILE C 127 ? 0.1567 0.1856 0.2262 -0.0058 -0.0061 0.0066  312  ILE C CB    
3525 C CG1   . ILE C 127 ? 0.1715 0.1759 0.2245 -0.0078 0.0003  0.0073  312  ILE C CG1   
3526 C CG2   . ILE C 127 ? 0.1543 0.1972 0.2361 -0.0030 -0.0002 0.0056  312  ILE C CG2   
3527 C CD1   . ILE C 127 ? 0.1770 0.1914 0.2229 -0.0106 -0.0016 0.0149  312  ILE C CD1   
3528 N N     . ASP C 128 ? 0.2017 0.2192 0.2454 -0.0053 0.0020  0.0107  313  ASP C N     
3529 C CA    . ASP C 128 ? 0.2171 0.2278 0.2494 -0.0062 0.0009  0.0044  313  ASP C CA    
3530 C C     . ASP C 128 ? 0.2153 0.2197 0.2385 -0.0065 0.0042  0.0101  313  ASP C C     
3531 O O     . ASP C 128 ? 0.2154 0.2294 0.2498 -0.0093 0.0025  0.0070  313  ASP C O     
3532 C CB    . ASP C 128 ? 0.2295 0.2394 0.2624 -0.0029 -0.0002 0.0086  313  ASP C CB    
3533 C CG    . ASP C 128 ? 0.2588 0.2801 0.2912 0.0012  0.0063  -0.0019 313  ASP C CG    
3534 O OD1   . ASP C 128 ? 0.2769 0.2984 0.3280 0.0040  0.0150  0.0123  313  ASP C OD1   
3535 O OD2   . ASP C 128 ? 0.3149 0.3315 0.3075 0.0011  0.0149  0.0044  313  ASP C OD2   
3536 N N     . GLY C 129 ? 0.2044 0.2052 0.2289 -0.0093 0.0070  0.0116  314  GLY C N     
3537 C CA    . GLY C 129 ? 0.1982 0.1896 0.2135 -0.0111 0.0136  0.0148  314  GLY C CA    
3538 C C     . GLY C 129 ? 0.2004 0.1908 0.2101 -0.0091 0.0109  0.0159  314  GLY C C     
3539 O O     . GLY C 129 ? 0.2068 0.1834 0.2237 -0.0161 0.0149  0.0237  314  GLY C O     
3540 N N     . VAL C 130 ? 0.1801 0.1741 0.1900 -0.0147 0.0088  0.0135  315  VAL C N     
3541 C CA    . VAL C 130 ? 0.1728 0.1820 0.1851 -0.0213 0.0039  0.0106  315  VAL C CA    
3542 C C     . VAL C 130 ? 0.1563 0.1555 0.1668 -0.0189 0.0068  0.0112  315  VAL C C     
3543 O O     . VAL C 130 ? 0.1525 0.1621 0.1798 -0.0207 0.0112  0.0163  315  VAL C O     
3544 C CB    . VAL C 130 ? 0.1677 0.1846 0.1871 -0.0240 0.0030  0.0085  315  VAL C CB    
3545 C CG1   . VAL C 130 ? 0.1994 0.2101 0.1894 -0.0229 0.0074  0.0065  315  VAL C CG1   
3546 C CG2   . VAL C 130 ? 0.1940 0.2147 0.2117 -0.0311 -0.0075 -0.0011 315  VAL C CG2   
3547 N N     . PRO C 131 ? 0.1539 0.1452 0.1630 -0.0202 0.0069  0.0077  316  PRO C N     
3548 C CA    . PRO C 131 ? 0.1431 0.1466 0.1462 -0.0223 0.0042  0.0064  316  PRO C CA    
3549 C C     . PRO C 131 ? 0.1504 0.1539 0.1340 -0.0197 -0.0004 0.0072  316  PRO C C     
3550 O O     . PRO C 131 ? 0.1702 0.1756 0.1383 -0.0335 0.0024  0.0022  316  PRO C O     
3551 C CB    . PRO C 131 ? 0.1499 0.1473 0.1517 -0.0153 0.0053  0.0034  316  PRO C CB    
3552 C CG    . PRO C 131 ? 0.1551 0.1545 0.1635 -0.0148 0.0080  0.0017  316  PRO C CG    
3553 C CD    . PRO C 131 ? 0.1536 0.1529 0.1669 -0.0165 0.0098  -0.0010 316  PRO C CD    
3554 N N     . HIS C 132 ? 0.1352 0.1340 0.1216 -0.0204 0.0020  0.0180  317  HIS C N     
3555 C CA    . HIS C 132 ? 0.1279 0.1400 0.1365 -0.0230 0.0004  0.0129  317  HIS C CA    
3556 C C     . HIS C 132 ? 0.1280 0.1512 0.1291 -0.0137 -0.0067 0.0105  317  HIS C C     
3557 O O     . HIS C 132 ? 0.1355 0.1766 0.1229 -0.0208 -0.0023 0.0178  317  HIS C O     
3558 C CB    . HIS C 132 ? 0.1321 0.1554 0.1499 -0.0185 -0.0001 0.0166  317  HIS C CB    
3559 C CG    . HIS C 132 ? 0.1348 0.1675 0.1698 -0.0210 -0.0072 0.0145  317  HIS C CG    
3560 N ND1   . HIS C 132 ? 0.1021 0.1689 0.1736 -0.0103 -0.0195 0.0043  317  HIS C ND1   
3561 C CD2   . HIS C 132 ? 0.1658 0.1937 0.1973 -0.0193 -0.0038 0.0205  317  HIS C CD2   
3562 C CE1   . HIS C 132 ? 0.1397 0.1966 0.2179 -0.0170 -0.0071 0.0126  317  HIS C CE1   
3563 N NE2   . HIS C 132 ? 0.1650 0.2032 0.2057 -0.0291 -0.0114 0.0139  317  HIS C NE2   
3564 N N     . LEU C 133 ? 0.1184 0.1310 0.1265 -0.0114 -0.0037 0.0127  318  LEU C N     
3565 C CA    . LEU C 133 ? 0.1110 0.1277 0.1244 -0.0059 -0.0004 0.0113  318  LEU C CA    
3566 C C     . LEU C 133 ? 0.1095 0.1282 0.1190 -0.0067 -0.0015 0.0083  318  LEU C C     
3567 O O     . LEU C 133 ? 0.1151 0.1335 0.1102 -0.0086 0.0000  0.0145  318  LEU C O     
3568 C CB    . LEU C 133 ? 0.1201 0.1272 0.1279 0.0006  -0.0012 0.0096  318  LEU C CB    
3569 C CG    . LEU C 133 ? 0.1349 0.1187 0.1382 -0.0013 -0.0024 0.0037  318  LEU C CG    
3570 C CD1   . LEU C 133 ? 0.1532 0.1371 0.1620 -0.0073 0.0152  -0.0085 318  LEU C CD1   
3571 C CD2   . LEU C 133 ? 0.1537 0.1378 0.1366 0.0029  -0.0117 0.0138  318  LEU C CD2   
3572 N N     . ILE C 134 ? 0.1052 0.1204 0.1044 -0.0095 0.0041  0.0108  319  ILE C N     
3573 C CA    . ILE C 134 ? 0.1118 0.1215 0.1124 -0.0104 -0.0017 0.0112  319  ILE C CA    
3574 C C     . ILE C 134 ? 0.1081 0.1172 0.1061 -0.0142 -0.0042 0.0149  319  ILE C C     
3575 O O     . ILE C 134 ? 0.1199 0.1222 0.1256 -0.0260 -0.0109 0.0333  319  ILE C O     
3576 C CB    . ILE C 134 ? 0.1178 0.1210 0.1062 -0.0026 -0.0004 0.0152  319  ILE C CB    
3577 C CG1   . ILE C 134 ? 0.1197 0.1394 0.1096 -0.0050 -0.0037 0.0106  319  ILE C CG1   
3578 C CG2   . ILE C 134 ? 0.1189 0.1560 0.1159 -0.0130 -0.0033 0.0019  319  ILE C CG2   
3579 C CD1   . ILE C 134 ? 0.1468 0.1471 0.1216 -0.0020 0.0102  0.0064  319  ILE C CD1   
3580 N N     . LEU C 135 ? 0.1046 0.0916 0.1074 -0.0172 -0.0044 0.0086  320  LEU C N     
3581 C CA    . LEU C 135 ? 0.1007 0.1077 0.0997 -0.0098 0.0028  0.0071  320  LEU C CA    
3582 C C     . LEU C 135 ? 0.1159 0.1161 0.1165 -0.0096 0.0048  0.0042  320  LEU C C     
3583 O O     . LEU C 135 ? 0.0995 0.1076 0.1240 0.0015  0.0087  -0.0032 320  LEU C O     
3584 C CB    . LEU C 135 ? 0.1070 0.1111 0.1026 -0.0074 0.0096  0.0113  320  LEU C CB    
3585 C CG    . LEU C 135 ? 0.1351 0.1440 0.1132 0.0005  0.0301  0.0142  320  LEU C CG    
3586 C CD1   . LEU C 135 ? 0.1766 0.1979 0.1745 -0.0078 0.0132  0.0018  320  LEU C CD1   
3587 C CD2   . LEU C 135 ? 0.1632 0.1689 0.1293 -0.0029 0.0406  0.0263  320  LEU C CD2   
3588 N N     . ILE C 136 ? 0.1200 0.1146 0.1090 -0.0124 0.0040  0.0008  321  ILE C N     
3589 C CA    . ILE C 136 ? 0.1356 0.1316 0.1276 -0.0149 0.0124  0.0003  321  ILE C CA    
3590 C C     . ILE C 136 ? 0.1195 0.1190 0.1138 -0.0095 0.0051  -0.0026 321  ILE C C     
3591 O O     . ILE C 136 ? 0.1195 0.1224 0.1371 -0.0008 0.0059  -0.0092 321  ILE C O     
3592 C CB    . ILE C 136 ? 0.1468 0.1407 0.1210 -0.0161 0.0150  -0.0032 321  ILE C CB    
3593 C CG1   . ILE C 136 ? 0.1705 0.1626 0.1523 -0.0155 0.0128  0.0041  321  ILE C CG1   
3594 C CG2   . ILE C 136 ? 0.1756 0.1623 0.1802 -0.0247 0.0127  -0.0146 321  ILE C CG2   
3595 C CD1   . ILE C 136 ? 0.1932 0.1723 0.1549 -0.0167 0.0179  0.0066  321  ILE C CD1   
3596 N N     . ALA C 137 ? 0.1078 0.1051 0.1005 -0.0176 0.0076  0.0015  322  ALA C N     
3597 C CA    . ALA C 137 ? 0.1065 0.1144 0.1029 -0.0128 0.0023  -0.0017 322  ALA C CA    
3598 C C     . ALA C 137 ? 0.1152 0.1312 0.1012 -0.0104 0.0037  -0.0021 322  ALA C C     
3599 O O     . ALA C 137 ? 0.1228 0.1523 0.1138 -0.0220 0.0123  -0.0014 322  ALA C O     
3600 C CB    . ALA C 137 ? 0.1213 0.1067 0.1198 -0.0074 0.0143  0.0020  322  ALA C CB    
3601 N N     . SER C 138 ? 0.1186 0.1300 0.0996 -0.0086 -0.0006 -0.0063 323  SER C N     
3602 C CA    . SER C 138 ? 0.1295 0.1469 0.0999 -0.0087 -0.0048 -0.0015 323  SER C CA    
3603 C C     . SER C 138 ? 0.1346 0.1449 0.1057 -0.0096 -0.0052 -0.0002 323  SER C C     
3604 O O     . SER C 138 ? 0.1550 0.1705 0.1101 -0.0090 -0.0176 0.0052  323  SER C O     
3605 C CB    . SER C 138 ? 0.1283 0.1517 0.1069 -0.0006 -0.0077 0.0101  323  SER C CB    
3606 O OG    . SER C 138 ? 0.1573 0.2093 0.1145 0.0095  0.0030  0.0171  323  SER C OG    
3607 N N     . ARG C 139 ? 0.1379 0.1473 0.1050 -0.0081 -0.0022 -0.0044 324  ARG C N     
3608 C CA    . ARG C 139 ? 0.1248 0.1411 0.0999 -0.0111 -0.0006 -0.0054 324  ARG C CA    
3609 C C     . ARG C 139 ? 0.1262 0.1311 0.1094 -0.0051 0.0020  -0.0131 324  ARG C C     
3610 O O     . ARG C 139 ? 0.1241 0.1352 0.1063 -0.0136 -0.0033 -0.0131 324  ARG C O     
3611 C CB    . ARG C 139 ? 0.1272 0.1426 0.0894 -0.0092 0.0057  -0.0057 324  ARG C CB    
3612 C CG    . ARG C 139 ? 0.1130 0.1533 0.0791 -0.0216 0.0064  -0.0021 324  ARG C CG    
3613 C CD    . ARG C 139 ? 0.1150 0.1455 0.1176 -0.0268 0.0079  -0.0100 324  ARG C CD    
3614 N NE    . ARG C 139 ? 0.1234 0.1310 0.1061 -0.0253 0.0013  -0.0079 324  ARG C NE    
3615 C CZ    . ARG C 139 ? 0.1062 0.1128 0.1216 -0.0250 0.0012  -0.0074 324  ARG C CZ    
3616 N NH1   . ARG C 139 ? 0.1110 0.1193 0.1396 -0.0170 -0.0191 -0.0197 324  ARG C NH1   
3617 N NH2   . ARG C 139 ? 0.1167 0.1363 0.1068 -0.0186 -0.0002 -0.0082 324  ARG C NH2   
3618 N N     . ASP C 140 ? 0.1303 0.1297 0.1193 -0.0097 0.0035  -0.0155 325  ASP C N     
3619 C CA    . ASP C 140 ? 0.1289 0.1216 0.1294 -0.0068 -0.0005 -0.0233 325  ASP C CA    
3620 C C     . ASP C 140 ? 0.1168 0.1199 0.1361 -0.0079 0.0025  -0.0183 325  ASP C C     
3621 O O     . ASP C 140 ? 0.1078 0.1381 0.1335 -0.0068 0.0069  -0.0298 325  ASP C O     
3622 C CB    . ASP C 140 ? 0.1380 0.1171 0.1501 -0.0073 -0.0019 -0.0296 325  ASP C CB    
3623 C CG    . ASP C 140 ? 0.1640 0.1436 0.1451 -0.0145 -0.0030 -0.0307 325  ASP C CG    
3624 O OD1   . ASP C 140 ? 0.1784 0.1751 0.1444 -0.0136 0.0177  -0.0414 325  ASP C OD1   
3625 O OD2   . ASP C 140 ? 0.2086 0.1528 0.2208 -0.0199 -0.0079 -0.0535 325  ASP C OD2   
3626 N N     . ILE C 141 ? 0.1205 0.1119 0.1370 -0.0059 0.0000  -0.0126 326  ILE C N     
3627 C CA    . ILE C 141 ? 0.1194 0.1076 0.1283 -0.0066 -0.0027 -0.0060 326  ILE C CA    
