data_1ZMC
# 
_entry.id   1ZMC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZMC         
RCSB  RCSB032888   
WWPDB D_1000032888 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1ZMD 
_pdbx_database_related.details        'crystal structure of the same protein complexed to NADH' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZMC 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brautigam, C.A.' 1 
'Chuang, J.L.'    2 
'Tomchick, D.R.'  3 
'Machius, M.'     4 
'Chuang, D.T.'    5 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure of Human Dihydrolipoamide Dehydrogenase: NAD(+)/NADH Binding and the Structural Basis of Disease-causing Mutations
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            350 
_citation.page_first                543 
_citation.page_last                 552 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15946682 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.05.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brautigam, C.A.' 1 
primary 'Chuang, J.L.'    2 
primary 'Tomchick, D.R.'  3 
primary 'Machius, M.'     4 
primary 'Chuang, D.T.'    5 
# 
_cell.entry_id           1ZMC 
_cell.length_a           176.124 
_cell.length_b           210.763 
_cell.length_c           126.903 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZMC 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Dihydrolipoyl dehydrogenase'     50208.406 8    1.8.1.4 ? ? ? 
2 non-polymer syn 'SULFATE ION'                     96.063    36   ?       ? ? ? 
3 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'     785.550   8    ?       ? ? ? 
4 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425   8    ?       ? ? ? 
5 water       nat water                             18.015    1401 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dihydrolipoamide dehydrogenase, Glycine cleavage system L protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGTDFASRGIEMSE
VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITI
DEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLN
TKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGD
VVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADT
DGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGTDFASRGIEMSE
VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITI
DEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLN
TKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGD
VVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADT
DGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   GLN n 
1 4   PRO n 
1 5   ILE n 
1 6   ASP n 
1 7   ALA n 
1 8   ASP n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ILE n 
1 13  GLY n 
1 14  SER n 
1 15  GLY n 
1 16  PRO n 
1 17  GLY n 
1 18  GLY n 
1 19  TYR n 
1 20  VAL n 
1 21  ALA n 
1 22  ALA n 
1 23  ILE n 
1 24  LYS n 
1 25  ALA n 
1 26  ALA n 
1 27  GLN n 
1 28  LEU n 
1 29  GLY n 
1 30  PHE n 
1 31  LYS n 
1 32  THR n 
1 33  VAL n 
1 34  CYS n 
1 35  ILE n 
1 36  GLU n 
1 37  LYS n 
1 38  ASN n 
1 39  GLU n 
1 40  THR n 
1 41  LEU n 
1 42  GLY n 
1 43  GLY n 
1 44  THR n 
1 45  CYS n 
1 46  LEU n 
1 47  ASN n 
1 48  VAL n 
1 49  GLY n 
1 50  CYS n 
1 51  ILE n 
1 52  PRO n 
1 53  SER n 
1 54  LYS n 
1 55  ALA n 
1 56  LEU n 
1 57  LEU n 
1 58  ASN n 
1 59  ASN n 
1 60  SER n 
1 61  HIS n 
1 62  TYR n 
1 63  TYR n 
1 64  HIS n 
1 65  MET n 
1 66  ALA n 
1 67  HIS n 
1 68  GLY n 
1 69  THR n 
1 70  ASP n 
1 71  PHE n 
1 72  ALA n 
1 73  SER n 
1 74  ARG n 
1 75  GLY n 
1 76  ILE n 
1 77  GLU n 
1 78  MET n 
1 79  SER n 
1 80  GLU n 
1 81  VAL n 
1 82  ARG n 
1 83  LEU n 
1 84  ASN n 
1 85  LEU n 
1 86  ASP n 
1 87  LYS n 
1 88  MET n 
1 89  MET n 
1 90  GLU n 
1 91  GLN n 
1 92  LYS n 
1 93  SER n 
1 94  THR n 
1 95  ALA n 
1 96  VAL n 
1 97  LYS n 
1 98  ALA n 
1 99  LEU n 
1 100 THR n 
1 101 GLY n 
1 102 GLY n 
1 103 ILE n 
1 104 ALA n 
1 105 HIS n 
1 106 LEU n 
1 107 PHE n 
1 108 LYS n 
1 109 GLN n 
1 110 ASN n 
1 111 LYS n 
1 112 VAL n 
1 113 VAL n 
1 114 HIS n 
1 115 VAL n 
1 116 ASN n 
1 117 GLY n 
1 118 TYR n 
1 119 GLY n 
1 120 LYS n 
1 121 ILE n 
1 122 THR n 
1 123 GLY n 
1 124 LYS n 
1 125 ASN n 
1 126 GLN n 
1 127 VAL n 
1 128 THR n 
1 129 ALA n 
1 130 THR n 
1 131 LYS n 
1 132 ALA n 
1 133 ASP n 
1 134 GLY n 
1 135 GLY n 
1 136 THR n 
1 137 GLN n 
1 138 VAL n 
1 139 ILE n 
1 140 ASP n 
1 141 THR n 
1 142 LYS n 
1 143 ASN n 
1 144 ILE n 
1 145 LEU n 
1 146 ILE n 
1 147 ALA n 
1 148 THR n 
1 149 GLY n 
1 150 SER n 
1 151 GLU n 
1 152 VAL n 
1 153 THR n 
1 154 PRO n 
1 155 PHE n 
1 156 PRO n 
1 157 GLY n 
1 158 ILE n 
1 159 THR n 
1 160 ILE n 
1 161 ASP n 
1 162 GLU n 
1 163 ASP n 
1 164 THR n 
1 165 ILE n 
1 166 VAL n 
1 167 SER n 
1 168 SER n 
1 169 THR n 
1 170 GLY n 
1 171 ALA n 
1 172 LEU n 
1 173 SER n 
1 174 LEU n 
1 175 LYS n 
1 176 LYS n 
1 177 VAL n 
1 178 PRO n 
1 179 GLU n 
1 180 LYS n 
1 181 MET n 
1 182 VAL n 
1 183 VAL n 
1 184 ILE n 
1 185 GLY n 
1 186 ALA n 
1 187 GLY n 
1 188 VAL n 
1 189 ILE n 
1 190 GLY n 
1 191 VAL n 
1 192 GLU n 
1 193 LEU n 
1 194 GLY n 
1 195 SER n 
1 196 VAL n 
1 197 TRP n 
1 198 GLN n 
1 199 ARG n 
1 200 LEU n 
1 201 GLY n 
1 202 ALA n 
1 203 ASP n 
1 204 VAL n 
1 205 THR n 
1 206 ALA n 
1 207 VAL n 
1 208 GLU n 
1 209 PHE n 
1 210 LEU n 
1 211 GLY n 
1 212 HIS n 
1 213 VAL n 
1 214 GLY n 
1 215 GLY n 
1 216 VAL n 
1 217 GLY n 
1 218 ILE n 
1 219 ASP n 
1 220 MET n 
1 221 GLU n 
1 222 ILE n 
1 223 SER n 
1 224 LYS n 
1 225 ASN n 
1 226 PHE n 
1 227 GLN n 
1 228 ARG n 
1 229 ILE n 
1 230 LEU n 
1 231 GLN n 
1 232 LYS n 
1 233 GLN n 
1 234 GLY n 
1 235 PHE n 
1 236 LYS n 
1 237 PHE n 
1 238 LYS n 
1 239 LEU n 
1 240 ASN n 
1 241 THR n 
1 242 LYS n 
1 243 VAL n 
1 244 THR n 
1 245 GLY n 
1 246 ALA n 
1 247 THR n 
1 248 LYS n 
1 249 LYS n 
1 250 SER n 
1 251 ASP n 
1 252 GLY n 
1 253 LYS n 
1 254 ILE n 
1 255 ASP n 
1 256 VAL n 
1 257 SER n 
1 258 ILE n 
1 259 GLU n 
1 260 ALA n 
1 261 ALA n 
1 262 SER n 
1 263 GLY n 
1 264 GLY n 
1 265 LYS n 
1 266 ALA n 
1 267 GLU n 
1 268 VAL n 
1 269 ILE n 
1 270 THR n 
1 271 CYS n 
1 272 ASP n 
1 273 VAL n 
1 274 LEU n 
1 275 LEU n 
1 276 VAL n 
1 277 CYS n 
1 278 ILE n 
1 279 GLY n 
1 280 ARG n 
1 281 ARG n 
1 282 PRO n 
1 283 PHE n 
1 284 THR n 
1 285 LYS n 
1 286 ASN n 
1 287 LEU n 
1 288 GLY n 
1 289 LEU n 
1 290 GLU n 
1 291 GLU n 
1 292 LEU n 
1 293 GLY n 
1 294 ILE n 
1 295 GLU n 
1 296 LEU n 
1 297 ASP n 
1 298 PRO n 
1 299 ARG n 
1 300 GLY n 
1 301 ARG n 
1 302 ILE n 
1 303 PRO n 
1 304 VAL n 
1 305 ASN n 
1 306 THR n 
1 307 ARG n 
1 308 PHE n 
1 309 GLN n 
1 310 THR n 
1 311 LYS n 
1 312 ILE n 
1 313 PRO n 
1 314 ASN n 
1 315 ILE n 
1 316 TYR n 
1 317 ALA n 
1 318 ILE n 
1 319 GLY n 
1 320 ASP n 
1 321 VAL n 
1 322 VAL n 
1 323 ALA n 
1 324 GLY n 
1 325 PRO n 
1 326 MET n 
1 327 LEU n 
1 328 ALA n 
1 329 HIS n 
1 330 LYS n 
1 331 ALA n 
1 332 GLU n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 ILE n 
1 337 ILE n 
1 338 CYS n 
1 339 VAL n 
1 340 GLU n 
1 341 GLY n 
1 342 MET n 
1 343 ALA n 
1 344 GLY n 
1 345 GLY n 
1 346 ALA n 
1 347 VAL n 
1 348 HIS n 
1 349 ILE n 
1 350 ASP n 
1 351 TYR n 
1 352 ASN n 
1 353 CYS n 
1 354 VAL n 
1 355 PRO n 
1 356 SER n 
1 357 VAL n 
1 358 ILE n 
1 359 TYR n 
1 360 THR n 
1 361 HIS n 
1 362 PRO n 
1 363 GLU n 
1 364 VAL n 
1 365 ALA n 
1 366 TRP n 
1 367 VAL n 
1 368 GLY n 
1 369 LYS n 
1 370 SER n 
1 371 GLU n 
1 372 GLU n 
1 373 GLN n 
1 374 LEU n 
1 375 LYS n 
1 376 GLU n 
1 377 GLU n 
1 378 GLY n 
1 379 ILE n 
1 380 GLU n 
1 381 TYR n 
1 382 LYS n 
1 383 VAL n 
1 384 GLY n 
1 385 LYS n 
1 386 PHE n 
1 387 PRO n 
1 388 PHE n 
1 389 ALA n 
1 390 ALA n 
1 391 ASN n 
1 392 SER n 
1 393 ARG n 
1 394 ALA n 
1 395 LYS n 
1 396 THR n 
1 397 ASN n 
1 398 ALA n 
1 399 ASP n 
1 400 THR n 
1 401 ASP n 
1 402 GLY n 
1 403 MET n 
1 404 VAL n 
1 405 LYS n 
1 406 ILE n 
1 407 LEU n 
1 408 GLY n 
1 409 GLN n 
1 410 LYS n 
1 411 SER n 
1 412 THR n 
1 413 ASP n 
1 414 ARG n 
1 415 VAL n 
1 416 LEU n 
1 417 GLY n 
1 418 ALA n 
1 419 HIS n 
1 420 ILE n 
1 421 LEU n 
1 422 GLY n 
1 423 PRO n 
1 424 GLY n 
1 425 ALA n 
1 426 GLY n 
1 427 GLU n 
1 428 MET n 
1 429 VAL n 
1 430 ASN n 
1 431 GLU n 
1 432 ALA n 
1 433 ALA n 
1 434 LEU n 
1 435 ALA n 
1 436 LEU n 
1 437 GLU n 
1 438 TYR n 
1 439 GLY n 
1 440 ALA n 
1 441 SER n 
1 442 CYS n 
1 443 GLU n 
1 444 ASP n 
1 445 ILE n 
1 446 ALA n 
1 447 ARG n 
1 448 VAL n 
1 449 CYS n 
1 450 HIS n 
1 451 ALA n 
1 452 HIS n 
1 453 PRO n 
1 454 THR n 
1 455 LEU n 
1 456 SER n 
1 457 GLU n 
1 458 ALA n 
1 459 PHE n 
1 460 ARG n 
1 461 GLU n 
1 462 ALA n 
1 463 ASN n 
1 464 LEU n 
1 465 ALA n 
1 466 ALA n 
1 467 SER n 
1 468 PHE n 
1 469 GLY n 
1 470 LYS n 
1 471 SER n 
1 472 ILE n 
1 473 ASN n 
1 474 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'DLD, GCSL, LAD, PHE3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               XL1-blue 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pTrcHisThE3 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PLASMID 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DLDH_HUMAN 
_struct_ref.pdbx_db_accession          P09622 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGTDFASRGIEMSE
VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITI
DEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLN
TKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGD
VVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADT
DGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
;
_struct_ref.pdbx_align_begin           36 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZMC A 1 ? 474 ? P09622 36 ? 509 ? 1 474 
2 1 1ZMC B 1 ? 474 ? P09622 36 ? 509 ? 1 474 
3 1 1ZMC C 1 ? 474 ? P09622 36 ? 509 ? 1 474 
4 1 1ZMC D 1 ? 474 ? P09622 36 ? 509 ? 1 474 
5 1 1ZMC E 1 ? 474 ? P09622 36 ? 509 ? 1 474 
6 1 1ZMC F 1 ? 474 ? P09622 36 ? 509 ? 1 474 
7 1 1ZMC G 1 ? 474 ? P09622 36 ? 509 ? 1 474 
8 1 1ZMC H 1 ? 474 ? P09622 36 ? 509 ? 1 474 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'     ? 'C27 H33 N9 O15 P2' 785.550 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                     ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1ZMC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'HEPES, PEG 4000, ammonium sulfate, pH 7.0, temperature 293K, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   APS 
_diffrn_detector.pdbx_collection_date   2004-08-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979351 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979351 
# 
_reflns.entry_id                     1ZMC 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             43.1 
_reflns.d_resolution_high            2.53 
_reflns.number_obs                   156541 
_reflns.number_all                   157516 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.046 
_reflns.pdbx_netI_over_sigmaI        16.5 
_reflns.B_iso_Wilson_estimate        41.6 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.53 
_reflns_shell.d_res_low              2.62 
_reflns_shell.percent_possible_all   96.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.304 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        3.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      15176 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1ZMC 
_refine.ls_number_reflns_obs                     156541 
_refine.ls_number_reflns_all                     157870 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               4216083.98 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.09 
_refine.ls_d_res_high                            2.53 
_refine.ls_percent_reflns_obs                    99.2 
_refine.ls_R_factor_obs                          0.211 
_refine.ls_R_factor_all                          0.211 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_factor_R_free                       0.267 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.6 
_refine.ls_number_reflns_R_free                  940 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               37.9 
_refine.aniso_B[1][1]                            10.12 
_refine.aniso_B[2][2]                            -4.35 
_refine.aniso_B[3][3]                            -5.77 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.316101 
_refine.solvent_model_param_bsol                 30.5242 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1JEH 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ZMC 
_refine_analyze.Luzzati_coordinate_error_obs    0.31 
_refine_analyze.Luzzati_sigma_a_obs             0.29 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.31 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28057 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         854 
_refine_hist.number_atoms_solvent             1401 
_refine_hist.number_atoms_total               30312 
_refine_hist.d_res_high                       2.53 
_refine_hist.d_res_low                        43.09 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 2.08  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.21  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.97  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.00  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.97  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.53 
_refine_ls_shell.d_res_low                        2.69 
_refine_ls_shell.number_reflns_R_work             25329 
_refine_ls_shell.R_factor_R_work                  0.276 
_refine_ls_shell.percent_reflns_obs               98.1 
_refine_ls_shell.R_factor_R_free                  0.314 
_refine_ls_shell.R_factor_R_free_error            0.025 
_refine_ls_shell.percent_reflns_R_free            0.6 
_refine_ls_shell.number_reflns_R_free             156 
_refine_ls_shell.number_reflns_obs                25329 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   ?           'X-RAY DIFFRACTION' 
3 nad_drg.param     ?           'X-RAY DIFFRACTION' 
4 so4_drg.param     ?           'X-RAY DIFFRACTION' 
5 fad.param         ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ZMC 
_struct.title                     'Crystal Structure of Human dihydrolipoamide dehydrogenase complexed to NAD+' 
_struct.pdbx_descriptor           'Dihydrolipoyl dehydrogenase, mitochondrial (E.C.1.8.1.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZMC 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;E3, lipoamide dehydrogenase, pyruvate dehydrogenase, alpha-ketoglutarate dehydrogenase, branched-chain alpha-ketoacid dehydrogenase, glycine decarboxylase, glycine cleavage, OXIDOREDUCTASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 4 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 4 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 4 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 3 ? 
NA N N 4 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 3 ? 
TA N N 4 ? 
UA N N 2 ? 
VA N N 2 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 3 ? 
AB N N 4 ? 
BB N N 2 ? 
CB N N 2 ? 
DB N N 2 ? 
EB N N 2 ? 
FB N N 2 ? 
GB N N 3 ? 
HB N N 4 ? 
IB N N 5 ? 
JB N N 5 ? 
KB N N 5 ? 
LB N N 5 ? 
MB N N 5 ? 
NB N N 5 ? 
OB N N 5 ? 
PB N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
4 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 15  ? LEU A 28  ? GLY A 15  LEU A 28  1 ? 14 
HELX_P HELX_P2   2   GLY A 42  ? GLY A 49  ? GLY A 42  GLY A 49  1 ? 8  
HELX_P HELX_P3   3   GLY A 49  ? GLY A 68  ? GLY A 49  GLY A 68  1 ? 20 
HELX_P HELX_P4   4   PHE A 71  ? ARG A 74  ? PHE A 71  ARG A 74  5 ? 4  
HELX_P HELX_P5   5   ASN A 84  ? ASN A 110 ? ASN A 84  ASN A 110 1 ? 27 
HELX_P HELX_P6   6   SER A 167 ? LEU A 172 ? SER A 167 LEU A 172 1 ? 6  
HELX_P HELX_P7   7   GLY A 187 ? LEU A 200 ? GLY A 187 LEU A 200 1 ? 14 
HELX_P HELX_P8   8   ASP A 219 ? LYS A 232 ? ASP A 219 LYS A 232 1 ? 14 
HELX_P HELX_P9   9   GLY A 288 ? GLY A 293 ? GLY A 288 GLY A 293 1 ? 6  
HELX_P HELX_P10  10  GLY A 319 ? VAL A 322 ? GLY A 319 VAL A 322 5 ? 4  
HELX_P HELX_P11  11  LEU A 327 ? ALA A 343 ? LEU A 327 ALA A 343 1 ? 17 
HELX_P HELX_P12  12  ASP A 350 ? VAL A 354 ? ASP A 350 VAL A 354 5 ? 5  
HELX_P HELX_P13  13  SER A 370 ? GLU A 376 ? SER A 370 GLU A 376 1 ? 7  
HELX_P HELX_P14  14  ASN A 391 ? ASN A 397 ? ASN A 391 ASN A 397 1 ? 7  
HELX_P HELX_P15  15  GLY A 424 ? GLY A 439 ? GLY A 424 GLY A 439 1 ? 16 
HELX_P HELX_P16  16  SER A 441 ? VAL A 448 ? SER A 441 VAL A 448 1 ? 8  
HELX_P HELX_P17  17  LEU A 455 ? GLY A 469 ? LEU A 455 GLY A 469 1 ? 15 
HELX_P HELX_P18  18  GLY B 15  ? GLN B 27  ? GLY B 15  GLN B 27  1 ? 13 
HELX_P HELX_P19  19  GLY B 42  ? GLY B 49  ? GLY B 42  GLY B 49  1 ? 8  
HELX_P HELX_P20  20  GLY B 49  ? GLY B 68  ? GLY B 49  GLY B 68  1 ? 20 
HELX_P HELX_P21  21  PHE B 71  ? ARG B 74  ? PHE B 71  ARG B 74  5 ? 4  
HELX_P HELX_P22  22  ASN B 84  ? ASN B 110 ? ASN B 84  ASN B 110 1 ? 27 
HELX_P HELX_P23  23  SER B 167 ? LEU B 172 ? SER B 167 LEU B 172 1 ? 6  
HELX_P HELX_P24  24  GLY B 187 ? GLY B 201 ? GLY B 187 GLY B 201 1 ? 15 
HELX_P HELX_P25  25  ASP B 219 ? LYS B 232 ? ASP B 219 LYS B 232 1 ? 14 
HELX_P HELX_P26  26  GLY B 288 ? GLY B 293 ? GLY B 288 GLY B 293 1 ? 6  
HELX_P HELX_P27  27  GLY B 319 ? VAL B 322 ? GLY B 319 VAL B 322 5 ? 4  
HELX_P HELX_P28  28  LEU B 327 ? ALA B 343 ? LEU B 327 ALA B 343 1 ? 17 
HELX_P HELX_P29  29  SER B 370 ? GLU B 377 ? SER B 370 GLU B 377 1 ? 8  
HELX_P HELX_P30  30  ASN B 391 ? ASN B 397 ? ASN B 391 ASN B 397 1 ? 7  
HELX_P HELX_P31  31  GLY B 424 ? TYR B 438 ? GLY B 424 TYR B 438 1 ? 15 
HELX_P HELX_P32  32  SER B 441 ? VAL B 448 ? SER B 441 VAL B 448 1 ? 8  
HELX_P HELX_P33  33  LEU B 455 ? GLY B 469 ? LEU B 455 GLY B 469 1 ? 15 
HELX_P HELX_P34  34  GLY C 15  ? GLN C 27  ? GLY C 15  GLN C 27  1 ? 13 
HELX_P HELX_P35  35  GLY C 42  ? GLY C 49  ? GLY C 42  GLY C 49  1 ? 8  
HELX_P HELX_P36  36  GLY C 49  ? GLY C 68  ? GLY C 49  GLY C 68  1 ? 20 
HELX_P HELX_P37  37  PHE C 71  ? ARG C 74  ? PHE C 71  ARG C 74  5 ? 4  
HELX_P HELX_P38  38  ASN C 84  ? ASN C 110 ? ASN C 84  ASN C 110 1 ? 27 
HELX_P HELX_P39  39  SER C 167 ? LEU C 172 ? SER C 167 LEU C 172 1 ? 6  
HELX_P HELX_P40  40  GLY C 187 ? GLY C 201 ? GLY C 187 GLY C 201 1 ? 15 
HELX_P HELX_P41  41  ASP C 219 ? LYS C 232 ? ASP C 219 LYS C 232 1 ? 14 
HELX_P HELX_P42  42  GLY C 288 ? GLY C 293 ? GLY C 288 GLY C 293 1 ? 6  
HELX_P HELX_P43  43  GLY C 319 ? VAL C 322 ? GLY C 319 VAL C 322 5 ? 4  
HELX_P HELX_P44  44  LEU C 327 ? ALA C 343 ? LEU C 327 ALA C 343 1 ? 17 
HELX_P HELX_P45  45  SER C 370 ? GLY C 378 ? SER C 370 GLY C 378 1 ? 9  
HELX_P HELX_P46  46  ASN C 391 ? ALA C 398 ? ASN C 391 ALA C 398 1 ? 8  
HELX_P HELX_P47  47  GLY C 424 ? TYR C 438 ? GLY C 424 TYR C 438 1 ? 15 
HELX_P HELX_P48  48  SER C 441 ? VAL C 448 ? SER C 441 VAL C 448 1 ? 8  
HELX_P HELX_P49  49  LEU C 455 ? GLY C 469 ? LEU C 455 GLY C 469 1 ? 15 
HELX_P HELX_P50  50  GLY D 15  ? LEU D 28  ? GLY D 15  LEU D 28  1 ? 14 
HELX_P HELX_P51  51  GLY D 42  ? GLY D 49  ? GLY D 42  GLY D 49  1 ? 8  
HELX_P HELX_P52  52  GLY D 49  ? GLY D 68  ? GLY D 49  GLY D 68  1 ? 20 
HELX_P HELX_P53  53  PHE D 71  ? ARG D 74  ? PHE D 71  ARG D 74  5 ? 4  
HELX_P HELX_P54  54  ASN D 84  ? ASN D 110 ? ASN D 84  ASN D 110 1 ? 27 
HELX_P HELX_P55  55  SER D 167 ? SER D 173 ? SER D 167 SER D 173 1 ? 7  
HELX_P HELX_P56  56  GLY D 187 ? LEU D 200 ? GLY D 187 LEU D 200 1 ? 14 
HELX_P HELX_P57  57  ASP D 219 ? LYS D 232 ? ASP D 219 LYS D 232 1 ? 14 
HELX_P HELX_P58  58  GLY D 288 ? GLY D 293 ? GLY D 288 GLY D 293 1 ? 6  
HELX_P HELX_P59  59  GLY D 319 ? VAL D 322 ? GLY D 319 VAL D 322 5 ? 4  
HELX_P HELX_P60  60  LEU D 327 ? ALA D 343 ? LEU D 327 ALA D 343 1 ? 17 
HELX_P HELX_P61  61  ASP D 350 ? VAL D 354 ? ASP D 350 VAL D 354 5 ? 5  
HELX_P HELX_P62  62  SER D 370 ? GLY D 378 ? SER D 370 GLY D 378 1 ? 9  
HELX_P HELX_P63  63  ASN D 391 ? ALA D 398 ? ASN D 391 ALA D 398 1 ? 8  
HELX_P HELX_P64  64  GLY D 424 ? GLY D 439 ? GLY D 424 GLY D 439 1 ? 16 
HELX_P HELX_P65  65  SER D 441 ? VAL D 448 ? SER D 441 VAL D 448 1 ? 8  
HELX_P HELX_P66  66  LEU D 455 ? GLY D 469 ? LEU D 455 GLY D 469 1 ? 15 
HELX_P HELX_P67  67  GLY E 15  ? LEU E 28  ? GLY E 15  LEU E 28  1 ? 14 
HELX_P HELX_P68  68  GLY E 42  ? GLY E 49  ? GLY E 42  GLY E 49  1 ? 8  
HELX_P HELX_P69  69  GLY E 49  ? GLY E 68  ? GLY E 49  GLY E 68  1 ? 20 
HELX_P HELX_P70  70  PHE E 71  ? ARG E 74  ? PHE E 71  ARG E 74  5 ? 4  
HELX_P HELX_P71  71  ASN E 84  ? ASN E 110 ? ASN E 84  ASN E 110 1 ? 27 
HELX_P HELX_P72  72  SER E 167 ? LEU E 172 ? SER E 167 LEU E 172 1 ? 6  
HELX_P HELX_P73  73  GLY E 187 ? LEU E 200 ? GLY E 187 LEU E 200 1 ? 14 
HELX_P HELX_P74  74  ASP E 219 ? GLY E 234 ? ASP E 219 GLY E 234 1 ? 16 
HELX_P HELX_P75  75  LEU E 327 ? ALA E 343 ? LEU E 327 ALA E 343 1 ? 17 
HELX_P HELX_P76  76  ASP E 350 ? VAL E 354 ? ASP E 350 VAL E 354 5 ? 5  
HELX_P HELX_P77  77  SER E 370 ? GLU E 377 ? SER E 370 GLU E 377 1 ? 8  
HELX_P HELX_P78  78  ASN E 391 ? ALA E 398 ? ASN E 391 ALA E 398 1 ? 8  
HELX_P HELX_P79  79  GLY E 424 ? TYR E 438 ? GLY E 424 TYR E 438 1 ? 15 
HELX_P HELX_P80  80  SER E 441 ? VAL E 448 ? SER E 441 VAL E 448 1 ? 8  
HELX_P HELX_P81  81  LEU E 455 ? GLY E 469 ? LEU E 455 GLY E 469 1 ? 15 
HELX_P HELX_P82  82  GLY F 15  ? LEU F 28  ? GLY F 15  LEU F 28  1 ? 14 
HELX_P HELX_P83  83  GLY F 42  ? GLY F 49  ? GLY F 42  GLY F 49  1 ? 8  
HELX_P HELX_P84  84  GLY F 49  ? GLY F 68  ? GLY F 49  GLY F 68  1 ? 20 
HELX_P HELX_P85  85  PHE F 71  ? ARG F 74  ? PHE F 71  ARG F 74  5 ? 4  
HELX_P HELX_P86  86  ASN F 84  ? LYS F 111 ? ASN F 84  LYS F 111 1 ? 28 
HELX_P HELX_P87  87  SER F 167 ? LEU F 172 ? SER F 167 LEU F 172 1 ? 6  
HELX_P HELX_P88  88  GLY F 187 ? LEU F 200 ? GLY F 187 LEU F 200 1 ? 14 
HELX_P HELX_P89  89  ASP F 219 ? GLY F 234 ? ASP F 219 GLY F 234 1 ? 16 
HELX_P HELX_P90  90  GLY F 288 ? GLY F 293 ? GLY F 288 GLY F 293 1 ? 6  
HELX_P HELX_P91  91  GLY F 319 ? VAL F 322 ? GLY F 319 VAL F 322 5 ? 4  
HELX_P HELX_P92  92  LEU F 327 ? ALA F 343 ? LEU F 327 ALA F 343 1 ? 17 
HELX_P HELX_P93  93  ASP F 350 ? VAL F 354 ? ASP F 350 VAL F 354 5 ? 5  
HELX_P HELX_P94  94  SER F 370 ? GLY F 378 ? SER F 370 GLY F 378 1 ? 9  
HELX_P HELX_P95  95  ASN F 391 ? ALA F 398 ? ASN F 391 ALA F 398 1 ? 8  
HELX_P HELX_P96  96  GLY F 424 ? GLY F 439 ? GLY F 424 GLY F 439 1 ? 16 
HELX_P HELX_P97  97  SER F 441 ? VAL F 448 ? SER F 441 VAL F 448 1 ? 8  
HELX_P HELX_P98  98  LEU F 455 ? PHE F 468 ? LEU F 455 PHE F 468 1 ? 14 
HELX_P HELX_P99  99  GLY G 15  ? GLY G 29  ? GLY G 15  GLY G 29  1 ? 15 
HELX_P HELX_P100 100 GLY G 42  ? GLY G 49  ? GLY G 42  GLY G 49  1 ? 8  
HELX_P HELX_P101 101 GLY G 49  ? GLY G 68  ? GLY G 49  GLY G 68  1 ? 20 
HELX_P HELX_P102 102 GLY G 68  ? SER G 73  ? GLY G 68  SER G 73  1 ? 6  
HELX_P HELX_P103 103 ASN G 84  ? ASN G 110 ? ASN G 84  ASN G 110 1 ? 27 
HELX_P HELX_P104 104 SER G 167 ? LEU G 172 ? SER G 167 LEU G 172 1 ? 6  
HELX_P HELX_P105 105 GLY G 187 ? LEU G 200 ? GLY G 187 LEU G 200 1 ? 14 
HELX_P HELX_P106 106 ASP G 219 ? GLY G 234 ? ASP G 219 GLY G 234 1 ? 16 
HELX_P HELX_P107 107 GLY G 288 ? GLY G 293 ? GLY G 288 GLY G 293 1 ? 6  
HELX_P HELX_P108 108 GLY G 319 ? VAL G 322 ? GLY G 319 VAL G 322 5 ? 4  
HELX_P HELX_P109 109 LEU G 327 ? ALA G 343 ? LEU G 327 ALA G 343 1 ? 17 
HELX_P HELX_P110 110 ASP G 350 ? VAL G 354 ? ASP G 350 VAL G 354 5 ? 5  
HELX_P HELX_P111 111 SER G 370 ? GLY G 378 ? SER G 370 GLY G 378 1 ? 9  
HELX_P HELX_P112 112 ASN G 391 ? ALA G 398 ? ASN G 391 ALA G 398 1 ? 8  
HELX_P HELX_P113 113 GLY G 424 ? GLY G 439 ? GLY G 424 GLY G 439 1 ? 16 
HELX_P HELX_P114 114 SER G 441 ? VAL G 448 ? SER G 441 VAL G 448 1 ? 8  
HELX_P HELX_P115 115 LEU G 455 ? PHE G 468 ? LEU G 455 PHE G 468 1 ? 14 
HELX_P HELX_P116 116 GLY H 15  ? LEU H 28  ? GLY H 15  LEU H 28  1 ? 14 
HELX_P HELX_P117 117 GLY H 42  ? GLY H 49  ? GLY H 42  GLY H 49  1 ? 8  
HELX_P HELX_P118 118 GLY H 49  ? GLY H 68  ? GLY H 49  GLY H 68  1 ? 20 
HELX_P HELX_P119 119 GLY H 68  ? ARG H 74  ? GLY H 68  ARG H 74  1 ? 7  
HELX_P HELX_P120 120 ASN H 84  ? LYS H 111 ? ASN H 84  LYS H 111 1 ? 28 
HELX_P HELX_P121 121 SER H 167 ? LEU H 172 ? SER H 167 LEU H 172 1 ? 6  
HELX_P HELX_P122 122 GLY H 187 ? LEU H 200 ? GLY H 187 LEU H 200 1 ? 14 
HELX_P HELX_P123 123 ASP H 219 ? GLY H 234 ? ASP H 219 GLY H 234 1 ? 16 
HELX_P HELX_P124 124 GLY H 288 ? GLY H 293 ? GLY H 288 GLY H 293 1 ? 6  
HELX_P HELX_P125 125 GLY H 319 ? VAL H 322 ? GLY H 319 VAL H 322 5 ? 4  
HELX_P HELX_P126 126 LEU H 327 ? ALA H 343 ? LEU H 327 ALA H 343 1 ? 17 
HELX_P HELX_P127 127 ASP H 350 ? VAL H 354 ? ASP H 350 VAL H 354 5 ? 5  
HELX_P HELX_P128 128 SER H 370 ? GLU H 377 ? SER H 370 GLU H 377 1 ? 8  
HELX_P HELX_P129 129 ASN H 391 ? ASN H 397 ? ASN H 391 ASN H 397 1 ? 7  
HELX_P HELX_P130 130 GLY H 424 ? TYR H 438 ? GLY H 424 TYR H 438 1 ? 15 
HELX_P HELX_P131 131 SER H 441 ? ARG H 447 ? SER H 441 ARG H 447 1 ? 7  
HELX_P HELX_P132 132 LEU H 455 ? GLY H 469 ? LEU H 455 GLY H 469 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            45 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            50 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             45 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             50 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.085 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  HIS 361 A . ? HIS 361 A PRO 362 A ? PRO 362 A 1 0.36  
2  HIS 452 A . ? HIS 452 A PRO 453 A ? PRO 453 A 1 0.09  
3  HIS 361 B . ? HIS 361 B PRO 362 B ? PRO 362 B 1 0.47  
4  HIS 452 B . ? HIS 452 B PRO 453 B ? PRO 453 B 1 0.17  
5  HIS 361 C . ? HIS 361 C PRO 362 C ? PRO 362 C 1 0.33  
6  HIS 452 C . ? HIS 452 C PRO 453 C ? PRO 453 C 1 -0.19 
7  HIS 361 D . ? HIS 361 D PRO 362 D ? PRO 362 D 1 0.57  
8  HIS 452 D . ? HIS 452 D PRO 453 D ? PRO 453 D 1 -0.06 
9  HIS 361 E . ? HIS 361 E PRO 362 E ? PRO 362 E 1 0.18  
10 HIS 452 E . ? HIS 452 E PRO 453 E ? PRO 453 E 1 -0.10 
11 HIS 361 F . ? HIS 361 F PRO 362 F ? PRO 362 F 1 0.26  
12 HIS 452 F . ? HIS 452 F PRO 453 F ? PRO 453 F 1 -0.15 
13 HIS 361 G . ? HIS 361 G PRO 362 G ? PRO 362 G 1 0.14  
14 HIS 452 G . ? HIS 452 G PRO 453 G ? PRO 453 G 1 -0.07 
15 HIS 361 H . ? HIS 361 H PRO 362 H ? PRO 362 H 1 0.46  
16 HIS 452 H . ? HIS 452 H PRO 453 H ? PRO 453 H 1 0.16  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 6 ? 
B  ? 5 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 5 ? 
G  ? 3 ? 
H  ? 5 ? 
I  ? 6 ? 
J  ? 5 ? 
K  ? 2 ? 
L  ? 5 ? 
M  ? 3 ? 
N  ? 5 ? 
O  ? 6 ? 
P  ? 5 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 2 ? 
T  ? 5 ? 
U  ? 3 ? 
V  ? 5 ? 
W  ? 6 ? 
X  ? 5 ? 
Y  ? 2 ? 
Z  ? 5 ? 
AA ? 3 ? 
AB ? 5 ? 
AC ? 6 ? 
AD ? 5 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 5 ? 
AI ? 3 ? 
AJ ? 5 ? 
AK ? 6 ? 
AL ? 5 ? 
AM ? 2 ? 
AN ? 5 ? 
AO ? 3 ? 
AP ? 5 ? 
AQ ? 6 ? 
AR ? 5 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 5 ? 
AW ? 3 ? 
AX ? 5 ? 
AY ? 6 ? 
AZ ? 5 ? 
BA ? 2 ? 
BB ? 5 ? 
BC ? 3 ? 
BD ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
B  1 2 ? parallel      
B  2 3 ? parallel      
B  3 4 ? parallel      
B  4 5 ? parallel      
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? parallel      
F  2 3 ? parallel      
F  3 4 ? parallel      
F  4 5 ? parallel      
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
I  1 2 ? parallel      
I  2 3 ? parallel      
I  3 4 ? parallel      
I  4 5 ? anti-parallel 
I  5 6 ? anti-parallel 
J  1 2 ? parallel      
J  2 3 ? parallel      
J  3 4 ? parallel      
J  4 5 ? parallel      
K  1 2 ? anti-parallel 
L  1 2 ? parallel      
L  2 3 ? parallel      
L  3 4 ? parallel      
L  4 5 ? parallel      
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
O  1 2 ? parallel      
O  2 3 ? parallel      
O  3 4 ? parallel      
O  4 5 ? anti-parallel 
O  5 6 ? anti-parallel 
P  1 2 ? parallel      
P  2 3 ? parallel      
P  3 4 ? parallel      
P  4 5 ? parallel      
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? parallel      
T  2 3 ? parallel      
T  3 4 ? parallel      
T  4 5 ? parallel      
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
V  4 5 ? anti-parallel 
W  1 2 ? parallel      
W  2 3 ? parallel      
W  3 4 ? parallel      
W  4 5 ? anti-parallel 
W  5 6 ? anti-parallel 
X  1 2 ? parallel      
X  2 3 ? parallel      
X  3 4 ? parallel      
X  4 5 ? parallel      
Y  1 2 ? anti-parallel 
Z  1 2 ? parallel      
Z  2 3 ? parallel      
Z  3 4 ? parallel      
Z  4 5 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AC 4 5 ? anti-parallel 
AC 5 6 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AD 3 4 ? parallel      
AD 4 5 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? parallel      
AH 2 3 ? parallel      
AH 3 4 ? parallel      
AH 4 5 ? parallel      
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AK 1 2 ? parallel      
AK 2 3 ? parallel      
AK 3 4 ? parallel      
AK 4 5 ? anti-parallel 
AK 5 6 ? anti-parallel 
AL 1 2 ? parallel      
AL 2 3 ? parallel      
AL 3 4 ? parallel      
AL 4 5 ? parallel      
AM 1 2 ? anti-parallel 
AN 1 2 ? parallel      
AN 2 3 ? parallel      
AN 3 4 ? parallel      
AN 4 5 ? parallel      
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AQ 1 2 ? parallel      
AQ 2 3 ? parallel      
AQ 3 4 ? parallel      
AQ 4 5 ? anti-parallel 
AQ 5 6 ? anti-parallel 
AR 1 2 ? parallel      
AR 2 3 ? parallel      
AR 3 4 ? parallel      
AR 4 5 ? parallel      
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? parallel      
AV 2 3 ? parallel      
AV 3 4 ? parallel      
AV 4 5 ? parallel      
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AX 4 5 ? anti-parallel 
AY 1 2 ? parallel      
AY 2 3 ? parallel      
AY 3 4 ? parallel      
AY 4 5 ? anti-parallel 
AY 5 6 ? anti-parallel 
AZ 1 2 ? parallel      
AZ 2 3 ? parallel      
AZ 3 4 ? parallel      
AZ 4 5 ? parallel      
BA 1 2 ? anti-parallel 
BB 1 2 ? parallel      
BB 2 3 ? parallel      
BB 3 4 ? parallel      
BB 4 5 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 113 ? ASN A 116 ? VAL A 113 ASN A 116 
A  2 THR A 32  ? GLU A 36  ? THR A 32  GLU A 36  
A  3 ILE A 5   ? ILE A 12  ? ILE A 5   ILE A 12  
A  4 THR A 136 ? ILE A 146 ? THR A 136 ILE A 146 
A  5 GLN A 126 ? THR A 130 ? GLN A 126 THR A 130 
A  6 TYR A 118 ? GLY A 123 ? TYR A 118 GLY A 123 
B  1 VAL A 113 ? ASN A 116 ? VAL A 113 ASN A 116 
B  2 THR A 32  ? GLU A 36  ? THR A 32  GLU A 36  
B  3 ILE A 5   ? ILE A 12  ? ILE A 5   ILE A 12  
B  4 THR A 136 ? ILE A 146 ? THR A 136 ILE A 146 
B  5 ILE A 315 ? ALA A 317 ? ILE A 315 ALA A 317 
C  1 ILE A 76  ? MET A 78  ? ILE A 76  MET A 78  
C  2 VAL B 81  ? LEU B 83  ? VAL B 81  LEU B 83  
D  1 VAL A 81  ? LEU A 83  ? VAL A 81  LEU A 83  
D  2 ILE B 76  ? MET B 78  ? ILE B 76  MET B 78  
E  1 SER A 150 ? VAL A 152 ? SER A 150 VAL A 152 
E  2 ARG A 280 ? PRO A 282 ? ARG A 280 PRO A 282 
F  1 ILE A 165 ? VAL A 166 ? ILE A 165 VAL A 166 
F  2 VAL A 273 ? VAL A 276 ? VAL A 273 VAL A 276 
F  3 LYS A 180 ? ILE A 184 ? LYS A 180 ILE A 184 
F  4 ASP A 203 ? VAL A 207 ? ASP A 203 VAL A 207 
F  5 LYS A 236 ? LYS A 238 ? LYS A 236 LYS A 238 
G  1 THR A 241 ? LYS A 248 ? THR A 241 LYS A 248 
G  2 ILE A 254 ? ALA A 260 ? ILE A 254 ALA A 260 
G  3 GLU A 267 ? CYS A 271 ? GLU A 267 CYS A 271 
H  1 SER A 356 ? ILE A 358 ? SER A 356 ILE A 358 
H  2 GLU A 363 ? GLY A 368 ? GLU A 363 GLY A 368 
H  3 VAL A 415 ? GLY A 422 ? VAL A 415 GLY A 422 
H  4 MET A 403 ? GLN A 409 ? MET A 403 GLN A 409 
H  5 TYR A 381 ? PRO A 387 ? TYR A 381 PRO A 387 
I  1 VAL B 113 ? ASN B 116 ? VAL B 113 ASN B 116 
I  2 THR B 32  ? GLU B 36  ? THR B 32  GLU B 36  
I  3 ILE B 5   ? ILE B 12  ? ILE B 5   ILE B 12  
I  4 VAL B 138 ? ILE B 146 ? VAL B 138 ILE B 146 
I  5 GLN B 126 ? THR B 130 ? GLN B 126 THR B 130 
I  6 TYR B 118 ? GLY B 123 ? TYR B 118 GLY B 123 
J  1 VAL B 113 ? ASN B 116 ? VAL B 113 ASN B 116 
J  2 THR B 32  ? GLU B 36  ? THR B 32  GLU B 36  
J  3 ILE B 5   ? ILE B 12  ? ILE B 5   ILE B 12  
J  4 VAL B 138 ? ILE B 146 ? VAL B 138 ILE B 146 
J  5 ILE B 315 ? ALA B 317 ? ILE B 315 ALA B 317 
K  1 SER B 150 ? VAL B 152 ? SER B 150 VAL B 152 
K  2 ARG B 280 ? PRO B 282 ? ARG B 280 PRO B 282 
L  1 ILE B 165 ? VAL B 166 ? ILE B 165 VAL B 166 
L  2 VAL B 273 ? VAL B 276 ? VAL B 273 VAL B 276 
L  3 LYS B 180 ? ILE B 184 ? LYS B 180 ILE B 184 
L  4 ASP B 203 ? GLU B 208 ? ASP B 203 GLU B 208 
L  5 LYS B 236 ? LEU B 239 ? LYS B 236 LEU B 239 
M  1 THR B 241 ? LYS B 248 ? THR B 241 LYS B 248 
M  2 ILE B 254 ? ALA B 260 ? ILE B 254 ALA B 260 
M  3 GLU B 267 ? CYS B 271 ? GLU B 267 CYS B 271 
N  1 SER B 356 ? ILE B 358 ? SER B 356 ILE B 358 
N  2 GLU B 363 ? GLY B 368 ? GLU B 363 GLY B 368 
N  3 VAL B 415 ? GLY B 422 ? VAL B 415 GLY B 422 
N  4 MET B 403 ? GLN B 409 ? MET B 403 GLN B 409 
N  5 TYR B 381 ? PRO B 387 ? TYR B 381 PRO B 387 
O  1 VAL C 113 ? ASN C 116 ? VAL C 113 ASN C 116 
O  2 THR C 32  ? GLU C 36  ? THR C 32  GLU C 36  
O  3 ILE C 5   ? ILE C 12  ? ILE C 5   ILE C 12  
O  4 VAL C 138 ? ILE C 146 ? VAL C 138 ILE C 146 
O  5 GLN C 126 ? THR C 130 ? GLN C 126 THR C 130 
O  6 TYR C 118 ? GLY C 123 ? TYR C 118 GLY C 123 
P  1 VAL C 113 ? ASN C 116 ? VAL C 113 ASN C 116 
P  2 THR C 32  ? GLU C 36  ? THR C 32  GLU C 36  
P  3 ILE C 5   ? ILE C 12  ? ILE C 5   ILE C 12  
P  4 VAL C 138 ? ILE C 146 ? VAL C 138 ILE C 146 
P  5 ILE C 315 ? ALA C 317 ? ILE C 315 ALA C 317 
Q  1 ILE C 76  ? MET C 78  ? ILE C 76  MET C 78  
Q  2 VAL D 81  ? LEU D 83  ? VAL D 81  LEU D 83  
R  1 VAL C 81  ? LEU C 83  ? VAL C 81  LEU C 83  
R  2 ILE D 76  ? MET D 78  ? ILE D 76  MET D 78  
S  1 SER C 150 ? VAL C 152 ? SER C 150 VAL C 152 
S  2 ARG C 280 ? PRO C 282 ? ARG C 280 PRO C 282 
T  1 ILE C 165 ? VAL C 166 ? ILE C 165 VAL C 166 
T  2 VAL C 273 ? VAL C 276 ? VAL C 273 VAL C 276 
T  3 LYS C 180 ? ILE C 184 ? LYS C 180 ILE C 184 
T  4 ASP C 203 ? GLU C 208 ? ASP C 203 GLU C 208 
T  5 LYS C 236 ? LEU C 239 ? LYS C 236 LEU C 239 
U  1 THR C 241 ? LYS C 248 ? THR C 241 LYS C 248 
U  2 ILE C 254 ? ALA C 260 ? ILE C 254 ALA C 260 
U  3 GLU C 267 ? CYS C 271 ? GLU C 267 CYS C 271 
V  1 SER C 356 ? ILE C 358 ? SER C 356 ILE C 358 
V  2 GLU C 363 ? GLY C 368 ? GLU C 363 GLY C 368 
V  3 VAL C 415 ? GLY C 422 ? VAL C 415 GLY C 422 
V  4 MET C 403 ? GLN C 409 ? MET C 403 GLN C 409 
V  5 TYR C 381 ? PRO C 387 ? TYR C 381 PRO C 387 
W  1 VAL D 113 ? ASN D 116 ? VAL D 113 ASN D 116 
W  2 THR D 32  ? GLU D 36  ? THR D 32  GLU D 36  
W  3 ILE D 5   ? ILE D 12  ? ILE D 5   ILE D 12  
W  4 THR D 136 ? ILE D 146 ? THR D 136 ILE D 146 
W  5 GLN D 126 ? THR D 130 ? GLN D 126 THR D 130 
W  6 TYR D 118 ? GLY D 123 ? TYR D 118 GLY D 123 
X  1 VAL D 113 ? ASN D 116 ? VAL D 113 ASN D 116 
X  2 THR D 32  ? GLU D 36  ? THR D 32  GLU D 36  
X  3 ILE D 5   ? ILE D 12  ? ILE D 5   ILE D 12  
X  4 THR D 136 ? ILE D 146 ? THR D 136 ILE D 146 
X  5 ILE D 315 ? ALA D 317 ? ILE D 315 ALA D 317 
Y  1 SER D 150 ? VAL D 152 ? SER D 150 VAL D 152 
Y  2 ARG D 280 ? PRO D 282 ? ARG D 280 PRO D 282 
Z  1 ILE D 165 ? VAL D 166 ? ILE D 165 VAL D 166 
Z  2 VAL D 273 ? VAL D 276 ? VAL D 273 VAL D 276 
Z  3 LYS D 180 ? ILE D 184 ? LYS D 180 ILE D 184 
Z  4 ASP D 203 ? VAL D 207 ? ASP D 203 VAL D 207 
Z  5 LYS D 236 ? LYS D 238 ? LYS D 236 LYS D 238 
AA 1 GLY D 245 ? LYS D 248 ? GLY D 245 LYS D 248 
AA 2 ILE D 254 ? ILE D 258 ? ILE D 254 ILE D 258 
AA 3 GLU D 267 ? CYS D 271 ? GLU D 267 CYS D 271 
AB 1 SER D 356 ? ILE D 358 ? SER D 356 ILE D 358 
AB 2 GLU D 363 ? GLY D 368 ? GLU D 363 GLY D 368 
AB 3 VAL D 415 ? GLY D 422 ? VAL D 415 GLY D 422 
AB 4 MET D 403 ? GLN D 409 ? MET D 403 GLN D 409 
AB 5 TYR D 381 ? PRO D 387 ? TYR D 381 PRO D 387 
AC 1 VAL E 113 ? ASN E 116 ? VAL E 113 ASN E 116 
AC 2 THR E 32  ? GLU E 36  ? THR E 32  GLU E 36  
AC 3 ILE E 5   ? ILE E 12  ? ILE E 5   ILE E 12  
AC 4 VAL E 138 ? ILE E 146 ? VAL E 138 ILE E 146 
AC 5 GLN E 126 ? THR E 130 ? GLN E 126 THR E 130 
AC 6 TYR E 118 ? GLY E 123 ? TYR E 118 GLY E 123 
AD 1 VAL E 113 ? ASN E 116 ? VAL E 113 ASN E 116 
AD 2 THR E 32  ? GLU E 36  ? THR E 32  GLU E 36  
AD 3 ILE E 5   ? ILE E 12  ? ILE E 5   ILE E 12  
AD 4 VAL E 138 ? ILE E 146 ? VAL E 138 ILE E 146 
AD 5 ILE E 315 ? ALA E 317 ? ILE E 315 ALA E 317 
AE 1 ILE E 76  ? MET E 78  ? ILE E 76  MET E 78  
AE 2 VAL F 81  ? LEU F 83  ? VAL F 81  LEU F 83  
AF 1 VAL E 81  ? LEU E 83  ? VAL E 81  LEU E 83  
AF 2 ILE F 76  ? MET F 78  ? ILE F 76  MET F 78  
AG 1 SER E 150 ? VAL E 152 ? SER E 150 VAL E 152 
AG 2 ARG E 280 ? PRO E 282 ? ARG E 280 PRO E 282 
AH 1 ILE E 165 ? VAL E 166 ? ILE E 165 VAL E 166 
AH 2 VAL E 273 ? VAL E 276 ? VAL E 273 VAL E 276 
AH 3 LYS E 180 ? ILE E 184 ? LYS E 180 ILE E 184 
AH 4 ASP E 203 ? GLU E 208 ? ASP E 203 GLU E 208 
AH 5 LYS E 236 ? LEU E 239 ? LYS E 236 LEU E 239 
AI 1 THR E 241 ? LYS E 248 ? THR E 241 LYS E 248 
AI 2 ILE E 254 ? ALA E 260 ? ILE E 254 ALA E 260 
AI 3 GLU E 267 ? CYS E 271 ? GLU E 267 CYS E 271 
AJ 1 SER E 356 ? ILE E 358 ? SER E 356 ILE E 358 
AJ 2 GLU E 363 ? GLY E 368 ? GLU E 363 GLY E 368 
AJ 3 VAL E 415 ? GLY E 422 ? VAL E 415 GLY E 422 
AJ 4 MET E 403 ? GLN E 409 ? MET E 403 GLN E 409 
AJ 5 TYR E 381 ? PRO E 387 ? TYR E 381 PRO E 387 
AK 1 VAL F 113 ? ASN F 116 ? VAL F 113 ASN F 116 
AK 2 THR F 32  ? GLU F 36  ? THR F 32  GLU F 36  
AK 3 ILE F 5   ? ILE F 12  ? ILE F 5   ILE F 12  
AK 4 THR F 136 ? ILE F 146 ? THR F 136 ILE F 146 
AK 5 GLN F 126 ? THR F 130 ? GLN F 126 THR F 130 
AK 6 TYR F 118 ? GLY F 123 ? TYR F 118 GLY F 123 
AL 1 VAL F 113 ? ASN F 116 ? VAL F 113 ASN F 116 
AL 2 THR F 32  ? GLU F 36  ? THR F 32  GLU F 36  
AL 3 ILE F 5   ? ILE F 12  ? ILE F 5   ILE F 12  
AL 4 THR F 136 ? ILE F 146 ? THR F 136 ILE F 146 
AL 5 ILE F 315 ? ALA F 317 ? ILE F 315 ALA F 317 
AM 1 SER F 150 ? VAL F 152 ? SER F 150 VAL F 152 
AM 2 ARG F 280 ? PRO F 282 ? ARG F 280 PRO F 282 
AN 1 ILE F 165 ? VAL F 166 ? ILE F 165 VAL F 166 
AN 2 VAL F 273 ? VAL F 276 ? VAL F 273 VAL F 276 
AN 3 LYS F 180 ? ILE F 184 ? LYS F 180 ILE F 184 
AN 4 ASP F 203 ? GLU F 208 ? ASP F 203 GLU F 208 
AN 5 LYS F 236 ? LEU F 239 ? LYS F 236 LEU F 239 
AO 1 THR F 241 ? LYS F 248 ? THR F 241 LYS F 248 
AO 2 ILE F 254 ? ALA F 260 ? ILE F 254 ALA F 260 
AO 3 GLU F 267 ? CYS F 271 ? GLU F 267 CYS F 271 
AP 1 SER F 356 ? ILE F 358 ? SER F 356 ILE F 358 
AP 2 GLU F 363 ? GLY F 368 ? GLU F 363 GLY F 368 
AP 3 VAL F 415 ? GLY F 422 ? VAL F 415 GLY F 422 
AP 4 MET F 403 ? GLN F 409 ? MET F 403 GLN F 409 
AP 5 TYR F 381 ? PRO F 387 ? TYR F 381 PRO F 387 
AQ 1 VAL G 113 ? ASN G 116 ? VAL G 113 ASN G 116 
AQ 2 THR G 32  ? GLU G 36  ? THR G 32  GLU G 36  
AQ 3 ILE G 5   ? ILE G 12  ? ILE G 5   ILE G 12  
AQ 4 THR G 136 ? ILE G 146 ? THR G 136 ILE G 146 
AQ 5 GLN G 126 ? THR G 130 ? GLN G 126 THR G 130 
AQ 6 TYR G 118 ? GLY G 123 ? TYR G 118 GLY G 123 
AR 1 VAL G 113 ? ASN G 116 ? VAL G 113 ASN G 116 
AR 2 THR G 32  ? GLU G 36  ? THR G 32  GLU G 36  
AR 3 ILE G 5   ? ILE G 12  ? ILE G 5   ILE G 12  
AR 4 THR G 136 ? ILE G 146 ? THR G 136 ILE G 146 
AR 5 ILE G 315 ? ALA G 317 ? ILE G 315 ALA G 317 
AS 1 ILE G 76  ? MET G 78  ? ILE G 76  MET G 78  
AS 2 VAL H 81  ? LEU H 83  ? VAL H 81  LEU H 83  
AT 1 VAL G 81  ? LEU G 83  ? VAL G 81  LEU G 83  
AT 2 ILE H 76  ? MET H 78  ? ILE H 76  MET H 78  
AU 1 SER G 150 ? VAL G 152 ? SER G 150 VAL G 152 
AU 2 ARG G 280 ? PRO G 282 ? ARG G 280 PRO G 282 
AV 1 ILE G 165 ? VAL G 166 ? ILE G 165 VAL G 166 
AV 2 VAL G 273 ? VAL G 276 ? VAL G 273 VAL G 276 
AV 3 LYS G 180 ? ILE G 184 ? LYS G 180 ILE G 184 
AV 4 ASP G 203 ? GLU G 208 ? ASP G 203 GLU G 208 
AV 5 LYS G 236 ? LEU G 239 ? LYS G 236 LEU G 239 
AW 1 THR G 241 ? LYS G 248 ? THR G 241 LYS G 248 
AW 2 ILE G 254 ? ALA G 260 ? ILE G 254 ALA G 260 
AW 3 GLU G 267 ? CYS G 271 ? GLU G 267 CYS G 271 
AX 1 SER G 356 ? ILE G 358 ? SER G 356 ILE G 358 
AX 2 GLU G 363 ? GLY G 368 ? GLU G 363 GLY G 368 
AX 3 VAL G 415 ? GLY G 422 ? VAL G 415 GLY G 422 
AX 4 MET G 403 ? GLN G 409 ? MET G 403 GLN G 409 
AX 5 TYR G 381 ? PRO G 387 ? TYR G 381 PRO G 387 
AY 1 VAL H 113 ? ASN H 116 ? VAL H 113 ASN H 116 
AY 2 THR H 32  ? GLU H 36  ? THR H 32  GLU H 36  
AY 3 ILE H 5   ? ILE H 12  ? ILE H 5   ILE H 12  
AY 4 THR H 136 ? ILE H 146 ? THR H 136 ILE H 146 
AY 5 GLN H 126 ? THR H 130 ? GLN H 126 THR H 130 
AY 6 TYR H 118 ? GLY H 123 ? TYR H 118 GLY H 123 
AZ 1 VAL H 113 ? ASN H 116 ? VAL H 113 ASN H 116 
AZ 2 THR H 32  ? GLU H 36  ? THR H 32  GLU H 36  
AZ 3 ILE H 5   ? ILE H 12  ? ILE H 5   ILE H 12  
AZ 4 THR H 136 ? ILE H 146 ? THR H 136 ILE H 146 
AZ 5 ILE H 315 ? ALA H 317 ? ILE H 315 ALA H 317 
BA 1 SER H 150 ? VAL H 152 ? SER H 150 VAL H 152 
BA 2 ARG H 280 ? PRO H 282 ? ARG H 280 PRO H 282 
BB 1 ILE H 165 ? VAL H 166 ? ILE H 165 VAL H 166 
BB 2 VAL H 273 ? VAL H 276 ? VAL H 273 VAL H 276 
BB 3 LYS H 180 ? ILE H 184 ? LYS H 180 ILE H 184 
BB 4 ASP H 203 ? VAL H 207 ? ASP H 203 VAL H 207 
BB 5 LYS H 236 ? LYS H 238 ? LYS H 236 LYS H 238 
BC 1 THR H 241 ? LYS H 248 ? THR H 241 LYS H 248 
BC 2 ILE H 254 ? ALA H 260 ? ILE H 254 ALA H 260 
BC 3 GLU H 267 ? CYS H 271 ? GLU H 267 CYS H 271 
BD 1 SER H 356 ? ILE H 358 ? SER H 356 ILE H 358 
BD 2 GLU H 363 ? GLY H 368 ? GLU H 363 GLY H 368 
BD 3 VAL H 415 ? GLY H 422 ? VAL H 415 GLY H 422 
BD 4 MET H 403 ? GLN H 409 ? MET H 403 GLN H 409 
BD 5 TYR H 381 ? PRO H 387 ? TYR H 381 PRO H 387 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O VAL A 115 ? O VAL A 115 N CYS A 34  ? N CYS A 34  
A  2 3 O VAL A 33  ? O VAL A 33  N VAL A 11  ? N VAL A 11  
A  3 4 N ILE A 12  ? N ILE A 12  O LEU A 145 ? O LEU A 145 
A  4 5 O GLN A 137 ? O GLN A 137 N ALA A 129 ? N ALA A 129 
A  5 6 O THR A 128 ? O THR A 128 N LYS A 120 ? N LYS A 120 
B  1 2 O VAL A 115 ? O VAL A 115 N CYS A 34  ? N CYS A 34  
B  2 3 O VAL A 33  ? O VAL A 33  N VAL A 11  ? N VAL A 11  
B  3 4 N ILE A 12  ? N ILE A 12  O LEU A 145 ? O LEU A 145 
B  4 5 N ILE A 146 ? N ILE A 146 O TYR A 316 ? O TYR A 316 
C  1 2 N GLU A 77  ? N GLU A 77  O ARG B 82  ? O ARG B 82  
D  1 2 N ARG A 82  ? N ARG A 82  O GLU B 77  ? O GLU B 77  
E  1 2 N GLU A 151 ? N GLU A 151 O ARG A 281 ? O ARG A 281 
F  1 2 N VAL A 166 ? N VAL A 166 O VAL A 276 ? O VAL A 276 
F  2 3 O LEU A 275 ? O LEU A 275 N ILE A 184 ? N ILE A 184 
F  3 4 N MET A 181 ? N MET A 181 O ASP A 203 ? O ASP A 203 
F  4 5 N ALA A 206 ? N ALA A 206 O LYS A 238 ? O LYS A 238 
G  1 2 N LYS A 242 ? N LYS A 242 O GLU A 259 ? O GLU A 259 
G  2 3 N VAL A 256 ? N VAL A 256 O ILE A 269 ? O ILE A 269 
H  1 2 N ILE A 358 ? N ILE A 358 O VAL A 364 ? O VAL A 364 
H  2 3 N ALA A 365 ? N ALA A 365 O ILE A 420 ? O ILE A 420 
H  3 4 O LEU A 416 ? O LEU A 416 N LEU A 407 ? N LEU A 407 
H  4 5 O VAL A 404 ? O VAL A 404 N PHE A 386 ? N PHE A 386 
I  1 2 O VAL B 113 ? O VAL B 113 N CYS B 34  ? N CYS B 34  
I  2 3 O ILE B 35  ? O ILE B 35  N VAL B 11  ? N VAL B 11  
I  3 4 N ALA B 7   ? N ALA B 7   O ASP B 140 ? O ASP B 140 
I  4 5 O ILE B 139 ? O ILE B 139 N VAL B 127 ? N VAL B 127 
I  5 6 O GLN B 126 ? O GLN B 126 N GLY B 123 ? N GLY B 123 
J  1 2 O VAL B 113 ? O VAL B 113 N CYS B 34  ? N CYS B 34  
J  2 3 O ILE B 35  ? O ILE B 35  N VAL B 11  ? N VAL B 11  
J  3 4 N ALA B 7   ? N ALA B 7   O ASP B 140 ? O ASP B 140 
J  4 5 N ILE B 146 ? N ILE B 146 O TYR B 316 ? O TYR B 316 
K  1 2 N GLU B 151 ? N GLU B 151 O ARG B 281 ? O ARG B 281 
L  1 2 N VAL B 166 ? N VAL B 166 O VAL B 276 ? O VAL B 276 
L  2 3 O LEU B 275 ? O LEU B 275 N ILE B 184 ? N ILE B 184 
L  3 4 N MET B 181 ? N MET B 181 O ASP B 203 ? O ASP B 203 
L  4 5 N GLU B 208 ? N GLU B 208 O LYS B 238 ? O LYS B 238 
M  1 2 N GLY B 245 ? N GLY B 245 O SER B 257 ? O SER B 257 
M  2 3 N ILE B 258 ? N ILE B 258 O GLU B 267 ? O GLU B 267 
N  1 2 N ILE B 358 ? N ILE B 358 O VAL B 364 ? O VAL B 364 
N  2 3 N ALA B 365 ? N ALA B 365 O ILE B 420 ? O ILE B 420 
N  3 4 O HIS B 419 ? O HIS B 419 N LYS B 405 ? N LYS B 405 
N  4 5 O ILE B 406 ? O ILE B 406 N GLY B 384 ? N GLY B 384 
O  1 2 O VAL C 113 ? O VAL C 113 N THR C 32  ? N THR C 32  
O  2 3 O VAL C 33  ? O VAL C 33  N VAL C 11  ? N VAL C 11  
O  3 4 N ALA C 7   ? N ALA C 7   O ASP C 140 ? O ASP C 140 
O  4 5 O ILE C 139 ? O ILE C 139 N VAL C 127 ? N VAL C 127 
O  5 6 O THR C 128 ? O THR C 128 N LYS C 120 ? N LYS C 120 
P  1 2 O VAL C 113 ? O VAL C 113 N THR C 32  ? N THR C 32  
P  2 3 O VAL C 33  ? O VAL C 33  N VAL C 11  ? N VAL C 11  
P  3 4 N ALA C 7   ? N ALA C 7   O ASP C 140 ? O ASP C 140 
P  4 5 N ILE C 146 ? N ILE C 146 O TYR C 316 ? O TYR C 316 
Q  1 2 N GLU C 77  ? N GLU C 77  O ARG D 82  ? O ARG D 82  
R  1 2 N ARG C 82  ? N ARG C 82  O GLU D 77  ? O GLU D 77  
S  1 2 N GLU C 151 ? N GLU C 151 O ARG C 281 ? O ARG C 281 
T  1 2 N VAL C 166 ? N VAL C 166 O VAL C 276 ? O VAL C 276 
T  2 3 O LEU C 275 ? O LEU C 275 N ILE C 184 ? N ILE C 184 
T  3 4 N VAL C 183 ? N VAL C 183 O VAL C 207 ? O VAL C 207 
T  4 5 N GLU C 208 ? N GLU C 208 O LYS C 238 ? O LYS C 238 
U  1 2 N THR C 247 ? N THR C 247 O ASP C 255 ? O ASP C 255 
U  2 3 N VAL C 256 ? N VAL C 256 O ILE C 269 ? O ILE C 269 
V  1 2 N ILE C 358 ? N ILE C 358 O VAL C 364 ? O VAL C 364 
V  2 3 N ALA C 365 ? N ALA C 365 O ILE C 420 ? O ILE C 420 
V  3 4 O GLY C 417 ? O GLY C 417 N LEU C 407 ? N LEU C 407 
V  4 5 O ILE C 406 ? O ILE C 406 N GLY C 384 ? N GLY C 384 
W  1 2 O VAL D 113 ? O VAL D 113 N CYS D 34  ? N CYS D 34  
W  2 3 O VAL D 33  ? O VAL D 33  N VAL D 11  ? N VAL D 11  
W  3 4 N ILE D 12  ? N ILE D 12  O LEU D 145 ? O LEU D 145 
W  4 5 O GLN D 137 ? O GLN D 137 N ALA D 129 ? N ALA D 129 
W  5 6 O THR D 128 ? O THR D 128 N LYS D 120 ? N LYS D 120 
X  1 2 O VAL D 113 ? O VAL D 113 N CYS D 34  ? N CYS D 34  
X  2 3 O VAL D 33  ? O VAL D 33  N VAL D 11  ? N VAL D 11  
X  3 4 N ILE D 12  ? N ILE D 12  O LEU D 145 ? O LEU D 145 
X  4 5 N ILE D 146 ? N ILE D 146 O TYR D 316 ? O TYR D 316 
Y  1 2 N GLU D 151 ? N GLU D 151 O ARG D 281 ? O ARG D 281 
Z  1 2 N VAL D 166 ? N VAL D 166 O VAL D 276 ? O VAL D 276 
Z  2 3 O LEU D 275 ? O LEU D 275 N ILE D 184 ? N ILE D 184 
Z  3 4 N MET D 181 ? N MET D 181 O ASP D 203 ? O ASP D 203 
Z  4 5 N ALA D 206 ? N ALA D 206 O LYS D 238 ? O LYS D 238 
AA 1 2 N GLY D 245 ? N GLY D 245 O SER D 257 ? O SER D 257 
AA 2 3 N VAL D 256 ? N VAL D 256 O ILE D 269 ? O ILE D 269 
AB 1 2 N ILE D 358 ? N ILE D 358 O VAL D 364 ? O VAL D 364 
AB 2 3 N ALA D 365 ? N ALA D 365 O ILE D 420 ? O ILE D 420 
AB 3 4 O LEU D 416 ? O LEU D 416 N LEU D 407 ? N LEU D 407 
AB 4 5 O ILE D 406 ? O ILE D 406 N GLY D 384 ? N GLY D 384 
AC 1 2 O VAL E 113 ? O VAL E 113 N THR E 32  ? N THR E 32  
AC 2 3 O VAL E 33  ? O VAL E 33  N VAL E 11  ? N VAL E 11  
AC 3 4 N ILE E 5   ? N ILE E 5   O VAL E 138 ? O VAL E 138 
AC 4 5 O ILE E 139 ? O ILE E 139 N VAL E 127 ? N VAL E 127 
AC 5 6 O THR E 128 ? O THR E 128 N LYS E 120 ? N LYS E 120 
AD 1 2 O VAL E 113 ? O VAL E 113 N THR E 32  ? N THR E 32  
AD 2 3 O VAL E 33  ? O VAL E 33  N VAL E 11  ? N VAL E 11  
AD 3 4 N ILE E 5   ? N ILE E 5   O VAL E 138 ? O VAL E 138 
AD 4 5 N ILE E 146 ? N ILE E 146 O TYR E 316 ? O TYR E 316 
AE 1 2 N GLU E 77  ? N GLU E 77  O ARG F 82  ? O ARG F 82  
AF 1 2 N ARG E 82  ? N ARG E 82  O GLU F 77  ? O GLU F 77  
AG 1 2 N GLU E 151 ? N GLU E 151 O ARG E 281 ? O ARG E 281 
AH 1 2 N VAL E 166 ? N VAL E 166 O VAL E 276 ? O VAL E 276 
AH 2 3 O LEU E 275 ? O LEU E 275 N VAL E 182 ? N VAL E 182 
AH 3 4 N VAL E 183 ? N VAL E 183 O VAL E 207 ? O VAL E 207 
AH 4 5 N ALA E 206 ? N ALA E 206 O LYS E 236 ? O LYS E 236 
AI 1 2 N LYS E 242 ? N LYS E 242 O GLU E 259 ? O GLU E 259 
AI 2 3 N VAL E 256 ? N VAL E 256 O ILE E 269 ? O ILE E 269 
AJ 1 2 N ILE E 358 ? N ILE E 358 O VAL E 364 ? O VAL E 364 
AJ 2 3 N ALA E 365 ? N ALA E 365 O ILE E 420 ? O ILE E 420 
AJ 3 4 O HIS E 419 ? O HIS E 419 N LYS E 405 ? N LYS E 405 
AJ 4 5 O GLY E 408 ? O GLY E 408 N LYS E 382 ? N LYS E 382 
AK 1 2 O VAL F 115 ? O VAL F 115 N CYS F 34  ? N CYS F 34  
AK 2 3 O VAL F 33  ? O VAL F 33  N VAL F 11  ? N VAL F 11  
AK 3 4 N THR F 10  ? N THR F 10  O LEU F 145 ? O LEU F 145 
AK 4 5 O GLN F 137 ? O GLN F 137 N ALA F 129 ? N ALA F 129 
AK 5 6 O THR F 128 ? O THR F 128 N LYS F 120 ? N LYS F 120 
AL 1 2 O VAL F 115 ? O VAL F 115 N CYS F 34  ? N CYS F 34  
AL 2 3 O VAL F 33  ? O VAL F 33  N VAL F 11  ? N VAL F 11  
AL 3 4 N THR F 10  ? N THR F 10  O LEU F 145 ? O LEU F 145 
AL 4 5 N ILE F 146 ? N ILE F 146 O TYR F 316 ? O TYR F 316 
AM 1 2 N GLU F 151 ? N GLU F 151 O ARG F 281 ? O ARG F 281 
AN 1 2 N VAL F 166 ? N VAL F 166 O VAL F 276 ? O VAL F 276 
AN 2 3 O LEU F 275 ? O LEU F 275 N ILE F 184 ? N ILE F 184 
AN 3 4 N VAL F 183 ? N VAL F 183 O VAL F 207 ? O VAL F 207 
AN 4 5 N GLU F 208 ? N GLU F 208 O LYS F 238 ? O LYS F 238 
AO 1 2 N THR F 244 ? N THR F 244 O SER F 257 ? O SER F 257 
AO 2 3 N VAL F 256 ? N VAL F 256 O ILE F 269 ? O ILE F 269 
AP 1 2 N ILE F 358 ? N ILE F 358 O VAL F 364 ? O VAL F 364 
AP 2 3 N ALA F 365 ? N ALA F 365 O ILE F 420 ? O ILE F 420 
AP 3 4 O LEU F 416 ? O LEU F 416 N LEU F 407 ? N LEU F 407 
AP 4 5 O GLY F 408 ? O GLY F 408 N LYS F 382 ? N LYS F 382 
AQ 1 2 O VAL G 113 ? O VAL G 113 N CYS G 34  ? N CYS G 34  
AQ 2 3 O VAL G 33  ? O VAL G 33  N VAL G 11  ? N VAL G 11  
AQ 3 4 N THR G 10  ? N THR G 10  O LEU G 145 ? O LEU G 145 
AQ 4 5 O GLN G 137 ? O GLN G 137 N ALA G 129 ? N ALA G 129 
AQ 5 6 O THR G 128 ? O THR G 128 N LYS G 120 ? N LYS G 120 
AR 1 2 O VAL G 113 ? O VAL G 113 N CYS G 34  ? N CYS G 34  
AR 2 3 O VAL G 33  ? O VAL G 33  N VAL G 11  ? N VAL G 11  
AR 3 4 N THR G 10  ? N THR G 10  O LEU G 145 ? O LEU G 145 
AR 4 5 N ILE G 146 ? N ILE G 146 O TYR G 316 ? O TYR G 316 
AS 1 2 N GLU G 77  ? N GLU G 77  O ARG H 82  ? O ARG H 82  
AT 1 2 N ARG G 82  ? N ARG G 82  O GLU H 77  ? O GLU H 77  
AU 1 2 N GLU G 151 ? N GLU G 151 O ARG G 281 ? O ARG G 281 
AV 1 2 N VAL G 166 ? N VAL G 166 O LEU G 274 ? O LEU G 274 
AV 2 3 O LEU G 275 ? O LEU G 275 N VAL G 182 ? N VAL G 182 
AV 3 4 N MET G 181 ? N MET G 181 O ASP G 203 ? O ASP G 203 
AV 4 5 N GLU G 208 ? N GLU G 208 O LYS G 238 ? O LYS G 238 
AW 1 2 N THR G 244 ? N THR G 244 O SER G 257 ? O SER G 257 
AW 2 3 N VAL G 256 ? N VAL G 256 O ILE G 269 ? O ILE G 269 
AX 1 2 N ILE G 358 ? N ILE G 358 O VAL G 364 ? O VAL G 364 
AX 2 3 N ALA G 365 ? N ALA G 365 O ILE G 420 ? O ILE G 420 
AX 3 4 O LEU G 416 ? O LEU G 416 N LEU G 407 ? N LEU G 407 
AX 4 5 O ILE G 406 ? O ILE G 406 N GLY G 384 ? N GLY G 384 
AY 1 2 O VAL H 113 ? O VAL H 113 N CYS H 34  ? N CYS H 34  
AY 2 3 O VAL H 33  ? O VAL H 33  N VAL H 11  ? N VAL H 11  
AY 3 4 N THR H 10  ? N THR H 10  O LEU H 145 ? O LEU H 145 
AY 4 5 O GLN H 137 ? O GLN H 137 N ALA H 129 ? N ALA H 129 
AY 5 6 O THR H 130 ? O THR H 130 N TYR H 118 ? N TYR H 118 
AZ 1 2 O VAL H 113 ? O VAL H 113 N CYS H 34  ? N CYS H 34  
AZ 2 3 O VAL H 33  ? O VAL H 33  N VAL H 11  ? N VAL H 11  
AZ 3 4 N THR H 10  ? N THR H 10  O LEU H 145 ? O LEU H 145 
AZ 4 5 N ILE H 146 ? N ILE H 146 O TYR H 316 ? O TYR H 316 
BA 1 2 N GLU H 151 ? N GLU H 151 O ARG H 281 ? O ARG H 281 
BB 1 2 N VAL H 166 ? N VAL H 166 O VAL H 276 ? O VAL H 276 
BB 2 3 O LEU H 275 ? O LEU H 275 N VAL H 182 ? N VAL H 182 
BB 3 4 N MET H 181 ? N MET H 181 O ASP H 203 ? O ASP H 203 
BB 4 5 N ALA H 206 ? N ALA H 206 O LYS H 238 ? O LYS H 238 
BC 1 2 N LYS H 242 ? N LYS H 242 O GLU H 259 ? O GLU H 259 
BC 2 3 N ILE H 258 ? N ILE H 258 O GLU H 267 ? O GLU H 267 
BD 1 2 N ILE H 358 ? N ILE H 358 O VAL H 364 ? O VAL H 364 
BD 2 3 N ALA H 365 ? N ALA H 365 O ILE H 420 ? O ILE H 420 
BD 3 4 O HIS H 419 ? O HIS H 419 N LYS H 405 ? N LYS H 405 
BD 4 5 O GLY H 408 ? O GLY H 408 N LYS H 382 ? N LYS H 382 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 2000' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 A 2001' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 2002' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 2003' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 2004' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 2005' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 2006' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 2007' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 C 2008' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 2009' 
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 C 2010' 
BC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 C 2011' 
BC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 D 2012' 
BC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 D 2013' 
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 2014' 
BC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 D 2015' 
BC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 2016' 
BC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 E 2017' 
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 E 2018' 
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 E 2019' 
CC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 E 2020' 
CC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 E 2021' 
CC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 F 2022' 
CC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 F 2023' 
CC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 F 2024' 
CC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 F 2025' 
CC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 G 2026' 
DC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 G 2027' 
DC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 G 2028' 
DC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 G 2029' 
DC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 G 2030' 
DC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 H 2031' 
DC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 H 2032' 
DC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 H 2033' 
DC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 H 2034' 
DC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 H 2035' 
EC1 Software ? ? ? ? 38 'BINDING SITE FOR RESIDUE FAD A 480'  
EC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE NAD A 481'  
EC3 Software ? ? ? ? 36 'BINDING SITE FOR RESIDUE FAD B 480'  
EC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE NAD B 481'  
EC5 Software ? ? ? ? 37 'BINDING SITE FOR RESIDUE FAD C 480'  
EC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE NAD C 481'  
EC7 Software ? ? ? ? 38 'BINDING SITE FOR RESIDUE FAD D 480'  
EC8 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE NAD D 481'  
EC9 Software ? ? ? ? 36 'BINDING SITE FOR RESIDUE FAD E 480'  
FC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE NAD E 481'  
FC2 Software ? ? ? ? 39 'BINDING SITE FOR RESIDUE FAD F 480'  
FC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE NAD F 481'  
FC4 Software ? ? ? ? 40 'BINDING SITE FOR RESIDUE FAD G 480'  
FC5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE NAD G 481'  
FC6 Software ? ? ? ? 36 'BINDING SITE FOR RESIDUE FAD H 480'  
FC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE NAD H 481'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 3  HIS A  64  ? HIS A 64   . ? 1_555 ? 