3628 C C     . ILE C 141 ? 0.1211 0.1096 0.1364 -0.0054 0.0015  0.0003  326  ILE C C     
3629 O O     . ILE C 141 ? 0.1074 0.1067 0.1521 -0.0087 0.0088  0.0127  326  ILE C O     
3630 C CB    . ILE C 141 ? 0.1110 0.1029 0.1269 -0.0027 -0.0064 -0.0103 326  ILE C CB    
3631 C CG1   . ILE C 141 ? 0.1278 0.1067 0.1171 -0.0057 -0.0017 0.0023  326  ILE C CG1   
3632 C CG2   . ILE C 141 ? 0.1394 0.1366 0.1277 -0.0041 -0.0002 -0.0070 326  ILE C CG2   
3633 C CD1   . ILE C 141 ? 0.1233 0.1192 0.1235 -0.0130 -0.0013 -0.0112 326  ILE C CD1   
3634 N N     . ALA C 142 ? 0.1244 0.1131 0.1297 -0.0076 0.0007  0.0085  327  ALA C N     
3635 C CA    . ALA C 142 ? 0.1219 0.1134 0.1312 -0.0079 -0.0011 0.0053  327  ALA C CA    
3636 C C     . ALA C 142 ? 0.1222 0.1126 0.1326 -0.0042 -0.0042 0.0058  327  ALA C C     
3637 O O     . ALA C 142 ? 0.1213 0.1057 0.1242 0.0004  -0.0087 0.0053  327  ALA C O     
3638 C CB    . ALA C 142 ? 0.1226 0.1133 0.1316 -0.0138 -0.0007 0.0086  327  ALA C CB    
3639 N N     . ALA C 143 ? 0.1268 0.1178 0.1361 0.0026  -0.0065 0.0064  328  ALA C N     
3640 C CA    . ALA C 143 ? 0.1289 0.1147 0.1380 0.0114  -0.0078 0.0048  328  ALA C CA    
3641 C C     . ALA C 143 ? 0.1357 0.1229 0.1365 0.0043  -0.0069 0.0068  328  ALA C C     
3642 O O     . ALA C 143 ? 0.1471 0.1364 0.1480 0.0034  -0.0060 0.0002  328  ALA C O     
3643 C CB    . ALA C 143 ? 0.1226 0.1154 0.1498 0.0118  -0.0123 0.0055  328  ALA C CB    
3644 N N     . GLY C 144 ? 0.1350 0.1224 0.1375 0.0114  -0.0010 0.0040  329  GLY C N     
3645 C CA    . GLY C 144 ? 0.1399 0.1310 0.1261 0.0108  0.0006  0.0086  329  GLY C CA    
3646 C C     . GLY C 144 ? 0.1379 0.1234 0.1179 0.0058  -0.0011 0.0059  329  GLY C C     
3647 O O     . GLY C 144 ? 0.1607 0.1344 0.1232 0.0100  0.0001  0.0002  329  GLY C O     
3648 N N     . GLU C 145 ? 0.1343 0.1107 0.0975 -0.0043 -0.0143 -0.0053 330  GLU C N     
3649 C CA    . GLU C 145 ? 0.1247 0.1090 0.0911 -0.0042 -0.0096 -0.0036 330  GLU C CA    
3650 C C     . GLU C 145 ? 0.1180 0.1113 0.0841 -0.0049 -0.0044 -0.0036 330  GLU C C     
3651 O O     . GLU C 145 ? 0.1165 0.1236 0.0848 -0.0029 -0.0079 -0.0047 330  GLU C O     
3652 C CB    . GLU C 145 ? 0.1226 0.1094 0.0863 -0.0079 -0.0082 -0.0043 330  GLU C CB    
3653 C CG    . GLU C 145 ? 0.1287 0.1046 0.0977 -0.0069 -0.0034 -0.0086 330  GLU C CG    
3654 C CD    . GLU C 145 ? 0.1263 0.1288 0.1181 -0.0043 -0.0018 0.0017  330  GLU C CD    
3655 O OE1   . GLU C 145 ? 0.0948 0.1118 0.1207 -0.0090 -0.0052 -0.0031 330  GLU C OE1   
3656 O OE2   . GLU C 145 ? 0.1438 0.1296 0.1019 0.0122  -0.0002 0.0060  330  GLU C OE2   
3657 N N     . GLU C 146 ? 0.1236 0.0964 0.0771 -0.0043 -0.0058 0.0078  331  GLU C N     
3658 C CA    . GLU C 146 ? 0.1107 0.0919 0.0759 -0.0096 0.0014  0.0024  331  GLU C CA    
3659 C C     . GLU C 146 ? 0.1123 0.1046 0.0803 -0.0085 -0.0029 0.0074  331  GLU C C     
3660 O O     . GLU C 146 ? 0.1148 0.1173 0.0851 -0.0205 -0.0020 0.0062  331  GLU C O     
3661 C CB    . GLU C 146 ? 0.1169 0.0932 0.0892 -0.0012 0.0000  -0.0019 331  GLU C CB    
3662 C CG    . GLU C 146 ? 0.1100 0.0884 0.0775 -0.0150 0.0024  -0.0018 331  GLU C CG    
3663 C CD    . GLU C 146 ? 0.1138 0.0940 0.0732 -0.0087 -0.0044 0.0021  331  GLU C CD    
3664 O OE1   . GLU C 146 ? 0.1050 0.1237 0.0808 -0.0077 0.0182  0.0014  331  GLU C OE1   
3665 O OE2   . GLU C 146 ? 0.1117 0.0987 0.0753 -0.0285 0.0036  -0.0115 331  GLU C OE2   
3666 N N     . LEU C 147 ? 0.1123 0.0983 0.0773 -0.0093 -0.0055 0.0082  332  LEU C N     
3667 C CA    . LEU C 147 ? 0.0872 0.0896 0.0761 -0.0057 -0.0046 0.0070  332  LEU C CA    
3668 C C     . LEU C 147 ? 0.0957 0.0990 0.0790 -0.0032 -0.0026 0.0026  332  LEU C C     
3669 O O     . LEU C 147 ? 0.1053 0.0991 0.0833 0.0007  0.0025  0.0008  332  LEU C O     
3670 C CB    . LEU C 147 ? 0.0938 0.0909 0.0891 -0.0103 -0.0050 0.0076  332  LEU C CB    
3671 C CG    . LEU C 147 ? 0.0890 0.0973 0.0909 -0.0055 -0.0008 0.0018  332  LEU C CG    
3672 C CD1   . LEU C 147 ? 0.1128 0.1655 0.1057 -0.0230 -0.0011 -0.0033 332  LEU C CD1   
3673 C CD2   . LEU C 147 ? 0.1336 0.1308 0.1176 0.0017  -0.0010 -0.0069 332  LEU C CD2   
3674 N N     . LEU C 148 ? 0.0871 0.0904 0.0734 -0.0075 -0.0024 0.0051  333  LEU C N     
3675 C CA    . LEU C 148 ? 0.0830 0.0925 0.0740 -0.0074 -0.0039 0.0066  333  LEU C CA    
3676 C C     . LEU C 148 ? 0.0888 0.0955 0.0689 -0.0041 -0.0031 0.0032  333  LEU C C     
3677 O O     . LEU C 148 ? 0.1005 0.1051 0.0670 -0.0027 0.0047  0.0025  333  LEU C O     
3678 C CB    . LEU C 148 ? 0.0781 0.1084 0.0794 -0.0136 -0.0026 0.0076  333  LEU C CB    
3679 C CG    . LEU C 148 ? 0.0910 0.0940 0.0765 -0.0067 -0.0061 0.0041  333  LEU C CG    
3680 C CD1   . LEU C 148 ? 0.0888 0.1262 0.0904 -0.0151 -0.0074 -0.0030 333  LEU C CD1   
3681 C CD2   . LEU C 148 ? 0.0880 0.0764 0.0940 -0.0038 -0.0161 -0.0108 333  LEU C CD2   
3682 N N     . TYR C 149 ? 0.0972 0.0977 0.0761 -0.0039 -0.0070 0.0071  334  TYR C N     
3683 C CA    . TYR C 149 ? 0.0969 0.1069 0.0875 -0.0032 -0.0055 0.0089  334  TYR C CA    
3684 C C     . TYR C 149 ? 0.0954 0.1189 0.0894 -0.0034 -0.0105 0.0048  334  TYR C C     
3685 O O     . TYR C 149 ? 0.0876 0.1314 0.0887 0.0004  -0.0003 0.0061  334  TYR C O     
3686 C CB    . TYR C 149 ? 0.0936 0.1049 0.0791 -0.0053 -0.0065 -0.0043 334  TYR C CB    
3687 C CG    . TYR C 149 ? 0.0864 0.0838 0.0691 -0.0018 -0.0149 -0.0005 334  TYR C CG    
3688 C CD1   . TYR C 149 ? 0.0875 0.0893 0.0875 -0.0114 0.0043  -0.0047 334  TYR C CD1   
3689 C CD2   . TYR C 149 ? 0.0803 0.1019 0.0644 -0.0046 0.0061  0.0191  334  TYR C CD2   
3690 C CE1   . TYR C 149 ? 0.1026 0.1028 0.0858 -0.0138 0.0012  0.0058  334  TYR C CE1   
3691 C CE2   . TYR C 149 ? 0.1149 0.1059 0.0854 -0.0078 0.0000  0.0080  334  TYR C CE2   
3692 C CZ    . TYR C 149 ? 0.0892 0.0966 0.0814 -0.0042 -0.0041 -0.0090 334  TYR C CZ    
3693 O OH    . TYR C 149 ? 0.1109 0.1008 0.0954 -0.0209 -0.0038 -0.0130 334  TYR C OH    
3694 N N     . ASP C 150 ? 0.1080 0.1120 0.1096 0.0003  -0.0096 0.0096  335  ASP C N     
3695 C CA    . ASP C 150 ? 0.1127 0.1209 0.1137 0.0024  -0.0147 0.0121  335  ASP C CA    
3696 C C     . ASP C 150 ? 0.1059 0.1208 0.1159 -0.0013 -0.0118 0.0123  335  ASP C C     
3697 O O     . ASP C 150 ? 0.1206 0.1249 0.1293 -0.0144 -0.0096 0.0243  335  ASP C O     
3698 C CB    . ASP C 150 ? 0.1203 0.1204 0.1061 -0.0001 -0.0152 0.0088  335  ASP C CB    
3699 C CG    . ASP C 150 ? 0.1487 0.1518 0.1464 0.0092  -0.0116 0.0075  335  ASP C CG    
3700 O OD1   . ASP C 150 ? 0.1527 0.1505 0.1401 0.0065  -0.0167 0.0221  335  ASP C OD1   
3701 O OD2   . ASP C 150 ? 0.2230 0.2173 0.1584 0.0420  -0.0379 0.0092  335  ASP C OD2   
3702 N N     . TYR C 151 ? 0.1016 0.1224 0.1114 -0.0071 -0.0115 0.0124  336  TYR C N     
3703 C CA    . TYR C 151 ? 0.1209 0.1217 0.1187 0.0003  -0.0069 0.0123  336  TYR C CA    
3704 C C     . TYR C 151 ? 0.1247 0.1238 0.1306 0.0046  -0.0165 0.0125  336  TYR C C     
3705 O O     . TYR C 151 ? 0.1376 0.1203 0.1397 -0.0011 -0.0251 0.0199  336  TYR C O     
3706 C CB    . TYR C 151 ? 0.1195 0.1242 0.1124 0.0101  -0.0081 0.0108  336  TYR C CB    
3707 C CG    . TYR C 151 ? 0.1146 0.1136 0.1040 0.0071  -0.0122 0.0062  336  TYR C CG    
3708 C CD1   . TYR C 151 ? 0.1104 0.1047 0.0998 -0.0058 -0.0117 -0.0011 336  TYR C CD1   
3709 C CD2   . TYR C 151 ? 0.0869 0.1038 0.1002 0.0004  0.0054  0.0003  336  TYR C CD2   
3710 C CE1   . TYR C 151 ? 0.0997 0.0945 0.0937 -0.0033 -0.0086 -0.0001 336  TYR C CE1   
3711 C CE2   . TYR C 151 ? 0.0983 0.1193 0.1144 0.0115  -0.0035 0.0082  336  TYR C CE2   
3712 C CZ    . TYR C 151 ? 0.1014 0.0910 0.0974 0.0019  -0.0022 -0.0030 336  TYR C CZ    
3713 O OH    . TYR C 151 ? 0.1014 0.0966 0.0941 -0.0113 -0.0190 0.0007  336  TYR C OH    
3714 N N     . GLY C 152 ? 0.1329 0.1274 0.1396 0.0024  -0.0218 0.0240  337  GLY C N     
3715 C CA    . GLY C 152 ? 0.1500 0.1398 0.1577 0.0095  -0.0159 0.0244  337  GLY C CA    
3716 C C     . GLY C 152 ? 0.1699 0.1577 0.1717 0.0112  -0.0126 0.0187  337  GLY C C     
3717 O O     . GLY C 152 ? 0.2051 0.1827 0.1948 0.0184  -0.0136 0.0321  337  GLY C O     
3718 N N     . ASP C 153 ? 0.1577 0.1552 0.1670 0.0113  -0.0111 0.0195  338  ASP C N     
3719 C CA    . ASP C 153 ? 0.1666 0.1672 0.1772 0.0056  -0.0053 0.0149  338  ASP C CA    
3720 C C     . ASP C 153 ? 0.1727 0.1779 0.1956 0.0067  -0.0042 0.0159  338  ASP C C     
3721 O O     . ASP C 153 ? 0.1521 0.1871 0.2031 0.0000  -0.0026 0.0202  338  ASP C O     
3722 C CB    . ASP C 153 ? 0.1590 0.1564 0.1739 0.0079  -0.0080 0.0056  338  ASP C CB    
3723 C CG    . ASP C 153 ? 0.1622 0.1657 0.1878 0.0014  0.0028  0.0100  338  ASP C CG    
3724 O OD1   . ASP C 153 ? 0.2025 0.1937 0.2103 0.0196  -0.0085 0.0094  338  ASP C OD1   
3725 O OD2   . ASP C 153 ? 0.1616 0.1583 0.2124 0.0079  -0.0002 -0.0032 338  ASP C OD2   
3726 N N     . ARG C 154 ? 0.1947 0.2109 0.2254 0.0082  -0.0125 0.0191  339  ARG C N     
3727 C CA    . ARG C 154 ? 0.2206 0.2407 0.2496 0.0069  -0.0075 0.0135  339  ARG C CA    
3728 C C     . ARG C 154 ? 0.2308 0.2518 0.2645 0.0107  -0.0065 0.0135  339  ARG C C     
3729 O O     . ARG C 154 ? 0.2411 0.2835 0.2895 0.0136  -0.0102 0.0178  339  ARG C O     
3730 C CB    . ARG C 154 ? 0.2299 0.2395 0.2464 0.0065  -0.0122 0.0162  339  ARG C CB    
3731 C CG    . ARG C 154 ? 0.2401 0.2633 0.2502 0.0052  -0.0025 0.0127  339  ARG C CG    