2   AC1 3  THR A  69  ? THR A 69   . ? 1_555 ? 
3   AC1 3  HOH IB .   ? HOH A 2026 . ? 1_555 ? 
4   AC2 8  THR A  284 ? THR A 284  . ? 1_555 ? 
5   AC2 8  ASN A  286 ? ASN A 286  . ? 1_555 ? 
6   AC2 8  LEU A  287 ? LEU A 287  . ? 1_555 ? 
7   AC2 8  GLY A  288 ? GLY A 288  . ? 1_555 ? 
8   AC2 8  LEU A  289 ? LEU A 289  . ? 1_555 ? 
9   AC2 8  GLU A  290 ? GLU A 290  . ? 1_555 ? 
10  AC2 8  GLU A  291 ? GLU A 291  . ? 1_555 ? 
11  AC2 8  HOH IB .   ? HOH A 2054 . ? 1_555 ? 
12  AC3 3  ARG A  299 ? ARG A 299  . ? 1_555 ? 
13  AC3 3  ARG A  301 ? ARG A 301  . ? 1_555 ? 
14  AC3 3  GLY A  324 ? GLY A 324  . ? 1_555 ? 
15  AC4 3  LEU A  210 ? LEU A 210  . ? 1_555 ? 
16  AC4 3  GLY A  211 ? GLY A 211  . ? 1_555 ? 
17  AC4 3  HIS A  212 ? HIS A 212  . ? 1_555 ? 
18  AC5 3  HIS B  64  ? HIS B 64   . ? 1_555 ? 
19  AC5 3  GLY B  68  ? GLY B 68   . ? 1_555 ? 
20  AC5 3  THR B  69  ? THR B 69   . ? 1_555 ? 
21  AC6 5  LYS A  111 ? LYS A 111  . ? 2_665 ? 
22  AC6 5  ILE B  379 ? ILE B 379  . ? 1_555 ? 
23  AC6 5  GLU B  380 ? GLU B 380  . ? 1_555 ? 
24  AC6 5  GLN B  409 ? GLN B 409  . ? 1_555 ? 
25  AC6 5  HOH JB .   ? HOH B 2036 . ? 1_555 ? 
26  AC7 4  ARG B  299 ? ARG B 299  . ? 1_555 ? 
27  AC7 4  ARG B  301 ? ARG B 301  . ? 1_555 ? 
28  AC7 4  ALA B  323 ? ALA B 323  . ? 1_555 ? 
29  AC7 4  GLY B  324 ? GLY B 324  . ? 1_555 ? 
30  AC8 3  LEU B  210 ? LEU B 210  . ? 1_555 ? 
31  AC8 3  GLY B  211 ? GLY B 211  . ? 1_555 ? 
32  AC8 3  HIS B  212 ? HIS B 212  . ? 1_555 ? 
33  AC9 3  HIS C  64  ? HIS C 64   . ? 1_555 ? 
34  AC9 3  THR C  69  ? THR C 69   . ? 1_555 ? 
35  AC9 3  HOH KB .   ? HOH C 2132 . ? 1_555 ? 
36  BC1 5  ILE C  379 ? ILE C 379  . ? 1_555 ? 
37  BC1 5  GLU C  380 ? GLU C 380  . ? 1_555 ? 
38  BC1 5  GLN C  409 ? GLN C 409  . ? 1_555 ? 
39  BC1 5  HOH KB .   ? HOH C 2041 . ? 1_555 ? 
40  BC1 5  LYS D  111 ? LYS D 111  . ? 2_765 ? 
41  BC2 3  ARG C  299 ? ARG C 299  . ? 1_555 ? 
42  BC2 3  ARG C  301 ? ARG C 301  . ? 1_555 ? 
43  BC2 3  GLY C  324 ? GLY C 324  . ? 1_555 ? 
44  BC3 2  GLY C  211 ? GLY C 211  . ? 1_555 ? 
45  BC3 2  HIS C  212 ? HIS C 212  . ? 1_555 ? 
46  BC4 3  HIS D  64  ? HIS D 64   . ? 1_555 ? 
47  BC4 3  GLY D  68  ? GLY D 68   . ? 1_555 ? 
48  BC4 3  THR D  69  ? THR D 69   . ? 1_555 ? 
49  BC5 8  THR D  284 ? THR D 284  . ? 1_555 ? 
50  BC5 8  ASN D  286 ? ASN D 286  . ? 1_555 ? 
51  BC5 8  LEU D  287 ? LEU D 287  . ? 1_555 ? 
52  BC5 8  GLY D  288 ? GLY D 288  . ? 1_555 ? 
53  BC5 8  LEU D  289 ? LEU D 289  . ? 1_555 ? 
54  BC5 8  GLU D  290 ? GLU D 290  . ? 1_555 ? 
55  BC5 8  GLU D  291 ? GLU D 291  . ? 1_555 ? 
56  BC5 8  HOH LB .   ? HOH D 2123 . ? 1_555 ? 
57  BC6 4  GLY D  378 ? GLY D 378  . ? 1_555 ? 
58  BC6 4  ILE D  379 ? ILE D 379  . ? 1_555 ? 
59  BC6 4  GLU D  380 ? GLU D 380  . ? 1_555 ? 
60  BC6 4  GLN D  409 ? GLN D 409  . ? 1_555 ? 
61  BC7 3  ARG D  299 ? ARG D 299  . ? 1_555 ? 
62  BC7 3  ARG D  301 ? ARG D 301  . ? 1_555 ? 
63  BC7 3  GLY D  324 ? GLY D 324  . ? 1_555 ? 
64  BC8 4  LEU D  210 ? LEU D 210  . ? 1_555 ? 
65  BC8 4  GLY D  211 ? GLY D 211  . ? 1_555 ? 
66  BC8 4  HIS D  212 ? HIS D 212  . ? 1_555 ? 
67  BC8 4  MET D  220 ? MET D 220  . ? 1_555 ? 
68  BC9 3  HIS E  64  ? HIS E 64   . ? 1_555 ? 
69  BC9 3  GLY E  68  ? GLY E 68   . ? 1_555 ? 
70  BC9 3  THR E  69  ? THR E 69   . ? 1_555 ? 
71  CC1 5  ASN E  286 ? ASN E 286  . ? 1_555 ? 
72  CC1 5  LEU E  287 ? LEU E 287  . ? 1_555 ? 
73  CC1 5  GLY E  288 ? GLY E 288  . ? 1_555 ? 
74  CC1 5  LEU E  289 ? LEU E 289  . ? 1_555 ? 
75  CC1 5  GLU E  290 ? GLU E 290  . ? 1_555 ? 
76  CC2 5  GLY E  378 ? GLY E 378  . ? 1_555 ? 
77  CC2 5  ILE E  379 ? ILE E 379  . ? 1_555 ? 
78  CC2 5  GLU E  380 ? GLU E 380  . ? 1_555 ? 
79  CC2 5  GLN E  409 ? GLN E 409  . ? 1_555 ? 
80  CC2 5  HOH MB .   ? HOH E 2058 . ? 1_555 ? 
81  CC3 4  ARG E  299 ? ARG E 299  . ? 1_555 ? 
82  CC3 4  ARG E  301 ? ARG E 301  . ? 1_555 ? 
83  CC3 4  ALA E  323 ? ALA E 323  . ? 1_555 ? 
84  CC3 4  GLY E  324 ? GLY E 324  . ? 1_555 ? 
85  CC4 3  LEU E  210 ? LEU E 210  . ? 1_555 ? 
86  CC4 3  GLY E  211 ? GLY E 211  . ? 1_555 ? 
87  CC4 3  HIS E  212 ? HIS E 212  . ? 1_555 ? 
88  CC5 4  HIS F  64  ? HIS F 64   . ? 1_555 ? 
89  CC5 4  GLY F  68  ? GLY F 68   . ? 1_555 ? 
90  CC5 4  THR F  69  ? THR F 69   . ? 1_555 ? 
91  CC5 4  HOH NB .   ? HOH F 2231 . ? 1_555 ? 
92  CC6 8  THR F  284 ? THR F 284  . ? 1_555 ? 
93  CC6 8  ASN F  286 ? ASN F 286  . ? 1_555 ? 
94  CC6 8  LEU F  287 ? LEU F 287  . ? 1_555 ? 
95  CC6 8  GLY F  288 ? GLY F 288  . ? 1_555 ? 
96  CC6 8  LEU F  289 ? LEU F 289  . ? 1_555 ? 
97  CC6 8  GLU F  290 ? GLU F 290  . ? 1_555 ? 
98  CC6 8  GLU F  291 ? GLU F 291  . ? 1_555 ? 
99  CC6 8  HOH NB .   ? HOH F 2220 . ? 1_555 ? 
100 CC7 3  ILE F  379 ? ILE F 379  . ? 1_555 ? 
101 CC7 3  GLU F  380 ? GLU F 380  . ? 1_555 ? 
102 CC7 3  GLN F  409 ? GLN F 409  . ? 1_555 ? 
103 CC8 3  ARG F  299 ? ARG F 299  . ? 1_555 ? 
104 CC8 3  ARG F  301 ? ARG F 301  . ? 1_555 ? 
105 CC8 3  LYS G  265 ? LYS G 265  . ? 1_555 ? 
106 CC9 4  HIS G  64  ? HIS G 64   . ? 1_555 ? 
107 CC9 4  THR G  69  ? THR G 69   . ? 1_555 ? 
108 CC9 4  HOH OB .   ? HOH G 2079 . ? 1_555 ? 
109 CC9 4  HOH OB .   ? HOH G 2257 . ? 1_555 ? 
110 DC1 8  THR G  284 ? THR G 284  . ? 1_555 ? 
111 DC1 8  ASN G  286 ? ASN G 286  . ? 1_555 ? 
112 DC1 8  LEU G  287 ? LEU G 287  . ? 1_555 ? 
113 DC1 8  GLY G  288 ? GLY G 288  . ? 1_555 ? 
114 DC1 8  LEU G  289 ? LEU G 289  . ? 1_555 ? 
115 DC1 8  GLU G  290 ? GLU G 290  . ? 1_555 ? 
116 DC1 8  GLU G  291 ? GLU G 291  . ? 1_555 ? 
117 DC1 8  HOH OB .   ? HOH G 2175 . ? 1_555 ? 
118 DC2 3  ILE G  379 ? ILE G 379  . ? 1_555 ? 
119 DC2 3  GLU G  380 ? GLU G 380  . ? 1_555 ? 
120 DC2 3  GLN G  409 ? GLN G 409  . ? 1_555 ? 
121 DC3 3  LYS F  265 ? LYS F 265  . ? 1_555 ? 
122 DC3 3  ARG G  299 ? ARG G 299  . ? 1_555 ? 
123 DC3 3  ARG G  301 ? ARG G 301  . ? 1_555 ? 
124 DC4 5  LEU G  210 ? LEU G 210  . ? 1_555 ? 
125 DC4 5  GLY G  211 ? GLY G 211  . ? 1_555 ? 
126 DC4 5  HIS G  212 ? HIS G 212  . ? 1_555 ? 
127 DC4 5  MET G  220 ? MET G 220  . ? 1_555 ? 
128 DC4 5  HOH OB .   ? HOH G 2217 . ? 1_555 ? 
129 DC5 4  HIS H  64  ? HIS H 64   . ? 1_555 ? 
130 DC5 4  GLY H  68  ? GLY H 68   . ? 1_555 ? 
131 DC5 4  THR H  69  ? THR H 69   . ? 1_555 ? 
132 DC5 4  HOH PB .   ? HOH H 2204 . ? 1_555 ? 
133 DC6 6  ASN H  286 ? ASN H 286  . ? 1_555 ? 
134 DC6 6  LEU H  287 ? LEU H 287  . ? 1_555 ? 
135 DC6 6  GLY H  288 ? GLY H 288  . ? 1_555 ? 
136 DC6 6  LEU H  289 ? LEU H 289  . ? 1_555 ? 
137 DC6 6  GLU H  290 ? GLU H 290  . ? 1_555 ? 
138 DC6 6  GLU H  291 ? GLU H 291  . ? 1_555 ? 
139 DC7 5  GLY H  378 ? GLY H 378  . ? 1_555 ? 
140 DC7 5  ILE H  379 ? ILE H 379  . ? 1_555 ? 
141 DC7 5  GLU H  380 ? GLU H 380  . ? 1_555 ? 
142 DC7 5  GLN H  409 ? GLN H 409  . ? 1_555 ? 
143 DC7 5  HOH PB .   ? HOH H 2071 . ? 1_555 ? 
144 DC8 4  ARG H  299 ? ARG H 299  . ? 1_555 ? 
145 DC8 4  ARG H  301 ? ARG H 301  . ? 1_555 ? 
146 DC8 4  ALA H  323 ? ALA H 323  . ? 1_555 ? 
147 DC8 4  GLY H  324 ? GLY H 324  . ? 1_555 ? 
148 DC9 4  LEU H  210 ? LEU H 210  . ? 1_555 ? 
149 DC9 4  GLY H  211 ? GLY H 211  . ? 1_555 ? 
150 DC9 4  HIS H  212 ? HIS H 212  . ? 1_555 ? 
151 DC9 4  MET H  220 ? MET H 220  . ? 1_555 ? 
152 EC1 38 ILE A  12  ? ILE A 12   . ? 1_555 ? 
153 EC1 38 GLY A  13  ? GLY A 13   . ? 1_555 ? 
154 EC1 38 GLY A  15  ? GLY A 15   . ? 1_555 ? 
155 EC1 38 PRO A  16  ? PRO A 16   . ? 1_555 ? 
156 EC1 38 GLY A  17  ? GLY A 17   . ? 1_555 ? 
157 EC1 38 GLU A  36  ? GLU A 36   . ? 1_555 ? 
158 EC1 38 LYS A  37  ? LYS A 37   . ? 1_555 ? 
159 EC1 38 ASN A  38  ? ASN A 38   . ? 1_555 ? 
160 EC1 38 GLY A  43  ? GLY A 43   . ? 1_555 ? 
161 EC1 38 THR A  44  ? THR A 44   . ? 1_555 ? 
162 EC1 38 CYS A  45  ? CYS A 45   . ? 1_555 ? 
163 EC1 38 GLY A  49  ? GLY A 49   . ? 1_555 ? 
164 EC1 38 CYS A  50  ? CYS A 50   . ? 1_555 ? 
165 EC1 38 LYS A  54  ? LYS A 54   . ? 1_555 ? 
166 EC1 38 GLY A  117 ? GLY A 117  . ? 1_555 ? 
167 EC1 38 TYR A  118 ? TYR A 118  . ? 1_555 ? 
168 EC1 38 GLY A  119 ? GLY A 119  . ? 1_555 ? 
169 EC1 38 ALA A  147 ? ALA A 147  . ? 1_555 ? 
170 EC1 38 THR A  148 ? THR A 148  . ? 1_555 ? 
171 EC1 38 GLY A  149 ? GLY A 149  . ? 1_555 ? 
172 EC1 38 SER A  150 ? SER A 150  . ? 1_555 ? 
173 EC1 38 SER A  168 ? SER A 168  . ? 1_555 ? 
174 EC1 38 ILE A  189 ? ILE A 189  . ? 1_555 ? 
175 EC1 38 ARG A  280 ? ARG A 280  . ? 1_555 ? 
176 EC1 38 PHE A  283 ? PHE A 283  . ? 1_555 ? 
177 EC1 38 GLY A  319 ? GLY A 319  . ? 1_555 ? 
178 EC1 38 ASP A  320 ? ASP A 320  . ? 1_555 ? 
179 EC1 38 MET A  326 ? MET A 326  . ? 1_555 ? 
180 EC1 38 LEU A  327 ? LEU A 327  . ? 1_555 ? 
181 EC1 38 ALA A  328 ? ALA A 328  . ? 1_555 ? 
182 EC1 38 HIS A  329 ? HIS A 329  . ? 1_555 ? 
183 EC1 38 ALA A  331 ? ALA A 331  . ? 1_555 ? 
184 EC1 38 TYR A  359 ? TYR A 359  . ? 1_555 ? 
185 EC1 38 HOH IB .   ? HOH A 2004 . ? 1_555 ? 
186 EC1 38 HOH IB .   ? HOH A 2005 . ? 1_555 ? 
187 EC1 38 HOH IB .   ? HOH A 2013 . ? 1_555 ? 
188 EC1 38 HOH IB .   ? HOH A 2017 . ? 1_555 ? 
189 EC1 38 HIS B  452 ? HIS B 452  . ? 1_555 ? 
190 EC2 17 GLY A  185 ? GLY A 185  . ? 1_555 ? 
191 EC2 17 GLY A  187 ? GLY A 187  . ? 1_555 ? 
192 EC2 17 VAL A  188 ? VAL A 188  . ? 1_555 ? 
193 EC2 17 VAL A  207 ? VAL A 207  . ? 1_555 ? 
194 EC2 17 GLU A  208 ? GLU A 208  . ? 1_555 ? 
195 EC2 17 PHE A  209 ? PHE A 209  . ? 1_555 ? 
196 EC2 17 LEU A  210 ? LEU A 210  . ? 1_555 ? 
197 EC2 17 VAL A  216 ? VAL A 216  . ? 1_555 ? 
198 EC2 17 THR A  241 ? THR A 241  . ? 1_555 ? 
199 EC2 17 LYS A  242 ? LYS A 242  . ? 1_555 ? 
200 EC2 17 VAL A  243 ? VAL A 243  . ? 1_555 ? 
201 EC2 17 CYS A  277 ? CYS A 277  . ? 1_555 ? 
202 EC2 17 ILE A  278 ? ILE A 278  . ? 1_555 ? 
203 EC2 17 GLY A  279 ? GLY A 279  . ? 1_555 ? 
204 EC2 17 ARG A  280 ? ARG A 280  . ? 1_555 ? 
205 EC2 17 ARG A  299 ? ARG A 299  . ? 1_555 ? 
206 EC2 17 HOH IB .   ? HOH A 2161 . ? 1_555 ? 
207 EC3 36 HIS A  452 ? HIS A 452  . ? 1_555 ? 
208 EC3 36 ILE B  12  ? ILE B 12   . ? 1_555 ? 
209 EC3 36 GLY B  13  ? GLY B 13   . ? 1_555 ? 
210 EC3 36 GLY B  15  ? GLY B 15   . ? 1_555 ? 
211 EC3 36 PRO B  16  ? PRO B 16   . ? 1_555 ? 
212 EC3 36 GLY B  17  ? GLY B 17   . ? 1_555 ? 
213 EC3 36 GLU B  36  ? GLU B 36   . ? 1_555 ? 
214 EC3 36 LYS B  37  ? LYS B 37   . ? 1_555 ? 
215 EC3 36 ASN B  38  ? ASN B 38   . ? 1_555 ? 
216 EC3 36 GLY B  43  ? GLY B 43   . ? 1_555 ? 
217 EC3 36 THR B  44  ? THR B 44   . ? 1_555 ? 
218 EC3 36 CYS B  45  ? CYS B 45   . ? 1_555 ? 
219 EC3 36 GLY B  49  ? GLY B 49   . ? 1_555 ? 
220 EC3 36 CYS B  50  ? CYS B 50   . ? 1_555 ? 
221 EC3 36 LYS B  54  ? LYS B 54   . ? 1_555 ? 
222 EC3 36 GLY B  117 ? GLY B 117  . ? 1_555 ? 
223 EC3 36 TYR B  118 ? TYR B 118  . ? 1_555 ? 
224 EC3 36 GLY B  119 ? GLY B 119  . ? 1_555 ? 
225 EC3 36 ALA B  147 ? ALA B 147  . ? 1_555 ? 
226 EC3 36 THR B  148 ? THR B 148  . ? 1_555 ? 
227 EC3 36 GLY B  149 ? GLY B 149  . ? 1_555 ? 
228 EC3 36 SER B  150 ? SER B 150  . ? 1_555 ? 
229 EC3 36 SER B  168 ? SER B 168  . ? 1_555 ? 
230 EC3 36 ILE B  189 ? ILE B 189  . ? 1_555 ? 
231 EC3 36 ARG B  280 ? ARG B 280  . ? 1_555 ? 
232 EC3 36 LEU B  287 ? LEU B 287  . ? 1_555 ? 
233 EC3 36 GLY B  319 ? GLY B 319  . ? 1_555 ? 
234 EC3 36 ASP B  320 ? ASP B 320  . ? 1_555 ? 
235 EC3 36 MET B  326 ? MET B 326  . ? 1_555 ? 
236 EC3 36 LEU B  327 ? LEU B 327  . ? 1_555 ? 
237 EC3 36 ALA B  328 ? ALA B 328  . ? 1_555 ? 
238 EC3 36 HIS B  329 ? HIS B 329  . ? 1_555 ? 
239 EC3 36 TYR B  359 ? TYR B 359  . ? 1_555 ? 
240 EC3 36 HOH JB .   ? HOH B 2023 . ? 1_555 ? 
241 EC3 36 HOH JB .   ? HOH B 2041 . ? 1_555 ? 
242 EC3 36 HOH JB .   ? HOH B 2099 . ? 1_555 ? 
243 EC4 15 PHE B  155 ? PHE B 155  . ? 1_555 ? 
244 EC4 15 GLY B  185 ? GLY B 185  . ? 1_555 ? 
245 EC4 15 GLY B  187 ? GLY B 187  . ? 1_555 ? 
246 EC4 15 VAL B  207 ? VAL B 207  . ? 1_555 ? 
247 EC4 15 GLU B  208 ? GLU B 208  . ? 1_555 ? 
248 EC4 15 PHE B  209 ? PHE B 209  . ? 1_555 ? 
249 EC4 15 LEU B  210 ? LEU B 210  . ? 1_555 ? 
250 EC4 15 GLY B  215 ? GLY B 215  . ? 1_555 ? 
251 EC4 15 VAL B  216 ? VAL B 216  . ? 1_555 ? 
252 EC4 15 THR B  241 ? THR B 241  . ? 1_555 ? 
253 EC4 15 VAL B  243 ? VAL B 243  . ? 1_555 ? 
254 EC4 15 CYS B  277 ? CYS B 277  . ? 1_555 ? 
255 EC4 15 ILE B  278 ? ILE B 278  . ? 1_555 ? 
256 EC4 15 GLY B  279 ? GLY B 279  . ? 1_555 ? 
257 EC4 15 HOH JB .   ? HOH B 2057 . ? 1_555 ? 
258 EC5 37 ILE C  12  ? ILE C 12   . ? 1_555 ? 
259 EC5 37 GLY C  13  ? GLY C 13   . ? 1_555 ? 
260 EC5 37 GLY C  15  ? GLY C 15   . ? 1_555 ? 
261 EC5 37 PRO C  16  ? PRO C 16   . ? 1_555 ? 
262 EC5 37 GLY C  17  ? GLY C 17   . ? 1_555 ? 
263 EC5 37 ILE C  35  ? ILE C 35   . ? 1_555 ? 
264 EC5 37 GLU C  36  ? GLU C 36   . ? 1_555 ? 
265 EC5 37 LYS C  37  ? LYS C 37   . ? 1_555 ? 
266 EC5 37 ASN C  38  ? ASN C 38   . ? 1_555 ? 
267 EC5 37 GLY C  43  ? GLY C 43   . ? 1_555 ? 
268 EC5 37 THR C  44  ? THR C 44   . ? 1_555 ? 
269 EC5 37 CYS C  45  ? CYS C 45   . ? 1_555 ? 
270 EC5 37 GLY C  49  ? GLY C 49   . ? 1_555 ? 
271 EC5 37 CYS C  50  ? CYS C 50   . ? 1_555 ? 
272 EC5 37 LYS C  54  ? LYS C 54   . ? 1_555 ? 
273 EC5 37 GLY C  117 ? GLY C 117  . ? 1_555 ? 
274 EC5 37 TYR C  118 ? TYR C 118  . ? 1_555 ? 
275 EC5 37 GLY C  119 ? GLY C 119  . ? 1_555 ? 
276 EC5 37 ALA C  147 ? ALA C 147  . ? 1_555 ? 
277 EC5 37 THR C  148 ? THR C 148  . ? 1_555 ? 
278 EC5 37 GLY C  149 ? GLY C 149  . ? 1_555 ? 
279 EC5 37 ILE C  189 ? ILE C 189  . ? 1_555 ? 
280 EC5 37 ARG C  280 ? ARG C 280  . ? 1_555 ? 
281 EC5 37 PHE C  283 ? PHE C 283  . ? 1_555 ? 
282 EC5 37 LEU C  287 ? LEU C 287  . ? 1_555 ? 
283 EC5 37 GLY C  319 ? GLY C 319  . ? 1_555 ? 
284 EC5 37 ASP C  320 ? ASP C 320  . ? 1_555 ? 
285 EC5 37 MET C  326 ? MET C 326  . ? 1_555 ? 
286 EC5 37 LEU C  327 ? LEU C 327  . ? 1_555 ? 
287 EC5 37 ALA C  328 ? ALA C 328  . ? 1_555 ? 
288 EC5 37 HIS C  329 ? HIS C 329  . ? 1_555 ? 
289 EC5 37 ALA C  331 ? ALA C 331  . ? 1_555 ? 
290 EC5 37 TYR C  359 ? TYR C 359  . ? 1_555 ? 
291 EC5 37 HOH KB .   ? HOH C 2021 . ? 1_555 ? 
292 EC5 37 HOH KB .   ? HOH C 2027 . ? 1_555 ? 
293 EC5 37 HOH KB .   ? HOH C 2122 . ? 1_555 ? 
294 EC5 37 HIS D  452 ? HIS D 452  . ? 1_555 ? 
295 EC6 15 PHE C  155 ? PHE C 155  . ? 1_555 ? 
296 EC6 15 GLY C  185 ? GLY C 185  . ? 1_555 ? 
297 EC6 15 GLY C  187 ? GLY C 187  . ? 1_555 ? 
298 EC6 15 VAL C  188 ? VAL C 188  . ? 1_555 ? 
299 EC6 15 VAL C  207 ? VAL C 207  . ? 1_555 ? 
300 EC6 15 GLU C  208 ? GLU C 208  . ? 1_555 ? 
301 EC6 15 PHE C  209 ? PHE C 209  . ? 1_555 ? 
302 EC6 15 LEU C  210 ? LEU C 210  . ? 1_555 ? 
303 EC6 15 GLY C  215 ? GLY C 215  . ? 1_555 ? 
304 EC6 15 VAL C  216 ? VAL C 216  . ? 1_555 ? 
305 EC6 15 THR C  241 ? THR C 241  . ? 1_555 ? 
306 EC6 15 VAL C  243 ? VAL C 243  . ? 1_555 ? 
307 EC6 15 CYS C  277 ? CYS C 277  . ? 1_555 ? 
308 EC6 15 ILE C  278 ? ILE C 278  . ? 1_555 ? 
309 EC6 15 GLY C  279 ? GLY C 279  . ? 1_555 ? 
310 EC7 38 HIS C  452 ? HIS C 452  . ? 1_555 ? 
311 EC7 38 ILE D  12  ? ILE D 12   . ? 1_555 ? 
312 EC7 38 GLY D  13  ? GLY D 13   . ? 1_555 ? 
313 EC7 38 SER D  14  ? SER D 14   . ? 1_555 ? 
314 EC7 38 GLY D  15  ? GLY D 15   . ? 1_555 ? 
315 EC7 38 PRO D  16  ? PRO D 16   . ? 1_555 ? 
316 EC7 38 GLY D  17  ? GLY D 17   . ? 1_555 ? 
317 EC7 38 GLU D  36  ? GLU D 36   . ? 1_555 ? 
318 EC7 38 LYS D  37  ? LYS D 37   . ? 1_555 ? 
319 EC7 38 ASN D  38  ? ASN D 38   . ? 1_555 ? 
320 EC7 38 GLY D  43  ? GLY D 43   . ? 1_555 ? 
321 EC7 38 THR D  44  ? THR D 44   . ? 1_555 ? 
322 EC7 38 CYS D  45  ? CYS D 45   . ? 1_555 ? 
323 EC7 38 GLY D  49  ? GLY D 49   . ? 1_555 ? 
324 EC7 38 CYS D  50  ? CYS D 50   . ? 1_555 ? 
325 EC7 38 LYS D  54  ? LYS D 54   . ? 1_555 ? 
326 EC7 38 GLY D  117 ? GLY D 117  . ? 1_555 ? 
327 EC7 38 TYR D  118 ? TYR D 118  . ? 1_555 ? 
328 EC7 38 GLY D  119 ? GLY D 119  . ? 1_555 ? 
329 EC7 38 ALA D  147 ? ALA D 147  . ? 1_555 ? 
330 EC7 38 THR D  148 ? THR D 148  . ? 1_555 ? 
331 EC7 38 GLY D  149 ? GLY D 149  . ? 1_555 ? 
332 EC7 38 SER D  150 ? SER D 150  . ? 1_555 ? 
333 EC7 38 SER D  168 ? SER D 168  . ? 1_555 ? 
334 EC7 38 ILE D  189 ? ILE D 189  . ? 1_555 ? 
335 EC7 38 ARG D  280 ? ARG D 280  . ? 1_555 ? 
336 EC7 38 PHE D  283 ? PHE D 283  . ? 1_555 ? 
337 EC7 38 GLY D  319 ? GLY D 319  . ? 1_555 ? 
338 EC7 38 ASP D  320 ? ASP D 320  . ? 1_555 ? 
339 EC7 38 MET D  326 ? MET D 326  . ? 1_555 ? 
340 EC7 38 LEU D  327 ? LEU D 327  . ? 1_555 ? 
341 EC7 38 ALA D  328 ? ALA D 328  . ? 1_555 ? 
342 EC7 38 HIS D  329 ? HIS D 329  . ? 1_555 ? 
343 EC7 38 TYR D  359 ? TYR D 359  . ? 1_555 ? 
344 EC7 38 HOH LB .   ? HOH D 2017 . ? 1_555 ? 
345 EC7 38 HOH LB .   ? HOH D 2020 . ? 1_555 ? 
346 EC7 38 HOH LB .   ? HOH D 2028 . ? 1_555 ? 
347 EC7 38 HOH LB .   ? HOH D 2073 . ? 1_555 ? 
348 EC8 20 GLY D  185 ? GLY D 185  . ? 1_555 ? 
349 EC8 20 GLY D  187 ? GLY D 187  . ? 1_555 ? 
350 EC8 20 VAL D  207 ? VAL D 207  . ? 1_555 ? 
351 EC8 20 GLU D  208 ? GLU D 208  . ? 1_555 ? 
352 EC8 20 PHE D  209 ? PHE D 209  . ? 1_555 ? 
353 EC8 20 LEU D  210 ? LEU D 210  . ? 1_555 ? 
354 EC8 20 GLY D  215 ? GLY D 215  . ? 1_555 ? 
355 EC8 20 VAL D  216 ? VAL D 216  . ? 1_555 ? 
356 EC8 20 THR D  241 ? THR D 241  . ? 1_555 ? 
357 EC8 20 LYS D  242 ? LYS D 242  . ? 1_555 ? 
358 EC8 20 VAL D  243 ? VAL D 243  . ? 1_555 ? 
359 EC8 20 CYS D  277 ? CYS D 277  . ? 1_555 ? 
360 EC8 20 ILE D  278 ? ILE D 278  . ? 1_555 ? 
361 EC8 20 GLY D  279 ? GLY D 279  . ? 1_555 ? 
362 EC8 20 ARG D  280 ? ARG D 280  . ? 1_555 ? 
363 EC8 20 ARG D  299 ? ARG D 299  . ? 1_555 ? 
364 EC8 20 MET D  326 ? MET D 326  . ? 1_555 ? 
365 EC8 20 HOH LB .   ? HOH D 2132 . ? 1_555 ? 
366 EC8 20 HOH LB .   ? HOH D 2133 . ? 1_555 ? 
367 EC8 20 HOH LB .   ? HOH D 2151 . ? 1_555 ? 
368 EC9 36 ILE E  12  ? ILE E 12   . ? 1_555 ? 
369 EC9 36 GLY E  13  ? GLY E 13   . ? 1_555 ? 
370 EC9 36 GLY E  15  ? GLY E 15   . ? 1_555 ? 
371 EC9 36 PRO E  16  ? PRO E 16   . ? 1_555 ? 
372 EC9 36 GLY E  17  ? GLY E 17   . ? 1_555 ? 
373 EC9 36 ILE E  35  ? ILE E 35   . ? 1_555 ? 
374 EC9 36 GLU E  36  ? GLU E 36   . ? 1_555 ? 
375 EC9 36 LYS E  37  ? LYS E 37   . ? 1_555 ? 
376 EC9 36 ASN E  38  ? ASN E 38   . ? 1_555 ? 
377 EC9 36 GLY E  43  ? GLY E 43   . ? 1_555 ? 
378 EC9 36 THR E  44  ? THR E 44   . ? 1_555 ? 
379 EC9 36 CYS E  45  ? CYS E 45   . ? 1_555 ? 
380 EC9 36 GLY E  49  ? GLY E 49   . ? 1_555 ? 
381 EC9 36 CYS E  50  ? CYS E 50   . ? 1_555 ? 
382 EC9 36 SER E  53  ? SER E 53   . ? 1_555 ? 
383 EC9 36 LYS E  54  ? LYS E 54   . ? 1_555 ? 
384 EC9 36 TYR E  118 ? TYR E 118  . ? 1_555 ? 
385 EC9 36 GLY E  119 ? GLY E 119  . ? 1_555 ? 
386 EC9 36 ALA E  147 ? ALA E 147  . ? 1_555 ? 
387 EC9 36 THR E  148 ? THR E 148  . ? 1_555 ? 
388 EC9 36 GLY E  149 ? GLY E 149  . ? 1_555 ? 
389 EC9 36 SER E  150 ? SER E 150  . ? 1_555 ? 
390 EC9 36 SER E  168 ? SER E 168  . ? 1_555 ? 
391 EC9 36 ILE E  189 ? ILE E 189  . ? 1_555 ? 
392 EC9 36 ARG E  280 ? ARG E 280  . ? 1_555 ? 
393 EC9 36 PHE E  283 ? PHE E 283  . ? 1_555 ? 
394 EC9 36 GLY E  319 ? GLY E 319  . ? 1_555 ? 
395 EC9 36 ASP E  320 ? ASP E 320  . ? 1_555 ? 
396 EC9 36 MET E  326 ? MET E 326  . ? 1_555 ? 
397 EC9 36 LEU E  327 ? LEU E 327  . ? 1_555 ? 
398 EC9 36 ALA E  328 ? ALA E 328  . ? 1_555 ? 
399 EC9 36 HIS E  329 ? HIS E 329  . ? 1_555 ? 
400 EC9 36 TYR E  359 ? TYR E 359  . ? 1_555 ? 
401 EC9 36 HOH MB .   ? HOH E 2024 . ? 1_555 ? 
402 EC9 36 HOH MB .   ? HOH E 2027 . ? 1_555 ? 
403 EC9 36 HIS F  452 ? HIS F 452  . ? 1_555 ? 
404 FC1 14 PHE E  155 ? PHE E 155  . ? 1_555 ? 
405 FC1 14 GLY E  185 ? GLY E 185  . ? 1_555 ? 
406 FC1 14 GLY E  187 ? GLY E 187  . ? 1_555 ? 
407 FC1 14 VAL E  207 ? VAL E 207  . ? 1_555 ? 
408 FC1 14 GLU E  208 ? GLU E 208  . ? 1_555 ? 
409 FC1 14 PHE E  209 ? PHE E 209  . ? 1_555 ? 
410 FC1 14 GLY E  215 ? GLY E 215  . ? 1_555 ? 
411 FC1 14 VAL E  216 ? VAL E 216  . ? 1_555 ? 
412 FC1 14 THR E  241 ? THR E 241  . ? 1_555 ? 
413 FC1 14 LYS E  242 ? LYS E 242  . ? 1_555 ? 
414 FC1 14 VAL E  243 ? VAL E 243  . ? 1_555 ? 
415 FC1 14 CYS E  277 ? CYS E 277  . ? 1_555 ? 
416 FC1 14 ILE E  278 ? ILE E 278  . ? 1_555 ? 
417 FC1 14 GLY E  279 ? GLY E 279  . ? 1_555 ? 
418 FC2 39 HIS E  452 ? HIS E 452  . ? 1_555 ? 
419 FC2 39 ILE F  12  ? ILE F 12   . ? 1_555 ? 
420 FC2 39 GLY F  13  ? GLY F 13   . ? 1_555 ? 
421 FC2 39 SER F  14  ? SER F 14   . ? 1_555 ? 
422 FC2 39 GLY F  15  ? GLY F 15   . ? 1_555 ? 
423 FC2 39 PRO F  16  ? PRO F 16   . ? 1_555 ? 
424 FC2 39 GLY F  17  ? GLY F 17   . ? 1_555 ? 
425 FC2 39 GLU F  36  ? GLU F 36   . ? 1_555 ? 
426 FC2 39 LYS F  37  ? LYS F 37   . ? 1_555 ? 
427 FC2 39 ASN F  38  ? ASN F 38   . ? 1_555 ? 
428 FC2 39 GLY F  43  ? GLY F 43   . ? 1_555 ? 
429 FC2 39 THR F  44  ? THR F 44   . ? 1_555 ? 
430 FC2 39 CYS F  45  ? CYS F 45   . ? 1_555 ? 
431 FC2 39 VAL F  48  ? VAL F 48   . ? 1_555 ? 
432 FC2 39 GLY F  49  ? GLY F 49   . ? 1_555 ? 
433 FC2 39 CYS F  50  ? CYS F 50   . ? 1_555 ? 
434 FC2 39 SER F  53  ? SER F 53   . ? 1_555 ? 
435 FC2 39 LYS F  54  ? LYS F 54   . ? 1_555 ? 
436 FC2 39 GLY F  117 ? GLY F 117  . ? 1_555 ? 
437 FC2 39 TYR F  118 ? TYR F 118  . ? 1_555 ? 
438 FC2 39 GLY F  119 ? GLY F 119  . ? 1_555 ? 
439 FC2 39 ALA F  147 ? ALA F 147  . ? 1_555 ? 
440 FC2 39 THR F  148 ? THR F 148  . ? 1_555 ? 
441 FC2 39 GLY F  149 ? GLY F 149  . ? 1_555 ? 
442 FC2 39 SER F  150 ? SER F 150  . ? 1_555 ? 
443 FC2 39 ILE F  189 ? ILE F 189  . ? 1_555 ? 
444 FC2 39 ARG F  280 ? ARG F 280  . ? 1_555 ? 
445 FC2 39 PHE F  283 ? PHE F 283  . ? 1_555 ? 
446 FC2 39 GLY F  319 ? GLY F 319  . ? 1_555 ? 
447 FC2 39 ASP F  320 ? ASP F 320  . ? 1_555 ? 
448 FC2 39 MET F  326 ? MET F 326  . ? 1_555 ? 
449 FC2 39 LEU F  327 ? LEU F 327  . ? 1_555 ? 
450 FC2 39 ALA F  328 ? ALA F 328  . ? 1_555 ? 
451 FC2 39 HIS F  329 ? HIS F 329  . ? 1_555 ? 
452 FC2 39 TYR F  359 ? TYR F 359  . ? 1_555 ? 
453 FC2 39 HOH NB .   ? HOH F 2026 . ? 1_555 ? 
454 FC2 39 HOH NB .   ? HOH F 2027 . ? 1_555 ? 
455 FC2 39 HOH NB .   ? HOH F 2037 . ? 1_555 ? 
456 FC2 39 HOH NB .   ? HOH F 2177 . ? 1_555 ? 
457 FC3 15 PHE F  155 ? PHE F 155  . ? 1_555 ? 
458 FC3 15 GLY F  185 ? GLY F 185  . ? 1_555 ? 
459 FC3 15 GLU F  208 ? GLU F 208  . ? 1_555 ? 
460 FC3 15 PHE F  209 ? PHE F 209  . ? 1_555 ? 
461 FC3 15 LEU F  210 ? LEU F 210  . ? 1_555 ? 
462 FC3 15 GLY F  215 ? GLY F 215  . ? 1_555 ? 
463 FC3 15 VAL F  216 ? VAL F 216  . ? 1_555 ? 
464 FC3 15 THR F  241 ? THR F 241  . ? 1_555 ? 
465 FC3 15 LYS F  242 ? LYS F 242  . ? 1_555 ? 
466 FC3 15 VAL F  243 ? VAL F 243  . ? 1_555 ? 
467 FC3 15 CYS F  277 ? CYS F 277  . ? 1_555 ? 
468 FC3 15 ILE F  278 ? ILE F 278  . ? 1_555 ? 
469 FC3 15 GLY F  279 ? GLY F 279  . ? 1_555 ? 
470 FC3 15 HOH NB .   ? HOH F 2224 . ? 1_555 ? 
471 FC3 15 SER G  262 ? SER G 262  . ? 1_555 ? 
472 FC4 40 ILE G  12  ? ILE G 12   . ? 1_555 ? 
473 FC4 40 GLY G  13  ? GLY G 13   . ? 1_555 ? 
474 FC4 40 GLY G  15  ? GLY G 15   . ? 1_555 ? 
475 FC4 40 PRO G  16  ? PRO G 16   . ? 1_555 ? 
476 FC4 40 GLY G  17  ? GLY G 17   . ? 1_555 ? 
477 FC4 40 ILE G  35  ? ILE G 35   . ? 1_555 ? 
478 FC4 40 GLU G  36  ? GLU G 36   . ? 1_555 ? 
479 FC4 40 LYS G  37  ? LYS G 37   . ? 1_555 ? 
480 FC4 40 ASN G  38  ? ASN G 38   . ? 1_555 ? 
481 FC4 40 GLY G  43  ? GLY G 43   . ? 1_555 ? 
482 FC4 40 THR G  44  ? THR G 44   . ? 1_555 ? 
483 FC4 40 CYS G  45  ? CYS G 45   . ? 1_555 ? 
484 FC4 40 VAL G  48  ? VAL G 48   . ? 1_555 ? 
485 FC4 40 GLY G  49  ? GLY G 49   . ? 1_555 ? 
486 FC4 40 CYS G  50  ? CYS G 50   . ? 1_555 ? 
487 FC4 40 SER G  53  ? SER G 53   . ? 1_555 ? 
488 FC4 40 LYS G  54  ? LYS G 54   . ? 1_555 ? 
489 FC4 40 TYR G  118 ? TYR G 118  . ? 1_555 ? 
490 FC4 40 GLY G  119 ? GLY G 119  . ? 1_555 ? 
491 FC4 40 ALA G  147 ? ALA G 147  . ? 1_555 ? 
492 FC4 40 THR G  148 ? THR G 148  . ? 1_555 ? 
493 FC4 40 GLY G  149 ? GLY G 149  . ? 1_555 ? 
494 FC4 40 SER G  150 ? SER G 150  . ? 1_555 ? 
495 FC4 40 SER G  168 ? SER G 168  . ? 1_555 ? 
496 FC4 40 ILE G  189 ? ILE G 189  . ? 1_555 ? 
497 FC4 40 PHE G  283 ? PHE G 283  . ? 1_555 ? 
498 FC4 40 GLY G  319 ? GLY G 319  . ? 1_555 ? 
499 FC4 40 ASP G  320 ? ASP G 320  . ? 1_555 ? 
500 FC4 40 MET G  326 ? MET G 326  . ? 1_555 ? 
501 FC4 40 LEU G  327 ? LEU G 327  . ? 1_555 ? 
502 FC4 40 ALA G  328 ? ALA G 328  . ? 1_555 ? 
503 FC4 40 HIS G  329 ? HIS G 329  . ? 1_555 ? 
504 FC4 40 ALA G  331 ? ALA G 331  . ? 1_555 ? 
505 FC4 40 TYR G  359 ? TYR G 359  . ? 1_555 ? 
506 FC4 40 HOH OB .   ? HOH G 2031 . ? 1_555 ? 
507 FC4 40 HOH OB .   ? HOH G 2032 . ? 1_555 ? 
508 FC4 40 HOH OB .   ? HOH G 2061 . ? 1_555 ? 
509 FC4 40 HOH OB .   ? HOH G 2101 . ? 1_555 ? 
510 FC4 40 HOH OB .   ? HOH G 2241 . ? 1_555 ? 
511 FC4 40 HIS H  452 ? HIS H 452  . ? 1_555 ? 
512 FC5 15 PHE G  155 ? PHE G 155  . ? 1_555 ? 
513 FC5 15 GLY G  185 ? GLY G 185  . ? 1_555 ? 
514 FC5 15 VAL G  207 ? VAL G 207  . ? 1_555 ? 
515 FC5 15 GLU G  208 ? GLU G 208  . ? 1_555 ? 
516 FC5 15 PHE G  209 ? PHE G 209  . ? 1_555 ? 
517 FC5 15 LEU G  210 ? LEU G 210  . ? 1_555 ? 
518 FC5 15 VAL G  216 ? VAL G 216  . ? 1_555 ? 
519 FC5 15 THR G  241 ? THR G 241  . ? 1_555 ? 
520 FC5 15 LYS G  242 ? LYS G 242  . ? 1_555 ? 
521 FC5 15 VAL G  243 ? VAL G 243  . ? 1_555 ? 
522 FC5 15 CYS G  277 ? CYS G 277  . ? 1_555 ? 
523 FC5 15 ILE G  278 ? ILE G 278  . ? 1_555 ? 
524 FC5 15 GLY G  279 ? GLY G 279  . ? 1_555 ? 
525 FC5 15 HOH OB .   ? HOH G 2237 . ? 1_555 ? 
526 FC5 15 HOH OB .   ? HOH G 2238 . ? 1_555 ? 
527 FC6 36 HIS G  452 ? HIS G 452  . ? 1_555 ? 
528 FC6 36 ILE H  12  ? ILE H 12   . ? 1_555 ? 
529 FC6 36 GLY H  13  ? GLY H 13   . ? 1_555 ? 
530 FC6 36 GLY H  15  ? GLY H 15   . ? 1_555 ? 
531 FC6 36 PRO H  16  ? PRO H 16   . ? 1_555 ? 
532 FC6 36 GLY H  17  ? GLY H 17   . ? 1_555 ? 
533 FC6 36 GLU H  36  ? GLU H 36   . ? 1_555 ? 
534 FC6 36 LYS H  37  ? LYS H 37   . ? 1_555 ? 
535 FC6 36 ASN H  38  ? ASN H 38   . ? 1_555 ? 
536 FC6 36 GLY H  43  ? GLY H 43   . ? 1_555 ? 
537 FC6 36 THR H  44  ? THR H 44   . ? 1_555 ? 
538 FC6 36 CYS H  45  ? CYS H 45   . ? 1_555 ? 
539 FC6 36 GLY H  49  ? GLY H 49   . ? 1_555 ? 
540 FC6 36 CYS H  50  ? CYS H 50   . ? 1_555 ? 
541 FC6 36 SER H  53  ? SER H 53   . ? 1_555 ? 
542 FC6 36 LYS H  54  ? LYS H 54   . ? 1_555 ? 
543 FC6 36 TYR H  118 ? TYR H 118  . ? 1_555 ? 
544 FC6 36 GLY H  119 ? GLY H 119  . ? 1_555 ? 
545 FC6 36 ALA H  147 ? ALA H 147  . ? 1_555 ? 
546 FC6 36 THR H  148 ? THR H 148  . ? 1_555 ? 
547 FC6 36 GLY H  149 ? GLY H 149  . ? 1_555 ? 
548 FC6 36 SER H  150 ? SER H 150  . ? 1_555 ? 
549 FC6 36 SER H  168 ? SER H 168  . ? 1_555 ? 
550 FC6 36 ARG H  280 ? ARG H 280  . ? 1_555 ? 
551 FC6 36 PHE H  283 ? PHE H 283  . ? 1_555 ? 
552 FC6 36 GLY H  319 ? GLY H 319  . ? 1_555 ? 
553 FC6 36 ASP H  320 ? ASP H 320  . ? 1_555 ? 
554 FC6 36 MET H  326 ? MET H 326  . ? 1_555 ? 
555 FC6 36 LEU H  327 ? LEU H 327  . ? 1_555 ? 
556 FC6 36 ALA H  328 ? ALA H 328  . ? 1_555 ? 
557 FC6 36 HIS H  329 ? HIS H 329  . ? 1_555 ? 
558 FC6 36 TYR H  359 ? TYR H 359  . ? 1_555 ? 
559 FC6 36 HOH PB .   ? HOH H 2036 . ? 1_555 ? 
560 FC6 36 HOH PB .   ? HOH H 2041 . ? 1_555 ? 
561 FC6 36 HOH PB .   ? HOH H 2091 . ? 1_555 ? 
562 FC6 36 HOH PB .   ? HOH H 2145 . ? 1_555 ? 
563 FC7 13 PHE H  155 ? PHE H 155  . ? 1_555 ? 
564 FC7 13 GLY H  185 ? GLY H 185  . ? 1_555 ? 
565 FC7 13 GLY H  187 ? GLY H 187  . ? 1_555 ? 
566 FC7 13 VAL H  207 ? VAL H 207  . ? 1_555 ? 
567 FC7 13 GLU H  208 ? GLU H 208  . ? 1_555 ? 
568 FC7 13 PHE H  209 ? PHE H 209  . ? 1_555 ? 
569 FC7 13 GLY H  215 ? GLY H 215  . ? 1_555 ? 
570 FC7 13 VAL H  216 ? VAL H 216  . ? 1_555 ? 
571 FC7 13 THR H  241 ? THR H 241  . ? 1_555 ? 
572 FC7 13 VAL H  243 ? VAL H 243  . ? 1_555 ? 
573 FC7 13 CYS H  277 ? CYS H 277  . ? 1_555 ? 
574 FC7 13 ILE H  278 ? ILE H 278  . ? 1_555 ? 
575 FC7 13 GLY H  279 ? GLY H 279  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZMC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZMC 
_atom_sites.fract_transf_matrix[1][1]   0.005678 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004745 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007880 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . GLN A  1 3   ? 50.890  111.823 -80.845  1.00 62.31  ? 3    GLN A N     1 
ATOM   2     C CA    . GLN A  1 3   ? 52.072  111.760 -81.747  1.00 61.38  ? 3    GLN A CA    1 
ATOM   3     C C     . GLN A  1 3   ? 53.195  112.798 -81.471  1.00 58.54  ? 3    GLN A C     1 
ATOM   4     O O     . GLN A  1 3   ? 53.770  113.358 -82.401  1.00 58.61  ? 3    GLN A O     1 
ATOM   5     C CB    . GLN A  1 3   ? 51.595  111.875 -83.201  1.00 63.22  ? 3    GLN A CB    1 
ATOM   6     C CG    . GLN A  1 3   ? 50.684  113.067 -83.433  1.00 66.43  ? 3    GLN A CG    1 
ATOM   7     C CD    . GLN A  1 3   ? 50.422  113.320 -84.897  1.00 69.36  ? 3    GLN A CD    1 
ATOM   8     O OE1   . GLN A  1 3   ? 51.338  113.665 -85.657  1.00 70.10  ? 3    GLN A OE1   1 
ATOM   9     N NE2   . GLN A  1 3   ? 49.166  113.149 -85.310  1.00 69.89  ? 3    GLN A NE2   1 
ATOM   10    N N     . PRO A  1 4   ? 53.509  113.079 -80.194  1.00 55.97  ? 4    PRO A N     1 
ATOM   11    C CA    . PRO A  1 4   ? 54.576  114.047 -79.963  1.00 54.59  ? 4    PRO A CA    1 
ATOM   12    C C     . PRO A  1 4   ? 55.895  113.364 -80.274  1.00 53.56  ? 4    PRO A C     1 
ATOM   13    O O     . PRO A  1 4   ? 55.983  112.138 -80.271  1.00 53.13  ? 4    PRO A O     1 
ATOM   14    C CB    . PRO A  1 4   ? 54.462  114.342 -78.472  1.00 53.74  ? 4    PRO A CB    1 
ATOM   15    C CG    . PRO A  1 4   ? 53.063  114.135 -78.202  1.00 53.86  ? 4    PRO A CG    1 
ATOM   16    C CD    . PRO A  1 4   ? 52.783  112.853 -78.940  1.00 55.32  ? 4    PRO A CD    1 
ATOM   17    N N     . ILE A  1 5   ? 56.924  114.149 -80.543  1.00 52.42  ? 5    ILE A N     1 
ATOM   18    C CA    . ILE A  1 5   ? 58.220  113.568 -80.822  1.00 51.96  ? 5    ILE A CA    1 
ATOM   19    C C     . ILE A  1 5   ? 59.192  114.112 -79.778  1.00 49.22  ? 5    ILE A C     1 
ATOM   20    O O     . ILE A  1 5   ? 59.029  115.225 -79.285  1.00 48.05  ? 5    ILE A O     1 
ATOM   21    C CB    . ILE A  1 5   ? 58.669  113.887 -82.281  1.00 54.16  ? 5    ILE A CB    1 
ATOM   22    C CG1   . ILE A  1 5   ? 60.051  113.289 -82.545  1.00 57.11  ? 5    ILE A CG1   1 
ATOM   23    C CG2   . ILE A  1 5   ? 58.636  115.389 -82.539  1.00 55.42  ? 5    ILE A CG2   1 
ATOM   24    C CD1   . ILE A  1 5   ? 60.556  113.502 -83.975  1.00 59.88  ? 5    ILE A CD1   1 
ATOM   25    N N     . ASP A  1 6   ? 60.174  113.314 -79.388  1.00 47.46  ? 6    ASP A N     1 
ATOM   26    C CA    . ASP A  1 6   ? 61.109  113.812 -78.396  1.00 47.29  ? 6    ASP A CA    1 
ATOM   27    C C     . ASP A  1 6   ? 62.534  113.832 -78.907  1.00 43.41  ? 6    ASP A C     1 
ATOM   28    O O     . ASP A  1 6   ? 62.994  112.920 -79.591  1.00 41.46  ? 6    ASP A O     1 
ATOM   29    C CB    . ASP A  1 6   ? 60.990  113.025 -77.087  1.00 51.28  ? 6    ASP A CB    1 
ATOM   30    C CG    . ASP A  1 6   ? 61.250  111.567 -77.271  1.00 56.06  ? 6    ASP A CG    1 
ATOM   31    O OD1   . ASP A  1 6   ? 62.436  111.223 -77.477  1.00 59.87  ? 6    ASP A OD1   1 
ATOM   32    O OD2   . ASP A  1 6   ? 60.275  110.772 -77.222  1.00 58.38  ? 6    ASP A OD2   1 
ATOM   33    N N     . ALA A  1 7   ? 63.226  114.911 -78.571  1.00 40.97  ? 7    ALA A N     1 
ATOM   34    C CA    . ALA A  1 7   ? 64.587  115.096 -79.021  1.00 37.60  ? 7    ALA A CA    1 
ATOM   35    C C     . ALA A  1 7   ? 65.485  115.684 -77.970  1.00 35.00  ? 7    ALA A C     1 
ATOM   36    O O     . ALA A  1 7   ? 65.024  116.173 -76.952  1.00 34.02  ? 7    ALA A O     1 
ATOM   37    C CB    . ALA A  1 7   ? 64.587  116.005 -80.225  1.00 37.15  ? 7    ALA A CB    1 
ATOM   38    N N     . ASP A  1 8   ? 66.787  115.637 -78.241  1.00 34.80  ? 8    ASP A N     1 
ATOM   39    C CA    . ASP A  1 8   ? 67.784  116.251 -77.363  1.00 31.79  ? 8    ASP A CA    1 
ATOM   40    C C     . ASP A  1 8   ? 67.950  117.676 -77.885  1.00 30.10  ? 8    ASP A C     1 
ATOM   41    O O     . ASP A  1 8   ? 68.065  118.620 -77.115  1.00 30.96  ? 8    ASP A O     1 
ATOM   42    C CB    . ASP A  1 8   ? 69.128  115.527 -77.438  1.00 30.73  ? 8    ASP A CB    1 
ATOM   43    C CG    . ASP A  1 8   ? 69.083  114.178 -76.789  1.00 31.69  ? 8    ASP A CG    1 
ATOM   44    O OD1   . ASP A  1 8   ? 68.568  114.092 -75.658  1.00 35.90  ? 8    ASP A OD1   1 
ATOM   45    O OD2   . ASP A  1 8   ? 69.557  113.204 -77.393  1.00 33.23  ? 8    ASP A OD2   1 
ATOM   46    N N     . VAL A  1 9   ? 67.935  117.831 -79.204  1.00 28.56  ? 9    VAL A N     1 
ATOM   47    C CA    . VAL A  1 9   ? 68.104  119.149 -79.786  1.00 26.27  ? 9    VAL A CA    1 
ATOM   48    C C     . VAL A  1 9   ? 67.136  119.453 -80.909  1.00 25.48  ? 9    VAL A C     1 
ATOM   49    O O     . VAL A  1 9   ? 67.020  118.714 -81.887  1.00 26.02  ? 9    VAL A O     1 
ATOM   50    C CB    . VAL A  1 9   ? 69.543  119.353 -80.307  1.00 23.61  ? 9    VAL A CB    1 
ATOM   51    C CG1   . VAL A  1 9   ? 69.703  120.805 -80.815  1.00 23.57  ? 9    VAL A CG1   1 
ATOM   52    C CG2   . VAL A  1 9   ? 70.539  119.063 -79.200  1.00 22.59  ? 9    VAL A CG2   1 
ATOM   53    N N     . THR A  1 10  ? 66.442  120.565 -80.765  1.00 25.16  ? 10   THR A N     1 
ATOM   54    C CA    . THR A  1 10  ? 65.496  120.950 -81.786  1.00 27.17  ? 10   THR A CA    1 
ATOM   55    C C     . THR A  1 10  ? 65.997  122.257 -82.346  1.00 27.18  ? 10   THR A C     1 
ATOM   56    O O     . THR A  1 10  ? 66.065  123.268 -81.642  1.00 28.20  ? 10   THR A O     1 
ATOM   57    C CB    . THR A  1 10  ? 64.049  121.113 -81.202  1.00 26.08  ? 10   THR A CB    1 
ATOM   58    O OG1   . THR A  1 10  ? 63.618  119.858 -80.658  1.00 25.15  ? 10   THR A OG1   1 
ATOM   59    C CG2   . THR A  1 10  ? 63.057  121.529 -82.297  1.00 21.93  ? 10   THR A CG2   1 
ATOM   60    N N     . VAL A  1 11  ? 66.380  122.217 -83.611  1.00 27.26  ? 11   VAL A N     1 
ATOM   61    C CA    . VAL A  1 11  ? 66.879  123.398 -84.271  1.00 27.83  ? 11   VAL A CA    1 
ATOM   62    C C     . VAL A  1 11  ? 65.759  124.080 -85.038  1.00 27.39  ? 11   VAL A C     1 
ATOM   63    O O     . VAL A  1 11  ? 65.089  123.446 -85.837  1.00 28.66  ? 11   VAL A O     1 
ATOM   64    C CB    . VAL A  1 11  ? 68.006  123.033 -85.215  1.00 27.65  ? 11   VAL A CB    1 
ATOM   65    C CG1   . VAL A  1 11  ? 68.535  124.297 -85.857  1.00 27.60  ? 11   VAL A CG1   1 
ATOM   66    C CG2   . VAL A  1 11  ? 69.106  122.305 -84.444  1.00 25.04  ? 11   VAL A CG2   1 
ATOM   67    N N     . ILE A  1 12  ? 65.537  125.364 -84.777  1.00 26.58  ? 12   ILE A N     1 
ATOM   68    C CA    . ILE A  1 12  ? 64.470  126.083 -85.465  1.00 25.95  ? 12   ILE A CA    1 
ATOM   69    C C     . ILE A  1 12  ? 65.117  126.911 -86.543  1.00 26.40  ? 12   ILE A C     1 
ATOM   70    O O     . ILE A  1 12  ? 65.762  127.917 -86.264  1.00 27.62  ? 12   ILE A O     1 
ATOM   71    C CB    . ILE A  1 12  ? 63.646  127.006 -84.506  1.00 25.79  ? 12   ILE A CB    1 
ATOM   72    C CG1   . ILE A  1 12  ? 63.063  126.174 -83.359  1.00 24.54  ? 12   ILE A CG1   1 
ATOM   73    C CG2   . ILE A  1 12  ? 62.445  127.641 -85.253  1.00 23.92  ? 12   ILE A CG2   1 
ATOM   74    C CD1   . ILE A  1 12  ? 62.379  127.000 -82.253  1.00 22.57  ? 12   ILE A CD1   1 
ATOM   75    N N     . GLY A  1 13  ? 64.947  126.460 -87.782  1.00 27.01  ? 13   GLY A N     1 
ATOM   76    C CA    . GLY A  1 13  ? 65.534  127.137 -88.920  1.00 26.72  ? 13   GLY A CA    1 
ATOM   77    C C     . GLY A  1 13  ? 66.525  126.234 -89.625  1.00 26.21  ? 13   GLY A C     1 
ATOM   78    O O     . GLY A  1 13  ? 67.363  125.601 -88.984  1.00 26.75  ? 13   GLY A O     1 
ATOM   79    N N     . SER A  1 14  ? 66.426  126.167 -90.941  1.00 25.33  ? 14   SER A N     1 
ATOM   80    C CA    . SER A  1 14  ? 67.319  125.327 -91.708  1.00 27.83  ? 14   SER A CA    1 
ATOM   81    C C     . SER A  1 14  ? 68.230  126.139 -92.610  1.00 27.16  ? 14   SER A C     1 
ATOM   82    O O     . SER A  1 14  ? 68.568  125.696 -93.699  1.00 26.99  ? 14   SER A O     1 
ATOM   83    C CB    . SER A  1 14  ? 66.534  124.334 -92.564  1.00 29.41  ? 14   SER A CB    1 
ATOM   84    O OG    . SER A  1 14  ? 65.896  124.999 -93.636  1.00 32.96  ? 14   SER A OG    1 
ATOM   85    N N     . GLY A  1 15  ? 68.586  127.341 -92.167  1.00 26.73  ? 15   GLY A N     1 
ATOM   86    C CA    . GLY A  1 15  ? 69.504  128.158 -92.926  1.00 26.99  ? 15   GLY A CA    1 
ATOM   87    C C     . GLY A  1 15  ? 70.927  127.673 -92.623  1.00 29.07  ? 15   GLY A C     1 
ATOM   88    O O     . GLY A  1 15  ? 71.106  126.653 -91.927  1.00 28.93  ? 15   GLY A O     1 
ATOM   89    N N     . PRO A  1 16  ? 71.967  128.384 -93.110  1.00 28.31  ? 16   PRO A N     1 
ATOM   90    C CA    . PRO A  1 16  ? 73.366  127.996 -92.873  1.00 26.99  ? 16   PRO A CA    1 
ATOM   91    C C     . PRO A  1 16  ? 73.649  127.640 -91.411  1.00 25.48  ? 16   PRO A C     1 
ATOM   92    O O     . PRO A  1 16  ? 74.328  126.651 -91.112  1.00 26.35  ? 16   PRO A O     1 
ATOM   93    C CB    . PRO A  1 16  ? 74.151  129.228 -93.334  1.00 27.89  ? 16   PRO A CB    1 
ATOM   94    C CG    . PRO A  1 16  ? 73.263  129.787 -94.433  1.00 27.75  ? 16   PRO A CG    1 
ATOM   95    C CD    . PRO A  1 16  ? 71.894  129.679 -93.816  1.00 26.69  ? 16   PRO A CD    1 
ATOM   96    N N     . GLY A  1 17  ? 73.143  128.447 -90.496  1.00 22.79  ? 17   GLY A N     1 
ATOM   97    C CA    . GLY A  1 17  ? 73.369  128.137 -89.102  1.00 24.11  ? 17   GLY A CA    1 
ATOM   98    C C     . GLY A  1 17  ? 72.623  126.888 -88.639  1.00 26.55  ? 17   GLY A C     1 
ATOM   99    O O     . GLY A  1 17  ? 73.215  125.940 -88.086  1.00 26.68  ? 17   GLY A O     1 
ATOM   100   N N     . GLY A  1 18  ? 71.309  126.900 -88.873  1.00 25.81  ? 18   GLY A N     1 
ATOM   101   C CA    . GLY A  1 18  ? 70.456  125.811 -88.476  1.00 24.37  ? 18   GLY A CA    1 
ATOM   102   C C     . GLY A  1 18  ? 70.786  124.439 -89.018  1.00 24.80  ? 18   GLY A C     1 
ATOM   103   O O     . GLY A  1 18  ? 70.946  123.500 -88.235  1.00 25.58  ? 18   GLY A O     1 
ATOM   104   N N     . TYR A  1 19  ? 70.902  124.300 -90.334  1.00 23.95  ? 19   TYR A N     1 
ATOM   105   C CA    . TYR A  1 19  ? 71.175  122.975 -90.897  1.00 23.43  ? 19   TYR A CA    1 
ATOM   106   C C     . TYR A  1 19  ? 72.564  122.399 -90.545  1.00 22.49  ? 19   TYR A C     1 
ATOM   107   O O     . TYR A  1 19  ? 72.703  121.194 -90.323  1.00 21.22  ? 19   TYR A O     1 
ATOM   108   C CB    . TYR A  1 19  ? 70.920  123.006 -92.413  1.00 23.28  ? 19   TYR A CB    1 
ATOM   109   C CG    . TYR A  1 19  ? 72.143  123.046 -93.287  1.00 22.50  ? 19   TYR A CG    1 
ATOM   110   C CD1   . TYR A  1 19  ? 72.839  121.874 -93.591  1.00 22.41  ? 19   TYR A CD1   1 
ATOM   111   C CD2   . TYR A  1 19  ? 72.597  124.249 -93.828  1.00 23.32  ? 19   TYR A CD2   1 
ATOM   112   C CE1   . TYR A  1 19  ? 73.947  121.901 -94.405  1.00 23.17  ? 19   TYR A CE1   1 
ATOM   113   C CE2   . TYR A  1 19  ? 73.711  124.291 -94.649  1.00 23.27  ? 19   TYR A CE2   1 
ATOM   114   C CZ    . TYR A  1 19  ? 74.390  123.107 -94.935  1.00 24.77  ? 19   TYR A CZ    1 
ATOM   115   O OH    . TYR A  1 19  ? 75.537  123.115 -95.725  1.00 27.35  ? 19   TYR A OH    1 
ATOM   116   N N     . VAL A  1 20  ? 73.580  123.257 -90.500  1.00 21.99  ? 20   VAL A N     1 
ATOM   117   C CA    . VAL A  1 20  ? 74.924  122.844 -90.128  1.00 22.66  ? 20   VAL A CA    1 
ATOM   118   C C     . VAL A  1 20  ? 74.888  122.418 -88.639  1.00 23.76  ? 20   VAL A C     1 
ATOM   119   O O     . VAL A  1 20  ? 75.495  121.427 -88.260  1.00 23.27  ? 20   VAL A O     1 
ATOM   120   C CB    . VAL A  1 20  ? 75.942  124.022 -90.362  1.00 22.75  ? 20   VAL A CB    1 
ATOM   121   C CG1   . VAL A  1 20  ? 77.218  123.788 -89.604  1.00 22.32  ? 20   VAL A CG1   1 
ATOM   122   C CG2   . VAL A  1 20  ? 76.276  124.141 -91.846  1.00 22.23  ? 20   VAL A CG2   1 
ATOM   123   N N     . ALA A  1 21  ? 74.146  123.148 -87.808  1.00 24.39  ? 21   ALA A N     1 
ATOM   124   C CA    . ALA A  1 21  ? 74.055  122.821 -86.384  1.00 25.88  ? 21   ALA A CA    1 
ATOM   125   C C     . ALA A  1 21  ? 73.336  121.499 -86.154  1.00 28.15  ? 21   ALA A C     1 
ATOM   126   O O     . ALA A  1 21  ? 73.724  120.699 -85.278  1.00 28.87  ? 21   ALA A O     1 
ATOM   127   C CB    . ALA A  1 21  ? 73.333  123.936 -85.615  1.00 22.18  ? 21   ALA A CB    1 
ATOM   128   N N     . ALA A  1 22  ? 72.276  121.272 -86.932  1.00 27.47  ? 22   ALA A N     1 
ATOM   129   C CA    . ALA A  1 22  ? 71.500  120.047 -86.812  1.00 26.42  ? 22   ALA A CA    1 
ATOM   130   C C     . ALA A  1 22  ? 72.389  118.834 -87.162  1.00 26.44  ? 22   ALA A C     1 
ATOM   131   O O     . ALA A  1 22  ? 72.386  117.827 -86.457  1.00 27.63  ? 22   ALA A O     1 
ATOM   132   C CB    . ALA A  1 22  ? 70.251  120.120 -87.732  1.00 23.81  ? 22   ALA A CB    1 
ATOM   133   N N     . ILE A  1 23  ? 73.164  118.941 -88.238  1.00 26.02  ? 23   ILE A N     1 
ATOM   134   C CA    . ILE A  1 23  ? 74.041  117.849 -88.658  1.00 25.02  ? 23   ILE A CA    1 
ATOM   135   C C     . ILE A  1 23  ? 75.118  117.588 -87.604  1.00 26.00  ? 23   ILE A C     1 
ATOM   136   O O     . ILE A  1 23  ? 75.375  116.442 -87.208  1.00 26.25  ? 23   ILE A O     1 
ATOM   137   C CB    . ILE A  1 23  ? 74.723  118.179 -90.020  1.00 22.40  ? 23   ILE A CB    1 
ATOM   138   C CG1   . ILE A  1 23  ? 73.687  118.163 -91.144  1.00 22.60  ? 23   ILE A CG1   1 
ATOM   139   C CG2   . ILE A  1 23  ? 75.813  117.202 -90.307  1.00 19.08  ? 23   ILE A CG2   1 
ATOM   140   C CD1   . ILE A  1 23  ? 74.111  118.928 -92.388  1.00 23.77  ? 23   ILE A CD1   1 
ATOM   141   N N     . LYS A  1 24  ? 75.737  118.666 -87.138  1.00 27.16  ? 24   LYS A N     1 
ATOM   142   C CA    . LYS A  1 24  ? 76.785  118.531 -86.145  1.00 26.32  ? 24   LYS A CA    1 
ATOM   143   C C     . LYS A  1 24  ? 76.231  117.904 -84.884  1.00 25.71  ? 24   LYS A C     1 
ATOM   144   O O     . LYS A  1 24  ? 76.825  116.975 -84.353  1.00 27.90  ? 24   LYS A O     1 
ATOM   145   C CB    . LYS A  1 24  ? 77.454  119.876 -85.831  1.00 23.93  ? 24   LYS A CB    1 
ATOM   146   C CG    . LYS A  1 24  ? 78.742  119.694 -85.028  1.00 24.35  ? 24   LYS A CG    1 
ATOM   147   C CD    . LYS A  1 24  ? 79.899  119.139 -85.870  1.00 22.77  ? 24   LYS A CD    1 
ATOM   148   C CE    . LYS A  1 24  ? 80.982  118.526 -84.972  1.00 26.29  ? 24   LYS A CE    1 
ATOM   149   N NZ    . LYS A  1 24  ? 82.280  118.310 -85.674  1.00 25.64  ? 24   LYS A NZ    1 
ATOM   150   N N     . ALA A  1 25  ? 75.087  118.388 -84.413  1.00 25.20  ? 25   ALA A N     1 
ATOM   151   C CA    . ALA A  1 25  ? 74.496  117.822 -83.208  1.00 23.65  ? 25   ALA A CA    1 
ATOM   152   C C     . ALA A  1 25  ? 74.236  116.328 -83.398  1.00 23.10  ? 25   ALA A C     1 
ATOM   153   O O     . ALA A  1 25  ? 74.566  115.515 -82.525  1.00 24.07  ? 25   ALA A O     1 
ATOM   154   C CB    . ALA A  1 25  ? 73.198  118.566 -82.836  1.00 23.31  ? 25   ALA A CB    1 
ATOM   155   N N     . ALA A  1 26  ? 73.662  115.953 -84.534  1.00 22.90  ? 26   ALA A N     1 
ATOM   156   C CA    . ALA A  1 26  ? 73.398  114.538 -84.789  1.00 24.35  ? 26   ALA A CA    1 
ATOM   157   C C     . ALA A  1 26  ? 74.705  113.740 -84.777  1.00 25.69  ? 26   ALA A C     1 
ATOM   158   O O     . ALA A  1 26  ? 74.781  112.646 -84.194  1.00 26.24  ? 26   ALA A O     1 
ATOM   159   C CB    . ALA A  1 26  ? 72.687  114.356 -86.129  1.00 23.39  ? 26   ALA A CB    1 
ATOM   160   N N     . GLN A  1 27  ? 75.739  114.286 -85.418  1.00 25.42  ? 27   GLN A N     1 
ATOM   161   C CA    . GLN A  1 27  ? 77.026  113.601 -85.465  1.00 24.67  ? 27   GLN A CA    1 
ATOM   162   C C     . GLN A  1 27  ? 77.693  113.536 -84.089  1.00 25.67  ? 27   GLN A C     1 
ATOM   163   O O     . GLN A  1 27  ? 78.604  112.730 -83.892  1.00 27.23  ? 27   GLN A O     1 
ATOM   164   C CB    . GLN A  1 27  ? 77.980  114.278 -86.457  1.00 21.31  ? 27   GLN A CB    1 
ATOM   165   C CG    . GLN A  1 27  ? 77.469  114.382 -87.869  1.00 19.36  ? 27   GLN A CG    1 
ATOM   166   C CD    . GLN A  1 27  ? 78.452  115.098 -88.781  1.00 19.48  ? 27   GLN A CD    1 
ATOM   167   O OE1   . GLN A  1 27  ? 79.290  115.866 -88.316  1.00 16.89  ? 27   GLN A OE1   1 
ATOM   168   N NE2   . GLN A  1 27  ? 78.335  114.871 -90.084  1.00 14.63  ? 27   GLN A NE2   1 
ATOM   169   N N     . LEU A  1 28  ? 77.281  114.392 -83.154  1.00 24.63  ? 28   LEU A N     1 
ATOM   170   C CA    . LEU A  1 28  ? 77.859  114.376 -81.797  1.00 26.20  ? 28   LEU A CA    1 
ATOM   171   C C     . LEU A  1 28  ? 77.117  113.377 -80.904  1.00 27.96  ? 28   LEU A C     1 
ATOM   172   O O     . LEU A  1 28  ? 77.522  113.120 -79.759  1.00 26.43  ? 28   LEU A O     1 
ATOM   173   C CB    . LEU A  1 28  ? 77.815  115.766 -81.143  1.00 24.47  ? 28   LEU A CB    1 
ATOM   174   C CG    . LEU A  1 28  ? 78.827  116.747 -81.777  1.00 27.34  ? 28   LEU A CG    1 
ATOM   175   C CD1   . LEU A  1 28  ? 78.583  118.198 -81.329  1.00 24.00  ? 28   LEU A CD1   1 
ATOM   176   C CD2   . LEU A  1 28  ? 80.239  116.269 -81.443  1.00 23.23  ? 28   LEU A CD2   1 
ATOM   177   N N     . GLY A  1 29  ? 76.031  112.827 -81.458  1.00 28.10  ? 29   GLY A N     1 
ATOM   178   C CA    . GLY A  1 29  ? 75.214  111.856 -80.755  1.00 27.57  ? 29   GLY A CA    1 
ATOM   179   C C     . GLY A  1 29  ? 73.857  112.337 -80.259  1.00 28.51  ? 29   GLY A C     1 
ATOM   180   O O     . GLY A  1 29  ? 73.131  111.586 -79.611  1.00 27.25  ? 29   GLY A O     1 
ATOM   181   N N     . PHE A  1 30  ? 73.500  113.581 -80.558  1.00 28.74  ? 30   PHE A N     1 
ATOM   182   C CA    . PHE A  1 30  ? 72.232  114.111 -80.099  1.00 28.79  ? 30   PHE A CA    1 
ATOM   183   C C     . PHE A  1 30  ? 71.072  113.702 -80.990  1.00 29.63  ? 30   PHE A C     1 
ATOM   184   O O     . PHE A  1 30  ? 71.212  113.733 -82.206  1.00 28.61  ? 30   PHE A O     1 
ATOM   185   C CB    . PHE A  1 30  ? 72.289  115.635 -80.058  1.00 28.93  ? 30   PHE A CB    1 
ATOM   186   C CG    . PHE A  1 30  ? 73.105  116.191 -78.928  1.00 29.21  ? 30   PHE A CG    1 
ATOM   187   C CD1   . PHE A  1 30  ? 72.731  115.960 -77.606  1.00 28.35  ? 30   PHE A CD1   1 
ATOM   188   C CD2   . PHE A  1 30  ? 74.205  117.010 -79.179  1.00 27.30  ? 30   PHE A CD2   1 
ATOM   189   C CE1   . PHE A  1 30  ? 73.433  116.544 -76.555  1.00 27.57  ? 30   PHE A CE1   1 
ATOM   190   C CE2   . PHE A  1 30  ? 74.915  117.598 -78.134  1.00 27.99  ? 30   PHE A CE2   1 
ATOM   191   C CZ    . PHE A  1 30  ? 74.524  117.364 -76.812  1.00 27.27  ? 30   PHE A CZ    1 
ATOM   192   N N     . LYS A  1 31  ? 69.946  113.304 -80.378  1.00 28.71  ? 31   LYS A N     1 
ATOM   193   C CA    . LYS A  1 31  ? 68.736  112.987 -81.130  1.00 28.58  ? 31   LYS A CA    1 
ATOM   194   C C     . LYS A  1 31  ? 68.309  114.395 -81.580  1.00 28.33  ? 31   LYS A C     1 
ATOM   195   O O     . LYS A  1 31  ? 67.896  115.239 -80.757  1.00 24.14  ? 31   LYS A O     1 
ATOM   196   C CB    . LYS A  1 31  ? 67.674  112.372 -80.223  1.00 32.31  ? 31   LYS A CB    1 
ATOM   197   C CG    . LYS A  1 31  ? 66.414  111.960 -80.960  1.00 37.26  ? 31   LYS A CG    1 
ATOM   198   C CD    . LYS A  1 31  ? 65.624  110.932 -80.143  1.00 44.25  ? 31   LYS A CD    1 
ATOM   199   C CE    . LYS A  1 31  ? 64.438  110.321 -80.932  1.00 47.89  ? 31   LYS A CE    1 
ATOM   200   N NZ    . LYS A  1 31  ? 63.858  109.081 -80.271  1.00 50.41  ? 31   LYS A NZ    1 
ATOM   201   N N     . THR A  1 32  ? 68.417  114.645 -82.887  1.00 27.65  ? 32   THR A N     1 
ATOM   202   C CA    . THR A  1 32  ? 68.159  115.970 -83.437  1.00 26.85  ? 32   THR A CA    1 
ATOM   203   C C     . THR A  1 32  ? 66.960  116.199 -84.346  1.00 26.10  ? 32   THR A C     1 
ATOM   204   O O     . THR A  1 32  ? 66.643  115.400 -85.218  1.00 26.44  ? 32   THR A O     1 
ATOM   205   C CB    . THR A  1 32  ? 69.463  116.460 -84.156  1.00 28.26  ? 32   THR A CB    1 
ATOM   206   O OG1   . THR A  1 32  ? 70.577  116.342 -83.248  1.00 26.28  ? 32   THR A OG1   1 
ATOM   207   C CG2   . THR A  1 32  ? 69.337  117.918 -84.620  1.00 28.09  ? 32   THR A CG2   1 
ATOM   208   N N     . VAL A  1 33  ? 66.309  117.331 -84.134  1.00 25.79  ? 33   VAL A N     1 
ATOM   209   C CA    . VAL A  1 33  ? 65.161  117.716 -84.933  1.00 25.09  ? 33   VAL A CA    1 
ATOM   210   C C     . VAL A  1 33  ? 65.394  119.108 -85.508  1.00 24.79  ? 33   VAL A C     1 
ATOM   211   O O     . VAL A  1 33  ? 65.810  120.014 -84.798  1.00 23.27  ? 33   VAL A O     1 
ATOM   212   C CB    . VAL A  1 33  ? 63.861  117.727 -84.074  1.00 25.87  ? 33   VAL A CB    1 
ATOM   213   C CG1   . VAL A  1 33  ? 62.782  118.565 -84.737  1.00 24.86  ? 33   VAL A CG1   1 
ATOM   214   C CG2   . VAL A  1 33  ? 63.358  116.315 -83.896  1.00 25.23  ? 33   VAL A CG2   1 
ATOM   215   N N     . CYS A  1 34  ? 65.158  119.257 -86.809  1.00 25.33  ? 34   CYS A N     1 
ATOM   216   C CA    . CYS A  1 34  ? 65.282  120.554 -87.471  1.00 26.54  ? 34   CYS A CA    1 
ATOM   217   C C     . CYS A  1 34  ? 63.916  120.889 -88.082  1.00 27.08  ? 34   CYS A C     1 
ATOM   218   O O     . CYS A  1 34  ? 63.339  120.079 -88.814  1.00 27.34  ? 34   CYS A O     1 
ATOM   219   C CB    . CYS A  1 34  ? 66.342  120.535 -88.584  1.00 25.64  ? 34   CYS A CB    1 
ATOM   220   S SG    . CYS A  1 34  ? 66.569  122.150 -89.376  1.00 26.96  ? 34   CYS A SG    1 
ATOM   221   N N     . ILE A  1 35  ? 63.418  122.085 -87.762  1.00 27.22  ? 35   ILE A N     1 
ATOM   222   C CA    . ILE A  1 35  ? 62.132  122.589 -88.243  1.00 27.11  ? 35   ILE A CA    1 
ATOM   223   C C     . ILE A  1 35  ? 62.319  123.714 -89.248  1.00 27.62  ? 35   ILE A C     1 
ATOM   224   O O     . ILE A  1 35  ? 63.134  124.602 -89.051  1.00 28.48  ? 35   ILE A O     1 
ATOM   225   C CB    . ILE A  1 35  ? 61.284  123.161 -87.108  1.00 26.55  ? 35   ILE A CB    1 
ATOM   226   C CG1   . ILE A  1 35  ? 61.150  122.141 -85.992  1.00 24.72  ? 35   ILE A CG1   1 
ATOM   227   C CG2   . ILE A  1 35  ? 59.911  123.566 -87.643  1.00 26.81  ? 35   ILE A CG2   1 
ATOM   228   C CD1   . ILE A  1 35  ? 60.623  122.735 -84.728  1.00 27.38  ? 35   ILE A CD1   1 
ATOM   229   N N     . GLU A  1 36  ? 61.539  123.674 -90.318  1.00 28.80  ? 36   GLU A N     1 
ATOM   230   C CA    . GLU A  1 36  ? 61.609  124.672 -91.369  1.00 30.81  ? 36   GLU A CA    1 
ATOM   231   C C     . GLU A  1 36  ? 60.208  124.995 -91.906  1.00 32.31  ? 36   GLU A C     1 
ATOM   232   O O     . GLU A  1 36  ? 59.447  124.091 -92.261  1.00 33.02  ? 36   GLU A O     1 
ATOM   233   C CB    . GLU A  1 36  ? 62.492  124.157 -92.514  1.00 31.27  ? 36   GLU A CB    1 
ATOM   234   C CG    . GLU A  1 36  ? 62.661  125.145 -93.634  1.00 29.99  ? 36   GLU A CG    1 
ATOM   235   C CD    . GLU A  1 36  ? 63.127  126.464 -93.100  1.00 31.90  ? 36   GLU A CD    1 
ATOM   236   O OE1   . GLU A  1 36  ? 64.315  126.557 -92.719  1.00 31.27  ? 36   GLU A OE1   1 
ATOM   237   O OE2   . GLU A  1 36  ? 62.296  127.395 -93.044  1.00 30.75  ? 36   GLU A OE2   1 
ATOM   238   N N     . LYS A  1 37  ? 59.882  126.285 -91.953  1.00 32.17  ? 37   LYS A N     1 
ATOM   239   C CA    . LYS A  1 37  ? 58.601  126.760 -92.452  1.00 31.89  ? 37   LYS A CA    1 
ATOM   240   C C     . LYS A  1 37  ? 58.570  126.804 -93.986  1.00 33.35  ? 37   LYS A C     1 
ATOM   241   O O     . LYS A  1 37  ? 57.510  126.600 -94.571  1.00 34.35  ? 37   LYS A O     1 
ATOM   242   C CB    . LYS A  1 37  ? 58.297  128.160 -91.897  1.00 30.64  ? 37   LYS A CB    1 
ATOM   243   C CG    . LYS A  1 37  ? 59.218  129.273 -92.396  1.00 29.61  ? 37   LYS A CG    1 
ATOM   244   C CD    . LYS A  1 37  ? 58.911  130.574 -91.652  1.00 31.32  ? 37   LYS A CD    1 
ATOM   245   C CE    . LYS A  1 37  ? 59.901  131.691 -91.985  1.00 33.37  ? 37   LYS A CE    1 
ATOM   246   N NZ    . LYS A  1 37  ? 59.996  131.971 -93.457  1.00 36.03  ? 37   LYS A NZ    1 
ATOM   247   N N     . ASN A  1 38  ? 59.716  127.055 -94.635  1.00 33.58  ? 38   ASN A N     1 
ATOM   248   C CA    . ASN A  1 38  ? 59.770  127.131 -96.098  1.00 33.80  ? 38   ASN A CA    1 
ATOM   249   C C     . ASN A  1 38  ? 59.719  125.784 -96.792  1.00 36.59  ? 38   ASN A C     1 
ATOM   250   O O     . ASN A  1 38  ? 59.968  124.761 -96.173  1.00 38.15  ? 38   ASN A O     1 
ATOM   251   C CB    . ASN A  1 38  ? 60.999  127.907 -96.544  1.00 31.69  ? 38   ASN A CB    1 
ATOM   252   C CG    . ASN A  1 38  ? 60.937  129.350 -96.116  1.00 33.30  ? 38   ASN A CG    1 
ATOM   253   O OD1   . ASN A  1 38  ? 59.997  129.749 -95.432  1.00 34.03  ? 38   ASN A OD1   1 
ATOM   254   N ND2   . ASN A  1 38  ? 61.934  130.143 -96.496  1.00 33.02  ? 38   ASN A ND2   1 
ATOM   255   N N     . GLU A  1 39  ? 59.393  125.791 -98.083  1.00 39.17  ? 39   GLU A N     1 
ATOM   256   C CA    . GLU A  1 39  ? 59.242  124.569 -98.878  1.00 40.94  ? 39   GLU A CA    1 
ATOM   257   C C     . GLU A  1 39  ? 60.497  123.749 -99.074  1.00 40.30  ? 39   GLU A C     1 
ATOM   258   O O     . GLU A  1 39  ? 60.437  122.578 -99.464  1.00 39.94  ? 39   GLU A O     1 
ATOM   259   C CB    . GLU A  1 39  ? 58.728  124.911 -100.263 1.00 45.08  ? 39   GLU A CB    1 
ATOM   260   C CG    . GLU A  1 39  ? 57.565  125.862 -100.317 1.00 52.86  ? 39   GLU A CG    1 
ATOM   261   C CD    . GLU A  1 39  ? 57.002  125.921 -101.722 1.00 57.19  ? 39   GLU A CD    1 
ATOM   262   O OE1   . GLU A  1 39  ? 57.820  125.853 -102.675 1.00 58.02  ? 39   GLU A OE1   1 
ATOM   263   O OE2   . GLU A  1 39  ? 55.760  126.032 -101.869 1.00 58.90  ? 39   GLU A OE2   1 
ATOM   264   N N     . THR A  1 40  ? 61.633  124.388 -98.853  1.00 38.96  ? 40   THR A N     1 
ATOM   265   C CA    . THR A  1 40  ? 62.926  123.757 -99.016  1.00 35.69  ? 40   THR A CA    1 
ATOM   266   C C     . THR A  1 40  ? 63.780  124.139 -97.815  1.00 35.19  ? 40   THR A C     1 
ATOM   267   O O     . THR A  1 40  ? 63.443  125.067 -97.055  1.00 36.83  ? 40   THR A O     1 
ATOM   268   C CB    . THR A  1 40  ? 63.619  124.278 -100.276 1.00 36.31  ? 40   THR A CB    1 
ATOM   269   O OG1   . THR A  1 40  ? 63.736  125.705 -100.191 1.00 36.14  ? 40   THR A OG1   1 
ATOM   270   C CG2   . THR A  1 40  ? 62.826  123.929 -101.504 1.00 32.49  ? 40   THR A CG2   1 
ATOM   271   N N     . LEU A  1 41  ? 64.888  123.429 -97.650  1.00 31.69  ? 41   LEU A N     1 
ATOM   272   C CA    . LEU A  1 41  ? 65.800  123.671 -96.548  1.00 27.96  ? 41   LEU A CA    1 
ATOM   273   C C     . LEU A  1 41  ? 66.853  124.639 -97.069  1.00 28.05  ? 41   LEU A C     1 
ATOM   274   O O     . LEU A  1 41  ? 66.912  124.927 -98.282  1.00 26.86  ? 41   LEU A O     1 
ATOM   275   C CB    . LEU A  1 41  ? 66.474  122.352 -96.149  1.00 24.79  ? 41   LEU A CB    1 
ATOM   276   C CG    . LEU A  1 41  ? 65.568  121.193 -95.735  1.00 23.76  ? 41   LEU A CG    1 
ATOM   277   C CD1   . LEU A  1 41  ? 66.329  119.884 -95.670  1.00 23.64  ? 41   LEU A CD1   1 
ATOM   278   C CD2   . LEU A  1 41  ? 64.953  121.517 -94.378  1.00 26.34  ? 41   LEU A CD2   1 
ATOM   279   N N     . GLY A  1 42  ? 67.663  125.168 -96.160  1.00 26.06  ? 42   GLY A N     1 
ATOM   280   C CA    . GLY A  1 42  ? 68.752  126.007 -96.612  1.00 25.66  ? 42   GLY A CA    1 
ATOM   281   C C     . GLY A  1 42  ? 68.651  127.480 -96.390  1.00 25.31  ? 42   GLY A C     1 
ATOM   282   O O     . GLY A  1 42  ? 69.615  128.208 -96.607  1.00 24.27  ? 42   GLY A O     1 
ATOM   283   N N     . GLY A  1 43  ? 67.474  127.913 -95.976  1.00 24.69  ? 43   GLY A N     1 
ATOM   284   C CA    . GLY A  1 43  ? 67.283  129.307 -95.703  1.00 25.41  ? 43   GLY A CA    1 
ATOM   285   C C     . GLY A  1 43  ? 67.649  130.325 -96.763  1.00 26.95  ? 43   GLY A C     1 
ATOM   286   O O     . GLY A  1 43  ? 67.721  130.079 -97.988  1.00 26.08  ? 43   GLY A O     1 
ATOM   287   N N     . THR A  1 44  ? 67.884  131.514 -96.238  1.00 26.34  ? 44   THR A N     1 
ATOM   288   C CA    . THR A  1 44  ? 68.193  132.667 -97.034  1.00 28.31  ? 44   THR A CA    1 
ATOM   289   C C     . THR A  1 44  ? 69.313  132.521 -98.036  1.00 29.06  ? 44   THR A C     1 
ATOM   290   O O     . THR A  1 44  ? 69.123  132.766 -99.228  1.00 30.37  ? 44   THR A O     1 
ATOM   291   C CB    . THR A  1 44  ? 68.489  133.830 -96.117  1.00 28.53  ? 44   THR A CB    1 
ATOM   292   O OG1   . THR A  1 44  ? 67.325  134.114 -95.332  1.00 29.31  ? 44   THR A OG1   1 
ATOM   293   C CG2   . THR A  1 44  ? 68.859  135.017 -96.897  1.00 28.75  ? 44   THR A CG2   1 
ATOM   294   N N     . CYS A  1 45  ? 70.467  132.108 -97.543  1.00 28.68  ? 45   CYS A N     1 
ATOM   295   C CA    . CYS A  1 45  ? 71.651  131.958 -98.358  1.00 30.24  ? 45   CYS A CA    1 
ATOM   296   C C     . CYS A  1 45  ? 71.511  131.107 -99.575  1.00 31.51  ? 45   CYS A C     1 
ATOM   297   O O     . CYS A  1 45  ? 71.871  131.502 -100.691 1.00 31.91  ? 45   CYS A O     1 
ATOM   298   C CB    . CYS A  1 45  ? 72.737  131.358 -97.513  1.00 32.90  ? 45   CYS A CB    1 
ATOM   299   S SG    . CYS A  1 45  ? 74.402  131.170 -98.211  1.00 33.60  ? 45   CYS A SG    1 
ATOM   300   N N     . LEU A  1 46  ? 71.012  129.911 -99.350  1.00 31.55  ? 46   LEU A N     1 
ATOM   301   C CA    . LEU A  1 46  ? 70.871  128.972 -100.426 1.00 32.94  ? 46   LEU A CA    1 
ATOM   302   C C     . LEU A  1 46  ? 69.722  129.241 -101.398 1.00 32.94  ? 46   LEU A C     1 
ATOM   303   O O     . LEU A  1 46  ? 69.884  129.126 -102.613 1.00 33.26  ? 46   LEU A O     1 
ATOM   304   C CB    . LEU A  1 46  ? 70.748  127.571 -99.831  1.00 33.82  ? 46   LEU A CB    1 
ATOM   305   C CG    . LEU A  1 46  ? 70.446  126.426 -100.791 1.00 36.40  ? 46   LEU A CG    1 
ATOM   306   C CD1   . LEU A  1 46  ? 71.420  126.406 -101.961 1.00 37.16  ? 46   LEU A CD1   1 
ATOM   307   C CD2   . LEU A  1 46  ? 70.541  125.155 -100.022 1.00 37.44  ? 46   LEU A CD2   1 
ATOM   308   N N     . ASN A  1 47  ? 68.572  129.629 -100.871 1.00 33.60  ? 47   ASN A N     1 
ATOM   309   C CA    . ASN A  1 47  ? 67.413  129.825 -101.719 1.00 33.22  ? 47   ASN A CA    1 
ATOM   310   C C     . ASN A  1 47  ? 67.298  131.168 -102.412 1.00 34.26  ? 47   ASN A C     1 
ATOM   311   O O     . ASN A  1 47  ? 66.961  131.217 -103.591 1.00 34.46  ? 47   ASN A O     1 
ATOM   312   C CB    . ASN A  1 47  ? 66.152  129.532 -100.906 1.00 33.01  ? 47   ASN A CB    1 