3732 C CD    . ARG C 154 ? 0.2621 0.2522 0.2553 0.0078  -0.0068 0.0200  339  ARG C CD    
3733 N NE    . ARG C 154 ? 0.2528 0.2683 0.2617 0.0214  -0.0035 0.0254  339  ARG C NE    
3734 C CZ    . ARG C 154 ? 0.2298 0.2574 0.2351 0.0180  -0.0155 0.0142  339  ARG C CZ    
3735 N NH1   . ARG C 154 ? 0.1569 0.2047 0.2095 0.0057  -0.0167 0.0225  339  ARG C NH1   
3736 N NH2   . ARG C 154 ? 0.2211 0.2751 0.2453 0.0167  -0.0152 0.0128  339  ARG C NH2   
3737 N N     . SER C 155 ? 0.2443 0.2465 0.2819 0.0152  -0.0013 0.0132  340  SER C N     
3738 C CA    . SER C 155 ? 0.2529 0.2554 0.2924 0.0154  0.0047  0.0112  340  SER C CA    
3739 C C     . SER C 155 ? 0.2531 0.2566 0.2970 0.0143  0.0050  0.0135  340  SER C C     
3740 O O     . SER C 155 ? 0.2506 0.2472 0.3029 0.0126  0.0075  0.0180  340  SER C O     
3741 C CB    . SER C 155 ? 0.2631 0.2651 0.2955 0.0151  0.0023  0.0056  340  SER C CB    
3742 O OG    . SER C 155 ? 0.2775 0.2688 0.2886 0.0040  0.0028  0.0089  340  SER C OG    
3743 N N     . LYS C 156 ? 0.2546 0.2549 0.3021 0.0152  0.0017  0.0114  341  LYS C N     
3744 C CA    . LYS C 156 ? 0.2543 0.2516 0.3015 0.0136  0.0039  0.0069  341  LYS C CA    
3745 C C     . LYS C 156 ? 0.2436 0.2445 0.3009 0.0167  0.0027  0.0029  341  LYS C C     
3746 O O     . LYS C 156 ? 0.2405 0.2390 0.3118 0.0184  0.0083  0.0008  341  LYS C O     
3747 C CB    . LYS C 156 ? 0.2556 0.2542 0.3058 0.0153  0.0037  0.0081  341  LYS C CB    
3748 C CG    . LYS C 156 ? 0.2661 0.2695 0.3106 0.0089  0.0023  0.0056  341  LYS C CG    
3749 C CD    . LYS C 156 ? 0.2752 0.2769 0.3142 0.0139  -0.0006 0.0082  341  LYS C CD    
3750 C CE    . LYS C 156 ? 0.3050 0.3205 0.3342 0.0050  0.0052  0.0030  341  LYS C CE    
3751 N NZ    . LYS C 156 ? 0.3357 0.3586 0.3462 0.0036  -0.0003 -0.0012 341  LYS C NZ    
3752 N N     . ALA C 157 ? 0.2350 0.2357 0.2996 0.0156  0.0020  -0.0013 342  ALA C N     
3753 C CA    . ALA C 157 ? 0.2292 0.2321 0.2924 0.0126  0.0040  -0.0006 342  ALA C CA    
3754 C C     . ALA C 157 ? 0.2250 0.2263 0.2892 0.0118  0.0041  -0.0019 342  ALA C C     
3755 O O     . ALA C 157 ? 0.2162 0.2247 0.3031 0.0204  0.0096  -0.0063 342  ALA C O     
3756 C CB    . ALA C 157 ? 0.2387 0.2383 0.3002 0.0112  0.0009  -0.0046 342  ALA C CB    
3757 N N     . SER C 158 ? 0.2197 0.2186 0.2823 0.0088  0.0064  0.0003  343  SER C N     
3758 C CA    . SER C 158 ? 0.2123 0.2080 0.2706 0.0078  0.0070  0.0010  343  SER C CA    
3759 C C     . SER C 158 ? 0.2128 0.2172 0.2687 0.0083  0.0071  -0.0011 343  SER C C     
3760 O O     . SER C 158 ? 0.1964 0.2066 0.2675 0.0058  0.0107  -0.0021 343  SER C O     
3761 C CB    . SER C 158 ? 0.2010 0.1952 0.2610 0.0069  0.0056  0.0034  343  SER C CB    
3762 O OG    . SER C 158 ? 0.1984 0.1636 0.2631 0.0129  -0.0009 0.0067  343  SER C OG    
3763 N N     . ILE C 159 ? 0.2217 0.2212 0.2703 0.0088  0.0044  -0.0024 344  ILE C N     
3764 C CA    . ILE C 159 ? 0.2388 0.2387 0.2778 0.0044  0.0043  -0.0026 344  ILE C CA    
3765 C C     . ILE C 159 ? 0.2371 0.2360 0.2795 0.0045  0.0055  -0.0025 344  ILE C C     
3766 O O     . ILE C 159 ? 0.2264 0.2351 0.2851 0.0034  0.0081  -0.0007 344  ILE C O     
3767 C CB    . ILE C 159 ? 0.2456 0.2462 0.2788 0.0054  0.0046  -0.0021 344  ILE C CB    
3768 C CG1   . ILE C 159 ? 0.2603 0.2669 0.2780 0.0089  0.0045  0.0004  344  ILE C CG1   
3769 C CG2   . ILE C 159 ? 0.2729 0.2736 0.2980 -0.0038 0.0000  -0.0031 344  ILE C CG2   
3770 C CD1   . ILE C 159 ? 0.2691 0.2643 0.2816 0.0045  0.0028  -0.0022 344  ILE C CD1   
3771 N N     . GLU C 160 ? 0.2438 0.2428 0.2894 0.0032  0.0067  -0.0061 345  GLU C N     
3772 C CA    . GLU C 160 ? 0.2558 0.2558 0.2921 0.0038  0.0060  -0.0062 345  GLU C CA    
3773 C C     . GLU C 160 ? 0.2389 0.2415 0.2851 0.0074  0.0073  -0.0062 345  GLU C C     
3774 O O     . GLU C 160 ? 0.2288 0.2420 0.2915 0.0095  0.0094  -0.0049 345  GLU C O     
3775 C CB    . GLU C 160 ? 0.2674 0.2644 0.3050 0.0061  0.0033  -0.0052 345  GLU C CB    
3776 C CG    . GLU C 160 ? 0.3333 0.3288 0.3303 0.0077  0.0048  -0.0062 345  GLU C CG    
3777 C CD    . GLU C 160 ? 0.3952 0.3969 0.4306 -0.0006 0.0035  0.0048  345  GLU C CD    
3778 O OE1   . GLU C 160 ? 0.4309 0.4272 0.4021 -0.0024 -0.0132 -0.0198 345  GLU C OE1   
3779 O OE2   . GLU C 160 ? 0.4285 0.4367 0.3901 0.0014  0.0144  -0.0060 345  GLU C OE2   
3780 N N     . ALA C 161 ? 0.2299 0.2354 0.2707 0.0089  0.0096  -0.0145 346  ALA C N     
3781 C CA    . ALA C 161 ? 0.2140 0.2171 0.2591 0.0099  0.0107  -0.0129 346  ALA C CA    
3782 C C     . ALA C 161 ? 0.2053 0.2122 0.2465 0.0084  0.0094  -0.0106 346  ALA C C     
3783 O O     . ALA C 161 ? 0.2038 0.2080 0.2489 0.0129  0.0134  -0.0145 346  ALA C O     
3784 C CB    . ALA C 161 ? 0.2239 0.2318 0.2697 0.0068  0.0091  -0.0133 346  ALA C CB    
3785 N N     . HIS C 162 ? 0.1893 0.1956 0.2341 0.0078  0.0120  -0.0087 347  HIS C N     
3786 C CA    . HIS C 162 ? 0.1739 0.1833 0.2120 0.0031  0.0120  -0.0107 347  HIS C CA    
3787 C C     . HIS C 162 ? 0.1687 0.1727 0.2000 0.0045  0.0104  -0.0064 347  HIS C C     
3788 O O     . HIS C 162 ? 0.1588 0.1734 0.2024 0.0027  0.0127  -0.0074 347  HIS C O     
3789 C CB    . HIS C 162 ? 0.1701 0.1749 0.2026 0.0038  0.0152  -0.0144 347  HIS C CB    
3790 C CG    . HIS C 162 ? 0.1717 0.1853 0.2057 0.0035  0.0146  -0.0144 347  HIS C CG    
3791 N ND1   . HIS C 162 ? 0.1872 0.2093 0.2230 0.0045  0.0097  -0.0174 347  HIS C ND1   
3792 C CD2   . HIS C 162 ? 0.1933 0.1829 0.2076 0.0010  0.0100  -0.0006 347  HIS C CD2   
3793 C CE1   . HIS C 162 ? 0.1904 0.2111 0.2102 -0.0006 0.0111  -0.0122 347  HIS C CE1   
3794 N NE2   . HIS C 162 ? 0.1794 0.2095 0.2172 0.0132  0.0106  -0.0121 347  HIS C NE2   
3795 N N     . PRO C 163 ? 0.1721 0.1801 0.1994 0.0027  0.0140  -0.0056 348  PRO C N     
3796 C CA    . PRO C 163 ? 0.1625 0.1776 0.1976 -0.0002 0.0128  -0.0040 348  PRO C CA    
3797 C C     . PRO C 163 ? 0.1478 0.1667 0.1814 -0.0007 0.0097  -0.0023 348  PRO C C     
3798 O O     . PRO C 163 ? 0.1406 0.1871 0.1851 0.0055  0.0037  0.0017  348  PRO C O     
3799 C CB    . PRO C 163 ? 0.1629 0.1819 0.1960 -0.0028 0.0172  0.0013  348  PRO C CB    
3800 C CG    . PRO C 163 ? 0.1785 0.1991 0.2098 -0.0078 0.0130  -0.0013 348  PRO C CG    
3801 C CD    . PRO C 163 ? 0.1775 0.1899 0.2020 0.0000  0.0118  -0.0012 348  PRO C CD    
3802 N N     . TRP C 164 ? 0.1394 0.1599 0.1847 0.0001  0.0105  -0.0038 349  TRP C N     
3803 C CA    . TRP C 164 ? 0.1396 0.1524 0.1650 0.0023  0.0071  -0.0031 349  TRP C CA    
3804 C C     . TRP C 164 ? 0.1365 0.1475 0.1608 0.0033  0.0027  -0.0015 349  TRP C C     
3805 O O     . TRP C 164 ? 0.1457 0.1447 0.1513 0.0034  0.0046  -0.0045 349  TRP C O     
3806 C CB    . TRP C 164 ? 0.1356 0.1470 0.1613 0.0028  0.0024  -0.0017 349  TRP C CB    
3807 C CG    . TRP C 164 ? 0.1294 0.1347 0.1578 -0.0024 0.0061  0.0027  349  TRP C CG    
3808 C CD1   . TRP C 164 ? 0.1371 0.1468 0.1666 0.0044  0.0039  0.0008  349  TRP C CD1   
3809 C CD2   . TRP C 164 ? 0.1243 0.1304 0.1511 -0.0002 0.0113  0.0065  349  TRP C CD2   
3810 N NE1   . TRP C 164 ? 0.1477 0.1285 0.1631 -0.0038 0.0125  -0.0017 349  TRP C NE1   
3811 C CE2   . TRP C 164 ? 0.1299 0.1238 0.1565 0.0010  0.0097  0.0055  349  TRP C CE2   
3812 C CE3   . TRP C 164 ? 0.1255 0.1221 0.1384 0.0102  0.0032  0.0078  349  TRP C CE3   
3813 C CZ2   . TRP C 164 ? 0.1340 0.1450 0.1524 0.0001  -0.0028 -0.0027 349  TRP C CZ2   
3814 C CZ3   . TRP C 164 ? 0.1168 0.1279 0.1526 0.0087  -0.0055 0.0066  349  TRP C CZ3   
3815 C CH2   . TRP C 164 ? 0.1378 0.1358 0.1422 0.0040  -0.0027 0.0114  349  TRP C CH2   
3816 N N     . LEU C 165 ? 0.1337 0.1517 0.1622 0.0040  0.0017  -0.0043 350  LEU C N     
3817 C CA    . LEU C 165 ? 0.1415 0.1455 0.1680 0.0039  -0.0034 -0.0032 350  LEU C CA    
3818 C C     . LEU C 165 ? 0.1501 0.1557 0.1762 0.0038  -0.0028 -0.0029 350  LEU C C     
3819 O O     . LEU C 165 ? 0.1573 0.1539 0.1814 -0.0024 -0.0030 0.0047  350  LEU C O     
3820 C CB    . LEU C 165 ? 0.1274 0.1352 0.1627 0.0039  -0.0106 -0.0028 350  LEU C CB    
3821 C CG    . LEU C 165 ? 0.1204 0.1287 0.1462 0.0119  -0.0003 -0.0183 350  LEU C CG    
3822 C CD1   . LEU C 165 ? 0.1534 0.1011 0.1703 0.0017  -0.0022 0.0041  350  LEU C CD1   
3823 C CD2   . LEU C 165 ? 0.1127 0.1269 0.1584 0.0244  0.0009  -0.0055 350  LEU C CD2   
3824 N N     . LYS C 166 ? 0.1419 0.1678 0.1833 0.0000  -0.0065 -0.0039 351  LYS C N     
3825 C CA    . LYS C 166 ? 0.1660 0.1935 0.1977 0.0017  -0.0066 -0.0055 351  LYS C CA    
3826 C C     . LYS C 166 ? 0.1586 0.1970 0.1937 0.0021  -0.0068 -0.0057 351  LYS C C     
3827 O O     . LYS C 166 ? 0.1719 0.2113 0.1903 -0.0027 -0.0038 -0.0076 351  LYS C O     
3828 C CB    . LYS C 166 ? 0.1678 0.2008 0.2056 0.0040  -0.0059 -0.0085 351  LYS C CB    
3829 C CG    . LYS C 166 ? 0.2381 0.2326 0.2535 0.0122  -0.0011 -0.0033 351  LYS C CG    
3830 C CD    . LYS C 166 ? 0.2676 0.3044 0.3162 0.0093  0.0046  -0.0038 351  LYS C CD    
3831 C CE    . LYS C 166 ? 0.3453 0.3375 0.3461 0.0066  0.0009  0.0071  351  LYS C CE    
3832 N NZ    . LYS C 166 ? 0.3677 0.4067 0.3919 0.0018  -0.0034 -0.0039 351  LYS C NZ    
3833 N N     . HIS C 167 ? 0.1372 0.1755 0.1900 0.0009  -0.0009 -0.0055 352  HIS C N     
3834 C CA    . HIS C 167 ? 0.1383 0.1789 0.1946 -0.0012 -0.0071 -0.0025 352  HIS C CA    
3835 C C     . HIS C 167 ? 0.1099 0.1897 0.1810 -0.0191 -0.0109 0.0128  352  HIS C C     
3836 O O     . HIS C 167 ? 0.1281 0.1602 0.1738 -0.0140 -0.0031 -0.0043 352  HIS C O     
3837 C CB    . HIS C 167 ? 0.1557 0.1959 0.2064 -0.0048 -0.0034 -0.0043 352  HIS C CB    
3838 C CG    . HIS C 167 ? 0.1917 0.2310 0.2481 0.0060  -0.0029 0.0007  352  HIS C CG    
3839 N ND1   . HIS C 167 ? 0.2146 0.2758 0.2766 0.0081  -0.0005 0.0038  352  HIS C ND1   
3840 C CD2   . HIS C 167 ? 0.2262 0.2544 0.2642 -0.0017 0.0065  -0.0024 352  HIS C CD2   
3841 C CE1   . HIS C 167 ? 0.2313 0.2892 0.2894 0.0064  0.0023  0.0045  352  HIS C CE1   
3842 N NE2   . HIS C 167 ? 0.2270 0.2646 0.2772 0.0067  0.0056  0.0069  352  HIS C NE2   
3843 N N     . ARG D 7   ? 0.3591 0.3579 0.3677 0.0091  0.0006  0.0037  192  ARG D N     
3844 C CA    . ARG D 7   ? 0.3557 0.3499 0.3605 0.0082  0.0014  0.0016  192  ARG D CA    
3845 C C     . ARG D 7   ? 0.3520 0.3474 0.3565 0.0088  -0.0006 0.0024  192  ARG D C     
3846 O O     . ARG D 7   ? 0.3475 0.3486 0.3570 0.0143  0.0000  0.0037  192  ARG D O     
3847 C CB    . ARG D 7   ? 0.3603 0.3531 0.3639 0.0080  0.0022  0.0010  192  ARG D CB    
3848 N N     . LYS D 8   ? 0.3477 0.3425 0.3479 0.0096  -0.0006 0.0006  193  LYS D N     
3849 C CA    . LYS D 8   ? 0.3404 0.3326 0.3382 0.0089  -0.0003 0.0023  193  LYS D CA    
3850 C C     . LYS D 8   ? 0.3358 0.3279 0.3371 0.0088  0.0014  0.0025  193  LYS D C     
3851 O O     . LYS D 8   ? 0.3330 0.3261 0.3396 0.0113  0.0001  0.0027  193  LYS D O     
3852 C CB    . LYS D 8   ? 0.3376 0.3320 0.3365 0.0087  0.0043  0.0030  193  LYS D CB    
3853 C CG    . LYS D 8   ? 0.3236 0.3209 0.3219 0.0089  0.0031  -0.0014 193  LYS D CG    
3854 C CD    . LYS D 8   ? 0.3166 0.3074 0.3090 -0.0001 0.0068  -0.0019 193  LYS D CD    
3855 C CE    . LYS D 8   ? 0.2841 0.2850 0.2915 -0.0105 0.0031  -0.0066 193  LYS D CE    
3856 N NZ    . LYS D 8   ? 0.2727 0.2604 0.2792 -0.0006 0.0102  -0.0141 193  LYS D NZ    
3857 N N     . SER D 9   ? 0.3297 0.3199 0.3301 0.0092  -0.0004 0.0033  194  SER D N     
3858 C CA    . SER D 9   ? 0.3305 0.3173 0.3294 0.0068  0.0004  0.0057  194  SER D CA    
3859 C C     . SER D 9   ? 0.3302 0.3226 0.3269 0.0037  0.0016  0.0032  194  SER D C     
3860 O O     . SER D 9   ? 0.3150 0.3071 0.3199 0.0035  0.0030  0.0026  194  SER D O     
3861 C CB    . SER D 9   ? 0.3308 0.3140 0.3332 0.0074  -0.0016 0.0050  194  SER D CB    
3862 O OG    . SER D 9   ? 0.3401 0.3195 0.3465 0.0062  0.0005  0.0100  194  SER D OG    
3863 N N     . LYS D 10  ? 0.3347 0.3254 0.3283 0.0013  0.0023  0.0037  195  LYS D N     
3864 C CA    . LYS D 10  ? 0.3433 0.3333 0.3369 0.0006  0.0002  0.0018  195  LYS D CA    
3865 C C     . LYS D 10  ? 0.3307 0.3230 0.3280 0.0025  -0.0016 -0.0010 195  LYS D C     
3866 O O     . LYS D 10  ? 0.3331 0.3140 0.3193 0.0050  -0.0030 -0.0015 195  LYS D O     
3867 C CB    . LYS D 10  ? 0.3482 0.3386 0.3390 0.0007  0.0002  0.0028  195  LYS D CB    
3868 C CG    . LYS D 10  ? 0.3643 0.3618 0.3523 0.0015  0.0050  0.0004  195  LYS D CG    
3869 C CD    . LYS D 10  ? 0.3642 0.3617 0.3541 -0.0007 0.0022  0.0046  195  LYS D CD    
3870 C CE    . LYS D 10  ? 0.3892 0.4007 0.3941 0.0038  0.0032  -0.0056 195  LYS D CE    
3871 N NZ    . LYS D 10  ? 0.3937 0.4202 0.4170 0.0016  0.0009  -0.0048 195  LYS D NZ    
3872 N N     . ALA D 11  ? 0.3264 0.3119 0.3248 0.0019  -0.0049 0.0005  196  ALA D N     
3873 C CA    . ALA D 11  ? 0.3147 0.3044 0.3148 0.0037  -0.0072 0.0001  196  ALA D CA    
3874 C C     . ALA D 11  ? 0.3062 0.2971 0.3076 0.0049  -0.0073 -0.0013 196  ALA D C     
3875 O O     . ALA D 11  ? 0.3054 0.2888 0.3033 0.0102  -0.0134 -0.0019 196  ALA D O     
3876 C CB    . ALA D 11  ? 0.3150 0.3119 0.3193 0.0033  -0.0078 -0.0008 196  ALA D CB    
3877 N N     . GLU D 12  ? 0.2908 0.2847 0.2973 0.0053  -0.0071 -0.0001 197  GLU D N     
3878 C CA    . GLU D 12  ? 0.2808 0.2817 0.2935 0.0055  -0.0036 -0.0018 197  GLU D CA    
3879 C C     . GLU D 12  ? 0.2706 0.2687 0.2827 0.0063  -0.0020 -0.0037 197  GLU D C     
3880 O O     . GLU D 12  ? 0.2550 0.2607 0.2830 0.0107  -0.0048 -0.0095 197  GLU D O     
3881 C CB    . GLU D 12  ? 0.2888 0.2852 0.2981 0.0060  -0.0026 0.0001  197  GLU D CB    
3882 C CG    . GLU D 12  ? 0.3130 0.3294 0.3296 0.0013  0.0000  0.0069  197  GLU D CG    
3883 C CD    . GLU D 12  ? 0.3565 0.3637 0.3780 0.0102  0.0011  -0.0024 197  GLU D CD    
3884 O OE1   . GLU D 12  ? 0.3939 0.4026 0.3912 0.0143  -0.0070 0.0051  197  GLU D OE1   
3885 O OE2   . GLU D 12  ? 0.3730 0.3776 0.3722 0.0124  0.0042  0.0004  197  GLU D OE2   
3886 N N     . LEU D 13  ? 0.2552 0.2535 0.2738 0.0093  -0.0024 -0.0103 198  LEU D N     
3887 C CA    . LEU D 13  ? 0.2514 0.2387 0.2586 0.0156  -0.0052 -0.0088 198  LEU D CA    
3888 C C     . LEU D 13  ? 0.2485 0.2332 0.2496 0.0137  -0.0052 -0.0106 198  LEU D C     
3889 O O     . LEU D 13  ? 0.2348 0.2124 0.2279 0.0187  -0.0096 -0.0131 198  LEU D O     
3890 C CB    . LEU D 13  ? 0.2532 0.2434 0.2640 0.0115  -0.0047 -0.0106 198  LEU D CB    
3891 C CG    . LEU D 13  ? 0.2583 0.2410 0.2525 0.0170  -0.0009 -0.0077 198  LEU D CG    
3892 C CD1   . LEU D 13  ? 0.2688 0.2519 0.2800 0.0070  -0.0037 -0.0073 198  LEU D CD1   
3893 C CD2   . LEU D 13  ? 0.2585 0.2259 0.2562 0.0115  -0.0055 -0.0069 198  LEU D CD2   
3894 N N     . GLN D 14  ? 0.2461 0.2318 0.2464 0.0170  -0.0101 -0.0068 199  GLN D N     
3895 C CA    . GLN D 14  ? 0.2442 0.2311 0.2429 0.0135  -0.0091 -0.0051 199  GLN D CA    
3896 C C     . GLN D 14  ? 0.2328 0.2271 0.2381 0.0119  -0.0081 -0.0042 199  GLN D C     
3897 O O     . GLN D 14  ? 0.2126 0.2158 0.2289 0.0185  -0.0119 -0.0032 199  GLN D O     
3898 C CB    . GLN D 14  ? 0.2539 0.2400 0.2488 0.0137  -0.0083 -0.0090 199  GLN D CB    
3899 C CG    . GLN D 14  ? 0.2785 0.2719 0.2698 0.0066  -0.0035 -0.0001 199  GLN D CG    
3900 C CD    . GLN D 14  ? 0.3000 0.3081 0.3088 0.0081  0.0000  -0.0007 199  GLN D CD    
3901 O OE1   . GLN D 14  ? 0.3516 0.3395 0.3327 -0.0014 0.0005  0.0042  199  GLN D OE1   
3902 N NE2   . GLN D 14  ? 0.3295 0.3121 0.3012 0.0091  0.0079  0.0011  199  GLN D NE2   
3903 N N     . SER D 15  ? 0.2218 0.2256 0.2326 0.0132  -0.0119 -0.0095 200  SER D N     
3904 C CA    . SER D 15  ? 0.2207 0.2397 0.2407 0.0135  -0.0095 -0.0059 200  SER D CA    
3905 C C     . SER D 15  ? 0.2230 0.2386 0.2393 0.0141  -0.0078 -0.0126 200  SER D C     
3906 O O     . SER D 15  ? 0.2058 0.2421 0.2358 0.0210  -0.0161 -0.0171 200  SER D O     
3907 C CB    . SER D 15  ? 0.2294 0.2495 0.2534 0.0102  -0.0115 -0.0081 200  SER D CB    
3908 O OG    . SER D 15  ? 0.2728 0.2969 0.2825 0.0002  -0.0012 -0.0105 200  SER D OG    
3909 N N     . GLU D 16  ? 0.2212 0.2396 0.2320 0.0195  -0.0100 -0.0170 201  GLU D N     
3910 C CA    . GLU D 16  ? 0.2228 0.2339 0.2309 0.0203  -0.0056 -0.0158 201  GLU D CA    
3911 C C     . GLU D 16  ? 0.2116 0.2150 0.2161 0.0189  -0.0039 -0.0164 201  GLU D C     
3912 O O     . GLU D 16  ? 0.2100 0.2257 0.2147 0.0292  -0.0013 -0.0198 201  GLU D O     
3913 C CB    . GLU D 16  ? 0.2396 0.2424 0.2418 0.0176  -0.0045 -0.0128 201  GLU D CB    
3914 C CG    . GLU D 16  ? 0.2573 0.2686 0.2705 0.0133  0.0010  -0.0105 201  GLU D CG    
3915 C CD    . GLU D 16  ? 0.2960 0.2911 0.3118 0.0114  -0.0021 -0.0207 201  GLU D CD    
3916 O OE1   . GLU D 16  ? 0.3146 0.3376 0.3370 0.0151  -0.0013 -0.0328 201  GLU D OE1   
3917 O OE2   . GLU D 16  ? 0.3116 0.3316 0.3436 0.0095  0.0060  -0.0123 201  GLU D OE2   
3918 N N     . GLU D 17  ? 0.2044 0.1998 0.2114 0.0197  -0.0051 -0.0147 202  GLU D N     
3919 C CA    . GLU D 17  ? 0.1999 0.1958 0.2056 0.0167  -0.0052 -0.0148 202  GLU D CA    
3920 C C     . GLU D 17  ? 0.1972 0.1910 0.2024 0.0124  -0.0097 -0.0148 202  GLU D C     
3921 O O     . GLU D 17  ? 0.1845 0.1920 0.2016 0.0180  -0.0109 -0.0190 202  GLU D O     
3922 C CB    . GLU D 17  ? 0.2106 0.1989 0.2129 0.0141  -0.0019 -0.0165 202  GLU D CB    
3923 C CG    . GLU D 17  ? 0.2168 0.2305 0.2300 0.0080  -0.0072 -0.0045 202  GLU D CG    
3924 C CD    . GLU D 17  ? 0.2451 0.2426 0.2539 0.0035  -0.0120 -0.0039 202  GLU D CD    
3925 O OE1   . GLU D 17  ? 0.2733 0.2730 0.2539 0.0093  -0.0105 -0.0002 202  GLU D OE1   
3926 O OE2   . GLU D 17  ? 0.2529 0.2662 0.2687 0.0063  -0.0137 0.0094  202  GLU D OE2   
3927 N N     . ARG D 18  ? 0.1792 0.1905 0.1963 0.0151  -0.0097 -0.0176 203  ARG D N     
3928 C CA    . ARG D 18  ? 0.1766 0.1854 0.1943 0.0093  -0.0096 -0.0129 203  ARG D CA    
3929 C C     . ARG D 18  ? 0.1674 0.1884 0.1860 0.0091  -0.0084 -0.0168 203  ARG D C     
3930 O O     . ARG D 18  ? 0.1615 0.1900 0.1753 0.0024  -0.0176 -0.0135 203  ARG D O     
3931 C CB    . ARG D 18  ? 0.1777 0.1841 0.1943 0.0119  -0.0119 -0.0156 203  ARG D CB    
3932 C CG    . ARG D 18  ? 0.1976 0.1921 0.2027 0.0020  -0.0083 -0.0103 203  ARG D CG    
3933 C CD    . ARG D 18  ? 0.1789 0.1959 0.1935 0.0007  -0.0075 -0.0087 203  ARG D CD    
3934 N NE    . ARG D 18  ? 0.1915 0.2261 0.1767 0.0040  -0.0016 -0.0031 203  ARG D NE    
3935 C CZ    . ARG D 18  ? 0.1835 0.2173 0.1899 0.0006  -0.0034 0.0000  203  ARG D CZ    
3936 N NH1   . ARG D 18  ? 0.1889 0.2157 0.2205 -0.0088 -0.0050 0.0028  203  ARG D NH1   
3937 N NH2   . ARG D 18  ? 0.2214 0.2464 0.2317 -0.0053 0.0137  0.0122  203  ARG D NH2   
3938 N N     . LYS D 19  ? 0.1729 0.1988 0.1851 0.0051  -0.0017 -0.0135 204  LYS D N     