ATOM   313   C CG    . ASN A  1 47  ? 66.097  128.086 -100.428 1.00 34.83  ? 47   ASN A CG    1 
ATOM   314   O OD1   . ASN A  1 47  ? 65.801  127.174 -101.207 1.00 35.27  ? 47   ASN A OD1   1 
ATOM   315   N ND2   . ASN A  1 47  ? 66.407  127.866 -99.150  1.00 34.14  ? 47   ASN A ND2   1 
ATOM   316   N N     . VAL A  1 48  ? 67.605  132.252 -101.704 1.00 34.78  ? 48   VAL A N     1 
ATOM   317   C CA    . VAL A  1 48  ? 67.489  133.594 -102.282 1.00 34.84  ? 48   VAL A CA    1 
ATOM   318   C C     . VAL A  1 48  ? 68.644  134.506 -101.883 1.00 34.73  ? 48   VAL A C     1 
ATOM   319   O O     . VAL A  1 48  ? 68.475  135.719 -101.815 1.00 34.72  ? 48   VAL A O     1 
ATOM   320   C CB    . VAL A  1 48  ? 66.170  134.309 -101.825 1.00 36.34  ? 48   VAL A CB    1 
ATOM   321   C CG1   . VAL A  1 48  ? 64.946  133.481 -102.203 1.00 35.41  ? 48   VAL A CG1   1 
ATOM   322   C CG2   . VAL A  1 48  ? 66.196  134.552 -100.320 1.00 35.19  ? 48   VAL A CG2   1 
ATOM   323   N N     . GLY A  1 49  ? 69.817  133.941 -101.626 1.00 34.12  ? 49   GLY A N     1 
ATOM   324   C CA    . GLY A  1 49  ? 70.917  134.784 -101.208 1.00 32.53  ? 49   GLY A CA    1 
ATOM   325   C C     . GLY A  1 49  ? 72.255  134.525 -101.864 1.00 32.88  ? 49   GLY A C     1 
ATOM   326   O O     . GLY A  1 49  ? 72.414  134.682 -103.078 1.00 32.50  ? 49   GLY A O     1 
ATOM   327   N N     . CYS A  1 50  ? 73.228  134.156 -101.038 1.00 31.16  ? 50   CYS A N     1 
ATOM   328   C CA    . CYS A  1 50  ? 74.578  133.860 -101.505 1.00 30.03  ? 50   CYS A CA    1 
ATOM   329   C C     . CYS A  1 50  ? 74.616  132.995 -102.764 1.00 27.11  ? 50   CYS A C     1 
ATOM   330   O O     . CYS A  1 50  ? 75.229  133.341 -103.782 1.00 26.88  ? 50   CYS A O     1 
ATOM   331   C CB    . CYS A  1 50  ? 75.394  133.069 -100.460 1.00 29.81  ? 50   CYS A CB    1 
ATOM   332   S SG    . CYS A  1 50  ? 75.082  133.089 -98.659  1.00 29.98  ? 50   CYS A SG    1 
ATOM   333   N N     . ILE A  1 51  ? 73.988  131.836 -102.666 1.00 25.05  ? 51   ILE A N     1 
ATOM   334   C CA    . ILE A  1 51  ? 74.025  130.906 -103.766 1.00 25.44  ? 51   ILE A CA    1 
ATOM   335   C C     . ILE A  1 51  ? 73.471  131.427 -105.083 1.00 26.41  ? 51   ILE A C     1 
ATOM   336   O O     . ILE A  1 51  ? 74.252  131.585 -106.020 1.00 26.25  ? 51   ILE A O     1 
ATOM   337   C CB    . ILE A  1 51  ? 73.370  129.588 -103.363 1.00 25.43  ? 51   ILE A CB    1 
ATOM   338   C CG1   . ILE A  1 51  ? 74.091  129.046 -102.118 1.00 24.67  ? 51   ILE A CG1   1 
ATOM   339   C CG2   . ILE A  1 51  ? 73.386  128.600 -104.528 1.00 23.41  ? 51   ILE A CG2   1 
ATOM   340   C CD1   . ILE A  1 51  ? 75.621  128.949 -102.233 1.00 18.73  ? 51   ILE A CD1   1 
ATOM   341   N N     . PRO A  1 52  ? 72.140  131.733 -105.175 1.00 26.98  ? 52   PRO A N     1 
ATOM   342   C CA    . PRO A  1 52  ? 71.657  132.228 -106.472 1.00 27.08  ? 52   PRO A CA    1 
ATOM   343   C C     . PRO A  1 52  ? 72.388  133.480 -106.935 1.00 28.38  ? 52   PRO A C     1 
ATOM   344   O O     . PRO A  1 52  ? 72.612  133.649 -108.131 1.00 30.62  ? 52   PRO A O     1 
ATOM   345   C CB    . PRO A  1 52  ? 70.162  132.468 -106.233 1.00 25.27  ? 52   PRO A CB    1 
ATOM   346   C CG    . PRO A  1 52  ? 70.102  132.801 -104.803 1.00 24.47  ? 52   PRO A CG    1 
ATOM   347   C CD    . PRO A  1 52  ? 71.056  131.798 -104.176 1.00 23.65  ? 52   PRO A CD    1 
ATOM   348   N N     . SER A  1 53  ? 72.789  134.346 -106.011 1.00 27.99  ? 53   SER A N     1 
ATOM   349   C CA    . SER A  1 53  ? 73.493  135.568 -106.417 1.00 29.43  ? 53   SER A CA    1 
ATOM   350   C C     . SER A  1 53  ? 74.877  135.252 -107.005 1.00 30.20  ? 53   SER A C     1 
ATOM   351   O O     . SER A  1 53  ? 75.224  135.766 -108.082 1.00 30.48  ? 53   SER A O     1 
ATOM   352   C CB    . SER A  1 53  ? 73.612  136.555 -105.239 1.00 28.16  ? 53   SER A CB    1 
ATOM   353   O OG    . SER A  1 53  ? 74.510  136.103 -104.239 1.00 29.60  ? 53   SER A OG    1 
ATOM   354   N N     . LYS A  1 54  ? 75.661  134.403 -106.329 1.00 29.48  ? 54   LYS A N     1 
ATOM   355   C CA    . LYS A  1 54  ? 76.983  134.059 -106.857 1.00 28.28  ? 54   LYS A CA    1 
ATOM   356   C C     . LYS A  1 54  ? 76.882  133.432 -108.246 1.00 27.62  ? 54   LYS A C     1 
ATOM   357   O O     . LYS A  1 54  ? 77.772  133.600 -109.072 1.00 27.63  ? 54   LYS A O     1 
ATOM   358   C CB    . LYS A  1 54  ? 77.724  133.093 -105.927 1.00 27.78  ? 54   LYS A CB    1 
ATOM   359   C CG    . LYS A  1 54  ? 78.900  133.715 -105.146 1.00 26.72  ? 54   LYS A CG    1 
ATOM   360   C CD    . LYS A  1 54  ? 78.434  134.517 -103.927 1.00 25.00  ? 54   LYS A CD    1 
ATOM   361   C CE    . LYS A  1 54  ? 77.713  135.792 -104.298 1.00 24.79  ? 54   LYS A CE    1 
ATOM   362   N NZ    . LYS A  1 54  ? 77.025  136.357 -103.116 1.00 26.90  ? 54   LYS A NZ    1 
ATOM   363   N N     . ALA A  1 55  ? 75.805  132.692 -108.498 1.00 26.86  ? 55   ALA A N     1 
ATOM   364   C CA    . ALA A  1 55  ? 75.605  132.065 -109.807 1.00 25.35  ? 55   ALA A CA    1 
ATOM   365   C C     . ALA A  1 55  ? 75.466  133.154 -110.888 1.00 25.25  ? 55   ALA A C     1 
ATOM   366   O O     . ALA A  1 55  ? 76.209  133.164 -111.889 1.00 24.00  ? 55   ALA A O     1 
ATOM   367   C CB    . ALA A  1 55  ? 74.359  131.166 -109.786 1.00 23.54  ? 55   ALA A CB    1 
ATOM   368   N N     . LEU A  1 56  ? 74.536  134.082 -110.671 1.00 25.74  ? 56   LEU A N     1 
ATOM   369   C CA    . LEU A  1 56  ? 74.319  135.159 -111.632 1.00 27.56  ? 56   LEU A CA    1 
ATOM   370   C C     . LEU A  1 56  ? 75.611  135.937 -111.809 1.00 29.81  ? 56   LEU A C     1 
ATOM   371   O O     . LEU A  1 56  ? 76.031  136.222 -112.940 1.00 32.04  ? 56   LEU A O     1 
ATOM   372   C CB    . LEU A  1 56  ? 73.158  136.047 -111.175 1.00 27.28  ? 56   LEU A CB    1 
ATOM   373   C CG    . LEU A  1 56  ? 71.789  135.324 -111.235 1.00 25.55  ? 56   LEU A CG    1 
ATOM   374   C CD1   . LEU A  1 56  ? 70.703  136.330 -110.996 1.00 25.18  ? 56   LEU A CD1   1 
ATOM   375   C CD2   . LEU A  1 56  ? 71.572  134.660 -112.597 1.00 23.42  ? 56   LEU A CD2   1 
ATOM   376   N N     . LEU A  1 57  ? 76.273  136.234 -110.691 1.00 30.85  ? 57   LEU A N     1 
ATOM   377   C CA    . LEU A  1 57  ? 77.557  136.919 -110.729 1.00 29.05  ? 57   LEU A CA    1 
ATOM   378   C C     . LEU A  1 57  ? 78.541  136.185 -111.635 1.00 29.76  ? 57   LEU A C     1 
ATOM   379   O O     . LEU A  1 57  ? 79.195  136.803 -112.463 1.00 31.52  ? 57   LEU A O     1 
ATOM   380   C CB    . LEU A  1 57  ? 78.151  137.013 -109.330 1.00 27.42  ? 57   LEU A CB    1 
ATOM   381   C CG    . LEU A  1 57  ? 77.713  138.229 -108.515 1.00 25.69  ? 57   LEU A CG    1 
ATOM   382   C CD1   . LEU A  1 57  ? 78.125  138.047 -107.072 1.00 23.04  ? 57   LEU A CD1   1 
ATOM   383   C CD2   . LEU A  1 57  ? 78.320  139.496 -109.113 1.00 22.88  ? 57   LEU A CD2   1 
ATOM   384   N N     . ASN A  1 58  ? 78.632  134.865 -111.513 1.00 30.24  ? 58   ASN A N     1 
ATOM   385   C CA    . ASN A  1 58  ? 79.588  134.122 -112.326 1.00 30.72  ? 58   ASN A CA    1 
ATOM   386   C C     . ASN A  1 58  ? 79.240  134.145 -113.807 1.00 32.05  ? 58   ASN A C     1 
ATOM   387   O O     . ASN A  1 58  ? 80.095  134.393 -114.658 1.00 32.63  ? 58   ASN A O     1 
ATOM   388   C CB    . ASN A  1 58  ? 79.689  132.676 -111.820 1.00 32.45  ? 58   ASN A CB    1 
ATOM   389   C CG    . ASN A  1 58  ? 80.845  131.874 -112.473 1.00 33.67  ? 58   ASN A CG    1 
ATOM   390   O OD1   . ASN A  1 58  ? 82.018  132.279 -112.429 1.00 32.93  ? 58   ASN A OD1   1 
ATOM   391   N ND2   . ASN A  1 58  ? 80.506  130.718 -113.065 1.00 33.01  ? 58   ASN A ND2   1 
ATOM   392   N N     . ASN A  1 59  ? 77.975  133.911 -114.118 1.00 32.83  ? 59   ASN A N     1 
ATOM   393   C CA    . ASN A  1 59  ? 77.557  133.888 -115.504 1.00 32.88  ? 59   ASN A CA    1 
ATOM   394   C C     . ASN A  1 59  ? 77.621  135.242 -116.191 1.00 33.90  ? 59   ASN A C     1 
ATOM   395   O O     . ASN A  1 59  ? 78.077  135.351 -117.331 1.00 33.23  ? 59   ASN A O     1 
ATOM   396   C CB    . ASN A  1 59  ? 76.140  133.327 -115.606 1.00 32.90  ? 59   ASN A CB    1 
ATOM   397   C CG    . ASN A  1 59  ? 76.048  131.903 -115.102 1.00 30.99  ? 59   ASN A CG    1 
ATOM   398   O OD1   . ASN A  1 59  ? 77.014  131.136 -115.181 1.00 33.80  ? 59   ASN A OD1   1 
ATOM   399   N ND2   . ASN A  1 59  ? 74.889  131.532 -114.603 1.00 27.03  ? 59   ASN A ND2   1 
ATOM   400   N N     . SER A  1 60  ? 77.149  136.270 -115.500 1.00 34.74  ? 60   SER A N     1 
ATOM   401   C CA    . SER A  1 60  ? 77.140  137.598 -116.066 1.00 35.03  ? 60   SER A CA    1 
ATOM   402   C C     . SER A  1 60  ? 78.558  138.013 -116.371 1.00 36.07  ? 60   SER A C     1 
ATOM   403   O O     . SER A  1 60  ? 78.813  138.629 -117.393 1.00 37.99  ? 60   SER A O     1 
ATOM   404   C CB    . SER A  1 60  ? 76.480  138.587 -115.100 1.00 35.19  ? 60   SER A CB    1 
ATOM   405   O OG    . SER A  1 60  ? 77.120  138.604 -113.841 1.00 35.14  ? 60   SER A OG    1 
ATOM   406   N N     . HIS A  1 61  ? 79.497  137.655 -115.506 1.00 36.54  ? 61   HIS A N     1 
ATOM   407   C CA    . HIS A  1 61  ? 80.889  138.035 -115.741 1.00 36.73  ? 61   HIS A CA    1 
ATOM   408   C C     . HIS A  1 61  ? 81.436  137.382 -116.997 1.00 38.77  ? 61   HIS A C     1 
ATOM   409   O O     . HIS A  1 61  ? 82.183  138.004 -117.761 1.00 39.24  ? 61   HIS A O     1 
ATOM   410   C CB    . HIS A  1 61  ? 81.767  137.643 -114.560 1.00 36.23  ? 61   HIS A CB    1 
ATOM   411   C CG    . HIS A  1 61  ? 83.232  137.669 -114.868 1.00 34.27  ? 61   HIS A CG    1 
ATOM   412   N ND1   . HIS A  1 61  ? 83.926  138.839 -115.102 1.00 34.85  ? 61   HIS A ND1   1 
ATOM   413   C CD2   . HIS A  1 61  ? 84.124  136.665 -115.028 1.00 31.61  ? 61   HIS A CD2   1 
ATOM   414   C CE1   . HIS A  1 61  ? 85.181  138.553 -115.395 1.00 34.18  ? 61   HIS A CE1   1 
ATOM   415   N NE2   . HIS A  1 61  ? 85.328  137.240 -115.356 1.00 34.09  ? 61   HIS A NE2   1 
ATOM   416   N N     . TYR A  1 62  ? 81.089  136.111 -117.195 1.00 39.77  ? 62   TYR A N     1 
ATOM   417   C CA    . TYR A  1 62  ? 81.542  135.402 -118.378 1.00 39.49  ? 62   TYR A CA    1 
ATOM   418   C C     . TYR A  1 62  ? 80.823  135.970 -119.593 1.00 38.80  ? 62   TYR A C     1 
ATOM   419   O O     . TYR A  1 62  ? 81.394  136.021 -120.677 1.00 39.01  ? 62   TYR A O     1 
ATOM   420   C CB    . TYR A  1 62  ? 81.311  133.893 -118.226 1.00 41.68  ? 62   TYR A CB    1 
ATOM   421   C CG    . TYR A  1 62  ? 82.392  133.251 -117.389 1.00 45.08  ? 62   TYR A CG    1 
ATOM   422   C CD1   . TYR A  1 62  ? 83.730  133.355 -117.764 1.00 46.16  ? 62   TYR A CD1   1 
ATOM   423   C CD2   . TYR A  1 62  ? 82.097  132.588 -116.197 1.00 46.05  ? 62   TYR A CD2   1 
ATOM   424   C CE1   . TYR A  1 62  ? 84.756  132.818 -116.971 1.00 48.52  ? 62   TYR A CE1   1 
ATOM   425   C CE2   . TYR A  1 62  ? 83.118  132.048 -115.399 1.00 48.17  ? 62   TYR A CE2   1 
ATOM   426   C CZ    . TYR A  1 62  ? 84.442  132.168 -115.791 1.00 48.69  ? 62   TYR A CZ    1 
ATOM   427   O OH    . TYR A  1 62  ? 85.455  131.648 -115.005 1.00 50.96  ? 62   TYR A OH    1 
ATOM   428   N N     . TYR A  1 63  ? 79.580  136.414 -119.410 1.00 37.28  ? 63   TYR A N     1 
ATOM   429   C CA    . TYR A  1 63  ? 78.845  137.015 -120.507 1.00 36.97  ? 63   TYR A CA    1 
ATOM   430   C C     . TYR A  1 63  ? 79.676  138.209 -120.976 1.00 37.10  ? 63   TYR A C     1 
ATOM   431   O O     . TYR A  1 63  ? 79.934  138.400 -122.167 1.00 35.13  ? 63   TYR A O     1 
ATOM   432   C CB    . TYR A  1 63  ? 77.484  137.510 -120.029 1.00 37.48  ? 63   TYR A CB    1 
ATOM   433   C CG    . TYR A  1 63  ? 76.733  138.331 -121.063 1.00 38.65  ? 63   TYR A CG    1 
ATOM   434   C CD1   . TYR A  1 63  ? 76.318  137.760 -122.272 1.00 39.88  ? 63   TYR A CD1   1 
ATOM   435   C CD2   . TYR A  1 63  ? 76.439  139.683 -120.842 1.00 39.26  ? 63   TYR A CD2   1 
ATOM   436   C CE1   . TYR A  1 63  ? 75.628  138.516 -123.235 1.00 40.66  ? 63   TYR A CE1   1 
ATOM   437   C CE2   . TYR A  1 63  ? 75.747  140.447 -121.802 1.00 38.59  ? 63   TYR A CE2   1 
ATOM   438   C CZ    . TYR A  1 63  ? 75.346  139.852 -122.993 1.00 39.49  ? 63   TYR A CZ    1 
ATOM   439   O OH    . TYR A  1 63  ? 74.660  140.570 -123.947 1.00 41.92  ? 63   TYR A OH    1 
ATOM   440   N N     . HIS A  1 64  ? 80.094  139.002 -119.998 1.00 37.06  ? 64   HIS A N     1 
ATOM   441   C CA    . HIS A  1 64  ? 80.888  140.190 -120.226 1.00 38.25  ? 64   HIS A CA    1 
ATOM   442   C C     . HIS A  1 64  ? 82.191  139.904 -120.979 1.00 38.69  ? 64   HIS A C     1 
ATOM   443   O O     . HIS A  1 64  ? 82.587  140.678 -121.848 1.00 39.28  ? 64   HIS A O     1 
ATOM   444   C CB    . HIS A  1 64  ? 81.195  140.839 -118.877 1.00 39.33  ? 64   HIS A CB    1 
ATOM   445   C CG    . HIS A  1 64  ? 82.016  142.087 -118.967 1.00 40.94  ? 64   HIS A CG    1 
ATOM   446   N ND1   . HIS A  1 64  ? 82.760  142.563 -117.908 1.00 41.42  ? 64   HIS A ND1   1 
ATOM   447   C CD2   . HIS A  1 64  ? 82.210  142.959 -119.984 1.00 41.26  ? 64   HIS A CD2   1 
ATOM   448   C CE1   . HIS A  1 64  ? 83.379  143.672 -118.270 1.00 40.50  ? 64   HIS A CE1   1 
ATOM   449   N NE2   . HIS A  1 64  ? 83.062  143.933 -119.525 1.00 41.28  ? 64   HIS A NE2   1 
ATOM   450   N N     . MET A  1 65  ? 82.854  138.797 -120.658 1.00 38.79  ? 65   MET A N     1 
ATOM   451   C CA    . MET A  1 65  ? 84.119  138.453 -121.301 1.00 39.55  ? 65   MET A CA    1 
ATOM   452   C C     . MET A  1 65  ? 83.936  138.009 -122.742 1.00 40.55  ? 65   MET A C     1 
ATOM   453   O O     . MET A  1 65  ? 84.827  138.183 -123.572 1.00 41.96  ? 65   MET A O     1 
ATOM   454   C CB    . MET A  1 65  ? 84.844  137.358 -120.498 1.00 40.33  ? 65   MET A CB    1 
ATOM   455   C CG    . MET A  1 65  ? 85.112  137.696 -118.989 1.00 39.60  ? 65   MET A CG    1 
ATOM   456   S SD    . MET A  1 65  ? 86.414  138.921 -118.620 1.00 41.27  ? 65   MET A SD    1 
ATOM   457   C CE    . MET A  1 65  ? 85.496  140.531 -118.612 1.00 39.58  ? 65   MET A CE    1 
ATOM   458   N N     . ALA A  1 66  ? 82.770  137.446 -123.036 1.00 41.53  ? 66   ALA A N     1 
ATOM   459   C CA    . ALA A  1 66  ? 82.447  136.960 -124.369 1.00 42.44  ? 66   ALA A CA    1 
ATOM   460   C C     . ALA A  1 66  ? 81.888  138.085 -125.255 1.00 43.66  ? 66   ALA A C     1 
ATOM   461   O O     . ALA A  1 66  ? 82.339  138.311 -126.382 1.00 44.19  ? 66   ALA A O     1 
ATOM   462   C CB    . ALA A  1 66  ? 81.431  135.817 -124.254 1.00 41.17  ? 66   ALA A CB    1 
ATOM   463   N N     . HIS A  1 67  ? 80.908  138.796 -124.725 1.00 43.68  ? 67   HIS A N     1 
ATOM   464   C CA    . HIS A  1 67  ? 80.258  139.879 -125.441 1.00 44.52  ? 67   HIS A CA    1 
ATOM   465   C C     . HIS A  1 67  ? 81.217  141.053 -125.635 1.00 44.31  ? 67   HIS A C     1 
ATOM   466   O O     . HIS A  1 67  ? 81.269  141.660 -126.704 1.00 43.76  ? 67   HIS A O     1 
ATOM   467   C CB    . HIS A  1 67  ? 79.014  140.283 -124.638 1.00 45.73  ? 67   HIS A CB    1 
ATOM   468   C CG    . HIS A  1 67  ? 78.245  141.422 -125.218 1.00 47.91  ? 67   HIS A CG    1 
ATOM   469   N ND1   . HIS A  1 67  ? 77.650  141.367 -126.461 1.00 48.31  ? 67   HIS A ND1   1 
ATOM   470   C CD2   . HIS A  1 67  ? 77.944  142.638 -124.706 1.00 48.95  ? 67   HIS A CD2   1 
ATOM   471   C CE1   . HIS A  1 67  ? 77.015  142.503 -126.689 1.00 49.48  ? 67   HIS A CE1   1 
ATOM   472   N NE2   . HIS A  1 67  ? 77.177  143.290 -125.639 1.00 50.29  ? 67   HIS A NE2   1 
ATOM   473   N N     . GLY A  1 68  ? 81.988  141.338 -124.588 1.00 45.05  ? 68   GLY A N     1 
ATOM   474   C CA    . GLY A  1 68  ? 82.945  142.432 -124.599 1.00 44.30  ? 68   GLY A CA    1 
ATOM   475   C C     . GLY A  1 68  ? 84.223  142.078 -125.322 1.00 44.27  ? 68   GLY A C     1 
ATOM   476   O O     . GLY A  1 68  ? 84.247  141.116 -126.074 1.00 44.26  ? 68   GLY A O     1 
ATOM   477   N N     . THR A  1 69  ? 85.299  142.814 -125.065 1.00 44.24  ? 69   THR A N     1 
ATOM   478   C CA    . THR A  1 69  ? 86.558  142.587 -125.774 1.00 46.13  ? 69   THR A CA    1 
ATOM   479   C C     . THR A  1 69  ? 87.550  141.543 -125.258 1.00 45.35  ? 69   THR A C     1 
ATOM   480   O O     . THR A  1 69  ? 88.483  141.173 -125.986 1.00 44.86  ? 69   THR A O     1 
ATOM   481   C CB    . THR A  1 69  ? 87.359  143.912 -125.915 1.00 48.59  ? 69   THR A CB    1 
ATOM   482   O OG1   . THR A  1 69  ? 87.569  144.472 -124.613 1.00 50.59  ? 69   THR A OG1   1 
ATOM   483   C CG2   . THR A  1 69  ? 86.621  144.933 -126.820 1.00 49.20  ? 69   THR A CG2   1 
ATOM   484   N N     . ASP A  1 70  ? 87.360  141.059 -124.033 1.00 43.58  ? 70   ASP A N     1 
ATOM   485   C CA    . ASP A  1 70  ? 88.310  140.110 -123.460 1.00 42.38  ? 70   ASP A CA    1 
ATOM   486   C C     . ASP A  1 70  ? 88.585  138.848 -124.285 1.00 42.17  ? 70   ASP A C     1 
ATOM   487   O O     . ASP A  1 70  ? 89.729  138.579 -124.661 1.00 41.60  ? 70   ASP A O     1 
ATOM   488   C CB    . ASP A  1 70  ? 87.888  139.728 -122.032 1.00 42.58  ? 70   ASP A CB    1 
ATOM   489   C CG    . ASP A  1 70  ? 88.922  138.851 -121.334 1.00 42.08  ? 70   ASP A CG    1 
ATOM   490   O OD1   . ASP A  1 70  ? 88.951  137.636 -121.597 1.00 41.58  ? 70   ASP A OD1   1 
ATOM   491   O OD2   . ASP A  1 70  ? 89.723  139.368 -120.530 1.00 41.29  ? 70   ASP A OD2   1 
ATOM   492   N N     . PHE A  1 71  ? 87.557  138.067 -124.574 1.00 40.91  ? 71   PHE A N     1 
ATOM   493   C CA    . PHE A  1 71  ? 87.780  136.856 -125.354 1.00 41.42  ? 71   PHE A CA    1 
ATOM   494   C C     . PHE A  1 71  ? 88.351  137.134 -126.743 1.00 41.69  ? 71   PHE A C     1 
ATOM   495   O O     . PHE A  1 71  ? 89.162  136.361 -127.250 1.00 41.83  ? 71   PHE A O     1 
ATOM   496   C CB    . PHE A  1 71  ? 86.474  136.076 -125.476 1.00 42.15  ? 71   PHE A CB    1 
ATOM   497   C CG    . PHE A  1 71  ? 86.233  135.116 -124.351 1.00 40.72  ? 71   PHE A CG    1 
ATOM   498   C CD1   . PHE A  1 71  ? 86.699  135.387 -123.075 1.00 41.52  ? 71   PHE A CD1   1 
ATOM   499   C CD2   . PHE A  1 71  ? 85.530  133.940 -124.573 1.00 40.67  ? 71   PHE A CD2   1 
ATOM   500   C CE1   . PHE A  1 71  ? 86.470  134.489 -122.029 1.00 42.82  ? 71   PHE A CE1   1 
ATOM   501   C CE2   . PHE A  1 71  ? 85.293  133.041 -123.545 1.00 41.39  ? 71   PHE A CE2   1 
ATOM   502   C CZ    . PHE A  1 71  ? 85.763  133.310 -122.268 1.00 40.99  ? 71   PHE A CZ    1 
ATOM   503   N N     . ALA A  1 72  ? 87.911  138.235 -127.350 1.00 40.95  ? 72   ALA A N     1 
ATOM   504   C CA    . ALA A  1 72  ? 88.365  138.630 -128.674 1.00 39.94  ? 72   ALA A CA    1 
ATOM   505   C C     . ALA A  1 72  ? 89.864  138.780 -128.634 1.00 40.16  ? 72   ALA A C     1 
ATOM   506   O O     . ALA A  1 72  ? 90.560  138.400 -129.573 1.00 39.57  ? 72   ALA A O     1 
ATOM   507   C CB    . ALA A  1 72  ? 87.728  139.964 -129.082 1.00 38.57  ? 72   ALA A CB    1 
ATOM   508   N N     . SER A  1 73  ? 90.359  139.339 -127.533 1.00 40.93  ? 73   SER A N     1 
ATOM   509   C CA    . SER A  1 73  ? 91.793  139.569 -127.385 1.00 41.36  ? 73   SER A CA    1 
ATOM   510   C C     . SER A  1 73  ? 92.581  138.303 -127.136 1.00 40.71  ? 73   SER A C     1 
ATOM   511   O O     . SER A  1 73  ? 93.803  138.350 -127.061 1.00 40.41  ? 73   SER A O     1 
ATOM   512   C CB    . SER A  1 73  ? 92.079  140.567 -126.259 1.00 41.40  ? 73   SER A CB    1 
ATOM   513   O OG    . SER A  1 73  ? 91.854  139.980 -124.990 1.00 42.72  ? 73   SER A OG    1 
ATOM   514   N N     . ARG A  1 74  ? 91.888  137.174 -127.017 1.00 41.12  ? 74   ARG A N     1 
ATOM   515   C CA    . ARG A  1 74  ? 92.561  135.901 -126.800 1.00 42.06  ? 74   ARG A CA    1 
ATOM   516   C C     . ARG A  1 74  ? 92.496  134.978 -128.007 1.00 42.37  ? 74   ARG A C     1 
ATOM   517   O O     . ARG A  1 74  ? 93.049  133.873 -127.987 1.00 43.52  ? 74   ARG A O     1 
ATOM   518   C CB    . ARG A  1 74  ? 91.973  135.185 -125.592 1.00 44.19  ? 74   ARG A CB    1 
ATOM   519   C CG    . ARG A  1 74  ? 92.197  135.930 -124.310 1.00 45.17  ? 74   ARG A CG    1 
ATOM   520   C CD    . ARG A  1 74  ? 91.457  135.291 -123.183 1.00 46.93  ? 74   ARG A CD    1 
ATOM   521   N NE    . ARG A  1 74  ? 91.332  136.218 -122.068 1.00 49.29  ? 74   ARG A NE    1 
ATOM   522   C CZ    . ARG A  1 74  ? 92.268  136.436 -121.156 1.00 50.64  ? 74   ARG A CZ    1 
ATOM   523   N NH1   . ARG A  1 74  ? 93.428  135.788 -121.205 1.00 49.88  ? 74   ARG A NH1   1 
ATOM   524   N NH2   . ARG A  1 74  ? 92.031  137.312 -120.192 1.00 51.54  ? 74   ARG A NH2   1 
ATOM   525   N N     . GLY A  1 75  ? 91.828  135.424 -129.063 1.00 41.63  ? 75   GLY A N     1 
ATOM   526   C CA    . GLY A  1 75  ? 91.737  134.591 -130.244 1.00 40.63  ? 75   GLY A CA    1 
ATOM   527   C C     . GLY A  1 75  ? 90.514  133.715 -130.195 1.00 39.57  ? 75   GLY A C     1 
ATOM   528   O O     . GLY A  1 75  ? 90.449  132.692 -130.858 1.00 39.58  ? 75   GLY A O     1 
ATOM   529   N N     . ILE A  1 76  ? 89.549  134.108 -129.375 1.00 40.45  ? 76   ILE A N     1 
ATOM   530   C CA    . ILE A  1 76  ? 88.299  133.372 -129.267 1.00 39.65  ? 76   ILE A CA    1 
ATOM   531   C C     . ILE A  1 76  ? 87.310  134.265 -130.012 1.00 41.22  ? 76   ILE A C     1 
ATOM   532   O O     . ILE A  1 76  ? 86.721  135.165 -129.447 1.00 41.20  ? 76   ILE A O     1 
ATOM   533   C CB    . ILE A  1 76  ? 87.916  133.199 -127.799 1.00 36.05  ? 76   ILE A CB    1 
ATOM   534   C CG1   . ILE A  1 76  ? 89.040  132.467 -127.056 1.00 33.51  ? 76   ILE A CG1   1 
ATOM   535   C CG2   . ILE A  1 76  ? 86.633  132.440 -127.695 1.00 35.34  ? 76   ILE A CG2   1 
ATOM   536   C CD1   . ILE A  1 76  ? 88.824  132.317 -125.556 1.00 29.08  ? 76   ILE A CD1   1 
ATOM   537   N N     . GLU A  1 77  ? 87.154  134.019 -131.305 1.00 45.00  ? 77   GLU A N     1 
ATOM   538   C CA    . GLU A  1 77  ? 86.296  134.855 -132.132 1.00 48.38  ? 77   GLU A CA    1 
ATOM   539   C C     . GLU A  1 77  ? 84.880  134.386 -132.317 1.00 50.64  ? 77   GLU A C     1 
ATOM   540   O O     . GLU A  1 77  ? 84.655  133.318 -132.877 1.00 50.61  ? 77   GLU A O     1 
ATOM   541   C CB    . GLU A  1 77  ? 86.952  135.044 -133.494 1.00 48.86  ? 77   GLU A CB    1 
ATOM   542   C CG    . GLU A  1 77  ? 88.153  135.965 -133.428 1.00 52.03  ? 77   GLU A CG    1 
ATOM   543   C CD    . GLU A  1 77  ? 88.995  135.954 -134.684 1.00 53.02  ? 77   GLU A CD    1 
ATOM   544   O OE1   . GLU A  1 77  ? 88.704  135.158 -135.608 1.00 52.46  ? 77   GLU A OE1   1 
ATOM   545   O OE2   . GLU A  1 77  ? 89.959  136.745 -134.731 1.00 52.68  ? 77   GLU A OE2   1 
ATOM   546   N N     . MET A  1 78  ? 83.935  135.209 -131.859 1.00 53.64  ? 78   MET A N     1 
ATOM   547   C CA    . MET A  1 78  ? 82.508  134.914 -131.962 1.00 57.13  ? 78   MET A CA    1 
ATOM   548   C C     . MET A  1 78  ? 81.708  135.859 -132.836 1.00 59.69  ? 78   MET A C     1 
ATOM   549   O O     . MET A  1 78  ? 81.954  137.073 -132.898 1.00 59.47  ? 78   MET A O     1 
ATOM   550   C CB    . MET A  1 78  ? 81.821  134.913 -130.599 1.00 57.92  ? 78   MET A CB    1 
ATOM   551   C CG    . MET A  1 78  ? 82.038  133.675 -129.768 1.00 61.40  ? 78   MET A CG    1 
ATOM   552   S SD    . MET A  1 78  ? 83.455  133.822 -128.717 1.00 62.77  ? 78   MET A SD    1 
ATOM   553   C CE    . MET A  1 78  ? 82.870  135.023 -127.553 1.00 62.27  ? 78   MET A CE    1 
ATOM   554   N N     . SER A  1 79  ? 80.714  135.263 -133.482 1.00 61.71  ? 79   SER A N     1 
ATOM   555   C CA    . SER A  1 79  ? 79.792  135.959 -134.349 1.00 62.84  ? 79   SER A CA    1 
ATOM   556   C C     . SER A  1 79  ? 79.077  137.035 -133.535 1.00 63.43  ? 79   SER A C     1 
ATOM   557   O O     . SER A  1 79  ? 79.615  138.114 -133.289 1.00 64.80  ? 79   SER A O     1 
ATOM   558   C CB    . SER A  1 79  ? 78.792  134.937 -134.905 1.00 63.47  ? 79   SER A CB    1 
ATOM   559   O OG    . SER A  1 79  ? 78.416  133.999 -133.902 1.00 62.18  ? 79   SER A OG    1 
ATOM   560   N N     . GLU A  1 80  ? 77.862  136.717 -133.117 1.00 63.22  ? 80   GLU A N     1 
ATOM   561   C CA    . GLU A  1 80  ? 77.035  137.614 -132.335 1.00 63.60  ? 80   GLU A CA    1 
ATOM   562   C C     . GLU A  1 80  ? 76.959  136.949 -130.972 1.00 62.36  ? 80   GLU A C     1 
ATOM   563   O O     . GLU A  1 80  ? 76.714  135.749 -130.902 1.00 64.24  ? 80   GLU A O     1 
ATOM   564   C CB    . GLU A  1 80  ? 75.643  137.688 -132.972 1.00 65.45  ? 80   GLU A CB    1 
ATOM   565   C CG    . GLU A  1 80  ? 74.552  138.381 -132.144 1.00 69.40  ? 80   GLU A CG    1 
ATOM   566   C CD    . GLU A  1 80  ? 73.139  137.826 -132.423 1.00 71.25  ? 80   GLU A CD    1 
ATOM   567   O OE1   . GLU A  1 80  ? 72.630  137.997 -133.554 1.00 71.36  ? 80   GLU A OE1   1 
ATOM   568   O OE2   . GLU A  1 80  ? 72.540  137.210 -131.504 1.00 72.00  ? 80   GLU A OE2   1 
ATOM   569   N N     . VAL A  1 81  ? 77.223  137.682 -129.892 1.00 59.64  ? 81   VAL A N     1 
ATOM   570   C CA    . VAL A  1 81  ? 77.108  137.071 -128.561 1.00 56.13  ? 81   VAL A CA    1 
ATOM   571   C C     . VAL A  1 81  ? 75.761  137.477 -128.014 1.00 54.93  ? 81   VAL A C     1 
ATOM   572   O O     . VAL A  1 81  ? 75.550  138.640 -127.714 1.00 54.39  ? 81   VAL A O     1 
ATOM   573   C CB    . VAL A  1 81  ? 78.173  137.560 -127.580 1.00 55.27  ? 81   VAL A CB    1 
ATOM   574   C CG1   . VAL A  1 81  ? 77.906  136.997 -126.206 1.00 53.03  ? 81   VAL A CG1   1 
ATOM   575   C CG2   . VAL A  1 81  ? 79.534  137.073 -128.047 1.00 55.60  ? 81   VAL A CG2   1 
ATOM   576   N N     . ARG A  1 82  ? 74.856  136.510 -127.866 1.00 54.49  ? 82   ARG A N     1 
ATOM   577   C CA    . ARG A  1 82  ? 73.513  136.781 -127.376 1.00 54.29  ? 82   ARG A CA    1 
ATOM   578   C C     . ARG A  1 82  ? 73.227  136.289 -125.960 1.00 51.74  ? 82   ARG A C     1 
ATOM   579   O O     . ARG A  1 82  ? 73.654  135.213 -125.551 1.00 51.87  ? 82   ARG A O     1 
ATOM   580   C CB    . ARG A  1 82  ? 72.492  136.173 -128.347 1.00 57.96  ? 82   ARG A CB    1 
ATOM   581   C CG    . ARG A  1 82  ? 71.204  136.992 -128.517 1.00 63.73  ? 82   ARG A CG    1 
ATOM   582   C CD    . ARG A  1 82  ? 70.150  136.236 -129.358 1.00 69.01  ? 82   ARG A CD    1 
ATOM   583   N NE    . ARG A  1 82  ? 69.539  135.090 -128.660 1.00 72.89  ? 82   ARG A NE    1 
ATOM   584   C CZ    . ARG A  1 82  ? 68.667  135.183 -127.646 1.00 74.61  ? 82   ARG A CZ    1 
ATOM   585   N NH1   . ARG A  1 82  ? 68.286  136.374 -127.190 1.00 74.81  ? 82   ARG A NH1   1 
ATOM   586   N NH2   . ARG A  1 82  ? 68.163  134.082 -127.088 1.00 74.11  ? 82   ARG A NH2   1 
ATOM   587   N N     . LEU A  1 83  ? 72.466  137.090 -125.231 1.00 48.27  ? 83   LEU A N     1 
ATOM   588   C CA    . LEU A  1 83  ? 72.094  136.740 -123.881 1.00 44.65  ? 83   LEU A CA    1 
ATOM   589   C C     . LEU A  1 83  ? 70.745  136.050 -123.818 1.00 44.17  ? 83   LEU A C     1 
ATOM   590   O O     . LEU A  1 83  ? 69.710  136.621 -124.179 1.00 44.35  ? 83   LEU A O     1 
ATOM   591   C CB    . LEU A  1 83  ? 72.018  137.972 -122.988 1.00 43.06  ? 83   LEU A CB    1 
ATOM   592   C CG    . LEU A  1 83  ? 71.404  137.689 -121.614 1.00 41.02  ? 83   LEU A CG    1 
ATOM   593   C CD1   . LEU A  1 83  ? 72.303  136.778 -120.810 1.00 40.23  ? 83   LEU A CD1   1 
ATOM   594   C CD2   . LEU A  1 83  ? 71.203  138.975 -120.883 1.00 41.36  ? 83   LEU A CD2   1 
ATOM   595   N N     . ASN A  1 84  ? 70.758  134.813 -123.354 1.00 41.86  ? 84   ASN A N     1 
ATOM   596   C CA    . ASN A  1 84  ? 69.529  134.092 -123.187 1.00 40.49  ? 84   ASN A CA    1 
ATOM   597   C C     . ASN A  1 84  ? 69.261  134.096 -121.672 1.00 40.54  ? 84   ASN A C     1 
ATOM   598   O O     . ASN A  1 84  ? 69.680  133.198 -120.937 1.00 38.71  ? 84   ASN A O     1 
ATOM   599   C CB    . ASN A  1 84  ? 69.673  132.688 -123.735 1.00 39.50  ? 84   ASN A CB    1 
ATOM   600   C CG    . ASN A  1 84  ? 68.520  131.837 -123.370 1.00 38.49  ? 84   ASN A CG    1 
ATOM   601   O OD1   . ASN A  1 84  ? 67.603  132.297 -122.704 1.00 36.90  ? 84   ASN A OD1   1 
ATOM   602   N ND2   . ASN A  1 84  ? 68.548  130.588 -123.788 1.00 40.02  ? 84   ASN A ND2   1 
ATOM   603   N N     . LEU A  1 85  ? 68.564  135.134 -121.219 1.00 40.82  ? 85   LEU A N     1 
ATOM   604   C CA    . LEU A  1 85  ? 68.276  135.294 -119.810 1.00 42.02  ? 85   LEU A CA    1 
ATOM   605   C C     . LEU A  1 85  ? 67.549  134.127 -119.176 1.00 43.67  ? 85   LEU A C     1 
ATOM   606   O O     . LEU A  1 85  ? 67.658  133.897 -117.965 1.00 44.22  ? 85   LEU A O     1 
ATOM   607   C CB    . LEU A  1 85  ? 67.478  136.564 -119.560 1.00 40.02  ? 85   LEU A CB    1 
ATOM   608   C CG    . LEU A  1 85  ? 67.335  136.855 -118.068 1.00 39.84  ? 85   LEU A CG    1 
ATOM   609   C CD1   . LEU A  1 85  ? 68.712  137.041 -117.452 1.00 38.30  ? 85   LEU A CD1   1 
ATOM   610   C CD2   . LEU A  1 85  ? 66.489  138.094 -117.860 1.00 39.74  ? 85   LEU A CD2   1 
ATOM   611   N N     . ASP A  1 86  ? 66.802  133.384 -119.974 1.00 43.96  ? 86   ASP A N     1 
ATOM   612   C CA    . ASP A  1 86  ? 66.083  132.258 -119.409 1.00 44.41  ? 86   ASP A CA    1 
ATOM   613   C C     . ASP A  1 86  ? 67.068  131.129 -119.084 1.00 43.31  ? 86   ASP A C     1 
ATOM   614   O O     . ASP A  1 86  ? 67.071  130.583 -117.980 1.00 41.61  ? 86   ASP A O     1 
ATOM   615   C CB    . ASP A  1 86  ? 65.007  131.787 -120.390 1.00 48.19  ? 86   ASP A CB    1 
ATOM   616   C CG    . ASP A  1 86  ? 63.934  132.852 -120.649 1.00 51.99  ? 86   ASP A CG    1 
ATOM   617   O OD1   . ASP A  1 86  ? 64.285  134.038 -120.891 1.00 55.08  ? 86   ASP A OD1   1 
ATOM   618   O OD2   . ASP A  1 86  ? 62.736  132.496 -120.626 1.00 52.35  ? 86   ASP A OD2   1 
ATOM   619   N N     . LYS A  1 87  ? 67.915  130.791 -120.047 1.00 41.58  ? 87   LYS A N     1 
ATOM   620   C CA    . LYS A  1 87  ? 68.878  129.739 -119.825 1.00 40.71  ? 87   LYS A CA    1 
ATOM   621   C C     . LYS A  1 87  ? 69.832  130.119 -118.672 1.00 38.52  ? 87   LYS A C     1 
ATOM   622   O O     . LYS A  1 87  ? 70.234  129.267 -117.879 1.00 37.50  ? 87   LYS A O     1 
ATOM   623   C CB    . LYS A  1 87  ? 69.646  129.472 -121.121 1.00 41.17  ? 87   LYS A CB    1 
ATOM   624   C CG    . LYS A  1 87  ? 70.618  128.331 -121.033 1.00 43.27  ? 87   LYS A CG    1 
ATOM   625   C CD    . LYS A  1 87  ? 69.905  127.015 -120.821 1.00 45.67  ? 87   LYS A CD    1 
ATOM   626   C CE    . LYS A  1 87  ? 70.910  125.894 -120.538 1.00 49.77  ? 87   LYS A CE    1 
ATOM   627   N NZ    . LYS A  1 87  ? 70.266  124.552 -120.342 1.00 49.76  ? 87   LYS A NZ    1 
ATOM   628   N N     . MET A  1 88  ? 70.168  131.397 -118.564 1.00 37.35  ? 88   MET A N     1 
ATOM   629   C CA    . MET A  1 88  ? 71.059  131.840 -117.507 1.00 36.74  ? 88   MET A CA    1 
ATOM   630   C C     . MET A  1 88  ? 70.396  131.644 -116.148 1.00 36.28  ? 88   MET A C     1 
ATOM   631   O O     . MET A  1 88  ? 71.052  131.239 -115.197 1.00 36.16  ? 88   MET A O     1 
ATOM   632   C CB    . MET A  1 88  ? 71.458  133.311 -117.706 1.00 39.78  ? 88   MET A CB    1 
ATOM   633   C CG    . MET A  1 88  ? 72.616  133.796 -116.810 1.00 40.76  ? 88   MET A CG    1 
ATOM   634   S SD    . MET A  1 88  ? 73.612  135.117 -117.566 1.00 44.51  ? 88   MET A SD    1 
ATOM   635   C CE    . MET A  1 88  ? 73.382  136.363 -116.446 1.00 43.77  ? 88   MET A CE    1 
ATOM   636   N N     . MET A  1 89  ? 69.099  131.914 -116.059 1.00 35.29  ? 89   MET A N     1 
ATOM   637   C CA    . MET A  1 89  ? 68.380  131.744 -114.808 1.00 34.87  ? 89   MET A CA    1 
ATOM   638   C C     . MET A  1 89  ? 68.217  130.276 -114.471 1.00 36.12  ? 89   MET A C     1 
ATOM   639   O O     . MET A  1 89  ? 68.113  129.899 -113.299 1.00 37.76  ? 89   MET A O     1 
ATOM   640   C CB    . MET A  1 89  ? 67.004  132.396 -114.895 1.00 34.32  ? 89   MET A CB    1 
ATOM   641   C CG    . MET A  1 89  ? 67.046  133.917 -114.898 1.00 35.35  ? 89   MET A CG    1 
ATOM   642   S SD    . MET A  1 89  ? 67.489  134.614 -113.275 1.00 35.13  ? 89   MET A SD    1 
ATOM   643   C CE    . MET A  1 89  ? 67.766  136.363 -113.661 1.00 36.66  ? 89   MET A CE    1 
ATOM   644   N N     . GLU A  1 90  ? 68.184  129.444 -115.503 1.00 37.09  ? 90   GLU A N     1 
ATOM   645   C CA    . GLU A  1 90  ? 68.031  128.007 -115.325 1.00 37.85  ? 90   GLU A CA    1 
ATOM   646   C C     . GLU A  1 90  ? 69.260  127.412 -114.634 1.00 37.40  ? 90   GLU A C     1 
ATOM   647   O O     . GLU A  1 90  ? 69.145  126.601 -113.701 1.00 35.35  ? 90   GLU A O     1 
ATOM   648   C CB    . GLU A  1 90  ? 67.837  127.324 -116.674 1.00 39.43  ? 90   GLU A CB    1 
ATOM   649   C CG    . GLU A  1 90  ? 67.724  125.823 -116.565 1.00 45.21  ? 90   GLU A CG    1 
ATOM   650   C CD    . GLU A  1 90  ? 68.097  125.126 -117.858 1.00 49.76  ? 90   GLU A CD    1 
ATOM   651   O OE1   . GLU A  1 90  ? 67.354  125.288 -118.852 1.00 50.35  ? 90   GLU A OE1   1 
ATOM   652   O OE2   . GLU A  1 90  ? 69.143  124.428 -117.879 1.00 51.87  ? 90   GLU A OE2   1 
ATOM   653   N N     . GLN A  1 91  ? 70.438  127.810 -115.104 1.00 36.01  ? 91   GLN A N     1 
ATOM   654   C CA    . GLN A  1 91  ? 71.674  127.320 -114.511 1.00 35.89  ? 91   GLN A CA    1 
ATOM   655   C C     . GLN A  1 91  ? 71.629  127.636 -113.014 1.00 35.99  ? 91   GLN A C     1 
ATOM   656   O O     . GLN A  1 91  ? 71.947  126.788 -112.175 1.00 35.84  ? 91   GLN A O     1 
ATOM   657   C CB    . GLN A  1 91  ? 72.866  127.999 -115.181 1.00 36.08  ? 91   GLN A CB    1 
ATOM   658   C CG    . GLN A  1 91  ? 74.245  127.510 -114.763 1.00 34.74  ? 91   GLN A CG    1 
ATOM   659   C CD    . GLN A  1 91  ? 74.626  127.956 -113.369 1.00 35.38  ? 91   GLN A CD    1 
ATOM   660   O OE1   . GLN A  1 91  ? 74.360  129.093 -112.973 1.00 34.30  ? 91   GLN A OE1   1 
ATOM   661   N NE2   . GLN A  1 91  ? 75.265  127.064 -112.617 1.00 35.32  ? 91   GLN A NE2   1 
ATOM   662   N N     . LYS A  1 92  ? 71.206  128.857 -112.701 1.00 35.18  ? 92   LYS A N     1 
ATOM   663   C CA    . LYS A  1 92  ? 71.080  129.340 -111.332 1.00 35.36  ? 92   LYS A CA    1 
ATOM   664   C C     . LYS A  1 92  ? 70.127  128.457 -110.520 1.00 35.92  ? 92   LYS A C     1 
ATOM   665   O O     . LYS A  1 92  ? 70.424  128.037 -109.405 1.00 36.51  ? 92   LYS A O     1 
ATOM   666   C CB    . LYS A  1 92  ? 70.566  130.781 -111.367 1.00 34.69  ? 92   LYS A CB    1 
ATOM   667   C CG    . LYS A  1 92  ? 70.277  131.390 -110.028 1.00 32.43  ? 92   LYS A CG    1 
ATOM   668   C CD    . LYS A  1 92  ? 69.274  132.511 -110.163 1.00 34.58  ? 92   LYS A CD    1 
ATOM   669   C CE    . LYS A  1 92  ? 67.850  131.972 -110.235 1.00 36.97  ? 92   LYS A CE    1 
ATOM   670   N NZ    . LYS A  1 92  ? 66.872  132.971 -109.754 1.00 36.28  ? 92   LYS A NZ    1 
ATOM   671   N N     . SER A  1 93  ? 68.974  128.169 -111.092 1.00 36.79  ? 93   SER A N     1 
ATOM   672   C CA    . SER A  1 93  ? 67.994  127.336 -110.416 1.00 36.32  ? 93   SER A CA    1 
ATOM   673   C C     . SER A  1 93  ? 68.418  125.881 -110.277 1.00 34.50  ? 93   SER A C     1 
ATOM   674   O O     . SER A  1 93  ? 68.060  125.222 -109.321 1.00 33.77  ? 93   SER A O     1 
ATOM   675   C CB    . SER A  1 93  ? 66.673  127.414 -111.176 1.00 36.92  ? 93   SER A CB    1 
ATOM   676   O OG    . SER A  1 93  ? 66.219  128.753 -111.193 1.00 40.18  ? 93   SER A OG    1 
ATOM   677   N N     . THR A  1 94  ? 69.167  125.384 -111.251 1.00 34.98  ? 94   THR A N     1 
ATOM   678   C CA    . THR A  1 94  ? 69.622  123.998 -111.255 1.00 35.08  ? 94   THR A CA    1 
ATOM   679   C C     . THR A  1 94  ? 70.576  123.761 -110.106 1.00 35.44  ? 94   THR A C     1 
ATOM   680   O O     . THR A  1 94  ? 70.587  122.689 -109.488 1.00 36.04  ? 94   THR A O     1 
ATOM   681   C CB    . THR A  1 94  ? 70.364  123.683 -112.552 1.00 35.46  ? 94   THR A CB    1 
ATOM   682   O OG1   . THR A  1 94  ? 69.483  123.908 -113.653 1.00 37.44  ? 94   THR A OG1   1 
ATOM   683   C CG2   . THR A  1 94  ? 70.865  122.240 -112.562 1.00 35.66  ? 94   THR A CG2   1 
ATOM   684   N N     . ALA A  1 95  ? 71.382  124.781 -109.844 1.00 33.92  ? 95   ALA A N     1 
ATOM   685   C CA    . ALA A  1 95  ? 72.359  124.731 -108.802 1.00 33.74  ? 95   ALA A CA    1 
ATOM   686   C C     . ALA A  1 95  ? 71.652  124.845 -107.472 1.00 34.39  ? 95   ALA A C     1 
ATOM   687   O O     . ALA A  1 95  ? 71.947  124.084 -106.551 1.00 35.83  ? 95   ALA A O     1 
ATOM   688   C CB    . ALA A  1 95  ? 73.346  125.849 -108.971 1.00 32.66  ? 95   ALA A CB    1 
ATOM   689   N N     . VAL A  1 96  ? 70.712  125.777 -107.371 1.00 32.97  ? 96   VAL A N     1 
ATOM   690   C CA    . VAL A  1 96  ? 69.971  125.961 -106.125 1.00 32.82  ? 96   VAL A CA    1 
ATOM   691   C C     . VAL A  1 96  ? 69.159  124.710 -105.790 1.00 34.03  ? 96   VAL A C     1 
ATOM   692   O O     . VAL A  1 96  ? 69.021  124.348 -104.619 1.00 35.75  ? 96   VAL A O     1 
ATOM   693   C CB    . VAL A  1 96  ? 69.039  127.208 -106.209 1.00 30.74  ? 96   VAL A CB    1 
ATOM   694   C CG1   . VAL A  1 96  ? 68.070  127.269 -105.010 1.00 30.89  ? 96   VAL A CG1   1 
ATOM   695   C CG2   . VAL A  1 96  ? 69.892  128.464 -106.262 1.00 28.54  ? 96   VAL A CG2   1 
ATOM   696   N N     . LYS A  1 97  ? 68.644  124.031 -106.811 1.00 34.80  ? 97   LYS A N     1 
ATOM   697   C CA    . LYS A  1 97  ? 67.838  122.829 -106.581 1.00 35.83  ? 97   LYS A CA    1 
ATOM   698   C C     . LYS A  1 97  ? 68.708  121.699 -106.058 1.00 35.34  ? 97   LYS A C     1 
ATOM   699   O O     . LYS A  1 97  ? 68.370  121.030 -105.080 1.00 35.06  ? 97   LYS A O     1 
ATOM   700   C CB    . LYS A  1 97  ? 67.142  122.384 -107.868 1.00 37.98  ? 97   LYS A CB    1 
ATOM   701   C CG    . LYS A  1 97  ? 66.110  121.286 -107.670 1.00 41.10  ? 97   LYS A CG    1 
ATOM   702   C CD    . LYS A  1 97  ? 65.272  121.082 -108.936 1.00 42.65  ? 97   LYS A CD    1 
ATOM   703   C CE    . LYS A  1 97  ? 64.146  120.060 -108.738 1.00 44.33  ? 97   LYS A CE    1 
ATOM   704   N NZ    . LYS A  1 97  ? 64.632  118.659 -108.503 1.00 43.87  ? 97   LYS A NZ    1 
ATOM   705   N N     . ALA A  1 98  ? 69.844  121.495 -106.711 1.00 33.90  ? 98   ALA A N     1 
ATOM   706   C CA    . ALA A  1 98  ? 70.759  120.446 -106.299 1.00 31.74  ? 98   ALA A CA    1 
ATOM   707   C C     . ALA A  1 98  ? 71.194  120.611 -104.842 1.00 31.59  ? 98   ALA A C     1 
ATOM   708   O O     . ALA A  1 98  ? 71.134  119.668 -104.050 1.00 31.40  ? 98   ALA A O     1 
ATOM   709   C CB    . ALA A  1 98  ? 71.971  120.441 -107.206 1.00 29.25  ? 98   ALA A CB    1 
ATOM   710   N N     . LEU A  1 99  ? 71.619  121.819 -104.489 1.00 31.30  ? 99   LEU A N     1 
ATOM   711   C CA    . LEU A  1 99  ? 72.091  122.078 -103.143 1.00 31.70  ? 99   LEU A CA    1 
ATOM   712   C C     . LEU A  1 99  ? 71.011  121.917 -102.083 1.00 32.83  ? 99   LEU A C     1 
ATOM   713   O O     . LEU A  1 99  ? 71.310  121.435 -100.975 1.00 32.91  ? 99   LEU A O     1 
ATOM   714   C CB    . LEU A  1 99  ? 72.788  123.455 -103.066 1.00 27.13  ? 99   LEU A CB    1 
ATOM   715   C CG    . LEU A  1 99  ? 74.165  123.416 -103.757 1.00 24.32  ? 99   LEU A CG    1 
ATOM   716   C CD1   . LEU A  1 99  ? 74.648  124.812 -103.882 1.00 19.99  ? 99   LEU A CD1   1 
ATOM   717   C CD2   . LEU A  1 99  ? 75.204  122.539 -103.007 1.00 21.67  ? 99   LEU A CD2   1 
ATOM   718   N N     . THR A  1 100 ? 69.769  122.291 -102.413 1.00 33.28  ? 100  THR A N     1 
ATOM   719   C CA    . THR A  1 100 ? 68.663  122.125 -101.456 1.00 33.55  ? 100  THR A CA    1 
ATOM   720   C C     . THR A  1 100 ? 68.463  120.611 -101.273 1.00 33.61  ? 100  THR A C     1 
ATOM   721   O O     . THR A  1 100 ? 68.319  120.118 -100.152 1.00 35.61  ? 100  THR A O     1 
ATOM   722   C CB    . THR A  1 100 ? 67.312  122.811 -101.942 1.00 32.91  ? 100  THR A CB    1 
ATOM   723   O OG1   . THR A  1 100 ? 66.923  122.305 -103.223 1.00 32.04  ? 100  THR A OG1   1 
ATOM   724   C CG2   . THR A  1 100 ? 67.474  124.319 -102.046 1.00 32.19  ? 100  THR A CG2   1 
ATOM   725   N N     . GLY A  1 101 ? 68.497  119.878 -102.383 1.00 32.28  ? 101  GLY A N     1 
ATOM   726   C CA    . GLY A  1 101 ? 68.333  118.442 -102.326 1.00 31.38  ? 101  GLY A CA    1 
ATOM   727   C C     . GLY A  1 101 ? 69.473  117.802 -101.569 1.00 31.34  ? 101  GLY A C     1 
ATOM   728   O O     . GLY A  1 101 ? 69.310  116.758 -100.937 1.00 30.29  ? 101  GLY A O     1 
ATOM   729   N N     . GLY A  1 102 ? 70.634  118.447 -101.640 1.00 31.69  ? 102  GLY A N     1 
ATOM   730   C CA    . GLY A  1 102 ? 71.814  117.959 -100.950 1.00 29.23  ? 102  GLY A CA    1 
ATOM   731   C C     . GLY A  1 102 ? 71.607  117.968 -99.443  1.00 28.25  ? 102  GLY A C     1 
ATOM   732   O O     . GLY A  1 102 ? 71.963  117.007 -98.729  1.00 27.00  ? 102  GLY A O     1 
ATOM   733   N N     . ILE A  1 103 ? 71.009  119.048 -98.955  1.00 25.99  ? 103  ILE A N     1 
ATOM   734   C CA    . ILE A  1 103 ? 70.762  119.158 -97.533  1.00 26.00  ? 103  ILE A CA    1 
ATOM   735   C C     . ILE A  1 103 ? 69.750  118.107 -97.114  1.00 26.85  ? 103  ILE A C     1 
ATOM   736   O O     . ILE A  1 103 ? 69.925  117.475 -96.085  1.00 27.26  ? 103  ILE A O     1 
ATOM   737   C CB    . ILE A  1 103 ? 70.273  120.591 -97.101  1.00 23.94  ? 103  ILE A CB    1 
ATOM   738   C CG1   . ILE A  1 103 ? 71.339  121.631 -97.459  1.00 21.36  ? 103  ILE A CG1   1 
ATOM   739   C CG2   . ILE A  1 103 ? 70.041  120.633 -95.570  1.00 21.78  ? 103  ILE A CG2   1 
ATOM   740   C CD1   . ILE A  1 103 ? 70.973  123.051 -97.159  1.00 18.55  ? 103  ILE A CD1   1 
ATOM   741   N N     . ALA A  1 104 ? 68.711  117.890 -97.912  1.00 28.52  ? 104  ALA A N     1 
ATOM   742   C CA    . ALA A  1 104 ? 67.706  116.888 -97.537  1.00 29.78  ? 104  ALA A CA    1 
ATOM   743   C C     . ALA A  1 104 ? 68.353  115.526 -97.301  1.00 29.31  ? 104  ALA A C     1 
ATOM   744   O O     . ALA A  1 104 ? 68.027  114.827 -96.336  1.00 28.84  ? 104  ALA A O     1 
ATOM   745   C CB    . ALA A  1 104 ? 66.620  116.786 -98.614  1.00 30.02  ? 104  ALA A CB    1 
ATOM   746   N N     A HIS A  1 105 ? 69.279  115.172 -98.178  0.50 30.33  ? 105  HIS A N     1 
ATOM   747   N N     B HIS A  1 105 ? 69.271  115.157 -98.196  0.50 30.55  ? 105  HIS A N     1 
ATOM   748   C CA    A HIS A  1 105 ? 69.985  113.903 -98.079  0.50 32.15  ? 105  HIS A CA    1 
ATOM   749   C CA    B HIS A  1 105 ? 70.004  113.885 -98.120  0.50 32.51  ? 105  HIS A CA    1 
ATOM   750   C C     A HIS A  1 105 ? 70.944  113.811 -96.888  0.50 31.96  ? 105  HIS A C     1 
ATOM   751   C C     B HIS A  1 105 ? 70.950  113.807 -96.902  0.50 32.22  ? 105  HIS A C     1 
ATOM   752   O O     A HIS A  1 105 ? 71.104  112.741 -96.292  0.50 32.09  ? 105  HIS A O     1 
ATOM   753   O O     B HIS A  1 105 ? 71.077  112.748 -96.278  0.50 32.38  ? 105  HIS A O     1 
ATOM   754   C CB    A HIS A  1 105 ? 70.740  113.647 -99.379  0.50 33.46  ? 105  HIS A CB    1 
ATOM   755   C CB    B HIS A  1 105 ? 70.804  113.655 -99.420  0.50 34.27  ? 105  HIS A CB    1 
ATOM   756   C CG    A HIS A  1 105 ? 69.870  113.142 -100.483 0.50 36.09  ? 105  HIS A CG    1 
ATOM   757   C CG    B HIS A  1 105 ? 71.982  112.739 -99.258  0.50 37.56  ? 105  HIS A CG    1 
ATOM   758   N ND1   A HIS A  1 105 ? 69.321  111.879 -100.473 0.50 36.90  ? 105  HIS A ND1   1 
ATOM   759   N ND1   B HIS A  1 105 ? 71.859  111.368 -99.172  0.50 38.63  ? 105  HIS A ND1   1 
ATOM   760   C CD2   A HIS A  1 105 ? 69.443  113.731 -101.624 0.50 36.97  ? 105  HIS A CD2   1 
ATOM   761   C CD2   B HIS A  1 105 ? 73.299  113.007 -99.091  0.50 38.60  ? 105  HIS A CD2   1 
ATOM   762   C CE1   A HIS A  1 105 ? 68.596  111.711 -101.562 0.50 38.48  ? 105  HIS A CE1   1 
ATOM   763   C CE1   B HIS A  1 105 ? 73.046  110.833 -98.953  0.50 38.59  ? 105  HIS A CE1   1 
ATOM   764   N NE2   A HIS A  1 105 ? 68.653  112.820 -102.277 0.50 37.73  ? 105  HIS A NE2   1 
ATOM   765   N NE2   B HIS A  1 105 ? 73.937  111.806 -98.900  0.50 39.02  ? 105  HIS A NE2   1 
ATOM   766   N N     . LEU A  1 106 ? 71.596  114.926 -96.564  1.00 31.35  ? 106  LEU A N     1 
ATOM   767   C CA    . LEU A  1 106 ? 72.527  114.970 -95.435  1.00 29.86  ? 106  LEU A CA    1 
ATOM   768   C C     . LEU A  1 106 ? 71.754  114.760 -94.143  1.00 29.17  ? 106  LEU A C     1 
ATOM   769   O O     . LEU A  1 106 ? 72.218  114.060 -93.244  1.00 29.17  ? 106  LEU A O     1 
ATOM   770   C CB    . LEU A  1 106 ? 73.299  116.309 -95.402  1.00 27.30  ? 106  LEU A CB    1 
ATOM   771   C CG    . LEU A  1 106 ? 74.351  116.495 -96.499  1.00 24.39  ? 106  LEU A CG    1 
ATOM   772   C CD1   . LEU A  1 106 ? 74.779  117.946 -96.582  1.00 22.20  ? 106  LEU A CD1   1 
ATOM   773   C CD2   . LEU A  1 106 ? 75.522  115.566 -96.230  1.00 20.30  ? 106  LEU A CD2   1 
ATOM   774   N N     . PHE A  1 107 ? 70.565  115.350 -94.065  1.00 28.03  ? 107  PHE A N     1 
ATOM   775   C CA    . PHE A  1 107 ? 69.714  115.200 -92.889  1.00 27.39  ? 107  PHE A CA    1 
ATOM   776   C C     . PHE A  1 107 ? 69.388  113.711 -92.717  1.00 27.23  ? 107  PHE A C     1 
ATOM   777   O O     . PHE A  1 107 ? 69.436  113.184 -91.609  1.00 24.59  ? 107  PHE A O     1 
ATOM   778   C CB    . PHE A  1 107 ? 68.426  115.989 -93.081  1.00 25.90  ? 107  PHE A CB    1 
ATOM   779   C CG    . PHE A  1 107 ? 68.487  117.394 -92.582  1.00 25.54  ? 107  PHE A CG    1 
ATOM   780   C CD1   . PHE A  1 107 ? 69.700  117.986 -92.255  1.00 25.11  ? 107  PHE A CD1   1 
ATOM   781   C CD2   . PHE A  1 107 ? 67.309  118.134 -92.420  1.00 27.15  ? 107  PHE A CD2   1 
ATOM   782   C CE1   . PHE A  1 107 ? 69.738  119.286 -91.773  1.00 25.19  ? 107  PHE A CE1   1 
ATOM   783   C CE2   . PHE A  1 107 ? 67.333  119.444 -91.937  1.00 25.94  ? 107  PHE A CE2   1 
ATOM   784   C CZ    . PHE A  1 107 ? 68.551  120.021 -91.612  1.00 26.29  ? 107  PHE A CZ    1 
ATOM   785   N N     . LYS A  1 108 ? 69.050  113.045 -93.819  1.00 27.27  ? 108  LYS A N     1 
ATOM   786   C CA    . LYS A  1 108 ? 68.740  111.626 -93.757  1.00 31.06  ? 108  LYS A CA    1 
ATOM   787   C C     . LYS A  1 108 ? 69.962  110.777 -93.391  1.00 31.30  ? 108  LYS A C     1 
ATOM   788   O O     . LYS A  1 108 ? 69.863  109.832 -92.607  1.00 30.32  ? 108  LYS A O     1 
ATOM   789   C CB    . LYS A  1 108 ? 68.140  111.155 -95.079  1.00 33.16  ? 108  LYS A CB    1 
ATOM   790   C CG    . LYS A  1 108 ? 66.756  111.683 -95.286  1.00 38.11  ? 108  LYS A CG    1 
ATOM   791   C CD    . LYS A  1 108 ? 65.975  110.910 -96.313  1.00 42.71  ? 108  LYS A CD    1 
ATOM   792   C CE    . LYS A  1 108 ? 64.533  111.396 -96.271  1.00 47.54  ? 108  LYS A CE    1 
ATOM   793   N NZ    . LYS A  1 108 ? 63.659  110.644 -97.201  1.00 49.84  ? 108  LYS A NZ    1 
ATOM   794   N N     . GLN A  1 109 ? 71.112  111.126 -93.959  1.00 30.41  ? 109  GLN A N     1 
ATOM   795   C CA    . GLN A  1 109 ? 72.368  110.430 -93.696  1.00 29.18  ? 109  GLN A CA    1 
ATOM   796   C C     . GLN A  1 109 ? 72.762  110.507 -92.209  1.00 29.17  ? 109  GLN A C     1 
ATOM   797   O O     . GLN A  1 109 ? 73.296  109.557 -91.640  1.00 28.51  ? 109  GLN A O     1 
ATOM   798   C CB    . GLN A  1 109 ? 73.449  111.057 -94.560  1.00 27.87  ? 109  GLN A CB    1 
ATOM   799   C CG    . GLN A  1 109 ? 74.858  110.580 -94.322  1.00 26.71  ? 109  GLN A CG    1 
ATOM   800   C CD    . GLN A  1 109 ? 75.830  111.181 -95.326  1.00 26.99  ? 109  GLN A CD    1 
ATOM   801   O OE1   . GLN A  1 109 ? 75.593  111.151 -96.536  1.00 30.48  ? 109  GLN A OE1   1 
ATOM   802   N NE2   . GLN A  1 109 ? 76.923  111.723 -94.834  1.00 28.30  ? 109  GLN A NE2   1 
ATOM   803   N N     . ASN A  1 110 ? 72.470  111.642 -91.590  1.00 29.83  ? 110  ASN A N     1 
ATOM   804   C CA    . ASN A  1 110 ? 72.790  111.887 -90.190  1.00 29.06  ? 110  ASN A CA    1 
ATOM   805   C C     . ASN A  1 110 ? 71.665  111.694 -89.197  1.00 29.70  ? 110  ASN A C     1 
ATOM   806   O O     . ASN A  1 110 ? 71.785  112.127 -88.063  1.00 30.14  ? 110  ASN A O     1 
ATOM   807   C CB    . ASN A  1 110 ? 73.344  113.301 -90.040  1.00 27.40  ? 110  ASN A CB    1 
ATOM   808   C CG    . ASN A  1 110 ? 74.695  113.442 -90.659  1.00 27.03  ? 110  ASN A CG    1 
ATOM   809   O OD1   . ASN A  1 110 ? 75.682  112.936 -90.129  1.00 27.37  ? 110  ASN A OD1   1 
ATOM   810   N ND2   . ASN A  1 110 ? 74.754  114.095 -91.808  1.00 23.92  ? 110  ASN A ND2   1 
ATOM   811   N N     . LYS A  1 111 ? 70.576  111.053 -89.605  1.00 31.02  ? 111  LYS A N     1 
ATOM   812   C CA    . LYS A  1 111 ? 69.463  110.835 -88.686  1.00 32.32  ? 111  LYS A CA    1 
ATOM   813   C C     . LYS A  1 111 ? 68.748  112.134 -88.245  1.00 31.03  ? 111  LYS A C     1 
ATOM   814   O O     . LYS A  1 111 ? 68.102  112.162 -87.204  1.00 29.24  ? 111  LYS A O     1 
ATOM   815   C CB    . LYS A  1 111 ? 69.948  110.106 -87.424  1.00 34.79  ? 111  LYS A CB    1 
ATOM   816   C CG    . LYS A  1 111 ? 70.281  108.621 -87.549  1.00 41.06  ? 111  LYS A CG    1 
ATOM   817   C CD    . LYS A  1 111 ? 70.906  108.106 -86.219  1.00 43.81  ? 111  LYS A CD    1 
ATOM   818   C CE    . LYS A  1 111 ? 71.770  106.854 -86.405  1.00 45.99  ? 111  LYS A CE    1 
ATOM   819   N NZ    . LYS A  1 111 ? 72.794  106.724 -85.303  1.00 49.97  ? 111  LYS A NZ    1 
ATOM   820   N N     . VAL A  1 112 ? 68.852  113.208 -89.014  1.00 29.97  ? 112  VAL A N     1 
ATOM   821   C CA    . VAL A  1 112 ? 68.184  114.430 -88.600  1.00 30.24  ? 112  VAL A CA    1 
ATOM   822   C C     . VAL A  1 112 ? 66.718  114.380 -88.997  1.00 32.62  ? 112  VAL A C     1 
ATOM   823   O O     . VAL A  1 112 ? 66.384  114.162 -90.154  1.00 33.19  ? 112  VAL A O     1 
ATOM   824   C CB    . VAL A  1 112 ? 68.832  115.668 -89.230  1.00 30.32  ? 112  VAL A CB    1 
ATOM   825   C CG1   . VAL A  1 112 ? 68.013  116.903 -88.876  1.00 28.44  ? 112  VAL A CG1   1 
ATOM   826   C CG2   . VAL A  1 112 ? 70.282  115.801 -88.753  1.00 24.38  ? 112  VAL A CG2   1 
ATOM   827   N N     . VAL A  1 113 ? 65.832  114.556 -88.030  1.00 33.53  ? 113  VAL A N     1 
ATOM   828   C CA    . VAL A  1 113 ? 64.415  114.533 -88.339  1.00 33.16  ? 113  VAL A CA    1 
ATOM   829   C C     . VAL A  1 113 ? 63.960  115.909 -88.796  1.00 32.99  ? 113  VAL A C     1 
ATOM   830   O O     . VAL A  1 113 ? 64.054  116.888 -88.058  1.00 33.27  ? 113  VAL A O     1 
ATOM   831   C CB    . VAL A  1 113 ? 63.592  114.086 -87.110  1.00 34.18  ? 113  VAL A CB    1 
ATOM   832   C CG1   . VAL A  1 113 ? 62.127  114.314 -87.362  1.00 31.39  ? 113  VAL A CG1   1 
ATOM   833   C CG2   . VAL A  1 113 ? 63.830  112.614 -86.839  1.00 31.07  ? 113  VAL A CG2   1 
ATOM   834   N N     . HIS A  1 114 ? 63.481  115.981 -90.030  1.00 34.10  ? 114  HIS A N     1 
ATOM   835   C CA    . HIS A  1 114 ? 63.021  117.245 -90.605  1.00 34.35  ? 114  HIS A CA    1 
ATOM   836   C C     . HIS A  1 114 ? 61.527  117.415 -90.366  1.00 35.21  ? 114  HIS A C     1 
ATOM   837   O O     . HIS A  1 114 ? 60.727  116.608 -90.819  1.00 35.91  ? 114  HIS A O     1 
ATOM   838   C CB    . HIS A  1 114 ? 63.324  117.243 -92.106  1.00 33.96  ? 114  HIS A CB    1 
ATOM   839   C CG    . HIS A  1 114 ? 62.719  118.374 -92.883  1.00 33.19  ? 114  HIS A CG    1 
ATOM   840   N ND1   . HIS A  1 114 ? 62.666  118.361 -94.259  1.00 33.33  ? 114  HIS A ND1   1 
ATOM   841   C CD2   . HIS A  1 114 ? 62.192  119.563 -92.498  1.00 33.50  ? 114  HIS A CD2   1 
ATOM   842   C CE1   . HIS A  1 114 ? 62.133  119.492 -94.690  1.00 33.87  ? 114  HIS A CE1   1 
ATOM   843   N NE2   . HIS A  1 114 ? 61.838  120.239 -93.640  1.00 33.76  ? 114  HIS A NE2   1 
ATOM   844   N N     . VAL A  1 115 ? 61.158  118.461 -89.639  1.00 35.95  ? 115  VAL A N     1 
ATOM   845   C CA    . VAL A  1 115 ? 59.758  118.752 -89.382  1.00 35.83  ? 115  VAL A CA    1 
ATOM   846   C C     . VAL A  1 115 ? 59.375  120.020 -90.138  1.00 36.35  ? 115  VAL A C     1 
ATOM   847   O O     . VAL A  1 115 ? 59.978  121.070 -89.943  1.00 35.64  ? 115  VAL A O     1 
ATOM   848   C CB    . VAL A  1 115 ? 59.482  118.975 -87.880  1.00 35.09  ? 115  VAL A CB    1 
ATOM   849   C CG1   . VAL A  1 115 ? 58.103  119.542 -87.697  1.00 32.84  ? 115  VAL A CG1   1 
ATOM   850   C CG2   . VAL A  1 115 ? 59.584  117.663 -87.125  1.00 35.25  ? 115  VAL A CG2   1 
ATOM   851   N N     . ASN A  1 116 ? 58.371  119.919 -91.001  1.00 37.88  ? 116  ASN A N     1 
ATOM   852   C CA    . ASN A  1 116 ? 57.908  121.074 -91.762  1.00 40.25  ? 116  ASN A CA    1 
ATOM   853   C C     . ASN A  1 116 ? 56.767  121.835 -91.076  1.00 40.59  ? 116  ASN A C     1 
ATOM   854   O O     . ASN A  1 116 ? 55.702  121.284 -90.807  1.00 41.69  ? 116  ASN A O     1 
ATOM   855   C CB    . ASN A  1 116 ? 57.472  120.644 -93.169  1.00 43.07  ? 116  ASN A CB    1 
ATOM   856   C CG    . ASN A  1 116 ? 56.726  121.748 -93.912  1.00 46.28  ? 116  ASN A CG    1 
ATOM   857   O OD1   . ASN A  1 116 ? 55.514  121.925 -93.724  1.00 49.90  ? 116  ASN A OD1   1 
ATOM   858   N ND2   . ASN A  1 116 ? 57.448  122.510 -94.741  1.00 44.90  ? 116  ASN A ND2   1 
ATOM   859   N N     . GLY A  1 117 ? 57.002  123.113 -90.800  1.00 41.09  ? 117  GLY A N     1 
ATOM   860   C CA    . GLY A  1 117 ? 56.001  123.934 -90.140  1.00 40.54  ? 117  GLY A CA    1 
ATOM   861   C C     . GLY A  1 117 ? 56.659  125.162 -89.546  1.00 40.24  ? 117  GLY A C     1 
ATOM   862   O O     . GLY A  1 117 ? 57.876  125.313 -89.642  1.00 41.07  ? 117  GLY A O     1 
ATOM   863   N N     . TYR A  1 118 ? 55.856  126.039 -88.952  1.00 39.80  ? 118  TYR A N     1 
ATOM   864   C CA    . TYR A  1 118 ? 56.345  127.256 -88.317  1.00 39.51  ? 118  TYR A CA    1 
ATOM   865   C C     . TYR A  1 118 ? 56.475  126.840 -86.861  1.00 39.05  ? 118  TYR A C     1 
ATOM   866   O O     . TYR A  1 118 ? 55.505  126.441 -86.214  1.00 38.23  ? 118  TYR A O     1 
ATOM   867   C CB    . TYR A  1 118 ? 55.317  128.390 -88.491  1.00 39.67  ? 118  TYR A CB    1 
ATOM   868   C CG    . TYR A  1 118 ? 55.820  129.818 -88.302  1.00 41.41  ? 118  TYR A CG    1 
ATOM   869   C CD1   . TYR A  1 118 ? 55.912  130.391 -87.029  1.00 42.62  ? 118  TYR A CD1   1 
ATOM   870   C CD2   . TYR A  1 118 ? 56.153  130.616 -89.406  1.00 42.79  ? 118  TYR A CD2   1 
ATOM   871   C CE1   . TYR A  1 118 ? 56.318  131.734 -86.860  1.00 43.88  ? 118  TYR A CE1   1 
ATOM   872   C CE2   . TYR A  1 118 ? 56.562  131.945 -89.252  1.00 42.68  ? 118  TYR A CE2   1 
ATOM   873   C CZ    . TYR A  1 118 ? 56.639  132.499 -87.980  1.00 44.26  ? 118  TYR A CZ    1 
ATOM   874   O OH    . TYR A  1 118 ? 57.005  133.823 -87.846  1.00 45.64  ? 118  TYR A OH    1 
ATOM   875   N N     . GLY A  1 119 ? 57.694  126.905 -86.358  1.00 39.37  ? 119  GLY A N     1 
ATOM   876   C CA    . GLY A  1 119 ? 57.930  126.502 -84.992  1.00 38.97  ? 119  GLY A CA    1 
ATOM   877   C C     . GLY A  1 119 ? 57.716  127.635 -84.034  1.00 39.37  ? 119  GLY A C     1 
ATOM   878   O O     . GLY A  1 119 ? 58.018  128.786 -84.328  1.00 40.74  ? 119  GLY A O     1 
ATOM   879   N N     . LYS A  1 120 ? 57.169  127.301 -82.880  1.00 40.13  ? 120  LYS A N     1 
ATOM   880   C CA    . LYS A  1 120 ? 56.937  128.276 -81.837  1.00 39.02  ? 120  LYS A CA    1 
ATOM   881   C C     . LYS A  1 120 ? 57.315  127.592 -80.525  1.00 37.47  ? 120  LYS A C     1 
ATOM   882   O O     . LYS A  1 120 ? 56.989  126.415 -80.305  1.00 35.87  ? 120  LYS A O     1 
ATOM   883   C CB    . LYS A  1 120 ? 55.467  128.700 -81.851  1.00 41.42  ? 120  LYS A CB    1 
ATOM   884   C CG    . LYS A  1 120 ? 55.033  129.509 -80.637  1.00 44.90  ? 120  LYS A CG    1 
ATOM   885   C CD    . LYS A  1 120 ? 53.801  130.349 -80.929  1.00 46.04  ? 120  LYS A CD    1 
ATOM   886   C CE    . LYS A  1 120 ? 53.417  131.192 -79.715  1.00 46.59  ? 120  LYS A CE    1 
ATOM   887   N NZ    . LYS A  1 120 ? 52.677  130.405 -78.674  1.00 50.21  ? 120  LYS A NZ    1 
ATOM   888   N N     . ILE A  1 121 ? 58.048  128.300 -79.673  1.00 36.53  ? 121  ILE A N     1 
ATOM   889   C CA    . ILE A  1 121 ? 58.427  127.720 -78.383  1.00 36.50  ? 121  ILE A CA    1 
ATOM   890   C C     . ILE A  1 121 ? 57.204  127.816 -77.461  1.00 36.51  ? 121  ILE A C     1 
ATOM   891   O O     . ILE A  1 121 ? 56.799  128.898 -77.019  1.00 36.02  ? 121  ILE A O     1 
ATOM   892   C CB    . ILE A  1 121 ? 59.658  128.451 -77.742  1.00 36.57  ? 121  ILE A CB    1 
ATOM   893   C CG1   . ILE A  1 121 ? 60.847  128.450 -78.725  1.00 34.54  ? 121  ILE A CG1   1 
ATOM   894   C CG2   . ILE A  1 121 ? 60.046  127.767 -76.406  1.00 33.36  ? 121  ILE A CG2   1 
ATOM   895   C CD1   . ILE A  1 121 ? 61.964  129.402 -78.341  1.00 32.48  ? 121  ILE A CD1   1 
ATOM   896   N N     . THR A  1 122 ? 56.614  126.663 -77.191  1.00 37.23  ? 122  THR A N     1 
ATOM   897   C CA    . THR A  1 122 ? 55.426  126.570 -76.360  1.00 39.36  ? 122  THR A CA    1 
ATOM   898   C C     . THR A  1 122 ? 55.740  126.056 -74.952  1.00 41.19  ? 122  THR A C     1 
ATOM   899   O O     . THR A  1 122 ? 54.839  125.680 -74.194  1.00 41.67  ? 122  THR A O     1 
ATOM   900   C CB    . THR A  1 122 ? 54.406  125.639 -77.028  1.00 38.82  ? 122  THR A CB    1 
ATOM   901   O OG1   . THR A  1 122 ? 55.040  124.393 -77.346  1.00 38.27  ? 122  THR A OG1   1 
ATOM   902   C CG2   . THR A  1 122 ? 53.896  126.258 -78.313  1.00 38.44  ? 122  THR A CG2   1 
ATOM   903   N N     . GLY A  1 123 ? 57.020  126.051 -74.603  1.00 41.52  ? 123  GLY A N     1 
ATOM   904   C CA    . GLY A  1 123 ? 57.418  125.581 -73.292  1.00 42.44  ? 123  GLY A CA    1 
ATOM   905   C C     . GLY A  1 123 ? 58.923  125.589 -73.177  1.00 42.89  ? 123  GLY A C     1 
ATOM   906   O O     . GLY A  1 123 ? 59.623  125.643 -74.187  1.00 43.37  ? 123  GLY A O     1 
ATOM   907   N N     . LYS A  1 124 ? 59.421  125.551 -71.946  1.00 43.65  ? 124  LYS A N     1 
ATOM   908   C CA    . LYS A  1 124 ? 60.860  125.548 -71.692  1.00 43.97  ? 124  LYS A CA    1 
ATOM   909   C C     . LYS A  1 124 ? 61.454  124.369 -72.448  1.00 41.38  ? 124  LYS A C     1 
ATOM   910   O O     . LYS A  1 124 ? 62.530  124.469 -73.013  1.00 42.53  ? 124  LYS A O     1 
ATOM   911   C CB    . LYS A  1 124 ? 61.146  125.411 -70.182  1.00 46.98  ? 124  LYS A CB    1 
ATOM   912   C CG    . LYS A  1 124 ? 62.311  126.268 -69.655  1.00 49.91  ? 124  LYS A CG    1 