3939 C CA    . LYS D 19  ? 0.1787 0.2141 0.1895 0.0115  -0.0035 -0.0105 204  LYS D CA    
3940 C C     . LYS D 19  ? 0.1777 0.2109 0.1856 0.0127  -0.0002 -0.0123 204  LYS D C     
3941 O O     . LYS D 19  ? 0.1782 0.2248 0.1786 0.0106  0.0077  -0.0164 204  LYS D O     
3942 C CB    . LYS D 19  ? 0.1952 0.2204 0.2047 0.0140  0.0009  -0.0125 204  LYS D CB    
3943 C CG    . LYS D 19  ? 0.2162 0.2496 0.2355 0.0120  0.0046  0.0016  204  LYS D CG    
3944 C CD    . LYS D 19  ? 0.2212 0.2638 0.2626 0.0058  0.0083  -0.0063 204  LYS D CD    
3945 C CE    . LYS D 19  ? 0.2639 0.2944 0.2731 0.0000  0.0045  0.0021  204  LYS D CE    
3946 N NZ    . LYS D 19  ? 0.2778 0.2977 0.3011 0.0113  0.0000  -0.0066 204  LYS D NZ    
3947 N N     . ARG D 20  ? 0.1723 0.2061 0.1798 0.0151  -0.0014 -0.0132 205  ARG D N     
3948 C CA    . ARG D 20  ? 0.1738 0.1992 0.1864 0.0208  -0.0031 -0.0117 205  ARG D CA    
3949 C C     . ARG D 20  ? 0.1646 0.1896 0.1749 0.0184  -0.0006 -0.0084 205  ARG D C     
3950 O O     . ARG D 20  ? 0.1812 0.1981 0.1739 0.0227  -0.0005 -0.0140 205  ARG D O     
3951 C CB    . ARG D 20  ? 0.1793 0.2027 0.1817 0.0168  -0.0001 -0.0108 205  ARG D CB    
3952 C CG    . ARG D 20  ? 0.1856 0.2112 0.2043 0.0216  0.0041  -0.0092 205  ARG D CG    
3953 C CD    . ARG D 20  ? 0.1920 0.2097 0.2041 0.0184  -0.0058 -0.0118 205  ARG D CD    
3954 N NE    . ARG D 20  ? 0.2096 0.2158 0.2344 0.0127  -0.0088 -0.0051 205  ARG D NE    
3955 C CZ    . ARG D 20  ? 0.2249 0.2066 0.2302 0.0085  -0.0043 -0.0112 205  ARG D CZ    
3956 N NH1   . ARG D 20  ? 0.2326 0.2561 0.2517 0.0069  -0.0098 -0.0146 205  ARG D NH1   
3957 N NH2   . ARG D 20  ? 0.2285 0.2134 0.2431 0.0147  -0.0117 -0.0057 205  ARG D NH2   
3958 N N     . ILE D 21  ? 0.1558 0.1817 0.1733 0.0182  -0.0035 -0.0097 206  ILE D N     
3959 C CA    . ILE D 21  ? 0.1442 0.1771 0.1764 0.0152  -0.0014 -0.0059 206  ILE D CA    
3960 C C     . ILE D 21  ? 0.1432 0.1784 0.1739 0.0122  -0.0061 -0.0064 206  ILE D C     
3961 O O     . ILE D 21  ? 0.1322 0.1840 0.1693 0.0127  -0.0025 -0.0035 206  ILE D O     
3962 C CB    . ILE D 21  ? 0.1555 0.1759 0.1749 0.0120  0.0005  -0.0068 206  ILE D CB    
3963 C CG1   . ILE D 21  ? 0.1766 0.1835 0.1982 0.0116  -0.0007 -0.0050 206  ILE D CG1   
3964 C CG2   . ILE D 21  ? 0.1578 0.1906 0.1958 0.0158  0.0015  -0.0071 206  ILE D CG2   
3965 C CD1   . ILE D 21  ? 0.1892 0.2138 0.2108 0.0022  0.0007  0.0073  206  ILE D CD1   
3966 N N     . ASP D 22  ? 0.1429 0.1911 0.1845 0.0103  -0.0095 -0.0088 207  ASP D N     
3967 C CA    . ASP D 22  ? 0.1490 0.1935 0.1997 0.0051  -0.0089 -0.0055 207  ASP D CA    
3968 C C     . ASP D 22  ? 0.1433 0.1915 0.2023 -0.0001 -0.0036 -0.0077 207  ASP D C     
3969 O O     . ASP D 22  ? 0.1405 0.1966 0.2348 0.0018  0.0037  -0.0090 207  ASP D O     
3970 C CB    . ASP D 22  ? 0.1638 0.2029 0.2035 0.0105  -0.0112 -0.0111 207  ASP D CB    
3971 C CG    . ASP D 22  ? 0.1661 0.2090 0.2040 0.0008  -0.0055 -0.0092 207  ASP D CG    
3972 O OD1   . ASP D 22  ? 0.1948 0.2378 0.2282 0.0041  -0.0082 -0.0045 207  ASP D OD1   
3973 O OD2   . ASP D 22  ? 0.2141 0.2460 0.2228 0.0030  -0.0124 0.0055  207  ASP D OD2   
3974 N N     . GLU D 23  ? 0.1525 0.2005 0.2080 -0.0006 -0.0050 -0.0059 208  GLU D N     
3975 C CA    . GLU D 23  ? 0.1640 0.1981 0.2067 -0.0044 0.0083  -0.0039 208  GLU D CA    
3976 C C     . GLU D 23  ? 0.1644 0.1897 0.2003 -0.0089 0.0076  -0.0005 208  GLU D C     
3977 O O     . GLU D 23  ? 0.1714 0.1955 0.2073 -0.0092 0.0206  -0.0020 208  GLU D O     
3978 C CB    . GLU D 23  ? 0.1700 0.2044 0.2172 -0.0018 0.0058  -0.0100 208  GLU D CB    
3979 C CG    . GLU D 23  ? 0.1789 0.2257 0.2206 0.0054  0.0054  -0.0003 208  GLU D CG    
3980 C CD    . GLU D 23  ? 0.1922 0.2267 0.2264 0.0034  0.0096  -0.0023 208  GLU D CD    
3981 O OE1   . GLU D 23  ? 0.2348 0.2668 0.2367 -0.0086 0.0014  -0.0125 208  GLU D OE1   
3982 O OE2   . GLU D 23  ? 0.2119 0.2855 0.2377 -0.0022 0.0016  0.0077  208  GLU D OE2   
3983 N N     . LEU D 24  ? 0.1422 0.1798 0.1867 -0.0102 0.0102  0.0074  209  LEU D N     
3984 C CA    . LEU D 24  ? 0.1418 0.1643 0.1771 -0.0051 0.0070  0.0030  209  LEU D CA    
3985 C C     . LEU D 24  ? 0.1341 0.1602 0.1696 -0.0092 0.0063  0.0028  209  LEU D C     
3986 O O     . LEU D 24  ? 0.1386 0.1680 0.1685 -0.0030 0.0056  0.0031  209  LEU D O     
3987 C CB    . LEU D 24  ? 0.1387 0.1596 0.1765 -0.0020 0.0076  0.0036  209  LEU D CB    
3988 C CG    . LEU D 24  ? 0.1703 0.1717 0.1522 -0.0038 0.0042  -0.0025 209  LEU D CG    
3989 C CD1   . LEU D 24  ? 0.1545 0.1703 0.1765 -0.0025 0.0012  -0.0031 209  LEU D CD1   
3990 C CD2   . LEU D 24  ? 0.2128 0.2081 0.1650 0.0042  -0.0022 0.0063  209  LEU D CD2   
3991 N N     . ILE D 25  ? 0.1322 0.1586 0.1695 -0.0060 0.0028  -0.0022 210  ILE D N     
3992 C CA    . ILE D 25  ? 0.1394 0.1669 0.1697 -0.0039 0.0059  0.0002  210  ILE D CA    
3993 C C     . ILE D 25  ? 0.1446 0.1707 0.1842 -0.0050 0.0078  -0.0009 210  ILE D C     
3994 O O     . ILE D 25  ? 0.1508 0.1736 0.2046 -0.0137 0.0123  0.0029  210  ILE D O     
3995 C CB    . ILE D 25  ? 0.1274 0.1554 0.1628 -0.0075 0.0012  -0.0020 210  ILE D CB    
3996 C CG1   . ILE D 25  ? 0.1377 0.1614 0.1524 -0.0088 0.0036  0.0127  210  ILE D CG1   
3997 C CG2   . ILE D 25  ? 0.1440 0.1672 0.1740 -0.0046 0.0088  -0.0083 210  ILE D CG2   
3998 C CD1   . ILE D 25  ? 0.1397 0.1941 0.1563 -0.0033 0.0025  0.0018  210  ILE D CD1   
3999 N N     . GLU D 26  ? 0.1531 0.1814 0.1904 -0.0073 0.0083  -0.0014 211  GLU D N     
4000 C CA    . GLU D 26  ? 0.1723 0.2002 0.2079 -0.0085 0.0057  0.0016  211  GLU D CA    
4001 C C     . GLU D 26  ? 0.1627 0.1931 0.2060 -0.0076 0.0096  0.0049  211  GLU D C     
4002 O O     . GLU D 26  ? 0.1585 0.1912 0.2196 -0.0113 0.0231  0.0070  211  GLU D O     
4003 C CB    . GLU D 26  ? 0.1772 0.2138 0.2234 -0.0060 0.0013  0.0041  211  GLU D CB    
4004 C CG    . GLU D 26  ? 0.2705 0.2840 0.2714 0.0056  -0.0010 -0.0100 211  GLU D CG    
4005 C CD    . GLU D 26  ? 0.3108 0.3515 0.3456 -0.0045 -0.0036 -0.0031 211  GLU D CD    
4006 O OE1   . GLU D 26  ? 0.3494 0.3847 0.3660 0.0137  0.0037  -0.0103 211  GLU D OE1   
4007 O OE2   . GLU D 26  ? 0.3650 0.3721 0.3728 -0.0022 -0.0053 -0.0133 211  GLU D OE2   
4008 N N     . SER D 27  ? 0.1556 0.1958 0.1982 -0.0099 0.0147  0.0052  212  SER D N     
4009 C CA    . SER D 27  ? 0.1689 0.2009 0.2044 -0.0125 0.0085  0.0048  212  SER D CA    
4010 C C     . SER D 27  ? 0.1668 0.1955 0.2053 -0.0127 0.0128  0.0063  212  SER D C     
4011 O O     . SER D 27  ? 0.1678 0.2042 0.2200 -0.0124 0.0151  0.0112  212  SER D O     
4012 C CB    . SER D 27  ? 0.1750 0.2009 0.2074 -0.0178 0.0097  0.0039  212  SER D CB    
4013 O OG    . SER D 27  ? 0.2031 0.2320 0.2209 -0.0366 0.0119  0.0038  212  SER D OG    
4014 N N     . GLY D 28  ? 0.1627 0.1876 0.2009 -0.0151 0.0136  0.0053  213  GLY D N     
4015 C CA    . GLY D 28  ? 0.1710 0.1882 0.1892 -0.0056 0.0068  -0.0010 213  GLY D CA    
4016 C C     . GLY D 28  ? 0.1742 0.1784 0.1851 -0.0115 0.0108  -0.0032 213  GLY D C     
4017 O O     . GLY D 28  ? 0.1925 0.1841 0.1941 -0.0096 0.0099  -0.0109 213  GLY D O     
4018 N N     . LYS D 29  ? 0.1736 0.1928 0.1912 -0.0099 0.0154  -0.0026 214  LYS D N     
4019 C CA    . LYS D 29  ? 0.1744 0.1948 0.1927 -0.0114 0.0137  -0.0034 214  LYS D CA    
4020 C C     . LYS D 29  ? 0.1680 0.1869 0.1806 -0.0041 0.0125  -0.0010 214  LYS D C     
4021 O O     . LYS D 29  ? 0.1774 0.2058 0.1813 -0.0118 0.0163  0.0033  214  LYS D O     
4022 C CB    . LYS D 29  ? 0.1897 0.2060 0.2019 -0.0081 0.0151  -0.0034 214  LYS D CB    
4023 C CG    . LYS D 29  ? 0.2157 0.2249 0.2415 -0.0169 0.0084  -0.0069 214  LYS D CG    
4024 C CD    . LYS D 29  ? 0.3013 0.2736 0.3127 0.0004  0.0024  0.0041  214  LYS D CD    
4025 C CE    . LYS D 29  ? 0.3439 0.3144 0.3280 0.0019  0.0006  0.0014  214  LYS D CE    
4026 N NZ    . LYS D 29  ? 0.3661 0.3229 0.3674 0.0029  0.0016  0.0072  214  LYS D NZ    
4027 N N     . GLU D 30  ? 0.1460 0.1614 0.1653 -0.0050 0.0212  0.0019  215  GLU D N     
4028 C CA    . GLU D 30  ? 0.1380 0.1613 0.1632 0.0034  0.0126  -0.0041 215  GLU D CA    
4029 C C     . GLU D 30  ? 0.1540 0.1705 0.1681 0.0015  0.0098  -0.0040 215  GLU D C     
4030 O O     . GLU D 30  ? 0.1590 0.1784 0.1600 0.0000  0.0011  -0.0125 215  GLU D O     
4031 C CB    . GLU D 30  ? 0.1409 0.1409 0.1612 0.0061  0.0170  -0.0006 215  GLU D CB    
4032 C CG    . GLU D 30  ? 0.1345 0.1280 0.1484 0.0008  0.0117  0.0053  215  GLU D CG    
4033 C CD    . GLU D 30  ? 0.1334 0.1190 0.1518 -0.0058 0.0083  0.0095  215  GLU D CD    
4034 O OE1   . GLU D 30  ? 0.1338 0.1305 0.1552 0.0048  0.0124  0.0172  215  GLU D OE1   
4035 O OE2   . GLU D 30  ? 0.1190 0.1067 0.1537 -0.0026 0.0040  -0.0015 215  GLU D OE2   
4036 N N     . GLU D 31  ? 0.1695 0.1807 0.1781 0.0097  0.0043  -0.0106 216  GLU D N     
4037 C CA    . GLU D 31  ? 0.1935 0.2012 0.1954 0.0065  0.0070  -0.0120 216  GLU D CA    
4038 C C     . GLU D 31  ? 0.1741 0.1779 0.1728 0.0125  0.0077  -0.0092 216  GLU D C     
4039 O O     . GLU D 31  ? 0.1967 0.1834 0.1719 0.0058  0.0092  -0.0126 216  GLU D O     
4040 C CB    . GLU D 31  ? 0.1869 0.2084 0.2040 0.0090  0.0047  -0.0159 216  GLU D CB    
4041 C CG    . GLU D 31  ? 0.2403 0.2524 0.2443 0.0013  0.0085  -0.0046 216  GLU D CG    
4042 C CD    . GLU D 31  ? 0.2487 0.2814 0.2628 0.0055  0.0124  -0.0027 216  GLU D CD    