ATOM   913   C CD    . LYS A  1 124 ? 62.000  127.785 -69.707  1.00 53.41  ? 124  LYS A CD    1 
ATOM   914   C CE    . LYS A  1 124 ? 61.290  128.328 -68.446  1.00 53.61  ? 124  LYS A CE    1 
ATOM   915   N NZ    . LYS A  1 124 ? 62.166  128.366 -67.227  1.00 55.02  ? 124  LYS A NZ    1 
ATOM   916   N N     . ASN A  1 125 ? 60.737  123.257 -72.484  1.00 38.55  ? 125  ASN A N     1 
ATOM   917   C CA    . ASN A  1 125 ? 61.233  122.085 -73.195  1.00 37.13  ? 125  ASN A CA    1 
ATOM   918   C C     . ASN A  1 125 ? 60.274  121.546 -74.250  1.00 36.78  ? 125  ASN A C     1 
ATOM   919   O O     . ASN A  1 125 ? 60.144  120.331 -74.427  1.00 35.99  ? 125  ASN A O     1 
ATOM   920   C CB    . ASN A  1 125 ? 61.585  120.985 -72.207  1.00 33.95  ? 125  ASN A CB    1 
ATOM   921   C CG    . ASN A  1 125 ? 62.693  121.394 -71.276  1.00 33.16  ? 125  ASN A CG    1 
ATOM   922   O OD1   . ASN A  1 125 ? 62.465  121.974 -70.217  1.00 33.72  ? 125  ASN A OD1   1 
ATOM   923   N ND2   . ASN A  1 125 ? 63.908  121.114 -71.676  1.00 33.83  ? 125  ASN A ND2   1 
ATOM   924   N N     . GLN A  1 126 ? 59.628  122.464 -74.963  1.00 36.66  ? 126  GLN A N     1 
ATOM   925   C CA    . GLN A  1 126 ? 58.680  122.099 -75.999  1.00 37.55  ? 126  GLN A CA    1 
ATOM   926   C C     . GLN A  1 126 ? 58.593  123.091 -77.168  1.00 37.30  ? 126  GLN A C     1 
ATOM   927   O O     . GLN A  1 126 ? 58.579  124.307 -76.984  1.00 37.78  ? 126  GLN A O     1 
ATOM   928   C CB    . GLN A  1 126 ? 57.304  121.903 -75.373  1.00 38.90  ? 126  GLN A CB    1 
ATOM   929   C CG    . GLN A  1 126 ? 56.173  121.802 -76.370  1.00 40.85  ? 126  GLN A CG    1 
ATOM   930   C CD    . GLN A  1 126 ? 54.908  121.315 -75.727  1.00 41.37  ? 126  GLN A CD    1 
ATOM   931   O OE1   . GLN A  1 126 ? 54.792  120.132 -75.392  1.00 42.22  ? 126  GLN A OE1   1 
ATOM   932   N NE2   . GLN A  1 126 ? 53.952  122.219 -75.534  1.00 40.62  ? 126  GLN A NE2   1 
ATOM   933   N N     . VAL A  1 127 ? 58.564  122.549 -78.379  1.00 35.61  ? 127  VAL A N     1 
ATOM   934   C CA    . VAL A  1 127 ? 58.452  123.362 -79.574  1.00 33.99  ? 127  VAL A CA    1 
ATOM   935   C C     . VAL A  1 127 ? 57.245  122.800 -80.334  1.00 33.65  ? 127  VAL A C     1 
ATOM   936   O O     . VAL A  1 127 ? 57.096  121.582 -80.449  1.00 33.61  ? 127  VAL A O     1 
ATOM   937   C CB    . VAL A  1 127 ? 59.737  123.263 -80.454  1.00 31.39  ? 127  VAL A CB    1 
ATOM   938   C CG1   . VAL A  1 127 ? 59.615  124.192 -81.661  1.00 30.82  ? 127  VAL A CG1   1 
ATOM   939   C CG2   . VAL A  1 127 ? 60.954  123.640 -79.637  1.00 30.16  ? 127  VAL A CG2   1 
ATOM   940   N N     . THR A  1 128 ? 56.365  123.678 -80.805  1.00 34.02  ? 128  THR A N     1 
ATOM   941   C CA    . THR A  1 128 ? 55.201  123.245 -81.576  1.00 33.26  ? 128  THR A CA    1 
ATOM   942   C C     . THR A  1 128 ? 55.275  123.818 -82.982  1.00 32.75  ? 128  THR A C     1 
ATOM   943   O O     . THR A  1 128 ? 55.358  125.023 -83.172  1.00 31.86  ? 128  THR A O     1 
ATOM   944   C CB    . THR A  1 128 ? 53.887  123.688 -80.929  1.00 33.08  ? 128  THR A CB    1 
ATOM   945   O OG1   . THR A  1 128 ? 53.823  123.189 -79.583  1.00 33.10  ? 128  THR A OG1   1 
ATOM   946   C CG2   . THR A  1 128 ? 52.705  123.136 -81.734  1.00 32.55  ? 128  THR A CG2   1 
ATOM   947   N N     . ALA A  1 129 ? 55.250  122.930 -83.963  1.00 33.76  ? 129  ALA A N     1 
ATOM   948   C CA    . ALA A  1 129 ? 55.348  123.316 -85.364  1.00 34.58  ? 129  ALA A CA    1 
ATOM   949   C C     . ALA A  1 129 ? 54.001  123.192 -86.032  1.00 36.58  ? 129  ALA A C     1 
ATOM   950   O O     . ALA A  1 129 ? 53.408  122.117 -86.043  1.00 35.76  ? 129  ALA A O     1 
ATOM   951   C CB    . ALA A  1 129 ? 56.350  122.427 -86.079  1.00 32.03  ? 129  ALA A CB    1 
ATOM   952   N N     . THR A  1 130 ? 53.531  124.291 -86.611  1.00 39.84  ? 130  THR A N     1 
ATOM   953   C CA    . THR A  1 130 ? 52.240  124.311 -87.288  1.00 40.65  ? 130  THR A CA    1 
ATOM   954   C C     . THR A  1 130 ? 52.391  124.352 -88.801  1.00 42.11  ? 130  THR A C     1 
ATOM   955   O O     . THR A  1 130 ? 52.970  125.290 -89.346  1.00 40.60  ? 130  THR A O     1 
ATOM   956   C CB    . THR A  1 130 ? 51.402  125.524 -86.840  1.00 39.26  ? 130  THR A CB    1 
ATOM   957   O OG1   . THR A  1 130 ? 51.142  125.434 -85.438  1.00 37.11  ? 130  THR A OG1   1 
ATOM   958   C CG2   . THR A  1 130 ? 50.088  125.560 -87.578  1.00 39.32  ? 130  THR A CG2   1 
ATOM   959   N N     . LYS A  1 131 ? 51.871  123.324 -89.472  1.00 44.85  ? 131  LYS A N     1 
ATOM   960   C CA    . LYS A  1 131 ? 51.929  123.257 -90.930  1.00 48.14  ? 131  LYS A CA    1 
ATOM   961   C C     . LYS A  1 131 ? 50.912  124.242 -91.538  1.00 49.85  ? 131  LYS A C     1 
ATOM   962   O O     . LYS A  1 131 ? 50.018  124.739 -90.846  1.00 49.50  ? 131  LYS A O     1 
ATOM   963   C CB    . LYS A  1 131 ? 51.620  121.837 -91.425  1.00 50.11  ? 131  LYS A CB    1 
ATOM   964   C CG    . LYS A  1 131 ? 52.437  120.723 -90.783  1.00 52.40  ? 131  LYS A CG    1 
ATOM   965   C CD    . LYS A  1 131 ? 52.561  119.538 -91.732  1.00 55.29  ? 131  LYS A CD    1 
ATOM   966   C CE    . LYS A  1 131 ? 53.246  118.345 -91.058  1.00 59.20  ? 131  LYS A CE    1 
ATOM   967   N NZ    . LYS A  1 131 ? 54.498  118.708 -90.312  1.00 60.94  ? 131  LYS A NZ    1 
ATOM   968   N N     . ALA A  1 132 ? 51.051  124.533 -92.828  1.00 52.11  ? 132  ALA A N     1 
ATOM   969   C CA    . ALA A  1 132 ? 50.142  125.456 -93.507  1.00 54.47  ? 132  ALA A CA    1 
ATOM   970   C C     . ALA A  1 132 ? 48.709  124.926 -93.488  1.00 56.25  ? 132  ALA A C     1 
ATOM   971   O O     . ALA A  1 132 ? 47.754  125.704 -93.514  1.00 56.64  ? 132  ALA A O     1 
ATOM   972   C CB    . ALA A  1 132 ? 50.593  125.667 -94.940  1.00 54.66  ? 132  ALA A CB    1 
ATOM   973   N N     . ASP A  1 133 ? 48.567  123.603 -93.433  1.00 57.32  ? 133  ASP A N     1 
ATOM   974   C CA    . ASP A  1 133 ? 47.256  122.962 -93.405  1.00 58.28  ? 133  ASP A CA    1 
ATOM   975   C C     . ASP A  1 133 ? 46.699  122.823 -91.990  1.00 58.34  ? 133  ASP A C     1 
ATOM   976   O O     . ASP A  1 133 ? 45.917  121.910 -91.716  1.00 59.36  ? 133  ASP A O     1 
ATOM   977   C CB    . ASP A  1 133 ? 47.344  121.574 -94.022  1.00 59.85  ? 133  ASP A CB    1 
ATOM   978   C CG    . ASP A  1 133 ? 48.342  120.700 -93.313  1.00 62.58  ? 133  ASP A CG    1 
ATOM   979   O OD1   . ASP A  1 133 ? 49.538  120.746 -93.694  1.00 63.66  ? 133  ASP A OD1   1 
ATOM   980   O OD2   . ASP A  1 133 ? 47.933  119.982 -92.365  1.00 63.20  ? 133  ASP A OD2   1 
ATOM   981   N N     . GLY A  1 134 ? 47.097  123.721 -91.095  1.00 57.72  ? 134  GLY A N     1 
ATOM   982   C CA    . GLY A  1 134 ? 46.627  123.654 -89.722  1.00 56.04  ? 134  GLY A CA    1 
ATOM   983   C C     . GLY A  1 134 ? 47.348  122.568 -88.941  1.00 55.02  ? 134  GLY A C     1 
ATOM   984   O O     . GLY A  1 134 ? 47.329  122.562 -87.706  1.00 54.16  ? 134  GLY A O     1 
ATOM   985   N N     . GLY A  1 135 ? 47.975  121.647 -89.674  1.00 54.43  ? 135  GLY A N     1 
ATOM   986   C CA    . GLY A  1 135 ? 48.711  120.552 -89.067  1.00 53.49  ? 135  GLY A CA    1 
ATOM   987   C C     . GLY A  1 135 ? 49.538  120.940 -87.851  1.00 53.08  ? 135  GLY A C     1 
ATOM   988   O O     . GLY A  1 135 ? 50.086  122.041 -87.738  1.00 51.00  ? 135  GLY A O     1 
ATOM   989   N N     . THR A  1 136 ? 49.649  119.997 -86.933  1.00 52.83  ? 136  THR A N     1 
ATOM   990   C CA    . THR A  1 136 ? 50.386  120.235 -85.719  1.00 51.51  ? 136  THR A CA    1 
ATOM   991   C C     . THR A  1 136 ? 51.312  119.060 -85.353  1.00 50.46  ? 136  THR A C     1 
ATOM   992   O O     . THR A  1 136 ? 50.944  117.884 -85.486  1.00 49.92  ? 136  THR A O     1 
ATOM   993   C CB    . THR A  1 136 ? 49.391  120.500 -84.584  1.00 52.68  ? 136  THR A CB    1 
ATOM   994   O OG1   . THR A  1 136 ? 50.080  120.544 -83.325  1.00 52.40  ? 136  THR A OG1   1 
ATOM   995   C CG2   . THR A  1 136 ? 48.304  119.397 -84.574  1.00 52.63  ? 136  THR A CG2   1 
ATOM   996   N N     . GLN A  1 137 ? 52.529  119.406 -84.930  1.00 47.77  ? 137  GLN A N     1 
ATOM   997   C CA    . GLN A  1 137 ? 53.536  118.442 -84.472  1.00 44.03  ? 137  GLN A CA    1 
ATOM   998   C C     . GLN A  1 137 ? 54.265  119.055 -83.263  1.00 41.40  ? 137  GLN A C     1 
ATOM   999   O O     . GLN A  1 137 ? 54.827  120.159 -83.327  1.00 38.37  ? 137  GLN A O     1 
ATOM   1000  C CB    . GLN A  1 137 ? 54.530  118.088 -85.582  1.00 43.03  ? 137  GLN A CB    1 
ATOM   1001  C CG    . GLN A  1 137 ? 55.676  117.203 -85.114  1.00 43.54  ? 137  GLN A CG    1 
ATOM   1002  C CD    . GLN A  1 137 ? 55.225  115.854 -84.589  1.00 43.70  ? 137  GLN A CD    1 
ATOM   1003  O OE1   . GLN A  1 137 ? 54.882  114.959 -85.358  1.00 44.56  ? 137  GLN A OE1   1 
ATOM   1004  N NE2   . GLN A  1 137 ? 55.224  115.704 -83.270  1.00 44.41  ? 137  GLN A NE2   1 
ATOM   1005  N N     . VAL A  1 138 ? 54.207  118.339 -82.145  1.00 40.17  ? 138  VAL A N     1 
ATOM   1006  C CA    . VAL A  1 138 ? 54.837  118.797 -80.922  1.00 38.48  ? 138  VAL A CA    1 
ATOM   1007  C C     . VAL A  1 138 ? 56.167  118.082 -80.717  1.00 37.31  ? 138  VAL A C     1 
ATOM   1008  O O     . VAL A  1 138 ? 56.331  116.892 -81.034  1.00 33.88  ? 138  VAL A O     1 
ATOM   1009  C CB    . VAL A  1 138 ? 53.914  118.565 -79.692  1.00 39.73  ? 138  VAL A CB    1 
ATOM   1010  C CG1   . VAL A  1 138 ? 54.542  119.164 -78.433  1.00 38.73  ? 138  VAL A CG1   1 
ATOM   1011  C CG2   . VAL A  1 138 ? 52.556  119.200 -79.938  1.00 40.37  ? 138  VAL A CG2   1 
ATOM   1012  N N     . ILE A  1 139 ? 57.127  118.840 -80.205  1.00 36.41  ? 139  ILE A N     1 
ATOM   1013  C CA    . ILE A  1 139 ? 58.445  118.304 -79.952  1.00 36.31  ? 139  ILE A CA    1 
ATOM   1014  C C     . ILE A  1 139 ? 58.896  118.616 -78.534  1.00 35.05  ? 139  ILE A C     1 
ATOM   1015  O O     . ILE A  1 139 ? 59.101  119.772 -78.185  1.00 35.09  ? 139  ILE A O     1 
ATOM   1016  C CB    . ILE A  1 139 ? 59.487  118.889 -80.939  1.00 36.76  ? 139  ILE A CB    1 
ATOM   1017  C CG1   . ILE A  1 139 ? 58.926  118.889 -82.358  1.00 35.81  ? 139  ILE A CG1   1 
ATOM   1018  C CG2   . ILE A  1 139 ? 60.756  118.030 -80.927  1.00 36.74  ? 139  ILE A CG2   1 
ATOM   1019  C CD1   . ILE A  1 139 ? 59.713  119.734 -83.295  1.00 37.29  ? 139  ILE A CD1   1 
ATOM   1020  N N     . ASP A  1 140 ? 58.999  117.586 -77.706  1.00 34.25  ? 140  ASP A N     1 
ATOM   1021  C CA    . ASP A  1 140 ? 59.496  117.777 -76.354  1.00 34.81  ? 140  ASP A CA    1 
ATOM   1022  C C     . ASP A  1 140 ? 61.001  117.562 -76.528  1.00 33.36  ? 140  ASP A C     1 
ATOM   1023  O O     . ASP A  1 140 ? 61.460  116.545 -77.080  1.00 32.33  ? 140  ASP A O     1 
ATOM   1024  C CB    . ASP A  1 140 ? 58.857  116.782 -75.384  1.00 36.40  ? 140  ASP A CB    1 
ATOM   1025  C CG    . ASP A  1 140 ? 57.349  116.950 -75.312  1.00 38.62  ? 140  ASP A CG    1 
ATOM   1026  O OD1   . ASP A  1 140 ? 56.875  118.098 -75.157  1.00 39.16  ? 140  ASP A OD1   1 
ATOM   1027  O OD2   . ASP A  1 140 ? 56.631  115.936 -75.422  1.00 42.80  ? 140  ASP A OD2   1 
ATOM   1028  N N     . THR A  1 141 ? 61.764  118.534 -76.056  1.00 30.97  ? 141  THR A N     1 
ATOM   1029  C CA    . THR A  1 141 ? 63.194  118.529 -76.274  1.00 29.03  ? 141  THR A CA    1 
ATOM   1030  C C     . THR A  1 141 ? 63.987  119.079 -75.084  1.00 28.12  ? 141  THR A C     1 
ATOM   1031  O O     . THR A  1 141 ? 63.527  119.964 -74.381  1.00 27.10  ? 141  THR A O     1 
ATOM   1032  C CB    . THR A  1 141 ? 63.462  119.354 -77.589  1.00 27.30  ? 141  THR A CB    1 
ATOM   1033  O OG1   . THR A  1 141 ? 64.842  119.298 -77.947  1.00 29.02  ? 141  THR A OG1   1 
ATOM   1034  C CG2   . THR A  1 141 ? 63.007  120.801 -77.420  1.00 24.60  ? 141  THR A CG2   1 
ATOM   1035  N N     . LYS A  1 142 ? 65.175  118.527 -74.853  1.00 28.07  ? 142  LYS A N     1 
ATOM   1036  C CA    . LYS A  1 142 ? 66.023  118.987 -73.763  1.00 27.78  ? 142  LYS A CA    1 
ATOM   1037  C C     . LYS A  1 142 ? 66.532  120.396 -74.074  1.00 27.56  ? 142  LYS A C     1 
ATOM   1038  O O     . LYS A  1 142 ? 66.544  121.275 -73.211  1.00 27.00  ? 142  LYS A O     1 
ATOM   1039  C CB    . LYS A  1 142 ? 67.204  118.042 -73.582  1.00 28.87  ? 142  LYS A CB    1 
ATOM   1040  C CG    . LYS A  1 142 ? 66.808  116.645 -73.196  1.00 31.99  ? 142  LYS A CG    1 
ATOM   1041  C CD    . LYS A  1 142 ? 68.036  115.877 -72.710  1.00 36.07  ? 142  LYS A CD    1 
ATOM   1042  C CE    . LYS A  1 142 ? 67.685  114.502 -72.130  1.00 37.34  ? 142  LYS A CE    1 
ATOM   1043  N NZ    . LYS A  1 142 ? 67.311  113.568 -73.223  1.00 38.44  ? 142  LYS A NZ    1 
ATOM   1044  N N     . ASN A  1 143 ? 66.954  120.597 -75.321  1.00 26.94  ? 143  ASN A N     1 
ATOM   1045  C CA    . ASN A  1 143 ? 67.453  121.893 -75.770  1.00 27.01  ? 143  ASN A CA    1 
ATOM   1046  C C     . ASN A  1 143 ? 66.736  122.429 -77.001  1.00 24.91  ? 143  ASN A C     1 
ATOM   1047  O O     . ASN A  1 143 ? 66.135  121.685 -77.756  1.00 24.43  ? 143  ASN A O     1 
ATOM   1048  C CB    . ASN A  1 143 ? 68.940  121.814 -76.090  1.00 27.75  ? 143  ASN A CB    1 
ATOM   1049  C CG    . ASN A  1 143 ? 69.738  121.286 -74.950  1.00 29.86  ? 143  ASN A CG    1 
ATOM   1050  O OD1   . ASN A  1 143 ? 69.817  121.906 -73.893  1.00 28.99  ? 143  ASN A OD1   1 
ATOM   1051  N ND2   . ASN A  1 143 ? 70.340  120.117 -75.149  1.00 31.86  ? 143  ASN A ND2   1 
ATOM   1052  N N     . ILE A  1 144 ? 66.836  123.740 -77.189  1.00 25.43  ? 144  ILE A N     1 
ATOM   1053  C CA    . ILE A  1 144 ? 66.240  124.433 -78.327  1.00 26.17  ? 144  ILE A CA    1 
ATOM   1054  C C     . ILE A  1 144 ? 67.289  125.398 -78.867  1.00 25.79  ? 144  ILE A C     1 
ATOM   1055  O O     . ILE A  1 144 ? 67.860  126.187 -78.107  1.00 25.36  ? 144  ILE A O     1 
ATOM   1056  C CB    . ILE A  1 144 ? 64.996  125.267 -77.921  1.00 26.03  ? 144  ILE A CB    1 
ATOM   1057  C CG1   . ILE A  1 144 ? 63.897  124.344 -77.384  1.00 25.98  ? 144  ILE A CG1   1 
ATOM   1058  C CG2   . ILE A  1 144 ? 64.509  126.100 -79.123  1.00 23.02  ? 144  ILE A CG2   1 
ATOM   1059  C CD1   . ILE A  1 144 ? 62.660  125.097 -76.877  1.00 27.02  ? 144  ILE A CD1   1 
ATOM   1060  N N     . LEU A  1 145 ? 67.527  125.321 -80.173  1.00 24.17  ? 145  LEU A N     1 
ATOM   1061  C CA    . LEU A  1 145 ? 68.472  126.180 -80.824  1.00 23.19  ? 145  LEU A CA    1 
ATOM   1062  C C     . LEU A  1 145 ? 67.768  127.069 -81.827  1.00 24.47  ? 145  LEU A C     1 
ATOM   1063  O O     . LEU A  1 145 ? 67.340  126.643 -82.903  1.00 24.73  ? 145  LEU A O     1 
ATOM   1064  C CB    . LEU A  1 145 ? 69.531  125.350 -81.525  1.00 23.55  ? 145  LEU A CB    1 
ATOM   1065  C CG    . LEU A  1 145 ? 70.578  126.141 -82.320  1.00 25.73  ? 145  LEU A CG    1 
ATOM   1066  C CD1   . LEU A  1 145 ? 70.974  127.396 -81.593  1.00 26.15  ? 145  LEU A CD1   1 
ATOM   1067  C CD2   . LEU A  1 145 ? 71.776  125.282 -82.544  1.00 28.11  ? 145  LEU A CD2   1 
ATOM   1068  N N     . ILE A  1 146 ? 67.658  128.329 -81.480  1.00 24.85  ? 146  ILE A N     1 
ATOM   1069  C CA    . ILE A  1 146 ? 67.013  129.258 -82.374  1.00 25.89  ? 146  ILE A CA    1 
ATOM   1070  C C     . ILE A  1 146 ? 67.978  129.698 -83.459  1.00 27.72  ? 146  ILE A C     1 
ATOM   1071  O O     . ILE A  1 146 ? 69.033  130.290 -83.178  1.00 26.29  ? 146  ILE A O     1 
ATOM   1072  C CB    . ILE A  1 146 ? 66.543  130.486 -81.635  1.00 26.72  ? 146  ILE A CB    1 
ATOM   1073  C CG1   . ILE A  1 146 ? 65.595  130.079 -80.501  1.00 25.15  ? 146  ILE A CG1   1 
ATOM   1074  C CG2   . ILE A  1 146 ? 65.869  131.398 -82.613  1.00 27.28  ? 146  ILE A CG2   1 
ATOM   1075  C CD1   . ILE A  1 146 ? 65.420  131.137 -79.457  1.00 27.64  ? 146  ILE A CD1   1 
ATOM   1076  N N     . ALA A  1 147 ? 67.601  129.411 -84.700  1.00 26.45  ? 147  ALA A N     1 
ATOM   1077  C CA    . ALA A  1 147 ? 68.411  129.767 -85.836  1.00 26.91  ? 147  ALA A CA    1 
ATOM   1078  C C     . ALA A  1 147 ? 67.457  130.300 -86.902  1.00 28.32  ? 147  ALA A C     1 
ATOM   1079  O O     . ALA A  1 147 ? 67.533  129.970 -88.082  1.00 27.18  ? 147  ALA A O     1 
ATOM   1080  C CB    . ALA A  1 147 ? 69.144  128.555 -86.318  1.00 26.65  ? 147  ALA A CB    1 
ATOM   1081  N N     . THR A  1 148 ? 66.564  131.166 -86.461  1.00 29.96  ? 148  THR A N     1 
ATOM   1082  C CA    . THR A  1 148 ? 65.561  131.728 -87.335  1.00 31.82  ? 148  THR A CA    1 
ATOM   1083  C C     . THR A  1 148 ? 66.019  132.706 -88.411  1.00 33.05  ? 148  THR A C     1 
ATOM   1084  O O     . THR A  1 148 ? 65.271  132.999 -89.333  1.00 34.93  ? 148  THR A O     1 
ATOM   1085  C CB    . THR A  1 148 ? 64.456  132.356 -86.504  1.00 30.77  ? 148  THR A CB    1 
ATOM   1086  O OG1   . THR A  1 148 ? 65.022  133.261 -85.558  1.00 31.01  ? 148  THR A OG1   1 
ATOM   1087  C CG2   . THR A  1 148 ? 63.715  131.281 -85.763  1.00 29.14  ? 148  THR A CG2   1 
ATOM   1088  N N     . GLY A  1 149 ? 67.236  133.221 -88.302  1.00 34.10  ? 149  GLY A N     1 
ATOM   1089  C CA    . GLY A  1 149 ? 67.751  134.104 -89.338  1.00 33.44  ? 149  GLY A CA    1 
ATOM   1090  C C     . GLY A  1 149 ? 67.290  135.546 -89.497  1.00 33.76  ? 149  GLY A C     1 
ATOM   1091  O O     . GLY A  1 149 ? 67.130  136.292 -88.522  1.00 31.47  ? 149  GLY A O     1 
ATOM   1092  N N     . SER A  1 150 ? 67.086  135.917 -90.759  1.00 34.94  ? 150  SER A N     1 
ATOM   1093  C CA    . SER A  1 150 ? 66.703  137.267 -91.152  1.00 35.71  ? 150  SER A CA    1 
ATOM   1094  C C     . SER A  1 150 ? 65.665  137.381 -92.284  1.00 36.67  ? 150  SER A C     1 
ATOM   1095  O O     . SER A  1 150 ? 65.194  136.391 -92.842  1.00 34.32  ? 150  SER A O     1 
ATOM   1096  C CB    . SER A  1 150 ? 67.972  138.036 -91.573  1.00 35.79  ? 150  SER A CB    1 
ATOM   1097  O OG    . SER A  1 150 ? 68.620  137.423 -92.692  1.00 34.84  ? 150  SER A OG    1 
ATOM   1098  N N     . GLU A  1 151 ? 65.339  138.634 -92.603  1.00 39.50  ? 151  GLU A N     1 
ATOM   1099  C CA    . GLU A  1 151 ? 64.408  139.016 -93.665  1.00 40.92  ? 151  GLU A CA    1 
ATOM   1100  C C     . GLU A  1 151 ? 64.884  140.383 -94.136  1.00 41.95  ? 151  GLU A C     1 
ATOM   1101  O O     . GLU A  1 151 ? 65.603  141.075 -93.408  1.00 42.23  ? 151  GLU A O     1 
ATOM   1102  C CB    . GLU A  1 151 ? 62.983  139.137 -93.127  1.00 41.37  ? 151  GLU A CB    1 
ATOM   1103  C CG    . GLU A  1 151 ? 62.842  140.137 -91.982  1.00 43.45  ? 151  GLU A CG    1 
ATOM   1104  C CD    . GLU A  1 151 ? 61.394  140.314 -91.519  1.00 43.57  ? 151  GLU A CD    1 
ATOM   1105  O OE1   . GLU A  1 151 ? 60.529  139.511 -91.937  1.00 42.69  ? 151  GLU A OE1   1 
ATOM   1106  O OE2   . GLU A  1 151 ? 61.134  141.254 -90.735  1.00 41.71  ? 151  GLU A OE2   1 
ATOM   1107  N N     . VAL A  1 152 ? 64.496  140.776 -95.347  1.00 42.92  ? 152  VAL A N     1 
ATOM   1108  C CA    . VAL A  1 152 ? 64.909  142.075 -95.867  1.00 42.91  ? 152  VAL A CA    1 
ATOM   1109  C C     . VAL A  1 152 ? 64.308  143.155 -95.001  1.00 42.91  ? 152  VAL A C     1 
ATOM   1110  O O     . VAL A  1 152 ? 63.184  143.023 -94.507  1.00 42.24  ? 152  VAL A O     1 
ATOM   1111  C CB    . VAL A  1 152 ? 64.434  142.336 -97.333  1.00 42.57  ? 152  VAL A CB    1 
ATOM   1112  C CG1   . VAL A  1 152 ? 64.773  141.151 -98.225  1.00 42.08  ? 152  VAL A CG1   1 
ATOM   1113  C CG2   . VAL A  1 152 ? 62.949  142.638 -97.359  1.00 44.05  ? 152  VAL A CG2   1 
ATOM   1114  N N     . THR A  1 153 ? 65.076  144.216 -94.800  1.00 42.90  ? 153  THR A N     1 
ATOM   1115  C CA    . THR A  1 153 ? 64.619  145.348 -94.012  1.00 43.64  ? 153  THR A CA    1 
ATOM   1116  C C     . THR A  1 153 ? 63.731  146.184 -94.930  1.00 45.25  ? 153  THR A C     1 
ATOM   1117  O O     . THR A  1 153 ? 64.148  146.570 -96.027  1.00 44.96  ? 153  THR A O     1 
ATOM   1118  C CB    . THR A  1 153 ? 65.804  146.220 -93.546  1.00 43.54  ? 153  THR A CB    1 
ATOM   1119  O OG1   . THR A  1 153 ? 66.581  145.502 -92.584  1.00 44.14  ? 153  THR A OG1   1 
ATOM   1120  C CG2   . THR A  1 153 ? 65.306  147.519 -92.937  1.00 42.81  ? 153  THR A CG2   1 
ATOM   1121  N N     . PRO A  1 154 ? 62.490  146.464 -94.506  1.00 46.14  ? 154  PRO A N     1 
ATOM   1122  C CA    . PRO A  1 154 ? 61.602  147.265 -95.353  1.00 46.36  ? 154  PRO A CA    1 
ATOM   1123  C C     . PRO A  1 154 ? 61.861  148.768 -95.258  1.00 45.79  ? 154  PRO A C     1 
ATOM   1124  O O     . PRO A  1 154 ? 62.234  149.289 -94.210  1.00 43.74  ? 154  PRO A O     1 
ATOM   1125  C CB    . PRO A  1 154 ? 60.218  146.884 -94.853  1.00 46.63  ? 154  PRO A CB    1 
ATOM   1126  C CG    . PRO A  1 154 ? 60.459  146.710 -93.371  1.00 47.80  ? 154  PRO A CG    1 
ATOM   1127  C CD    . PRO A  1 154 ? 61.787  145.973 -93.306  1.00 47.23  ? 154  PRO A CD    1 
ATOM   1128  N N     . PHE A  1 155 ? 61.670  149.441 -96.386  1.00 46.94  ? 155  PHE A N     1 
ATOM   1129  C CA    . PHE A  1 155 ? 61.848  150.881 -96.498  1.00 48.81  ? 155  PHE A CA    1 
ATOM   1130  C C     . PHE A  1 155 ? 60.445  151.459 -96.322  1.00 50.74  ? 155  PHE A C     1 
ATOM   1131  O O     . PHE A  1 155 ? 59.585  151.275 -97.186  1.00 51.19  ? 155  PHE A O     1 
ATOM   1132  C CB    . PHE A  1 155 ? 62.389  151.210 -97.890  1.00 47.71  ? 155  PHE A CB    1 
ATOM   1133  C CG    . PHE A  1 155 ? 62.690  152.672 -98.118  1.00 49.00  ? 155  PHE A CG    1 
ATOM   1134  C CD1   . PHE A  1 155 ? 61.704  153.646 -97.978  1.00 49.36  ? 155  PHE A CD1   1 
ATOM   1135  C CD2   . PHE A  1 155 ? 63.959  153.070 -98.533  1.00 49.67  ? 155  PHE A CD2   1 
ATOM   1136  C CE1   . PHE A  1 155 ? 61.979  154.987 -98.250  1.00 48.95  ? 155  PHE A CE1   1 
ATOM   1137  C CE2   . PHE A  1 155 ? 64.242  154.415 -98.809  1.00 49.37  ? 155  PHE A CE2   1 
ATOM   1138  C CZ    . PHE A  1 155 ? 63.249  155.371 -98.667  1.00 48.54  ? 155  PHE A CZ    1 
ATOM   1139  N N     . PRO A  1 156 ? 60.190  152.156 -95.197  1.00 52.08  ? 156  PRO A N     1 
ATOM   1140  C CA    . PRO A  1 156 ? 58.864  152.743 -94.945  1.00 52.67  ? 156  PRO A CA    1 
ATOM   1141  C C     . PRO A  1 156 ? 58.465  153.778 -96.006  1.00 52.48  ? 156  PRO A C     1 
ATOM   1142  O O     . PRO A  1 156 ? 59.161  154.766 -96.211  1.00 52.50  ? 156  PRO A O     1 
ATOM   1143  C CB    . PRO A  1 156 ? 59.023  153.352 -93.552  1.00 53.20  ? 156  PRO A CB    1 
ATOM   1144  C CG    . PRO A  1 156 ? 60.463  153.787 -93.549  1.00 54.04  ? 156  PRO A CG    1 
ATOM   1145  C CD    . PRO A  1 156 ? 61.156  152.581 -94.166  1.00 52.27  ? 156  PRO A CD    1 
ATOM   1146  N N     . GLY A  1 157 ? 57.344  153.544 -96.677  1.00 51.87  ? 157  GLY A N     1 
ATOM   1147  C CA    . GLY A  1 157 ? 56.913  154.467 -97.705  1.00 51.57  ? 157  GLY A CA    1 
ATOM   1148  C C     . GLY A  1 157 ? 56.912  153.767 -99.044  1.00 51.69  ? 157  GLY A C     1 
ATOM   1149  O O     . GLY A  1 157 ? 55.973  153.905 -99.829  1.00 52.79  ? 157  GLY A O     1 
ATOM   1150  N N     . ILE A  1 158 ? 57.976  153.021 -99.317  1.00 50.29  ? 158  ILE A N     1 
ATOM   1151  C CA    . ILE A  1 158 ? 58.045  152.277 -100.564 1.00 48.71  ? 158  ILE A CA    1 
ATOM   1152  C C     . ILE A  1 158 ? 57.637  150.857 -100.237 1.00 49.37  ? 158  ILE A C     1 
ATOM   1153  O O     . ILE A  1 158 ? 58.112  150.271 -99.269  1.00 49.94  ? 158  ILE A O     1 
ATOM   1154  C CB    . ILE A  1 158 ? 59.460  152.235 -101.147 1.00 45.99  ? 158  ILE A CB    1 
ATOM   1155  C CG1   . ILE A  1 158 ? 60.037  153.646 -101.217 1.00 45.20  ? 158  ILE A CG1   1 
ATOM   1156  C CG2   . ILE A  1 158 ? 59.423  151.626 -102.527 1.00 43.12  ? 158  ILE A CG2   1 
ATOM   1157  C CD1   . ILE A  1 158 ? 61.499  153.685 -101.515 1.00 43.38  ? 158  ILE A CD1   1 
ATOM   1158  N N     . THR A  1 159 ? 56.728  150.310 -101.025 1.00 49.77  ? 159  THR A N     1 
ATOM   1159  C CA    . THR A  1 159 ? 56.312  148.946 -100.798 1.00 51.27  ? 159  THR A CA    1 
ATOM   1160  C C     . THR A  1 159 ? 56.832  148.133 -101.981 1.00 50.88  ? 159  THR A C     1 
ATOM   1161  O O     . THR A  1 159 ? 56.754  148.550 -103.143 1.00 50.18  ? 159  THR A O     1 
ATOM   1162  C CB    . THR A  1 159 ? 54.769  148.837 -100.608 1.00 51.92  ? 159  THR A CB    1 
ATOM   1163  O OG1   . THR A  1 159 ? 54.096  149.590 -101.620 1.00 55.29  ? 159  THR A OG1   1 
ATOM   1164  C CG2   . THR A  1 159 ? 54.372  149.385 -99.233  1.00 52.00  ? 159  THR A CG2   1 
ATOM   1165  N N     . ILE A  1 160 ? 57.406  146.985 -101.647 1.00 49.90  ? 160  ILE A N     1 
ATOM   1166  C CA    . ILE A  1 160 ? 58.021  146.077 -102.600 1.00 48.32  ? 160  ILE A CA    1 
ATOM   1167  C C     . ILE A  1 160 ? 57.004  145.127 -103.208 1.00 49.04  ? 160  ILE A C     1 
ATOM   1168  O O     . ILE A  1 160 ? 56.194  144.547 -102.491 1.00 50.04  ? 160  ILE A O     1 
ATOM   1169  C CB    . ILE A  1 160 ? 59.151  145.282 -101.861 1.00 46.96  ? 160  ILE A CB    1 
ATOM   1170  C CG1   . ILE A  1 160 ? 60.221  146.277 -101.395 1.00 43.19  ? 160  ILE A CG1   1 
ATOM   1171  C CG2   . ILE A  1 160 ? 59.719  144.160 -102.735 1.00 46.02  ? 160  ILE A CG2   1 
ATOM   1172  C CD1   . ILE A  1 160 ? 61.389  145.655 -100.727 1.00 40.56  ? 160  ILE A CD1   1 
ATOM   1173  N N     . ASP A  1 161 ? 57.034  144.968 -104.526 1.00 49.16  ? 161  ASP A N     1 
ATOM   1174  C CA    . ASP A  1 161 ? 56.104  144.055 -105.173 1.00 49.89  ? 161  ASP A CA    1 
ATOM   1175  C C     . ASP A  1 161 ? 56.841  142.922 -105.875 1.00 49.83  ? 161  ASP A C     1 
ATOM   1176  O O     . ASP A  1 161 ? 56.240  142.081 -106.531 1.00 49.01  ? 161  ASP A O     1 
ATOM   1177  C CB    . ASP A  1 161 ? 55.194  144.806 -106.163 1.00 52.44  ? 161  ASP A CB    1 
ATOM   1178  C CG    . ASP A  1 161 ? 55.965  145.582 -107.232 1.00 54.45  ? 161  ASP A CG    1 
ATOM   1179  O OD1   . ASP A  1 161 ? 56.940  145.051 -107.802 1.00 56.40  ? 161  ASP A OD1   1 
ATOM   1180  O OD2   . ASP A  1 161 ? 55.572  146.732 -107.525 1.00 56.51  ? 161  ASP A OD2   1 
ATOM   1181  N N     . GLU A  1 162 ? 58.157  142.904 -105.709 1.00 50.51  ? 162  GLU A N     1 
ATOM   1182  C CA    . GLU A  1 162 ? 59.017  141.900 -106.317 1.00 50.89  ? 162  GLU A CA    1 
ATOM   1183  C C     . GLU A  1 162 ? 58.791  141.777 -107.806 1.00 50.78  ? 162  GLU A C     1 
ATOM   1184  O O     . GLU A  1 162 ? 58.983  140.712 -108.384 1.00 50.12  ? 162  GLU A O     1 
ATOM   1185  C CB    . GLU A  1 162 ? 58.833  140.538 -105.646 1.00 51.71  ? 162  GLU A CB    1 
ATOM   1186  C CG    . GLU A  1 162 ? 59.119  140.549 -104.142 1.00 52.69  ? 162  GLU A CG    1 
ATOM   1187  C CD    . GLU A  1 162 ? 60.543  140.975 -103.781 1.00 52.66  ? 162  GLU A CD    1 
ATOM   1188  O OE1   . GLU A  1 162 ? 61.331  141.341 -104.683 1.00 51.46  ? 162  GLU A OE1   1 
ATOM   1189  O OE2   . GLU A  1 162 ? 60.867  140.940 -102.571 1.00 53.36  ? 162  GLU A OE2   1 
ATOM   1190  N N     . ASP A  1 163 ? 58.380  142.886 -108.416 1.00 51.57  ? 163  ASP A N     1 
ATOM   1191  C CA    . ASP A  1 163 ? 58.159  142.962 -109.858 1.00 51.59  ? 163  ASP A CA    1 
ATOM   1192  C C     . ASP A  1 163 ? 58.936  144.153 -110.431 1.00 50.07  ? 163  ASP A C     1 
ATOM   1193  O O     . ASP A  1 163 ? 59.838  143.965 -111.246 1.00 50.66  ? 163  ASP A O     1 
ATOM   1194  C CB    . ASP A  1 163 ? 56.659  143.076 -110.176 1.00 53.60  ? 163  ASP A CB    1 
ATOM   1195  C CG    . ASP A  1 163 ? 56.389  143.454 -111.632 1.00 55.04  ? 163  ASP A CG    1 
ATOM   1196  O OD1   . ASP A  1 163 ? 57.042  142.910 -112.564 1.00 53.26  ? 163  ASP A OD1   1 
ATOM   1197  O OD2   . ASP A  1 163 ? 55.500  144.306 -111.833 1.00 56.33  ? 163  ASP A OD2   1 
ATOM   1198  N N     . THR A  1 164 ? 58.599  145.368 -110.003 1.00 48.42  ? 164  THR A N     1 
ATOM   1199  C CA    . THR A  1 164 ? 59.302  146.565 -110.475 1.00 47.95  ? 164  THR A CA    1 
ATOM   1200  C C     . THR A  1 164 ? 59.995  147.221 -109.298 1.00 46.67  ? 164  THR A C     1 
ATOM   1201  O O     . THR A  1 164 ? 60.979  147.956 -109.445 1.00 46.00  ? 164  THR A O     1 
ATOM   1202  C CB    . THR A  1 164 ? 58.345  147.572 -111.100 1.00 47.54  ? 164  THR A CB    1 
ATOM   1203  O OG1   . THR A  1 164 ? 57.165  147.683 -110.287 1.00 49.20  ? 164  THR A OG1   1 
ATOM   1204  C CG2   . THR A  1 164 ? 57.996  147.136 -112.495 1.00 47.78  ? 164  THR A CG2   1 
ATOM   1205  N N     . ILE A  1 165 ? 59.443  146.962 -108.124 1.00 45.16  ? 165  ILE A N     1 
ATOM   1206  C CA    . ILE A  1 165 ? 60.006  147.465 -106.887 1.00 45.35  ? 165  ILE A CA    1 
ATOM   1207  C C     . ILE A  1 165 ? 60.360  146.167 -106.178 1.00 45.20  ? 165  ILE A C     1 
ATOM   1208  O O     . ILE A  1 165 ? 59.491  145.494 -105.608 1.00 44.96  ? 165  ILE A O     1 
ATOM   1209  C CB    . ILE A  1 165 ? 58.968  148.297 -106.098 1.00 45.36  ? 165  ILE A CB    1 
ATOM   1210  C CG1   . ILE A  1 165 ? 58.539  149.488 -106.957 1.00 46.21  ? 165  ILE A CG1   1 
ATOM   1211  C CG2   . ILE A  1 165 ? 59.567  148.820 -104.793 1.00 45.34  ? 165  ILE A CG2   1 
ATOM   1212  C CD1   . ILE A  1 165 ? 57.469  150.314 -106.352 1.00 47.22  ? 165  ILE A CD1   1 
ATOM   1213  N N     . VAL A  1 166 ? 61.644  145.811 -106.258 1.00 44.32  ? 166  VAL A N     1 
ATOM   1214  C CA    . VAL A  1 166 ? 62.152  144.571 -105.679 1.00 42.52  ? 166  VAL A CA    1 
ATOM   1215  C C     . VAL A  1 166 ? 63.071  144.639 -104.446 1.00 42.98  ? 166  VAL A C     1 
ATOM   1216  O O     . VAL A  1 166 ? 63.554  145.700 -104.036 1.00 42.23  ? 166  VAL A O     1 
ATOM   1217  C CB    . VAL A  1 166 ? 62.891  143.763 -106.765 1.00 40.13  ? 166  VAL A CB    1 
ATOM   1218  C CG1   . VAL A  1 166 ? 61.952  143.488 -107.902 1.00 37.99  ? 166  VAL A CG1   1 
ATOM   1219  C CG2   . VAL A  1 166 ? 64.115  144.533 -107.262 1.00 37.00  ? 166  VAL A CG2   1 
ATOM   1220  N N     . SER A  1 167 ? 63.262  143.466 -103.846 1.00 43.56  ? 167  SER A N     1 
ATOM   1221  C CA    . SER A  1 167 ? 64.156  143.280 -102.713 1.00 42.14  ? 167  SER A CA    1 
ATOM   1222  C C     . SER A  1 167 ? 65.212  142.421 -103.401 1.00 41.76  ? 167  SER A C     1 
ATOM   1223  O O     . SER A  1 167 ? 65.124  142.183 -104.611 1.00 41.69  ? 167  SER A O     1 
ATOM   1224  C CB    . SER A  1 167 ? 63.468  142.493 -101.593 1.00 40.70  ? 167  SER A CB    1 
ATOM   1225  O OG    . SER A  1 167 ? 63.594  141.093 -101.779 1.00 41.41  ? 167  SER A OG    1 
ATOM   1226  N N     . SER A  1 168 ? 66.210  141.955 -102.669 1.00 40.74  ? 168  SER A N     1 
ATOM   1227  C CA    . SER A  1 168 ? 67.221  141.124 -103.302 1.00 39.44  ? 168  SER A CA    1 
ATOM   1228  C C     . SER A  1 168 ? 66.587  139.894 -103.947 1.00 38.79  ? 168  SER A C     1 
ATOM   1229  O O     . SER A  1 168 ? 67.064  139.419 -104.978 1.00 38.44  ? 168  SER A O     1 
ATOM   1230  C CB    . SER A  1 168 ? 68.283  140.713 -102.284 1.00 38.34  ? 168  SER A CB    1 
ATOM   1231  O OG    . SER A  1 168 ? 67.689  140.432 -101.037 1.00 38.69  ? 168  SER A OG    1 
ATOM   1232  N N     . THR A  1 169 ? 65.494  139.400 -103.368 1.00 38.92  ? 169  THR A N     1 
ATOM   1233  C CA    . THR A  1 169 ? 64.828  138.210 -103.902 1.00 39.81  ? 169  THR A CA    1 
ATOM   1234  C C     . THR A  1 169 ? 64.324  138.438 -105.334 1.00 41.23  ? 169  THR A C     1 
ATOM   1235  O O     . THR A  1 169 ? 64.617  137.651 -106.246 1.00 42.32  ? 169  THR A O     1 
ATOM   1236  C CB    . THR A  1 169 ? 63.649  137.758 -102.984 1.00 40.47  ? 169  THR A CB    1 
ATOM   1237  O OG1   . THR A  1 169 ? 64.155  137.371 -101.696 1.00 39.61  ? 169  THR A OG1   1 
ATOM   1238  C CG2   . THR A  1 169 ? 62.902  136.578 -103.599 1.00 38.11  ? 169  THR A CG2   1 
ATOM   1239  N N     . GLY A  1 170 ? 63.575  139.517 -105.534 1.00 41.95  ? 170  GLY A N     1 
ATOM   1240  C CA    . GLY A  1 170 ? 63.075  139.828 -106.860 1.00 41.28  ? 170  GLY A CA    1 
ATOM   1241  C C     . GLY A  1 170 ? 64.196  140.156 -107.842 1.00 42.44  ? 170  GLY A C     1 
ATOM   1242  O O     . GLY A  1 170 ? 64.143  139.785 -109.022 1.00 42.00  ? 170  GLY A O     1 
ATOM   1243  N N     . ALA A  1 171 ? 65.227  140.844 -107.365 1.00 42.01  ? 171  ALA A N     1 
ATOM   1244  C CA    . ALA A  1 171 ? 66.343  141.203 -108.232 1.00 41.08  ? 171  ALA A CA    1 
ATOM   1245  C C     . ALA A  1 171 ? 66.989  139.972 -108.844 1.00 41.44  ? 171  ALA A C     1 
ATOM   1246  O O     . ALA A  1 171 ? 67.409  140.000 -110.002 1.00 41.03  ? 171  ALA A O     1 
ATOM   1247  C CB    . ALA A  1 171 ? 67.372  141.992 -107.456 1.00 41.90  ? 171  ALA A CB    1 
ATOM   1248  N N     . LEU A  1 172 ? 67.055  138.889 -108.069 1.00 41.15  ? 172  LEU A N     1 
ATOM   1249  C CA    . LEU A  1 172 ? 67.661  137.650 -108.535 1.00 40.51  ? 172  LEU A CA    1 
ATOM   1250  C C     . LEU A  1 172 ? 66.856  136.929 -109.602 1.00 42.56  ? 172  LEU A C     1 
ATOM   1251  O O     . LEU A  1 172 ? 67.383  136.019 -110.263 1.00 43.20  ? 172  LEU A O     1 
ATOM   1252  C CB    . LEU A  1 172 ? 67.886  136.707 -107.359 1.00 39.30  ? 172  LEU A CB    1 
ATOM   1253  C CG    . LEU A  1 172 ? 69.018  137.118 -106.410 1.00 40.92  ? 172  LEU A CG    1 
ATOM   1254  C CD1   . LEU A  1 172 ? 68.994  136.245 -105.148 1.00 40.51  ? 172  LEU A CD1   1 
ATOM   1255  C CD2   . LEU A  1 172 ? 70.355  137.013 -107.142 1.00 38.54  ? 172  LEU A CD2   1 
ATOM   1256  N N     . SER A  1 173 ? 65.598  137.340 -109.792 1.00 42.93  ? 173  SER A N     1 
ATOM   1257  C CA    . SER A  1 173 ? 64.717  136.688 -110.767 1.00 44.33  ? 173  SER A CA    1 
ATOM   1258  C C     . SER A  1 173 ? 64.065  137.548 -111.861 1.00 44.86  ? 173  SER A C     1 
ATOM   1259  O O     . SER A  1 173 ? 63.109  137.117 -112.495 1.00 44.40  ? 173  SER A O     1 
ATOM   1260  C CB    . SER A  1 173 ? 63.622  135.917 -110.021 1.00 43.79  ? 173  SER A CB    1 
ATOM   1261  O OG    . SER A  1 173 ? 64.165  134.795 -109.347 1.00 44.83  ? 173  SER A OG    1 
ATOM   1262  N N     . LEU A  1 174 ? 64.578  138.749 -112.092 1.00 45.52  ? 174  LEU A N     1 
ATOM   1263  C CA    . LEU A  1 174 ? 64.019  139.609 -113.122 1.00 45.67  ? 174  LEU A CA    1 
ATOM   1264  C C     . LEU A  1 174 ? 63.773  138.835 -114.421 1.00 47.38  ? 174  LEU A C     1 
ATOM   1265  O O     . LEU A  1 174 ? 64.631  138.087 -114.897 1.00 46.92  ? 174  LEU A O     1 
ATOM   1266  C CB    . LEU A  1 174 ? 64.961  140.786 -113.371 1.00 44.86  ? 174  LEU A CB    1 
ATOM   1267  C CG    . LEU A  1 174 ? 64.787  142.085 -112.571 1.00 43.52  ? 174  LEU A CG    1 
ATOM   1268  C CD1   . LEU A  1 174 ? 64.389  141.819 -111.152 1.00 42.43  ? 174  LEU A CD1   1 
ATOM   1269  C CD2   . LEU A  1 174 ? 66.090  142.869 -112.623 1.00 43.59  ? 174  LEU A CD2   1 
ATOM   1270  N N     . LYS A  1 175 ? 62.590  139.029 -114.995 1.00 49.77  ? 175  LYS A N     1 
ATOM   1271  C CA    . LYS A  1 175 ? 62.200  138.339 -116.225 1.00 52.50  ? 175  LYS A CA    1 
ATOM   1272  C C     . LYS A  1 175 ? 62.969  138.767 -117.477 1.00 52.69  ? 175  LYS A C     1 
ATOM   1273  O O     . LYS A  1 175 ? 63.110  137.992 -118.438 1.00 50.94  ? 175  LYS A O     1 
ATOM   1274  C CB    . LYS A  1 175 ? 60.697  138.506 -116.448 1.00 54.41  ? 175  LYS A CB    1 
ATOM   1275  C CG    . LYS A  1 175 ? 59.834  137.811 -115.390 1.00 56.50  ? 175  LYS A CG    1 
ATOM   1276  C CD    . LYS A  1 175 ? 60.023  136.286 -115.401 1.00 57.93  ? 175  LYS A CD    1 
ATOM   1277  C CE    . LYS A  1 175 ? 59.568  135.655 -116.715 1.00 59.00  ? 175  LYS A CE    1 
ATOM   1278  N NZ    . LYS A  1 175 ? 59.938  134.212 -116.788 1.00 59.73  ? 175  LYS A NZ    1 
ATOM   1279  N N     . LYS A  1 176 ? 63.448  140.007 -117.467 1.00 53.23  ? 176  LYS A N     1 
ATOM   1280  C CA    . LYS A  1 176 ? 64.238  140.537 -118.571 1.00 53.70  ? 176  LYS A CA    1 
ATOM   1281  C C     . LYS A  1 176 ? 65.136  141.641 -118.046 1.00 51.85  ? 176  LYS A C     1 
ATOM   1282  O O     . LYS A  1 176 ? 64.902  142.174 -116.962 1.00 51.39  ? 176  LYS A O     1 
ATOM   1283  C CB    . LYS A  1 176 ? 63.336  141.039 -119.699 1.00 56.49  ? 176  LYS A CB    1 
ATOM   1284  C CG    . LYS A  1 176 ? 62.918  139.918 -120.676 1.00 61.32  ? 176  LYS A CG    1 
ATOM   1285  C CD    . LYS A  1 176 ? 64.101  139.420 -121.521 1.00 63.92  ? 176  LYS A CD    1 
ATOM   1286  C CE    . LYS A  1 176 ? 63.706  138.265 -122.439 1.00 65.61  ? 176  LYS A CE    1 
ATOM   1287  N NZ    . LYS A  1 176 ? 63.476  137.009 -121.666 1.00 65.87  ? 176  LYS A NZ    1 
ATOM   1288  N N     . VAL A  1 177 ? 66.184  141.962 -118.794 1.00 50.47  ? 177  VAL A N     1 
ATOM   1289  C CA    . VAL A  1 177 ? 67.116  142.991 -118.353 1.00 49.22  ? 177  VAL A CA    1 
ATOM   1290  C C     . VAL A  1 177 ? 66.424  144.357 -118.305 1.00 49.78  ? 177  VAL A C     1 
ATOM   1291  O O     . VAL A  1 177 ? 65.807  144.778 -119.277 1.00 51.29  ? 177  VAL A O     1 
ATOM   1292  C CB    . VAL A  1 177 ? 68.364  143.067 -119.288 1.00 47.29  ? 177  VAL A CB    1 
ATOM   1293  C CG1   . VAL A  1 177 ? 69.347  144.098 -118.754 1.00 45.51  ? 177  VAL A CG1   1 
ATOM   1294  C CG2   . VAL A  1 177 ? 69.029  141.690 -119.412 1.00 43.99  ? 177  VAL A CG2   1 
ATOM   1295  N N     . PRO A  1 178 ? 66.484  145.051 -117.160 1.00 49.47  ? 178  PRO A N     1 
ATOM   1296  C CA    . PRO A  1 178 ? 65.838  146.363 -117.093 1.00 48.98  ? 178  PRO A CA    1 
ATOM   1297  C C     . PRO A  1 178 ? 66.700  147.412 -117.790 1.00 48.83  ? 178  PRO A C     1 
ATOM   1298  O O     . PRO A  1 178 ? 67.923  147.386 -117.706 1.00 47.74  ? 178  PRO A O     1 
ATOM   1299  C CB    . PRO A  1 178 ? 65.712  146.606 -115.596 1.00 48.59  ? 178  PRO A CB    1 
ATOM   1300  C CG    . PRO A  1 178 ? 66.934  145.956 -115.069 1.00 48.18  ? 178  PRO A CG    1 
ATOM   1301  C CD    . PRO A  1 178 ? 66.978  144.648 -115.834 1.00 48.53  ? 178  PRO A CD    1 
ATOM   1302  N N     . GLU A  1 179 ? 66.043  148.329 -118.484 1.00 49.75  ? 179  GLU A N     1 
ATOM   1303  C CA    . GLU A  1 179 ? 66.718  149.390 -119.223 1.00 49.85  ? 179  GLU A CA    1 
ATOM   1304  C C     . GLU A  1 179 ? 67.568  150.250 -118.305 1.00 47.34  ? 179  GLU A C     1 
ATOM   1305  O O     . GLU A  1 179 ? 68.760  150.428 -118.515 1.00 44.17  ? 179  GLU A O     1 
ATOM   1306  C CB    . GLU A  1 179 ? 65.670  150.265 -119.902 1.00 52.55  ? 179  GLU A CB    1 
ATOM   1307  C CG    . GLU A  1 179 ? 65.860  150.438 -121.382 1.00 57.50  ? 179  GLU A CG    1 
ATOM   1308  C CD    . GLU A  1 179 ? 65.910  151.896 -121.766 1.00 61.57  ? 179  GLU A CD    1 
ATOM   1309  O OE1   . GLU A  1 179 ? 64.959  152.635 -121.403 1.00 63.68  ? 179  GLU A OE1   1 
ATOM   1310  O OE2   . GLU A  1 179 ? 66.900  152.305 -122.421 1.00 62.75  ? 179  GLU A OE2   1 
ATOM   1311  N N     . LYS A  1 180 ? 66.909  150.798 -117.297 1.00 47.20  ? 180  LYS A N     1 
ATOM   1312  C CA    . LYS A  1 180 ? 67.537  151.652 -116.307 1.00 47.72  ? 180  LYS A CA    1 
ATOM   1313  C C     . LYS A  1 180 ? 67.184  151.061 -114.942 1.00 46.15  ? 180  LYS A C     1 
ATOM   1314  O O     . LYS A  1 180 ? 66.042  150.670 -114.708 1.00 44.81  ? 180  LYS A O     1 
ATOM   1315  C CB    . LYS A  1 180 ? 66.981  153.077 -116.440 1.00 50.19  ? 180  LYS A CB    1 
ATOM   1316  C CG    . LYS A  1 180 ? 67.777  154.167 -115.751 1.00 54.23  ? 180  LYS A CG    1 
ATOM   1317  C CD    . LYS A  1 180 ? 67.271  155.534 -116.204 1.00 57.65  ? 180  LYS A CD    1 
ATOM   1318  C CE    . LYS A  1 180 ? 67.990  156.672 -115.479 1.00 60.41  ? 180  LYS A CE    1 
ATOM   1319  N NZ    . LYS A  1 180 ? 67.399  158.006 -115.797 1.00 61.88  ? 180  LYS A NZ    1 
ATOM   1320  N N     . MET A  1 181 ? 68.169  150.962 -114.054 1.00 45.20  ? 181  MET A N     1 
ATOM   1321  C CA    . MET A  1 181 ? 67.920  150.425 -112.715 1.00 44.12  ? 181  MET A CA    1 
ATOM   1322  C C     . MET A  1 181 ? 68.593  151.288 -111.684 1.00 42.68  ? 181  MET A C     1 
ATOM   1323  O O     . MET A  1 181 ? 69.684  151.797 -111.909 1.00 42.94  ? 181  MET A O     1 
ATOM   1324  C CB    . MET A  1 181 ? 68.460  148.995 -112.555 1.00 42.60  ? 181  MET A CB    1 
ATOM   1325  C CG    . MET A  1 181 ? 67.952  148.316 -111.277 1.00 42.19  ? 181  MET A CG    1 
ATOM   1326  S SD    . MET A  1 181 ? 68.793  146.753 -110.748 1.00 42.48  ? 181  MET A SD    1 
ATOM   1327  C CE    . MET A  1 181 ? 68.437  145.652 -112.114 1.00 41.98  ? 181  MET A CE    1 
ATOM   1328  N N     . VAL A  1 182 ? 67.939  151.461 -110.550 1.00 42.31  ? 182  VAL A N     1 
ATOM   1329  C CA    . VAL A  1 182 ? 68.543  152.233 -109.491 1.00 43.94  ? 182  VAL A CA    1 
ATOM   1330  C C     . VAL A  1 182 ? 68.533  151.409 -108.187 1.00 43.73  ? 182  VAL A C     1 
ATOM   1331  O O     . VAL A  1 182 ? 67.521  150.811 -107.824 1.00 42.34  ? 182  VAL A O     1 
ATOM   1332  C CB    . VAL A  1 182 ? 67.822  153.593 -109.321 1.00 44.95  ? 182  VAL A CB    1 
ATOM   1333  C CG1   . VAL A  1 182 ? 66.514  153.421 -108.600 1.00 46.48  ? 182  VAL A CG1   1 
ATOM   1334  C CG2   . VAL A  1 182 ? 68.712  154.551 -108.575 1.00 46.79  ? 182  VAL A CG2   1 
ATOM   1335  N N     . VAL A  1 183 ? 69.674  151.353 -107.501 1.00 43.55  ? 183  VAL A N     1 
ATOM   1336  C CA    . VAL A  1 183 ? 69.776  150.585 -106.258 1.00 42.09  ? 183  VAL A CA    1 
ATOM   1337  C C     . VAL A  1 183 ? 69.879  151.486 -105.035 1.00 42.38  ? 183  VAL A C     1 
ATOM   1338  O O     . VAL A  1 183 ? 70.738  152.377 -104.975 1.00 42.07  ? 183  VAL A O     1 
ATOM   1339  C CB    . VAL A  1 183 ? 71.028  149.662 -106.274 1.00 42.19  ? 183  VAL A CB    1 
ATOM   1340  C CG1   . VAL A  1 183 ? 71.110  148.854 -104.967 1.00 41.04  ? 183  VAL A CG1   1 
ATOM   1341  C CG2   . VAL A  1 183 ? 70.990  148.748 -107.484 1.00 38.10  ? 183  VAL A CG2   1 
ATOM   1342  N N     . ILE A  1 184 ? 69.010  151.258 -104.057 1.00 41.87  ? 184  ILE A N     1 
ATOM   1343  C CA    . ILE A  1 184 ? 69.054  152.056 -102.839 1.00 41.84  ? 184  ILE A CA    1 
ATOM   1344  C C     . ILE A  1 184 ? 70.059  151.376 -101.937 1.00 43.13  ? 184  ILE A C     1 
ATOM   1345  O O     . ILE A  1 184 ? 69.864  150.220 -101.561 1.00 45.43  ? 184  ILE A O     1 
ATOM   1346  C CB    . ILE A  1 184 ? 67.711  152.072 -102.092 1.00 40.80  ? 184  ILE A CB    1 
ATOM   1347  C CG1   . ILE A  1 184 ? 66.590  152.520 -103.022 1.00 40.81  ? 184  ILE A CG1   1 
ATOM   1348  C CG2   . ILE A  1 184 ? 67.800  153.008 -100.893 1.00 39.15  ? 184  ILE A CG2   1 
ATOM   1349  C CD1   . ILE A  1 184 ? 65.252  152.523 -102.367 1.00 39.87  ? 184  ILE A CD1   1 
ATOM   1350  N N     . GLY A  1 185 ? 71.129  152.083 -101.589 1.00 42.82  ? 185  GLY A N     1 
ATOM   1351  C CA    . GLY A  1 185 ? 72.140  151.499 -100.731 1.00 41.47  ? 185  GLY A CA    1 
ATOM   1352  C C     . GLY A  1 185 ? 73.262  150.849 -101.515 1.00 41.10  ? 185  GLY A C     1 
ATOM   1353  O O     . GLY A  1 185 ? 73.027  150.134 -102.491 1.00 41.84  ? 185  GLY A O     1 
ATOM   1354  N N     . ALA A  1 186 ? 74.490  151.102 -101.079 1.00 40.07  ? 186  ALA A N     1 
ATOM   1355  C CA    . ALA A  1 186 ? 75.664  150.552 -101.728 1.00 37.78  ? 186  ALA A CA    1 
ATOM   1356  C C     . ALA A  1 186 ? 76.372  149.596 -100.781 1.00 37.17  ? 186  ALA A C     1 
ATOM   1357  O O     . ALA A  1 186 ? 77.587  149.672 -100.585 1.00 36.48  ? 186  ALA A O     1 
ATOM   1358  C CB    . ALA A  1 186 ? 76.597  151.669 -102.159 1.00 37.66  ? 186  ALA A CB    1 
ATOM   1359  N N     . GLY A  1 187 ? 75.585  148.706 -100.182 1.00 35.81  ? 187  GLY A N     1 
ATOM   1360  C CA    . GLY A  1 187 ? 76.138  147.706 -99.295  1.00 34.79  ? 187  GLY A CA    1 
ATOM   1361  C C     . GLY A  1 187 ? 76.598  146.616 -100.234 1.00 35.44  ? 187  GLY A C     1 
ATOM   1362  O O     . GLY A  1 187 ? 76.363  146.736 -101.443 1.00 35.24  ? 187  GLY A O     1 
ATOM   1363  N N     . VAL A  1 188 ? 77.235  145.563 -99.705  1.00 35.40  ? 188  VAL A N     1 
ATOM   1364  C CA    . VAL A  1 188 ? 77.748  144.459 -100.536 1.00 33.07  ? 188  VAL A CA    1 
ATOM   1365  C C     . VAL A  1 188 ? 76.665  143.835 -101.416 1.00 32.83  ? 188  VAL A C     1 
ATOM   1366  O O     . VAL A  1 188 ? 76.895  143.584 -102.601 1.00 31.11  ? 188  VAL A O     1 
ATOM   1367  C CB    . VAL A  1 188 ? 78.424  143.337 -99.671  1.00 31.91  ? 188  VAL A CB    1 
ATOM   1368  C CG1   . VAL A  1 188 ? 78.895  142.184 -100.543 1.00 29.55  ? 188  VAL A CG1   1 
ATOM   1369  C CG2   . VAL A  1 188 ? 79.613  143.905 -98.937  1.00 30.95  ? 188  VAL A CG2   1 
ATOM   1370  N N     . ILE A  1 189 ? 75.486  143.595 -100.855 1.00 33.04  ? 189  ILE A N     1 
ATOM   1371  C CA    . ILE A  1 189 ? 74.420  142.995 -101.647 1.00 35.42  ? 189  ILE A CA    1 
ATOM   1372  C C     . ILE A  1 189 ? 74.022  143.893 -102.837 1.00 37.18  ? 189  ILE A C     1 
ATOM   1373  O O     . ILE A  1 189 ? 73.946  143.437 -103.991 1.00 35.95  ? 189  ILE A O     1 
ATOM   1374  C CB    . ILE A  1 189 ? 73.210  142.679 -100.754 1.00 35.30  ? 189  ILE A CB    1 
ATOM   1375  C CG1   . ILE A  1 189 ? 73.674  141.726 -99.636  1.00 35.47  ? 189  ILE A CG1   1 
ATOM   1376  C CG2   . ILE A  1 189 ? 72.085  142.062 -101.594 1.00 33.71  ? 189  ILE A CG2   1 
ATOM   1377  C CD1   . ILE A  1 189 ? 72.662  141.438 -98.559  1.00 36.33  ? 189  ILE A CD1   1 
ATOM   1378  N N     . GLY A  1 190 ? 73.797  145.176 -102.554 1.00 38.05  ? 190  GLY A N     1 
ATOM   1379  C CA    . GLY A  1 190 ? 73.441  146.104 -103.603 1.00 35.75  ? 190  GLY A CA    1 
ATOM   1380  C C     . GLY A  1 190 ? 74.516  146.149 -104.674 1.00 35.94  ? 190  GLY A C     1 
ATOM   1381  O O     . GLY A  1 190 ? 74.212  146.118 -105.863 1.00 37.68  ? 190  GLY A O     1 
ATOM   1382  N N     . VAL A  1 191 ? 75.780  146.213 -104.278 1.00 34.65  ? 191  VAL A N     1 
ATOM   1383  C CA    . VAL A  1 191 ? 76.851  146.273 -105.268 1.00 32.81  ? 191  VAL A CA    1 
ATOM   1384  C C     . VAL A  1 191 ? 76.862  145.054 -106.170 1.00 31.40  ? 191  VAL A C     1 
ATOM   1385  O O     . VAL A  1 191 ? 76.918  145.187 -107.384 1.00 31.37  ? 191  VAL A O     1 
ATOM   1386  C CB    . VAL A  1 191 ? 78.230  146.422 -104.580 1.00 33.68  ? 191  VAL A CB    1 
ATOM   1387  C CG1   . VAL A  1 191 ? 79.344  146.534 -105.615 1.00 33.78  ? 191  VAL A CG1   1 
ATOM   1388  C CG2   . VAL A  1 191 ? 78.215  147.642 -103.689 1.00 33.31  ? 191  VAL A CG2   1 
ATOM   1389  N N     . GLU A  1 192 ? 76.789  143.867 -105.582 1.00 30.94  ? 192  GLU A N     1 
ATOM   1390  C CA    . GLU A  1 192 ? 76.818  142.637 -106.372 1.00 31.88  ? 192  GLU A CA    1 
ATOM   1391  C C     . GLU A  1 192 ? 75.691  142.553 -107.394 1.00 30.78  ? 192  GLU A C     1 
ATOM   1392  O O     . GLU A  1 192 ? 75.931  142.385 -108.591 1.00 28.50  ? 192  GLU A O     1 
ATOM   1393  C CB    . GLU A  1 192 ? 76.771  141.397 -105.463 1.00 30.97  ? 192  GLU A CB    1 
ATOM   1394  C CG    . GLU A  1 192 ? 77.905  141.327 -104.468 1.00 32.49  ? 192  GLU A CG    1 
ATOM   1395  C CD    . GLU A  1 192 ? 78.034  139.963 -103.795 1.00 35.08  ? 192  GLU A CD    1 
ATOM   1396  O OE1   . GLU A  1 192 ? 76.988  139.326 -103.497 1.00 34.99  ? 192  GLU A OE1   1 
ATOM   1397  O OE2   . GLU A  1 192 ? 79.193  139.546 -103.552 1.00 33.94  ? 192  GLU A OE2   1 
ATOM   1398  N N     . LEU A  1 193 ? 74.461  142.661 -106.913 1.00 30.91  ? 193  LEU A N     1 
ATOM   1399  C CA    . LEU A  1 193 ? 73.313  142.596 -107.796 1.00 32.09  ? 193  LEU A CA    1 
ATOM   1400  C C     . LEU A  1 193 ? 73.398  143.710 -108.836 1.00 32.05  ? 193  LEU A C     1 
ATOM   1401  O O     . LEU A  1 193 ? 73.199  143.485 -110.039 1.00 33.04  ? 193  LEU A O     1 
ATOM   1402  C CB    . LEU A  1 193 ? 72.029  142.723 -106.982 1.00 32.38  ? 193  LEU A CB    1 
ATOM   1403  C CG    . LEU A  1 193 ? 71.819  141.623 -105.951 1.00 32.15  ? 193  LEU A CG    1 
ATOM   1404  C CD1   . LEU A  1 193 ? 70.600  141.939 -105.125 1.00 32.99  ? 193  LEU A CD1   1 
ATOM   1405  C CD2   . LEU A  1 193 ? 71.666  140.286 -106.644 1.00 32.06  ? 193  LEU A CD2   1 
ATOM   1406  N N     . GLY A  1 194 ? 73.711  144.912 -108.370 1.00 30.75  ? 194  GLY A N     1 
ATOM   1407  C CA    . GLY A  1 194 ? 73.822  146.034 -109.272 1.00 30.12  ? 194  GLY A CA    1 
ATOM   1408  C C     . GLY A  1 194 ? 74.782  145.744 -110.399 1.00 30.67  ? 194  GLY A C     1 
ATOM   1409  O O     . GLY A  1 194 ? 74.529  146.082 -111.548 1.00 31.93  ? 194  GLY A O     1 
ATOM   1410  N N     . SER A  1 195 ? 75.895  145.108 -110.081 1.00 31.11  ? 195  SER A N     1 
ATOM   1411  C CA    . SER A  1 195 ? 76.877  144.820 -111.104 1.00 31.91  ? 195  SER A CA    1 
ATOM   1412  C C     . SER A  1 195 ? 76.440  143.672 -112.018 1.00 33.78  ? 195  SER A C     1 
ATOM   1413  O O     . SER A  1 195 ? 76.807  143.621 -113.197 1.00 33.33  ? 195  SER A O     1 
ATOM   1414  C CB    . SER A  1 195 ? 78.217  144.511 -110.449 1.00 30.76  ? 195  SER A CB    1 
ATOM   1415  O OG    . SER A  1 195 ? 79.180  144.175 -111.432 1.00 31.23  ? 195  SER A OG    1 
ATOM   1416  N N     . VAL A  1 196 ? 75.662  142.742 -111.478 1.00 34.09  ? 196  VAL A N     1 
ATOM   1417  C CA    . VAL A  1 196 ? 75.183  141.633 -112.286 1.00 34.13  ? 196  VAL A CA    1 
ATOM   1418  C C     . VAL A  1 196 ? 74.422  142.192 -113.498 1.00 34.39  ? 196  VAL A C     1 
ATOM   1419  O O     . VAL A  1 196 ? 74.773  141.928 -114.654 1.00 34.24  ? 196  VAL A O     1 
ATOM   1420  C CB    . VAL A  1 196 ? 74.236  140.689 -111.457 1.00 33.57  ? 196  VAL A CB    1 
ATOM   1421  C CG1   . VAL A  1 196 ? 73.411  139.811 -112.386 1.00 30.78  ? 196  VAL A CG1   1 
ATOM   1422  C CG2   . VAL A  1 196 ? 75.059  139.806 -110.527 1.00 31.52  ? 196  VAL A CG2   1 
ATOM   1423  N N     . TRP A  1 197 ? 73.398  142.989 -113.219 1.00 34.32  ? 197  TRP A N     1 
ATOM   1424  C CA    . TRP A  1 197 ? 72.566  143.568 -114.263 1.00 33.94  ? 197  TRP A CA    1 
ATOM   1425  C C     . TRP A  1 197 ? 73.278  144.579 -115.168 1.00 34.96  ? 197  TRP A C     1 
ATOM   1426  O O     . TRP A  1 197 ? 73.041  144.635 -116.378 1.00 34.51  ? 197  TRP A O     1 
ATOM   1427  C CB    . TRP A  1 197 ? 71.325  144.155 -113.607 1.00 31.48  ? 197  TRP A CB    1 
ATOM   1428  C CG    . TRP A  1 197 ? 70.479  143.073 -113.018 1.00 31.53  ? 197  TRP A CG    1 
ATOM   1429  C CD1   . TRP A  1 197 ? 70.342  142.763 -111.694 1.00 29.79  ? 197  TRP A CD1   1 
ATOM   1430  C CD2   . TRP A  1 197 ? 69.704  142.090 -113.741 1.00 32.45  ? 197  TRP A CD2   1 
ATOM   1431  N NE1   . TRP A  1 197 ? 69.541  141.654 -111.545 1.00 30.10  ? 197  TRP A NE1   1 
ATOM   1432  C CE2   . TRP A  1 197 ? 69.136  141.221 -112.784 1.00 32.59  ? 197  TRP A CE2   1 
ATOM   1433  C CE3   . TRP A  1 197 ? 69.444  141.861 -115.100 1.00 32.84  ? 197  TRP A CE3   1 
ATOM   1434  C CZ2   . TRP A  1 197 ? 68.318  140.138 -113.146 1.00 33.24  ? 197  TRP A CZ2   1 
ATOM   1435  C CZ3   . TRP A  1 197 ? 68.627  140.774 -115.455 1.00 34.38  ? 197  TRP A CZ3   1 
ATOM   1436  C CH2   . TRP A  1 197 ? 68.077  139.933 -114.481 1.00 32.97  ? 197  TRP A CH2   1 
ATOM   1437  N N     . GLN A  1 198 ? 74.156  145.369 -114.575 1.00 36.00  ? 198  GLN A N     1 
ATOM   1438  C CA    . GLN A  1 198 ? 74.945  146.323 -115.328 1.00 38.16  ? 198  GLN A CA    1 
ATOM   1439  C C     . GLN A  1 198 ? 75.636  145.497 -116.413 1.00 39.19  ? 198  GLN A C     1 
ATOM   1440  O O     . GLN A  1 198 ? 75.570  145.811 -117.595 1.00 40.18  ? 198  GLN A O     1 
ATOM   1441  C CB    . GLN A  1 198 ? 75.973  146.964 -114.387 1.00 39.50  ? 198  GLN A CB    1 
ATOM   1442  C CG    . GLN A  1 198 ? 76.800  148.131 -114.925 1.00 39.78  ? 198  GLN A CG    1 
ATOM   1443  C CD    . GLN A  1 198 ? 77.937  147.699 -115.828 1.00 41.69  ? 198  GLN A CD    1 
ATOM   1444  O OE1   . GLN A  1 198 ? 78.562  146.653 -115.615 1.00 42.80  ? 198  GLN A OE1   1 
ATOM   1445  N NE2   . GLN A  1 198 ? 78.232  148.516 -116.833 1.00 42.32  ? 198  GLN A NE2   1 
ATOM   1446  N N     . ARG A  1 199 ? 76.272  144.408 -116.016 1.00 41.56  ? 199  ARG A N     1 
ATOM   1447  C CA    . ARG A  1 199 ? 76.968  143.562 -116.979 1.00 44.48  ? 199  ARG A CA    1 
ATOM   1448  C C     . ARG A  1 199 ? 76.055  143.097 -118.103 1.00 44.59  ? 199  ARG A C     1 
ATOM   1449  O O     . ARG A  1 199 ? 76.482  142.964 -119.250 1.00 43.25  ? 199  ARG A O     1 
ATOM   1450  C CB    . ARG A  1 199 ? 77.554  142.327 -116.284 1.00 47.23  ? 199  ARG A CB    1 
ATOM   1451  C CG    . ARG A  1 199 ? 78.683  142.616 -115.305 1.00 50.23  ? 199  ARG A CG    1 
ATOM   1452  C CD    . ARG A  1 199 ? 79.005  141.376 -114.497 1.00 51.90  ? 199  ARG A CD    1 
ATOM   1453  N NE    . ARG A  1 199 ? 80.121  141.565 -113.574 1.00 51.77  ? 199  ARG A NE    1 
ATOM   1454  C CZ    . ARG A  1 199 ? 80.462  140.675 -112.649 1.00 52.59  ? 199  ARG A CZ    1 
ATOM   1455  N NH1   . ARG A  1 199 ? 79.771  139.548 -112.524 1.00 51.14  ? 199  ARG A NH1   1 
ATOM   1456  N NH2   . ARG A  1 199 ? 81.499  140.901 -111.861 1.00 53.65  ? 199  ARG A NH2   1 
ATOM   1457  N N     . LEU A  1 200 ? 74.797  142.853 -117.762 1.00 45.05  ? 200  LEU A N     1 
ATOM   1458  C CA    . LEU A  1 200 ? 73.841  142.354 -118.728 1.00 46.24  ? 200  LEU A CA    1 
ATOM   1459  C C     . LEU A  1 200 ? 73.127  143.410 -119.573 1.00 47.73  ? 200  LEU A C     1 
ATOM   1460  O O     . LEU A  1 200 ? 72.117  143.116 -120.203 1.00 48.50  ? 200  LEU A O     1 
ATOM   1461  C CB    . LEU A  1 200 ? 72.817  141.471 -118.015 1.00 45.92  ? 200  LEU A CB    1 
ATOM   1462  C CG    . LEU A  1 200 ? 73.358  140.284 -117.203 1.00 45.63  ? 200  LEU A CG    1 
ATOM   1463  C CD1   . LEU A  1 200 ? 72.199  139.567 -116.529 1.00 44.84  ? 200  LEU A CD1   1 
ATOM   1464  C CD2   . LEU A  1 200 ? 74.114  139.326 -118.093 1.00 45.13  ? 200  LEU A CD2   1 
ATOM   1465  N N     . GLY A  1 201 ? 73.639  144.637 -119.587 1.00 48.39  ? 201  GLY A N     1 
ATOM   1466  C CA    . GLY A  1 201 ? 73.025  145.661 -120.418 1.00 48.42  ? 201  GLY A CA    1 
ATOM   1467  C C     . GLY A  1 201 ? 72.266  146.778 -119.731 1.00 48.57  ? 201  GLY A C     1 
ATOM   1468  O O     . GLY A  1 201 ? 72.018  147.811 -120.346 1.00 49.62  ? 201  GLY A O     1 
ATOM   1469  N N     . ALA A  1 202 ? 71.900  146.586 -118.469 1.00 48.10  ? 202  ALA A N     1 
ATOM   1470  C CA    . ALA A  1 202 ? 71.163  147.595 -117.716 1.00 46.93  ? 202  ALA A CA    1 
ATOM   1471  C C     . ALA A  1 202 ? 71.994  148.818 -117.290 1.00 46.62  ? 202  ALA A C     1 
ATOM   1472  O O     . ALA A  1 202 ? 73.153  148.689 -116.905 1.00 46.23  ? 202  ALA A O     1 
ATOM   1473  C CB    . ALA A  1 202 ? 70.532  146.952 -116.487 1.00 45.84  ? 202  ALA A CB    1 
ATOM   1474  N N     . ASP A  1 203 ? 71.376  149.999 -117.380 1.00 46.42  ? 203  ASP A N     1 
ATOM   1475  C CA    . ASP A  1 203 ? 71.976  151.273 -116.977 1.00 45.43  ? 203  ASP A CA    1 
ATOM   1476  C C     . ASP A  1 203 ? 71.725  151.303 -115.480 1.00 43.72  ? 203  ASP A C     1 
ATOM   1477  O O     . ASP A  1 203 ? 70.580  151.429 -115.030 1.00 42.24  ? 203  ASP A O     1 
ATOM   1478  C CB    . ASP A  1 203 ? 71.261  152.453 -117.651 1.00 47.77  ? 203  ASP A CB    1 
ATOM   1479  C CG    . ASP A  1 203 ? 71.916  153.787 -117.342 1.00 49.15  ? 203  ASP A CG    1 
ATOM   1480  O OD1   . ASP A  1 203 ? 71.881  154.224 -116.170 1.00 50.68  ? 203  ASP A OD1   1 
ATOM   1481  O OD2   . ASP A  1 203 ? 72.470  154.392 -118.279 1.00 51.27  ? 203  ASP A OD2   1 
ATOM   1482  N N     . VAL A  1 204 ? 72.796  151.205 -114.704 1.00 42.58  ? 204  VAL A N     1 
ATOM   1483  C CA    . VAL A  1 204 ? 72.639  151.129 -113.265 1.00 41.04  ? 204  VAL A CA    1 
ATOM   1484  C C     . VAL A  1 204 ? 73.234  152.255 -112.446 1.00 39.87  ? 204  VAL A C     1 
ATOM   1485  O O     . VAL A  1 204 ? 74.279  152.805 -112.782 1.00 40.66  ? 204  VAL A O     1 
ATOM   1486  C CB    . VAL A  1 204 ? 73.216  149.770 -112.756 1.00 41.42  ? 204  VAL A CB    1 
ATOM   1487  C CG1   . VAL A  1 204 ? 72.929  149.586 -111.275 1.00 40.68  ? 204  VAL A CG1   1 
ATOM   1488  C CG2   . VAL A  1 204 ? 72.623  148.619 -113.566 1.00 40.17  ? 204  VAL A CG2   1 
ATOM   1489  N N     . THR A  1 205 ? 72.539  152.587 -111.366 1.00 37.95  ? 205  THR A N     1 
ATOM   1490  C CA    . THR A  1 205 ? 72.983  153.605 -110.443 1.00 36.88  ? 205  THR A CA    1 
ATOM   1491  C C     . THR A  1 205 ? 72.589  153.258 -109.006 1.00 37.41  ? 205  THR A C     1 
ATOM   1492  O O     . THR A  1 205 ? 71.446  152.892 -108.710 1.00 32.80  ? 205  THR A O     1 
ATOM   1493  C CB    . THR A  1 205 ? 72.416  154.976 -110.785 1.00 35.82  ? 205  THR A CB    1 
ATOM   1494  O OG1   . THR A  1 205 ? 72.747  155.293 -112.142 1.00 37.63  ? 205  THR A OG1   1 
ATOM   1495  C CG2   . THR A  1 205 ? 72.998  156.029 -109.841 1.00 32.72  ? 205  THR A CG2   1 
ATOM   1496  N N     . ALA A  1 206 ? 73.575  153.367 -108.123 1.00 38.76  ? 206  ALA A N     1 
ATOM   1497  C CA    . ALA A  1 206 ? 73.369  153.090 -106.718 1.00 41.29  ? 206  ALA A CA    1 
ATOM   1498  C C     . ALA A  1 206 ? 73.469  154.405 -105.954 1.00 42.22  ? 206  ALA A C     1 
ATOM   1499  O O     . ALA A  1 206 ? 74.448  155.142 -106.090 1.00 42.93  ? 206  ALA A O     1 
ATOM   1500  C CB    . ALA A  1 206 ? 74.412  152.096 -106.214 1.00 40.20  ? 206  ALA A CB    1 
ATOM   1501  N N     . VAL A  1 207 ? 72.434  154.687 -105.169 1.00 43.30  ? 207  VAL A N     1 
ATOM   1502  C CA    . VAL A  1 207 ? 72.354  155.896 -104.372 1.00 44.76  ? 207  VAL A CA    1 
ATOM   1503  C C     . VAL A  1 207 ? 72.600  155.553 -102.923 1.00 44.83  ? 207  VAL A C     1 
ATOM   1504  O O     . VAL A  1 207 ? 71.739  154.970 -102.267 1.00 45.07  ? 207  VAL A O     1 
ATOM   1505  C CB    . VAL A  1 207 ? 70.971  156.529 -104.502 1.00 45.36  ? 207  VAL A CB    1 
ATOM   1506  C CG1   . VAL A  1 207 ? 70.846  157.730 -103.572 1.00 45.59  ? 207  VAL A CG1   1 
ATOM   1507  C CG2   . VAL A  1 207 ? 70.754  156.942 -105.934 1.00 45.42  ? 207  VAL A CG2   1 
ATOM   1508  N N     . GLU A  1 208 ? 73.781  155.925 -102.436 1.00 44.96  ? 208  GLU A N     1 
ATOM   1509  C CA    . GLU A  1 208 ? 74.184  155.658 -101.063 1.00 43.73  ? 208  GLU A CA    1 
ATOM   1510  C C     . GLU A  1 208 ? 74.154  156.912 -100.196 1.00 44.63  ? 208  GLU A C     1 
ATOM   1511  O O     . GLU A  1 208 ? 74.533  157.996 -100.621 1.00 44.69  ? 208  GLU A O     1 
ATOM   1512  C CB    . GLU A  1 208 ? 75.592  155.040 -101.046 1.00 42.97  ? 208  GLU A CB    1 