4043 O OE1   . GLU D 31  ? 0.3242 0.3393 0.3335 0.0216  -0.0116 0.0137  216  GLU D OE1   
4044 O OE2   . GLU D 31  ? 0.3502 0.3644 0.3159 0.0014  -0.0006 0.0155  216  GLU D OE2   
4045 N N     . GLY D 32  ? 0.1621 0.1630 0.1659 0.0111  0.0103  -0.0079 217  GLY D N     
4046 C CA    . GLY D 32  ? 0.1543 0.1548 0.1522 0.0086  0.0031  -0.0039 217  GLY D CA    
4047 C C     . GLY D 32  ? 0.1555 0.1439 0.1468 0.0102  0.0054  -0.0022 217  GLY D C     
4048 O O     . GLY D 32  ? 0.1662 0.1369 0.1442 0.0124  -0.0037 -0.0009 217  GLY D O     
4049 N N     . MET D 33  ? 0.1501 0.1352 0.1402 0.0112  0.0050  0.0002  218  MET D N     
4050 C CA    . MET D 33  ? 0.1556 0.1525 0.1327 0.0008  0.0100  0.0025  218  MET D CA    
4051 C C     . MET D 33  ? 0.1516 0.1403 0.1329 0.0056  0.0078  0.0007  218  MET D C     
4052 O O     . MET D 33  ? 0.1584 0.1494 0.1412 0.0077  0.0148  0.0105  218  MET D O     
4053 C CB    . MET D 33  ? 0.1488 0.1489 0.1324 0.0060  0.0063  0.0008  218  MET D CB    
4054 C CG    . MET D 33  ? 0.1766 0.1533 0.1273 -0.0050 0.0100  0.0001  218  MET D CG    
4055 S SD    . MET D 33  ? 0.1736 0.2063 0.1248 -0.0240 0.0183  -0.0146 218  MET D SD    
4056 C CE    . MET D 33  ? 0.1669 0.2278 0.1883 -0.0161 0.0101  0.0036  218  MET D CE    
4057 N N     . LYS D 34  ? 0.1497 0.1330 0.1304 0.0083  0.0079  0.0115  219  LYS D N     
4058 C CA    . LYS D 34  ? 0.1558 0.1464 0.1357 0.0148  0.0055  0.0031  219  LYS D CA    
4059 C C     . LYS D 34  ? 0.1514 0.1336 0.1351 0.0084  0.0098  0.0087  219  LYS D C     
4060 O O     . LYS D 34  ? 0.1583 0.1134 0.1310 0.0113  0.0166  0.0165  219  LYS D O     
4061 C CB    . LYS D 34  ? 0.1667 0.1641 0.1421 0.0151  0.0058  0.0036  219  LYS D CB    
4062 C CG    . LYS D 34  ? 0.1780 0.1915 0.1398 0.0108  0.0049  -0.0020 219  LYS D CG    
4063 C CD    . LYS D 34  ? 0.1991 0.1925 0.1450 0.0137  -0.0049 -0.0101 219  LYS D CD    
4064 C CE    . LYS D 34  ? 0.2561 0.2462 0.2086 -0.0067 -0.0092 -0.0121 219  LYS D CE    
4065 N NZ    . LYS D 34  ? 0.3010 0.2989 0.2321 0.0035  -0.0115 -0.0206 219  LYS D NZ    
4066 N N     . ILE D 35  ? 0.1530 0.1301 0.1366 0.0089  0.0071  0.0037  220  ILE D N     
4067 C CA    . ILE D 35  ? 0.1526 0.1363 0.1478 0.0081  0.0054  -0.0001 220  ILE D CA    
4068 C C     . ILE D 35  ? 0.1600 0.1608 0.1507 0.0093  0.0033  0.0018  220  ILE D C     
4069 O O     . ILE D 35  ? 0.1683 0.1806 0.1511 0.0153  0.0017  0.0050  220  ILE D O     
4070 C CB    . ILE D 35  ? 0.1415 0.1230 0.1494 0.0077  0.0044  -0.0010 220  ILE D CB    
4071 C CG1   . ILE D 35  ? 0.1621 0.1226 0.1092 0.0090  0.0068  -0.0033 220  ILE D CG1   
4072 C CG2   . ILE D 35  ? 0.1527 0.1265 0.1512 0.0153  0.0123  0.0100  220  ILE D CG2   
4073 C CD1   . ILE D 35  ? 0.1438 0.1096 0.1351 0.0122  0.0131  -0.0007 220  ILE D CD1   
4074 N N     . ASP D 36  ? 0.1612 0.1699 0.1588 0.0133  0.0046  -0.0022 221  ASP D N     
4075 C CA    . ASP D 36  ? 0.1776 0.1900 0.1701 0.0110  0.0017  -0.0086 221  ASP D CA    
4076 C C     . ASP D 36  ? 0.1673 0.1745 0.1467 0.0083  0.0011  -0.0028 221  ASP D C     
4077 O O     . ASP D 36  ? 0.1642 0.1628 0.1240 0.0161  0.0027  0.0054  221  ASP D O     
4078 C CB    . ASP D 36  ? 0.2071 0.2147 0.2005 0.0122  -0.0015 -0.0153 221  ASP D CB    
4079 C CG    . ASP D 36  ? 0.2563 0.2369 0.2220 0.0107  -0.0097 -0.0089 221  ASP D CG    
4080 O OD1   . ASP D 36  ? 0.2644 0.2388 0.2010 0.0001  -0.0027 -0.0088 221  ASP D OD1   
4081 O OD2   . ASP D 36  ? 0.3480 0.2914 0.3036 -0.0009 -0.0059 -0.0263 221  ASP D OD2   
4082 N N     . LEU D 37  ? 0.1585 0.1659 0.1413 0.0052  0.0009  -0.0012 222  LEU D N     
4083 C CA    . LEU D 37  ? 0.1515 0.1537 0.1253 0.0002  -0.0008 0.0006  222  LEU D CA    
4084 C C     . LEU D 37  ? 0.1519 0.1501 0.1215 -0.0058 -0.0039 -0.0062 222  LEU D C     
4085 O O     . LEU D 37  ? 0.1843 0.1663 0.1188 -0.0124 0.0010  -0.0162 222  LEU D O     
4086 C CB    . LEU D 37  ? 0.1656 0.1610 0.1352 -0.0016 0.0015  0.0063  222  LEU D CB    
4087 C CG    . LEU D 37  ? 0.1897 0.1697 0.1589 -0.0044 -0.0035 0.0101  222  LEU D CG    
4088 C CD1   . LEU D 37  ? 0.2202 0.1974 0.1939 0.0130  -0.0002 0.0162  222  LEU D CD1   
4089 C CD2   . LEU D 37  ? 0.2243 0.1795 0.1626 -0.0124 -0.0070 0.0091  222  LEU D CD2   
4090 N N     . ILE D 38  ? 0.1448 0.1376 0.1165 -0.0021 -0.0084 0.0050  223  ILE D N     
4091 C CA    . ILE D 38  ? 0.1347 0.1240 0.1192 -0.0039 -0.0086 -0.0027 223  ILE D CA    
4092 C C     . ILE D 38  ? 0.1330 0.1230 0.1199 -0.0024 -0.0088 -0.0003 223  ILE D C     
4093 O O     . ILE D 38  ? 0.1264 0.1216 0.1175 -0.0037 -0.0056 -0.0131 223  ILE D O     
4094 C CB    . ILE D 38  ? 0.1304 0.1196 0.1301 -0.0007 -0.0130 0.0011  223  ILE D CB    
4095 C CG1   . ILE D 38  ? 0.1354 0.1309 0.1556 0.0002  -0.0033 -0.0132 223  ILE D CG1   
4096 C CG2   . ILE D 38  ? 0.1336 0.1237 0.1158 -0.0163 -0.0048 0.0068  223  ILE D CG2   
4097 C CD1   . ILE D 38  ? 0.1794 0.1482 0.1925 0.0134  0.0129  -0.0191 223  ILE D CD1   
4098 N N     . ASP D 39  ? 0.1390 0.1346 0.1298 -0.0003 -0.0099 -0.0096 224  ASP D N     
4099 C CA    . ASP D 39  ? 0.1294 0.1329 0.1248 -0.0076 -0.0094 -0.0151 224  ASP D CA    
4100 C C     . ASP D 39  ? 0.1319 0.1368 0.1300 -0.0056 -0.0029 -0.0081 224  ASP D C     
4101 O O     . ASP D 39  ? 0.1485 0.1487 0.1331 -0.0047 -0.0002 -0.0099 224  ASP D O     
4102 C CB    . ASP D 39  ? 0.1309 0.1298 0.1470 -0.0087 -0.0108 -0.0142 224  ASP D CB    
4103 C CG    . ASP D 39  ? 0.1411 0.1498 0.1659 0.0011  -0.0041 -0.0100 224  ASP D CG    
4104 O OD1   . ASP D 39  ? 0.1455 0.1540 0.1601 -0.0055 -0.0147 -0.0178 224  ASP D OD1   
4105 O OD2   . ASP D 39  ? 0.1887 0.1842 0.2486 -0.0161 -0.0140 -0.0080 224  ASP D OD2   
4106 N N     . GLY D 40  ? 0.1282 0.1474 0.1193 -0.0051 0.0004  -0.0116 225  GLY D N     
4107 C CA    . GLY D 40  ? 0.1292 0.1489 0.1153 -0.0110 -0.0023 -0.0057 225  GLY D CA    
4108 C C     . GLY D 40  ? 0.1184 0.1596 0.1189 -0.0044 0.0005  -0.0027 225  GLY D C     
4109 O O     . GLY D 40  ? 0.1266 0.1775 0.1209 -0.0083 0.0021  -0.0074 225  GLY D O     
4110 N N     . LYS D 41  ? 0.1039 0.1404 0.1119 -0.0097 -0.0065 -0.0055 226  LYS D N     
4111 C CA    . LYS D 41  ? 0.1090 0.1246 0.1131 -0.0031 -0.0061 -0.0065 226  LYS D CA    
4112 C C     . LYS D 41  ? 0.1132 0.1247 0.1070 0.0001  -0.0020 -0.0005 226  LYS D C     
4113 O O     . LYS D 41  ? 0.1321 0.1389 0.1132 -0.0038 -0.0114 -0.0058 226  LYS D O     
4114 C CB    . LYS D 41  ? 0.1110 0.1047 0.1141 -0.0059 -0.0007 -0.0087 226  LYS D CB    
4115 C CG    . LYS D 41  ? 0.1093 0.1073 0.1235 -0.0085 0.0019  0.0043  226  LYS D CG    
4116 C CD    . LYS D 41  ? 0.1219 0.1175 0.1260 0.0069  0.0059  -0.0084 226  LYS D CD    
4117 C CE    . LYS D 41  ? 0.1306 0.1319 0.1685 0.0014  0.0144  -0.0072 226  LYS D CE    
4118 N NZ    . LYS D 41  ? 0.1334 0.1290 0.1600 0.0092  0.0177  0.0044  226  LYS D NZ    
4119 N N     . GLY D 42  ? 0.1111 0.1250 0.0998 0.0059  -0.0025 -0.0058 227  GLY D N     
4120 C CA    . GLY D 42  ? 0.1185 0.1180 0.0969 0.0098  0.0011  0.0010  227  GLY D CA    
4121 C C     . GLY D 42  ? 0.1185 0.1090 0.0925 0.0022  0.0041  -0.0032 227  GLY D C     
4122 O O     . GLY D 42  ? 0.1276 0.1329 0.1126 -0.0034 -0.0015 -0.0188 227  GLY D O     
4123 N N     . ARG D 43  ? 0.1102 0.1018 0.0878 0.0105  -0.0002 0.0077  228  ARG D N     
4124 C CA    . ARG D 43  ? 0.1163 0.1030 0.0894 0.0055  0.0022  0.0091  228  ARG D CA    
4125 C C     . ARG D 43  ? 0.1158 0.0943 0.0894 0.0089  0.0060  0.0031  228  ARG D C     
4126 O O     . ARG D 43  ? 0.1287 0.1005 0.0933 0.0100  0.0102  0.0074  228  ARG D O     
4127 C CB    . ARG D 43  ? 0.1211 0.1076 0.0939 0.0074  -0.0048 0.0075  228  ARG D CB    
4128 C CG    . ARG D 43  ? 0.1431 0.1019 0.0832 0.0038  -0.0002 0.0032  228  ARG D CG    
4129 C CD    . ARG D 43  ? 0.1615 0.0951 0.0829 -0.0063 0.0062  0.0000  228  ARG D CD    
4130 N NE    . ARG D 43  ? 0.1527 0.0883 0.0649 -0.0004 -0.0035 0.0005  228  ARG D NE    
4131 C CZ    . ARG D 43  ? 0.1164 0.0907 0.1034 0.0046  0.0017  0.0023  228  ARG D CZ    
4132 N NH1   . ARG D 43  ? 0.1236 0.1023 0.1272 0.0069  0.0130  0.0122  228  ARG D NH1   
4133 N NH2   . ARG D 43  ? 0.1434 0.1217 0.1077 0.0102  0.0114  0.0024  228  ARG D NH2   
4134 N N     . GLY D 44  ? 0.1152 0.0822 0.0980 0.0081  0.0080  0.0033  229  GLY D N     
4135 C CA    . GLY D 44  ? 0.1152 0.0926 0.0998 0.0134  0.0068  -0.0011 229  GLY D CA    
4136 C C     . GLY D 44  ? 0.1145 0.0929 0.1029 0.0092  0.0079  0.0012  229  GLY D C     
4137 O O     . GLY D 44  ? 0.1310 0.1085 0.1213 0.0086  0.0170  -0.0002 229  GLY D O     
4138 N N     . VAL D 45  ? 0.1022 0.0861 0.1060 0.0053  0.0077  -0.0003 230  VAL D N     
4139 C CA    . VAL D 45  ? 0.1128 0.0869 0.1070 0.0051  0.0120  -0.0077 230  VAL D CA    
4140 C C     . VAL D 45  ? 0.1192 0.0796 0.1019 0.0063  0.0100  0.0005  230  VAL D C     
4141 O O     . VAL D 45  ? 0.1329 0.0854 0.0967 0.0026  0.0133  0.0076  230  VAL D O     
4142 C CB    . VAL D 45  ? 0.1134 0.0996 0.1120 0.0083  0.0098  -0.0022 230  VAL D CB    
4143 C CG1   . VAL D 45  ? 0.1186 0.1118 0.1285 0.0072  0.0149  -0.0067 230  VAL D CG1   
4144 C CG2   . VAL D 45  ? 0.1304 0.0978 0.1164 0.0037  0.0071  -0.0061 230  VAL D CG2   
4145 N N     . ILE D 46  ? 0.1283 0.0865 0.1038 0.0101  0.0099  -0.0100 231  ILE D N     
4146 C CA    . ILE D 46  ? 0.1372 0.0986 0.1117 0.0092  0.0105  -0.0107 231  ILE D CA    