ATOM   1513  C CG    . GLU A  1 208 ? 76.215  154.869 -99.646  1.00 40.14  ? 208  GLU A CG    1 
ATOM   1514  C CD    . GLU A  1 208 ? 75.383  153.990 -98.718  1.00 37.70  ? 208  GLU A CD    1 
ATOM   1515  O OE1   . GLU A  1 208 ? 75.132  152.829 -99.088  1.00 35.42  ? 208  GLU A OE1   1 
ATOM   1516  O OE2   . GLU A  1 208 ? 74.984  154.459 -97.623  1.00 37.19  ? 208  GLU A OE2   1 
ATOM   1517  N N     . PHE A  1 209 ? 73.693  156.734 -98.967  1.00 46.21  ? 209  PHE A N     1 
ATOM   1518  C CA    . PHE A  1 209 ? 73.590  157.801 -97.980  1.00 46.79  ? 209  PHE A CA    1 
ATOM   1519  C C     . PHE A  1 209 ? 74.949  158.096 -97.337  1.00 46.10  ? 209  PHE A C     1 
ATOM   1520  O O     . PHE A  1 209 ? 75.190  159.188 -96.837  1.00 46.47  ? 209  PHE A O     1 
ATOM   1521  C CB    . PHE A  1 209 ? 72.597  157.367 -96.909  1.00 48.54  ? 209  PHE A CB    1 
ATOM   1522  C CG    . PHE A  1 209 ? 72.472  158.323 -95.779  1.00 50.32  ? 209  PHE A CG    1 
ATOM   1523  C CD1   . PHE A  1 209 ? 71.815  159.535 -95.954  1.00 51.62  ? 209  PHE A CD1   1 
ATOM   1524  C CD2   . PHE A  1 209 ? 72.997  158.012 -94.527  1.00 51.49  ? 209  PHE A CD2   1 
ATOM   1525  C CE1   . PHE A  1 209 ? 71.674  160.433 -94.895  1.00 51.96  ? 209  PHE A CE1   1 
ATOM   1526  C CE2   . PHE A  1 209 ? 72.866  158.896 -93.458  1.00 52.00  ? 209  PHE A CE2   1 
ATOM   1527  C CZ    . PHE A  1 209 ? 72.199  160.114 -93.643  1.00 52.11  ? 209  PHE A CZ    1 
ATOM   1528  N N     . LEU A  1 210 ? 75.825  157.097 -97.351  1.00 45.87  ? 210  LEU A N     1 
ATOM   1529  C CA    . LEU A  1 210 ? 77.163  157.197 -96.779  1.00 44.43  ? 210  LEU A CA    1 
ATOM   1530  C C     . LEU A  1 210 ? 78.129  157.613 -97.869  1.00 44.73  ? 210  LEU A C     1 
ATOM   1531  O O     . LEU A  1 210 ? 77.759  157.624 -99.041  1.00 44.74  ? 210  LEU A O     1 
ATOM   1532  C CB    . LEU A  1 210 ? 77.568  155.848 -96.200  1.00 43.85  ? 210  LEU A CB    1 
ATOM   1533  C CG    . LEU A  1 210 ? 76.728  155.433 -94.989  1.00 44.57  ? 210  LEU A CG    1 
ATOM   1534  C CD1   . LEU A  1 210 ? 76.924  153.951 -94.719  1.00 42.31  ? 210  LEU A CD1   1 
ATOM   1535  C CD2   . LEU A  1 210 ? 77.106  156.289 -93.768  1.00 43.19  ? 210  LEU A CD2   1 
ATOM   1536  N N     . GLY A  1 211 ? 79.360  157.955 -97.492  1.00 44.38  ? 211  GLY A N     1 
ATOM   1537  C CA    . GLY A  1 211 ? 80.344  158.398 -98.474  1.00 44.46  ? 211  GLY A CA    1 
ATOM   1538  C C     . GLY A  1 211 ? 81.155  157.337 -99.213  1.00 44.79  ? 211  GLY A C     1 
ATOM   1539  O O     . GLY A  1 211 ? 81.876  157.646 -100.162 1.00 45.56  ? 211  GLY A O     1 
ATOM   1540  N N     . HIS A  1 212 ? 81.064  156.086 -98.788  1.00 43.84  ? 212  HIS A N     1 
ATOM   1541  C CA    . HIS A  1 212 ? 81.799  155.039 -99.471  1.00 42.70  ? 212  HIS A CA    1 
ATOM   1542  C C     . HIS A  1 212 ? 80.828  153.969 -99.894  1.00 42.44  ? 212  HIS A C     1 
ATOM   1543  O O     . HIS A  1 212 ? 79.661  153.954 -99.503  1.00 41.33  ? 212  HIS A O     1 
ATOM   1544  C CB    . HIS A  1 212 ? 82.834  154.393 -98.554  1.00 42.93  ? 212  HIS A CB    1 
ATOM   1545  C CG    . HIS A  1 212 ? 82.221  153.722 -97.368  1.00 44.59  ? 212  HIS A CG    1 
ATOM   1546  N ND1   . HIS A  1 212 ? 81.638  154.440 -96.348  1.00 43.76  ? 212  HIS A ND1   1 
ATOM   1547  C CD2   . HIS A  1 212 ? 81.979  152.416 -97.095  1.00 44.12  ? 212  HIS A CD2   1 
ATOM   1548  C CE1   . HIS A  1 212 ? 81.059  153.610 -95.501  1.00 44.60  ? 212  HIS A CE1   1 
ATOM   1549  N NE2   . HIS A  1 212 ? 81.250  152.375 -95.931  1.00 46.13  ? 212  HIS A NE2   1 
ATOM   1550  N N     . VAL A  1 213 ? 81.346  153.048 -100.686 1.00 42.82  ? 213  VAL A N     1 
ATOM   1551  C CA    . VAL A  1 213 ? 80.571  151.928 -101.171 1.00 42.00  ? 213  VAL A CA    1 
ATOM   1552  C C     . VAL A  1 213 ? 81.165  150.661 -100.546 1.00 40.11  ? 213  VAL A C     1 
ATOM   1553  O O     . VAL A  1 213 ? 82.359  150.618 -100.231 1.00 38.28  ? 213  VAL A O     1 
ATOM   1554  C CB    . VAL A  1 213 ? 80.635  151.882 -102.714 1.00 41.50  ? 213  VAL A CB    1 
ATOM   1555  C CG1   . VAL A  1 213 ? 82.010  152.281 -103.164 1.00 43.34  ? 213  VAL A CG1   1 
ATOM   1556  C CG2   . VAL A  1 213 ? 80.307  150.506 -103.214 1.00 41.99  ? 213  VAL A CG2   1 
ATOM   1557  N N     . GLY A  1 214 ? 80.314  149.658 -100.329 1.00 39.36  ? 214  GLY A N     1 
ATOM   1558  C CA    . GLY A  1 214 ? 80.767  148.401 -99.762  1.00 38.59  ? 214  GLY A CA    1 
ATOM   1559  C C     . GLY A  1 214 ? 80.277  148.110 -98.364  1.00 38.50  ? 214  GLY A C     1 
ATOM   1560  O O     . GLY A  1 214 ? 80.553  147.041 -97.811  1.00 39.06  ? 214  GLY A O     1 
ATOM   1561  N N     . GLY A  1 215 ? 79.572  149.063 -97.771  1.00 38.43  ? 215  GLY A N     1 
ATOM   1562  C CA    . GLY A  1 215 ? 79.042  148.855 -96.436  1.00 39.12  ? 215  GLY A CA    1 
ATOM   1563  C C     . GLY A  1 215 ? 79.969  149.043 -95.241  1.00 40.51  ? 215  GLY A C     1 
ATOM   1564  O O     . GLY A  1 215 ? 81.015  149.691 -95.335  1.00 41.29  ? 215  GLY A O     1 
ATOM   1565  N N     . VAL A  1 216 ? 79.567  148.458 -94.111  1.00 40.19  ? 216  VAL A N     1 
ATOM   1566  C CA    . VAL A  1 216 ? 80.299  148.540 -92.840  1.00 39.77  ? 216  VAL A CA    1 
ATOM   1567  C C     . VAL A  1 216 ? 81.617  147.755 -92.812  1.00 40.27  ? 216  VAL A C     1 
ATOM   1568  O O     . VAL A  1 216 ? 81.707  146.670 -93.392  1.00 40.20  ? 216  VAL A O     1 
ATOM   1569  C CB    . VAL A  1 216 ? 79.406  148.024 -91.642  1.00 39.76  ? 216  VAL A CB    1 
ATOM   1570  C CG1   . VAL A  1 216 ? 80.196  148.065 -90.322  1.00 38.97  ? 216  VAL A CG1   1 
ATOM   1571  C CG2   . VAL A  1 216 ? 78.146  148.866 -91.511  1.00 36.87  ? 216  VAL A CG2   1 
ATOM   1572  N N     . GLY A  1 217 ? 82.631  148.322 -92.146  1.00 39.85  ? 217  GLY A N     1 
ATOM   1573  C CA    . GLY A  1 217 ? 83.917  147.654 -92.001  1.00 38.49  ? 217  GLY A CA    1 
ATOM   1574  C C     . GLY A  1 217 ? 84.926  147.600 -93.138  1.00 38.10  ? 217  GLY A C     1 
ATOM   1575  O O     . GLY A  1 217 ? 86.111  147.367 -92.884  1.00 38.34  ? 217  GLY A O     1 
ATOM   1576  N N     . ILE A  1 218 ? 84.487  147.780 -94.380  1.00 36.23  ? 218  ILE A N     1 
ATOM   1577  C CA    . ILE A  1 218 ? 85.415  147.749 -95.506  1.00 36.08  ? 218  ILE A CA    1 
ATOM   1578  C C     . ILE A  1 218 ? 86.474  148.830 -95.292  1.00 35.87  ? 218  ILE A C     1 
ATOM   1579  O O     . ILE A  1 218 ? 86.189  149.880 -94.718  1.00 37.14  ? 218  ILE A O     1 
ATOM   1580  C CB    . ILE A  1 218 ? 84.683  148.015 -96.866  1.00 36.57  ? 218  ILE A CB    1 
ATOM   1581  C CG1   . ILE A  1 218 ? 85.626  147.716 -98.035  1.00 36.63  ? 218  ILE A CG1   1 
ATOM   1582  C CG2   . ILE A  1 218 ? 84.193  149.483 -96.957  1.00 34.79  ? 218  ILE A CG2   1 
ATOM   1583  C CD1   . ILE A  1 218 ? 85.000  147.925 -99.399  1.00 36.58  ? 218  ILE A CD1   1 
ATOM   1584  N N     . ASP A  1 219 ? 87.696  148.568 -95.727  1.00 34.97  ? 219  ASP A N     1 
ATOM   1585  C CA    . ASP A  1 219 ? 88.749  149.555 -95.593  1.00 35.64  ? 219  ASP A CA    1 
ATOM   1586  C C     . ASP A  1 219 ? 88.482  150.687 -96.581  1.00 35.80  ? 219  ASP A C     1 
ATOM   1587  O O     . ASP A  1 219 ? 88.222  150.440 -97.762  1.00 34.16  ? 219  ASP A O     1 
ATOM   1588  C CB    . ASP A  1 219 ? 90.105  148.943 -95.901  1.00 35.27  ? 219  ASP A CB    1 
ATOM   1589  C CG    . ASP A  1 219 ? 91.222  149.925 -95.714  1.00 35.43  ? 219  ASP A CG    1 
ATOM   1590  O OD1   . ASP A  1 219 ? 91.488  150.298 -94.551  1.00 34.86  ? 219  ASP A OD1   1 
ATOM   1591  O OD2   . ASP A  1 219 ? 91.815  150.330 -96.732  1.00 34.84  ? 219  ASP A OD2   1 
ATOM   1592  N N     . MET A  1 220 ? 88.574  151.924 -96.101  1.00 36.12  ? 220  MET A N     1 
ATOM   1593  C CA    . MET A  1 220 ? 88.308  153.073 -96.953  1.00 37.93  ? 220  MET A CA    1 
ATOM   1594  C C     . MET A  1 220 ? 89.127  153.126 -98.234  1.00 37.91  ? 220  MET A C     1 
ATOM   1595  O O     . MET A  1 220 ? 88.576  153.379 -99.309  1.00 39.04  ? 220  MET A O     1 
ATOM   1596  C CB    . MET A  1 220 ? 88.492  154.368 -96.170  1.00 38.92  ? 220  MET A CB    1 
ATOM   1597  C CG    . MET A  1 220 ? 87.385  154.657 -95.155  1.00 40.46  ? 220  MET A CG    1 
ATOM   1598  S SD    . MET A  1 220 ? 85.708  154.739 -95.863  1.00 44.28  ? 220  MET A SD    1 
ATOM   1599  C CE    . MET A  1 220 ? 85.019  153.091 -95.416  1.00 39.67  ? 220  MET A CE    1 
ATOM   1600  N N     . GLU A  1 221 ? 90.434  152.892 -98.146  1.00 37.36  ? 221  GLU A N     1 
ATOM   1601  C CA    . GLU A  1 221 ? 91.228  152.946 -99.361  1.00 37.75  ? 221  GLU A CA    1 
ATOM   1602  C C     . GLU A  1 221 ? 90.719  151.929 -100.379 1.00 37.91  ? 221  GLU A C     1 
ATOM   1603  O O     . GLU A  1 221 ? 90.496  152.263 -101.541 1.00 37.84  ? 221  GLU A O     1 
ATOM   1604  C CB    . GLU A  1 221 ? 92.706  152.693 -99.089  1.00 37.62  ? 221  GLU A CB    1 
ATOM   1605  C CG    . GLU A  1 221 ? 93.542  153.098 -100.295 1.00 39.46  ? 221  GLU A CG    1 
ATOM   1606  C CD    . GLU A  1 221 ? 94.993  152.742 -100.166 1.00 40.99  ? 221  GLU A CD    1 
ATOM   1607  O OE1   . GLU A  1 221 ? 95.427  152.434 -99.038  1.00 43.57  ? 221  GLU A OE1   1 
ATOM   1608  O OE2   . GLU A  1 221 ? 95.702  152.777 -101.196 1.00 41.95  ? 221  GLU A OE2   1 
ATOM   1609  N N     . ILE A  1 222 ? 90.539  150.690 -99.928  1.00 37.06  ? 222  ILE A N     1 
ATOM   1610  C CA    . ILE A  1 222 ? 90.038  149.625 -100.782 1.00 36.17  ? 222  ILE A CA    1 
ATOM   1611  C C     . ILE A  1 222 ? 88.705  150.050 -101.411 1.00 36.74  ? 222  ILE A C     1 
ATOM   1612  O O     . ILE A  1 222 ? 88.483  149.881 -102.610 1.00 36.12  ? 222  ILE A O     1 
ATOM   1613  C CB    . ILE A  1 222 ? 89.792  148.320 -99.968  1.00 34.98  ? 222  ILE A CB    1 
ATOM   1614  C CG1   . ILE A  1 222 ? 91.080  147.814 -99.344  1.00 32.35  ? 222  ILE A CG1   1 
ATOM   1615  C CG2   . ILE A  1 222 ? 89.261  147.239 -100.878 1.00 33.77  ? 222  ILE A CG2   1 
ATOM   1616  C CD1   . ILE A  1 222 ? 92.026  147.290 -100.368 1.00 33.47  ? 222  ILE A CD1   1 
ATOM   1617  N N     . SER A  1 223 ? 87.824  150.601 -100.583 1.00 37.63  ? 223  SER A N     1 
ATOM   1618  C CA    . SER A  1 223 ? 86.504  151.018 -101.033 1.00 39.12  ? 223  SER A CA    1 
ATOM   1619  C C     . SER A  1 223 ? 86.546  152.065 -102.141 1.00 40.56  ? 223  SER A C     1 
ATOM   1620  O O     . SER A  1 223 ? 85.781  151.987 -103.102 1.00 40.98  ? 223  SER A O     1 
ATOM   1621  C CB    . SER A  1 223 ? 85.688  151.546 -99.848  1.00 38.44  ? 223  SER A CB    1 
ATOM   1622  O OG    . SER A  1 223 ? 84.425  152.030 -100.274 1.00 39.15  ? 223  SER A OG    1 
ATOM   1623  N N     . LYS A  1 224 ? 87.430  153.051 -102.016 1.00 41.93  ? 224  LYS A N     1 
ATOM   1624  C CA    . LYS A  1 224 ? 87.504  154.084 -103.043 1.00 43.08  ? 224  LYS A CA    1 
ATOM   1625  C C     . LYS A  1 224 ? 88.125  153.501 -104.306 1.00 41.11  ? 224  LYS A C     1 
ATOM   1626  O O     . LYS A  1 224 ? 87.640  153.773 -105.402 1.00 41.25  ? 224  LYS A O     1 
ATOM   1627  C CB    . LYS A  1 224 ? 88.299  155.297 -102.553 1.00 46.62  ? 224  LYS A CB    1 
ATOM   1628  C CG    . LYS A  1 224 ? 87.693  156.009 -101.330 1.00 52.74  ? 224  LYS A CG    1 
ATOM   1629  C CD    . LYS A  1 224 ? 86.178  156.363 -101.485 1.00 58.71  ? 224  LYS A CD    1 
ATOM   1630  C CE    . LYS A  1 224 ? 85.871  157.480 -102.517 1.00 61.14  ? 224  LYS A CE    1 
ATOM   1631  N NZ    . LYS A  1 224 ? 86.294  158.856 -102.070 1.00 64.15  ? 224  LYS A NZ    1 
ATOM   1632  N N     . ASN A  1 225 ? 89.178  152.702 -104.169 1.00 39.28  ? 225  ASN A N     1 
ATOM   1633  C CA    . ASN A  1 225 ? 89.778  152.090 -105.339 1.00 39.05  ? 225  ASN A CA    1 
ATOM   1634  C C     . ASN A  1 225 ? 88.841  151.112 -106.037 1.00 38.58  ? 225  ASN A C     1 
ATOM   1635  O O     . ASN A  1 225 ? 88.918  150.907 -107.238 1.00 37.39  ? 225  ASN A O     1 
ATOM   1636  C CB    . ASN A  1 225 ? 91.065  151.368 -104.946 1.00 40.94  ? 225  ASN A CB    1 
ATOM   1637  C CG    . ASN A  1 225 ? 92.182  152.318 -104.571 1.00 44.08  ? 225  ASN A CG    1 
ATOM   1638  O OD1   . ASN A  1 225 ? 92.016  153.538 -104.527 1.00 46.40  ? 225  ASN A OD1   1 
ATOM   1639  N ND2   . ASN A  1 225 ? 93.345  151.743 -104.284 1.00 45.05  ? 225  ASN A ND2   1 
ATOM   1640  N N     . PHE A  1 226 ? 87.963  150.509 -105.246 1.00 38.60  ? 226  PHE A N     1 
ATOM   1641  C CA    . PHE A  1 226 ? 86.978  149.561 -105.746 1.00 37.11  ? 226  PHE A CA    1 
ATOM   1642  C C     . PHE A  1 226 ? 85.910  150.319 -106.515 1.00 38.59  ? 226  PHE A C     1 
ATOM   1643  O O     . PHE A  1 226 ? 85.491  149.914 -107.600 1.00 38.53  ? 226  PHE A O     1 
ATOM   1644  C CB    . PHE A  1 226 ? 86.356  148.799 -104.560 1.00 33.46  ? 226  PHE A CB    1 
ATOM   1645  C CG    . PHE A  1 226 ? 85.213  147.874 -104.921 1.00 31.10  ? 226  PHE A CG    1 
ATOM   1646  C CD1   . PHE A  1 226 ? 85.358  146.892 -105.893 1.00 29.98  ? 226  PHE A CD1   1 
ATOM   1647  C CD2   . PHE A  1 226 ? 84.011  147.942 -104.224 1.00 29.31  ? 226  PHE A CD2   1 
ATOM   1648  C CE1   . PHE A  1 226 ? 84.315  145.989 -106.156 1.00 29.86  ? 226  PHE A CE1   1 
ATOM   1649  C CE2   . PHE A  1 226 ? 82.967  147.044 -104.482 1.00 28.97  ? 226  PHE A CE2   1 
ATOM   1650  C CZ    . PHE A  1 226 ? 83.115  146.074 -105.439 1.00 27.69  ? 226  PHE A CZ    1 
ATOM   1651  N N     . GLN A  1 227 ? 85.488  151.435 -105.935 1.00 40.05  ? 227  GLN A N     1 
ATOM   1652  C CA    . GLN A  1 227 ? 84.462  152.279 -106.527 1.00 41.11  ? 227  GLN A CA    1 
ATOM   1653  C C     . GLN A  1 227 ? 84.950  152.769 -107.865 1.00 41.81  ? 227  GLN A C     1 
ATOM   1654  O O     . GLN A  1 227 ? 84.235  152.712 -108.866 1.00 42.80  ? 227  GLN A O     1 
ATOM   1655  C CB    . GLN A  1 227 ? 84.189  153.476 -105.630 1.00 43.31  ? 227  GLN A CB    1 
ATOM   1656  C CG    . GLN A  1 227 ? 82.923  154.228 -105.957 1.00 45.33  ? 227  GLN A CG    1 
ATOM   1657  C CD    . GLN A  1 227 ? 82.852  155.558 -105.242 1.00 46.73  ? 227  GLN A CD    1 
ATOM   1658  O OE1   . GLN A  1 227 ? 83.240  155.670 -104.078 1.00 49.26  ? 227  GLN A OE1   1 
ATOM   1659  N NE2   . GLN A  1 227 ? 82.344  156.574 -105.930 1.00 47.83  ? 227  GLN A NE2   1 
ATOM   1660  N N     . ARG A  1 228 ? 86.182  153.254 -107.873 1.00 41.85  ? 228  ARG A N     1 
ATOM   1661  C CA    . ARG A  1 228 ? 86.791  153.755 -109.085 1.00 43.38  ? 228  ARG A CA    1 
ATOM   1662  C C     . ARG A  1 228 ? 86.699  152.707 -110.178 1.00 42.46  ? 228  ARG A C     1 
ATOM   1663  O O     . ARG A  1 228 ? 86.267  153.008 -111.288 1.00 44.12  ? 228  ARG A O     1 
ATOM   1664  C CB    . ARG A  1 228 ? 88.247  154.113 -108.806 1.00 47.64  ? 228  ARG A CB    1 
ATOM   1665  C CG    . ARG A  1 228 ? 89.053  154.665 -109.970 1.00 54.35  ? 228  ARG A CG    1 
ATOM   1666  C CD    . ARG A  1 228 ? 90.421  155.129 -109.441 1.00 59.91  ? 228  ARG A CD    1 
ATOM   1667  N NE    . ARG A  1 228 ? 90.262  156.015 -108.277 1.00 65.00  ? 228  ARG A NE    1 
ATOM   1668  C CZ    . ARG A  1 228 ? 90.956  155.922 -107.138 1.00 66.22  ? 228  ARG A CZ    1 
ATOM   1669  N NH1   . ARG A  1 228 ? 91.877  154.974 -106.985 1.00 66.45  ? 228  ARG A NH1   1 
ATOM   1670  N NH2   . ARG A  1 228 ? 90.728  156.782 -106.146 1.00 65.58  ? 228  ARG A NH2   1 
ATOM   1671  N N     . ILE A  1 229 ? 87.071  151.470 -109.865 1.00 40.43  ? 229  ILE A N     1 
ATOM   1672  C CA    . ILE A  1 229 ? 87.038  150.412 -110.867 1.00 39.92  ? 229  ILE A CA    1 
ATOM   1673  C C     . ILE A  1 229 ? 85.631  150.099 -111.357 1.00 39.67  ? 229  ILE A C     1 
ATOM   1674  O O     . ILE A  1 229 ? 85.427  149.817 -112.536 1.00 37.35  ? 229  ILE A O     1 
ATOM   1675  C CB    . ILE A  1 229 ? 87.676  149.119 -110.340 1.00 39.55  ? 229  ILE A CB    1 
ATOM   1676  C CG1   . ILE A  1 229 ? 89.102  149.400 -109.868 1.00 38.21  ? 229  ILE A CG1   1 
ATOM   1677  C CG2   . ILE A  1 229 ? 87.695  148.063 -111.439 1.00 37.18  ? 229  ILE A CG2   1 
ATOM   1678  C CD1   . ILE A  1 229 ? 89.738  148.238 -109.122 1.00 39.17  ? 229  ILE A CD1   1 
ATOM   1679  N N     . LEU A  1 230 ? 84.672  150.145 -110.439 1.00 40.43  ? 230  LEU A N     1 
ATOM   1680  C CA    . LEU A  1 230 ? 83.282  149.878 -110.769 1.00 42.69  ? 230  LEU A CA    1 
ATOM   1681  C C     . LEU A  1 230 ? 82.696  150.982 -111.641 1.00 44.14  ? 230  LEU A C     1 
ATOM   1682  O O     . LEU A  1 230 ? 81.899  150.707 -112.539 1.00 44.59  ? 230  LEU A O     1 
ATOM   1683  C CB    . LEU A  1 230 ? 82.445  149.752 -109.497 1.00 42.13  ? 230  LEU A CB    1 
ATOM   1684  C CG    . LEU A  1 230 ? 82.647  148.490 -108.662 1.00 43.02  ? 230  LEU A CG    1 
ATOM   1685  C CD1   . LEU A  1 230 ? 81.885  148.589 -107.336 1.00 42.84  ? 230  LEU A CD1   1 
ATOM   1686  C CD2   . LEU A  1 230 ? 82.180  147.290 -109.466 1.00 41.87  ? 230  LEU A CD2   1 
ATOM   1687  N N     . GLN A  1 231 ? 83.070  152.232 -111.373 1.00 44.83  ? 231  GLN A N     1 
ATOM   1688  C CA    . GLN A  1 231 ? 82.545  153.328 -112.167 1.00 44.52  ? 231  GLN A CA    1 
ATOM   1689  C C     . GLN A  1 231 ? 83.133  153.267 -113.550 1.00 44.85  ? 231  GLN A C     1 
ATOM   1690  O O     . GLN A  1 231 ? 82.452  153.569 -114.520 1.00 45.26  ? 231  GLN A O     1 
ATOM   1691  C CB    . GLN A  1 231 ? 82.832  154.670 -111.501 1.00 44.04  ? 231  GLN A CB    1 
ATOM   1692  C CG    . GLN A  1 231 ? 81.949  154.892 -110.290 1.00 44.93  ? 231  GLN A CG    1 
ATOM   1693  C CD    . GLN A  1 231 ? 82.312  156.134 -109.518 1.00 46.08  ? 231  GLN A CD    1 
ATOM   1694  O OE1   . GLN A  1 231 ? 81.595  156.555 -108.597 1.00 44.33  ? 231  GLN A OE1   1 
ATOM   1695  N NE2   . GLN A  1 231 ? 83.437  156.731 -109.880 1.00 46.54  ? 231  GLN A NE2   1 
ATOM   1696  N N     . LYS A  1 232 ? 84.386  152.844 -113.647 1.00 44.82  ? 232  LYS A N     1 
ATOM   1697  C CA    . LYS A  1 232 ? 85.036  152.731 -114.942 1.00 46.34  ? 232  LYS A CA    1 
ATOM   1698  C C     . LYS A  1 232 ? 84.385  151.590 -115.763 1.00 45.45  ? 232  LYS A C     1 
ATOM   1699  O O     . LYS A  1 232 ? 84.661  151.407 -116.950 1.00 45.98  ? 232  LYS A O     1 
ATOM   1700  C CB    . LYS A  1 232 ? 86.543  152.498 -114.724 1.00 48.61  ? 232  LYS A CB    1 
ATOM   1701  C CG    . LYS A  1 232 ? 87.424  152.587 -115.972 1.00 52.02  ? 232  LYS A CG    1 
ATOM   1702  C CD    . LYS A  1 232 ? 87.476  151.260 -116.742 1.00 55.54  ? 232  LYS A CD    1 
ATOM   1703  C CE    . LYS A  1 232 ? 88.420  151.340 -117.957 1.00 59.02  ? 232  LYS A CE    1 
ATOM   1704  N NZ    . LYS A  1 232 ? 88.646  150.022 -118.648 1.00 59.02  ? 232  LYS A NZ    1 
ATOM   1705  N N     . GLN A  1 233 ? 83.505  150.835 -115.120 1.00 44.72  ? 233  GLN A N     1 
ATOM   1706  C CA    . GLN A  1 233 ? 82.802  149.727 -115.770 1.00 43.92  ? 233  GLN A CA    1 
ATOM   1707  C C     . GLN A  1 233 ? 81.404  150.150 -116.206 1.00 42.64  ? 233  GLN A C     1 
ATOM   1708  O O     . GLN A  1 233 ? 80.772  149.463 -116.997 1.00 41.70  ? 233  GLN A O     1 
ATOM   1709  C CB    . GLN A  1 233 ? 82.658  148.512 -114.822 1.00 44.21  ? 233  GLN A CB    1 
ATOM   1710  C CG    . GLN A  1 233 ? 83.961  147.860 -114.373 1.00 43.74  ? 233  GLN A CG    1 
ATOM   1711  C CD    . GLN A  1 233 ? 83.753  146.552 -113.622 1.00 42.14  ? 233  GLN A CD    1 
ATOM   1712  O OE1   . GLN A  1 233 ? 82.851  146.425 -112.799 1.00 41.83  ? 233  GLN A OE1   1 
ATOM   1713  N NE2   . GLN A  1 233 ? 84.606  145.584 -113.894 1.00 41.92  ? 233  GLN A NE2   1 
ATOM   1714  N N     . GLY A  1 234 ? 80.917  151.263 -115.665 1.00 42.31  ? 234  GLY A N     1 
ATOM   1715  C CA    . GLY A  1 234 ? 79.593  151.736 -116.016 1.00 41.36  ? 234  GLY A CA    1 
ATOM   1716  C C     . GLY A  1 234 ? 78.685  151.849 -114.815 1.00 42.19  ? 234  GLY A C     1 
ATOM   1717  O O     . GLY A  1 234 ? 77.657  152.497 -114.874 1.00 44.28  ? 234  GLY A O     1 
ATOM   1718  N N     . PHE A  1 235 ? 79.051  151.202 -113.721 1.00 42.61  ? 235  PHE A N     1 
ATOM   1719  C CA    . PHE A  1 235 ? 78.248  151.249 -112.507 1.00 42.94  ? 235  PHE A CA    1 
ATOM   1720  C C     . PHE A  1 235 ? 78.369  152.682 -111.984 1.00 43.64  ? 235  PHE A C     1 
ATOM   1721  O O     . PHE A  1 235 ? 79.459  153.136 -111.658 1.00 45.13  ? 235  PHE A O     1 
ATOM   1722  C CB    . PHE A  1 235 ? 78.820  150.254 -111.484 1.00 43.77  ? 235  PHE A CB    1 
ATOM   1723  C CG    . PHE A  1 235 ? 77.847  149.833 -110.402 1.00 44.61  ? 235  PHE A CG    1 
ATOM   1724  C CD1   . PHE A  1 235 ? 76.917  150.724 -109.875 1.00 43.38  ? 235  PHE A CD1   1 
ATOM   1725  C CD2   . PHE A  1 235 ? 77.904  148.541 -109.872 1.00 45.32  ? 235  PHE A CD2   1 
ATOM   1726  C CE1   . PHE A  1 235 ? 76.066  150.337 -108.845 1.00 43.18  ? 235  PHE A CE1   1 
ATOM   1727  C CE2   . PHE A  1 235 ? 77.053  148.144 -108.836 1.00 43.15  ? 235  PHE A CE2   1 
ATOM   1728  C CZ    . PHE A  1 235 ? 76.134  149.044 -108.324 1.00 43.42  ? 235  PHE A CZ    1 
ATOM   1729  N N     . LYS A  1 236 ? 77.265  153.406 -111.899 1.00 44.16  ? 236  LYS A N     1 
ATOM   1730  C CA    . LYS A  1 236 ? 77.336  154.780 -111.422 1.00 44.56  ? 236  LYS A CA    1 
ATOM   1731  C C     . LYS A  1 236 ? 76.911  154.851 -109.965 1.00 44.12  ? 236  LYS A C     1 
ATOM   1732  O O     . LYS A  1 236 ? 76.047  154.089 -109.520 1.00 42.58  ? 236  LYS A O     1 
ATOM   1733  C CB    . LYS A  1 236 ? 76.442  155.687 -112.286 1.00 45.68  ? 236  LYS A CB    1 
ATOM   1734  C CG    . LYS A  1 236 ? 76.637  155.493 -113.797 1.00 47.14  ? 236  LYS A CG    1 
ATOM   1735  C CD    . LYS A  1 236 ? 75.429  155.939 -114.606 1.00 46.91  ? 236  LYS A CD    1 
ATOM   1736  C CE    . LYS A  1 236 ? 75.270  155.068 -115.860 1.00 50.38  ? 236  LYS A CE    1 
ATOM   1737  N NZ    . LYS A  1 236 ? 76.506  154.933 -116.728 1.00 50.41  ? 236  LYS A NZ    1 
ATOM   1738  N N     . PHE A  1 237 ? 77.527  155.772 -109.227 1.00 44.10  ? 237  PHE A N     1 
ATOM   1739  C CA    . PHE A  1 237 ? 77.210  155.961 -107.816 1.00 45.02  ? 237  PHE A CA    1 
ATOM   1740  C C     . PHE A  1 237 ? 76.844  157.401 -107.484 1.00 46.58  ? 237  PHE A C     1 
ATOM   1741  O O     . PHE A  1 237 ? 77.390  158.355 -108.042 1.00 48.97  ? 237  PHE A O     1 
ATOM   1742  C CB    . PHE A  1 237 ? 78.395  155.541 -106.929 1.00 43.43  ? 237  PHE A CB    1 
ATOM   1743  C CG    . PHE A  1 237 ? 78.689  154.069 -106.962 1.00 39.32  ? 237  PHE A CG    1 
ATOM   1744  C CD1   . PHE A  1 237 ? 77.922  153.175 -106.215 1.00 37.73  ? 237  PHE A CD1   1 
ATOM   1745  C CD2   . PHE A  1 237 ? 79.721  153.575 -107.759 1.00 38.08  ? 237  PHE A CD2   1 
ATOM   1746  C CE1   . PHE A  1 237 ? 78.179  151.806 -106.259 1.00 34.44  ? 237  PHE A CE1   1 
ATOM   1747  C CE2   . PHE A  1 237 ? 79.991  152.206 -107.817 1.00 36.45  ? 237  PHE A CE2   1 
ATOM   1748  C CZ    . PHE A  1 237 ? 79.214  151.321 -107.060 1.00 35.76  ? 237  PHE A CZ    1 
ATOM   1749  N N     . LYS A  1 238 ? 75.888  157.529 -106.579 1.00 46.65  ? 238  LYS A N     1 
ATOM   1750  C CA    . LYS A  1 238 ? 75.432  158.801 -106.079 1.00 45.49  ? 238  LYS A CA    1 
ATOM   1751  C C     . LYS A  1 238 ? 75.573  158.618 -104.581 1.00 45.12  ? 238  LYS A C     1 
ATOM   1752  O O     . LYS A  1 238 ? 74.632  158.230 -103.891 1.00 42.93  ? 238  LYS A O     1 
ATOM   1753  C CB    . LYS A  1 238 ? 73.976  159.055 -106.462 1.00 45.79  ? 238  LYS A CB    1 
ATOM   1754  C CG    . LYS A  1 238 ? 73.829  159.899 -107.716 1.00 46.95  ? 238  LYS A CG    1 
ATOM   1755  C CD    . LYS A  1 238 ? 72.369  160.107 -108.107 1.00 47.45  ? 238  LYS A CD    1 
ATOM   1756  C CE    . LYS A  1 238 ? 72.245  160.942 -109.393 1.00 48.13  ? 238  LYS A CE    1 
ATOM   1757  N NZ    . LYS A  1 238 ? 72.717  162.351 -109.221 1.00 48.13  ? 238  LYS A NZ    1 
ATOM   1758  N N     . LEU A  1 239 ? 76.791  158.843 -104.102 1.00 45.26  ? 239  LEU A N     1 
ATOM   1759  C CA    . LEU A  1 239 ? 77.085  158.720 -102.685 1.00 46.01  ? 239  LEU A CA    1 
ATOM   1760  C C     . LEU A  1 239 ? 76.590  159.963 -101.952 1.00 46.56  ? 239  LEU A C     1 
ATOM   1761  O O     . LEU A  1 239 ? 76.217  160.955 -102.574 1.00 47.08  ? 239  LEU A O     1 
ATOM   1762  C CB    . LEU A  1 239 ? 78.594  158.570 -102.465 1.00 44.13  ? 239  LEU A CB    1 
ATOM   1763  C CG    . LEU A  1 239 ? 79.311  157.469 -103.239 1.00 44.25  ? 239  LEU A CG    1 
ATOM   1764  C CD1   . LEU A  1 239 ? 80.745  157.357 -102.753 1.00 44.01  ? 239  LEU A CD1   1 
ATOM   1765  C CD2   . LEU A  1 239 ? 78.595  156.156 -103.031 1.00 42.75  ? 239  LEU A CD2   1 
ATOM   1766  N N     . ASN A  1 240 ? 76.580  159.890 -100.626 1.00 47.59  ? 240  ASN A N     1 
ATOM   1767  C CA    . ASN A  1 240 ? 76.164  161.007 -99.789  1.00 48.69  ? 240  ASN A CA    1 
ATOM   1768  C C     . ASN A  1 240 ? 74.820  161.575 -100.227 1.00 48.89  ? 240  ASN A C     1 
ATOM   1769  O O     . ASN A  1 240 ? 74.593  162.781 -100.180 1.00 48.47  ? 240  ASN A O     1 
ATOM   1770  C CB    . ASN A  1 240 ? 77.248  162.073 -99.850  1.00 48.73  ? 240  ASN A CB    1 
ATOM   1771  C CG    . ASN A  1 240 ? 78.594  161.541 -99.404  1.00 48.99  ? 240  ASN A CG    1 
ATOM   1772  O OD1   . ASN A  1 240 ? 78.810  161.314 -98.217  1.00 49.46  ? 240  ASN A OD1   1 
ATOM   1773  N ND2   . ASN A  1 240 ? 79.499  161.319 -100.356 1.00 48.04  ? 240  ASN A ND2   1 
ATOM   1774  N N     . THR A  1 241 ? 73.934  160.675 -100.639 1.00 49.84  ? 241  THR A N     1 
ATOM   1775  C CA    . THR A  1 241 ? 72.604  161.014 -101.131 1.00 49.93  ? 241  THR A CA    1 
ATOM   1776  C C     . THR A  1 241 ? 71.588  160.072 -100.505 1.00 50.34  ? 241  THR A C     1 
ATOM   1777  O O     . THR A  1 241 ? 71.789  158.857 -100.487 1.00 49.61  ? 241  THR A O     1 
ATOM   1778  C CB    . THR A  1 241 ? 72.535  160.856 -102.676 1.00 49.87  ? 241  THR A CB    1 
ATOM   1779  O OG1   . THR A  1 241 ? 73.510  161.707 -103.292 1.00 48.59  ? 241  THR A OG1   1 
ATOM   1780  C CG2   . THR A  1 241 ? 71.141  161.200 -103.200 1.00 48.59  ? 241  THR A CG2   1 
ATOM   1781  N N     . LYS A  1 242 ? 70.501  160.645 -99.999  1.00 51.80  ? 242  LYS A N     1 
ATOM   1782  C CA    . LYS A  1 242 ? 69.425  159.888 -99.363  1.00 53.93  ? 242  LYS A CA    1 
ATOM   1783  C C     . LYS A  1 242 ? 68.237  159.694 -100.304 1.00 53.61  ? 242  LYS A C     1 
ATOM   1784  O O     . LYS A  1 242 ? 67.837  160.627 -100.987 1.00 54.16  ? 242  LYS A O     1 
ATOM   1785  C CB    . LYS A  1 242 ? 68.930  160.624 -98.107  1.00 55.43  ? 242  LYS A CB    1 
ATOM   1786  C CG    . LYS A  1 242 ? 67.804  159.899 -97.381  1.00 58.31  ? 242  LYS A CG    1 
ATOM   1787  C CD    . LYS A  1 242 ? 66.773  160.839 -96.742  1.00 61.74  ? 242  LYS A CD    1 
ATOM   1788  C CE    . LYS A  1 242 ? 67.344  161.707 -95.613  1.00 63.86  ? 242  LYS A CE    1 
ATOM   1789  N NZ    . LYS A  1 242 ? 67.934  163.010 -96.080  1.00 64.35  ? 242  LYS A NZ    1 
ATOM   1790  N N     . VAL A  1 243 ? 67.688  158.483 -100.345 1.00 54.18  ? 243  VAL A N     1 
ATOM   1791  C CA    . VAL A  1 243 ? 66.509  158.188 -101.160 1.00 55.40  ? 243  VAL A CA    1 
ATOM   1792  C C     . VAL A  1 243 ? 65.339  158.437 -100.212 1.00 55.94  ? 243  VAL A C     1 
ATOM   1793  O O     . VAL A  1 243 ? 65.148  157.694 -99.259  1.00 57.24  ? 243  VAL A O     1 
ATOM   1794  C CB    . VAL A  1 243 ? 66.453  156.701 -101.627 1.00 55.43  ? 243  VAL A CB    1 
ATOM   1795  C CG1   . VAL A  1 243 ? 65.120  156.420 -102.291 1.00 55.53  ? 243  VAL A CG1   1 
ATOM   1796  C CG2   . VAL A  1 243 ? 67.576  156.402 -102.610 1.00 56.15  ? 243  VAL A CG2   1 
ATOM   1797  N N     . THR A  1 244 ? 64.562  159.482 -100.464 1.00 56.47  ? 244  THR A N     1 
ATOM   1798  C CA    . THR A  1 244 ? 63.445  159.829 -99.588  1.00 56.40  ? 244  THR A CA    1 
ATOM   1799  C C     . THR A  1 244 ? 62.167  159.044 -99.840  1.00 56.93  ? 244  THR A C     1 
ATOM   1800  O O     . THR A  1 244 ? 61.381  158.816 -98.920  1.00 56.47  ? 244  THR A O     1 
ATOM   1801  C CB    . THR A  1 244 ? 63.111  161.319 -99.701  1.00 56.31  ? 244  THR A CB    1 
ATOM   1802  O OG1   . THR A  1 244 ? 62.628  161.598 -101.019 1.00 55.66  ? 244  THR A OG1   1 
ATOM   1803  C CG2   . THR A  1 244 ? 64.358  162.159 -99.440  1.00 56.48  ? 244  THR A CG2   1 
ATOM   1804  N N     . GLY A  1 245 ? 61.952  158.635 -101.085 1.00 57.05  ? 245  GLY A N     1 
ATOM   1805  C CA    . GLY A  1 245 ? 60.748  157.894 -101.396 1.00 57.71  ? 245  GLY A CA    1 
ATOM   1806  C C     . GLY A  1 245 ? 60.641  157.566 -102.864 1.00 58.48  ? 245  GLY A C     1 
ATOM   1807  O O     . GLY A  1 245 ? 61.469  157.999 -103.671 1.00 57.60  ? 245  GLY A O     1 
ATOM   1808  N N     . ALA A  1 246 ? 59.619  156.793 -103.211 1.00 59.55  ? 246  ALA A N     1 
ATOM   1809  C CA    . ALA A  1 246 ? 59.417  156.402 -104.596 1.00 61.23  ? 246  ALA A CA    1 
ATOM   1810  C C     . ALA A  1 246 ? 57.953  156.184 -104.894 1.00 62.73  ? 246  ALA A C     1 
ATOM   1811  O O     . ALA A  1 246 ? 57.166  155.824 -104.015 1.00 62.21  ? 246  ALA A O     1 
ATOM   1812  C CB    . ALA A  1 246 ? 60.188  155.144 -104.900 1.00 60.61  ? 246  ALA A CB    1 
ATOM   1813  N N     . THR A  1 247 ? 57.601  156.395 -106.152 1.00 64.95  ? 247  THR A N     1 
ATOM   1814  C CA    . THR A  1 247 ? 56.230  156.237 -106.588 1.00 68.16  ? 247  THR A CA    1 
ATOM   1815  C C     . THR A  1 247 ? 56.189  155.885 -108.075 1.00 69.79  ? 247  THR A C     1 
ATOM   1816  O O     . THR A  1 247 ? 56.846  156.532 -108.892 1.00 69.44  ? 247  THR A O     1 
ATOM   1817  C CB    . THR A  1 247 ? 55.437  157.527 -106.317 1.00 68.89  ? 247  THR A CB    1 
ATOM   1818  O OG1   . THR A  1 247 ? 54.214  157.484 -107.060 1.00 70.34  ? 247  THR A OG1   1 
ATOM   1819  C CG2   . THR A  1 247 ? 56.263  158.771 -106.698 1.00 68.69  ? 247  THR A CG2   1 
ATOM   1820  N N     . LYS A  1 248 ? 55.412  154.857 -108.415 1.00 72.10  ? 248  LYS A N     1 
ATOM   1821  C CA    . LYS A  1 248 ? 55.300  154.374 -109.793 1.00 75.08  ? 248  LYS A CA    1 
ATOM   1822  C C     . LYS A  1 248 ? 54.376  155.179 -110.706 1.00 76.47  ? 248  LYS A C     1 
ATOM   1823  O O     . LYS A  1 248 ? 53.212  155.412 -110.390 1.00 75.81  ? 248  LYS A O     1 
ATOM   1824  C CB    . LYS A  1 248 ? 54.874  152.898 -109.785 1.00 76.46  ? 248  LYS A CB    1 
ATOM   1825  C CG    . LYS A  1 248 ? 53.665  152.605 -108.901 1.00 78.54  ? 248  LYS A CG    1 
ATOM   1826  C CD    . LYS A  1 248 ? 53.868  151.377 -107.992 1.00 79.23  ? 248  LYS A CD    1 
ATOM   1827  C CE    . LYS A  1 248 ? 53.987  150.064 -108.766 1.00 78.83  ? 248  LYS A CE    1 
ATOM   1828  N NZ    . LYS A  1 248 ? 53.955  148.887 -107.844 1.00 78.88  ? 248  LYS A NZ    1 
ATOM   1829  N N     . LYS A  1 249 ? 54.924  155.581 -111.852 1.00 78.39  ? 249  LYS A N     1 
ATOM   1830  C CA    . LYS A  1 249 ? 54.218  156.373 -112.853 1.00 79.87  ? 249  LYS A CA    1 
ATOM   1831  C C     . LYS A  1 249 ? 53.144  155.610 -113.623 1.00 80.48  ? 249  LYS A C     1 
ATOM   1832  O O     . LYS A  1 249 ? 53.250  154.401 -113.825 1.00 80.97  ? 249  LYS A O     1 
ATOM   1833  C CB    . LYS A  1 249 ? 55.226  156.971 -113.845 1.00 81.06  ? 249  LYS A CB    1 
ATOM   1834  C CG    . LYS A  1 249 ? 55.816  158.310 -113.404 1.00 82.76  ? 249  LYS A CG    1 
ATOM   1835  C CD    . LYS A  1 249 ? 55.158  159.511 -114.123 1.00 84.61  ? 249  LYS A CD    1 
ATOM   1836  C CE    . LYS A  1 249 ? 53.606  159.466 -114.158 1.00 85.17  ? 249  LYS A CE    1 
ATOM   1837  N NZ    . LYS A  1 249 ? 52.918  159.449 -112.825 1.00 84.38  ? 249  LYS A NZ    1 
ATOM   1838  N N     . SER A  1 250 ? 52.117  156.346 -114.055 1.00 80.75  ? 250  SER A N     1 
ATOM   1839  C CA    . SER A  1 250 ? 50.986  155.806 -114.810 1.00 79.83  ? 250  SER A CA    1 
ATOM   1840  C C     . SER A  1 250 ? 51.477  155.164 -116.089 1.00 78.89  ? 250  SER A C     1 
ATOM   1841  O O     . SER A  1 250 ? 50.799  154.322 -116.678 1.00 79.26  ? 250  SER A O     1 
ATOM   1842  C CB    . SER A  1 250 ? 50.008  156.927 -115.155 1.00 80.67  ? 250  SER A CB    1 
ATOM   1843  O OG    . SER A  1 250 ? 49.708  157.705 -114.006 1.00 81.92  ? 250  SER A OG    1 
ATOM   1844  N N     . ASP A  1 251 ? 52.663  155.575 -116.515 1.00 77.91  ? 251  ASP A N     1 
ATOM   1845  C CA    . ASP A  1 251 ? 53.272  155.047 -117.725 1.00 77.06  ? 251  ASP A CA    1 
ATOM   1846  C C     . ASP A  1 251 ? 53.947  153.706 -117.438 1.00 75.70  ? 251  ASP A C     1 
ATOM   1847  O O     . ASP A  1 251 ? 54.108  152.881 -118.331 1.00 76.12  ? 251  ASP A O     1 
ATOM   1848  C CB    . ASP A  1 251 ? 54.302  156.043 -118.269 1.00 78.63  ? 251  ASP A CB    1 
ATOM   1849  C CG    . ASP A  1 251 ? 55.728  155.634 -117.963 1.00 79.53  ? 251  ASP A CG    1 
ATOM   1850  O OD1   . ASP A  1 251 ? 56.268  154.801 -118.715 1.00 80.00  ? 251  ASP A OD1   1 
ATOM   1851  O OD2   . ASP A  1 251 ? 56.304  156.129 -116.968 1.00 80.21  ? 251  ASP A OD2   1 
ATOM   1852  N N     . GLY A  1 252 ? 54.345  153.486 -116.191 1.00 73.75  ? 252  GLY A N     1 
ATOM   1853  C CA    . GLY A  1 252 ? 54.998  152.232 -115.860 1.00 71.46  ? 252  GLY A CA    1 
ATOM   1854  C C     . GLY A  1 252 ? 56.341  152.392 -115.163 1.00 69.76  ? 252  GLY A C     1 
ATOM   1855  O O     . GLY A  1 252 ? 56.671  151.631 -114.252 1.00 69.88  ? 252  GLY A O     1 
ATOM   1856  N N     . LYS A  1 253 ? 57.131  153.371 -115.591 1.00 67.64  ? 253  LYS A N     1 
ATOM   1857  C CA    . LYS A  1 253 ? 58.424  153.614 -114.970 1.00 65.28  ? 253  LYS A CA    1 
ATOM   1858  C C     . LYS A  1 253 ? 58.213  154.084 -113.524 1.00 63.99  ? 253  LYS A C     1 
ATOM   1859  O O     . LYS A  1 253 ? 57.089  154.326 -113.093 1.00 64.37  ? 253  LYS A O     1 
ATOM   1860  C CB    . LYS A  1 253 ? 59.202  154.652 -115.781 1.00 65.20  ? 253  LYS A CB    1 
ATOM   1861  C CG    . LYS A  1 253 ? 59.510  154.209 -117.213 1.00 64.56  ? 253  LYS A CG    1 
ATOM   1862  C CD    . LYS A  1 253 ? 60.274  155.280 -117.967 1.00 64.63  ? 253  LYS A CD    1 
ATOM   1863  C CE    . LYS A  1 253 ? 60.556  154.867 -119.397 1.00 65.77  ? 253  LYS A CE    1 
ATOM   1864  N NZ    . LYS A  1 253 ? 61.350  153.611 -119.494 1.00 66.55  ? 253  LYS A NZ    1 
ATOM   1865  N N     . ILE A  1 254 ? 59.290  154.209 -112.766 1.00 62.87  ? 254  ILE A N     1 
ATOM   1866  C CA    . ILE A  1 254 ? 59.169  154.625 -111.375 1.00 61.28  ? 254  ILE A CA    1 
ATOM   1867  C C     . ILE A  1 254 ? 60.064  155.821 -111.063 1.00 58.79  ? 254  ILE A C     1 
ATOM   1868  O O     . ILE A  1 254 ? 61.222  155.849 -111.465 1.00 58.07  ? 254  ILE A O     1 
ATOM   1869  C CB    . ILE A  1 254 ? 59.499  153.424 -110.437 1.00 61.92  ? 254  ILE A CB    1 
ATOM   1870  C CG1   . ILE A  1 254 ? 59.724  153.903 -109.011 1.00 62.21  ? 254  ILE A CG1   1 
ATOM   1871  C CG2   . ILE A  1 254 ? 60.728  152.687 -110.937 1.00 62.45  ? 254  ILE A CG2   1 
ATOM   1872  C CD1   . ILE A  1 254 ? 59.892  152.764 -108.044 1.00 64.44  ? 254  ILE A CD1   1 
ATOM   1873  N N     . ASP A  1 255 ? 59.513  156.813 -110.367 1.00 57.08  ? 255  ASP A N     1 
ATOM   1874  C CA    . ASP A  1 255 ? 60.267  158.010 -110.002 1.00 55.75  ? 255  ASP A CA    1 
ATOM   1875  C C     . ASP A  1 255 ? 60.765  157.910 -108.567 1.00 54.15  ? 255  ASP A C     1 
ATOM   1876  O O     . ASP A  1 255 ? 60.000  157.630 -107.643 1.00 52.50  ? 255  ASP A O     1 
ATOM   1877  C CB    . ASP A  1 255 ? 59.415  159.290 -110.153 1.00 57.16  ? 255  ASP A CB    1 
ATOM   1878  C CG    . ASP A  1 255 ? 59.104  159.642 -111.612 1.00 57.80  ? 255  ASP A CG    1 
ATOM   1879  O OD1   . ASP A  1 255 ? 60.025  159.617 -112.457 1.00 56.64  ? 255  ASP A OD1   1 
ATOM   1880  O OD2   . ASP A  1 255 ? 57.931  159.963 -111.906 1.00 59.61  ? 255  ASP A OD2   1 
ATOM   1881  N N     . VAL A  1 256 ? 62.060  158.149 -108.393 1.00 53.64  ? 256  VAL A N     1 
ATOM   1882  C CA    . VAL A  1 256 ? 62.689  158.086 -107.080 1.00 52.81  ? 256  VAL A CA    1 
ATOM   1883  C C     . VAL A  1 256 ? 63.142  159.474 -106.668 1.00 52.90  ? 256  VAL A C     1 
ATOM   1884  O O     . VAL A  1 256 ? 63.982  160.080 -107.321 1.00 52.82  ? 256  VAL A O     1 
ATOM   1885  C CB    . VAL A  1 256 ? 63.946  157.157 -107.073 1.00 51.42  ? 256  VAL A CB    1 
ATOM   1886  C CG1   . VAL A  1 256 ? 64.330  156.830 -105.652 1.00 48.95  ? 256  VAL A CG1   1 
ATOM   1887  C CG2   . VAL A  1 256 ? 63.685  155.887 -107.848 1.00 49.88  ? 256  VAL A CG2   1 
ATOM   1888  N N     . SER A  1 257 ? 62.580  159.978 -105.584 1.00 54.13  ? 257  SER A N     1 
ATOM   1889  C CA    . SER A  1 257 ? 62.969  161.286 -105.099 1.00 56.54  ? 257  SER A CA    1 
ATOM   1890  C C     . SER A  1 257 ? 64.149  161.112 -104.154 1.00 58.11  ? 257  SER A C     1 
ATOM   1891  O O     . SER A  1 257 ? 64.092  160.330 -103.207 1.00 57.27  ? 257  SER A O     1 
ATOM   1892  C CB    . SER A  1 257 ? 61.794  161.963 -104.388 1.00 56.91  ? 257  SER A CB    1 
ATOM   1893  O OG    . SER A  1 257 ? 61.051  161.044 -103.614 1.00 57.50  ? 257  SER A OG    1 
ATOM   1894  N N     . ILE A  1 258 ? 65.230  161.830 -104.446 1.00 60.42  ? 258  ILE A N     1 
ATOM   1895  C CA    . ILE A  1 258 ? 66.452  161.785 -103.650 1.00 61.83  ? 258  ILE A CA    1 
ATOM   1896  C C     . ILE A  1 258 ? 66.869  163.210 -103.276 1.00 63.93  ? 258  ILE A C     1 
ATOM   1897  O O     . ILE A  1 258 ? 66.206  164.183 -103.652 1.00 64.90  ? 258  ILE A O     1 
ATOM   1898  C CB    . ILE A  1 258 ? 67.618  161.141 -104.437 1.00 60.97  ? 258  ILE A CB    1 
ATOM   1899  C CG1   . ILE A  1 258 ? 67.935  161.991 -105.668 1.00 59.54  ? 258  ILE A CG1   1 
ATOM   1900  C CG2   . ILE A  1 258 ? 67.259  159.720 -104.839 1.00 60.50  ? 258  ILE A CG2   1 
ATOM   1901  C CD1   . ILE A  1 258 ? 69.170  161.560 -106.404 1.00 59.38  ? 258  ILE A CD1   1 
ATOM   1902  N N     . GLU A  1 259 ? 67.973  163.318 -102.539 1.00 65.21  ? 259  GLU A N     1 
ATOM   1903  C CA    . GLU A  1 259 ? 68.521  164.599 -102.102 1.00 66.26  ? 259  GLU A CA    1 
ATOM   1904  C C     . GLU A  1 259 ? 69.793  164.334 -101.335 1.00 66.36  ? 259  GLU A C     1 
ATOM   1905  O O     . GLU A  1 259 ? 70.019  163.215 -100.864 1.00 67.09  ? 259  GLU A O     1 
ATOM   1906  C CB    . GLU A  1 259 ? 67.550  165.335 -101.180 1.00 67.11  ? 259  GLU A CB    1 
ATOM   1907  C CG    . GLU A  1 259 ? 67.212  164.562 -99.925  1.00 68.77  ? 259  GLU A CG    1 
ATOM   1908  C CD    . GLU A  1 259 ? 66.547  165.418 -98.874  1.00 69.76  ? 259  GLU A CD    1 
ATOM   1909  O OE1   . GLU A  1 259 ? 65.753  166.312 -99.243  1.00 70.10  ? 259  GLU A OE1   1 
ATOM   1910  O OE2   . GLU A  1 259 ? 66.814  165.186 -97.676  1.00 70.77  ? 259  GLU A OE2   1 
ATOM   1911  N N     . ALA A  1 260 ? 70.610  165.371 -101.199 1.00 65.98  ? 260  ALA A N     1 
ATOM   1912  C CA    . ALA A  1 260 ? 71.859  165.245 -100.482 1.00 64.97  ? 260  ALA A CA    1 
ATOM   1913  C C     . ALA A  1 260 ? 71.622  164.660 -99.100  1.00 64.94  ? 260  ALA A C     1 
ATOM   1914  O O     . ALA A  1 260 ? 70.591  164.913 -98.475  1.00 63.90  ? 260  ALA A O     1 
ATOM   1915  C CB    . ALA A  1 260 ? 72.543  166.602 -100.353 1.00 64.84  ? 260  ALA A CB    1 
ATOM   1916  N N     . ALA A  1 261 ? 72.570  163.867 -98.625  1.00 65.89  ? 261  ALA A N     1 
ATOM   1917  C CA    . ALA A  1 261 ? 72.463  163.286 -97.319  1.00 66.13  ? 261  ALA A CA    1 
ATOM   1918  C C     . ALA A  1 261 ? 72.139  164.283 -96.193  1.00 67.22  ? 261  ALA A C     1 
ATOM   1919  O O     . ALA A  1 261 ? 71.357  163.901 -95.284  1.00 66.76  ? 261  ALA A O     1 
ATOM   1920  C CB    . ALA A  1 261 ? 73.703  162.515 -97.015  1.00 66.07  ? 261  ALA A CB    1 
ATOM   1921  N N     . SER A  1 262 ? 72.634  165.531 -96.243  1.00 68.30  ? 262  SER A N     1 
ATOM   1922  C CA    . SER A  1 262 ? 72.307  166.476 -95.187  1.00 69.33  ? 262  SER A CA    1 
ATOM   1923  C C     . SER A  1 262 ? 71.235  167.414 -95.694  1.00 70.89  ? 262  SER A C     1 
ATOM   1924  O O     . SER A  1 262 ? 70.044  167.052 -95.789  1.00 71.35  ? 262  SER A O     1 
ATOM   1925  C CB    . SER A  1 262 ? 73.547  167.263 -94.775  1.00 68.84  ? 262  SER A CB    1 
ATOM   1926  O OG    . SER A  1 262 ? 74.342  167.585 -95.893  1.00 68.58  ? 262  SER A OG    1 
ATOM   1927  N N     . GLY A  1 263 ? 71.634  168.645 -95.990  1.00 72.48  ? 263  GLY A N     1 
ATOM   1928  C CA    . GLY A  1 263 ? 70.642  169.555 -96.518  1.00 72.57  ? 263  GLY A CA    1 
ATOM   1929  C C     . GLY A  1 263 ? 70.279  169.065 -97.915  1.00 72.37  ? 263  GLY A C     1 
ATOM   1930  O O     . GLY A  1 263 ? 71.193  168.708 -98.644  1.00 73.59  ? 263  GLY A O     1 
ATOM   1931  N N     . GLY A  1 264 ? 69.033  169.213 -98.401  1.00 71.74  ? 264  GLY A N     1 
ATOM   1932  C CA    . GLY A  1 264 ? 68.673  168.701 -99.749  1.00 70.60  ? 264  GLY A CA    1 
ATOM   1933  C C     . GLY A  1 264 ? 68.725  169.442 -101.105 1.00 69.74  ? 264  GLY A C     1 
ATOM   1934  O O     . GLY A  1 264 ? 68.142  170.524 -101.331 1.00 70.85  ? 264  GLY A O     1 
ATOM   1935  N N     . LYS A  1 265 ? 69.503  168.871 -102.013 1.00 68.17  ? 265  LYS A N     1 
ATOM   1936  C CA    . LYS A  1 265 ? 69.615  169.394 -103.392 1.00 66.64  ? 265  LYS A CA    1 
ATOM   1937  C C     . LYS A  1 265 ? 68.575  168.490 -104.107 1.00 65.89  ? 265  LYS A C     1 
ATOM   1938  O O     . LYS A  1 265 ? 68.784  167.899 -105.186 1.00 66.17  ? 265  LYS A O     1 
ATOM   1939  C CB    . LYS A  1 265 ? 71.033  169.189 -103.963 1.00 66.62  ? 265  LYS A CB    1 
ATOM   1940  C CG    . LYS A  1 265 ? 71.902  170.425 -103.758 1.00 66.94  ? 265  LYS A CG    1 
ATOM   1941  C CD    . LYS A  1 265 ? 73.215  170.145 -103.041 1.00 67.15  ? 265  LYS A CD    1 
ATOM   1942  C CE    . LYS A  1 265 ? 73.202  170.646 -101.598 1.00 67.13  ? 265  LYS A CE    1 
ATOM   1943  N NZ    . LYS A  1 265 ? 72.197  169.920 -100.766 1.00 67.38  ? 265  LYS A NZ    1 
ATOM   1944  N N     . ALA A  1 266 ? 67.442  168.363 -103.431 1.00 64.75  ? 266  ALA A N     1 
ATOM   1945  C CA    . ALA A  1 266 ? 66.316  167.535 -103.849 1.00 64.66  ? 266  ALA A CA    1 
ATOM   1946  C C     . ALA A  1 266 ? 66.045  167.392 -105.346 1.00 65.34  ? 266  ALA A C     1 
ATOM   1947  O O     . ALA A  1 266 ? 65.388  168.235 -105.948 1.00 66.38  ? 266  ALA A O     1 
ATOM   1948  C CB    . ALA A  1 266 ? 65.061  168.027 -103.152 1.00 62.64  ? 266  ALA A CB    1 
ATOM   1949  N N     . GLU A  1 267 ? 66.545  166.320 -105.951 1.00 66.42  ? 267  GLU A N     1 
ATOM   1950  C CA    . GLU A  1 267 ? 66.288  166.071 -107.367 1.00 66.38  ? 267  GLU A CA    1 
ATOM   1951  C C     . GLU A  1 267 ? 65.515  164.757 -107.506 1.00 65.28  ? 267  GLU A C     1 
ATOM   1952  O O     . GLU A  1 267 ? 65.171  164.121 -106.507 1.00 65.26  ? 267  GLU A O     1 
ATOM   1953  C CB    . GLU A  1 267 ? 67.587  166.035 -108.184 1.00 68.22  ? 267  GLU A CB    1 
ATOM   1954  C CG    . GLU A  1 267 ? 68.546  164.923 -107.848 1.00 71.24  ? 267  GLU A CG    1 
ATOM   1955  C CD    . GLU A  1 267 ? 69.761  164.917 -108.767 1.00 74.12  ? 267  GLU A CD    1 
ATOM   1956  O OE1   . GLU A  1 267 ? 69.583  164.738 -109.996 1.00 74.97  ? 267  GLU A OE1   1 
ATOM   1957  O OE2   . GLU A  1 267 ? 70.894  165.090 -108.262 1.00 75.26  ? 267  GLU A OE2   1 
ATOM   1958  N N     . VAL A  1 268 ? 65.222  164.365 -108.740 1.00 63.59  ? 268  VAL A N     1 
ATOM   1959  C CA    . VAL A  1 268 ? 64.453  163.147 -109.001 1.00 61.24  ? 268  VAL A CA    1 
ATOM   1960  C C     . VAL A  1 268 ? 65.068  162.337 -110.138 1.00 60.28  ? 268  VAL A C     1 
ATOM   1961  O O     . VAL A  1 268 ? 65.730  162.877 -111.025 1.00 60.71  ? 268  VAL A O     1 
ATOM   1962  C CB    . VAL A  1 268 ? 62.971  163.490 -109.357 1.00 60.81  ? 268  VAL A CB    1 
ATOM   1963  C CG1   . VAL A  1 268 ? 62.215  162.242 -109.795 1.00 60.47  ? 268  VAL A CG1   1 
ATOM   1964  C CG2   . VAL A  1 268 ? 62.278  164.105 -108.146 1.00 59.59  ? 268  VAL A CG2   1 
ATOM   1965  N N     . ILE A  1 269 ? 64.856  161.031 -110.108 1.00 57.83  ? 269  ILE A N     1 
ATOM   1966  C CA    . ILE A  1 269 ? 65.406  160.186 -111.143 1.00 56.13  ? 269  ILE A CA    1 
ATOM   1967  C C     . ILE A  1 269 ? 64.366  159.161 -111.535 1.00 54.48  ? 269  ILE A C     1 
ATOM   1968  O O     . ILE A  1 269 ? 63.427  158.917 -110.790 1.00 54.26  ? 269  ILE A O     1 
ATOM   1969  C CB    . ILE A  1 269 ? 66.668  159.511 -110.635 1.00 56.77  ? 269  ILE A CB    1 
ATOM   1970  C CG1   . ILE A  1 269 ? 66.390  158.906 -109.259 1.00 57.64  ? 269  ILE A CG1   1 
ATOM   1971  C CG2   . ILE A  1 269 ? 67.793  160.529 -110.542 1.00 54.78  ? 269  ILE A CG2   1 
ATOM   1972  C CD1   . ILE A  1 269 ? 67.552  158.169 -108.682 1.00 57.82  ? 269  ILE A CD1   1 
ATOM   1973  N N     . THR A  1 270 ? 64.521  158.575 -112.713 1.00 53.43  ? 270  THR A N     1 
ATOM   1974  C CA    . THR A  1 270 ? 63.557  157.588 -113.182 1.00 53.12  ? 270  THR A CA    1 
ATOM   1975  C C     . THR A  1 270 ? 64.247  156.327 -113.667 1.00 52.50  ? 270  THR A C     1 
ATOM   1976  O O     . THR A  1 270 ? 65.334  156.393 -114.237 1.00 52.05  ? 270  THR A O     1 
ATOM   1977  C CB    . THR A  1 270 ? 62.682  158.163 -114.314 1.00 52.60  ? 270  THR A CB    1 
ATOM   1978  O OG1   . THR A  1 270 ? 62.043  159.355 -113.847 1.00 52.44  ? 270  THR A OG1   1 
ATOM   1979  C CG2   . THR A  1 270 ? 61.609  157.176 -114.720 1.00 50.94  ? 270  THR A CG2   1 
ATOM   1980  N N     . CYS A  1 271 ? 63.595  155.186 -113.438 1.00 52.06  ? 271  CYS A N     1 
ATOM   1981  C CA    . CYS A  1 271 ? 64.129  153.870 -113.805 1.00 52.71  ? 271  CYS A CA    1 
ATOM   1982  C C     . CYS A  1 271 ? 63.052  152.822 -114.101 1.00 52.49  ? 271  CYS A C     1 
ATOM   1983  O O     . CYS A  1 271 ? 61.868  153.030 -113.839 1.00 52.86  ? 271  CYS A O     1 
ATOM   1984  C CB    . CYS A  1 271 ? 65.005  153.333 -112.673 1.00 51.62  ? 271  CYS A CB    1 
ATOM   1985  S SG    . CYS A  1 271 ? 64.121  153.194 -111.099 1.00 52.62  ? 271  CYS A SG    1 
ATOM   1986  N N     . ASP A  1 272 ? 63.489  151.686 -114.632 1.00 51.85  ? 272  ASP A N     1 
ATOM   1987  C CA    . ASP A  1 272 ? 62.603  150.578 -114.957 1.00 51.46  ? 272  ASP A CA    1 
ATOM   1988  C C     . ASP A  1 272 ? 62.341  149.738 -113.718 1.00 51.13  ? 272  ASP A C     1 
ATOM   1989  O O     . ASP A  1 272 ? 61.222  149.284 -113.485 1.00 51.24  ? 272  ASP A O     1 
ATOM   1990  C CB    . ASP A  1 272 ? 63.247  149.690 -116.007 1.00 52.04  ? 272  ASP A CB    1 
ATOM   1991  C CG    . ASP A  1 272 ? 63.295  150.337 -117.362 1.00 53.77  ? 272  ASP A CG    1 
ATOM   1992  O OD1   . ASP A  1 272 ? 63.503  151.567 -117.437 1.00 52.79  ? 272  ASP A OD1   1 
ATOM   1993  O OD2   . ASP A  1 272 ? 63.135  149.597 -118.356 1.00 56.42  ? 272  ASP A OD2   1 
ATOM   1994  N N     . VAL A  1 273 ? 63.392  149.524 -112.934 1.00 50.34  ? 273  VAL A N     1 
ATOM   1995  C CA    . VAL A  1 273 ? 63.296  148.722 -111.728 1.00 48.23  ? 273  VAL A CA    1 
ATOM   1996  C C     . VAL A  1 273 ? 64.027  149.378 -110.577 1.00 47.11  ? 273  VAL A C     1 
ATOM   1997  O O     . VAL A  1 273 ? 65.093  149.968 -110.746 1.00 46.29  ? 273  VAL A O     1 
ATOM   1998  C CB    . VAL A  1 273 ? 63.890  147.305 -111.947 1.00 49.04  ? 273  VAL A CB    1 
ATOM   1999  C CG1   . VAL A  1 273 ? 63.885  146.525 -110.639 1.00 48.72  ? 273  VAL A CG1   1 
ATOM   2000  C CG2   . VAL A  1 273 ? 63.083  146.556 -112.992 1.00 47.17  ? 273  VAL A CG2   1 
ATOM   2001  N N     . LEU A  1 274 ? 63.436  149.256 -109.400 1.00 45.84  ? 274  LEU A N     1 
ATOM   2002  C CA    . LEU A  1 274 ? 64.006  149.813 -108.191 1.00 44.61  ? 274  LEU A CA    1 
ATOM   2003  C C     . LEU A  1 274 ? 64.328  148.685 -107.204 1.00 44.63  ? 274  LEU A C     1 
ATOM   2004  O O     . LEU A  1 274 ? 63.444  147.900 -106.831 1.00 44.53  ? 274  LEU A O     1 
ATOM   2005  C CB    . LEU A  1 274 ? 63.020  150.795 -107.561 1.00 41.06  ? 274  LEU A CB    1 
ATOM   2006  C CG    . LEU A  1 274 ? 63.425  151.371 -106.210 1.00 40.22  ? 274  LEU A CG    1 
ATOM   2007  C CD1   . LEU A  1 274 ? 64.699  152.172 -106.371 1.00 37.65  ? 274  LEU A CD1   1 
ATOM   2008  C CD2   . LEU A  1 274 ? 62.302  152.232 -105.654 1.00 36.69  ? 274  LEU A CD2   1 
ATOM   2009  N N     . LEU A  1 275 ? 65.602  148.602 -106.809 1.00 43.99  ? 275  LEU A N     1 
ATOM   2010  C CA    . LEU A  1 275 ? 66.069  147.604 -105.852 1.00 42.71  ? 275  LEU A CA    1 
ATOM   2011  C C     . LEU A  1 275 ? 66.250  148.218 -104.472 1.00 42.30  ? 275  LEU A C     1 
ATOM   2012  O O     . LEU A  1 275 ? 67.182  148.997 -104.236 1.00 41.41  ? 275  LEU A O     1 
ATOM   2013  C CB    . LEU A  1 275 ? 67.401  146.988 -106.293 1.00 42.73  ? 275  LEU A CB    1 
ATOM   2014  C CG    . LEU A  1 275 ? 68.064  146.020 -105.288 1.00 42.91  ? 275  LEU A CG    1 
ATOM   2015  C CD1   . LEU A  1 275 ? 67.082  144.932 -104.840 1.00 41.21  ? 275  LEU A CD1   1 
ATOM   2016  C CD2   . LEU A  1 275 ? 69.305  145.399 -105.934 1.00 42.09  ? 275  LEU A CD2   1 
ATOM   2017  N N     . VAL A  1 276 ? 65.341  147.866 -103.568 1.00 42.85  ? 276  VAL A N     1 
ATOM   2018  C CA    . VAL A  1 276 ? 65.385  148.338 -102.193 1.00 43.86  ? 276  VAL A CA    1 
ATOM   2019  C C     . VAL A  1 276 ? 66.339  147.395 -101.464 1.00 44.73  ? 276  VAL A C     1 
ATOM   2020  O O     . VAL A  1 276 ? 65.995  146.253 -101.151 1.00 45.05  ? 276  VAL A O     1 
ATOM   2021  C CB    . VAL A  1 276 ? 64.007  148.256 -101.574 1.00 44.12  ? 276  VAL A CB    1 
ATOM   2022  C CG1   . VAL A  1 276 ? 63.902  149.210 -100.419 1.00 44.48  ? 276  VAL A CG1   1 
ATOM   2023  C CG2   . VAL A  1 276 ? 62.975  148.578 -102.620 1.00 44.93  ? 276  VAL A CG2   1 
ATOM   2024  N N     . CYS A  1 277 ? 67.545  147.885 -101.209 1.00 44.54  ? 277  CYS A N     1 
ATOM   2025  C CA    . CYS A  1 277 ? 68.568  147.081 -100.581 1.00 44.19  ? 277  CYS A CA    1 
ATOM   2026  C C     . CYS A  1 277 ? 69.198  147.829 -99.438  1.00 43.34  ? 277  CYS A C     1 
ATOM   2027  O O     . CYS A  1 277 ? 70.382  148.161 -99.470  1.00 44.43  ? 277  CYS A O     1 
ATOM   2028  C CB    . CYS A  1 277 ? 69.641  146.748 -101.610 1.00 44.73  ? 277  CYS A CB    1 
ATOM   2029  S SG    . CYS A  1 277 ? 70.172  145.046 -101.562 1.00 44.12  ? 277  CYS A SG    1 
ATOM   2030  N N     . ILE A  1 278 ? 68.411  148.076 -98.413  1.00 42.70  ? 278  ILE A N     1 
ATOM   2031  C CA    . ILE A  1 278 ? 68.912  148.818 -97.283  1.00 43.26  ? 278  ILE A CA    1 
ATOM   2032  C C     . ILE A  1 278 ? 69.192  147.958 -96.068  1.00 43.23  ? 278  ILE A C     1 
ATOM   2033  O O     . ILE A  1 278 ? 69.200  148.451 -94.945  1.00 44.59  ? 278  ILE A O     1 
ATOM   2034  C CB    . ILE A  1 278 ? 67.924  149.936 -96.917  1.00 43.59  ? 278  ILE A CB    1 
ATOM   2035  C CG1   . ILE A  1 278 ? 66.539  149.335 -96.647  1.00 43.54  ? 278  ILE A CG1   1 
ATOM   2036  C CG2   . ILE A  1 278 ? 67.880  150.950 -98.053  1.00 43.50  ? 278  ILE A CG2   1 
ATOM   2037  C CD1   . ILE A  1 278 ? 65.575  150.232 -95.869  1.00 43.27  ? 278  ILE A CD1   1 
ATOM   2038  N N     . GLY A  1 279 ? 69.414  146.667 -96.293  1.00 43.12  ? 279  GLY A N     1 
ATOM   2039  C CA    . GLY A  1 279 ? 69.721  145.781 -95.187  1.00 40.88  ? 279  GLY A CA    1 
ATOM   2040  C C     . GLY A  1 279 ? 68.754  144.647 -94.921  1.00 40.36  ? 279  GLY A C     1 
ATOM   2041  O O     . GLY A  1 279 ? 67.777  144.450 -95.663  1.00 40.76  ? 279  GLY A O     1 
ATOM   2042  N N     . ARG A  1 280 ? 69.063  143.886 -93.869  1.00 36.85  ? 280  ARG A N     1 
ATOM   2043  C CA    . ARG A  1 280 ? 68.256  142.767 -93.422  1.00 34.70  ? 280  ARG A CA    1 
ATOM   2044  C C     . ARG A  1 280 ? 68.210  142.924 -91.909  1.00 35.77  ? 280  ARG A C     1 
ATOM   2045  O O     . ARG A  1 280 ? 69.049  143.610 -91.317  1.00 35.08  ? 280  ARG A O     1 
ATOM   2046  C CB    . ARG A  1 280 ? 68.903  141.433 -93.803  1.00 33.24  ? 280  ARG A CB    1 
ATOM   2047  C CG    . ARG A  1 280 ? 69.065  141.232 -95.303  1.00 32.91  ? 280  ARG A CG    1 
ATOM   2048  C CD    . ARG A  1 280 ? 69.669  139.882 -95.641  1.00 33.30  ? 280  ARG A CD    1 
ATOM   2049  N NE    . ARG A  1 280 ? 68.777  138.774 -95.298  1.00 33.71  ? 280  ARG A NE    1 
ATOM   2050  C CZ    . ARG A  1 280 ? 67.648  138.498 -95.941  1.00 33.24  ? 280  ARG A CZ    1 
ATOM   2051  N NH1   . ARG A  1 280 ? 67.268  139.249 -96.967  1.00 32.66  ? 280  ARG A NH1   1 
ATOM   2052  N NH2   . ARG A  1 280 ? 66.902  137.466 -95.568  1.00 33.48  ? 280  ARG A NH2   1 
ATOM   2053  N N     . ARG A  1 281 ? 67.222  142.312 -91.276  1.00 35.36  ? 281  ARG A N     1 
ATOM   2054  C CA    . ARG A  1 281 ? 67.106  142.427 -89.838  1.00 35.64  ? 281  ARG A CA    1 
ATOM   2055  C C     . ARG A  1 281 ? 66.748  141.057 -89.263  1.00 33.59  ? 281  ARG A C     1 
ATOM   2056  O O     . ARG A  1 281 ? 66.138  140.228 -89.935  1.00 34.05  ? 281  ARG A O     1 
ATOM   2057  C CB    . ARG A  1 281 ? 66.059  143.499 -89.498  1.00 37.06  ? 281  ARG A CB    1 
ATOM   2058  C CG    . ARG A  1 281 ? 64.651  143.177 -89.975  1.00 39.59  ? 281  ARG A CG    1 
ATOM   2059  C CD    . ARG A  1 281 ? 63.711  144.382 -89.893  1.00 42.32  ? 281  ARG A CD    1 
ATOM   2060  N NE    . ARG A  1 281 ? 62.317  143.990 -90.100  1.00 46.06  ? 281  ARG A NE    1 
ATOM   2061  C CZ    . ARG A  1 281 ? 61.287  144.831 -90.102  1.00 48.09  ? 281  ARG A CZ    1 
ATOM   2062  N NH1   . ARG A  1 281 ? 61.490  146.133 -89.913  1.00 48.19  ? 281  ARG A NH1   1 
ATOM   2063  N NH2   . ARG A  1 281 ? 60.050  144.365 -90.266  1.00 47.38  ? 281  ARG A NH2   1 
ATOM   2064  N N     . PRO A  1 282 ? 67.146  140.793 -88.012  1.00 32.32  ? 282  PRO A N     1 
ATOM   2065  C CA    . PRO A  1 282 ? 66.843  139.494 -87.402  1.00 31.49  ? 282  PRO A CA    1 
ATOM   2066  C C     . PRO A  1 282 ? 65.359  139.138 -87.382  1.00 31.56  ? 282  PRO A C     1 
ATOM   2067  O O     . PRO A  1 282 ? 64.527  139.970 -87.050  1.00 33.73  ? 282  PRO A O     1 
ATOM   2068  C CB    . PRO A  1 282 ? 67.459  139.607 -86.005  1.00 29.16  ? 282  PRO A CB    1 
ATOM   2069  C CG    . PRO A  1 282 ? 67.469  141.062 -85.735  1.00 31.43  ? 282  PRO A CG    1 
ATOM   2070  C CD    . PRO A  1 282 ? 67.828  141.683 -87.059  1.00 30.24  ? 282  PRO A CD    1 
ATOM   2071  N N     . PHE A  1 283 ? 65.041  137.891 -87.721  1.00 31.24  ? 283  PHE A N     1 
ATOM   2072  C CA    . PHE A  1 283 ? 63.663  137.434 -87.763  1.00 32.26  ? 283  PHE A CA    1 
ATOM   2073  C C     . PHE A  1 283 ? 63.285  136.524 -86.592  1.00 33.49  ? 283  PHE A C     1 
ATOM   2074  O O     . PHE A  1 283 ? 63.779  135.407 -86.511  1.00 34.24  ? 283  PHE A O     1 
ATOM   2075  C CB    . PHE A  1 283 ? 63.425  136.704 -89.085  1.00 31.33  ? 283  PHE A CB    1 
ATOM   2076  C CG    . PHE A  1 283 ? 62.003  136.320 -89.307  1.00 32.18  ? 283  PHE A CG    1 
ATOM   2077  C CD1   . PHE A  1 283 ? 61.066  137.277 -89.680  1.00 30.81  ? 283  PHE A CD1   1 
ATOM   2078  C CD2   . PHE A  1 283 ? 61.579  135.001 -89.096  1.00 32.50  ? 283  PHE A CD2   1 
ATOM   2079  C CE1   . PHE A  1 283 ? 59.731  136.931 -89.838  1.00 29.98  ? 283  PHE A CE1   1 
ATOM   2080  C CE2   . PHE A  1 283 ? 60.236  134.650 -89.254  1.00 30.23  ? 283  PHE A CE2   1 
ATOM   2081  C CZ    . PHE A  1 283 ? 59.321  135.615 -89.624  1.00 30.36  ? 283  PHE A CZ    1 
ATOM   2082  N N     . THR A  1 284 ? 62.400  136.994 -85.706  1.00 34.77  ? 284  THR A N     1 
ATOM   2083  C CA    . THR A  1 284 ? 61.966  136.227 -84.529  1.00 36.82  ? 284  THR A CA    1 
ATOM   2084  C C     . THR A  1 284 ? 60.449  136.216 -84.353  1.00 40.35  ? 284  THR A C     1 
ATOM   2085  O O     . THR A  1 284 ? 59.939  135.959 -83.250  1.00 40.78  ? 284  THR A O     1 
ATOM   2086  C CB    . THR A  1 284 ? 62.553  136.804 -83.210  1.00 35.16  ? 284  THR A CB    1 
ATOM   2087  O OG1   . THR A  1 284 ? 62.230  138.191 -83.107  1.00 36.50  ? 284  THR A OG1   1 
ATOM   2088  C CG2   . THR A  1 284 ? 64.026  136.659 -83.162  1.00 34.51  ? 284  THR A CG2   1 
ATOM   2089  N N     . LYS A  1 285 ? 59.735  136.489 -85.437  1.00 43.81  ? 285  LYS A N     1 
ATOM   2090  C CA    . LYS A  1 285 ? 58.277  136.565 -85.435  1.00 46.38  ? 285  LYS A CA    1 
ATOM   2091  C C     . LYS A  1 285 ? 57.599  135.324 -84.867  1.00 46.84  ? 285  LYS A C     1 
ATOM   2092  O O     . LYS A  1 285 ? 57.890  134.203 -85.270  1.00 46.62  ? 285  LYS A O     1 
ATOM   2093  C CB    . LYS A  1 285 ? 57.805  136.819 -86.870  1.00 49.03  ? 285  LYS A CB    1 
ATOM   2094  C CG    . LYS A  1 285 ? 56.421  137.443 -87.012  1.00 51.97  ? 285  LYS A CG    1 
ATOM   2095  C CD    . LYS A  1 285 ? 56.392  138.861 -86.460  1.00 56.49  ? 285  LYS A CD    1 
ATOM   2096  C CE    . LYS A  1 285 ? 57.485  139.764 -87.091  1.00 59.12  ? 285  LYS A CE    1 
ATOM   2097  N NZ    . LYS A  1 285 ? 57.340  139.984 -88.570  1.00 60.56  ? 285  LYS A NZ    1 
ATOM   2098  N N     . ASN A  1 286 ? 56.699  135.557 -83.915  1.00 46.83  ? 286  ASN A N     1 
ATOM   2099  C CA    . ASN A  1 286 ? 55.906  134.500 -83.266  1.00 46.96  ? 286  ASN A CA    1 
ATOM   2100  C C     . ASN A  1 286 ? 56.658  133.263 -82.818  1.00 46.70  ? 286  ASN A C     1 
ATOM   2101  O O     . ASN A  1 286 ? 56.109  132.143 -82.814  1.00 47.11  ? 286  ASN A O     1 
ATOM   2102  C CB    . ASN A  1 286 ? 54.783  134.074 -84.188  1.00 48.82  ? 286  ASN A CB    1 
ATOM   2103  C CG    . ASN A  1 286 ? 54.245  135.226 -84.986  1.00 52.05  ? 286  ASN A CG    1 
ATOM   2104  O OD1   . ASN A  1 286 ? 54.081  135.133 -86.203  1.00 54.67  ? 286  ASN A OD1   1 
ATOM   2105  N ND2   . ASN A  1 286 ? 53.931  136.322 -84.296  1.00 52.30  ? 286  ASN A ND2   1 
ATOM   2106  N N     . LEU A  1 287 ? 57.901  133.452 -82.411  1.00 45.29  ? 287  LEU A N     1 
ATOM   2107  C CA    . LEU A  1 287 ? 58.727  132.365 -81.931  1.00 43.61  ? 287  LEU A CA    1 
ATOM   2108  C C     . LEU A  1 287 ? 58.335  132.033 -80.482  1.00 43.39  ? 287  LEU A C     1 
ATOM   2109  O O     . LEU A  1 287 ? 58.630  130.957 -79.964  1.00 42.84  ? 287  LEU A O     1 
ATOM   2110  C CB    . LEU A  1 287 ? 60.181  132.812 -82.026  1.00 43.61  ? 287  LEU A CB    1 
ATOM   2111  C CG    . LEU A  1 287 ? 61.320  131.813 -81.932  1.00 42.05  ? 287  LEU A CG    1 