4147 C C     . ILE D 46  ? 0.1440 0.1053 0.1228 0.0089  0.0083  -0.0081 231  ILE D C     
4148 O O     . ILE D 46  ? 0.1508 0.1092 0.1342 0.0110  0.0200  -0.0077 231  ILE D O     
4149 C CB    . ILE D 46  ? 0.1396 0.1002 0.1095 0.0111  0.0113  -0.0144 231  ILE D CB    
4150 C CG1   . ILE D 46  ? 0.1353 0.1384 0.1276 0.0017  0.0021  -0.0088 231  ILE D CG1   
4151 C CG2   . ILE D 46  ? 0.1847 0.1170 0.1399 0.0111  0.0111  -0.0290 231  ILE D CG2   
4152 C CD1   . ILE D 46  ? 0.1544 0.1563 0.1298 -0.0009 -0.0013 0.0059  231  ILE D CD1   
4153 N N     . ALA D 47  ? 0.1446 0.1044 0.1191 0.0109  0.0041  -0.0103 232  ALA D N     
4154 C CA    . ALA D 47  ? 0.1521 0.1147 0.1338 0.0111  0.0099  -0.0044 232  ALA D CA    
4155 C C     . ALA D 47  ? 0.1563 0.1325 0.1425 0.0112  0.0069  -0.0075 232  ALA D C     
4156 O O     . ALA D 47  ? 0.1721 0.1378 0.1532 0.0019  0.0144  -0.0194 232  ALA D O     
4157 C CB    . ALA D 47  ? 0.1554 0.1098 0.1331 0.0149  0.0058  0.0017  232  ALA D CB    
4158 N N     . THR D 48  ? 0.1649 0.1239 0.1340 0.0123  0.0089  -0.0024 233  THR D N     
4159 C CA    . THR D 48  ? 0.1753 0.1454 0.1450 0.0130  0.0099  -0.0001 233  THR D CA    
4160 C C     . THR D 48  ? 0.1777 0.1490 0.1464 0.0146  0.0075  -0.0038 233  THR D C     
4161 O O     . THR D 48  ? 0.2091 0.1780 0.1665 0.0280  0.0143  0.0011  233  THR D O     
4162 C CB    . THR D 48  ? 0.1769 0.1386 0.1436 0.0139  0.0040  0.0050  233  THR D CB    
4163 O OG1   . THR D 48  ? 0.1859 0.1794 0.1390 0.0029  0.0173  -0.0015 233  THR D OG1   
4164 C CG2   . THR D 48  ? 0.1832 0.1492 0.1599 0.0182  0.0065  -0.0137 233  THR D CG2   
4165 N N     . LYS D 49  ? 0.1785 0.1503 0.1535 0.0177  0.0048  -0.0043 234  LYS D N     
4166 C CA    . LYS D 49  ? 0.1768 0.1583 0.1608 0.0149  0.0030  -0.0049 234  LYS D CA    
4167 C C     . LYS D 49  ? 0.1783 0.1588 0.1672 0.0095  0.0040  -0.0035 234  LYS D C     
4168 O O     . LYS D 49  ? 0.1731 0.1564 0.1566 0.0058  0.0022  -0.0001 234  LYS D O     
4169 C CB    . LYS D 49  ? 0.1739 0.1614 0.1580 0.0172  0.0029  -0.0067 234  LYS D CB    
4170 C CG    . LYS D 49  ? 0.1662 0.1612 0.1633 0.0165  0.0038  -0.0117 234  LYS D CG    
4171 C CD    . LYS D 49  ? 0.1778 0.1861 0.1712 0.0109  0.0021  -0.0104 234  LYS D CD    
4172 C CE    . LYS D 49  ? 0.2046 0.2143 0.1826 0.0016  0.0000  -0.0130 234  LYS D CE    
4173 N NZ    . LYS D 49  ? 0.2086 0.2405 0.2049 0.0047  0.0105  -0.0204 234  LYS D NZ    
4174 N N     . GLN D 50  ? 0.1913 0.1647 0.1722 0.0149  0.0022  -0.0006 235  GLN D N     
4175 C CA    . GLN D 50  ? 0.2002 0.1668 0.1860 0.0112  0.0019  0.0027  235  GLN D CA    
4176 C C     . GLN D 50  ? 0.1896 0.1573 0.1804 0.0152  0.0041  -0.0004 235  GLN D C     
4177 O O     . GLN D 50  ? 0.1999 0.1652 0.1781 0.0067  0.0095  0.0053  235  GLN D O     
4178 C CB    . GLN D 50  ? 0.2248 0.1844 0.2039 0.0166  0.0033  0.0061  235  GLN D CB    
4179 C CG    . GLN D 50  ? 0.2666 0.2448 0.2432 0.0011  -0.0041 0.0016  235  GLN D CG    
4180 C CD    . GLN D 50  ? 0.3362 0.2880 0.3073 0.0115  0.0022  -0.0040 235  GLN D CD    
4181 O OE1   . GLN D 50  ? 0.3689 0.3321 0.3189 0.0048  0.0015  0.0112  235  GLN D OE1   
4182 N NE2   . GLN D 50  ? 0.3508 0.3352 0.3101 0.0071  0.0049  0.0010  235  GLN D NE2   
4183 N N     . PHE D 51  ? 0.1833 0.1495 0.1703 0.0160  0.0042  0.0039  236  PHE D N     
4184 C CA    . PHE D 51  ? 0.1694 0.1481 0.1714 0.0195  -0.0005 0.0005  236  PHE D CA    
4185 C C     . PHE D 51  ? 0.1688 0.1532 0.1744 0.0137  -0.0017 0.0037  236  PHE D C     
4186 O O     . PHE D 51  ? 0.1673 0.1536 0.1954 0.0185  -0.0008 0.0134  236  PHE D O     
4187 C CB    . PHE D 51  ? 0.1722 0.1542 0.1643 0.0136  0.0039  0.0015  236  PHE D CB    
4188 C CG    . PHE D 51  ? 0.1565 0.1550 0.1635 0.0103  0.0016  0.0017  236  PHE D CG    
4189 C CD1   . PHE D 51  ? 0.1635 0.1503 0.1561 0.0008  0.0065  0.0082  236  PHE D CD1   
4190 C CD2   . PHE D 51  ? 0.1695 0.1300 0.1645 0.0295  0.0017  0.0014  236  PHE D CD2   
4191 C CE1   . PHE D 51  ? 0.1496 0.1467 0.1778 0.0108  0.0123  0.0006  236  PHE D CE1   
4192 C CE2   . PHE D 51  ? 0.1746 0.1366 0.1686 0.0110  0.0070  0.0001  236  PHE D CE2   
4193 C CZ    . PHE D 51  ? 0.1595 0.1470 0.1753 0.0101  0.0089  0.0031  236  PHE D CZ    
4194 N N     . SER D 52  ? 0.1605 0.1525 0.1733 0.0164  0.0011  0.0024  237  SER D N     
4195 C CA    . SER D 52  ? 0.1584 0.1529 0.1759 0.0173  -0.0045 0.0029  237  SER D CA    
4196 C C     . SER D 52  ? 0.1443 0.1422 0.1741 0.0138  -0.0035 0.0021  237  SER D C     
4197 O O     . SER D 52  ? 0.1475 0.1382 0.1813 0.0169  -0.0070 0.0032  237  SER D O     
4198 C CB    . SER D 52  ? 0.1530 0.1602 0.1751 0.0183  0.0026  0.0042  237  SER D CB    
4199 O OG    . SER D 52  ? 0.2082 0.1870 0.1850 0.0323  -0.0085 -0.0091 237  SER D OG    
4200 N N     . ARG D 53  ? 0.1517 0.1479 0.1755 0.0161  -0.0070 0.0065  238  ARG D N     
4201 C CA    . ARG D 53  ? 0.1500 0.1477 0.1792 0.0081  0.0002  0.0020  238  ARG D CA    
4202 C C     . ARG D 53  ? 0.1538 0.1516 0.1739 0.0087  -0.0026 -0.0018 238  ARG D C     
4203 O O     . ARG D 53  ? 0.1585 0.1517 0.1810 0.0130  -0.0040 -0.0091 238  ARG D O     
4204 C CB    . ARG D 53  ? 0.1582 0.1436 0.1896 0.0097  -0.0012 0.0082  238  ARG D CB    
4205 C CG    . ARG D 53  ? 0.1935 0.1997 0.2057 0.0037  -0.0013 0.0040  238  ARG D CG    
4206 C CD    . ARG D 53  ? 0.2790 0.2500 0.2893 -0.0110 0.0115  0.0132  238  ARG D CD    
4207 N NE    . ARG D 53  ? 0.3327 0.3322 0.3336 -0.0039 -0.0057 0.0000  238  ARG D NE    
4208 C CZ    . ARG D 53  ? 0.3620 0.3678 0.3709 -0.0016 0.0056  0.0024  238  ARG D CZ    
4209 N NH1   . ARG D 53  ? 0.3928 0.3785 0.3727 0.0019  0.0115  -0.0030 238  ARG D NH1   
4210 N NH2   . ARG D 53  ? 0.3839 0.3780 0.3911 -0.0070 -0.0020 0.0013  238  ARG D NH2   
4211 N N     . GLY D 54  ? 0.1437 0.1389 0.1717 0.0038  -0.0052 -0.0042 239  GLY D N     
4212 C CA    . GLY D 54  ? 0.1455 0.1482 0.1782 0.0092  -0.0055 -0.0066 239  GLY D CA    
4213 C C     . GLY D 54  ? 0.1455 0.1481 0.1748 0.0123  -0.0025 -0.0068 239  GLY D C     
4214 O O     . GLY D 54  ? 0.1626 0.1653 0.1852 0.0068  -0.0054 -0.0195 239  GLY D O     
4215 N N     . ASP D 55  ? 0.1430 0.1464 0.1732 0.0178  0.0065  -0.0074 240  ASP D N     
4216 C CA    . ASP D 55  ? 0.1478 0.1438 0.1783 0.0103  0.0051  -0.0076 240  ASP D CA    
4217 C C     . ASP D 55  ? 0.1318 0.1322 0.1719 0.0066  0.0040  -0.0104 240  ASP D C     
4218 O O     . ASP D 55  ? 0.1303 0.1349 0.1861 0.0029  0.0038  -0.0107 240  ASP D O     
4219 C CB    . ASP D 55  ? 0.1553 0.1483 0.1741 0.0154  0.0045  -0.0077 240  ASP D CB    
4220 C CG    . ASP D 55  ? 0.1842 0.1755 0.2078 0.0132  0.0047  -0.0057 240  ASP D CG    
4221 O OD1   . ASP D 55  ? 0.2004 0.1709 0.2246 0.0254  -0.0103 -0.0021 240  ASP D OD1   
4222 O OD2   . ASP D 55  ? 0.2099 0.1912 0.2148 -0.0028 0.0117  -0.0158 240  ASP D OD2   
4223 N N     . PHE D 56  ? 0.1335 0.1305 0.1772 0.0082  -0.0010 -0.0106 241  PHE D N     
4224 C CA    . PHE D 56  ? 0.1268 0.1290 0.1608 0.0035  -0.0033 -0.0100 241  PHE D CA    
4225 C C     . PHE D 56  ? 0.1283 0.1330 0.1594 0.0060  -0.0006 -0.0059 241  PHE D C     
4226 O O     . PHE D 56  ? 0.1306 0.1402 0.1696 0.0148  0.0001  -0.0138 241  PHE D O     
4227 C CB    . PHE D 56  ? 0.1280 0.1306 0.1706 -0.0047 -0.0005 -0.0115 241  PHE D CB    
4228 C CG    . PHE D 56  ? 0.1247 0.1461 0.1741 0.0065  -0.0001 -0.0030 241  PHE D CG    
4229 C CD1   . PHE D 56  ? 0.1665 0.1374 0.1737 0.0027  0.0107  -0.0014 241  PHE D CD1   
4230 C CD2   . PHE D 56  ? 0.1059 0.1545 0.1621 0.0003  0.0036  0.0027  241  PHE D CD2   
4231 C CE1   . PHE D 56  ? 0.1521 0.1429 0.1825 0.0090  -0.0017 0.0013  241  PHE D CE1   
4232 C CE2   . PHE D 56  ? 0.1258 0.1578 0.1679 0.0028  0.0064  0.0018  241  PHE D CE2   
4233 C CZ    . PHE D 56  ? 0.1321 0.1333 0.1718 0.0020  0.0117  -0.0008 241  PHE D CZ    
4234 N N     . VAL D 57  ? 0.1223 0.1250 0.1446 0.0060  -0.0010 -0.0034 242  VAL D N     
4235 C CA    . VAL D 57  ? 0.1143 0.1189 0.1320 0.0029  0.0012  -0.0033 242  VAL D CA    
4236 C C     . VAL D 57  ? 0.1192 0.1193 0.1288 0.0014  0.0011  -0.0092 242  VAL D C     
4237 O O     . VAL D 57  ? 0.1121 0.1240 0.1387 0.0049  0.0109  -0.0130 242  VAL D O     
4238 C CB    . VAL D 57  ? 0.1088 0.1161 0.1305 0.0061  -0.0001 -0.0032 242  VAL D CB    
4239 C CG1   . VAL D 57  ? 0.1298 0.1230 0.1119 0.0015  -0.0003 0.0084  242  VAL D CG1   
4240 C CG2   . VAL D 57  ? 0.1385 0.1318 0.1125 -0.0006 -0.0030 0.0000  242  VAL D CG2   
4241 N N     . VAL D 58  ? 0.1094 0.1191 0.1246 -0.0036 0.0036  -0.0086 243  VAL D N     
4242 C CA    . VAL D 58  ? 0.1176 0.1190 0.1183 0.0002  0.0039  -0.0035 243  VAL D CA    
4243 C C     . VAL D 58  ? 0.1135 0.1166 0.1172 -0.0081 0.0064  -0.0025 243  VAL D C     
4244 O O     . VAL D 58  ? 0.1190 0.1060 0.1308 -0.0145 0.0073  0.0124  243  VAL D O     
4245 C CB    . VAL D 58  ? 0.1154 0.1198 0.1208 0.0000  0.0040  -0.0018 243  VAL D CB    
4246 C CG1   . VAL D 58  ? 0.1278 0.1284 0.1359 0.0023  0.0169  0.0060  243  VAL D CG1   
4247 C CG2   . VAL D 58  ? 0.1452 0.1249 0.1237 -0.0019 0.0119  0.0041  243  VAL D CG2   
4248 N N     . GLU D 59  ? 0.1003 0.1228 0.1273 -0.0064 0.0024  -0.0062 244  GLU D N     
4249 C CA    . GLU D 59  ? 0.1012 0.1196 0.1330 -0.0033 0.0040  -0.0087 244  GLU D CA    