ATOM   2112  C CD1   . LEU A  1 287 ? 61.002  130.569 -82.742  1.00 39.21  ? 287  LEU A CD1   1 
ATOM   2113  C CD2   . LEU A  1 287 ? 62.578  132.516 -82.420  1.00 40.98  ? 287  LEU A CD2   1 
ATOM   2114  N N     . GLY A  1 288 ? 57.645  132.969 -79.841  1.00 43.64  ? 288  GLY A N     1 
ATOM   2115  C CA    . GLY A  1 288 ? 57.199  132.764 -78.479  1.00 42.70  ? 288  GLY A CA    1 
ATOM   2116  C C     . GLY A  1 288 ? 58.117  133.403 -77.469  1.00 43.59  ? 288  GLY A C     1 
ATOM   2117  O O     . GLY A  1 288 ? 57.947  133.215 -76.266  1.00 45.25  ? 288  GLY A O     1 
ATOM   2118  N N     . LEU A  1 289 ? 59.084  134.167 -77.957  1.00 43.51  ? 289  LEU A N     1 
ATOM   2119  C CA    . LEU A  1 289 ? 60.047  134.824 -77.100  1.00 45.60  ? 289  LEU A CA    1 
ATOM   2120  C C     . LEU A  1 289 ? 59.446  135.677 -75.987  1.00 48.42  ? 289  LEU A C     1 
ATOM   2121  O O     . LEU A  1 289 ? 59.876  135.579 -74.835  1.00 47.40  ? 289  LEU A O     1 
ATOM   2122  C CB    . LEU A  1 289 ? 60.983  135.691 -77.939  1.00 44.27  ? 289  LEU A CB    1 
ATOM   2123  C CG    . LEU A  1 289 ? 61.627  134.974 -79.120  1.00 45.30  ? 289  LEU A CG    1 
ATOM   2124  C CD1   . LEU A  1 289 ? 62.606  135.906 -79.823  1.00 44.62  ? 289  LEU A CD1   1 
ATOM   2125  C CD2   . LEU A  1 289 ? 62.328  133.717 -78.627  1.00 45.54  ? 289  LEU A CD2   1 
ATOM   2126  N N     . GLU A  1 290 ? 58.455  136.505 -76.319  1.00 51.79  ? 290  GLU A N     1 
ATOM   2127  C CA    . GLU A  1 290 ? 57.879  137.395 -75.322  1.00 54.57  ? 290  GLU A CA    1 
ATOM   2128  C C     . GLU A  1 290 ? 57.277  136.654 -74.147  1.00 55.02  ? 290  GLU A C     1 
ATOM   2129  O O     . GLU A  1 290 ? 57.301  137.154 -73.023  1.00 55.22  ? 290  GLU A O     1 
ATOM   2130  C CB    . GLU A  1 290 ? 56.840  138.335 -75.939  1.00 58.02  ? 290  GLU A CB    1 
ATOM   2131  C CG    . GLU A  1 290 ? 56.761  139.689 -75.193  1.00 62.90  ? 290  GLU A CG    1 
ATOM   2132  C CD    . GLU A  1 290 ? 55.363  140.305 -75.195  1.00 65.75  ? 290  GLU A CD    1 
ATOM   2133  O OE1   . GLU A  1 290 ? 54.806  140.525 -76.295  1.00 66.55  ? 290  GLU A OE1   1 
ATOM   2134  O OE2   . GLU A  1 290 ? 54.819  140.571 -74.093  1.00 67.50  ? 290  GLU A OE2   1 
ATOM   2135  N N     . GLU A  1 291 ? 56.746  135.464 -74.398  1.00 55.24  ? 291  GLU A N     1 
ATOM   2136  C CA    . GLU A  1 291 ? 56.172  134.654 -73.328  1.00 55.79  ? 291  GLU A CA    1 
ATOM   2137  C C     . GLU A  1 291 ? 57.259  134.068 -72.415  1.00 55.43  ? 291  GLU A C     1 
ATOM   2138  O O     . GLU A  1 291 ? 57.122  134.089 -71.192  1.00 56.03  ? 291  GLU A O     1 
ATOM   2139  C CB    . GLU A  1 291 ? 55.347  133.518 -73.912  1.00 57.93  ? 291  GLU A CB    1 
ATOM   2140  C CG    . GLU A  1 291 ? 54.006  133.954 -74.442  1.00 62.46  ? 291  GLU A CG    1 
ATOM   2141  C CD    . GLU A  1 291 ? 53.665  133.279 -75.755  1.00 65.04  ? 291  GLU A CD    1 
ATOM   2142  O OE1   . GLU A  1 291 ? 54.299  133.637 -76.774  1.00 65.85  ? 291  GLU A OE1   1 
ATOM   2143  O OE2   . GLU A  1 291 ? 52.780  132.389 -75.765  1.00 66.18  ? 291  GLU A OE2   1 
ATOM   2144  N N     . LEU A  1 292 ? 58.333  133.546 -73.011  1.00 53.43  ? 292  LEU A N     1 
ATOM   2145  C CA    . LEU A  1 292 ? 59.439  132.960 -72.251  1.00 50.47  ? 292  LEU A CA    1 
ATOM   2146  C C     . LEU A  1 292 ? 60.129  133.983 -71.364  1.00 49.42  ? 292  LEU A C     1 
ATOM   2147  O O     . LEU A  1 292 ? 60.665  133.630 -70.316  1.00 49.80  ? 292  LEU A O     1 
ATOM   2148  C CB    . LEU A  1 292 ? 60.481  132.357 -73.199  1.00 49.00  ? 292  LEU A CB    1 
ATOM   2149  C CG    . LEU A  1 292 ? 60.018  131.200 -74.078  1.00 47.70  ? 292  LEU A CG    1 
ATOM   2150  C CD1   . LEU A  1 292 ? 60.990  130.997 -75.209  1.00 49.98  ? 292  LEU A CD1   1 
ATOM   2151  C CD2   . LEU A  1 292 ? 59.896  129.952 -73.249  1.00 46.33  ? 292  LEU A CD2   1 
ATOM   2152  N N     . GLY A  1 293 ? 60.109  135.246 -71.789  1.00 48.11  ? 293  GLY A N     1 
ATOM   2153  C CA    . GLY A  1 293 ? 60.764  136.312 -71.044  1.00 46.82  ? 293  GLY A CA    1 
ATOM   2154  C C     . GLY A  1 293 ? 62.082  136.697 -71.707  1.00 46.44  ? 293  GLY A C     1 
ATOM   2155  O O     . GLY A  1 293 ? 62.914  137.398 -71.131  1.00 46.17  ? 293  GLY A O     1 
ATOM   2156  N N     . ILE A  1 294 ? 62.276  136.210 -72.928  1.00 46.03  ? 294  ILE A N     1 
ATOM   2157  C CA    . ILE A  1 294 ? 63.474  136.493 -73.697  1.00 45.47  ? 294  ILE A CA    1 
ATOM   2158  C C     . ILE A  1 294 ? 63.282  137.790 -74.478  1.00 45.87  ? 294  ILE A C     1 
ATOM   2159  O O     . ILE A  1 294 ? 62.716  137.804 -75.564  1.00 47.15  ? 294  ILE A O     1 
ATOM   2160  C CB    . ILE A  1 294 ? 63.783  135.327 -74.667  1.00 44.73  ? 294  ILE A CB    1 
ATOM   2161  C CG1   . ILE A  1 294 ? 64.065  134.053 -73.856  1.00 43.84  ? 294  ILE A CG1   1 
ATOM   2162  C CG2   . ILE A  1 294 ? 64.963  135.691 -75.566  1.00 43.02  ? 294  ILE A CG2   1 
ATOM   2163  C CD1   . ILE A  1 294 ? 64.270  132.807 -74.682  1.00 43.36  ? 294  ILE A CD1   1 
ATOM   2164  N N     . GLU A  1 295 ? 63.760  138.885 -73.913  1.00 45.18  ? 295  GLU A N     1 
ATOM   2165  C CA    . GLU A  1 295 ? 63.623  140.173 -74.556  1.00 45.61  ? 295  GLU A CA    1 
ATOM   2166  C C     . GLU A  1 295 ? 64.690  140.383 -75.624  1.00 44.19  ? 295  GLU A C     1 
ATOM   2167  O O     . GLU A  1 295 ? 65.832  139.971 -75.449  1.00 42.39  ? 295  GLU A O     1 
ATOM   2168  C CB    . GLU A  1 295 ? 63.711  141.266 -73.499  1.00 49.66  ? 295  GLU A CB    1 
ATOM   2169  C CG    . GLU A  1 295 ? 62.884  140.951 -72.252  1.00 55.74  ? 295  GLU A CG    1 
ATOM   2170  C CD    . GLU A  1 295 ? 62.763  142.135 -71.300  1.00 60.54  ? 295  GLU A CD    1 
ATOM   2171  O OE1   . GLU A  1 295 ? 63.153  143.265 -71.685  1.00 62.47  ? 295  GLU A OE1   1 
ATOM   2172  O OE2   . GLU A  1 295 ? 62.264  141.937 -70.165  1.00 63.58  ? 295  GLU A OE2   1 
ATOM   2173  N N     . LEU A  1 296 ? 64.304  141.031 -76.724  1.00 42.43  ? 296  LEU A N     1 
ATOM   2174  C CA    . LEU A  1 296 ? 65.204  141.311 -77.839  1.00 40.39  ? 296  LEU A CA    1 
ATOM   2175  C C     . LEU A  1 296 ? 66.037  142.551 -77.534  1.00 41.26  ? 296  LEU A C     1 
ATOM   2176  O O     . LEU A  1 296 ? 65.697  143.314 -76.635  1.00 42.50  ? 296  LEU A O     1 
ATOM   2177  C CB    . LEU A  1 296 ? 64.384  141.549 -79.116  1.00 38.64  ? 296  LEU A CB    1 
ATOM   2178  C CG    . LEU A  1 296 ? 63.439  140.426 -79.556  1.00 35.36  ? 296  LEU A CG    1 
ATOM   2179  C CD1   . LEU A  1 296 ? 62.611  140.844 -80.768  1.00 32.50  ? 296  LEU A CD1   1 
ATOM   2180  C CD2   . LEU A  1 296 ? 64.267  139.203 -79.851  1.00 33.19  ? 296  LEU A CD2   1 
ATOM   2181  N N     . ASP A  1 297 ? 67.139  142.762 -78.252  1.00 40.76  ? 297  ASP A N     1 
ATOM   2182  C CA    . ASP A  1 297 ? 67.919  143.963 -77.997  1.00 40.01  ? 297  ASP A CA    1 
ATOM   2183  C C     . ASP A  1 297 ? 67.318  145.024 -78.910  1.00 40.22  ? 297  ASP A C     1 
ATOM   2184  O O     . ASP A  1 297 ? 66.298  144.767 -79.542  1.00 41.37  ? 297  ASP A O     1 
ATOM   2185  C CB    . ASP A  1 297 ? 69.438  143.730 -78.226  1.00 38.76  ? 297  ASP A CB    1 
ATOM   2186  C CG    . ASP A  1 297 ? 69.864  143.728 -79.699  1.00 39.20  ? 297  ASP A CG    1 
ATOM   2187  O OD1   . ASP A  1 297 ? 69.071  144.068 -80.605  1.00 38.20  ? 297  ASP A OD1   1 
ATOM   2188  O OD2   . ASP A  1 297 ? 71.044  143.387 -79.940  1.00 38.73  ? 297  ASP A OD2   1 
ATOM   2189  N N     . PRO A  1 298 ? 67.902  146.231 -78.974  1.00 40.62  ? 298  PRO A N     1 
ATOM   2190  C CA    . PRO A  1 298 ? 67.327  147.267 -79.848  1.00 41.38  ? 298  PRO A CA    1 
ATOM   2191  C C     . PRO A  1 298 ? 67.220  146.931 -81.332  1.00 42.87  ? 298  PRO A C     1 
ATOM   2192  O O     . PRO A  1 298 ? 66.242  147.291 -81.981  1.00 43.70  ? 298  PRO A O     1 
ATOM   2193  C CB    . PRO A  1 298 ? 68.216  148.473 -79.588  1.00 41.02  ? 298  PRO A CB    1 
ATOM   2194  C CG    . PRO A  1 298 ? 68.560  148.291 -78.124  1.00 41.35  ? 298  PRO A CG    1 
ATOM   2195  C CD    . PRO A  1 298 ? 68.875  146.815 -78.034  1.00 39.17  ? 298  PRO A CD    1 
ATOM   2196  N N     . ARG A  1 299 ? 68.217  146.241 -81.874  1.00 43.75  ? 299  ARG A N     1 
ATOM   2197  C CA    . ARG A  1 299 ? 68.189  145.869 -83.282  1.00 42.27  ? 299  ARG A CA    1 
ATOM   2198  C C     . ARG A  1 299 ? 67.299  144.647 -83.488  1.00 40.06  ? 299  ARG A C     1 
ATOM   2199  O O     . ARG A  1 299 ? 67.147  144.168 -84.592  1.00 40.11  ? 299  ARG A O     1 
ATOM   2200  C CB    . ARG A  1 299 ? 69.622  145.624 -83.771  1.00 43.30  ? 299  ARG A CB    1 
ATOM   2201  C CG    . ARG A  1 299 ? 70.501  146.870 -83.596  1.00 47.94  ? 299  ARG A CG    1 
ATOM   2202  C CD    . ARG A  1 299 ? 71.952  146.649 -83.958  1.00 49.79  ? 299  ARG A CD    1 
ATOM   2203  N NE    . ARG A  1 299 ? 72.055  145.964 -85.234  1.00 53.59  ? 299  ARG A NE    1 
ATOM   2204  C CZ    . ARG A  1 299 ? 73.196  145.612 -85.815  1.00 55.03  ? 299  ARG A CZ    1 
ATOM   2205  N NH1   . ARG A  1 299 ? 74.363  145.885 -85.238  1.00 54.58  ? 299  ARG A NH1   1 
ATOM   2206  N NH2   . ARG A  1 299 ? 73.163  144.963 -86.974  1.00 56.70  ? 299  ARG A NH2   1 
ATOM   2207  N N     . GLY A  1 300 ? 66.693  144.151 -82.418  1.00 38.22  ? 300  GLY A N     1 
ATOM   2208  C CA    . GLY A  1 300 ? 65.824  143.000 -82.556  1.00 36.89  ? 300  GLY A CA    1 
ATOM   2209  C C     . GLY A  1 300 ? 66.505  141.649 -82.421  1.00 36.53  ? 300  GLY A C     1 
ATOM   2210  O O     . GLY A  1 300 ? 65.867  140.610 -82.644  1.00 34.28  ? 300  GLY A O     1 
ATOM   2211  N N     . ARG A  1 301 ? 67.785  141.662 -82.044  1.00 35.24  ? 301  ARG A N     1 
ATOM   2212  C CA    . ARG A  1 301 ? 68.570  140.438 -81.857  1.00 34.89  ? 301  ARG A CA    1 
ATOM   2213  C C     . ARG A  1 301 ? 68.390  139.756 -80.491  1.00 33.90  ? 301  ARG A C     1 
ATOM   2214  O O     . ARG A  1 301 ? 68.062  140.391 -79.485  1.00 33.31  ? 301  ARG A O     1 
ATOM   2215  C CB    . ARG A  1 301 ? 70.049  140.731 -82.092  1.00 34.26  ? 301  ARG A CB    1 
ATOM   2216  C CG    . ARG A  1 301 ? 70.281  141.323 -83.458  1.00 36.30  ? 301  ARG A CG    1 
ATOM   2217  C CD    . ARG A  1 301 ? 71.708  141.690 -83.683  1.00 35.35  ? 301  ARG A CD    1 
ATOM   2218  N NE    . ARG A  1 301 ? 72.135  142.704 -82.744  1.00 36.87  ? 301  ARG A NE    1 
ATOM   2219  C CZ    . ARG A  1 301 ? 73.313  143.316 -82.808  1.00 40.50  ? 301  ARG A CZ    1 
ATOM   2220  N NH1   . ARG A  1 301 ? 74.165  143.004 -83.782  1.00 40.25  ? 301  ARG A NH1   1 
ATOM   2221  N NH2   . ARG A  1 301 ? 73.645  144.228 -81.893  1.00 40.46  ? 301  ARG A NH2   1 
ATOM   2222  N N     . ILE A  1 302 ? 68.580  138.442 -80.490  1.00 32.42  ? 302  ILE A N     1 
ATOM   2223  C CA    . ILE A  1 302 ? 68.461  137.646 -79.289  1.00 30.74  ? 302  ILE A CA    1 
ATOM   2224  C C     . ILE A  1 302 ? 69.789  137.711 -78.562  1.00 31.00  ? 302  ILE A C     1 
ATOM   2225  O O     . ILE A  1 302 ? 70.801  137.269 -79.077  1.00 33.05  ? 302  ILE A O     1 
ATOM   2226  C CB    . ILE A  1 302 ? 68.155  136.185 -79.625  1.00 28.38  ? 302  ILE A CB    1 
ATOM   2227  C CG1   . ILE A  1 302 ? 66.891  136.098 -80.484  1.00 26.07  ? 302  ILE A CG1   1 
ATOM   2228  C CG2   . ILE A  1 302 ? 67.982  135.407 -78.341  1.00 29.17  ? 302  ILE A CG2   1 
ATOM   2229  C CD1   . ILE A  1 302 ? 66.477  134.675 -80.872  1.00 21.96  ? 302  ILE A CD1   1 
ATOM   2230  N N     . PRO A  1 303 ? 69.812  138.290 -77.361  1.00 31.51  ? 303  PRO A N     1 
ATOM   2231  C CA    . PRO A  1 303 ? 71.095  138.354 -76.652  1.00 30.55  ? 303  PRO A CA    1 
ATOM   2232  C C     . PRO A  1 303 ? 71.502  136.998 -76.042  1.00 30.37  ? 303  PRO A C     1 
ATOM   2233  O O     . PRO A  1 303 ? 70.673  136.273 -75.500  1.00 30.13  ? 303  PRO A O     1 
ATOM   2234  C CB    . PRO A  1 303 ? 70.863  139.468 -75.629  1.00 31.18  ? 303  PRO A CB    1 
ATOM   2235  C CG    . PRO A  1 303 ? 69.386  139.443 -75.408  1.00 29.58  ? 303  PRO A CG    1 
ATOM   2236  C CD    . PRO A  1 303 ? 68.807  139.177 -76.751  1.00 29.80  ? 303  PRO A CD    1 
ATOM   2237  N N     . VAL A  1 304 ? 72.781  136.652 -76.163  1.00 30.04  ? 304  VAL A N     1 
ATOM   2238  C CA    . VAL A  1 304 ? 73.279  135.373 -75.674  1.00 29.29  ? 304  VAL A CA    1 
ATOM   2239  C C     . VAL A  1 304 ? 74.643  135.478 -75.000  1.00 28.95  ? 304  VAL A C     1 
ATOM   2240  O O     . VAL A  1 304 ? 75.379  136.451 -75.187  1.00 29.15  ? 304  VAL A O     1 
ATOM   2241  C CB    . VAL A  1 304 ? 73.382  134.346 -76.843  1.00 29.08  ? 304  VAL A CB    1 
ATOM   2242  C CG1   . VAL A  1 304 ? 72.020  134.160 -77.498  1.00 28.11  ? 304  VAL A CG1   1 
ATOM   2243  C CG2   . VAL A  1 304 ? 74.391  134.820 -77.892  1.00 27.45  ? 304  VAL A CG2   1 
ATOM   2244  N N     . ASN A  1 305 ? 74.980  134.470 -74.210  1.00 27.66  ? 305  ASN A N     1 
ATOM   2245  C CA    . ASN A  1 305 ? 76.262  134.470 -73.531  1.00 26.42  ? 305  ASN A CA    1 
ATOM   2246  C C     . ASN A  1 305 ? 77.315  133.751 -74.402  1.00 26.91  ? 305  ASN A C     1 
ATOM   2247  O O     . ASN A  1 305 ? 77.025  133.386 -75.548  1.00 25.79  ? 305  ASN A O     1 
ATOM   2248  C CB    . ASN A  1 305 ? 76.137  133.783 -72.180  1.00 24.92  ? 305  ASN A CB    1 
ATOM   2249  C CG    . ASN A  1 305 ? 75.738  132.325 -72.301  1.00 22.88  ? 305  ASN A CG    1 
ATOM   2250  O OD1   . ASN A  1 305 ? 75.917  131.695 -73.335  1.00 21.51  ? 305  ASN A OD1   1 
ATOM   2251  N ND2   . ASN A  1 305 ? 75.200  131.783 -71.228  1.00 25.28  ? 305  ASN A ND2   1 
ATOM   2252  N N     . THR A  1 306 ? 78.517  133.521 -73.856  1.00 26.24  ? 306  THR A N     1 
ATOM   2253  C CA    . THR A  1 306 ? 79.592  132.891 -74.640  1.00 25.99  ? 306  THR A CA    1 
ATOM   2254  C C     . THR A  1 306 ? 79.360  131.443 -75.117  1.00 25.72  ? 306  THR A C     1 
ATOM   2255  O O     . THR A  1 306 ? 80.100  130.944 -75.948  1.00 25.12  ? 306  THR A O     1 
ATOM   2256  C CB    . THR A  1 306 ? 80.969  133.029 -73.926  1.00 23.40  ? 306  THR A CB    1 
ATOM   2257  O OG1   . THR A  1 306 ? 81.025  132.189 -72.770  1.00 25.17  ? 306  THR A OG1   1 
ATOM   2258  C CG2   . THR A  1 306 ? 81.192  134.489 -73.503  1.00 18.98  ? 306  THR A CG2   1 
ATOM   2259  N N     . ARG A  1 307 ? 78.316  130.792 -74.608  1.00 26.05  ? 307  ARG A N     1 
ATOM   2260  C CA    . ARG A  1 307 ? 77.950  129.439 -75.034  1.00 27.32  ? 307  ARG A CA    1 
ATOM   2261  C C     . ARG A  1 307 ? 76.711  129.532 -75.942  1.00 26.91  ? 307  ARG A C     1 
ATOM   2262  O O     . ARG A  1 307 ? 76.114  128.520 -76.314  1.00 25.72  ? 307  ARG A O     1 
ATOM   2263  C CB    . ARG A  1 307 ? 77.642  128.533 -73.827  1.00 27.66  ? 307  ARG A CB    1 
ATOM   2264  C CG    . ARG A  1 307 ? 78.824  127.695 -73.353  1.00 26.38  ? 307  ARG A CG    1 
ATOM   2265  C CD    . ARG A  1 307 ? 79.976  128.567 -72.867  1.00 28.72  ? 307  ARG A CD    1 
ATOM   2266  N NE    . ARG A  1 307 ? 81.118  127.758 -72.453  1.00 28.16  ? 307  ARG A NE    1 
ATOM   2267  C CZ    . ARG A  1 307 ? 82.200  128.218 -71.840  1.00 27.56  ? 307  ARG A CZ    1 
ATOM   2268  N NH1   . ARG A  1 307 ? 82.316  129.503 -71.555  1.00 26.64  ? 307  ARG A NH1   1 
ATOM   2269  N NH2   . ARG A  1 307 ? 83.165  127.372 -71.512  1.00 29.85  ? 307  ARG A NH2   1 
ATOM   2270  N N     . PHE A  1 308 ? 76.355  130.771 -76.289  1.00 27.00  ? 308  PHE A N     1 
ATOM   2271  C CA    . PHE A  1 308 ? 75.215  131.095 -77.150  1.00 27.11  ? 308  PHE A CA    1 
ATOM   2272  C C     . PHE A  1 308 ? 73.862  130.846 -76.489  1.00 28.62  ? 308  PHE A C     1 
ATOM   2273  O O     . PHE A  1 308 ? 72.833  130.702 -77.171  1.00 27.76  ? 308  PHE A O     1 
ATOM   2274  C CB    . PHE A  1 308 ? 75.326  130.358 -78.477  1.00 24.73  ? 308  PHE A CB    1 
ATOM   2275  C CG    . PHE A  1 308 ? 76.403  130.904 -79.364  1.00 25.94  ? 308  PHE A CG    1 
ATOM   2276  C CD1   . PHE A  1 308 ? 76.161  132.044 -80.151  1.00 24.98  ? 308  PHE A CD1   1 
ATOM   2277  C CD2   . PHE A  1 308 ? 77.679  130.319 -79.388  1.00 23.78  ? 308  PHE A CD2   1 
ATOM   2278  C CE1   . PHE A  1 308 ? 77.166  132.606 -80.953  1.00 24.21  ? 308  PHE A CE1   1 
ATOM   2279  C CE2   . PHE A  1 308 ? 78.698  130.873 -80.187  1.00 26.28  ? 308  PHE A CE2   1 
ATOM   2280  C CZ    . PHE A  1 308 ? 78.441  132.025 -80.975  1.00 25.05  ? 308  PHE A CZ    1 
ATOM   2281  N N     . GLN A  1 309 ? 73.893  130.849 -75.149  1.00 29.79  ? 309  GLN A N     1 
ATOM   2282  C CA    . GLN A  1 309 ? 72.719  130.657 -74.297  1.00 31.51  ? 309  GLN A CA    1 
ATOM   2283  C C     . GLN A  1 309 ? 71.925  131.949 -74.072  1.00 31.54  ? 309  GLN A C     1 
ATOM   2284  O O     . GLN A  1 309 ? 72.487  132.993 -73.682  1.00 32.41  ? 309  GLN A O     1 
ATOM   2285  C CB    . GLN A  1 309 ? 73.122  130.114 -72.919  1.00 30.31  ? 309  GLN A CB    1 
ATOM   2286  C CG    . GLN A  1 309 ? 73.459  128.642 -72.855  1.00 31.84  ? 309  GLN A CG    1 
ATOM   2287  C CD    . GLN A  1 309 ? 73.992  128.225 -71.491  1.00 34.37  ? 309  GLN A CD    1 
ATOM   2288  O OE1   . GLN A  1 309 ? 74.059  129.026 -70.559  1.00 35.33  ? 309  GLN A OE1   1 
ATOM   2289  N NE2   . GLN A  1 309 ? 74.370  126.966 -71.371  1.00 35.73  ? 309  GLN A NE2   1 
ATOM   2290  N N     . THR A  1 310 ? 70.619  131.862 -74.324  1.00 30.47  ? 310  THR A N     1 
ATOM   2291  C CA    . THR A  1 310 ? 69.730  132.987 -74.101  1.00 30.64  ? 310  THR A CA    1 
ATOM   2292  C C     . THR A  1 310 ? 69.590  133.059 -72.572  1.00 31.62  ? 310  THR A C     1 
ATOM   2293  O O     . THR A  1 310 ? 70.292  132.369 -71.835  1.00 30.52  ? 310  THR A O     1 
ATOM   2294  C CB    . THR A  1 310 ? 68.289  132.785 -74.777  1.00 29.97  ? 310  THR A CB    1 
ATOM   2295  O OG1   . THR A  1 310 ? 67.500  131.846 -74.034  1.00 26.29  ? 310  THR A OG1   1 
ATOM   2296  C CG2   . THR A  1 310 ? 68.413  132.291 -76.218  1.00 25.96  ? 310  THR A CG2   1 
ATOM   2297  N N     . LYS A  1 311 ? 68.707  133.922 -72.107  1.00 33.42  ? 311  LYS A N     1 
ATOM   2298  C CA    . LYS A  1 311 ? 68.431  134.086 -70.680  1.00 34.86  ? 311  LYS A CA    1 
ATOM   2299  C C     . LYS A  1 311 ? 68.039  132.710 -70.084  1.00 33.66  ? 311  LYS A C     1 
ATOM   2300  O O     . LYS A  1 311 ? 68.292  132.418 -68.920  1.00 33.07  ? 311  LYS A O     1 
ATOM   2301  C CB    . LYS A  1 311 ? 67.293  135.102 -70.572  1.00 39.31  ? 311  LYS A CB    1 
ATOM   2302  C CG    . LYS A  1 311 ? 66.765  135.468 -69.204  1.00 44.31  ? 311  LYS A CG    1 
ATOM   2303  C CD    . LYS A  1 311 ? 65.828  136.667 -69.391  1.00 46.91  ? 311  LYS A CD    1 
ATOM   2304  C CE    . LYS A  1 311 ? 65.210  137.124 -68.091  1.00 49.68  ? 311  LYS A CE    1 
ATOM   2305  N NZ    . LYS A  1 311 ? 64.490  138.409 -68.304  1.00 51.82  ? 311  LYS A NZ    1 
ATOM   2306  N N     . ILE A  1 312 ? 67.417  131.870 -70.900  1.00 31.81  ? 312  ILE A N     1 
ATOM   2307  C CA    . ILE A  1 312 ? 67.019  130.532 -70.473  1.00 31.53  ? 312  ILE A CA    1 
ATOM   2308  C C     . ILE A  1 312 ? 68.086  129.581 -71.023  1.00 31.39  ? 312  ILE A C     1 
ATOM   2309  O O     . ILE A  1 312 ? 68.055  129.217 -72.186  1.00 30.09  ? 312  ILE A O     1 
ATOM   2310  C CB    . ILE A  1 312 ? 65.618  130.212 -71.018  1.00 31.38  ? 312  ILE A CB    1 
ATOM   2311  C CG1   . ILE A  1 312 ? 64.623  131.187 -70.350  1.00 31.78  ? 312  ILE A CG1   1 
ATOM   2312  C CG2   . ILE A  1 312 ? 65.285  128.736 -70.805  1.00 27.32  ? 312  ILE A CG2   1 
ATOM   2313  C CD1   . ILE A  1 312 ? 63.201  131.112 -70.813  1.00 31.16  ? 312  ILE A CD1   1 
ATOM   2314  N N     . PRO A  1 313 ? 69.039  129.165 -70.163  1.00 31.83  ? 313  PRO A N     1 
ATOM   2315  C CA    . PRO A  1 313 ? 70.184  128.284 -70.429  1.00 31.13  ? 313  PRO A CA    1 
ATOM   2316  C C     . PRO A  1 313 ? 70.040  127.045 -71.333  1.00 29.92  ? 313  PRO A C     1 
ATOM   2317  O O     . PRO A  1 313 ? 71.036  126.563 -71.874  1.00 28.90  ? 313  PRO A O     1 
ATOM   2318  C CB    . PRO A  1 313 ? 70.682  127.953 -69.017  1.00 31.71  ? 313  PRO A CB    1 
ATOM   2319  C CG    . PRO A  1 313 ? 69.426  127.899 -68.260  1.00 29.86  ? 313  PRO A CG    1 
ATOM   2320  C CD    . PRO A  1 313 ? 68.753  129.168 -68.718  1.00 29.58  ? 313  PRO A CD    1 
ATOM   2321  N N     . ASN A  1 314 ? 68.836  126.523 -71.518  1.00 28.93  ? 314  ASN A N     1 
ATOM   2322  C CA    . ASN A  1 314 ? 68.721  125.368 -72.396  1.00 28.34  ? 314  ASN A CA    1 
ATOM   2323  C C     . ASN A  1 314 ? 68.202  125.824 -73.759  1.00 28.92  ? 314  ASN A C     1 
ATOM   2324  O O     . ASN A  1 314 ? 67.975  125.010 -74.660  1.00 29.20  ? 314  ASN A O     1 
ATOM   2325  C CB    . ASN A  1 314 ? 67.807  124.301 -71.790  1.00 27.96  ? 314  ASN A CB    1 
ATOM   2326  C CG    . ASN A  1 314 ? 66.337  124.707 -71.800  1.00 30.56  ? 314  ASN A CG    1 
ATOM   2327  O OD1   . ASN A  1 314 ? 65.931  125.649 -71.119  1.00 31.42  ? 314  ASN A OD1   1 
ATOM   2328  N ND2   . ASN A  1 314 ? 65.537  123.998 -72.588  1.00 28.00  ? 314  ASN A ND2   1 
ATOM   2329  N N     . ILE A  1 315 ? 68.017  127.139 -73.894  1.00 28.22  ? 315  ILE A N     1 
ATOM   2330  C CA    . ILE A  1 315 ? 67.547  127.757 -75.133  1.00 27.10  ? 315  ILE A CA    1 
ATOM   2331  C C     . ILE A  1 315 ? 68.696  128.626 -75.642  1.00 26.36  ? 315  ILE A C     1 
ATOM   2332  O O     . ILE A  1 315 ? 69.208  129.516 -74.959  1.00 24.67  ? 315  ILE A O     1 
ATOM   2333  C CB    . ILE A  1 315 ? 66.239  128.603 -74.913  1.00 27.38  ? 315  ILE A CB    1 
ATOM   2334  C CG1   . ILE A  1 315 ? 65.139  127.715 -74.330  1.00 25.28  ? 315  ILE A CG1   1 
ATOM   2335  C CG2   . ILE A  1 315 ? 65.727  129.180 -76.260  1.00 26.42  ? 315  ILE A CG2   1 
ATOM   2336  C CD1   . ILE A  1 315 ? 63.798  128.422 -74.148  1.00 24.37  ? 315  ILE A CD1   1 
ATOM   2337  N N     . TYR A  1 316 ? 69.103  128.328 -76.863  1.00 26.35  ? 316  TYR A N     1 
ATOM   2338  C CA    . TYR A  1 316 ? 70.221  128.989 -77.475  1.00 25.38  ? 316  TYR A CA    1 
ATOM   2339  C C     . TYR A  1 316 ? 69.794  129.633 -78.784  1.00 25.64  ? 316  TYR A C     1 
ATOM   2340  O O     . TYR A  1 316 ? 68.744  129.316 -79.325  1.00 26.67  ? 316  TYR A O     1 
ATOM   2341  C CB    . TYR A  1 316 ? 71.316  127.959 -77.784  1.00 25.53  ? 316  TYR A CB    1 
ATOM   2342  C CG    . TYR A  1 316 ? 71.827  127.118 -76.631  1.00 24.38  ? 316  TYR A CG    1 
ATOM   2343  C CD1   . TYR A  1 316 ? 71.036  126.128 -76.055  1.00 24.01  ? 316  TYR A CD1   1 
ATOM   2344  C CD2   . TYR A  1 316 ? 73.144  127.252 -76.175  1.00 24.99  ? 316  TYR A CD2   1 
ATOM   2345  C CE1   . TYR A  1 316 ? 71.540  125.278 -75.060  1.00 24.02  ? 316  TYR A CE1   1 
ATOM   2346  C CE2   . TYR A  1 316 ? 73.664  126.408 -75.177  1.00 24.55  ? 316  TYR A CE2   1 
ATOM   2347  C CZ    . TYR A  1 316 ? 72.857  125.421 -74.628  1.00 25.68  ? 316  TYR A CZ    1 
ATOM   2348  O OH    . TYR A  1 316 ? 73.366  124.547 -73.676  1.00 26.47  ? 316  TYR A OH    1 
ATOM   2349  N N     . ALA A  1 317 ? 70.631  130.529 -79.293  1.00 25.50  ? 317  ALA A N     1 
ATOM   2350  C CA    . ALA A  1 317 ? 70.376  131.201 -80.558  1.00 24.37  ? 317  ALA A CA    1 
ATOM   2351  C C     . ALA A  1 317 ? 71.724  131.532 -81.177  1.00 23.71  ? 317  ALA A C     1 
ATOM   2352  O O     . ALA A  1 317 ? 72.663  131.913 -80.490  1.00 21.97  ? 317  ALA A O     1 
ATOM   2353  C CB    . ALA A  1 317 ? 69.575  132.463 -80.335  1.00 22.89  ? 317  ALA A CB    1 
ATOM   2354  N N     . ILE A  1 318 ? 71.802  131.372 -82.490  1.00 25.83  ? 318  ILE A N     1 
ATOM   2355  C CA    . ILE A  1 318 ? 73.008  131.641 -83.263  1.00 25.48  ? 318  ILE A CA    1 
ATOM   2356  C C     . ILE A  1 318 ? 72.610  132.244 -84.620  1.00 27.55  ? 318  ILE A C     1 
ATOM   2357  O O     . ILE A  1 318 ? 71.421  132.370 -84.925  1.00 28.91  ? 318  ILE A O     1 
ATOM   2358  C CB    . ILE A  1 318 ? 73.770  130.330 -83.486  1.00 24.18  ? 318  ILE A CB    1 
ATOM   2359  C CG1   . ILE A  1 318 ? 72.874  129.308 -84.188  1.00 23.07  ? 318  ILE A CG1   1 
ATOM   2360  C CG2   . ILE A  1 318 ? 74.188  129.736 -82.139  1.00 25.35  ? 318  ILE A CG2   1 
ATOM   2361  C CD1   . ILE A  1 318 ? 72.972  129.302 -85.678  1.00 21.30  ? 318  ILE A CD1   1 
ATOM   2362  N N     . GLY A  1 319 ? 73.598  132.624 -85.432  1.00 29.21  ? 319  GLY A N     1 
ATOM   2363  C CA    . GLY A  1 319 ? 73.313  133.148 -86.762  1.00 28.30  ? 319  GLY A CA    1 
ATOM   2364  C C     . GLY A  1 319 ? 72.816  134.577 -86.876  1.00 29.27  ? 319  GLY A C     1 
ATOM   2365  O O     . GLY A  1 319 ? 73.059  135.377 -85.978  1.00 31.07  ? 319  GLY A O     1 
ATOM   2366  N N     . ASP A  1 320 ? 72.102  134.889 -87.961  1.00 27.87  ? 320  ASP A N     1 
ATOM   2367  C CA    . ASP A  1 320 ? 71.608  136.240 -88.191  1.00 27.24  ? 320  ASP A CA    1 
ATOM   2368  C C     . ASP A  1 320 ? 70.739  136.841 -87.103  1.00 27.53  ? 320  ASP A C     1 
ATOM   2369  O O     . ASP A  1 320 ? 70.570  138.054 -87.078  1.00 30.18  ? 320  ASP A O     1 
ATOM   2370  C CB    . ASP A  1 320 ? 70.863  136.342 -89.522  1.00 27.67  ? 320  ASP A CB    1 
ATOM   2371  C CG    . ASP A  1 320 ? 71.793  136.535 -90.717  1.00 29.31  ? 320  ASP A CG    1 
ATOM   2372  O OD1   . ASP A  1 320 ? 73.022  136.654 -90.558  1.00 30.42  ? 320  ASP A OD1   1 
ATOM   2373  O OD2   . ASP A  1 320 ? 71.276  136.569 -91.848  1.00 32.86  ? 320  ASP A OD2   1 
ATOM   2374  N N     . VAL A  1 321 ? 70.184  136.040 -86.201  1.00 25.68  ? 321  VAL A N     1 
ATOM   2375  C CA    . VAL A  1 321 ? 69.367  136.640 -85.151  1.00 24.87  ? 321  VAL A CA    1 
ATOM   2376  C C     . VAL A  1 321 ? 70.160  137.128 -83.960  1.00 24.75  ? 321  VAL A C     1 
ATOM   2377  O O     . VAL A  1 321 ? 69.611  137.782 -83.090  1.00 24.23  ? 321  VAL A O     1 
ATOM   2378  C CB    . VAL A  1 321 ? 68.309  135.688 -84.609  1.00 25.49  ? 321  VAL A CB    1 
ATOM   2379  C CG1   . VAL A  1 321 ? 67.275  135.443 -85.666  1.00 27.25  ? 321  VAL A CG1   1 
ATOM   2380  C CG2   . VAL A  1 321 ? 68.966  134.397 -84.118  1.00 22.98  ? 321  VAL A CG2   1 
ATOM   2381  N N     . VAL A  1 322 ? 71.444  136.792 -83.897  1.00 25.81  ? 322  VAL A N     1 
ATOM   2382  C CA    . VAL A  1 322 ? 72.262  137.234 -82.784  1.00 25.52  ? 322  VAL A CA    1 
ATOM   2383  C C     . VAL A  1 322 ? 73.326  138.197 -83.307  1.00 24.97  ? 322  VAL A C     1 
ATOM   2384  O O     . VAL A  1 322 ? 73.444  138.394 -84.504  1.00 24.79  ? 322  VAL A O     1 
ATOM   2385  C CB    . VAL A  1 322 ? 72.883  136.012 -82.020  1.00 27.70  ? 322  VAL A CB    1 
ATOM   2386  C CG1   . VAL A  1 322 ? 71.751  135.069 -81.571  1.00 27.64  ? 322  VAL A CG1   1 
ATOM   2387  C CG2   . VAL A  1 322 ? 73.880  135.272 -82.876  1.00 25.79  ? 322  VAL A CG2   1 
ATOM   2388  N N     . ALA A  1 323 ? 74.071  138.824 -82.411  1.00 25.20  ? 323  ALA A N     1 
ATOM   2389  C CA    . ALA A  1 323 ? 75.103  139.782 -82.800  1.00 25.71  ? 323  ALA A CA    1 
ATOM   2390  C C     . ALA A  1 323 ? 76.227  139.200 -83.652  1.00 25.68  ? 323  ALA A C     1 
ATOM   2391  O O     . ALA A  1 323 ? 76.414  137.980 -83.735  1.00 26.10  ? 323  ALA A O     1 
ATOM   2392  C CB    . ALA A  1 323 ? 75.695  140.421 -81.560  1.00 25.01  ? 323  ALA A CB    1 
ATOM   2393  N N     . GLY A  1 324 ? 77.000  140.096 -84.257  1.00 25.55  ? 324  GLY A N     1 
ATOM   2394  C CA    . GLY A  1 324 ? 78.115  139.692 -85.092  1.00 24.85  ? 324  GLY A CA    1 
ATOM   2395  C C     . GLY A  1 324 ? 77.734  139.861 -86.542  1.00 26.76  ? 324  GLY A C     1 
ATOM   2396  O O     . GLY A  1 324 ? 76.545  139.969 -86.852  1.00 27.35  ? 324  GLY A O     1 
ATOM   2397  N N     . PRO A  1 325 ? 78.713  139.850 -87.462  1.00 27.59  ? 325  PRO A N     1 
ATOM   2398  C CA    . PRO A  1 325 ? 78.444  140.012 -88.895  1.00 27.35  ? 325  PRO A CA    1 
ATOM   2399  C C     . PRO A  1 325 ? 77.419  139.031 -89.412  1.00 28.14  ? 325  PRO A C     1 
ATOM   2400  O O     . PRO A  1 325 ? 77.523  137.835 -89.155  1.00 27.80  ? 325  PRO A O     1 
ATOM   2401  C CB    . PRO A  1 325 ? 79.807  139.795 -89.530  1.00 26.79  ? 325  PRO A CB    1 
ATOM   2402  C CG    . PRO A  1 325 ? 80.443  138.809 -88.615  1.00 27.91  ? 325  PRO A CG    1 
ATOM   2403  C CD    . PRO A  1 325 ? 80.092  139.372 -87.250  1.00 28.40  ? 325  PRO A CD    1 
ATOM   2404  N N     . MET A  1 326 ? 76.428  139.545 -90.139  1.00 28.41  ? 326  MET A N     1 
ATOM   2405  C CA    . MET A  1 326 ? 75.377  138.708 -90.680  1.00 27.41  ? 326  MET A CA    1 
ATOM   2406  C C     . MET A  1 326 ? 75.841  138.053 -91.971  1.00 27.27  ? 326  MET A C     1 
ATOM   2407  O O     . MET A  1 326 ? 75.529  138.500 -93.088  1.00 28.78  ? 326  MET A O     1 
ATOM   2408  C CB    . MET A  1 326 ? 74.114  139.538 -90.891  1.00 27.71  ? 326  MET A CB    1 
ATOM   2409  C CG    . MET A  1 326 ? 73.515  140.060 -89.583  1.00 30.67  ? 326  MET A CG    1 
ATOM   2410  S SD    . MET A  1 326 ? 72.250  141.408 -89.757  1.00 33.26  ? 326  MET A SD    1 
ATOM   2411  C CE    . MET A  1 326 ? 70.749  140.464 -90.304  1.00 24.89  ? 326  MET A CE    1 
ATOM   2412  N N     . LEU A  1 327 ? 76.596  136.977 -91.794  1.00 25.22  ? 327  LEU A N     1 
ATOM   2413  C CA    . LEU A  1 327 ? 77.141  136.212 -92.898  1.00 24.15  ? 327  LEU A CA    1 
ATOM   2414  C C     . LEU A  1 327 ? 76.960  134.689 -92.765  1.00 24.49  ? 327  LEU A C     1 
ATOM   2415  O O     . LEU A  1 327 ? 76.834  134.159 -91.656  1.00 24.50  ? 327  LEU A O     1 
ATOM   2416  C CB    . LEU A  1 327 ? 78.606  136.596 -93.067  1.00 20.86  ? 327  LEU A CB    1 
ATOM   2417  C CG    . LEU A  1 327 ? 78.681  138.105 -93.342  1.00 22.31  ? 327  LEU A CG    1 
ATOM   2418  C CD1   . LEU A  1 327 ? 80.110  138.586 -93.269  1.00 20.50  ? 327  LEU A CD1   1 
ATOM   2419  C CD2   . LEU A  1 327 ? 78.061  138.398 -94.711  1.00 21.00  ? 327  LEU A CD2   1 
ATOM   2420  N N     . ALA A  1 328 ? 76.945  133.994 -93.901  1.00 23.91  ? 328  ALA A N     1 
ATOM   2421  C CA    . ALA A  1 328 ? 76.754  132.554 -93.910  1.00 25.54  ? 328  ALA A CA    1 
ATOM   2422  C C     . ALA A  1 328 ? 77.793  131.769 -93.120  1.00 27.29  ? 328  ALA A C     1 
ATOM   2423  O O     . ALA A  1 328 ? 77.445  130.920 -92.292  1.00 28.63  ? 328  ALA A O     1 
ATOM   2424  C CB    . ALA A  1 328 ? 76.691  132.036 -95.333  1.00 22.89  ? 328  ALA A CB    1 
ATOM   2425  N N     . HIS A  1 329 ? 79.067  132.029 -93.361  1.00 27.27  ? 329  HIS A N     1 
ATOM   2426  C CA    . HIS A  1 329 ? 80.077  131.280 -92.624  1.00 29.57  ? 329  HIS A CA    1 
ATOM   2427  C C     . HIS A  1 329 ? 80.078  131.584 -91.129  1.00 29.86  ? 329  HIS A C     1 
ATOM   2428  O O     . HIS A  1 329 ? 80.494  130.750 -90.330  1.00 30.40  ? 329  HIS A O     1 
ATOM   2429  C CB    . HIS A  1 329 ? 81.475  131.522 -93.196  1.00 30.16  ? 329  HIS A CB    1 
ATOM   2430  C CG    . HIS A  1 329 ? 81.721  132.937 -93.604  1.00 32.29  ? 329  HIS A CG    1 
ATOM   2431  N ND1   . HIS A  1 329 ? 81.015  133.544 -94.620  1.00 33.24  ? 329  HIS A ND1   1 
ATOM   2432  C CD2   . HIS A  1 329 ? 82.614  133.852 -93.160  1.00 31.89  ? 329  HIS A CD2   1 
ATOM   2433  C CE1   . HIS A  1 329 ? 81.468  134.773 -94.788  1.00 33.57  ? 329  HIS A CE1   1 
ATOM   2434  N NE2   . HIS A  1 329 ? 82.439  134.984 -93.916  1.00 32.43  ? 329  HIS A NE2   1 
ATOM   2435  N N     . LYS A  1 330 ? 79.616  132.774 -90.759  1.00 29.24  ? 330  LYS A N     1 
ATOM   2436  C CA    . LYS A  1 330 ? 79.555  133.169 -89.362  1.00 28.80  ? 330  LYS A CA    1 
ATOM   2437  C C     . LYS A  1 330 ? 78.465  132.356 -88.684  1.00 29.01  ? 330  LYS A C     1 
ATOM   2438  O O     . LYS A  1 330 ? 78.615  131.888 -87.557  1.00 27.68  ? 330  LYS A O     1 
ATOM   2439  C CB    . LYS A  1 330 ? 79.254  134.671 -89.265  1.00 28.32  ? 330  LYS A CB    1 
ATOM   2440  C CG    . LYS A  1 330 ? 79.100  135.230 -87.848  1.00 28.15  ? 330  LYS A CG    1 
ATOM   2441  C CD    . LYS A  1 330 ? 77.680  135.138 -87.364  1.00 27.75  ? 330  LYS A CD    1 
ATOM   2442  C CE    . LYS A  1 330 ? 77.427  136.159 -86.285  1.00 29.95  ? 330  LYS A CE    1 
ATOM   2443  N NZ    . LYS A  1 330 ? 76.021  136.055 -85.806  1.00 31.42  ? 330  LYS A NZ    1 
ATOM   2444  N N     . ALA A  1 331 ? 77.366  132.179 -89.402  1.00 29.05  ? 331  ALA A N     1 
ATOM   2445  C CA    . ALA A  1 331 ? 76.243  131.432 -88.876  1.00 28.63  ? 331  ALA A CA    1 
ATOM   2446  C C     . ALA A  1 331 ? 76.590  129.949 -88.698  1.00 27.20  ? 331  ALA A C     1 
ATOM   2447  O O     . ALA A  1 331 ? 76.291  129.368 -87.651  1.00 27.00  ? 331  ALA A O     1 
ATOM   2448  C CB    . ALA A  1 331 ? 75.044  131.591 -89.800  1.00 27.82  ? 331  ALA A CB    1 
ATOM   2449  N N     . GLU A  1 332 ? 77.232  129.351 -89.701  1.00 24.61  ? 332  GLU A N     1 
ATOM   2450  C CA    . GLU A  1 332 ? 77.594  127.941 -89.628  1.00 26.02  ? 332  GLU A CA    1 
ATOM   2451  C C     . GLU A  1 332 ? 78.580  127.649 -88.479  1.00 26.24  ? 332  GLU A C     1 
ATOM   2452  O O     . GLU A  1 332 ? 78.424  126.654 -87.767  1.00 26.00  ? 332  GLU A O     1 
ATOM   2453  C CB    . GLU A  1 332 ? 78.180  127.463 -90.967  1.00 26.57  ? 332  GLU A CB    1 
ATOM   2454  C CG    . GLU A  1 332 ? 77.282  127.725 -92.184  1.00 30.47  ? 332  GLU A CG    1 
ATOM   2455  C CD    . GLU A  1 332 ? 77.817  127.089 -93.480  1.00 34.06  ? 332  GLU A CD    1 
ATOM   2456  O OE1   . GLU A  1 332 ? 78.983  126.656 -93.489  1.00 36.82  ? 332  GLU A OE1   1 
ATOM   2457  O OE2   . GLU A  1 332 ? 77.082  127.030 -94.491  1.00 36.11  ? 332  GLU A OE2   1 
ATOM   2458  N N     . ASP A  1 333 ? 79.573  128.522 -88.290  1.00 25.87  ? 333  ASP A N     1 
ATOM   2459  C CA    . ASP A  1 333 ? 80.562  128.344 -87.224  1.00 28.13  ? 333  ASP A CA    1 
ATOM   2460  C C     . ASP A  1 333 ? 79.891  128.414 -85.864  1.00 27.54  ? 333  ASP A C     1 
ATOM   2461  O O     . ASP A  1 333 ? 80.239  127.667 -84.972  1.00 25.32  ? 333  ASP A O     1 
ATOM   2462  C CB    . ASP A  1 333 ? 81.670  129.410 -87.293  1.00 31.41  ? 333  ASP A CB    1 
ATOM   2463  C CG    . ASP A  1 333 ? 82.820  129.014 -88.221  1.00 34.98  ? 333  ASP A CG    1 
ATOM   2464  O OD1   . ASP A  1 333 ? 82.540  128.554 -89.349  1.00 36.21  ? 333  ASP A OD1   1 
ATOM   2465  O OD2   . ASP A  1 333 ? 84.005  129.166 -87.830  1.00 38.52  ? 333  ASP A OD2   1 
ATOM   2466  N N     . GLU A  1 334 ? 78.920  129.313 -85.713  1.00 28.62  ? 334  GLU A N     1 
ATOM   2467  C CA    . GLU A  1 334 ? 78.213  129.443 -84.443  1.00 29.68  ? 334  GLU A CA    1 
ATOM   2468  C C     . GLU A  1 334 ? 77.332  128.235 -84.182  1.00 29.91  ? 334  GLU A C     1 
ATOM   2469  O O     . GLU A  1 334 ? 77.166  127.810 -83.038  1.00 30.17  ? 334  GLU A O     1 
ATOM   2470  C CB    . GLU A  1 334 ? 77.373  130.713 -84.414  1.00 30.46  ? 334  GLU A CB    1 
ATOM   2471  C CG    . GLU A  1 334 ? 78.212  131.963 -84.510  1.00 33.03  ? 334  GLU A CG    1 
ATOM   2472  C CD    . GLU A  1 334 ? 77.410  133.222 -84.285  1.00 35.61  ? 334  GLU A CD    1 
ATOM   2473  O OE1   . GLU A  1 334 ? 76.222  133.231 -84.662  1.00 38.68  ? 334  GLU A OE1   1 
ATOM   2474  O OE2   . GLU A  1 334 ? 77.960  134.204 -83.746  1.00 36.75  ? 334  GLU A OE2   1 
ATOM   2475  N N     . GLY A  1 335 ? 76.771  127.684 -85.249  1.00 28.85  ? 335  GLY A N     1 
ATOM   2476  C CA    . GLY A  1 335 ? 75.947  126.508 -85.101  1.00 29.35  ? 335  GLY A CA    1 
ATOM   2477  C C     . GLY A  1 335 ? 76.807  125.377 -84.571  1.00 27.81  ? 335  GLY A C     1 
ATOM   2478  O O     . GLY A  1 335 ? 76.461  124.738 -83.579  1.00 30.22  ? 335  GLY A O     1 
ATOM   2479  N N     . ILE A  1 336 ? 77.938  125.143 -85.225  1.00 25.82  ? 336  ILE A N     1 
ATOM   2480  C CA    . ILE A  1 336 ? 78.864  124.097 -84.808  1.00 24.74  ? 336  ILE A CA    1 
ATOM   2481  C C     . ILE A  1 336 ? 79.436  124.228 -83.382  1.00 23.77  ? 336  ILE A C     1 
ATOM   2482  O O     . ILE A  1 336 ? 79.386  123.272 -82.608  1.00 21.70  ? 336  ILE A O     1 
ATOM   2483  C CB    . ILE A  1 336 ? 80.013  123.986 -85.796  1.00 24.72  ? 336  ILE A CB    1 
ATOM   2484  C CG1   . ILE A  1 336 ? 79.461  123.508 -87.148  1.00 26.97  ? 336  ILE A CG1   1 
ATOM   2485  C CG2   . ILE A  1 336 ? 81.008  122.982 -85.297  1.00 25.50  ? 336  ILE A CG2   1 
ATOM   2486  C CD1   . ILE A  1 336 ? 80.344  123.786 -88.339  1.00 26.16  ? 336  ILE A CD1   1 
ATOM   2487  N N     . ILE A  1 337 ? 79.950  125.403 -83.019  1.00 22.88  ? 337  ILE A N     1 
ATOM   2488  C CA    . ILE A  1 337 ? 80.513  125.563 -81.688  1.00 24.66  ? 337  ILE A CA    1 
ATOM   2489  C C     . ILE A  1 337 ? 79.441  125.551 -80.603  1.00 26.79  ? 337  ILE A C     1 
ATOM   2490  O O     . ILE A  1 337 ? 79.704  125.122 -79.484  1.00 26.91  ? 337  ILE A O     1 
ATOM   2491  C CB    . ILE A  1 337 ? 81.426  126.864 -81.566  1.00 25.04  ? 337  ILE A CB    1 
ATOM   2492  C CG1   . ILE A  1 337 ? 80.601  128.152 -81.693  1.00 24.51  ? 337  ILE A CG1   1 
ATOM   2493  C CG2   . ILE A  1 337 ? 82.514  126.845 -82.648  1.00 22.68  ? 337  ILE A CG2   1 
ATOM   2494  C CD1   . ILE A  1 337 ? 81.428  129.411 -81.728  1.00 18.92  ? 337  ILE A CD1   1 
ATOM   2495  N N     . CYS A  1 338 ? 78.226  125.993 -80.927  1.00 27.33  ? 338  CYS A N     1 
ATOM   2496  C CA    . CYS A  1 338 ? 77.161  125.998 -79.936  1.00 27.00  ? 338  CYS A CA    1 
ATOM   2497  C C     . CYS A  1 338 ? 76.823  124.563 -79.522  1.00 26.62  ? 338  CYS A C     1 
ATOM   2498  O O     . CYS A  1 338 ? 76.662  124.232 -78.342  1.00 24.58  ? 338  CYS A O     1 
ATOM   2499  C CB    . CYS A  1 338 ? 75.912  126.679 -80.507  1.00 26.89  ? 338  CYS A CB    1 
ATOM   2500  S SG    . CYS A  1 338 ? 74.450  126.631 -79.438  1.00 28.31  ? 338  CYS A SG    1 
ATOM   2501  N N     . VAL A  1 339 ? 76.725  123.716 -80.530  1.00 27.75  ? 339  VAL A N     1 
ATOM   2502  C CA    . VAL A  1 339 ? 76.372  122.326 -80.331  1.00 27.14  ? 339  VAL A CA    1 
ATOM   2503  C C     . VAL A  1 339 ? 77.515  121.567 -79.668  1.00 28.12  ? 339  VAL A C     1 
ATOM   2504  O O     . VAL A  1 339 ? 77.276  120.646 -78.872  1.00 29.11  ? 339  VAL A O     1 
ATOM   2505  C CB    . VAL A  1 339 ? 75.899  121.764 -81.696  1.00 26.39  ? 339  VAL A CB    1 
ATOM   2506  C CG1   . VAL A  1 339 ? 75.939  120.264 -81.747  1.00 26.62  ? 339  VAL A CG1   1 
ATOM   2507  C CG2   . VAL A  1 339 ? 74.470  122.263 -81.913  1.00 23.96  ? 339  VAL A CG2   1 
ATOM   2508  N N     . GLU A  1 340 ? 78.754  121.976 -79.941  1.00 27.58  ? 340  GLU A N     1 
ATOM   2509  C CA    . GLU A  1 340 ? 79.889  121.322 -79.292  1.00 27.40  ? 340  GLU A CA    1 
ATOM   2510  C C     . GLU A  1 340 ? 79.865  121.682 -77.807  1.00 27.62  ? 340  GLU A C     1 
ATOM   2511  O O     . GLU A  1 340 ? 80.253  120.858 -76.950  1.00 28.07  ? 340  GLU A O     1 
ATOM   2512  C CB    . GLU A  1 340 ? 81.233  121.745 -79.919  1.00 25.80  ? 340  GLU A CB    1 
ATOM   2513  C CG    . GLU A  1 340 ? 81.530  121.071 -81.271  1.00 25.88  ? 340  GLU A CG    1 
ATOM   2514  C CD    . GLU A  1 340 ? 82.745  121.652 -81.975  1.00 24.91  ? 340  GLU A CD    1 
ATOM   2515  O OE1   . GLU A  1 340 ? 83.123  122.800 -81.664  1.00 26.44  ? 340  GLU A OE1   1 
ATOM   2516  O OE2   . GLU A  1 340 ? 83.311  120.967 -82.847  1.00 24.92  ? 340  GLU A OE2   1 
ATOM   2517  N N     . GLY A  1 341 ? 79.400  122.904 -77.518  1.00 25.20  ? 341  GLY A N     1 
ATOM   2518  C CA    . GLY A  1 341 ? 79.311  123.378 -76.149  1.00 24.12  ? 341  GLY A CA    1 
ATOM   2519  C C     . GLY A  1 341 ? 78.300  122.569 -75.368  1.00 24.95  ? 341  GLY A C     1 
ATOM   2520  O O     . GLY A  1 341 ? 78.539  122.211 -74.205  1.00 21.40  ? 341  GLY A O     1 
ATOM   2521  N N     . MET A  1 342 ? 77.171  122.286 -76.029  1.00 25.50  ? 342  MET A N     1 
ATOM   2522  C CA    . MET A  1 342 ? 76.081  121.487 -75.459  1.00 26.51  ? 342  MET A CA    1 
ATOM   2523  C C     . MET A  1 342 ? 76.666  120.111 -75.113  1.00 26.68  ? 342  MET A C     1 
ATOM   2524  O O     . MET A  1 342 ? 76.213  119.450 -74.187  1.00 28.57  ? 342  MET A O     1 
ATOM   2525  C CB    . MET A  1 342 ? 74.918  121.323 -76.467  1.00 27.33  ? 342  MET A CB    1 
ATOM   2526  C CG    . MET A  1 342 ? 74.157  122.606 -76.884  1.00 28.26  ? 342  MET A CG    1 
ATOM   2527  S SD    . MET A  1 342 ? 72.767  122.214 -78.030  1.00 33.00  ? 342  MET A SD    1 
ATOM   2528  C CE    . MET A  1 342 ? 72.343  123.762 -78.695  1.00 29.93  ? 342  MET A CE    1 
ATOM   2529  N N     . ALA A  1 343 ? 77.673  119.695 -75.881  1.00 26.37  ? 343  ALA A N     1 
ATOM   2530  C CA    . ALA A  1 343 ? 78.378  118.425 -75.664  1.00 24.72  ? 343  ALA A CA    1 
ATOM   2531  C C     . ALA A  1 343 ? 79.530  118.633 -74.645  1.00 26.19  ? 343  ALA A C     1 
ATOM   2532  O O     . ALA A  1 343 ? 80.343  117.735 -74.400  1.00 23.86  ? 343  ALA A O     1 
ATOM   2533  C CB    . ALA A  1 343 ? 78.930  117.911 -76.971  1.00 21.79  ? 343  ALA A CB    1 
ATOM   2534  N N     . GLY A  1 344 ? 79.604  119.834 -74.071  1.00 25.85  ? 344  GLY A N     1 
ATOM   2535  C CA    . GLY A  1 344 ? 80.623  120.098 -73.079  1.00 26.30  ? 344  GLY A CA    1 
ATOM   2536  C C     . GLY A  1 344 ? 81.928  120.756 -73.467  1.00 26.24  ? 344  GLY A C     1 
ATOM   2537  O O     . GLY A  1 344 ? 82.638  121.212 -72.593  1.00 27.31  ? 344  GLY A O     1 
ATOM   2538  N N     . GLY A  1 345 ? 82.243  120.834 -74.753  1.00 27.83  ? 345  GLY A N     1 
ATOM   2539  C CA    . GLY A  1 345 ? 83.515  121.424 -75.164  1.00 27.77  ? 345  GLY A CA    1 
ATOM   2540  C C     . GLY A  1 345 ? 83.655  122.930 -75.200  1.00 27.40  ? 345  GLY A C     1 
ATOM   2541  O O     . GLY A  1 345 ? 82.701  123.656 -75.009  1.00 26.90  ? 345  GLY A O     1 
ATOM   2542  N N     . ALA A  1 346 ? 84.863  123.409 -75.442  1.00 28.32  ? 346  ALA A N     1 
ATOM   2543  C CA    . ALA A  1 346 ? 85.076  124.840 -75.501  1.00 29.00  ? 346  ALA A CA    1 
ATOM   2544  C C     . ALA A  1 346 ? 84.250  125.440 -76.644  1.00 31.12  ? 346  ALA A C     1 
ATOM   2545  O O     . ALA A  1 346 ? 83.924  124.752 -77.628  1.00 32.28  ? 346  ALA A O     1 
ATOM   2546  C CB    . ALA A  1 346 ? 86.528  125.127 -75.699  1.00 29.96  ? 346  ALA A CB    1 
ATOM   2547  N N     . VAL A  1 347 ? 83.915  126.723 -76.503  1.00 30.13  ? 347  VAL A N     1 
ATOM   2548  C CA    . VAL A  1 347 ? 83.115  127.451 -77.487  1.00 28.55  ? 347  VAL A CA    1 
ATOM   2549  C C     . VAL A  1 347 ? 83.850  128.754 -77.760  1.00 31.56  ? 347  VAL A C     1 
ATOM   2550  O O     . VAL A  1 347 ? 83.872  129.652 -76.921  1.00 33.55  ? 347  VAL A O     1 
ATOM   2551  C CB    . VAL A  1 347 ? 81.682  127.780 -76.934  1.00 26.96  ? 347  VAL A CB    1 
ATOM   2552  C CG1   . VAL A  1 347 ? 80.933  128.626 -77.933  1.00 24.15  ? 347  VAL A CG1   1 
ATOM   2553  C CG2   . VAL A  1 347 ? 80.889  126.489 -76.623  1.00 22.74  ? 347  VAL A CG2   1 
ATOM   2554  N N     . HIS A  1 348 ? 84.454  128.876 -78.932  1.00 33.34  ? 348  HIS A N     1 
ATOM   2555  C CA    . HIS A  1 348 ? 85.199  130.084 -79.240  1.00 34.56  ? 348  HIS A CA    1 
ATOM   2556  C C     . HIS A  1 348 ? 85.015  130.639 -80.622  1.00 34.31  ? 348  HIS A C     1 
ATOM   2557  O O     . HIS A  1 348 ? 85.005  129.913 -81.604  1.00 36.53  ? 348  HIS A O     1 
ATOM   2558  C CB    . HIS A  1 348 ? 86.697  129.855 -79.072  1.00 37.35  ? 348  HIS A CB    1 
ATOM   2559  C CG    . HIS A  1 348 ? 87.119  129.629 -77.664  1.00 41.24  ? 348  HIS A CG    1 
ATOM   2560  N ND1   . HIS A  1 348 ? 87.041  130.611 -76.702  1.00 43.60  ? 348  HIS A ND1   1 
ATOM   2561  C CD2   . HIS A  1 348 ? 87.620  128.532 -77.048  1.00 42.44  ? 348  HIS A CD2   1 
ATOM   2562  C CE1   . HIS A  1 348 ? 87.477  130.128 -75.550  1.00 43.53  ? 348  HIS A CE1   1 
ATOM   2563  N NE2   . HIS A  1 348 ? 87.834  128.869 -75.734  1.00 43.74  ? 348  HIS A NE2   1 
ATOM   2564  N N     . ILE A  1 349 ? 84.882  131.948 -80.696  1.00 33.96  ? 349  ILE A N     1 
ATOM   2565  C CA    . ILE A  1 349 ? 84.800  132.603 -81.975  1.00 34.02  ? 349  ILE A CA    1 
ATOM   2566  C C     . ILE A  1 349 ? 85.183  134.033 -81.768  1.00 34.73  ? 349  ILE A C     1 
ATOM   2567  O O     . ILE A  1 349 ? 84.816  134.677 -80.780  1.00 34.53  ? 349  ILE A O     1 
ATOM   2568  C CB    . ILE A  1 349 ? 83.416  132.505 -82.638  1.00 34.64  ? 349  ILE A CB    1 
ATOM   2569  C CG1   . ILE A  1 349 ? 83.494  133.085 -84.056  1.00 35.10  ? 349  ILE A CG1   1 
ATOM   2570  C CG2   . ILE A  1 349 ? 82.369  133.215 -81.816  1.00 35.04  ? 349  ILE A CG2   1 
ATOM   2571  C CD1   . ILE A  1 349 ? 82.228  132.857 -84.894  1.00 35.13  ? 349  ILE A CD1   1 
ATOM   2572  N N     . ASP A  1 350 ? 85.986  134.505 -82.700  1.00 35.37  ? 350  ASP A N     1 
ATOM   2573  C CA    . ASP A  1 350 ? 86.468  135.862 -82.680  1.00 35.80  ? 350  ASP A CA    1 
ATOM   2574  C C     . ASP A  1 350 ? 86.036  136.464 -84.011  1.00 35.36  ? 350  ASP A C     1 
ATOM   2575  O O     . ASP A  1 350 ? 86.584  136.144 -85.072  1.00 33.60  ? 350  ASP A O     1 
ATOM   2576  C CB    . ASP A  1 350 ? 87.983  135.836 -82.520  1.00 37.38  ? 350  ASP A CB    1 
ATOM   2577  C CG    . ASP A  1 350 ? 88.636  137.127 -82.920  1.00 39.33  ? 350  ASP A CG    1 
ATOM   2578  O OD1   . ASP A  1 350 ? 88.206  138.201 -82.440  1.00 38.83  ? 350  ASP A OD1   1 
ATOM   2579  O OD2   . ASP A  1 350 ? 89.595  137.049 -83.719  1.00 42.14  ? 350  ASP A OD2   1 
ATOM   2580  N N     . TYR A  1 351 ? 85.023  137.318 -83.940  1.00 35.30  ? 351  TYR A N     1 
ATOM   2581  C CA    . TYR A  1 351 ? 84.468  137.971 -85.118  1.00 35.47  ? 351  TYR A CA    1 
ATOM   2582  C C     . TYR A  1 351 ? 85.457  138.817 -85.916  1.00 36.34  ? 351  TYR A C     1 
ATOM   2583  O O     . TYR A  1 351 ? 85.156  139.263 -87.014  1.00 37.19  ? 351  TYR A O     1 
ATOM   2584  C CB    . TYR A  1 351 ? 83.261  138.785 -84.684  1.00 35.05  ? 351  TYR A CB    1 
ATOM   2585  C CG    . TYR A  1 351 ? 82.224  137.913 -84.012  1.00 35.28  ? 351  TYR A CG    1 
ATOM   2586  C CD1   . TYR A  1 351 ? 81.527  136.941 -84.740  1.00 32.88  ? 351  TYR A CD1   1 
ATOM   2587  C CD2   . TYR A  1 351 ? 81.969  138.022 -82.645  1.00 35.29  ? 351  TYR A CD2   1 
ATOM   2588  C CE1   . TYR A  1 351 ? 80.608  136.107 -84.129  1.00 34.78  ? 351  TYR A CE1   1 
ATOM   2589  C CE2   . TYR A  1 351 ? 81.040  137.177 -82.018  1.00 36.59  ? 351  TYR A CE2   1 
ATOM   2590  C CZ    . TYR A  1 351 ? 80.361  136.221 -82.771  1.00 36.04  ? 351  TYR A CZ    1 
ATOM   2591  O OH    . TYR A  1 351 ? 79.434  135.383 -82.172  1.00 36.09  ? 351  TYR A OH    1 
ATOM   2592  N N     . ASN A  1 352 ? 86.646  139.021 -85.364  1.00 37.02  ? 352  ASN A N     1 
ATOM   2593  C CA    . ASN A  1 352 ? 87.677  139.777 -86.043  1.00 38.08  ? 352  ASN A CA    1 
ATOM   2594  C C     . ASN A  1 352 ? 88.309  138.913 -87.144  1.00 38.53  ? 352  ASN A C     1 
ATOM   2595  O O     . ASN A  1 352 ? 88.834  139.447 -88.125  1.00 40.09  ? 352  ASN A O     1 
ATOM   2596  C CB    . ASN A  1 352 ? 88.740  140.216 -85.026  1.00 40.84  ? 352  ASN A CB    1 
ATOM   2597  C CG    . ASN A  1 352 ? 89.922  140.956 -85.667  1.00 43.63  ? 352  ASN A CG    1 
ATOM   2598  O OD1   . ASN A  1 352 ? 89.751  141.973 -86.349  1.00 45.10  ? 352  ASN A OD1   1 
ATOM   2599  N ND2   . ASN A  1 352 ? 91.131  140.445 -85.438  1.00 42.87  ? 352  ASN A ND2   1 
ATOM   2600  N N     . CYS A  1 353 ? 88.239  137.585 -86.992  1.00 37.95  ? 353  CYS A N     1 
ATOM   2601  C CA    . CYS A  1 353 ? 88.816  136.643 -87.969  1.00 36.23  ? 353  CYS A CA    1 
ATOM   2602  C C     . CYS A  1 353 ? 87.777  136.065 -88.943  1.00 34.18  ? 353  CYS A C     1 
ATOM   2603  O O     . CYS A  1 353 ? 88.033  135.081 -89.664  1.00 33.29  ? 353  CYS A O     1 
ATOM   2604  C CB    . CYS A  1 353 ? 89.539  135.502 -87.236  1.00 37.04  ? 353  CYS A CB    1 
ATOM   2605  S SG    . CYS A  1 353 ? 90.884  136.027 -86.163  1.00 40.32  ? 353  CYS A SG    1 
ATOM   2606  N N     . VAL A  1 354 ? 86.596  136.677 -88.934  1.00 31.96  ? 354  VAL A N     1 
ATOM   2607  C CA    . VAL A  1 354 ? 85.500  136.295 -89.811  1.00 29.30  ? 354  VAL A CA    1 
ATOM   2608  C C     . VAL A  1 354 ? 85.649  137.128 -91.080  1.00 27.41  ? 354  VAL A C     1 
ATOM   2609  O O     . VAL A  1 354 ? 85.291  138.306 -91.118  1.00 27.96  ? 354  VAL A O     1 
ATOM   2610  C CB    . VAL A  1 354 ? 84.138  136.590 -89.148  1.00 28.45  ? 354  VAL A CB    1 
ATOM   2611  C CG1   . VAL A  1 354 ? 83.015  136.555 -90.193  1.00 26.85  ? 354  VAL A CG1   1 
ATOM   2612  C CG2   . VAL A  1 354 ? 83.882  135.570 -88.035  1.00 28.67  ? 354  VAL A CG2   1 
ATOM   2613  N N     . PRO A  1 355 ? 86.172  136.520 -92.141  1.00 24.15  ? 355  PRO A N     1 
ATOM   2614  C CA    . PRO A  1 355 ? 86.356  137.265 -93.387  1.00 25.58  ? 355  PRO A CA    1 
ATOM   2615  C C     . PRO A  1 355 ? 85.076  137.759 -94.047  1.00 24.83  ? 355  PRO A C     1 
ATOM   2616  O O     . PRO A  1 355 ? 83.994  137.294 -93.734  1.00 23.88  ? 355  PRO A O     1 
ATOM   2617  C CB    . PRO A  1 355 ? 87.120  136.277 -94.267  1.00 24.52  ? 355  PRO A CB    1 
ATOM   2618  C CG    . PRO A  1 355 ? 86.564  134.961 -93.836  1.00 24.10  ? 355  PRO A CG    1 
ATOM   2619  C CD    . PRO A  1 355 ? 86.444  135.089 -92.325  1.00 22.96  ? 355  PRO A CD    1 
ATOM   2620  N N     . SER A  1 356 ? 85.240  138.723 -94.952  1.00 26.02  ? 356  SER A N     1 
ATOM   2621  C CA    . SER A  1 356 ? 84.158  139.317 -95.745  1.00 26.49  ? 356  SER A CA    1 
ATOM   2622  C C     . SER A  1 356 ? 84.551  139.248 -97.216  1.00 26.61  ? 356  SER A C     1 
ATOM   2623  O O     . SER A  1 356 ? 85.710  139.487 -97.569  1.00 25.44  ? 356  SER A O     1 
ATOM   2624  C CB    . SER A  1 356 ? 83.937  140.792 -95.394  1.00 27.74  ? 356  SER A CB    1 
ATOM   2625  O OG    . SER A  1 356 ? 83.372  140.943 -94.108  1.00 31.78  ? 356  SER A OG    1 
ATOM   2626  N N     . VAL A  1 357 ? 83.586  138.921 -98.069  1.00 27.12  ? 357  VAL A N     1 
ATOM   2627  C CA    . VAL A  1 357 ? 83.854  138.846 -99.495  1.00 27.75  ? 357  VAL A CA    1 
ATOM   2628  C C     . VAL A  1 357 ? 82.774  139.478 -100.368 1.00 28.56  ? 357  VAL A C     1 
ATOM   2629  O O     . VAL A  1 357 ? 81.580  139.313 -100.116 1.00 29.09  ? 357  VAL A O     1 
ATOM   2630  C CB    . VAL A  1 357 ? 84.001  137.396 -99.956  1.00 26.72  ? 357  VAL A CB    1 
ATOM   2631  C CG1   . VAL A  1 357 ? 84.206  137.357 -101.472 1.00 24.31  ? 357  VAL A CG1   1 
ATOM   2632  C CG2   . VAL A  1 357 ? 85.147  136.737 -99.219  1.00 25.49  ? 357  VAL A CG2   1 
ATOM   2633  N N     . ILE A  1 358 ? 83.224  140.216 -101.382 1.00 28.87  ? 358  ILE A N     1 
ATOM   2634  C CA    . ILE A  1 358 ? 82.350  140.819 -102.382 1.00 28.02  ? 358  ILE A CA    1 
ATOM   2635  C C     . ILE A  1 358 ? 82.735  140.077 -103.660 1.00 29.00  ? 358  ILE A C     1 
ATOM   2636  O O     . ILE A  1 358 ? 83.857  140.218 -104.178 1.00 27.90  ? 358  ILE A O     1 
ATOM   2637  C CB    . ILE A  1 358 ? 82.600  142.323 -102.581 1.00 28.94  ? 358  ILE A CB    1 
ATOM   2638  C CG1   . ILE A  1 358 ? 82.591  143.049 -101.232 1.00 28.33  ? 358  ILE A CG1   1 
ATOM   2639  C CG2   . ILE A  1 358 ? 81.477  142.915 -103.456 1.00 26.81  ? 358  ILE A CG2   1 
ATOM   2640  C CD1   . ILE A  1 358 ? 82.806  144.547 -101.360 1.00 26.07  ? 358  ILE A CD1   1 
ATOM   2641  N N     . TYR A  1 359 ? 81.803  139.274 -104.167 1.00 29.53  ? 359  TYR A N     1 
ATOM   2642  C CA    . TYR A  1 359 ? 82.071  138.467 -105.346 1.00 29.98  ? 359  TYR A CA    1 
ATOM   2643  C C     . TYR A  1 359 ? 81.959  139.154 -106.720 1.00 30.58  ? 359  TYR A C     1 
ATOM   2644  O O     . TYR A  1 359 ? 81.743  138.507 -107.736 1.00 31.99  ? 359  TYR A O     1 
ATOM   2645  C CB    . TYR A  1 359 ? 81.200  137.206 -105.293 1.00 27.70  ? 359  TYR A CB    1 
ATOM   2646  C CG    . TYR A  1 359 ? 81.450  136.329 -104.080 1.00 27.49  ? 359  TYR A CG    1 
ATOM   2647  C CD1   . TYR A  1 359 ? 80.948  136.666 -102.822 1.00 26.77  ? 359  TYR A CD1   1 
ATOM   2648  C CD2   . TYR A  1 359 ? 82.203  135.165 -104.192 1.00 28.94  ? 359  TYR A CD2   1 
ATOM   2649  C CE1   . TYR A  1 359 ? 81.187  135.865 -101.705 1.00 27.85  ? 359  TYR A CE1   1 
ATOM   2650  C CE2   . TYR A  1 359 ? 82.459  134.355 -103.083 1.00 29.71  ? 359  TYR A CE2   1 
ATOM   2651  C CZ    . TYR A  1 359 ? 81.953  134.706 -101.842 1.00 29.43  ? 359  TYR A CZ    1 
ATOM   2652  O OH    . TYR A  1 359 ? 82.254  133.897 -100.769 1.00 28.91  ? 359  TYR A OH    1 
ATOM   2653  N N     . THR A  1 360 ? 82.119  140.461 -106.766 1.00 31.39  ? 360  THR A N     1 
ATOM   2654  C CA    . THR A  1 360 ? 82.085  141.152 -108.044 1.00 33.30  ? 360  THR A CA    1 
ATOM   2655  C C     . THR A  1 360 ? 83.380  140.734 -108.758 1.00 34.79  ? 360  THR A C     1 
ATOM   2656  O O     . THR A  1 360 ? 84.033  139.766 -108.361 1.00 34.34  ? 360  THR A O     1 
ATOM   2657  C CB    . THR A  1 360 ? 82.114  142.674 -107.836 1.00 33.48  ? 360  THR A CB    1 
ATOM   2658  O OG1   . THR A  1 360 ? 83.287  143.019 -107.095 1.00 35.30  ? 360  THR A OG1   1 
ATOM   2659  C CG2   . THR A  1 360 ? 80.915  143.140 -107.022 1.00 33.37  ? 360  THR A CG2   1 
ATOM   2660  N N     . HIS A  1 361 ? 83.737  141.459 -109.813 1.00 35.45  ? 361  HIS A N     1 
ATOM   2661  C CA    . HIS A  1 361 ? 84.980  141.229 -110.547 1.00 35.76  ? 361  HIS A CA    1 
ATOM   2662  C C     . HIS A  1 361 ? 85.517  142.626 -110.874 1.00 35.79  ? 361  HIS A C     1 
ATOM   2663  O O     . HIS A  1 361 ? 84.952  143.332 -111.685 1.00 37.64  ? 361  HIS A O     1 
ATOM   2664  C CB    . HIS A  1 361 ? 84.739  140.470 -111.845 1.00 36.83  ? 361  HIS A CB    1 
ATOM   2665  C CG    . HIS A  1 361 ? 85.997  139.955 -112.480 1.00 39.23  ? 361  HIS A CG    1 
ATOM   2666  N ND1   . HIS A  1 361 ? 86.313  138.611 -112.520 1.00 39.82  ? 361  HIS A ND1   1 
ATOM   2667  C CD2   . HIS A  1 361 ? 87.056  140.607 -113.016 1.00 39.76  ? 361  HIS A CD2   1 
ATOM   2668  C CE1   . HIS A  1 361 ? 87.516  138.460 -113.046 1.00 40.74  ? 361  HIS A CE1   1 
ATOM   2669  N NE2   . HIS A  1 361 ? 87.990  139.655 -113.354 1.00 40.78  ? 361  HIS A NE2   1 
ATOM   2670  N N     . PRO A  1 362 ? 86.632  143.032 -110.276 1.00 35.38  ? 362  PRO A N     1 
ATOM   2671  C CA    . PRO A  1 362 ? 87.493  142.350 -109.314 1.00 34.44  ? 362  PRO A CA    1 
ATOM   2672  C C     . PRO A  1 362 ? 86.765  142.009 -108.042 1.00 34.90  ? 362  PRO A C     1 
ATOM   2673  O O     . PRO A  1 362 ? 85.800  142.668 -107.671 1.00 34.00  ? 362  PRO A O     1 
ATOM   2674  C CB    . PRO A  1 362 ? 88.572  143.376 -109.056 1.00 34.90  ? 362  PRO A CB    1 
ATOM   2675  C CG    . PRO A  1 362 ? 87.770  144.633 -109.030 1.00 33.57  ? 362  PRO A CG    1 
ATOM   2676  C CD    . PRO A  1 362 ? 86.888  144.482 -110.246 1.00 34.09  ? 362  PRO A CD    1 
ATOM   2677  N N     . GLU A  1 363 ? 87.230  140.972 -107.364 1.00 35.72  ? 363  GLU A N     1 
ATOM   2678  C CA    . GLU A  1 363 ? 86.620  140.605 -106.101 1.00 35.75  ? 363  GLU A CA    1 
ATOM   2679  C C     . GLU A  1 363 ? 87.194  141.506 -105.024 1.00 34.95  ? 363  GLU A C     1 
ATOM   2680  O O     . GLU A  1 363 ? 88.192  142.193 -105.263 1.00 34.01  ? 363  GLU A O     1 
ATOM   2681  C CB    . GLU A  1 363 ? 86.922  139.147 -105.777 1.00 35.78  ? 363  GLU A CB    1 
ATOM   2682  C CG    . GLU A  1 363 ? 86.212  138.212 -106.704 1.00 37.94  ? 363  GLU A CG    1 
ATOM   2683  C CD    . GLU A  1 363 ? 86.533  136.787 -106.435 1.00 38.83  ? 363  GLU A CD    1 
ATOM   2684  O OE1   . GLU A  1 363 ? 87.538  136.529 -105.735 1.00 40.99  ? 363  GLU A OE1   1 
ATOM   2685  O OE2   . GLU A  1 363 ? 85.784  135.926 -106.937 1.00 41.45  ? 363  GLU A OE2   1 
ATOM   2686  N N     . VAL A  1 364 ? 86.536  141.518 -103.861 1.00 34.07  ? 364  VAL A N     1 
ATOM   2687  C CA    . VAL A  1 364 ? 86.988  142.288 -102.708 1.00 32.86  ? 364  VAL A CA    1 
ATOM   2688  C C     . VAL A  1 364 ? 86.873  141.378 -101.488 1.00 32.92  ? 364  VAL A C     1 
ATOM   2689  O O     . VAL A  1 364 ? 85.815  140.808 -101.250 1.00 32.17  ? 364  VAL A O     1 
ATOM   2690  C CB    . VAL A  1 364 ? 86.105  143.505 -102.416 1.00 33.63  ? 364  VAL A CB    1 
ATOM   2691  C CG1   . VAL A  1 364 ? 86.827  144.404 -101.438 1.00 32.15  ? 364  VAL A CG1   1 
ATOM   2692  C CG2   . VAL A  1 364 ? 85.747  144.240 -103.675 1.00 31.79  ? 364  VAL A CG2   1 
ATOM   2693  N N     . ALA A  1 365 ? 87.942  141.263 -100.703 1.00 32.39  ? 365  ALA A N     1 
ATOM   2694  C CA    . ALA A  1 365 ? 87.905  140.408 -99.526  1.00 30.49  ? 365  ALA A CA    1 
ATOM   2695  C C     . ALA A  1 365 ? 88.791  140.896 -98.368  1.00 30.77  ? 365  ALA A C     1 
ATOM   2696  O O     . ALA A  1 365 ? 89.897  141.392 -98.576  1.00 29.85  ? 365  ALA A O     1 
ATOM   2697  C CB    . ALA A  1 365 ? 88.291  138.984 -99.929  1.00 29.82  ? 365  ALA A CB    1 
ATOM   2698  N N     . TRP A  1 366 ? 88.304  140.764 -97.139  1.00 29.64  ? 366  TRP A N     1 
ATOM   2699  C CA    . TRP A  1 366 ? 89.110  141.187 -96.004  1.00 28.62  ? 366  TRP A CA    1 
ATOM   2700  C C     . TRP A  1 366 ? 88.780  140.435 -94.730  1.00 28.11  ? 366  TRP A C     1 
ATOM   2701  O O     . TRP A  1 366 ? 87.724  139.810 -94.618  1.00 27.39  ? 366  TRP A O     1 
ATOM   2702  C CB    . TRP A  1 366 ? 88.982  142.693 -95.773  1.00 26.11  ? 366  TRP A CB    1 
ATOM   2703  C CG    . TRP A  1 366 ? 87.598  143.154 -95.386  1.00 26.75  ? 366  TRP A CG    1 
ATOM   2704  C CD1   . TRP A  1 366 ? 87.104  143.331 -94.118  1.00 24.99  ? 366  TRP A CD1   1 
ATOM   2705  C CD2   . TRP A  1 366 ? 86.551  143.553 -96.284  1.00 25.85  ? 366  TRP A CD2   1 
ATOM   2706  N NE1   . TRP A  1 366 ? 85.817  143.822 -94.177  1.00 26.47  ? 366  TRP A NE1   1 
ATOM   2707  C CE2   . TRP A  1 366 ? 85.453  143.968 -95.491  1.00 25.99  ? 366  TRP A CE2   1 
ATOM   2708  C CE3   . TRP A  1 366 ? 86.436  143.601 -97.683  1.00 25.51  ? 366  TRP A CE3   1 
ATOM   2709  C CZ2   . TRP A  1 366 ? 84.258  144.428 -96.049  1.00 23.66  ? 366  TRP A CZ2   1 
ATOM   2710  C CZ3   . TRP A  1 366 ? 85.246  144.057 -98.244  1.00 26.48  ? 366  TRP A CZ3   1 
ATOM   2711  C CH2   . TRP A  1 366 ? 84.170  144.467 -97.421  1.00 27.27  ? 366  TRP A CH2   1 
ATOM   2712  N N     . VAL A  1 367 ? 89.724  140.477 -93.792  1.00 26.90  ? 367  VAL A N     1 
ATOM   2713  C CA    . VAL A  1 367 ? 89.586  139.829 -92.490  1.00 26.92  ? 367  VAL A CA    1 
ATOM   2714  C C     . VAL A  1 367 ? 90.508  140.620 -91.570  1.00 26.57  ? 367  VAL A C     1 
ATOM   2715  O O     . VAL A  1 367 ? 91.498  141.186 -92.028  1.00 25.97  ? 367  VAL A O     1 
ATOM   2716  C CB    . VAL A  1 367 ? 89.985  138.304 -92.545  1.00 26.62  ? 367  VAL A CB    1 
ATOM   2717  C CG1   . VAL A  1 367 ? 91.466  138.154 -92.855  1.00 24.46  ? 367  VAL A CG1   1 
ATOM   2718  C CG2   . VAL A  1 367 ? 89.633  137.626 -91.238  1.00 25.63  ? 367  VAL A CG2   1 
ATOM   2719  N N     . GLY A  1 368 ? 90.181  140.685 -90.283  1.00 27.65  ? 368  GLY A N     1 
ATOM   2720  C CA    . GLY A  1 368 ? 90.992  141.477 -89.373  1.00 30.11  ? 368  GLY A CA    1 
ATOM   2721  C C     . GLY A  1 368 ? 90.557  142.945 -89.413  1.00 32.10  ? 368  GLY A C     1 
ATOM   2722  O O     . GLY A  1 368 ? 89.414  143.223 -89.765  1.00 33.24  ? 368  GLY A O     1 
ATOM   2723  N N     . LYS A  1 369 ? 91.444  143.895 -89.110  1.00 32.61  ? 369  LYS A N     1 
ATOM   2724  C CA    . LYS A  1 369 ? 91.032  145.306 -89.066  1.00 33.85  ? 369  LYS A CA    1 
ATOM   2725  C C     . LYS A  1 369 ? 91.271  146.163 -90.295  1.00 34.13  ? 369  LYS A C     1 
ATOM   2726  O O     . LYS A  1 369 ? 92.105  145.857 -91.138  1.00 34.17  ? 369  LYS A O     1 
ATOM   2727  C CB    . LYS A  1 369 ? 91.716  146.031 -87.903  1.00 36.27  ? 369  LYS A CB    1 
ATOM   2728  C CG    . LYS A  1 369 ? 91.961  145.233 -86.648  1.00 36.09  ? 369  LYS A CG    1 
ATOM   2729  C CD    . LYS A  1 369 ? 90.793  145.297 -85.720  1.00 38.23  ? 369  LYS A CD    1 
ATOM   2730  C CE    . LYS A  1 369 ? 91.192  144.749 -84.372  1.00 40.02  ? 369  LYS A CE    1 
ATOM   2731  N NZ    . LYS A  1 369 ? 89.992  144.520 -83.556  1.00 41.77  ? 369  LYS A NZ    1 
ATOM   2732  N N     . SER A  1 370 ? 90.548  147.272 -90.374  1.00 35.04  ? 370  SER A N     1 
ATOM   2733  C CA    . SER A  1 370 ? 90.725  148.210 -91.479  1.00 36.66  ? 370  SER A CA    1 
ATOM   2734  C C     . SER A  1 370 ? 91.604  149.324 -90.928  1.00 37.14  ? 370  SER A C     1 
ATOM   2735  O O     . SER A  1 370 ? 91.770  149.432 -89.708  1.00 37.29  ? 370  SER A O     1 
ATOM   2736  C CB    . SER A  1 370 ? 89.382  148.796 -91.889  1.00 37.66  ? 370  SER A CB    1 
ATOM   2737  O OG    . SER A  1 370 ? 88.797  149.487 -90.802  1.00 40.35  ? 370  SER A OG    1 
ATOM   2738  N N     . GLU A  1 371 ? 92.169  150.160 -91.797  1.00 37.72  ? 371  GLU A N     1 
ATOM   2739  C CA    . GLU A  1 371 ? 92.993  151.247 -91.287  1.00 37.52  ? 371  GLU A CA    1 
ATOM   2740  C C     . GLU A  1 371 ? 92.200  152.094 -90.307  1.00 37.00  ? 371  GLU A C     1 
ATOM   2741  O O     . GLU A  1 371 ? 92.680  152.421 -89.224  1.00 37.74  ? 371  GLU A O     1 
ATOM   2742  C CB    . GLU A  1 371 ? 93.511  152.128 -92.419  1.00 37.19  ? 371  GLU A CB    1 
ATOM   2743  C CG    . GLU A  1 371 ? 94.724  151.533 -93.102  1.00 38.78  ? 371  GLU A CG    1 
ATOM   2744  C CD    . GLU A  1 371 ? 95.640  152.584 -93.722  1.00 39.64  ? 371  GLU A CD    1 
ATOM   2745  O OE1   . GLU A  1 371 ? 96.024  153.529 -92.993  1.00 40.95  ? 371  GLU A OE1   1 
ATOM   2746  O OE2   . GLU A  1 371 ? 95.986  152.460 -94.925  1.00 36.08  ? 371  GLU A OE2   1 
ATOM   2747  N N     . GLU A  1 372 ? 90.973  152.423 -90.677  1.00 36.15  ? 372  GLU A N     1 
ATOM   2748  C CA    . GLU A  1 372 ? 90.143  153.233 -89.817  1.00 36.11  ? 372  GLU A CA    1 
ATOM   2749  C C     . GLU A  1 372 ? 89.954  152.616 -88.436  1.00 36.72  ? 372  GLU A C     1 
ATOM   2750  O O     . GLU A  1 372 ? 90.001  153.320 -87.431  1.00 38.60  ? 372  GLU A O     1 
ATOM   2751  C CB    . GLU A  1 372 ? 88.792  153.476 -90.484  1.00 34.45  ? 372  GLU A CB    1 
ATOM   2752  C CG    . GLU A  1 372 ? 88.880  154.295 -91.779  1.00 34.74  ? 372  GLU A CG    1 
ATOM   2753  C CD    . GLU A  1 372 ? 89.580  153.560 -92.929  1.00 36.97  ? 372  GLU A CD    1 
ATOM   2754  O OE1   . GLU A  1 372 ? 89.222  152.392 -93.213  1.00 37.20  ? 372  GLU A OE1   1 
ATOM   2755  O OE2   . GLU A  1 372 ? 90.477  154.156 -93.572  1.00 35.81  ? 372  GLU A OE2   1 
ATOM   2756  N N     . GLN A  1 373 ? 89.757  151.306 -88.362  1.00 37.65  ? 373  GLN A N     1 
ATOM   2757  C CA    . GLN A  1 373 ? 89.554  150.670 -87.061  1.00 38.06  ? 373  GLN A CA    1 
ATOM   2758  C C     . GLN A  1 373 ? 90.797  150.753 -86.191  1.00 37.61  ? 373  GLN A C     1 
ATOM   2759  O O     . GLN A  1 373 ? 90.700  150.948 -84.982  1.00 35.76  ? 373  GLN A O     1 
ATOM   2760  C CB    . GLN A  1 373 ? 89.142  149.216 -87.237  1.00 39.51  ? 373  GLN A CB    1 
ATOM   2761  C CG    . GLN A  1 373 ? 87.879  149.068 -88.051  1.00 43.59  ? 373  GLN A CG    1 
ATOM   2762  C CD    . GLN A  1 373 ? 87.533  147.631 -88.340  1.00 45.13  ? 373  GLN A CD    1 
ATOM   2763  O OE1   . GLN A  1 373 ? 88.376  146.846 -88.781  1.00 46.47  ? 373  GLN A OE1   1 
ATOM   2764  N NE2   . GLN A  1 373 ? 86.283  147.280 -88.111  1.00 47.11  ? 373  GLN A NE2   1 
ATOM   2765  N N     . LEU A  1 374 ? 91.967  150.601 -86.802  1.00 36.49  ? 374  LEU A N     1 
ATOM   2766  C CA    . LEU A  1 374 ? 93.178  150.695 -86.028  1.00 37.47  ? 374  LEU A CA    1 
ATOM   2767  C C     . LEU A  1 374 ? 93.335  152.127 -85.505  1.00 40.39  ? 374  LEU A C     1 
ATOM   2768  O O     . LEU A  1 374 ? 93.687  152.333 -84.334  1.00 39.95  ? 374  LEU A O     1 
ATOM   2769  C CB    . LEU A  1 374 ? 94.384  150.298 -86.860  1.00 35.54  ? 374  LEU A CB    1 
ATOM   2770  C CG    . LEU A  1 374 ? 94.394  148.857 -87.369  1.00 34.39  ? 374  LEU A CG    1 
ATOM   2771  C CD1   . LEU A  1 374 ? 95.633  148.682 -88.210  1.00 29.87  ? 374  LEU A CD1   1 
ATOM   2772  C CD2   . LEU A  1 374 ? 94.369  147.842 -86.216  1.00 32.27  ? 374  LEU A CD2   1 
ATOM   2773  N N     . LYS A  1 375 ? 93.071  153.122 -86.349  1.00 41.77  ? 375  LYS A N     1 
ATOM   2774  C CA    . LYS A  1 375 ? 93.188  154.498 -85.881  1.00 44.89  ? 375  LYS A CA    1 
ATOM   2775  C C     . LYS A  1 375 ? 92.240  154.813 -84.720  1.00 46.84  ? 375  LYS A C     1 
ATOM   2776  O O     . LYS A  1 375 ? 92.650  155.406 -83.727  1.00 47.61  ? 375  LYS A O     1 
ATOM   2777  C CB    . LYS A  1 375 ? 92.931  155.493 -87.009  1.00 43.70  ? 375  LYS A CB    1 
ATOM   2778  C CG    . LYS A  1 375 ? 94.019  155.529 -88.043  1.00 44.91  ? 375  LYS A CG    1 
ATOM   2779  C CD    . LYS A  1 375 ? 93.770  156.614 -89.088  1.00 46.22  ? 375  LYS A CD    1 
ATOM   2780  C CE    . LYS A  1 375 ? 94.661  156.421 -90.325  1.00 48.73  ? 375  LYS A CE    1 
ATOM   2781  N NZ    . LYS A  1 375 ? 96.136  156.322 -90.024  1.00 48.03  ? 375  LYS A NZ    1 
ATOM   2782  N N     . GLU A  1 376 ? 90.979  154.419 -84.828  1.00 48.66  ? 376  GLU A N     1 
ATOM   2783  C CA    . GLU A  1 376 ? 90.055  154.733 -83.753  1.00 52.27  ? 376  GLU A CA    1 
ATOM   2784  C C     . GLU A  1 376 ? 90.337  153.871 -82.524  1.00 52.78  ? 376  GLU A C     1 
ATOM   2785  O O     . GLU A  1 376 ? 89.698  154.008 -81.481  1.00 53.35  ? 376  GLU A O     1 
ATOM   2786  C CB    . GLU A  1 376 ? 88.607  154.570 -84.230  1.00 54.37  ? 376  GLU A CB    1 
ATOM   2787  C CG    . GLU A  1 376 ? 88.273  153.180 -84.705  1.00 60.91  ? 376  GLU A CG    1 
ATOM   2788  C CD    . GLU A  1 376 ? 86.973  152.644 -84.108  1.00 64.80  ? 376  GLU A CD    1 
ATOM   2789  O OE1   . GLU A  1 376 ? 85.877  153.015 -84.598  1.00 66.08  ? 376  GLU A OE1   1 
ATOM   2790  O OE2   . GLU A  1 376 ? 87.056  151.857 -83.131  1.00 66.92  ? 376  GLU A OE2   1 
ATOM   2791  N N     . GLU A  1 377 ? 91.317  152.988 -82.654  1.00 53.84  ? 377  GLU A N     1 
ATOM   2792  C CA    . GLU A  1 377 ? 91.715  152.109 -81.564  1.00 54.33  ? 377  GLU A CA    1 
ATOM   2793  C C     . GLU A  1 377 ? 93.086  152.499 -81.018  1.00 53.45  ? 377  GLU A C     1 
ATOM   2794  O O     . GLU A  1 377 ? 93.517  151.990 -79.981  1.00 52.40  ? 377  GLU A O     1 
ATOM   2795  C CB    . GLU A  1 377 ? 91.755  150.659 -82.034  1.00 55.67  ? 377  GLU A CB    1 
ATOM   2796  C CG    . GLU A  1 377 ? 90.400  150.001 -82.156  1.00 59.09  ? 377  GLU A CG    1 
ATOM   2797  C CD    . GLU A  1 377 ? 90.520  148.540 -82.577  1.00 61.75  ? 377  GLU A CD    1 
ATOM   2798  O OE1   . GLU A  1 377 ? 91.653  148.010 -82.549  1.00 62.82  ? 377  GLU A OE1   1 
ATOM   2799  O OE2   . GLU A  1 377 ? 89.490  147.924 -82.931  1.00 62.12  ? 377  GLU A OE2   1 
ATOM   2800  N N     . GLY A  1 378 ? 93.771  153.387 -81.734  1.00 52.77  ? 378  GLY A N     1 
ATOM   2801  C CA    . GLY A  1 378 ? 95.080  153.851 -81.302  1.00 52.63  ? 378  GLY A CA    1 
ATOM   2802  C C     . GLY A  1 378 ? 96.254  152.934 -81.598  1.00 53.06  ? 378  GLY A C     1 
ATOM   2803  O O     . GLY A  1 378 ? 97.393  153.241 -81.239  1.00 53.30  ? 378  GLY A O     1 
ATOM   2804  N N     . ILE A  1 379 ? 95.989  151.810 -82.255  1.00 51.99  ? 379  ILE A N     1 
ATOM   2805  C CA    . ILE A  1 379 ? 97.037  150.859 -82.586  1.00 51.14  ? 379  ILE A CA    1 
ATOM   2806  C C     . ILE A  1 379 ? 98.058  151.462 -83.553  1.00 50.85  ? 379  ILE A C     1 
ATOM   2807  O O     . ILE A  1 379 ? 97.699  152.107 -84.532  1.00 51.58  ? 379  ILE A O     1 
ATOM   2808  C CB    . ILE A  1 379 ? 96.431  149.582 -83.214  1.00 51.10  ? 379  ILE A CB    1 
ATOM   2809  C CG1   . ILE A  1 379 ? 95.365  148.992 -82.275  1.00 52.18  ? 379  ILE A CG1   1 
ATOM   2810  C CG2   . ILE A  1 379 ? 97.521  148.574 -83.498  1.00 50.48  ? 379  ILE A CG2   1 
ATOM   2811  C CD1   . ILE A  1 379 ? 95.862  148.627 -80.870  1.00 49.97  ? 379  ILE A CD1   1 
ATOM   2812  N N     . GLU A  1 380 ? 99.338  151.265 -83.266  1.00 50.46  ? 380  GLU A N     1 
ATOM   2813  C CA    . GLU A  1 380 ? 100.382 151.774 -84.141  1.00 49.84  ? 380  GLU A CA    1 
ATOM   2814  C C     . GLU A  1 380 ? 100.637 150.693 -85.168  1.00 47.93  ? 380  GLU A C     1 
ATOM   2815  O O     . GLU A  1 380 ? 100.796 149.534 -84.807  1.00 46.91  ? 380  GLU A O     1 
ATOM   2816  C CB    . GLU A  1 380 ? 101.636 152.049 -83.338  1.00 52.57  ? 380  GLU A CB    1 
ATOM   2817  C CG    . GLU A  1 380 ? 101.479 153.210 -82.405  1.00 57.67  ? 380  GLU A CG    1 
ATOM   2818  C CD    . GLU A  1 380 ? 102.808 153.849 -82.085  1.00 61.90  ? 380  GLU A CD    1 
ATOM   2819  O OE1   . GLU A  1 380 ? 103.758 153.667 -82.881  1.00 64.56  ? 380  GLU A OE1   1 
ATOM   2820  O OE2   . GLU A  1 380 ? 102.904 154.547 -81.054  1.00 64.76  ? 380  GLU A OE2   1 
ATOM   2821  N N     . TYR A  1 381 ? 100.694 151.048 -86.446  1.00 46.79  ? 381  TYR A N     1 
ATOM   2822  C CA    . TYR A  1 381 ? 100.876 150.016 -87.459  1.00 44.07  ? 381  TYR A CA    1 
ATOM   2823  C C     . TYR A  1 381 ? 101.638 150.428 -88.695  1.00 43.02  ? 381  TYR A C     1 
ATOM   2824  O O     . TYR A  1 381 ? 101.776 151.607 -88.985  1.00 43.13  ? 381  TYR A O     1 
ATOM   2825  C CB    . TYR A  1 381 ? 99.504  149.518 -87.876  1.00 43.44  ? 381  TYR A CB    1 
ATOM   2826  C CG    . TYR A  1 381 ? 98.689  150.598 -88.554  1.00 42.69  ? 381  TYR A CG    1 
ATOM   2827  C CD1   . TYR A  1 381 ? 98.811  150.827 -89.930  1.00 42.38  ? 381  TYR A CD1   1 
ATOM   2828  C CD2   . TYR A  1 381 ? 97.792  151.382 -87.831  1.00 42.50  ? 381  TYR A CD2   1 
ATOM   2829  C CE1   . TYR A  1 381 ? 98.057  151.797 -90.571  1.00 42.21  ? 381  TYR A CE1   1 
ATOM   2830  C CE2   . TYR A  1 381 ? 97.029  152.365 -88.460  1.00 42.29  ? 381  TYR A CE2   1 
ATOM   2831  C CZ    . TYR A  1 381 ? 97.162  152.563 -89.833  1.00 43.70  ? 381  TYR A CZ    1 
ATOM   2832  O OH    . TYR A  1 381 ? 96.379  153.487 -90.493  1.00 44.41  ? 381  TYR A OH    1 
ATOM   2833  N N     . LYS A  1 382 ? 102.118 149.427 -89.426  1.00 42.75  ? 382  LYS A N     1 
ATOM   2834  C CA    . LYS A  1 382 ? 102.847 149.638 -90.669  1.00 41.49  ? 382  LYS A CA    1 
ATOM   2835  C C     . LYS A  1 382 ? 101.966 149.111 -91.805  1.00 40.81  ? 382  LYS A C     1 
ATOM   2836  O O     . LYS A  1 382 ? 100.980 148.401 -91.556  1.00 39.34  ? 382  LYS A O     1 
ATOM   2837  C CB    . LYS A  1 382 ? 104.221 148.933 -90.630  1.00 42.28  ? 382  LYS A CB    1 
ATOM   2838  C CG    . LYS A  1 382 ? 104.208 147.434 -90.350  1.00 45.29  ? 382  LYS A CG    1 
ATOM   2839  C CD    . LYS A  1 382 ? 105.557 147.024 -89.806  1.00 47.05  ? 382  LYS A CD    1 
ATOM   2840  C CE    . LYS A  1 382 ? 105.723 145.523 -89.705  1.00 46.08  ? 382  LYS A CE    1 
ATOM   2841  N NZ    . LYS A  1 382 ? 107.144 145.266 -89.313  1.00 46.74  ? 382  LYS A NZ    1 
ATOM   2842  N N     . VAL A  1 383 ? 102.308 149.470 -93.043  1.00 39.23  ? 383  VAL A N     1 
ATOM   2843  C CA    . VAL A  1 383 ? 101.520 149.066 -94.198  1.00 37.45  ? 383  VAL A CA    1 
ATOM   2844  C C     . VAL A  1 383 ? 102.315 148.543 -95.370  1.00 37.54  ? 383  VAL A C     1 
ATOM   2845  O O     . VAL A  1 383 ? 103.281 149.157 -95.808  1.00 38.08  ? 383  VAL A O     1 
ATOM   2846  C CB    . VAL A  1 383 ? 100.680 150.230 -94.728  1.00 37.03  ? 383  VAL A CB    1 
ATOM   2847  C CG1   . VAL A  1 383 ? 99.762  149.740 -95.844  1.00 35.61  ? 383  VAL A CG1   1 
ATOM   2848  C CG2   . VAL A  1 383 ? 99.897  150.854 -93.594  1.00 36.47  ? 383  VAL A CG2   1 
ATOM   2849  N N     . GLY A  1 384 ? 101.872 147.409 -95.894  1.00 37.91  ? 384  GLY A N     1 
ATOM   2850  C CA    . GLY A  1 384 ? 102.518 146.814 -97.047  1.00 36.89  ? 384  GLY A CA    1 
ATOM   2851  C C     . GLY A  1 384 ? 101.508 146.742 -98.171  1.00 35.97  ? 384  GLY A C     1 
ATOM   2852  O O     . GLY A  1 384 ? 100.348 146.371 -97.950  1.00 34.91  ? 384  GLY A O     1 
ATOM   2853  N N     . LYS A  1 385 ? 101.944 147.114 -99.370  1.00 35.66  ? 385  LYS A N     1 
ATOM   2854  C CA    . LYS A  1 385 ? 101.089 147.088 -100.548 1.00 35.82  ? 385  LYS A CA    1 
ATOM   2855  C C     . LYS A  1 385 ? 101.757 146.434 -101.736 1.00 36.18  ? 385  LYS A C     1 
ATOM   2856  O O     . LYS A  1 385 ? 102.958 146.602 -101.984 1.00 37.58  ? 385  LYS A O     1 
ATOM   2857  C CB    . LYS A  1 385 ? 100.677 148.494 -100.963 1.00 34.82  ? 385  LYS A CB    1 
ATOM   2858  C CG    . LYS A  1 385 ? 99.638  149.132 -100.084 1.00 37.05  ? 385  LYS A CG    1 
ATOM   2859  C CD    . LYS A  1 385 ? 99.424  150.582 -100.487 1.00 38.30  ? 385  LYS A CD    1 
ATOM   2860  C CE    . LYS A  1 385 ? 98.515  151.296 -99.492  1.00 42.68  ? 385  LYS A CE    1 
ATOM   2861  N NZ    . LYS A  1 385 ? 98.425  152.782 -99.692  1.00 43.90  ? 385  LYS A NZ    1 
ATOM   2862  N N     . PHE A  1 386 ? 100.966 145.668 -102.468 1.00 35.26  ? 386  PHE A N     1 
ATOM   2863  C CA    . PHE A  1 386 ? 101.450 145.026 -103.666 1.00 33.82  ? 386  PHE A CA    1 
ATOM   2864  C C     . PHE A  1 386 ? 100.298 145.019 -104.660 1.00 34.32  ? 386  PHE A C     1 
ATOM   2865  O O     . PHE A  1 386 ? 99.206  144.500 -104.358 1.00 34.07  ? 386  PHE A O     1 
ATOM   2866  C CB    . PHE A  1 386 ? 101.918 143.601 -103.403 1.00 30.36  ? 386  PHE A CB    1 
ATOM   2867  C CG    . PHE A  1 386 ? 102.724 143.051 -104.522 1.00 29.04  ? 386  PHE A CG    1 
ATOM   2868  C CD1   . PHE A  1 386 ? 104.082 143.324 -104.609 1.00 29.23  ? 386  PHE A CD1   1 
ATOM   2869  C CD2   . PHE A  1 386 ? 102.111 142.354 -105.558 1.00 28.49  ? 386  PHE A CD2   1 
ATOM   2870  C CE1   . PHE A  1 386 ? 104.817 142.912 -105.722 1.00 29.90  ? 386  PHE A CE1   1 
ATOM   2871  C CE2   . PHE A  1 386 ? 102.836 141.938 -106.676 1.00 27.97  ? 386  PHE A CE2   1 
ATOM   2872  C CZ    . PHE A  1 386 ? 104.188 142.218 -106.756 1.00 29.04  ? 386  PHE A CZ    1 
ATOM   2873  N N     . PRO A  1 387 ? 100.522 145.597 -105.856 1.00 33.44  ? 387  PRO A N     1 
ATOM   2874  C CA    . PRO A  1 387 ? 99.496  145.667 -106.899 1.00 34.03  ? 387  PRO A CA    1 
ATOM   2875  C C     . PRO A  1 387 ? 99.470  144.396 -107.755 1.00 35.23  ? 387  PRO A C     1 
ATOM   2876  O O     . PRO A  1 387 ? 100.510 143.797 -108.036 1.00 35.61  ? 387  PRO A O     1 
ATOM   2877  C CB    . PRO A  1 387 ? 99.920  146.896 -107.690 1.00 32.14  ? 387  PRO A CB    1 
ATOM   2878  C CG    . PRO A  1 387 ? 101.427 146.721 -107.724 1.00 31.08  ? 387  PRO A CG    1 
ATOM   2879  C CD    . PRO A  1 387 ? 101.769 146.259 -106.303 1.00 33.21  ? 387  PRO A CD    1 
ATOM   2880  N N     . PHE A  1 388 ? 98.285  143.978 -108.176 1.00 35.70  ? 388  PHE A N     1 
ATOM   2881  C CA    . PHE A  1 388 ? 98.218  142.772 -108.988 1.00 37.44  ? 388  PHE A CA    1 
ATOM   2882  C C     . PHE A  1 388 ? 98.859  142.943 -110.347 1.00 38.29  ? 388  PHE A C     1 
ATOM   2883  O O     . PHE A  1 388 ? 99.140  141.956 -111.032 1.00 39.21  ? 388  PHE A O     1 
ATOM   2884  C CB    . PHE A  1 388 ? 96.781  142.306 -109.141 1.00 35.37  ? 388  PHE A CB    1 
ATOM   2885  C CG    . PHE A  1 388 ? 96.283  141.548 -107.966 1.00 34.44  ? 388  PHE A CG    1 
ATOM   2886  C CD1   . PHE A  1 388 ? 96.881  140.356 -107.597 1.00 32.88  ? 388  PHE A CD1   1 
ATOM   2887  C CD2   . PHE A  1 388 ? 95.206  142.021 -107.226 1.00 35.10  ? 388  PHE A CD2   1 
ATOM   2888  C CE1   . PHE A  1 388 ? 96.416  139.640 -106.512 1.00 31.94  ? 388  PHE A CE1   1 
ATOM   2889  C CE2   . PHE A  1 388 ? 94.731  141.310 -106.134 1.00 34.10  ? 388  PHE A CE2   1 
ATOM   2890  C CZ    . PHE A  1 388 ? 95.336  140.120 -105.779 1.00 32.19  ? 388  PHE A CZ    1 
ATOM   2891  N N     . ALA A  1 389 ? 99.098  144.197 -110.723 1.00 37.77  ? 389  ALA A N     1 
ATOM   2892  C CA    . ALA A  1 389 ? 99.732  144.512 -111.993 1.00 37.27  ? 389  ALA A CA    1 
ATOM   2893  C C     . ALA A  1 389 ? 101.165 143.989 -111.988 1.00 37.23  ? 389  ALA A C     1 
ATOM   2894  O O     . ALA A  1 389 ? 101.751 143.786 -113.045 1.00 38.69  ? 389  ALA A O     1 
ATOM   2895  C CB    . ALA A  1 389 ? 99.734  146.006 -112.223 1.00 34.44  ? 389  ALA A CB    1 
ATOM   2896  N N     . ALA A  1 390 ? 101.730 143.770 -110.803 1.00 36.11  ? 390  ALA A N     1 
ATOM   2897  C CA    . ALA A  1 390 ? 103.096 143.271 -110.715 1.00 35.63  ? 390  ALA A CA    1 
ATOM   2898  C C     . ALA A  1 390 ? 103.161 141.782 -110.357 1.00 35.20  ? 390  ALA A C     1 
ATOM   2899  O O     . ALA A  1 390 ? 104.251 141.228 -110.150 1.00 33.45  ? 390  ALA A O     1 
ATOM   2900  C CB    . ALA A  1 390 ? 103.892 144.096 -109.702 1.00 35.27  ? 390  ALA A CB    1 
ATOM   2901  N N     . ASN A  1 391 ? 101.994 141.141 -110.279 1.00 35.50  ? 391  ASN A N     1 
ATOM   2902  C CA    . ASN A  1 391 ? 101.915 139.711 -109.954 1.00 35.13  ? 391  ASN A CA    1 
ATOM   2903  C C     . ASN A  1 391 ? 101.847 138.913 -111.240 1.00 33.39  ? 391  ASN A C     1 
ATOM   2904  O O     . ASN A  1 391 ? 100.983 139.152 -112.065 1.00 32.68  ? 391  ASN A O     1 
ATOM   2905  C CB    . ASN A  1 391 ? 100.683 139.413 -109.093 1.00 35.69  ? 391  ASN A CB    1 
ATOM   2906  C CG    . ASN A  1 391 ? 100.443 137.922 -108.927 1.00 34.95  ? 391  ASN A CG    1 
ATOM   2907  O OD1   . ASN A  1 391 ? 99.846  137.285 -109.794 1.00 35.86  ? 391  ASN A OD1   1 
ATOM   2908  N ND2   . ASN A  1 391 ? 100.935 137.353 -107.821 1.00 33.57  ? 391  ASN A ND2   1 
ATOM   2909  N N     . SER A  1 392 ? 102.737 137.943 -111.391 1.00 33.82  ? 392  SER A N     1 
ATOM   2910  C CA    . SER A  1 392 ? 102.797 137.173 -112.625 1.00 34.57  ? 392  SER A CA    1 
ATOM   2911  C C     . SER A  1 392 ? 101.565 136.413 -113.063 1.00 34.06  ? 392  SER A C     1 
ATOM   2912  O O     . SER A  1 392 ? 101.171 136.527 -114.218 1.00 34.22  ? 392  SER A O     1 
ATOM   2913  C CB    . SER A  1 392 ? 104.005 136.251 -112.602 1.00 34.54  ? 392  SER A CB    1 
ATOM   2914  O OG    . SER A  1 392 ? 105.179 137.047 -112.638 1.00 36.54  ? 392  SER A OG    1 
ATOM   2915  N N     . ARG A  1 393 ? 100.940 135.644 -112.177 1.00 34.50  ? 393  ARG A N     1 
ATOM   2916  C CA    . ARG A  1 393 ? 99.743  134.927 -112.602 1.00 33.62  ? 393  ARG A CA    1 
ATOM   2917  C C     . ARG A  1 393 ? 98.697  135.926 -113.088 1.00 33.73  ? 393  ARG A C     1 
ATOM   2918  O O     . ARG A  1 393 ? 97.972  135.656 -114.044 1.00 34.52  ? 393  ARG A O     1 
ATOM   2919  C CB    . ARG A  1 393 ? 99.125  134.072 -111.482 1.00 32.89  ? 393  ARG A CB    1 
ATOM   2920  C CG    . ARG A  1 393 ? 97.889  133.325 -111.986 1.00 29.94  ? 393  ARG A CG    1 
ATOM   2921  C CD    . ARG A  1 393 ? 97.475  132.143 -111.154 1.00 31.42  ? 393  ARG A CD    1 
ATOM   2922  N NE    . ARG A  1 393 ? 96.714  131.180 -111.952 1.00 30.58  ? 393  ARG A NE    1 
ATOM   2923  C CZ    . ARG A  1 393 ? 96.015  130.168 -111.441 1.00 31.91  ? 393  ARG A CZ    1 
ATOM   2924  N NH1   . ARG A  1 393 ? 95.962  129.977 -110.124 1.00 31.12  ? 393  ARG A NH1   1 
ATOM   2925  N NH2   . ARG A  1 393 ? 95.381  129.330 -112.245 1.00 32.36  ? 393  ARG A NH2   1 
ATOM   2926  N N     . ALA A  1 394 ? 98.610  137.077 -112.437 1.00 32.63  ? 394  ALA A N     1 
ATOM   2927  C CA    . ALA A  1 394 ? 97.633  138.069 -112.848 1.00 33.08  ? 394  ALA A CA    1 
ATOM   2928  C C     . ALA A  1 394 ? 97.951  138.688 -114.218 1.00 34.00  ? 394  ALA A C     1 
ATOM   2929  O O     . ALA A  1 394 ? 97.041  139.001 -114.975 1.00 33.86  ? 394  ALA A O     1 
ATOM   2930  C CB    . ALA A  1 394 ? 97.523  139.164 -111.788 1.00 32.08  ? 394  ALA A CB    1 
ATOM   2931  N N     . LYS A  1 395 ? 99.236  138.851 -114.532 1.00 34.03  ? 395  LYS A N     1 
ATOM   2932  C CA    . LYS A  1 395 ? 99.643  139.456 -115.786 1.00 34.26  ? 395  LYS A CA    1 
ATOM   2933  C C     . LYS A  1 395 ? 99.422  138.479 -116.911 1.00 35.12  ? 395  LYS A C     1 
ATOM   2934  O O     . LYS A  1 395 ? 98.834  138.828 -117.938 1.00 35.44  ? 395  LYS A O     1 
ATOM   2935  C CB    . LYS A  1 395 ? 101.115 139.881 -115.732 1.00 32.54  ? 395  LYS A CB    1 
ATOM   2936  C CG    . LYS A  1 395 ? 101.531 140.866 -116.819 1.00 33.93  ? 395  LYS A CG    1 
ATOM   2937  C CD    . LYS A  1 395 ? 100.646 142.121 -116.819 1.00 34.46  ? 395  LYS A CD    1 
ATOM   2938  C CE    . LYS A  1 395 ? 100.955 143.084 -117.970 1.00 35.91  ? 395  LYS A CE    1 
ATOM   2939  N NZ    . LYS A  1 395 ? 99.946  144.199 -118.050 1.00 36.32  ? 395  LYS A NZ    1 
ATOM   2940  N N     . THR A  1 396 ? 99.873  137.247 -116.701 1.00 36.01  ? 396  THR A N     1 
ATOM   2941  C CA    . THR A  1 396 ? 99.728  136.204 -117.704 1.00 37.26  ? 396  THR A CA    1 
ATOM   2942  C C     . THR A  1 396 ? 98.251  136.026 -118.057 1.00 38.40  ? 396  THR A C     1 
ATOM   2943  O O     . THR A  1 396 ? 97.905  135.827 -119.230 1.00 39.77  ? 396  THR A O     1 
ATOM   2944  C CB    . THR A  1 396 ? 100.299 134.874 -117.197 1.00 37.61  ? 396  THR A CB    1 
ATOM   2945  O OG1   . THR A  1 396 ? 101.626 135.077 -116.699 1.00 38.94  ? 396  THR A OG1   1 
ATOM   2946  C CG2   . THR A  1 396 ? 100.371 133.882 -118.313 1.00 37.10  ? 396  THR A CG2   1 
ATOM   2947  N N     . ASN A  1 397 ? 97.397  136.113 -117.036 1.00 38.93  ? 397  ASN A N     1 
ATOM   2948  C CA    . ASN A  1 397 ? 95.943  135.996 -117.170 1.00 40.64  ? 397  ASN A CA    1 
ATOM   2949  C C     . ASN A  1 397 ? 95.343  137.281 -117.770 1.00 40.84  ? 397  ASN A C     1 
ATOM   2950  O O     . ASN A  1 397 ? 94.187  137.295 -118.185 1.00 39.87  ? 397  ASN A O     1 
ATOM   2951  C CB    . ASN A  1 397 ? 95.296  135.764 -115.790 1.00 41.64  ? 397  ASN A CB    1 
ATOM   2952  C CG    . ASN A  1 397 ? 95.344  134.307 -115.331 1.00 44.56  ? 397  ASN A CG    1 
ATOM   2953  O OD1   . ASN A  1 397 ? 96.215  133.534 -115.730 1.00 46.82  ? 397  ASN A OD1   1 
ATOM   2954  N ND2   . ASN A  1 397 ? 94.411  133.938 -114.454 1.00 46.40  ? 397  ASN A ND2   1 
ATOM   2955  N N     . ALA A  1 398 ? 96.126  138.354 -117.805 1.00 40.70  ? 398  ALA A N     1 
ATOM   2956  C CA    . ALA A  1 398 ? 95.646  139.638 -118.313 1.00 43.04  ? 398  ALA A CA    1 
ATOM   2957  C C     . ALA A  1 398 ? 94.415  140.144 -117.520 1.00 44.13  ? 398  ALA A C     1 
ATOM   2958  O O     . ALA A  1 398 ? 93.431  140.617 -118.099 1.00 45.38  ? 398  ALA A O     1 
ATOM   2959  C CB    . ALA A  1 398 ? 95.316  139.535 -119.813 1.00 43.03  ? 398  ALA A CB    1 
ATOM   2960  N N     . ASP A  1 399 ? 94.494  140.050 -116.191 1.00 44.20  ? 399  ASP A N     1 
ATOM   2961  C CA    . ASP A  1 399 ? 93.435  140.477 -115.280 1.00 43.50  ? 399  ASP A CA    1 
ATOM   2962  C C     . ASP A  1 399 ? 94.228  141.022 -114.089 1.00 43.50  ? 399  ASP A C     1 
ATOM   2963  O O     . ASP A  1 399 ? 94.323  140.390 -113.039 1.00 43.42  ? 399  ASP A O     1 
ATOM   2964  C CB    . ASP A  1 399 ? 92.592  139.256 -114.892 1.00 43.71  ? 399  ASP A CB    1 
ATOM   2965  C CG    . ASP A  1 399 ? 91.406  139.598 -114.009 1.00 45.68  ? 399  ASP A CG    1 
ATOM   2966  O OD1   . ASP A  1 399 ? 91.162  140.795 -113.717 1.00 48.10  ? 399  ASP A OD1   1 
ATOM   2967  O OD2   . ASP A  1 399 ? 90.708  138.646 -113.604 1.00 45.83  ? 399  ASP A OD2   1 
ATOM   2968  N N     . THR A  1 400 ? 94.796  142.211 -114.281 1.00 43.48  ? 400  THR A N     1 
ATOM   2969  C CA    . THR A  1 400 ? 95.647  142.870 -113.295 1.00 43.16  ? 400  THR A CA    1 
ATOM   2970  C C     . THR A  1 400 ? 95.052  143.933 -112.366 1.00 43.04  ? 400  THR A C     1 
ATOM   2971  O O     . THR A  1 400 ? 95.782  144.670 -111.699 1.00 42.23  ? 400  THR A O     1 
ATOM   2972  C CB    . THR A  1 400 ? 96.830  143.464 -114.017 1.00 42.85  ? 400  THR A CB    1 
ATOM   2973  O OG1   . THR A  1 400 ? 96.350  144.304 -115.072 1.00 44.46  ? 400  THR A OG1   1 
ATOM   2974  C CG2   . THR A  1 400 ? 97.675  142.358 -114.616 1.00 42.57  ? 400  THR A CG2   1 
ATOM   2975  N N     . ASP A  1 401 ? 93.733  143.997 -112.318 1.00 43.38  ? 401  ASP A N     1 
ATOM   2976  C CA    . ASP A  1 401 ? 93.015  144.937 -111.460 1.00 44.64  ? 401  ASP A CA    1 
ATOM   2977  C C     . ASP A  1 401 ? 93.292  144.775 -109.951 1.00 44.65  ? 401  ASP A C     1 
ATOM   2978  O O     . ASP A  1 401 ? 93.214  143.667 -109.423 1.00 46.42  ? 401  ASP A O     1 
ATOM   2979  C CB    . ASP A  1 401 ? 91.516  144.739 -111.670 1.00 46.44  ? 401  ASP A CB    1 
ATOM   2980  C CG    . ASP A  1 401 ? 90.857  145.907 -112.352 1.00 48.85  ? 401  ASP A CG    1 
ATOM   2981  O OD1   . ASP A  1 401 ? 91.577  146.840 -112.779 1.00 49.67  ? 401  ASP A OD1   1 
ATOM   2982  O OD2   . ASP A  1 401 ? 89.608  145.880 -112.463 1.00 49.70  ? 401  ASP A OD2   1 
ATOM   2983  N N     . GLY A  1 402 ? 93.614  145.866 -109.260 1.00 42.49  ? 402  GLY A N     1 
ATOM   2984  C CA    . GLY A  1 402 ? 93.791  145.799 -107.815 1.00 40.34  ? 402  GLY A CA    1 
ATOM   2985  C C     . GLY A  1 402 ? 95.099  145.552 -107.075 1.00 39.78  ? 402  GLY A C     1 
ATOM   2986  O O     . GLY A  1 402 ? 96.197  145.557 -107.643 1.00 40.60  ? 402  GLY A O     1 
ATOM   2987  N N     . MET A  1 403 ? 94.964  145.312 -105.771 1.00 37.12  ? 403  MET A N     1 
ATOM   2988  C CA    . MET A  1 403 ? 96.120  145.083 -104.910 1.00 34.56  ? 403  MET A CA    1 
ATOM   2989  C C     . MET A  1 403 ? 95.838  144.342 -103.596 1.00 32.83  ? 403  MET A C     1 
ATOM   2990  O O     . MET A  1 403 ? 94.686  144.090 -103.199 1.00 29.56  ? 403  MET A O     1 
ATOM   2991  C CB    . MET A  1 403 ? 96.713  146.424 -104.526 1.00 34.39  ? 403  MET A CB    1 
ATOM   2992  C CG    . MET A  1 403 ? 95.711  147.230 -103.722 1.00 34.63  ? 403  MET A CG    1 
ATOM   2993  S SD    . MET A  1 403 ? 96.400  148.622 -102.872 1.00 40.46  ? 403  MET A SD    1 
ATOM   2994  C CE    . MET A  1 403 ? 95.045  149.074 -101.777 1.00 37.31  ? 403  MET A CE    1 
ATOM   2995  N N     . VAL A  1 404 ? 96.926  143.998 -102.919 1.00 31.87  ? 404  VAL A N     1 
ATOM   2996  C CA    . VAL A  1 404 ? 96.830  143.387 -101.598 1.00 29.58  ? 404  VAL A CA    1 
ATOM   2997  C C     . VAL A  1 404 ? 97.438  144.427 -100.633 1.00 29.51  ? 404  VAL A C     1 
ATOM   2998  O O     . VAL A  1 404 ? 98.485  145.033 -100.883 1.00 28.86  ? 404  VAL A O     1 
ATOM   2999  C CB    . VAL A  1 404 ? 97.592  142.055 -101.515 1.00 28.45  ? 404  VAL A CB    1 
ATOM   3000  C CG1   . VAL A  1 404 ? 97.594  141.539 -100.077 1.00 28.24  ? 404  VAL A CG1   1 
ATOM   3001  C CG2   . VAL A  1 404 ? 96.950  141.040 -102.435 1.00 25.33  ? 404  VAL A CG2   1 
ATOM   3002  N N     . LYS A  1 405 ? 96.740  144.662 -99.545  1.00 29.53  ? 405  LYS A N     1 
ATOM   3003  C CA    . LYS A  1 405 ? 97.190  145.623 -98.568  1.00 29.83  ? 405  LYS A CA    1 
ATOM   3004  C C     . LYS A  1 405 ? 97.207  144.980 -97.200  1.00 30.41  ? 405  LYS A C     1 
ATOM   3005  O O     . LYS A  1 405 ? 96.163  144.599 -96.666  1.00 30.13  ? 405  LYS A O     1 
ATOM   3006  C CB    . LYS A  1 405 ? 96.249  146.823 -98.574  1.00 30.13  ? 405  LYS A CB    1 
ATOM   3007  C CG    . LYS A  1 405 ? 96.428  147.795 -97.423  1.00 29.62  ? 405  LYS A CG    1 
ATOM   3008  C CD    . LYS A  1 405 ? 95.445  148.939 -97.595  1.00 30.73  ? 405  LYS A CD    1 
ATOM   3009  C CE    . LYS A  1 405 ? 95.329  149.826 -96.382  1.00 30.05  ? 405  LYS A CE    1 
ATOM   3010  N NZ    . LYS A  1 405 ? 94.364  150.927 -96.683  1.00 29.87  ? 405  LYS A NZ    1 
ATOM   3011  N N     . ILE A  1 406 ? 98.409  144.872 -96.646  1.00 30.60  ? 406  ILE A N     1 
ATOM   3012  C CA    . ILE A  1 406 ? 98.636  144.289 -95.334  1.00 29.84  ? 406  ILE A CA    1 
ATOM   3013  C C     . ILE A  1 406 ? 98.931  145.345 -94.228  1.00 30.57  ? 406  ILE A C     1 
ATOM   3014  O O     . ILE A  1 406 ? 99.746  146.252 -94.422  1.00 30.02  ? 406  ILE A O     1 
ATOM   3015  C CB    . ILE A  1 406 ? 99.818  143.274 -95.420  1.00 29.88  ? 406  ILE A CB    1 
ATOM   3016  C CG1   . ILE A  1 406 ? 99.477  142.184 -96.445  1.00 30.16  ? 406  ILE A CG1   1 
ATOM   3017  C CG2   . ILE A  1 406 ? 100.127 142.669 -94.038  1.00 24.94  ? 406  ILE A CG2   1 
ATOM   3018  C CD1   . ILE A  1 406 ? 98.272  141.315 -96.043  1.00 31.01  ? 406  ILE A CD1   1 
ATOM   3019  N N     . LEU A  1 407 ? 98.244  145.207 -93.089  1.00 30.21  ? 407  LEU A N     1 
ATOM   3020  C CA    . LEU A  1 407 ? 98.407  146.065 -91.920  1.00 31.07  ? 407  LEU A CA    1 
ATOM   3021  C C     . LEU A  1 407 ? 99.062  145.243 -90.785  1.00 32.28  ? 407  LEU A C     1 
ATOM   3022  O O     . LEU A  1 407 ? 98.486  144.273 -90.284  1.00 33.00  ? 407  LEU A O     1 
ATOM   3023  C CB    . LEU A  1 407 ? 97.045  146.595 -91.452  1.00 31.41  ? 407  LEU A CB    1 
ATOM   3024  C CG    . LEU A  1 407 ? 96.171  147.301 -92.503  1.00 33.91  ? 407  LEU A CG    1 
ATOM   3025  C CD1   . LEU A  1 407 ? 94.796  147.557 -91.929  1.00 30.01  ? 407  LEU A CD1   1 
ATOM   3026  C CD2   . LEU A  1 407 ? 96.828  148.616 -92.975  1.00 33.56  ? 407  LEU A CD2   1 
ATOM   3027  N N     . GLY A  1 408 ? 100.276 145.617 -90.399  1.00 32.72  ? 408  GLY A N     1 
ATOM   3028  C CA    . GLY A  1 408 ? 100.966 144.902 -89.337  1.00 34.09  ? 408  GLY A CA    1 
ATOM   3029  C C     . GLY A  1 408 ? 101.199 145.768 -88.113  1.00 34.22  ? 408  GLY A C     1 
ATOM   3030  O O     . GLY A  1 408 ? 101.267 146.990 -88.220  1.00 33.28  ? 408  GLY A O     1 
ATOM   3031  N N     . GLN A  1 409 ? 101.309 145.154 -86.942  1.00 35.46  ? 409  GLN A N     1 
ATOM   3032  C CA    . GLN A  1 409 ? 101.556 145.945 -85.742  1.00 38.92  ? 409  GLN A CA    1 
ATOM   3033  C C     . GLN A  1 409 ? 102.997 146.476 -85.839  1.00 40.44  ? 409  GLN A C     1 
ATOM   3034  O O     . GLN A  1 409 ? 103.943 145.738 -86.139  1.00 39.13  ? 409  GLN A O     1 
ATOM   3035  C CB    . GLN A  1 409 ? 101.362 145.104 -84.476  1.00 39.18  ? 409  GLN A CB    1 
ATOM   3036  C CG    . GLN A  1 409 ? 100.987 145.914 -83.227  1.00 44.32  ? 409  GLN A CG    1 
ATOM   3037  C CD    . GLN A  1 409 ? 102.130 146.801 -82.695  1.00 48.53  ? 409  GLN A CD    1 
ATOM   3038  O OE1   . GLN A  1 409 ? 103.220 146.306 -82.366  1.00 49.75  ? 409  GLN A OE1   1 
ATOM   3039  N NE2   . GLN A  1 409 ? 101.877 148.115 -82.595  1.00 47.57  ? 409  GLN A NE2   1 
ATOM   3040  N N     . LYS A  1 410 ? 103.133 147.773 -85.606  1.00 42.76  ? 410  LYS A N     1 
ATOM   3041  C CA    . LYS A  1 410 ? 104.398 148.485 -85.684  1.00 46.30  ? 410  LYS A CA    1 
ATOM   3042  C C     . LYS A  1 410 ? 105.608 147.762 -85.090  1.00 47.20  ? 410  LYS A C     1 
ATOM   3043  O O     . LYS A  1 410 ? 106.679 147.716 -85.705  1.00 46.86  ? 410  LYS A O     1 
ATOM   3044  C CB    . LYS A  1 410 ? 104.222 149.847 -85.012  1.00 49.47  ? 410  LYS A CB    1 
ATOM   3045  C CG    . LYS A  1 410 ? 105.408 150.796 -85.107  1.00 53.91  ? 410  LYS A CG    1 
ATOM   3046  C CD    . LYS A  1 410 ? 105.503 151.456 -86.466  1.00 56.13  ? 410  LYS A CD    1 
ATOM   3047  C CE    . LYS A  1 410 ? 106.605 152.498 -86.452  1.00 58.43  ? 410  LYS A CE    1 
ATOM   3048  N NZ    . LYS A  1 410 ? 106.688 153.232 -87.740  1.00 61.81  ? 410  LYS A NZ    1 
ATOM   3049  N N     . SER A  1 411 ? 105.446 147.193 -83.902  1.00 47.87  ? 411  SER A N     1 
ATOM   3050  C CA    . SER A  1 411 ? 106.567 146.519 -83.268  1.00 49.74  ? 411  SER A CA    1 
ATOM   3051  C C     . SER A  1 411 ? 106.522 144.992 -83.223  1.00 50.31  ? 411  SER A C     1 
ATOM   3052  O O     . SER A  1 411 ? 107.562 144.343 -83.391  1.00 51.28  ? 411  SER A O     1 
ATOM   3053  C CB    . SER A  1 411 ? 106.768 147.073 -81.855  1.00 50.90  ? 411  SER A CB    1 
ATOM   3054  O OG    . SER A  1 411 ? 105.556 147.053 -81.124  1.00 52.91  ? 411  SER A OG    1 
ATOM   3055  N N     . THR A  1 412 ? 105.342 144.417 -82.990  1.00 49.26  ? 412  THR A N     1 
ATOM   3056  C CA    . THR A  1 412 ? 105.213 142.963 -82.938  1.00 47.83  ? 412  THR A CA    1 
ATOM   3057  C C     . THR A  1 412 ? 105.265 142.336 -84.334  1.00 45.97  ? 412  THR A C     1 
ATOM   3058  O O     . THR A  1 412 ? 105.452 141.136 -84.472  1.00 45.80  ? 412  THR A O     1 
ATOM   3059  C CB    . THR A  1 412 ? 103.895 142.552 -82.273  1.00 48.26  ? 412  THR A CB    1 
ATOM   3060  O OG1   . THR A  1 412 ? 102.802 143.004 -83.072  1.00 49.56  ? 412  THR A OG1   1 
ATOM   3061  C CG2   . THR A  1 412 ? 103.777 143.175 -80.899  1.00 49.43  ? 412  THR A CG2   1 
ATOM   3062  N N     . ASP A  1 413 ? 105.114 143.163 -85.362  1.00 43.99  ? 413  ASP A N     1 
ATOM   3063  C CA    . ASP A  1 413 ? 105.114 142.717 -86.751  1.00 41.71  ? 413  ASP A CA    1 
ATOM   3064  C C     . ASP A  1 413 ? 103.942 141.777 -87.037  1.00 40.20  ? 413  ASP A C     1 
ATOM   3065  O O     . ASP A  1 413 ? 103.852 141.188 -88.110  1.00 38.57  ? 413  ASP A O     1 
ATOM   3066  C CB    . ASP A  1 413 ? 106.448 142.042 -87.116  1.00 42.57  ? 413  ASP A CB    1 
ATOM   3067  C CG    . ASP A  1 413 ? 106.578 141.767 -88.631  1.00 45.99  ? 413  ASP A CG    1 
ATOM   3068  O OD1   . ASP A  1 413 ? 106.022 142.566 -89.431  1.00 46.04  ? 413  ASP A OD1   1 
ATOM   3069  O OD2   . ASP A  1 413 ? 107.239 140.765 -89.023  1.00 46.00  ? 413  ASP A OD2   1 
ATOM   3070  N N     . ARG A  1 414 ? 103.038 141.630 -86.076  1.00 39.61  ? 414  ARG A N     1 
ATOM   3071  C CA    . ARG A  1 414 ? 101.876 140.770 -86.293  1.00 39.85  ? 414  ARG A CA    1 
ATOM   3072  C C     . ARG A  1 414 ? 100.852 141.360 -87.244  1.00 37.41  ? 414  ARG A C     1 
ATOM   3073  O O     . ARG A  1 414 ? 100.574 142.560 -87.236  1.00 36.08  ? 414  ARG A O     1 
ATOM   3074  C CB    . ARG A  1 414 ? 101.169 140.435 -84.985  1.00 42.38  ? 414  ARG A CB    1 
ATOM   3075  C CG    . ARG A  1 414 ? 101.772 139.264 -84.266  1.00 47.50  ? 414  ARG A CG    1 
ATOM   3076  C CD    . ARG A  1 414 ? 100.753 138.733 -83.309  1.00 52.20  ? 414  ARG A CD    1 
ATOM   3077  N NE    . ARG A  1 414 ? 101.235 137.611 -82.501  1.00 55.98  ? 414  ARG A NE    1 
ATOM   3078  C CZ    . ARG A  1 414 ? 100.520 137.071 -81.516  1.00 56.47  ? 414  ARG A CZ    1 
ATOM   3079  N NH1   . ARG A  1 414 ? 99.316  137.560 -81.238  1.00 58.08  ? 414  ARG A NH1   1 
ATOM   3080  N NH2   . ARG A  1 414 ? 100.991 136.053 -80.813  1.00 55.78  ? 414  ARG A NH2   1 
ATOM   3081  N N     . VAL A  1 415 ? 100.284 140.486 -88.059  1.00 35.39  ? 415  VAL A N     1 
ATOM   3082  C CA    . VAL A  1 415 ? 99.280  140.886 -89.016  1.00 33.47  ? 415  VAL A CA    1 
ATOM   3083  C C     . VAL A  1 415 ? 98.013  141.255 -88.274  1.00 32.02  ? 415  VAL A C     1 
ATOM   3084  O O     . VAL A  1 415 ? 97.543  140.510 -87.427  1.00 30.25  ? 415  VAL A O     1 
ATOM   3085  C CB    . VAL A  1 415 ? 98.996  139.748 -90.016  1.00 34.01  ? 415  VAL A CB    1 
ATOM   3086  C CG1   . VAL A  1 415 ? 97.896  140.159 -90.973  1.00 33.26  ? 415  VAL A CG1   1 
ATOM   3087  C CG2   . VAL A  1 415 ? 100.268 139.402 -90.774  1.00 32.21  ? 415  VAL A CG2   1 
ATOM   3088  N N     . LEU A  1 416 ? 97.472  142.422 -88.598  1.00 31.56  ? 416  LEU A N     1 
ATOM   3089  C CA    . LEU A  1 416 ? 96.258  142.905 -87.956  1.00 31.48  ? 416  LEU A CA    1 
ATOM   3090  C C     . LEU A  1 416 ? 95.087  142.887 -88.920  1.00 31.57  ? 416  LEU A C     1 
ATOM   3091  O O     . LEU A  1 416 ? 93.931  142.815 -88.499  1.00 31.54  ? 416  LEU A O     1 
ATOM   3092  C CB    . LEU A  1 416 ? 96.447  144.340 -87.461  1.00 30.23  ? 416  LEU A CB    1 
ATOM   3093  C CG    . LEU A  1 416 ? 97.568  144.588 -86.477  1.00 30.05  ? 416  LEU A CG    1 
ATOM   3094  C CD1   . LEU A  1 416 ? 97.594  146.039 -86.109  1.00 31.74  ? 416  LEU A CD1   1 
ATOM   3095  C CD2   . LEU A  1 416 ? 97.354  143.757 -85.249  1.00 31.11  ? 416  LEU A CD2   1 
ATOM   3096  N N     . GLY A  1 417 ? 95.397  143.002 -90.210  1.00 30.26  ? 417  GLY A N     1 
ATOM   3097  C CA    . GLY A  1 417 ? 94.365  143.003 -91.224  1.00 28.26  ? 417  GLY A CA    1 
ATOM   3098  C C     . GLY A  1 417 ? 94.923  142.784 -92.617  1.00 28.84  ? 417  GLY A C     1 
ATOM   3099  O O     . GLY A  1 417 ? 96.073  143.112 -92.914  1.00 27.93  ? 417  GLY A O     1 
ATOM   3100  N N     . ALA A  1 418 ? 94.090  142.227 -93.482  1.00 28.48  ? 418  ALA A N     1 
ATOM   3101  C CA    . ALA A  1 418 ? 94.466  141.951 -94.857  1.00 27.85  ? 418  ALA A CA    1 
ATOM   3102  C C     . ALA A  1 418 ? 93.278  142.376 -95.698  1.00 28.57  ? 418  ALA A C     1 
ATOM   3103  O O     . ALA A  1 418 ? 92.132  142.014 -95.416  1.00 28.23  ? 418  ALA A O     1 
ATOM   3104  C CB    . ALA A  1 418 ? 94.732  140.479 -95.031  1.00 27.70  ? 418  ALA A CB    1 
ATOM   3105  N N     . HIS A  1 419 ? 93.553  143.150 -96.732  1.00 28.47  ? 419  HIS A N     1 
ATOM   3106  C CA    . HIS A  1 419 ? 92.504  143.644 -97.583  1.00 28.97  ? 419  HIS A CA    1 
ATOM   3107  C C     . HIS A  1 419 ? 92.937  143.388 -99.016  1.00 29.76  ? 419  HIS A C     1 
ATOM   3108  O O     . HIS A  1 419 ? 94.006  143.816 -99.443  1.00 31.10  ? 419  HIS A O     1 
ATOM   3109  C CB    . HIS A  1 419 ? 92.294  145.135 -97.295  1.00 29.58  ? 419  HIS A CB    1 
ATOM   3110  C CG    . HIS A  1 419 ? 92.077  145.426 -95.845  1.00 29.60  ? 419  HIS A CG    1 
ATOM   3111  N ND1   . HIS A  1 419 ? 90.832  145.406 -95.260  1.00 29.87  ? 419  HIS A ND1   1 
ATOM   3112  C CD2   . HIS A  1 419 ? 92.962  145.599 -94.835  1.00 31.00  ? 419  HIS A CD2   1 
ATOM   3113  C CE1   . HIS A  1 419 ? 90.958  145.542 -93.952  1.00 30.22  ? 419  HIS A CE1   1 
ATOM   3114  N NE2   . HIS A  1 419 ? 92.242  145.658 -93.667  1.00 30.72  ? 419  HIS A NE2   1 
ATOM   3115  N N     . ILE A  1 420 ? 92.086  142.678 -99.750  1.00 30.64  ? 420  ILE A N     1 
ATOM   3116  C CA    . ILE A  1 420 ? 92.368  142.308 -101.118 1.00 29.60  ? 420  ILE A CA    1 
ATOM   3117  C C     . ILE A  1 420 ? 91.338  142.813 -102.112 1.00 30.68  ? 420  ILE A C     1 
ATOM   3118  O O     . ILE A  1 420 ? 90.126  142.524 -102.042 1.00 29.17  ? 420  ILE A O     1 
ATOM   3119  C CB    . ILE A  1 420 ? 92.472  140.797 -101.229 1.00 29.03  ? 420  ILE A CB    1 
ATOM   3120  C CG1   . ILE A  1 420 ? 93.375  140.270 -100.118 1.00 27.79  ? 420  ILE A CG1   1 
ATOM   3121  C CG2   . ILE A  1 420 ? 93.016  140.419 -102.566 1.00 27.58  ? 420  ILE A CG2   1 
ATOM   3122  C CD1   . ILE A  1 420 ? 92.840  139.042 -99.412  1.00 29.61  ? 420  ILE A CD1   1 
ATOM   3123  N N     . LEU A  1 421 ? 91.850  143.591 -103.050 1.00 31.74  ? 421  LEU A N     1 
ATOM   3124  C CA    . LEU A  1 421 ? 91.035  144.146 -104.101 1.00 30.58  ? 421  LEU A CA    1 
ATOM   3125  C C     . LEU A  1 421 ? 91.632  143.637 -105.403 1.00 29.57  ? 421  LEU A C     1 
ATOM   3126  O O     . LEU A  1 421 ? 92.754  143.989 -105.749 1.00 28.80  ? 421  LEU A O     1 
ATOM   3127  C CB    . LEU A  1 421 ? 91.080  145.674 -104.054 1.00 31.03  ? 421  LEU A CB    1 
ATOM   3128  C CG    . LEU A  1 421 ? 90.364  146.360 -105.225 1.00 32.16  ? 421  LEU A CG    1 
ATOM   3129  C CD1   . LEU A  1 421 ? 88.878  145.948 -105.278 1.00 30.34  ? 421  LEU A CD1   1 
ATOM   3130  C CD2   . LEU A  1 421 ? 90.523  147.858 -105.077 1.00 31.29  ? 421  LEU A CD2   1 
ATOM   3131  N N     . GLY A  1 422 ? 90.892  142.795 -106.112 1.00 28.42  ? 422  GLY A N     1 
ATOM   3132  C CA    . GLY A  1 422 ? 91.397  142.284 -107.370 1.00 29.34  ? 422  GLY A CA    1 
ATOM   3133  C C     . GLY A  1 422 ? 91.007  140.845 -107.588 1.00 29.37  ? 422  GLY A C     1 
ATOM   3134  O O     . GLY A  1 422 ? 90.111  140.344 -106.915 1.00 31.83  ? 422  GLY A O     1 
ATOM   3135  N N     . PRO A  1 423 ? 91.673  140.138 -108.502 1.00 29.09  ? 423  PRO A N     1 
ATOM   3136  C CA    . PRO A  1 423 ? 91.347  138.728 -108.780 1.00 29.15  ? 423  PRO A CA    1 
ATOM   3137  C C     . PRO A  1 423 ? 91.664  137.723 -107.681 1.00 30.59  ? 423  PRO A C     1 
ATOM   3138  O O     . PRO A  1 423 ? 92.681  137.839 -106.991 1.00 31.23  ? 423  PRO A O     1 
ATOM   3139  C CB    . PRO A  1 423 ? 92.148  138.435 -110.038 1.00 29.24  ? 423  PRO A CB    1 
ATOM   3140  C CG    . PRO A  1 423 ? 93.384  139.285 -109.834 1.00 27.62  ? 423  PRO A CG    1 
ATOM   3141  C CD    . PRO A  1 423 ? 92.785  140.597 -109.350 1.00 27.17  ? 423  PRO A CD    1 
ATOM   3142  N N     . GLY A  1 424 ? 90.795  136.727 -107.525 1.00 30.42  ? 424  GLY A N     1 
ATOM   3143  C CA    . GLY A  1 424 ? 91.027  135.701 -106.521 1.00 30.22  ? 424  GLY A CA    1 
ATOM   3144  C C     . GLY A  1 424 ? 90.892  136.095 -105.061 1.00 29.82  ? 424  GLY A C     1 
ATOM   3145  O O     . GLY A  1 424 ? 91.144  135.279 -104.180 1.00 29.85  ? 424  GLY A O     1 
ATOM   3146  N N     . ALA A  1 425 ? 90.473  137.330 -104.808 1.00 30.12  ? 425  ALA A N     1 
ATOM   3147  C CA    . ALA A  1 425 ? 90.318  137.836 -103.450 1.00 30.42  ? 425  ALA A CA    1 
ATOM   3148  C C     . ALA A  1 425 ? 89.521  136.888 -102.574 1.00 31.28  ? 425  ALA A C     1 
ATOM   3149  O O     . ALA A  1 425 ? 89.964  136.536 -101.485 1.00 31.51  ? 425  ALA A O     1 
ATOM   3150  C CB    . ALA A  1 425 ? 89.647  139.241 -103.464 1.00 28.88  ? 425  ALA A CB    1 
ATOM   3151  N N     . GLY A  1 426 ? 88.355  136.464 -103.063 1.00 33.32  ? 426  GLY A N     1 
ATOM   3152  C CA    . GLY A  1 426 ? 87.486  135.576 -102.299 1.00 33.00  ? 426  GLY A CA    1 
ATOM   3153  C C     . GLY A  1 426 ? 88.151  134.336 -101.727 1.00 32.48  ? 426  GLY A C     1 
ATOM   3154  O O     . GLY A  1 426 ? 87.913  133.958 -100.573 1.00 33.04  ? 426  GLY A O     1 
ATOM   3155  N N     . GLU A  1 427 ? 88.977  133.691 -102.545 1.00 31.25  ? 427  GLU A N     1 
ATOM   3156  C CA    . GLU A  1 427 ? 89.680  132.501 -102.110 1.00 30.57  ? 427  GLU A CA    1 
ATOM   3157  C C     . GLU A  1 427 ? 90.919  132.850 -101.270 1.00 30.35  ? 427  GLU A C     1 
ATOM   3158  O O     . GLU A  1 427 ? 91.257  132.152 -100.320 1.00 30.94  ? 427  GLU A O     1 
ATOM   3159  C CB    . GLU A  1 427 ? 90.085  131.660 -103.330 1.00 28.14  ? 427  GLU A CB    1 
ATOM   3160  C CG    . GLU A  1 427 ? 88.912  131.063 -104.108 1.00 26.91  ? 427  GLU A CG    1 
ATOM   3161  C CD    . GLU A  1 427 ? 87.953  130.255 -103.238 1.00 27.39  ? 427  GLU A CD    1 
ATOM   3162  O OE1   . GLU A  1 427 ? 88.403  129.582 -102.281 1.00 28.18  ? 427  GLU A OE1   1 
ATOM   3163  O OE2   . GLU A  1 427 ? 86.743  130.283 -103.527 1.00 27.94  ? 427  GLU A OE2   1 
ATOM   3164  N N     . MET A  1 428 ? 91.570  133.955 -101.602 1.00 29.69  ? 428  MET A N     1 
ATOM   3165  C CA    . MET A  1 428 ? 92.779  134.355 -100.911 1.00 28.25  ? 428  MET A CA    1 
ATOM   3166  C C     . MET A  1 428 ? 92.635  134.744 -99.443  1.00 28.59  ? 428  MET A C     1 
ATOM   3167  O O     . MET A  1 428 ? 93.566  134.565 -98.663  1.00 29.83  ? 428  MET A O     1 
ATOM   3168  C CB    . MET A  1 428 ? 93.413  135.505 -101.669 1.00 29.18  ? 428  MET A CB    1 
ATOM   3169  C CG    . MET A  1 428 ? 94.877  135.724 -101.362 1.00 31.37  ? 428  MET A CG    1 
ATOM   3170  S SD    . MET A  1 428 ? 95.475  137.220 -102.176 1.00 33.23  ? 428  MET A SD    1 
ATOM   3171  C CE    . MET A  1 428 ? 95.341  136.716 -103.908 1.00 30.61  ? 428  MET A CE    1 
ATOM   3172  N N     . VAL A  1 429 ? 91.476  135.278 -99.069  1.00 27.15  ? 429  VAL A N     1 
ATOM   3173  C CA    . VAL A  1 429 ? 91.236  135.752 -97.713  1.00 25.26  ? 429  VAL A CA    1 
ATOM   3174  C C     . VAL A  1 429 ? 91.269  134.619 -96.687  1.00 26.52  ? 429  VAL A C     1 
ATOM   3175  O O     . VAL A  1 429 ? 91.499  134.826 -95.488  1.00 24.98  ? 429  VAL A O     1 
ATOM   3176  C CB    . VAL A  1 429 ? 89.871  136.480 -97.647  1.00 24.94  ? 429  VAL A CB    1 
ATOM   3177  C CG1   . VAL A  1 429 ? 88.718  135.457 -97.751  1.00 24.86  ? 429  VAL A CG1   1 
ATOM   3178  C CG2   . VAL A  1 429 ? 89.785  137.313 -96.382  1.00 23.18  ? 429  VAL A CG2   1 
ATOM   3179  N N     . ASN A  1 430 ? 91.034  133.412 -97.172  1.00 26.92  ? 430  ASN A N     1 
ATOM   3180  C CA    . ASN A  1 430 ? 91.030  132.274 -96.306  1.00 27.92  ? 430  ASN A CA    1 
ATOM   3181  C C     . ASN A  1 430 ? 92.430  131.954 -95.840  1.00 27.24  ? 430  ASN A C     1 
ATOM   3182  O O     . ASN A  1 430 ? 92.607  131.467 -94.736  1.00 28.14  ? 430  ASN A O     1 
ATOM   3183  C CB    . ASN A  1 430 ? 90.358  131.130 -97.027  1.00 28.65  ? 430  ASN A CB    1 
ATOM   3184  C CG    . ASN A  1 430 ? 88.911  131.443 -97.296  1.00 31.33  ? 430  ASN A CG    1 
ATOM   3185  O OD1   . ASN A  1 430 ? 88.113  131.585 -96.353  1.00 27.68  ? 430  ASN A OD1   1 
ATOM   3186  N ND2   . ASN A  1 430 ? 88.560  131.595 -98.578  1.00 31.22  ? 430  ASN A ND2   1 
ATOM   3187  N N     . GLU A  1 431 ? 93.423  132.257 -96.663  1.00 25.72  ? 431  GLU A N     1 
ATOM   3188  C CA    . GLU A  1 431 ? 94.812  132.031 -96.264  1.00 26.89  ? 431  GLU A CA    1 
ATOM   3189  C C     . GLU A  1 431 ? 95.146  133.077 -95.181  1.00 26.46  ? 431  GLU A C     1 
ATOM   3190  O O     . GLU A  1 431 ? 95.785  132.791 -94.148  1.00 28.00  ? 431  GLU A O     1 
ATOM   3191  C CB    . GLU A  1 431 ? 95.760  132.219 -97.451  1.00 24.55  ? 431  GLU A CB    1 
ATOM   3192  C CG    . GLU A  1 431 ? 97.137  131.824 -97.101  1.00 26.45  ? 431  GLU A CG    1 
ATOM   3193  C CD    . GLU A  1 431 ? 98.196  132.295 -98.067  1.00 29.61  ? 431  GLU A CD    1 
ATOM   3194  O OE1   . GLU A  1 431 ? 97.977  132.309 -99.295  1.00 28.47  ? 431  GLU A OE1   1 
ATOM   3195  O OE2   . GLU A  1 431 ? 99.291  132.629 -97.574  1.00 31.04  ? 431  GLU A OE2   1 
ATOM   3196  N N     . ALA A  1 432 ? 94.692  134.300 -95.429  1.00 26.02  ? 432  ALA A N     1 
ATOM   3197  C CA    . ALA A  1 432 ? 94.913  135.396 -94.508  1.00 24.70  ? 432  ALA A CA    1 
ATOM   3198  C C     . ALA A  1 432 ? 94.277  134.993 -93.194  1.00 24.75  ? 432  ALA A C     1 
ATOM   3199  O O     . ALA A  1 432 ? 94.892  135.128 -92.144  1.00 25.27  ? 432  ALA A O     1 
ATOM   3200  C CB    . ALA A  1 432 ? 94.274  136.690 -95.057  1.00 21.82  ? 432  ALA A CB    1 
ATOM   3201  N N     . ALA A  1 433 ? 93.061  134.458 -93.266  1.00 24.23  ? 433  ALA A N     1 
ATOM   3202  C CA    . ALA A  1 433 ? 92.328  134.050 -92.064  1.00 25.49  ? 433  ALA A CA    1 
ATOM   3203  C C     . ALA A  1 433 ? 93.107  133.053 -91.221  1.00 26.61  ? 433  ALA A C     1 
ATOM   3204  O O     . ALA A  1 433 ? 93.095  133.132 -89.974  1.00 26.65  ? 433  ALA A O     1 
ATOM   3205  C CB    . ALA A  1 433 ? 90.955  133.446 -92.428  1.00 26.27  ? 433  ALA A CB    1 
ATOM   3206  N N     . LEU A  1 434 ? 93.761  132.112 -91.900  1.00 24.52  ? 434  LEU A N     1 
ATOM   3207  C CA    . LEU A  1 434 ? 94.534  131.119 -91.202  1.00 25.55  ? 434  LEU A CA    1 
ATOM   3208  C C     . LEU A  1 434 ? 95.708  131.829 -90.565  1.00 25.94  ? 434  LEU A C     1 
ATOM   3209  O O     . LEU A  1 434 ? 96.113  131.491 -89.457  1.00 24.96  ? 434  LEU A O     1 
ATOM   3210  C CB    . LEU A  1 434 ? 95.021  130.023 -92.155  1.00 26.04  ? 434  LEU A CB    1 
ATOM   3211  C CG    . LEU A  1 434 ? 95.887  128.897 -91.566  1.00 25.67  ? 434  LEU A CG    1 
ATOM   3212  C CD1   . LEU A  1 434 ? 95.143  128.074 -90.479  1.00 26.28  ? 434  LEU A CD1   1 
ATOM   3213  C CD2   . LEU A  1 434 ? 96.302  127.986 -92.733  1.00 27.55  ? 434  LEU A CD2   1 
ATOM   3214  N N     . ALA A  1 435 ? 96.255  132.831 -91.245  1.00 27.36  ? 435  ALA A N     1 
ATOM   3215  C CA    . ALA A  1 435 ? 97.389  133.555 -90.651  1.00 28.67  ? 435  ALA A CA    1 
ATOM   3216  C C     . ALA A  1 435 ? 96.997  134.267 -89.330  1.00 29.52  ? 435  ALA A C     1 
ATOM   3217  O O     . ALA A  1 435 ? 97.696  134.150 -88.304  1.00 29.11  ? 435  ALA A O     1 
ATOM   3218  C CB    . ALA A  1 435 ? 97.968  134.561 -91.651  1.00 25.12  ? 435  ALA A CB    1 
ATOM   3219  N N     . LEU A  1 436 ? 95.879  134.988 -89.354  1.00 29.44  ? 436  LEU A N     1 
ATOM   3220  C CA    . LEU A  1 436 ? 95.400  135.694 -88.161  1.00 30.85  ? 436  LEU A CA    1 
ATOM   3221  C C     . LEU A  1 436 ? 95.100  134.790 -86.968  1.00 30.31  ? 436  LEU A C     1 
ATOM   3222  O O     . LEU A  1 436 ? 95.302  135.191 -85.827  1.00 32.80  ? 436  LEU A O     1 
ATOM   3223  C CB    . LEU A  1 436 ? 94.143  136.502 -88.478  1.00 30.65  ? 436  LEU A CB    1 
ATOM   3224  C CG    . LEU A  1 436 ? 94.334  137.828 -89.214  1.00 31.35  ? 436  LEU A CG    1 
ATOM   3225  C CD1   . LEU A  1 436 ? 92.960  138.370 -89.532  1.00 33.34  ? 436  LEU A CD1   1 
ATOM   3226  C CD2   . LEU A  1 436 ? 95.115  138.835 -88.371  1.00 30.38  ? 436  LEU A CD2   1 
ATOM   3227  N N     . GLU A  1 437 ? 94.613  133.582 -87.228  1.00 30.05  ? 437  GLU A N     1 
ATOM   3228  C CA    . GLU A  1 437 ? 94.283  132.647 -86.161  1.00 29.04  ? 437  GLU A CA    1 
ATOM   3229  C C     . GLU A  1 437 ? 95.530  132.186 -85.442  1.00 27.14  ? 437  GLU A C     1 
ATOM   3230  O O     . GLU A  1 437 ? 95.535  131.974 -84.234  1.00 25.46  ? 437  GLU A O     1 
ATOM   3231  C CB    . GLU A  1 437 ? 93.562  131.438 -86.734  1.00 32.00  ? 437  GLU A CB    1 
ATOM   3232  C CG    . GLU A  1 437 ? 93.289  130.301 -85.735  1.00 37.80  ? 437  GLU A CG    1 
ATOM   3233  C CD    . GLU A  1 437 ? 92.364  130.703 -84.592  1.00 40.77  ? 437  GLU A CD    1 
ATOM   3234  O OE1   . GLU A  1 437 ? 91.454  131.560 -84.827  1.00 43.41  ? 437  GLU A OE1   1 
ATOM   3235  O OE2   . GLU A  1 437 ? 92.552  130.144 -83.476  1.00 37.87  ? 437  GLU A OE2   1 
ATOM   3236  N N     . TYR A  1 438 ? 96.591  132.015 -86.207  1.00 25.75  ? 438  TYR A N     1 
ATOM   3237  C CA    . TYR A  1 438 ? 97.836  131.571 -85.638  1.00 24.66  ? 438  TYR A CA    1 
ATOM   3238  C C     . TYR A  1 438 ? 98.592  132.747 -85.043  1.00 25.50  ? 438  TYR A C     1 
ATOM   3239  O O     . TYR A  1 438 ? 99.572  132.571 -84.325  1.00 23.57  ? 438  TYR A O     1 
ATOM   3240  C CB    . TYR A  1 438 ? 98.676  130.856 -86.697  1.00 22.74  ? 438  TYR A CB    1 
ATOM   3241  C CG    . TYR A  1 438 ? 98.796  129.381 -86.407  1.00 22.06  ? 438  TYR A CG    1 
ATOM   3242  C CD1   . TYR A  1 438 ? 97.737  128.515 -86.660  1.00 22.35  ? 438  TYR A CD1   1 
ATOM   3243  C CD2   . TYR A  1 438 ? 99.931  128.863 -85.775  1.00 22.36  ? 438  TYR A CD2   1 
ATOM   3244  C CE1   . TYR A  1 438 ? 97.793  127.165 -86.288  1.00 24.48  ? 438  TYR A CE1   1 
ATOM   3245  C CE2   . TYR A  1 438 ? 99.997  127.513 -85.389  1.00 23.36  ? 438  TYR A CE2   1 
ATOM   3246  C CZ    . TYR A  1 438 ? 98.921  126.669 -85.654  1.00 24.29  ? 438  TYR A CZ    1 
ATOM   3247  O OH    . TYR A  1 438 ? 98.970  125.328 -85.324  1.00 26.51  ? 438  TYR A OH    1 
ATOM   3248  N N     . GLY A  1 439 ? 98.103  133.952 -85.318  1.00 26.28  ? 439  GLY A N     1 
ATOM   3249  C CA    . GLY A  1 439 ? 98.767  135.131 -84.814  1.00 26.09  ? 439  GLY A CA    1 
ATOM   3250  C C     . GLY A  1 439 ? 100.048 135.328 -85.595  1.00 26.62  ? 439  GLY A C     1 
ATOM   3251  O O     . GLY A  1 439 ? 101.087 135.669 -85.040  1.00 26.52  ? 439  GLY A O     1 
ATOM   3252  N N     . ALA A  1 440 ? 99.958  135.119 -86.899  1.00 27.30  ? 440  ALA A N     1 
ATOM   3253  C CA    . ALA A  1 440 ? 101.101 135.249 -87.783  1.00 28.38  ? 440  ALA A CA    1 
ATOM   3254  C C     . ALA A  1 440 ? 101.682 136.644 -87.848  1.00 29.35  ? 440  ALA A C     1 
ATOM   3255  O O     . ALA A  1 440 ? 101.007 137.637 -87.572  1.00 30.67  ? 440  ALA A O     1 
ATOM   3256  C CB    . ALA A  1 440 ? 100.716 134.819 -89.183  1.00 26.75  ? 440  ALA A CB    1 
ATOM   3257  N N     . SER A  1 441 ? 102.953 136.698 -88.222  1.00 30.68  ? 441  SER A N     1 
ATOM   3258  C CA    . SER A  1 441 ? 103.653 137.953 -88.410  1.00 31.75  ? 441  SER A CA    1 
ATOM   3259  C C     . SER A  1 441 ? 103.811 138.110 -89.950  1.00 33.19  ? 441  SER A C     1 
ATOM   3260  O O     . SER A  1 441 ? 103.620 137.151 -90.704  1.00 30.87  ? 441  SER A O     1 
ATOM   3261  C CB    . SER A  1 441 ? 105.017 137.914 -87.722  1.00 29.90  ? 441  SER A CB    1 
ATOM   3262  O OG    . SER A  1 441 ? 105.913 137.077 -88.418  1.00 31.01  ? 441  SER A OG    1 
ATOM   3263  N N     . CYS A  1 442 ? 104.120 139.323 -90.398  1.00 34.26  ? 442  CYS A N     1 
ATOM   3264  C CA    . CYS A  1 442 ? 104.307 139.615 -91.809  1.00 34.94  ? 442  CYS A CA    1 
ATOM   3265  C C     . CYS A  1 442 ? 105.518 138.869 -92.303  1.00 35.41  ? 442  CYS A C     1 
ATOM   3266  O O     . CYS A  1 442 ? 105.557 138.417 -93.450  1.00 34.99  ? 442  CYS A O     1 
ATOM   3267  C CB    . CYS A  1 442 ? 104.497 141.117 -92.002  1.00 35.41  ? 442  CYS A CB    1 
ATOM   3268  S SG    . CYS A  1 442 ? 103.059 142.002 -91.441  1.00 36.85  ? 442  CYS A SG    1 
ATOM   3269  N N     . GLU A  1 443 ? 106.500 138.734 -91.415  1.00 36.59  ? 443  GLU A N     1 
ATOM   3270  C CA    . GLU A  1 443 ? 107.728 138.028 -91.740  1.00 36.55  ? 443  GLU A CA    1 
ATOM   3271  C C     . GLU A  1 443 ? 107.405 136.552 -91.937  1.00 35.46  ? 443  GLU A C     1 
ATOM   3272  O O     . GLU A  1 443 ? 107.871 135.944 -92.893  1.00 34.88  ? 443  GLU A O     1 
ATOM   3273  C CB    . GLU A  1 443 ? 108.777 138.199 -90.631  1.00 37.73  ? 443  GLU A CB    1 
ATOM   3274  C CG    . GLU A  1 443 ? 110.206 137.949 -91.111  1.00 41.86  ? 443  GLU A CG    1 
ATOM   3275  C CD    . GLU A  1 443 ? 111.232 137.809 -89.993  1.00 44.45  ? 443  GLU A CD    1 
ATOM   3276  O OE1   . GLU A  1 443 ? 110.967 138.248 -88.856  1.00 48.18  ? 443  GLU A OE1   1 
ATOM   3277  O OE2   . GLU A  1 443 ? 112.325 137.264 -90.259  1.00 47.04  ? 443  GLU A OE2   1 
ATOM   3278  N N     . ASP A  1 444 ? 106.602 135.975 -91.048  1.00 34.55  ? 444  ASP A N     1 
ATOM   3279  C CA    . ASP A  1 444 ? 106.241 134.567 -91.190  1.00 34.44  ? 444  ASP A CA    1 
ATOM   3280  C C     . ASP A  1 444 ? 105.648 134.270 -92.558  1.00 34.09  ? 444  ASP A C     1 
ATOM   3281  O O     . ASP A  1 444 ? 106.040 133.313 -93.230  1.00 36.05  ? 444  ASP A O     1 
ATOM   3282  C CB    . ASP A  1 444 ? 105.194 134.145 -90.167  1.00 37.25  ? 444  ASP A CB    1 
ATOM   3283  C CG    . ASP A  1 444 ? 105.753 133.925 -88.790  1.00 38.14  ? 444  ASP A CG    1 
ATOM   3284  O OD1   . ASP A  1 444 ? 106.965 133.675 -88.635  1.00 39.09  ? 444  ASP A OD1   1 
ATOM   3285  O OD2   . ASP A  1 444 ? 104.934 133.979 -87.851  1.00 41.49  ? 444  ASP A OD2   1 
ATOM   3286  N N     . ILE A  1 445 ? 104.673 135.082 -92.946  1.00 31.73  ? 445  ILE A N     1 
ATOM   3287  C CA    . ILE A  1 445 ? 103.987 134.908 -94.210  1.00 31.51  ? 445  ILE A CA    1 
ATOM   3288  C C     . ILE A  1 445 ? 104.925 135.110 -95.384  1.00 33.05  ? 445  ILE A C     1 
ATOM   3289  O O     . ILE A  1 445 ? 104.958 134.298 -96.303  1.00 32.28  ? 445  ILE A O     1 
ATOM   3290  C CB    . ILE A  1 445 ? 102.762 135.869 -94.314  1.00 29.66  ? 445  ILE A CB    1 
ATOM   3291  C CG1   . ILE A  1 445 ? 101.700 135.431 -93.301  1.00 24.89  ? 445  ILE A CG1   1 
ATOM   3292  C CG2   . ILE A  1 445 ? 102.209 135.878 -95.747  1.00 26.16  ? 445  ILE A CG2   1 
ATOM   3293  C CD1   . ILE A  1 445 ? 100.674 136.480 -92.987  1.00 26.45  ? 445  ILE A CD1   1 
ATOM   3294  N N     . ALA A  1 446 ? 105.695 136.190 -95.340  1.00 34.97  ? 446  ALA A N     1 
ATOM   3295  C CA    . ALA A  1 446 ? 106.647 136.487 -96.405  1.00 36.60  ? 446  ALA A CA    1 
ATOM   3296  C C     . ALA A  1 446 ? 107.588 135.308 -96.666  1.00 37.78  ? 446  ALA A C     1 
ATOM   3297  O O     . ALA A  1 446 ? 107.993 135.082 -97.810  1.00 38.98  ? 446  ALA A O     1 
ATOM   3298  C CB    . ALA A  1 446 ? 107.455 137.730 -96.060  1.00 35.05  ? 446  ALA A CB    1 
ATOM   3299  N N     . ARG A  1 447 ? 107.920 134.552 -95.621  1.00 37.87  ? 447  ARG A N     1 
ATOM   3300  C CA    . ARG A  1 447 ? 108.824 133.408 -95.760  1.00 39.27  ? 447  ARG A CA    1 
ATOM   3301  C C     . ARG A  1 447 ? 108.175 132.063 -96.107  1.00 38.71  ? 447  ARG A C     1 
ATOM   3302  O O     . ARG A  1 447 ? 108.880 131.099 -96.363  1.00 38.28  ? 447  ARG A O     1 
ATOM   3303  C CB    . ARG A  1 447 ? 109.693 133.254 -94.500  1.00 40.70  ? 447  ARG A CB    1 
ATOM   3304  C CG    . ARG A  1 447 ? 110.673 134.399 -94.273  1.00 42.06  ? 447  ARG A CG    1 
ATOM   3305  C CD    . ARG A  1 447 ? 111.532 134.192 -93.012  1.00 45.65  ? 447  ARG A CD    1 
ATOM   3306  N NE    . ARG A  1 447 ? 112.407 135.338 -92.770  1.00 46.51  ? 447  ARG A NE    1 
ATOM   3307  C CZ    . ARG A  1 447 ? 113.368 135.747 -93.598  1.00 47.00  ? 447  ARG A CZ    1 
ATOM   3308  N NH1   . ARG A  1 447 ? 113.614 135.103 -94.734  1.00 46.62  ? 447  ARG A NH1   1 
ATOM   3309  N NH2   . ARG A  1 447 ? 114.060 136.839 -93.310  1.00 46.95  ? 447  ARG A NH2   1 
ATOM   3310  N N     . VAL A  1 448 ? 106.846 131.982 -96.103  1.00 38.96  ? 448  VAL A N     1 