4250 C C     . GLU D 59  ? 0.0926 0.1173 0.1230 -0.0068 0.0034  -0.0046 244  GLU D C     
4251 O O     . GLU D 59  ? 0.1070 0.1159 0.1182 -0.0026 0.0098  -0.0011 244  GLU D O     
4252 C CB    . GLU D 59  ? 0.1098 0.1224 0.1376 -0.0080 0.0042  -0.0084 244  GLU D CB    
4253 C CG    . GLU D 59  ? 0.1015 0.1299 0.1276 -0.0157 -0.0057 -0.0117 244  GLU D CG    
4254 C CD    . GLU D 59  ? 0.1152 0.1273 0.1460 -0.0078 0.0062  -0.0115 244  GLU D CD    
4255 O OE1   . GLU D 59  ? 0.1267 0.1611 0.1524 -0.0199 0.0068  -0.0117 244  GLU D OE1   
4256 O OE2   . GLU D 59  ? 0.1103 0.1478 0.1490 -0.0183 0.0006  -0.0180 244  GLU D OE2   
4257 N N     . TYR D 60  ? 0.1077 0.1184 0.1250 -0.0081 0.0050  -0.0019 245  TYR D N     
4258 C CA    . TYR D 60  ? 0.0998 0.1105 0.1111 -0.0115 0.0054  0.0020  245  TYR D CA    
4259 C C     . TYR D 60  ? 0.1098 0.1200 0.1226 -0.0131 -0.0007 0.0009  245  TYR D C     
4260 O O     . TYR D 60  ? 0.1027 0.1354 0.1161 -0.0130 -0.0010 -0.0049 245  TYR D O     
4261 C CB    . TYR D 60  ? 0.0917 0.1200 0.1070 0.0001  0.0091  0.0084  245  TYR D CB    
4262 C CG    . TYR D 60  ? 0.0753 0.0989 0.0884 -0.0074 0.0033  0.0029  245  TYR D CG    
4263 C CD1   . TYR D 60  ? 0.0685 0.1088 0.0725 -0.0146 -0.0028 0.0069  245  TYR D CD1   
4264 C CD2   . TYR D 60  ? 0.0984 0.0948 0.1003 -0.0136 -0.0072 0.0035  245  TYR D CD2   
4265 C CE1   . TYR D 60  ? 0.0772 0.0940 0.0878 -0.0062 0.0107  0.0090  245  TYR D CE1   
4266 C CE2   . TYR D 60  ? 0.0785 0.1189 0.0798 -0.0187 -0.0004 0.0057  245  TYR D CE2   
4267 C CZ    . TYR D 60  ? 0.0691 0.1032 0.0756 -0.0132 0.0037  0.0030  245  TYR D CZ    
4268 O OH    . TYR D 60  ? 0.0779 0.1175 0.1027 -0.0154 0.0058  0.0081  245  TYR D OH    
4269 N N     . HIS D 61  ? 0.1048 0.1132 0.1280 -0.0207 -0.0004 0.0007  246  HIS D N     
4270 C CA    . HIS D 61  ? 0.1165 0.1104 0.1345 -0.0160 0.0014  0.0029  246  HIS D CA    
4271 C C     . HIS D 61  ? 0.1185 0.1138 0.1275 -0.0141 -0.0005 0.0040  246  HIS D C     
4272 O O     . HIS D 61  ? 0.1198 0.1191 0.1291 -0.0157 -0.0025 0.0107  246  HIS D O     
4273 C CB    . HIS D 61  ? 0.1160 0.1112 0.1335 -0.0184 0.0040  0.0007  246  HIS D CB    
4274 C CG    . HIS D 61  ? 0.1232 0.1265 0.1577 -0.0157 -0.0035 -0.0020 246  HIS D CG    
4275 N ND1   . HIS D 61  ? 0.1315 0.1431 0.1721 -0.0184 0.0051  -0.0072 246  HIS D ND1   
4276 C CD2   . HIS D 61  ? 0.1327 0.1563 0.1857 -0.0057 0.0128  -0.0026 246  HIS D CD2   
4277 C CE1   . HIS D 61  ? 0.1195 0.1397 0.1930 -0.0131 0.0086  0.0012  246  HIS D CE1   
4278 N NE2   . HIS D 61  ? 0.1591 0.1378 0.1953 -0.0075 0.0016  -0.0041 246  HIS D NE2   
4279 N N     . GLY D 62  ? 0.1316 0.1124 0.1205 -0.0112 -0.0013 0.0038  247  GLY D N     
4280 C CA    . GLY D 62  ? 0.1430 0.1309 0.1329 -0.0090 -0.0047 -0.0058 247  GLY D CA    
4281 C C     . GLY D 62  ? 0.1501 0.1404 0.1434 -0.0142 -0.0005 -0.0084 247  GLY D C     
4282 O O     . GLY D 62  ? 0.1698 0.1686 0.1633 -0.0048 0.0043  -0.0169 247  GLY D O     
4283 N N     . ASP D 63  ? 0.1638 0.1461 0.1434 -0.0203 0.0045  -0.0087 248  ASP D N     
4284 C CA    . ASP D 63  ? 0.1647 0.1666 0.1558 -0.0267 0.0014  -0.0082 248  ASP D CA    
4285 C C     . ASP D 63  ? 0.1597 0.1686 0.1513 -0.0290 0.0059  -0.0071 248  ASP D C     
4286 O O     . ASP D 63  ? 0.1384 0.1879 0.1499 -0.0469 0.0029  -0.0095 248  ASP D O     
4287 C CB    . ASP D 63  ? 0.1861 0.1745 0.1792 -0.0217 0.0025  -0.0071 248  ASP D CB    
4288 C CG    . ASP D 63  ? 0.2407 0.2258 0.2219 -0.0085 0.0032  0.0028  248  ASP D CG    
4289 O OD1   . ASP D 63  ? 0.2878 0.2644 0.2557 -0.0058 0.0252  0.0162  248  ASP D OD1   
4290 O OD2   . ASP D 63  ? 0.3035 0.2777 0.2982 0.0123  0.0108  0.0056  248  ASP D OD2   
4291 N N     . LEU D 64  ? 0.1607 0.1628 0.1459 -0.0325 0.0066  -0.0063 249  LEU D N     
4292 C CA    . LEU D 64  ? 0.1598 0.1664 0.1517 -0.0281 0.0020  -0.0088 249  LEU D CA    
4293 C C     . LEU D 64  ? 0.1624 0.1648 0.1490 -0.0324 0.0073  -0.0094 249  LEU D C     
4294 O O     . LEU D 64  ? 0.1617 0.1666 0.1485 -0.0484 0.0141  -0.0137 249  LEU D O     
4295 C CB    . LEU D 64  ? 0.1645 0.1773 0.1592 -0.0236 0.0063  -0.0026 249  LEU D CB    
4296 C CG    . LEU D 64  ? 0.1595 0.1650 0.1454 -0.0303 -0.0036 -0.0117 249  LEU D CG    
4297 C CD1   . LEU D 64  ? 0.1619 0.1668 0.1593 -0.0407 0.0101  -0.0119 249  LEU D CD1   
4298 C CD2   . LEU D 64  ? 0.1715 0.1811 0.1752 -0.0208 -0.0017 -0.0123 249  LEU D CD2   
4299 N N     . ILE D 65  ? 0.1651 0.1590 0.1379 -0.0288 0.0059  -0.0110 250  ILE D N     
4300 C CA    . ILE D 65  ? 0.1673 0.1589 0.1362 -0.0282 0.0055  -0.0062 250  ILE D CA    
4301 C C     . ILE D 65  ? 0.1706 0.1623 0.1398 -0.0256 0.0013  -0.0057 250  ILE D C     
4302 O O     . ILE D 65  ? 0.1525 0.1716 0.1253 -0.0427 -0.0024 -0.0145 250  ILE D O     
4303 C CB    . ILE D 65  ? 0.1676 0.1548 0.1397 -0.0308 0.0065  -0.0074 250  ILE D CB    
4304 C CG1   . ILE D 65  ? 0.1566 0.1649 0.1523 -0.0273 0.0021  -0.0123 250  ILE D CG1   
4305 C CG2   . ILE D 65  ? 0.1951 0.1749 0.1321 -0.0237 0.0090  -0.0126 250  ILE D CG2   
4306 C CD1   . ILE D 65  ? 0.1758 0.1675 0.1447 -0.0259 -0.0020 -0.0024 250  ILE D CD1   
4307 N N     . GLU D 66  ? 0.1698 0.1629 0.1380 -0.0257 0.0018  -0.0092 251  GLU D N     
4308 C CA    . GLU D 66  ? 0.1789 0.1686 0.1519 -0.0217 -0.0017 -0.0047 251  GLU D CA    
4309 C C     . GLU D 66  ? 0.1801 0.1623 0.1555 -0.0217 -0.0018 -0.0064 251  GLU D C     
4310 O O     . GLU D 66  ? 0.1810 0.1582 0.1495 -0.0273 0.0022  -0.0107 251  GLU D O     
4311 C CB    . GLU D 66  ? 0.1853 0.1752 0.1481 -0.0207 -0.0005 -0.0082 251  GLU D CB    
4312 C CG    . GLU D 66  ? 0.2261 0.2052 0.2184 -0.0175 -0.0008 -0.0073 251  GLU D CG    
4313 C CD    . GLU D 66  ? 0.2547 0.2593 0.2727 -0.0091 0.0050  -0.0072 251  GLU D CD    
4314 O OE1   . GLU D 66  ? 0.2858 0.2931 0.3037 -0.0116 0.0153  -0.0068 251  GLU D OE1   
4315 O OE2   . GLU D 66  ? 0.2716 0.2806 0.2736 -0.0070 0.0079  0.0048  251  GLU D OE2   
4316 N N     . ILE D 67  ? 0.1818 0.1744 0.1520 -0.0180 -0.0022 -0.0078 252  ILE D N     
4317 C CA    . ILE D 67  ? 0.1856 0.1870 0.1620 -0.0102 -0.0065 -0.0037 252  ILE D CA    
4318 C C     . ILE D 67  ? 0.1954 0.1802 0.1663 -0.0109 -0.0055 -0.0026 252  ILE D C     
4319 O O     . ILE D 67  ? 0.2067 0.1697 0.1573 -0.0034 -0.0146 -0.0098 252  ILE D O     
4320 C CB    . ILE D 67  ? 0.1803 0.1867 0.1652 -0.0121 -0.0041 0.0008  252  ILE D CB    
4321 C CG1   . ILE D 67  ? 0.1789 0.2069 0.1822 -0.0101 0.0027  0.0059  252  ILE D CG1   
4322 C CG2   . ILE D 67  ? 0.2092 0.2175 0.1695 0.0008  -0.0113 -0.0066 252  ILE D CG2   
4323 C CD1   . ILE D 67  ? 0.1827 0.1997 0.1754 -0.0065 -0.0079 0.0065  252  ILE D CD1   
4324 N N     . THR D 68  ? 0.2042 0.1884 0.1714 -0.0095 -0.0117 -0.0063 253  THR D N     
4325 C CA    . THR D 68  ? 0.2254 0.1957 0.1866 -0.0080 -0.0104 -0.0071 253  THR D CA    
4326 C C     . THR D 68  ? 0.2204 0.1872 0.1846 -0.0105 -0.0114 -0.0131 253  THR D C     
4327 O O     . THR D 68  ? 0.2283 0.1891 0.1867 -0.0100 -0.0093 -0.0190 253  THR D O     
4328 C CB    . THR D 68  ? 0.2376 0.2017 0.1959 -0.0050 -0.0119 -0.0081 253  THR D CB    
4329 O OG1   . THR D 68  ? 0.2626 0.2544 0.2414 -0.0009 -0.0003 -0.0163 253  THR D OG1   
4330 C CG2   . THR D 68  ? 0.2424 0.2045 0.1774 -0.0070 -0.0169 -0.0174 253  THR D CG2   
4331 N N     . ASP D 69  ? 0.2236 0.1827 0.1806 -0.0169 -0.0117 -0.0091 254  ASP D N     
4332 C CA    . ASP D 69  ? 0.2253 0.1925 0.1840 -0.0124 -0.0112 -0.0102 254  ASP D CA    
4333 C C     . ASP D 69  ? 0.2127 0.1754 0.1755 -0.0125 -0.0063 -0.0084 254  ASP D C     
4334 O O     . ASP D 69  ? 0.2232 0.1645 0.1661 -0.0154 -0.0158 -0.0075 254  ASP D O     
4335 C CB    . ASP D 69  ? 0.2381 0.2086 0.1988 -0.0126 -0.0033 -0.0112 254  ASP D CB    
4336 C CG    . ASP D 69  ? 0.2867 0.2564 0.2465 -0.0077 -0.0010 0.0034  254  ASP D CG    
4337 O OD1   . ASP D 69  ? 0.3298 0.2985 0.2938 0.0034  -0.0048 0.0127  254  ASP D OD1   
4338 O OD2   . ASP D 69  ? 0.3313 0.3085 0.3004 -0.0080 0.0115  -0.0177 254  ASP D OD2   
4339 N N     . ALA D 70  ? 0.2059 0.1690 0.1586 -0.0092 -0.0075 -0.0085 255  ALA D N     
4340 C CA    . ALA D 70  ? 0.1991 0.1688 0.1652 -0.0100 -0.0065 -0.0065 255  ALA D CA    
4341 C C     . ALA D 70  ? 0.2066 0.1702 0.1628 -0.0053 -0.0051 -0.0093 255  ALA D C     
4342 O O     . ALA D 70  ? 0.2127 0.1742 0.1631 -0.0041 -0.0020 -0.0110 255  ALA D O     
4343 C CB    . ALA D 70  ? 0.1941 0.1646 0.1582 -0.0069 -0.0079 -0.0036 255  ALA D CB    
4344 N N     . LYS D 71  ? 0.2101 0.1735 0.1616 -0.0115 -0.0049 -0.0125 256  LYS D N     
4345 C CA    . LYS D 71  ? 0.2185 0.1891 0.1773 -0.0047 -0.0063 -0.0154 256  LYS D CA    
4346 C C     . LYS D 71  ? 0.2223 0.1942 0.1805 -0.0028 -0.0043 -0.0167 256  LYS D C     
4347 O O     . LYS D 71  ? 0.2255 0.1781 0.1838 0.0087  -0.0038 -0.0266 256  LYS D O     
4348 C CB    . LYS D 71  ? 0.2172 0.2063 0.1767 -0.0035 -0.0063 -0.0186 256  LYS D CB    
4349 C CG    . LYS D 71  ? 0.2522 0.2298 0.2027 -0.0088 -0.0065 -0.0031 256  LYS D CG    
4350 C CD    . LYS D 71  ? 0.2812 0.2858 0.2344 -0.0043 -0.0098 0.0090  256  LYS D CD    
4351 C CE    . LYS D 71  ? 0.2814 0.2911 0.2481 -0.0029 -0.0065 0.0002  256  LYS D CE    
4352 N NZ    . LYS D 71  ? 0.2688 0.2565 0.2255 0.0039  0.0049  0.0075  256  LYS D NZ    
4353 N N     . LYS D 72  ? 0.2339 0.1943 0.1926 -0.0022 -0.0074 -0.0197 257  LYS D N     
4354 C CA