ATOM   3311  C CA    . VAL A  1 448 ? 106.186 130.727 -96.487  1.00 38.81  ? 448  VAL A CA    1 
ATOM   3312  C C     . VAL A  1 448 ? 106.346 130.580 -98.008  1.00 37.58  ? 448  VAL A C     1 
ATOM   3313  O O     . VAL A  1 448 ? 106.037 131.501 -98.769  1.00 37.10  ? 448  VAL A O     1 
ATOM   3314  C CB    . VAL A  1 448 ? 104.652 130.714 -96.137  1.00 39.71  ? 448  VAL A CB    1 
ATOM   3315  C CG1   . VAL A  1 448 ? 103.927 129.653 -96.976  1.00 39.89  ? 448  VAL A CG1   1 
ATOM   3316  C CG2   . VAL A  1 448 ? 104.450 130.440 -94.660  1.00 38.13  ? 448  VAL A CG2   1 
ATOM   3317  N N     . CYS A  1 449 ? 106.838 129.433 -98.453  1.00 36.45  ? 449  CYS A N     1 
ATOM   3318  C CA    . CYS A  1 449 ? 107.021 129.236 -99.869  1.00 36.02  ? 449  CYS A CA    1 
ATOM   3319  C C     . CYS A  1 449 ? 105.676 129.254 -100.600 1.00 35.25  ? 449  CYS A C     1 
ATOM   3320  O O     . CYS A  1 449 ? 104.812 128.418 -100.363 1.00 35.23  ? 449  CYS A O     1 
ATOM   3321  C CB    . CYS A  1 449 ? 107.732 127.908 -100.128 1.00 38.04  ? 449  CYS A CB    1 
ATOM   3322  S SG    . CYS A  1 449 ? 108.185 127.645 -101.869 1.00 43.99  ? 449  CYS A SG    1 
ATOM   3323  N N     . HIS A  1 450 ? 105.490 130.232 -101.472 1.00 33.47  ? 450  HIS A N     1 
ATOM   3324  C CA    . HIS A  1 450 ? 104.273 130.302 -102.253 1.00 31.35  ? 450  HIS A CA    1 
ATOM   3325  C C     . HIS A  1 450 ? 104.613 129.838 -103.662 1.00 31.25  ? 450  HIS A C     1 
ATOM   3326  O O     . HIS A  1 450 ? 105.713 130.086 -104.175 1.00 31.10  ? 450  HIS A O     1 
ATOM   3327  C CB    . HIS A  1 450 ? 103.715 131.719 -102.299 1.00 30.25  ? 450  HIS A CB    1 
ATOM   3328  C CG    . HIS A  1 450 ? 102.898 132.085 -101.102 1.00 29.22  ? 450  HIS A CG    1 
ATOM   3329  N ND1   . HIS A  1 450 ? 103.451 132.316 -99.859  1.00 29.61  ? 450  HIS A ND1   1 
ATOM   3330  C CD2   . HIS A  1 450 ? 101.564 132.262 -100.962 1.00 26.55  ? 450  HIS A CD2   1 
ATOM   3331  C CE1   . HIS A  1 450 ? 102.488 132.619 -99.008  1.00 28.65  ? 450  HIS A CE1   1 
ATOM   3332  N NE2   . HIS A  1 450 ? 101.335 132.593 -99.653  1.00 25.47  ? 450  HIS A NE2   1 
ATOM   3333  N N     . ALA A  1 451 ? 103.653 129.161 -104.276 1.00 30.01  ? 451  ALA A N     1 
ATOM   3334  C CA    . ALA A  1 451 ? 103.813 128.616 -105.608 1.00 30.14  ? 451  ALA A CA    1 
ATOM   3335  C C     . ALA A  1 451 ? 103.861 129.704 -106.664 1.00 29.95  ? 451  ALA A C     1 
ATOM   3336  O O     . ALA A  1 451 ? 103.153 130.702 -106.573 1.00 28.74  ? 451  ALA A O     1 
ATOM   3337  C CB    . ALA A  1 451 ? 102.666 127.654 -105.901 1.00 28.51  ? 451  ALA A CB    1 
ATOM   3338  N N     . HIS A  1 452 ? 104.713 129.501 -107.661 1.00 30.23  ? 452  HIS A N     1 
ATOM   3339  C CA    . HIS A  1 452 ? 104.840 130.435 -108.758 1.00 30.34  ? 452  HIS A CA    1 
ATOM   3340  C C     . HIS A  1 452 ? 104.433 129.758 -110.066 1.00 30.21  ? 452  HIS A C     1 
ATOM   3341  O O     . HIS A  1 452 ? 104.931 128.693 -110.408 1.00 31.17  ? 452  HIS A O     1 
ATOM   3342  C CB    . HIS A  1 452 ? 106.271 130.927 -108.891 1.00 31.92  ? 452  HIS A CB    1 
ATOM   3343  C CG    . HIS A  1 452 ? 106.434 131.999 -109.927 1.00 33.40  ? 452  HIS A CG    1 
ATOM   3344  N ND1   . HIS A  1 452 ? 106.116 133.317 -109.688 1.00 33.66  ? 452  HIS A ND1   1 
ATOM   3345  C CD2   . HIS A  1 452 ? 106.813 131.936 -111.227 1.00 33.60  ? 452  HIS A CD2   1 
ATOM   3346  C CE1   . HIS A  1 452 ? 106.290 134.020 -110.793 1.00 33.08  ? 452  HIS A CE1   1 
ATOM   3347  N NE2   . HIS A  1 452 ? 106.711 133.205 -111.742 1.00 32.93  ? 452  HIS A NE2   1 
ATOM   3348  N N     . PRO A  1 453 ? 103.550 130.394 -110.839 1.00 30.09  ? 453  PRO A N     1 
ATOM   3349  C CA    . PRO A  1 453 ? 102.898 131.694 -110.599 1.00 29.58  ? 453  PRO A CA    1 
ATOM   3350  C C     . PRO A  1 453 ? 101.496 131.627 -110.000 1.00 29.36  ? 453  PRO A C     1 
ATOM   3351  O O     . PRO A  1 453 ? 100.621 130.979 -110.570 1.00 28.44  ? 453  PRO A O     1 
ATOM   3352  C CB    . PRO A  1 453 ? 102.849 132.297 -111.989 1.00 29.69  ? 453  PRO A CB    1 
ATOM   3353  C CG    . PRO A  1 453 ? 102.580 131.054 -112.840 1.00 27.97  ? 453  PRO A CG    1 
ATOM   3354  C CD    . PRO A  1 453 ? 103.514 130.038 -112.272 1.00 28.00  ? 453  PRO A CD    1 
ATOM   3355  N N     . THR A  1 454 ? 101.273 132.306 -108.875 1.00 28.12  ? 454  THR A N     1 
ATOM   3356  C CA    . THR A  1 454 ? 99.941  132.321 -108.264 1.00 27.73  ? 454  THR A CA    1 
ATOM   3357  C C     . THR A  1 454 ? 99.579  133.683 -107.689 1.00 28.50  ? 454  THR A C     1 
ATOM   3358  O O     . THR A  1 454 ? 100.435 134.427 -107.225 1.00 28.47  ? 454  THR A O     1 
ATOM   3359  C CB    . THR A  1 454 ? 99.777  131.295 -107.099 1.00 26.88  ? 454  THR A CB    1 
ATOM   3360  O OG1   . THR A  1 454 ? 100.689 131.628 -106.048 1.00 26.87  ? 454  THR A OG1   1 
ATOM   3361  C CG2   . THR A  1 454 ? 100.000 129.862 -107.575 1.00 24.06  ? 454  THR A CG2   1 
ATOM   3362  N N     . LEU A  1 455 ? 98.293  133.997 -107.713 1.00 28.36  ? 455  LEU A N     1 
ATOM   3363  C CA    . LEU A  1 455 ? 97.814  135.253 -107.173 1.00 28.94  ? 455  LEU A CA    1 
ATOM   3364  C C     . LEU A  1 455 ? 98.235  135.406 -105.698 1.00 30.20  ? 455  LEU A C     1 
ATOM   3365  O O     . LEU A  1 455 ? 98.436  136.511 -105.195 1.00 30.85  ? 455  LEU A O     1 
ATOM   3366  C CB    . LEU A  1 455 ? 96.282  135.324 -107.287 1.00 28.27  ? 455  LEU A CB    1 
ATOM   3367  C CG    . LEU A  1 455 ? 95.611  135.384 -108.674 1.00 28.85  ? 455  LEU A CG    1 
ATOM   3368  C CD1   . LEU A  1 455 ? 94.106  135.170 -108.536 1.00 26.28  ? 455  LEU A CD1   1 
ATOM   3369  C CD2   . LEU A  1 455 ? 95.904  136.729 -109.344 1.00 27.08  ? 455  LEU A CD2   1 
ATOM   3370  N N     . SER A  1 456 ? 98.367  134.292 -105.001 1.00 31.71  ? 456  SER A N     1 
ATOM   3371  C CA    . SER A  1 456 ? 98.719  134.348 -103.599 1.00 32.54  ? 456  SER A CA    1 
ATOM   3372  C C     . SER A  1 456 ? 100.091 134.993 -103.393 1.00 33.68  ? 456  SER A C     1 
ATOM   3373  O O     . SER A  1 456 ? 100.437 135.399 -102.286 1.00 34.87  ? 456  SER A O     1 
ATOM   3374  C CB    . SER A  1 456 ? 98.703  132.939 -103.019 1.00 31.92  ? 456  SER A CB    1 
ATOM   3375  O OG    . SER A  1 456 ? 99.715  132.160 -103.615 1.00 31.86  ? 456  SER A OG    1 
ATOM   3376  N N     . GLU A  1 457 ? 100.875 135.094 -104.457 1.00 33.79  ? 457  GLU A N     1 
ATOM   3377  C CA    . GLU A  1 457 ? 102.200 135.698 -104.339 1.00 34.19  ? 457  GLU A CA    1 
ATOM   3378  C C     . GLU A  1 457 ? 102.089 137.181 -103.989 1.00 34.48  ? 457  GLU A C     1 
ATOM   3379  O O     . GLU A  1 457 ? 102.961 137.734 -103.323 1.00 35.10  ? 457  GLU A O     1 
ATOM   3380  C CB    . GLU A  1 457 ? 103.004 135.502 -105.637 1.00 34.28  ? 457  GLU A CB    1 
ATOM   3381  C CG    . GLU A  1 457 ? 103.346 134.044 -105.915 1.00 34.02  ? 457  GLU A CG    1 
ATOM   3382  C CD    . GLU A  1 457 ? 104.221 133.856 -107.140 1.00 37.44  ? 457  GLU A CD    1 
ATOM   3383  O OE1   . GLU A  1 457 ? 105.470 133.963 -107.017 1.00 36.22  ? 457  GLU A OE1   1 
ATOM   3384  O OE2   . GLU A  1 457 ? 103.651 133.605 -108.228 1.00 37.91  ? 457  GLU A OE2   1 
ATOM   3385  N N     . ALA A  1 458 ? 101.012 137.819 -104.433 1.00 33.40  ? 458  ALA A N     1 
ATOM   3386  C CA    . ALA A  1 458 ? 100.790 139.216 -104.119 1.00 33.11  ? 458  ALA A CA    1 
ATOM   3387  C C     . ALA A  1 458 ? 100.643 139.335 -102.606 1.00 33.47  ? 458  ALA A C     1 
ATOM   3388  O O     . ALA A  1 458 ? 101.155 140.274 -101.976 1.00 32.73  ? 458  ALA A O     1 
ATOM   3389  C CB    . ALA A  1 458 ? 99.535  139.711 -104.792 1.00 31.49  ? 458  ALA A CB    1 
ATOM   3390  N N     . PHE A  1 459 ? 99.925  138.372 -102.037 1.00 32.92  ? 459  PHE A N     1 
ATOM   3391  C CA    . PHE A  1 459 ? 99.666  138.326 -100.607 1.00 31.58  ? 459  PHE A CA    1 
ATOM   3392  C C     . PHE A  1 459 ? 100.991 138.223 -99.866  1.00 30.81  ? 459  PHE A C     1 
ATOM   3393  O O     . PHE A  1 459 ? 101.216 138.907 -98.872  1.00 29.88  ? 459  PHE A O     1 
ATOM   3394  C CB    . PHE A  1 459 ? 98.782  137.120 -100.280 1.00 30.91  ? 459  PHE A CB    1 
ATOM   3395  C CG    . PHE A  1 459 ? 98.442  136.992 -98.820  1.00 30.99  ? 459  PHE A CG    1 
ATOM   3396  C CD1   . PHE A  1 459 ? 97.636  137.935 -98.187  1.00 31.04  ? 459  PHE A CD1   1 
ATOM   3397  C CD2   . PHE A  1 459 ? 98.965  135.951 -98.064  1.00 30.99  ? 459  PHE A CD2   1 
ATOM   3398  C CE1   . PHE A  1 459 ? 97.366  137.840 -96.823  1.00 30.06  ? 459  PHE A CE1   1 
ATOM   3399  C CE2   . PHE A  1 459 ? 98.699  135.851 -96.699  1.00 30.81  ? 459  PHE A CE2   1 
ATOM   3400  C CZ    . PHE A  1 459 ? 97.903  136.795 -96.083  1.00 30.29  ? 459  PHE A CZ    1 
ATOM   3401  N N     . ARG A  1 460 ? 101.860 137.366 -100.375 1.00 30.99  ? 460  ARG A N     1 
ATOM   3402  C CA    . ARG A  1 460 ? 103.181 137.148 -99.809  1.00 32.36  ? 460  ARG A CA    1 
ATOM   3403  C C     . ARG A  1 460 ? 104.047 138.439 -99.879  1.00 32.41  ? 460  ARG A C     1 
ATOM   3404  O O     . ARG A  1 460 ? 104.628 138.870 -98.879  1.00 31.28  ? 460  ARG A O     1 
ATOM   3405  C CB    . ARG A  1 460 ? 103.840 135.992 -100.563 1.00 31.14  ? 460  ARG A CB    1 
ATOM   3406  C CG    . ARG A  1 460 ? 105.165 135.595 -100.031 1.00 33.91  ? 460  ARG A CG    1 
ATOM   3407  C CD    . ARG A  1 460 ? 105.915 134.752 -101.021 1.00 35.86  ? 460  ARG A CD    1 
ATOM   3408  N NE    . ARG A  1 460 ? 107.033 134.073 -100.377 1.00 38.11  ? 460  ARG A NE    1 
ATOM   3409  C CZ    . ARG A  1 460 ? 107.799 133.155 -100.965 1.00 39.71  ? 460  ARG A CZ    1 
ATOM   3410  N NH1   . ARG A  1 460 ? 107.577 132.794 -102.230 1.00 41.34  ? 460  ARG A NH1   1 
ATOM   3411  N NH2   . ARG A  1 460 ? 108.781 132.586 -100.280 1.00 38.33  ? 460  ARG A NH2   1 
ATOM   3412  N N     . GLU A  1 461 ? 104.097 139.056 -101.056 1.00 32.99  ? 461  GLU A N     1 
ATOM   3413  C CA    . GLU A  1 461 ? 104.857 140.289 -101.285 1.00 33.17  ? 461  GLU A CA    1 
ATOM   3414  C C     . GLU A  1 461 ? 104.364 141.479 -100.457 1.00 33.08  ? 461  GLU A C     1 
ATOM   3415  O O     . GLU A  1 461 ? 105.152 142.318 -100.038 1.00 34.84  ? 461  GLU A O     1 
ATOM   3416  C CB    . GLU A  1 461 ? 104.795 140.671 -102.767 1.00 35.34  ? 461  GLU A CB    1 
ATOM   3417  C CG    . GLU A  1 461 ? 105.467 139.708 -103.748 1.00 37.20  ? 461  GLU A CG    1 
ATOM   3418  C CD    . GLU A  1 461 ? 106.886 140.116 -104.099 1.00 38.74  ? 461  GLU A CD    1 
ATOM   3419  O OE1   . GLU A  1 461 ? 107.737 140.194 -103.201 1.00 42.49  ? 461  GLU A OE1   1 
ATOM   3420  O OE2   . GLU A  1 461 ? 107.161 140.366 -105.280 1.00 42.28  ? 461  GLU A OE2   1 
ATOM   3421  N N     . ALA A  1 462 ? 103.059 141.572 -100.242 1.00 32.26  ? 462  ALA A N     1 
ATOM   3422  C CA    . ALA A  1 462 ? 102.518 142.675 -99.457  1.00 31.96  ? 462  ALA A CA    1 
ATOM   3423  C C     . ALA A  1 462 ? 102.942 142.532 -97.993  1.00 32.39  ? 462  ALA A C     1 
ATOM   3424  O O     . ALA A  1 462 ? 103.164 143.526 -97.296  1.00 32.20  ? 462  ALA A O     1 
ATOM   3425  C CB    . ALA A  1 462 ? 100.984 142.725 -99.574  1.00 30.65  ? 462  ALA A CB    1 
ATOM   3426  N N     . ASN A  1 463 ? 103.056 141.295 -97.527  1.00 32.54  ? 463  ASN A N     1 
ATOM   3427  C CA    . ASN A  1 463 ? 103.469 141.059 -96.155  1.00 33.78  ? 463  ASN A CA    1 
ATOM   3428  C C     . ASN A  1 463 ? 104.942 141.395 -96.036  1.00 35.48  ? 463  ASN A C     1 
ATOM   3429  O O     . ASN A  1 463 ? 105.376 142.019 -95.066  1.00 37.60  ? 463  ASN A O     1 
ATOM   3430  C CB    . ASN A  1 463 ? 103.216 139.609 -95.754  1.00 33.09  ? 463  ASN A CB    1 
ATOM   3431  C CG    . ASN A  1 463 ? 101.861 139.424 -95.109  1.00 34.92  ? 463  ASN A CG    1 
ATOM   3432  O OD1   . ASN A  1 463 ? 101.641 139.824 -93.962  1.00 30.98  ? 463  ASN A OD1   1 
ATOM   3433  N ND2   . ASN A  1 463 ? 100.929 138.836 -95.857  1.00 36.14  ? 463  ASN A ND2   1 
ATOM   3434  N N     . LEU A  1 464 ? 105.705 140.972 -97.032  1.00 34.49  ? 464  LEU A N     1 
ATOM   3435  C CA    . LEU A  1 464 ? 107.116 141.249 -97.069  1.00 34.89  ? 464  LEU A CA    1 
ATOM   3436  C C     . LEU A  1 464 ? 107.324 142.767 -97.116  1.00 36.55  ? 464  LEU A C     1 
ATOM   3437  O O     . LEU A  1 464 ? 108.195 143.295 -96.430  1.00 37.62  ? 464  LEU A O     1 
ATOM   3438  C CB    . LEU A  1 464 ? 107.712 140.606 -98.309  1.00 34.74  ? 464  LEU A CB    1 
ATOM   3439  C CG    . LEU A  1 464 ? 109.136 140.985 -98.672  1.00 31.99  ? 464  LEU A CG    1 
ATOM   3440  C CD1   . LEU A  1 464 ? 110.073 140.397 -97.655  1.00 29.72  ? 464  LEU A CD1   1 
ATOM   3441  C CD2   . LEU A  1 464 ? 109.450 140.465 -100.063 1.00 32.28  ? 464  LEU A CD2   1 
ATOM   3442  N N     . ALA A  1 465 ? 106.536 143.475 -97.923  1.00 36.81  ? 465  ALA A N     1 
ATOM   3443  C CA    . ALA A  1 465 ? 106.684 144.929 -97.992  1.00 37.65  ? 465  ALA A CA    1 
ATOM   3444  C C     . ALA A  1 465 ? 106.456 145.511 -96.594  1.00 37.39  ? 465  ALA A C     1 
ATOM   3445  O O     . ALA A  1 465 ? 107.215 146.348 -96.140  1.00 38.05  ? 465  ALA A O     1 
ATOM   3446  C CB    . ALA A  1 465 ? 105.703 145.530 -99.007  1.00 35.71  ? 465  ALA A CB    1 
ATOM   3447  N N     . ALA A  1 466 ? 105.429 145.031 -95.904  1.00 38.72  ? 466  ALA A N     1 
ATOM   3448  C CA    . ALA A  1 466 ? 105.115 145.493 -94.553  1.00 39.69  ? 466  ALA A CA    1 
ATOM   3449  C C     . ALA A  1 466 ? 106.223 145.127 -93.568  1.00 40.46  ? 466  ALA A C     1 
ATOM   3450  O O     . ALA A  1 466 ? 106.533 145.878 -92.652  1.00 42.21  ? 466  ALA A O     1 
ATOM   3451  C CB    . ALA A  1 466 ? 103.786 144.879 -94.082  1.00 37.85  ? 466  ALA A CB    1 
ATOM   3452  N N     . SER A  1 467 ? 106.818 143.964 -93.768  1.00 41.93  ? 467  SER A N     1 
ATOM   3453  C CA    . SER A  1 467 ? 107.866 143.472 -92.890  1.00 43.89  ? 467  SER A CA    1 
ATOM   3454  C C     . SER A  1 467 ? 109.250 144.081 -93.148  1.00 44.82  ? 467  SER A C     1 
ATOM   3455  O O     . SER A  1 467 ? 109.788 144.800 -92.314  1.00 45.19  ? 467  SER A O     1 
ATOM   3456  C CB    . SER A  1 467 ? 107.937 141.942 -93.002  1.00 44.05  ? 467  SER A CB    1 
ATOM   3457  O OG    . SER A  1 467 ? 108.860 141.388 -92.078  1.00 46.33  ? 467  SER A OG    1 
ATOM   3458  N N     . PHE A  1 468 ? 109.820 143.777 -94.307  1.00 45.94  ? 468  PHE A N     1 
ATOM   3459  C CA    . PHE A  1 468 ? 111.145 144.259 -94.696  1.00 46.88  ? 468  PHE A CA    1 
ATOM   3460  C C     . PHE A  1 468 ? 111.156 145.718 -95.173  1.00 45.76  ? 468  PHE A C     1 
ATOM   3461  O O     . PHE A  1 468 ? 112.164 146.408 -95.058  1.00 45.73  ? 468  PHE A O     1 
ATOM   3462  C CB    . PHE A  1 468 ? 111.688 143.342 -95.795  1.00 48.82  ? 468  PHE A CB    1 
ATOM   3463  C CG    . PHE A  1 468 ? 113.027 143.747 -96.333  1.00 51.30  ? 468  PHE A CG    1 
ATOM   3464  C CD1   . PHE A  1 468 ? 114.190 143.513 -95.595  1.00 50.78  ? 468  PHE A CD1   1 
ATOM   3465  C CD2   . PHE A  1 468 ? 113.131 144.315 -97.605  1.00 51.44  ? 468  PHE A CD2   1 
ATOM   3466  C CE1   . PHE A  1 468 ? 115.438 143.831 -96.117  1.00 51.24  ? 468  PHE A CE1   1 
ATOM   3467  C CE2   . PHE A  1 468 ? 114.375 144.639 -98.139  1.00 52.73  ? 468  PHE A CE2   1 
ATOM   3468  C CZ    . PHE A  1 468 ? 115.535 144.393 -97.392  1.00 51.96  ? 468  PHE A CZ    1 
ATOM   3469  N N     . GLY A  1 469 ? 110.031 146.171 -95.717  1.00 45.79  ? 469  GLY A N     1 
ATOM   3470  C CA    . GLY A  1 469 ? 109.927 147.532 -96.206  1.00 44.29  ? 469  GLY A CA    1 
ATOM   3471  C C     . GLY A  1 469 ? 109.698 147.590 -97.704  1.00 45.15  ? 469  GLY A C     1 
ATOM   3472  O O     . GLY A  1 469 ? 109.068 148.515 -98.211  1.00 45.25  ? 469  GLY A O     1 
ATOM   3473  N N     . LYS A  1 470 ? 110.210 146.594 -98.420  1.00 45.83  ? 470  LYS A N     1 
ATOM   3474  C CA    . LYS A  1 470 ? 110.075 146.530 -99.870  1.00 46.84  ? 470  LYS A CA    1 
ATOM   3475  C C     . LYS A  1 470 ? 109.699 145.124 -100.267 1.00 45.85  ? 470  LYS A C     1 
ATOM   3476  O O     . LYS A  1 470 ? 110.161 144.183 -99.648  1.00 46.83  ? 470  LYS A O     1 
ATOM   3477  C CB    . LYS A  1 470 ? 111.411 146.799 -100.563 1.00 49.27  ? 470  LYS A CB    1 
ATOM   3478  C CG    . LYS A  1 470 ? 112.224 147.986 -100.110 1.00 51.53  ? 470  LYS A CG    1 
ATOM   3479  C CD    . LYS A  1 470 ? 113.630 147.851 -100.720 1.00 54.79  ? 470  LYS A CD    1 
ATOM   3480  C CE    . LYS A  1 470 ? 114.523 149.061 -100.465 1.00 55.95  ? 470  LYS A CE    1 
ATOM   3481  N NZ    . LYS A  1 470 ? 113.992 150.276 -101.124 1.00 56.56  ? 470  LYS A NZ    1 
ATOM   3482  N N     . SER A  1 471 ? 108.887 144.969 -101.303 1.00 46.22  ? 471  SER A N     1 
ATOM   3483  C CA    . SER A  1 471 ? 108.574 143.628 -101.774 1.00 47.29  ? 471  SER A CA    1 
ATOM   3484  C C     . SER A  1 471 ? 109.686 143.342 -102.792 1.00 48.62  ? 471  SER A C     1 
ATOM   3485  O O     . SER A  1 471 ? 110.696 144.047 -102.812 1.00 48.99  ? 471  SER A O     1 
ATOM   3486  C CB    . SER A  1 471 ? 107.183 143.556 -102.422 1.00 46.03  ? 471  SER A CB    1 
ATOM   3487  O OG    . SER A  1 471 ? 107.071 144.393 -103.547 1.00 47.55  ? 471  SER A OG    1 
ATOM   3488  N N     . ILE A  1 472 ? 109.536 142.319 -103.627 1.00 49.84  ? 472  ILE A N     1 
ATOM   3489  C CA    . ILE A  1 472 ? 110.590 142.025 -104.594 1.00 48.48  ? 472  ILE A CA    1 
ATOM   3490  C C     . ILE A  1 472 ? 110.225 142.485 -105.999 1.00 48.72  ? 472  ILE A C     1 
ATOM   3491  O O     . ILE A  1 472 ? 111.059 143.054 -106.698 1.00 48.59  ? 472  ILE A O     1 
ATOM   3492  C CB    . ILE A  1 472 ? 110.949 140.493 -104.637 1.00 47.97  ? 472  ILE A CB    1 
ATOM   3493  C CG1   . ILE A  1 472 ? 112.145 140.182 -103.746 1.00 48.48  ? 472  ILE A CG1   1 
ATOM   3494  C CG2   . ILE A  1 472 ? 111.395 140.090 -106.023 1.00 47.73  ? 472  ILE A CG2   1 
ATOM   3495  C CD1   . ILE A  1 472 ? 111.866 140.212 -102.294 1.00 50.74  ? 472  ILE A CD1   1 
ATOM   3496  N N     . ASN A  1 473 ? 108.980 142.257 -106.406 1.00 48.85  ? 473  ASN A N     1 
ATOM   3497  C CA    . ASN A  1 473 ? 108.554 142.609 -107.754 1.00 49.00  ? 473  ASN A CA    1 
ATOM   3498  C C     . ASN A  1 473 ? 107.860 143.942 -107.911 1.00 49.60  ? 473  ASN A C     1 
ATOM   3499  O O     . ASN A  1 473 ? 107.129 144.162 -108.878 1.00 48.73  ? 473  ASN A O     1 
ATOM   3500  C CB    . ASN A  1 473 ? 107.682 141.493 -108.325 1.00 49.03  ? 473  ASN A CB    1 
ATOM   3501  C CG    . ASN A  1 473 ? 108.439 140.180 -108.457 1.00 48.82  ? 473  ASN A CG    1 
ATOM   3502  O OD1   . ASN A  1 473 ? 109.356 140.060 -109.273 1.00 48.82  ? 473  ASN A OD1   1 
ATOM   3503  N ND2   . ASN A  1 473 ? 108.063 139.192 -107.647 1.00 48.43  ? 473  ASN A ND2   1 
ATOM   3504  N N     . PHE A  1 474 ? 108.094 144.835 -106.959 1.00 50.91  ? 474  PHE A N     1 
ATOM   3505  C CA    . PHE A  1 474 ? 107.524 146.166 -107.033 1.00 52.50  ? 474  PHE A CA    1 
ATOM   3506  C C     . PHE A  1 474 ? 108.279 147.109 -106.098 1.00 53.48  ? 474  PHE A C     1 
ATOM   3507  O O     . PHE A  1 474 ? 109.000 146.607 -105.208 1.00 54.31  ? 474  PHE A O     1 
ATOM   3508  C CB    . PHE A  1 474 ? 106.042 146.128 -106.678 1.00 51.69  ? 474  PHE A CB    1 
ATOM   3509  C CG    . PHE A  1 474 ? 105.321 147.417 -106.955 1.00 51.46  ? 474  PHE A CG    1 
ATOM   3510  C CD1   . PHE A  1 474 ? 105.181 147.880 -108.258 1.00 51.43  ? 474  PHE A CD1   1 
ATOM   3511  C CD2   . PHE A  1 474 ? 104.771 148.162 -105.914 1.00 50.11  ? 474  PHE A CD2   1 
ATOM   3512  C CE1   . PHE A  1 474 ? 104.499 149.069 -108.522 1.00 50.87  ? 474  PHE A CE1   1 
ATOM   3513  C CE2   . PHE A  1 474 ? 104.089 149.350 -106.164 1.00 49.48  ? 474  PHE A CE2   1 
ATOM   3514  C CZ    . PHE A  1 474 ? 103.950 149.806 -107.469 1.00 50.44  ? 474  PHE A CZ    1 
ATOM   3515  O OXT   . PHE A  1 474 ? 108.148 148.338 -106.269 1.00 54.74  ? 474  PHE A OXT   1 
ATOM   3516  N N     . PRO B  1 4   ? 136.319 146.401 -117.659 1.00 73.00  ? 4    PRO B N     1 
ATOM   3517  C CA    . PRO B  1 4   ? 136.944 146.613 -116.321 1.00 72.78  ? 4    PRO B CA    1 
ATOM   3518  C C     . PRO B  1 4   ? 135.886 147.135 -115.341 1.00 73.23  ? 4    PRO B C     1 
ATOM   3519  O O     . PRO B  1 4   ? 135.602 148.331 -115.340 1.00 73.63  ? 4    PRO B O     1 
ATOM   3520  C CB    . PRO B  1 4   ? 138.038 147.644 -116.529 1.00 72.86  ? 4    PRO B CB    1 
ATOM   3521  C CG    . PRO B  1 4   ? 137.446 148.467 -117.722 1.00 72.84  ? 4    PRO B CG    1 
ATOM   3522  C CD    . PRO B  1 4   ? 136.799 147.409 -118.627 1.00 72.50  ? 4    PRO B CD    1 
ATOM   3523  N N     . ILE B  1 5   ? 135.303 146.256 -114.516 1.00 73.70  ? 5    ILE B N     1 
ATOM   3524  C CA    . ILE B  1 5   ? 134.246 146.662 -113.555 1.00 73.87  ? 5    ILE B CA    1 
ATOM   3525  C C     . ILE B  1 5   ? 134.203 145.819 -112.265 1.00 72.96  ? 5    ILE B C     1 
ATOM   3526  O O     . ILE B  1 5   ? 134.596 144.653 -112.269 1.00 72.58  ? 5    ILE B O     1 
ATOM   3527  C CB    . ILE B  1 5   ? 132.839 146.621 -114.226 1.00 74.78  ? 5    ILE B CB    1 
ATOM   3528  C CG1   . ILE B  1 5   ? 131.858 147.493 -113.450 1.00 75.69  ? 5    ILE B CG1   1 
ATOM   3529  C CG2   . ILE B  1 5   ? 132.294 145.196 -114.250 1.00 74.48  ? 5    ILE B CG2   1 
ATOM   3530  C CD1   . ILE B  1 5   ? 130.526 147.639 -114.149 1.00 76.63  ? 5    ILE B CD1   1 
ATOM   3531  N N     . ASP B  1 6   ? 133.703 146.393 -111.169 1.00 72.43  ? 6    ASP B N     1 
ATOM   3532  C CA    . ASP B  1 6   ? 133.688 145.657 -109.900 1.00 72.78  ? 6    ASP B CA    1 
ATOM   3533  C C     . ASP B  1 6   ? 132.377 145.586 -109.122 1.00 70.63  ? 6    ASP B C     1 
ATOM   3534  O O     . ASP B  1 6   ? 131.483 146.417 -109.306 1.00 70.34  ? 6    ASP B O     1 
ATOM   3535  C CB    . ASP B  1 6   ? 134.766 146.210 -108.960 1.00 76.15  ? 6    ASP B CB    1 
ATOM   3536  C CG    . ASP B  1 6   ? 134.422 147.586 -108.428 1.00 79.06  ? 6    ASP B CG    1 
ATOM   3537  O OD1   . ASP B  1 6   ? 134.452 148.555 -109.225 1.00 81.58  ? 6    ASP B OD1   1 
ATOM   3538  O OD2   . ASP B  1 6   ? 134.111 147.693 -107.216 1.00 80.32  ? 6    ASP B OD2   1 
ATOM   3539  N N     . ALA B  1 7   ? 132.294 144.599 -108.223 1.00 68.24  ? 7    ALA B N     1 
ATOM   3540  C CA    . ALA B  1 7   ? 131.093 144.392 -107.418 1.00 65.93  ? 7    ALA B CA    1 
ATOM   3541  C C     . ALA B  1 7   ? 131.223 143.469 -106.195 1.00 63.65  ? 7    ALA B C     1 
ATOM   3542  O O     . ALA B  1 7   ? 132.252 142.825 -105.977 1.00 62.41  ? 7    ALA B O     1 
ATOM   3543  C CB    . ALA B  1 7   ? 129.976 143.876 -108.319 1.00 66.21  ? 7    ALA B CB    1 
ATOM   3544  N N     . ASP B  1 8   ? 130.139 143.422 -105.418 1.00 61.45  ? 8    ASP B N     1 
ATOM   3545  C CA    . ASP B  1 8   ? 130.013 142.606 -104.206 1.00 60.04  ? 8    ASP B CA    1 
ATOM   3546  C C     . ASP B  1 8   ? 129.476 141.219 -104.543 1.00 58.95  ? 8    ASP B C     1 
ATOM   3547  O O     . ASP B  1 8   ? 130.094 140.189 -104.250 1.00 57.37  ? 8    ASP B O     1 
ATOM   3548  C CB    . ASP B  1 8   ? 129.036 143.269 -103.239 1.00 60.30  ? 8    ASP B CB    1 
ATOM   3549  C CG    . ASP B  1 8   ? 129.665 144.387 -102.459 1.00 61.52  ? 8    ASP B CG    1 
ATOM   3550  O OD1   . ASP B  1 8   ? 130.425 144.086 -101.520 1.00 63.33  ? 8    ASP B OD1   1 
ATOM   3551  O OD2   . ASP B  1 8   ? 129.413 145.564 -102.782 1.00 61.91  ? 8    ASP B OD2   1 
ATOM   3552  N N     . VAL B  1 9   ? 128.290 141.218 -105.143 1.00 57.90  ? 9    VAL B N     1 
ATOM   3553  C CA    . VAL B  1 9   ? 127.627 139.996 -105.556 1.00 55.26  ? 9    VAL B CA    1 
ATOM   3554  C C     . VAL B  1 9   ? 127.431 140.044 -107.075 1.00 53.26  ? 9    VAL B C     1 
ATOM   3555  O O     . VAL B  1 9   ? 126.891 141.008 -107.633 1.00 50.63  ? 9    VAL B O     1 
ATOM   3556  C CB    . VAL B  1 9   ? 126.244 139.821 -104.831 1.00 55.31  ? 9    VAL B CB    1 
ATOM   3557  C CG1   . VAL B  1 9   ? 125.539 138.584 -105.350 1.00 55.49  ? 9    VAL B CG1   1 
ATOM   3558  C CG2   . VAL B  1 9   ? 126.436 139.679 -103.321 1.00 53.80  ? 9    VAL B CG2   1 
ATOM   3559  N N     . THR B  1 10  ? 127.924 139.009 -107.743 1.00 52.48  ? 10   THR B N     1 
ATOM   3560  C CA    . THR B  1 10  ? 127.777 138.901 -109.185 1.00 53.02  ? 10   THR B CA    1 
ATOM   3561  C C     . THR B  1 10  ? 126.994 137.611 -109.430 1.00 52.66  ? 10   THR B C     1 
ATOM   3562  O O     . THR B  1 10  ? 127.459 136.512 -109.117 1.00 53.14  ? 10   THR B O     1 
ATOM   3563  C CB    . THR B  1 10  ? 129.147 138.833 -109.914 1.00 52.10  ? 10   THR B CB    1 
ATOM   3564  O OG1   . THR B  1 10  ? 129.904 140.015 -109.641 1.00 52.58  ? 10   THR B OG1   1 
ATOM   3565  C CG2   . THR B  1 10  ? 128.936 138.764 -111.403 1.00 51.63  ? 10   THR B CG2   1 
ATOM   3566  N N     . VAL B  1 11  ? 125.787 137.749 -109.962 1.00 51.81  ? 11   VAL B N     1 
ATOM   3567  C CA    . VAL B  1 11  ? 124.948 136.588 -110.225 1.00 50.33  ? 11   VAL B CA    1 
ATOM   3568  C C     . VAL B  1 11  ? 124.820 136.298 -111.721 1.00 47.89  ? 11   VAL B C     1 
ATOM   3569  O O     . VAL B  1 11  ? 124.516 137.176 -112.532 1.00 45.84  ? 11   VAL B O     1 
ATOM   3570  C CB    . VAL B  1 11  ? 123.547 136.766 -109.581 1.00 51.63  ? 11   VAL B CB    1 
ATOM   3571  C CG1   . VAL B  1 11  ? 122.998 138.156 -109.886 1.00 52.77  ? 11   VAL B CG1   1 
ATOM   3572  C CG2   . VAL B  1 11  ? 122.597 135.695 -110.093 1.00 51.36  ? 11   VAL B CG2   1 
ATOM   3573  N N     . ILE B  1 12  ? 125.082 135.046 -112.071 1.00 46.30  ? 12   ILE B N     1 
ATOM   3574  C CA    . ILE B  1 12  ? 125.019 134.595 -113.447 1.00 44.85  ? 12   ILE B CA    1 
ATOM   3575  C C     . ILE B  1 12  ? 123.677 133.905 -113.688 1.00 43.45  ? 12   ILE B C     1 
ATOM   3576  O O     . ILE B  1 12  ? 123.452 132.788 -113.230 1.00 42.41  ? 12   ILE B O     1 
ATOM   3577  C CB    . ILE B  1 12  ? 126.164 133.601 -113.743 1.00 45.04  ? 12   ILE B CB    1 
ATOM   3578  C CG1   . ILE B  1 12  ? 127.475 134.135 -113.152 1.00 45.35  ? 12   ILE B CG1   1 
ATOM   3579  C CG2   . ILE B  1 12  ? 126.318 133.410 -115.248 1.00 43.63  ? 12   ILE B CG2   1 
ATOM   3580  C CD1   . ILE B  1 12  ? 128.603 133.102 -113.086 1.00 45.82  ? 12   ILE B CD1   1 
ATOM   3581  N N     . GLY B  1 13  ? 122.790 134.599 -114.389 1.00 42.67  ? 13   GLY B N     1 
ATOM   3582  C CA    . GLY B  1 13  ? 121.486 134.055 -114.709 1.00 42.53  ? 13   GLY B CA    1 
ATOM   3583  C C     . GLY B  1 13  ? 120.382 134.987 -114.269 1.00 42.41  ? 13   GLY B C     1 
ATOM   3584  O O     . GLY B  1 13  ? 120.358 135.404 -113.113 1.00 42.89  ? 13   GLY B O     1 
ATOM   3585  N N     . SER B  1 14  ? 119.470 135.330 -115.173 1.00 40.95  ? 14   SER B N     1 
ATOM   3586  C CA    . SER B  1 14  ? 118.376 136.216 -114.808 1.00 40.18  ? 14   SER B CA    1 
ATOM   3587  C C     . SER B  1 14  ? 117.069 135.423 -114.702 1.00 38.98  ? 14   SER B C     1 
ATOM   3588  O O     . SER B  1 14  ? 115.996 135.915 -115.040 1.00 38.89  ? 14   SER B O     1 
ATOM   3589  C CB    . SER B  1 14  ? 118.232 137.336 -115.835 1.00 39.16  ? 14   SER B CB    1 
ATOM   3590  O OG    . SER B  1 14  ? 117.715 136.830 -117.054 1.00 41.18  ? 14   SER B OG    1 
ATOM   3591  N N     . GLY B  1 15  ? 117.169 134.188 -114.231 1.00 37.85  ? 15   GLY B N     1 
ATOM   3592  C CA    . GLY B  1 15  ? 115.977 133.373 -114.071 1.00 39.21  ? 15   GLY B CA    1 
ATOM   3593  C C     . GLY B  1 15  ? 115.331 133.621 -112.720 1.00 39.31  ? 15   GLY B C     1 
ATOM   3594  O O     . GLY B  1 15  ? 115.818 134.470 -111.978 1.00 40.20  ? 15   GLY B O     1 
ATOM   3595  N N     . PRO B  1 16  ? 114.238 132.910 -112.370 1.00 39.22  ? 16   PRO B N     1 
ATOM   3596  C CA    . PRO B  1 16  ? 113.556 133.089 -111.083 1.00 38.60  ? 16   PRO B CA    1 
ATOM   3597  C C     . PRO B  1 16  ? 114.542 133.154 -109.917 1.00 37.84  ? 16   PRO B C     1 
ATOM   3598  O O     . PRO B  1 16  ? 114.405 133.994 -109.028 1.00 37.43  ? 16   PRO B O     1 
ATOM   3599  C CB    . PRO B  1 16  ? 112.646 131.874 -111.017 1.00 38.50  ? 16   PRO B CB    1 
ATOM   3600  C CG    . PRO B  1 16  ? 112.235 131.736 -112.447 1.00 38.29  ? 16   PRO B CG    1 
ATOM   3601  C CD    . PRO B  1 16  ? 113.574 131.845 -113.143 1.00 39.00  ? 16   PRO B CD    1 
ATOM   3602  N N     . GLY B  1 17  ? 115.541 132.279 -109.926 1.00 36.64  ? 17   GLY B N     1 
ATOM   3603  C CA    . GLY B  1 17  ? 116.521 132.308 -108.858 1.00 37.07  ? 17   GLY B CA    1 
ATOM   3604  C C     . GLY B  1 17  ? 117.422 133.532 -108.937 1.00 37.49  ? 17   GLY B C     1 
ATOM   3605  O O     . GLY B  1 17  ? 117.620 134.259 -107.960 1.00 36.40  ? 17   GLY B O     1 
ATOM   3606  N N     . GLY B  1 18  ? 117.944 133.772 -110.133 1.00 37.02  ? 18   GLY B N     1 
ATOM   3607  C CA    . GLY B  1 18  ? 118.851 134.876 -110.355 1.00 36.30  ? 18   GLY B CA    1 
ATOM   3608  C C     . GLY B  1 18  ? 118.381 136.307 -110.174 1.00 36.43  ? 18   GLY B C     1 
ATOM   3609  O O     . GLY B  1 18  ? 118.977 137.054 -109.389 1.00 36.56  ? 18   GLY B O     1 
ATOM   3610  N N     . TYR B  1 19  ? 117.345 136.701 -110.905 1.00 35.54  ? 19   TYR B N     1 
ATOM   3611  C CA    . TYR B  1 19  ? 116.829 138.065 -110.841 1.00 35.78  ? 19   TYR B CA    1 
ATOM   3612  C C     . TYR B  1 19  ? 116.268 138.412 -109.465 1.00 35.12  ? 19   TYR B C     1 
ATOM   3613  O O     . TYR B  1 19  ? 116.303 139.557 -109.042 1.00 34.49  ? 19   TYR B O     1 
ATOM   3614  C CB    . TYR B  1 19  ? 115.779 138.276 -111.953 1.00 35.17  ? 19   TYR B CB    1 
ATOM   3615  C CG    . TYR B  1 19  ? 114.326 138.226 -111.515 1.00 36.69  ? 19   TYR B CG    1 
ATOM   3616  C CD1   . TYR B  1 19  ? 113.720 139.330 -110.913 1.00 38.29  ? 19   TYR B CD1   1 
ATOM   3617  C CD2   . TYR B  1 19  ? 113.538 137.102 -111.770 1.00 37.23  ? 19   TYR B CD2   1 
ATOM   3618  C CE1   . TYR B  1 19  ? 112.360 139.323 -110.586 1.00 39.71  ? 19   TYR B CE1   1 
ATOM   3619  C CE2   . TYR B  1 19  ? 112.181 137.082 -111.450 1.00 38.32  ? 19   TYR B CE2   1 
ATOM   3620  C CZ    . TYR B  1 19  ? 111.592 138.194 -110.865 1.00 39.37  ? 19   TYR B CZ    1 
ATOM   3621  O OH    . TYR B  1 19  ? 110.233 138.197 -110.619 1.00 40.13  ? 19   TYR B OH    1 
ATOM   3622  N N     . VAL B  1 20  ? 115.747 137.414 -108.767 1.00 36.24  ? 20   VAL B N     1 
ATOM   3623  C CA    . VAL B  1 20  ? 115.202 137.637 -107.436 1.00 36.89  ? 20   VAL B CA    1 
ATOM   3624  C C     . VAL B  1 20  ? 116.375 137.782 -106.463 1.00 37.90  ? 20   VAL B C     1 
ATOM   3625  O O     . VAL B  1 20  ? 116.363 138.640 -105.577 1.00 38.32  ? 20   VAL B O     1 
ATOM   3626  C CB    . VAL B  1 20  ? 114.283 136.459 -107.007 1.00 37.11  ? 20   VAL B CB    1 
ATOM   3627  C CG1   . VAL B  1 20  ? 113.968 136.532 -105.515 1.00 36.54  ? 20   VAL B CG1   1 
ATOM   3628  C CG2   . VAL B  1 20  ? 112.995 136.504 -107.816 1.00 36.48  ? 20   VAL B CG2   1 
ATOM   3629  N N     . ALA B  1 21  ? 117.394 136.947 -106.644 1.00 37.75  ? 21   ALA B N     1 
ATOM   3630  C CA    . ALA B  1 21  ? 118.578 137.004 -105.798 1.00 37.14  ? 21   ALA B CA    1 
ATOM   3631  C C     . ALA B  1 21  ? 119.261 138.360 -105.975 1.00 36.97  ? 21   ALA B C     1 
ATOM   3632  O O     . ALA B  1 21  ? 119.572 139.049 -104.996 1.00 34.79  ? 21   ALA B O     1 
ATOM   3633  C CB    . ALA B  1 21  ? 119.537 135.876 -106.166 1.00 35.41  ? 21   ALA B CB    1 
ATOM   3634  N N     . ALA B  1 22  ? 119.489 138.725 -107.238 1.00 37.48  ? 22   ALA B N     1 
ATOM   3635  C CA    . ALA B  1 22  ? 120.133 139.990 -107.584 1.00 38.62  ? 22   ALA B CA    1 
ATOM   3636  C C     . ALA B  1 22  ? 119.426 141.150 -106.867 1.00 39.07  ? 22   ALA B C     1 
ATOM   3637  O O     . ALA B  1 22  ? 120.060 141.911 -106.127 1.00 38.78  ? 22   ALA B O     1 
ATOM   3638  C CB    . ALA B  1 22  ? 120.111 140.196 -109.124 1.00 35.96  ? 22   ALA B CB    1 
ATOM   3639  N N     . ILE B  1 23  ? 118.114 141.261 -107.077 1.00 39.42  ? 23   ILE B N     1 
ATOM   3640  C CA    . ILE B  1 23  ? 117.302 142.305 -106.459 1.00 39.64  ? 23   ILE B CA    1 
ATOM   3641  C C     . ILE B  1 23  ? 117.443 142.337 -104.942 1.00 40.59  ? 23   ILE B C     1 
ATOM   3642  O O     . ILE B  1 23  ? 117.740 143.385 -104.366 1.00 40.62  ? 23   ILE B O     1 
ATOM   3643  C CB    . ILE B  1 23  ? 115.817 142.130 -106.820 1.00 39.97  ? 23   ILE B CB    1 
ATOM   3644  C CG1   . ILE B  1 23  ? 115.630 142.455 -108.301 1.00 40.27  ? 23   ILE B CG1   1 
ATOM   3645  C CG2   . ILE B  1 23  ? 114.937 143.001 -105.923 1.00 38.72  ? 23   ILE B CG2   1 
ATOM   3646  C CD1   . ILE B  1 23  ? 114.265 142.125 -108.850 1.00 40.56  ? 23   ILE B CD1   1 
ATOM   3647  N N     . LYS B  1 24  ? 117.231 141.190 -104.301 1.00 41.48  ? 24   LYS B N     1 
ATOM   3648  C CA    . LYS B  1 24  ? 117.341 141.099 -102.846 1.00 42.34  ? 24   LYS B CA    1 
ATOM   3649  C C     . LYS B  1 24  ? 118.766 141.413 -102.375 1.00 43.24  ? 24   LYS B C     1 
ATOM   3650  O O     . LYS B  1 24  ? 118.951 141.921 -101.271 1.00 44.39  ? 24   LYS B O     1 
ATOM   3651  C CB    . LYS B  1 24  ? 116.933 139.702 -102.346 1.00 40.61  ? 24   LYS B CB    1 
ATOM   3652  C CG    . LYS B  1 24  ? 116.823 139.575 -100.823 1.00 38.50  ? 24   LYS B CG    1 
ATOM   3653  C CD    . LYS B  1 24  ? 115.633 140.347 -100.271 1.00 38.40  ? 24   LYS B CD    1 
ATOM   3654  C CE    . LYS B  1 24  ? 115.528 140.227 -98.750  1.00 37.94  ? 24   LYS B CE    1 
ATOM   3655  N NZ    . LYS B  1 24  ? 114.315 140.903 -98.197  1.00 35.51  ? 24   LYS B NZ    1 
ATOM   3656  N N     . ALA B  1 25  ? 119.768 141.099 -103.194 1.00 42.91  ? 25   ALA B N     1 
ATOM   3657  C CA    . ALA B  1 25  ? 121.149 141.382 -102.822 1.00 43.37  ? 25   ALA B CA    1 
ATOM   3658  C C     . ALA B  1 25  ? 121.302 142.899 -102.758 1.00 44.27  ? 25   ALA B C     1 
ATOM   3659  O O     . ALA B  1 25  ? 121.841 143.445 -101.793 1.00 42.89  ? 25   ALA B O     1 
ATOM   3660  C CB    . ALA B  1 25  ? 122.101 140.805 -103.856 1.00 41.17  ? 25   ALA B CB    1 
ATOM   3661  N N     . ALA B  1 26  ? 120.809 143.571 -103.795 1.00 44.91  ? 26   ALA B N     1 
ATOM   3662  C CA    . ALA B  1 26  ? 120.883 145.025 -103.878 1.00 45.90  ? 26   ALA B CA    1 
ATOM   3663  C C     . ALA B  1 26  ? 120.132 145.677 -102.708 1.00 47.05  ? 26   ALA B C     1 
ATOM   3664  O O     . ALA B  1 26  ? 120.652 146.590 -102.062 1.00 47.54  ? 26   ALA B O     1 
ATOM   3665  C CB    . ALA B  1 26  ? 120.309 145.499 -105.216 1.00 44.27  ? 26   ALA B CB    1 
ATOM   3666  N N     . GLN B  1 27  ? 118.920 145.198 -102.433 1.00 47.73  ? 27   GLN B N     1 
ATOM   3667  C CA    . GLN B  1 27  ? 118.109 145.738 -101.352 1.00 48.64  ? 27   GLN B CA    1 
ATOM   3668  C C     . GLN B  1 27  ? 118.761 145.536 -99.992  1.00 49.41  ? 27   GLN B C     1 
ATOM   3669  O O     . GLN B  1 27  ? 118.323 146.101 -98.989  1.00 49.31  ? 27   GLN B O     1 
ATOM   3670  C CB    . GLN B  1 27  ? 116.734 145.073 -101.314 1.00 48.81  ? 27   GLN B CB    1 
ATOM   3671  C CG    . GLN B  1 27  ? 115.901 145.189 -102.573 1.00 49.55  ? 27   GLN B CG    1 
ATOM   3672  C CD    . GLN B  1 27  ? 114.553 144.506 -102.410 1.00 49.39  ? 27   GLN B CD    1 
ATOM   3673  O OE1   . GLN B  1 27  ? 114.458 143.472 -101.754 1.00 48.39  ? 27   GLN B OE1   1 
ATOM   3674  N NE2   . GLN B  1 27  ? 113.511 145.077 -103.008 1.00 48.46  ? 27   GLN B NE2   1 
ATOM   3675  N N     . LEU B  1 28  ? 119.804 144.724 -99.965  1.00 50.28  ? 28   LEU B N     1 
ATOM   3676  C CA    . LEU B  1 28  ? 120.511 144.416 -98.731  1.00 51.92  ? 28   LEU B CA    1 
ATOM   3677  C C     . LEU B  1 28  ? 121.734 145.310 -98.513  1.00 53.29  ? 28   LEU B C     1 
ATOM   3678  O O     . LEU B  1 28  ? 122.304 145.338 -97.421  1.00 53.46  ? 28   LEU B O     1 
ATOM   3679  C CB    . LEU B  1 28  ? 120.938 142.942 -98.755  1.00 51.60  ? 28   LEU B CB    1 
ATOM   3680  C CG    . LEU B  1 28  ? 120.078 141.883 -98.055  1.00 51.08  ? 28   LEU B CG    1 
ATOM   3681  C CD1   . LEU B  1 28  ? 118.621 142.201 -98.219  1.00 52.47  ? 28   LEU B CD1   1 
ATOM   3682  C CD2   . LEU B  1 28  ? 120.399 140.510 -98.624  1.00 50.19  ? 28   LEU B CD2   1 
ATOM   3683  N N     . GLY B  1 29  ? 122.125 146.039 -99.557  1.00 54.59  ? 29   GLY B N     1 
ATOM   3684  C CA    . GLY B  1 29  ? 123.282 146.917 -99.475  1.00 55.68  ? 29   GLY B CA    1 
ATOM   3685  C C     . GLY B  1 29  ? 124.509 146.362 -100.191 1.00 55.93  ? 29   GLY B C     1 
ATOM   3686  O O     . GLY B  1 29  ? 125.652 146.661 -99.817  1.00 57.26  ? 29   GLY B O     1 
ATOM   3687  N N     . PHE B  1 30  ? 124.282 145.536 -101.207 1.00 54.43  ? 30   PHE B N     1 
ATOM   3688  C CA    . PHE B  1 30  ? 125.382 144.969 -101.969 1.00 53.06  ? 30   PHE B CA    1 
ATOM   3689  C C     . PHE B  1 30  ? 125.468 145.664 -103.318 1.00 53.42  ? 30   PHE B C     1 
ATOM   3690  O O     . PHE B  1 30  ? 124.462 146.160 -103.848 1.00 52.84  ? 30   PHE B O     1 
ATOM   3691  C CB    . PHE B  1 30  ? 125.171 143.480 -102.236 1.00 50.95  ? 30   PHE B CB    1 
ATOM   3692  C CG    . PHE B  1 30  ? 125.387 142.590 -101.048 1.00 49.53  ? 30   PHE B CG    1 
ATOM   3693  C CD1   . PHE B  1 30  ? 126.588 142.604 -100.358 1.00 48.08  ? 30   PHE B CD1   1 
ATOM   3694  C CD2   . PHE B  1 30  ? 124.399 141.680 -100.661 1.00 48.86  ? 30   PHE B CD2   1 
ATOM   3695  C CE1   . PHE B  1 30  ? 126.805 141.729 -99.307  1.00 47.19  ? 30   PHE B CE1   1 
ATOM   3696  C CE2   . PHE B  1 30  ? 124.608 140.801 -99.612  1.00 47.48  ? 30   PHE B CE2   1 
ATOM   3697  C CZ    . PHE B  1 30  ? 125.818 140.825 -98.931  1.00 47.48  ? 30   PHE B CZ    1 
ATOM   3698  N N     . LYS B  1 31  ? 126.682 145.706 -103.857 1.00 53.46  ? 31   LYS B N     1 
ATOM   3699  C CA    . LYS B  1 31  ? 126.920 146.269 -105.176 1.00 53.63  ? 31   LYS B CA    1 
ATOM   3700  C C     . LYS B  1 31  ? 126.658 145.012 -105.998 1.00 52.24  ? 31   LYS B C     1 
ATOM   3701  O O     . LYS B  1 31  ? 127.478 144.092 -106.014 1.00 50.66  ? 31   LYS B O     1 
ATOM   3702  C CB    . LYS B  1 31  ? 128.378 146.725 -105.312 1.00 55.16  ? 31   LYS B CB    1 
ATOM   3703  C CG    . LYS B  1 31  ? 128.677 147.543 -106.568 1.00 57.74  ? 31   LYS B CG    1 
ATOM   3704  C CD    . LYS B  1 31  ? 130.065 148.200 -106.501 1.00 60.55  ? 31   LYS B CD    1 
ATOM   3705  C CE    . LYS B  1 31  ? 130.331 149.132 -107.700 1.00 61.93  ? 31   LYS B CE    1 
ATOM   3706  N NZ    . LYS B  1 31  ? 131.679 149.784 -107.650 1.00 62.02  ? 31   LYS B NZ    1 
ATOM   3707  N N     . THR B  1 32  ? 125.498 144.960 -106.646 1.00 51.90  ? 32   THR B N     1 
ATOM   3708  C CA    . THR B  1 32  ? 125.113 143.775 -107.405 1.00 51.84  ? 32   THR B CA    1 
ATOM   3709  C C     . THR B  1 32  ? 125.072 143.919 -108.919 1.00 52.29  ? 32   THR B C     1 
ATOM   3710  O O     . THR B  1 32  ? 124.547 144.894 -109.470 1.00 51.04  ? 32   THR B O     1 
ATOM   3711  C CB    . THR B  1 32  ? 123.716 143.229 -106.948 1.00 50.84  ? 32   THR B CB    1 
ATOM   3712  O OG1   . THR B  1 32  ? 123.474 143.568 -105.578 1.00 49.39  ? 32   THR B OG1   1 
ATOM   3713  C CG2   . THR B  1 32  ? 123.683 141.717 -107.057 1.00 50.47  ? 32   THR B CG2   1 
ATOM   3714  N N     . VAL B  1 33  ? 125.627 142.906 -109.575 1.00 53.49  ? 33   VAL B N     1 
ATOM   3715  C CA    . VAL B  1 33  ? 125.668 142.827 -111.029 1.00 55.43  ? 33   VAL B CA    1 
ATOM   3716  C C     . VAL B  1 33  ? 125.078 141.473 -111.465 1.00 55.44  ? 33   VAL B C     1 
ATOM   3717  O O     . VAL B  1 33  ? 125.462 140.422 -110.932 1.00 55.87  ? 33   VAL B O     1 
ATOM   3718  C CB    . VAL B  1 33  ? 127.128 142.943 -111.562 1.00 55.75  ? 33   VAL B CB    1 
ATOM   3719  C CG1   . VAL B  1 33  ? 128.000 141.875 -110.922 1.00 56.82  ? 33   VAL B CG1   1 
ATOM   3720  C CG2   . VAL B  1 33  ? 127.148 142.776 -113.068 1.00 56.45  ? 33   VAL B CG2   1 
ATOM   3721  N N     . CYS B  1 34  ? 124.137 141.507 -112.414 1.00 55.32  ? 34   CYS B N     1 
ATOM   3722  C CA    . CYS B  1 34  ? 123.503 140.291 -112.936 1.00 53.97  ? 34   CYS B CA    1 
ATOM   3723  C C     . CYS B  1 34  ? 123.905 140.098 -114.394 1.00 53.58  ? 34   CYS B C     1 
ATOM   3724  O O     . CYS B  1 34  ? 123.762 141.009 -115.207 1.00 53.19  ? 34   CYS B O     1 
ATOM   3725  C CB    . CYS B  1 34  ? 121.969 140.379 -112.818 1.00 54.35  ? 34   CYS B CB    1 
ATOM   3726  S SG    . CYS B  1 34  ? 121.037 138.882 -113.307 1.00 49.99  ? 34   CYS B SG    1 
ATOM   3727  N N     . ILE B  1 35  ? 124.407 138.904 -114.701 1.00 53.89  ? 35   ILE B N     1 
ATOM   3728  C CA    . ILE B  1 35  ? 124.873 138.536 -116.044 1.00 55.50  ? 35   ILE B CA    1 
ATOM   3729  C C     . ILE B  1 35  ? 123.874 137.610 -116.770 1.00 55.55  ? 35   ILE B C     1 
ATOM   3730  O O     . ILE B  1 35  ? 123.500 136.563 -116.244 1.00 56.10  ? 35   ILE B O     1 
ATOM   3731  C CB    . ILE B  1 35  ? 126.281 137.837 -115.943 1.00 55.47  ? 35   ILE B CB    1 
ATOM   3732  C CG1   . ILE B  1 35  ? 127.301 138.811 -115.333 1.00 54.52  ? 35   ILE B CG1   1 
ATOM   3733  C CG2   . ILE B  1 35  ? 126.750 137.365 -117.311 1.00 54.66  ? 35   ILE B CG2   1 
ATOM   3734  C CD1   . ILE B  1 35  ? 128.564 138.155 -114.845 1.00 54.02  ? 35   ILE B CD1   1 
ATOM   3735  N N     . GLU B  1 36  ? 123.453 137.995 -117.976 1.00 54.97  ? 36   GLU B N     1 
ATOM   3736  C CA    . GLU B  1 36  ? 122.485 137.209 -118.754 1.00 54.35  ? 36   GLU B CA    1 
ATOM   3737  C C     . GLU B  1 36  ? 122.926 136.967 -120.198 1.00 54.46  ? 36   GLU B C     1 
ATOM   3738  O O     . GLU B  1 36  ? 123.278 137.904 -120.914 1.00 55.69  ? 36   GLU B O     1 
ATOM   3739  C CB    . GLU B  1 36  ? 121.116 137.917 -118.748 1.00 53.76  ? 36   GLU B CB    1 
ATOM   3740  C CG    . GLU B  1 36  ? 120.017 137.248 -119.587 1.00 53.45  ? 36   GLU B CG    1 
ATOM   3741  C CD    . GLU B  1 36  ? 119.827 135.770 -119.260 1.00 53.25  ? 36   GLU B CD    1 
ATOM   3742  O OE1   . GLU B  1 36  ? 119.697 135.421 -118.069 1.00 53.55  ? 36   GLU B OE1   1 
ATOM   3743  O OE2   . GLU B  1 36  ? 119.800 134.951 -120.197 1.00 53.29  ? 36   GLU B OE2   1 
ATOM   3744  N N     . LYS B  1 37  ? 122.886 135.714 -120.633 1.00 53.93  ? 37   LYS B N     1 
ATOM   3745  C CA    . LYS B  1 37  ? 123.291 135.383 -121.992 1.00 54.13  ? 37   LYS B CA    1 
ATOM   3746  C C     . LYS B  1 37  ? 122.216 135.629 -123.075 1.00 53.94  ? 37   LYS B C     1 
ATOM   3747  O O     . LYS B  1 37  ? 122.560 135.862 -124.233 1.00 54.64  ? 37   LYS B O     1 
ATOM   3748  C CB    . LYS B  1 37  ? 123.758 133.921 -122.047 1.00 53.80  ? 37   LYS B CB    1 
ATOM   3749  C CG    . LYS B  1 37  ? 122.635 132.915 -121.912 1.00 55.17  ? 37   LYS B CG    1 
ATOM   3750  C CD    . LYS B  1 37  ? 123.110 131.483 -122.065 1.00 55.81  ? 37   LYS B CD    1 
ATOM   3751  C CE    . LYS B  1 37  ? 121.921 130.542 -122.176 1.00 56.41  ? 37   LYS B CE    1 
ATOM   3752  N NZ    . LYS B  1 37  ? 122.335 129.121 -122.312 1.00 58.10  ? 37   LYS B NZ    1 
ATOM   3753  N N     . ASN B  1 38  ? 120.931 135.608 -122.711 1.00 53.07  ? 38   ASN B N     1 
ATOM   3754  C CA    . ASN B  1 38  ? 119.860 135.787 -123.697 1.00 52.59  ? 38   ASN B CA    1 
ATOM   3755  C C     . ASN B  1 38  ? 119.362 137.215 -123.949 1.00 52.21  ? 38   ASN B C     1 
ATOM   3756  O O     . ASN B  1 38  ? 119.675 138.136 -123.211 1.00 51.90  ? 38   ASN B O     1 
ATOM   3757  C CB    . ASN B  1 38  ? 118.671 134.875 -123.350 1.00 53.29  ? 38   ASN B CB    1 
ATOM   3758  C CG    . ASN B  1 38  ? 119.067 133.395 -123.248 1.00 54.07  ? 38   ASN B CG    1 
ATOM   3759  O OD1   . ASN B  1 38  ? 120.047 132.957 -123.848 1.00 55.11  ? 38   ASN B OD1   1 
ATOM   3760  N ND2   . ASN B  1 38  ? 118.292 132.622 -122.491 1.00 53.69  ? 38   ASN B ND2   1 
ATOM   3761  N N     . GLU B  1 39  ? 118.581 137.374 -125.015 1.00 53.20  ? 39   GLU B N     1 
ATOM   3762  C CA    . GLU B  1 39  ? 118.024 138.664 -125.432 1.00 53.62  ? 39   GLU B CA    1 
ATOM   3763  C C     . GLU B  1 39  ? 117.101 139.330 -124.429 1.00 52.31  ? 39   GLU B C     1 
ATOM   3764  O O     . GLU B  1 39  ? 116.796 140.518 -124.563 1.00 52.16  ? 39   GLU B O     1 
ATOM   3765  C CB    . GLU B  1 39  ? 117.253 138.502 -126.741 1.00 56.79  ? 39   GLU B CB    1 
ATOM   3766  C CG    . GLU B  1 39  ? 118.110 138.000 -127.878 1.00 62.51  ? 39   GLU B CG    1 
ATOM   3767  C CD    . GLU B  1 39  ? 117.320 137.751 -129.147 1.00 64.85  ? 39   GLU B CD    1 
ATOM   3768  O OE1   . GLU B  1 39  ? 116.081 137.930 -129.122 1.00 66.30  ? 39   GLU B OE1   1 
ATOM   3769  O OE2   . GLU B  1 39  ? 117.948 137.370 -130.166 1.00 66.17  ? 39   GLU B OE2   1 
ATOM   3770  N N     . THR B  1 40  ? 116.644 138.564 -123.441 1.00 50.52  ? 40   THR B N     1 
ATOM   3771  C CA    . THR B  1 40  ? 115.734 139.067 -122.414 1.00 47.22  ? 40   THR B CA    1 
ATOM   3772  C C     . THR B  1 40  ? 116.039 138.502 -121.040 1.00 46.01  ? 40   THR B C     1 
ATOM   3773  O O     . THR B  1 40  ? 116.758 137.523 -120.914 1.00 47.01  ? 40   THR B O     1 
ATOM   3774  C CB    . THR B  1 40  ? 114.287 138.716 -122.754 1.00 47.50  ? 40   THR B CB    1 
ATOM   3775  O OG1   . THR B  1 40  ? 114.176 137.302 -122.956 1.00 46.18  ? 40   THR B OG1   1 
ATOM   3776  C CG2   . THR B  1 40  ? 113.852 139.446 -124.007 1.00 44.35  ? 40   THR B CG2   1 
ATOM   3777  N N     . LEU B  1 41  ? 115.493 139.120 -120.003 1.00 44.66  ? 41   LEU B N     1 
ATOM   3778  C CA    . LEU B  1 41  ? 115.723 138.639 -118.643 1.00 44.37  ? 41   LEU B CA    1 
ATOM   3779  C C     . LEU B  1 41  ? 114.537 137.767 -118.237 1.00 43.62  ? 41   LEU B C     1 
ATOM   3780  O O     . LEU B  1 41  ? 113.473 137.854 -118.840 1.00 43.66  ? 41   LEU B O     1 
ATOM   3781  C CB    . LEU B  1 41  ? 115.842 139.829 -117.682 1.00 44.94  ? 41   LEU B CB    1 
ATOM   3782  C CG    . LEU B  1 41  ? 116.919 140.873 -117.986 1.00 44.50  ? 41   LEU B CG    1 
ATOM   3783  C CD1   . LEU B  1 41  ? 116.715 142.132 -117.155 1.00 43.71  ? 41   LEU B CD1   1 
ATOM   3784  C CD2   . LEU B  1 41  ? 118.271 140.259 -117.723 1.00 44.15  ? 41   LEU B CD2   1 
ATOM   3785  N N     . GLY B  1 42  ? 114.705 136.924 -117.229 1.00 42.53  ? 42   GLY B N     1 
ATOM   3786  C CA    . GLY B  1 42  ? 113.574 136.115 -116.805 1.00 43.48  ? 42   GLY B CA    1 
ATOM   3787  C C     . GLY B  1 42  ? 113.773 134.616 -116.838 1.00 43.06  ? 42   GLY B C     1 
ATOM   3788  O O     . GLY B  1 42  ? 113.008 133.872 -116.229 1.00 43.73  ? 42   GLY B O     1 
ATOM   3789  N N     . GLY B  1 43  ? 114.790 134.173 -117.565 1.00 41.90  ? 43   GLY B N     1 
ATOM   3790  C CA    . GLY B  1 43  ? 115.079 132.760 -117.642 1.00 40.41  ? 43   GLY B CA    1 
ATOM   3791  C C     . GLY B  1 43  ? 114.065 131.900 -118.360 1.00 40.11  ? 43   GLY B C     1 
ATOM   3792  O O     . GLY B  1 43  ? 113.237 132.368 -119.129 1.00 39.65  ? 43   GLY B O     1 
ATOM   3793  N N     . THR B  1 44  ? 114.156 130.609 -118.093 1.00 40.12  ? 44   THR B N     1 
ATOM   3794  C CA    . THR B  1 44  ? 113.273 129.625 -118.678 1.00 39.46  ? 44   THR B CA    1 
ATOM   3795  C C     . THR B  1 44  ? 111.807 129.892 -118.346 1.00 39.96  ? 44   THR B C     1 
ATOM   3796  O O     . THR B  1 44  ? 110.953 129.900 -119.226 1.00 39.78  ? 44   THR B O     1 
ATOM   3797  C CB    . THR B  1 44  ? 113.647 128.236 -118.158 1.00 40.12  ? 44   THR B CB    1 
ATOM   3798  O OG1   . THR B  1 44  ? 114.981 127.925 -118.572 1.00 40.40  ? 44   THR B OG1   1 
ATOM   3799  C CG2   . THR B  1 44  ? 112.682 127.181 -118.679 1.00 40.34  ? 44   THR B CG2   1 
ATOM   3800  N N     . CYS B  1 45  ? 111.517 130.118 -117.071 1.00 39.88  ? 45   CYS B N     1 
ATOM   3801  C CA    . CYS B  1 45  ? 110.146 130.343 -116.640 1.00 40.67  ? 45   CYS B CA    1 
ATOM   3802  C C     . CYS B  1 45  ? 109.387 131.418 -117.388 1.00 40.86  ? 45   CYS B C     1 
ATOM   3803  O O     . CYS B  1 45  ? 108.290 131.182 -117.898 1.00 41.65  ? 45   CYS B O     1 
ATOM   3804  C CB    . CYS B  1 45  ? 110.134 130.674 -115.156 1.00 41.39  ? 45   CYS B CB    1 
ATOM   3805  S SG    . CYS B  1 45  ? 108.533 130.943 -114.293 1.00 43.69  ? 45   CYS B SG    1 
ATOM   3806  N N     . LEU B  1 46  ? 109.966 132.607 -117.450 1.00 40.76  ? 46   LEU B N     1 
ATOM   3807  C CA    . LEU B  1 46  ? 109.311 133.725 -118.110 1.00 40.88  ? 46   LEU B CA    1 
ATOM   3808  C C     . LEU B  1 46  ? 109.260 133.721 -119.654 1.00 39.92  ? 46   LEU B C     1 
ATOM   3809  O O     . LEU B  1 46  ? 108.247 134.082 -120.241 1.00 38.98  ? 46   LEU B O     1 
ATOM   3810  C CB    . LEU B  1 46  ? 109.948 135.014 -117.601 1.00 41.08  ? 46   LEU B CB    1 
ATOM   3811  C CG    . LEU B  1 46  ? 109.478 136.354 -118.158 1.00 43.07  ? 46   LEU B CG    1 
ATOM   3812  C CD1   . LEU B  1 46  ? 107.953 136.446 -118.176 1.00 44.39  ? 46   LEU B CD1   1 
ATOM   3813  C CD2   . LEU B  1 46  ? 110.083 137.455 -117.299 1.00 42.38  ? 46   LEU B CD2   1 
ATOM   3814  N N     . ASN B  1 47  ? 110.333 133.282 -120.302 1.00 39.63  ? 47   ASN B N     1 
ATOM   3815  C CA    . ASN B  1 47  ? 110.402 133.281 -121.758 1.00 39.97  ? 47   ASN B CA    1 
ATOM   3816  C C     . ASN B  1 47  ? 109.889 132.029 -122.468 1.00 39.15  ? 47   ASN B C     1 
ATOM   3817  O O     . ASN B  1 47  ? 109.156 132.134 -123.443 1.00 40.05  ? 47   ASN B O     1 
ATOM   3818  C CB    . ASN B  1 47  ? 111.845 133.566 -122.192 1.00 41.33  ? 47   ASN B CB    1 
ATOM   3819  C CG    . ASN B  1 47  ? 112.394 134.840 -121.577 1.00 43.47  ? 47   ASN B CG    1 
ATOM   3820  O OD1   . ASN B  1 47  ? 111.904 135.941 -121.848 1.00 46.06  ? 47   ASN B OD1   1 
ATOM   3821  N ND2   . ASN B  1 47  ? 113.411 134.700 -120.738 1.00 43.59  ? 47   ASN B ND2   1 
ATOM   3822  N N     . VAL B  1 48  ? 110.284 130.852 -122.001 1.00 37.28  ? 48   VAL B N     1 
ATOM   3823  C CA    . VAL B  1 48  ? 109.831 129.611 -122.621 1.00 35.93  ? 48   VAL B CA    1 
ATOM   3824  C C     . VAL B  1 48  ? 109.287 128.599 -121.604 1.00 35.91  ? 48   VAL B C     1 
ATOM   3825  O O     . VAL B  1 48  ? 109.372 127.402 -121.836 1.00 35.34  ? 48   VAL B O     1 
ATOM   3826  C CB    . VAL B  1 48  ? 110.971 128.903 -123.382 1.00 35.62  ? 48   VAL B CB    1 
ATOM   3827  C CG1   . VAL B  1 48  ? 111.513 129.792 -124.505 1.00 33.12  ? 48   VAL B CG1   1 
ATOM   3828  C CG2   . VAL B  1 48  ? 112.050 128.511 -122.405 1.00 32.21  ? 48   VAL B CG2   1 
ATOM   3829  N N     . GLY B  1 49  ? 108.728 129.063 -120.488 1.00 35.13  ? 49   GLY B N     1 
ATOM   3830  C CA    . GLY B  1 49  ? 108.237 128.119 -119.503 1.00 34.15  ? 49   GLY B CA    1 
ATOM   3831  C C     . GLY B  1 49  ? 106.908 128.449 -118.867 1.00 34.32  ? 49   GLY B C     1 
ATOM   3832  O O     . GLY B  1 49  ? 105.901 128.548 -119.566 1.00 35.35  ? 49   GLY B O     1 
ATOM   3833  N N     . CYS B  1 50  ? 106.915 128.622 -117.543 1.00 33.66  ? 50   CYS B N     1 
ATOM   3834  C CA    . CYS B  1 50  ? 105.710 128.931 -116.756 1.00 32.78  ? 50   CYS B CA    1 
ATOM   3835  C C     . CYS B  1 50  ? 104.814 129.999 -117.333 1.00 31.22  ? 50   CYS B C     1 
ATOM   3836  O O     . CYS B  1 50  ? 103.616 129.842 -117.463 1.00 28.57  ? 50   CYS B O     1 
ATOM   3837  C CB    . CYS B  1 50  ? 106.012 129.465 -115.341 1.00 33.86  ? 50   CYS B CB    1 
ATOM   3838  S SG    . CYS B  1 50  ? 107.510 129.148 -114.345 1.00 38.95  ? 50   CYS B SG    1 
ATOM   3839  N N     . ILE B  1 51  ? 105.401 131.142 -117.616 1.00 31.87  ? 51   ILE B N     1 
ATOM   3840  C CA    . ILE B  1 51  ? 104.577 132.219 -118.071 1.00 32.52  ? 51   ILE B CA    1 
ATOM   3841  C C     . ILE B  1 51  ? 103.884 131.957 -119.386 1.00 32.92  ? 51   ILE B C     1 
ATOM   3842  O O     . ILE B  1 51  ? 102.653 131.982 -119.432 1.00 32.90  ? 51   ILE B O     1 
ATOM   3843  C CB    . ILE B  1 51  ? 105.369 133.526 -118.081 1.00 32.16  ? 51   ILE B CB    1 
ATOM   3844  C CG1   . ILE B  1 51  ? 106.029 133.704 -116.710 1.00 30.79  ? 51   ILE B CG1   1 
ATOM   3845  C CG2   . ILE B  1 51  ? 104.422 134.714 -118.391 1.00 31.44  ? 51   ILE B CG2   1 
ATOM   3846  C CD1   . ILE B  1 51  ? 105.040 133.575 -115.494 1.00 27.89  ? 51   ILE B CD1   1 
ATOM   3847  N N     . PRO B  1 52  ? 104.643 131.676 -120.466 1.00 32.42  ? 52   PRO B N     1 
ATOM   3848  C CA    . PRO B  1 52  ? 103.938 131.427 -121.721 1.00 33.15  ? 52   PRO B CA    1 
ATOM   3849  C C     . PRO B  1 52  ? 102.957 130.243 -121.655 1.00 33.53  ? 52   PRO B C     1 
ATOM   3850  O O     . PRO B  1 52  ? 101.880 130.291 -122.252 1.00 33.64  ? 52   PRO B O     1 
ATOM   3851  C CB    . PRO B  1 52  ? 105.080 131.222 -122.732 1.00 32.70  ? 52   PRO B CB    1 
ATOM   3852  C CG    . PRO B  1 52  ? 106.216 130.731 -121.893 1.00 30.83  ? 52   PRO B CG    1 
ATOM   3853  C CD    . PRO B  1 52  ? 106.105 131.578 -120.656 1.00 32.44  ? 52   PRO B CD    1 
ATOM   3854  N N     . SER B  1 53  ? 103.295 129.202 -120.907 1.00 32.72  ? 53   SER B N     1 
ATOM   3855  C CA    . SER B  1 53  ? 102.391 128.056 -120.840 1.00 34.46  ? 53   SER B CA    1 
ATOM   3856  C C     . SER B  1 53  ? 101.094 128.284 -120.010 1.00 33.80  ? 53   SER B C     1 
ATOM   3857  O O     . SER B  1 53  ? 100.022 127.745 -120.341 1.00 34.06  ? 53   SER B O     1 
ATOM   3858  C CB    . SER B  1 53  ? 103.149 126.814 -120.335 1.00 35.09  ? 53   SER B CB    1 
ATOM   3859  O OG    . SER B  1 53  ? 103.380 126.890 -118.954 1.00 33.68  ? 53   SER B OG    1 
ATOM   3860  N N     . LYS B  1 54  ? 101.179 129.069 -118.941 1.00 31.19  ? 54   LYS B N     1 
ATOM   3861  C CA    . LYS B  1 54  ? 100.002 129.341 -118.137 1.00 29.42  ? 54   LYS B CA    1 
ATOM   3862  C C     . LYS B  1 54  ? 99.041  130.223 -118.969 1.00 30.14  ? 54   LYS B C     1 
ATOM   3863  O O     . LYS B  1 54  ? 97.801  130.126 -118.839 1.00 29.09  ? 54   LYS B O     1 
ATOM   3864  C CB    . LYS B  1 54  ? 100.402 130.056 -116.833 1.00 29.68  ? 54   LYS B CB    1 
ATOM   3865  C CG    . LYS B  1 54  ? 100.407 129.205 -115.533 1.00 27.51  ? 54   LYS B CG    1 
ATOM   3866  C CD    . LYS B  1 54  ? 101.629 128.327 -115.403 1.00 25.38  ? 54   LYS B CD    1 
ATOM   3867  C CE    . LYS B  1 54  ? 101.565 127.124 -116.312 1.00 27.57  ? 54   LYS B CE    1 
ATOM   3868  N NZ    . LYS B  1 54  ? 102.773 126.273 -116.155 1.00 25.92  ? 54   LYS B NZ    1 
ATOM   3869  N N     . ALA B  1 55  ? 99.617  131.075 -119.828 1.00 29.60  ? 55   ALA B N     1 
ATOM   3870  C CA    . ALA B  1 55  ? 98.824  131.964 -120.693 1.00 29.26  ? 55   ALA B CA    1 
ATOM   3871  C C     . ALA B  1 55  ? 98.074  131.097 -121.689 1.00 29.22  ? 55   ALA B C     1 
ATOM   3872  O O     . ALA B  1 55  ? 96.846  131.195 -121.814 1.00 29.29  ? 55   ALA B O     1 
ATOM   3873  C CB    . ALA B  1 55  ? 99.728  132.967 -121.433 1.00 29.63  ? 55   ALA B CB    1 
ATOM   3874  N N     . LEU B  1 56  ? 98.804  130.230 -122.388 1.00 29.36  ? 56   LEU B N     1 
ATOM   3875  C CA    . LEU B  1 56  ? 98.147  129.325 -123.328 1.00 30.59  ? 56   LEU B CA    1 
ATOM   3876  C C     . LEU B  1 56  ? 97.121  128.447 -122.590 1.00 31.32  ? 56   LEU B C     1 
ATOM   3877  O O     . LEU B  1 56  ? 96.010  128.258 -123.080 1.00 32.93  ? 56   LEU B O     1 
ATOM   3878  C CB    . LEU B  1 56  ? 99.178  128.476 -124.097 1.00 27.16  ? 56   LEU B CB    1 
ATOM   3879  C CG    . LEU B  1 56  ? 100.058 129.298 -125.068 1.00 25.80  ? 56   LEU B CG    1 
ATOM   3880  C CD1   . LEU B  1 56  ? 100.908 128.355 -125.896 1.00 24.91  ? 56   LEU B CD1   1 
ATOM   3881  C CD2   . LEU B  1 56  ? 99.204  130.182 -125.983 1.00 20.81  ? 56   LEU B CD2   1 
ATOM   3882  N N     . LEU B  1 57  ? 97.465  127.925 -121.409 1.00 31.42  ? 57   LEU B N     1 
ATOM   3883  C CA    . LEU B  1 57  ? 96.493  127.118 -120.658 1.00 30.50  ? 57   LEU B CA    1 
ATOM   3884  C C     . LEU B  1 57  ? 95.234  127.931 -120.338 1.00 30.75  ? 57   LEU B C     1 
ATOM   3885  O O     . LEU B  1 57  ? 94.123  127.421 -120.463 1.00 30.97  ? 57   LEU B O     1 
ATOM   3886  C CB    . LEU B  1 57  ? 97.098  126.584 -119.355 1.00 26.76  ? 57   LEU B CB    1 
ATOM   3887  C CG    . LEU B  1 57  ? 97.991  125.352 -119.474 1.00 26.77  ? 57   LEU B CG    1 
ATOM   3888  C CD1   . LEU B  1 57  ? 99.041  125.365 -118.371 1.00 24.27  ? 57   LEU B CD1   1 
ATOM   3889  C CD2   . LEU B  1 57  ? 97.138  124.084 -119.431 1.00 22.92  ? 57   LEU B CD2   1 
ATOM   3890  N N     . ASN B  1 58  ? 95.405  129.190 -119.936 1.00 30.34  ? 58   ASN B N     1 
ATOM   3891  C CA    . ASN B  1 58  ? 94.260  130.030 -119.595 1.00 31.86  ? 58   ASN B CA    1 
ATOM   3892  C C     . ASN B  1 58  ? 93.388  130.317 -120.827 1.00 32.03  ? 58   ASN B C     1 
ATOM   3893  O O     . ASN B  1 58  ? 92.169  130.198 -120.783 1.00 31.40  ? 58   ASN B O     1 
ATOM   3894  C CB    . ASN B  1 58  ? 94.733  131.357 -118.967 1.00 34.34  ? 58   ASN B CB    1 
ATOM   3895  C CG    . ASN B  1 58  ? 93.585  132.161 -118.337 1.00 36.04  ? 58   ASN B CG    1 
ATOM   3896  O OD1   . ASN B  1 58  ? 93.472  133.373 -118.540 1.00 38.04  ? 58   ASN B OD1   1 
ATOM   3897  N ND2   . ASN B  1 58  ? 92.740  131.486 -117.560 1.00 36.49  ? 58   ASN B ND2   1 
ATOM   3898  N N     . ASN B  1 59  ? 94.019  130.692 -121.928 1.00 32.38  ? 59   ASN B N     1 
ATOM   3899  C CA    . ASN B  1 59  ? 93.280  130.985 -123.139 1.00 34.12  ? 59   ASN B CA    1 
ATOM   3900  C C     . ASN B  1 59  ? 92.582  129.773 -123.746 1.00 34.47  ? 59   ASN B C     1 
ATOM   3901  O O     . ASN B  1 59  ? 91.483  129.889 -124.282 1.00 34.35  ? 59   ASN B O     1 
ATOM   3902  C CB    . ASN B  1 59  ? 94.214  131.623 -124.176 1.00 34.48  ? 59   ASN B CB    1 
ATOM   3903  C CG    . ASN B  1 59  ? 94.756  132.954 -123.708 1.00 34.89  ? 59   ASN B CG    1 
ATOM   3904  O OD1   . ASN B  1 59  ? 94.124  133.638 -122.897 1.00 34.85  ? 59   ASN B OD1   1 
ATOM   3905  N ND2   . ASN B  1 59  ? 95.920  133.338 -124.215 1.00 32.58  ? 59   ASN B ND2   1 
ATOM   3906  N N     . SER B  1 60  ? 93.215  128.610 -123.652 1.00 34.77  ? 60   SER B N     1 
ATOM   3907  C CA    . SER B  1 60  ? 92.652  127.405 -124.234 1.00 33.78  ? 60   SER B CA    1 
ATOM   3908  C C     . SER B  1 60  ? 91.483  126.901 -123.440 1.00 34.34  ? 60   SER B C     1 
ATOM   3909  O O     . SER B  1 60  ? 90.589  126.247 -123.972 1.00 35.07  ? 60   SER B O     1 
ATOM   3910  C CB    . SER B  1 60  ? 93.715  126.307 -124.355 1.00 32.33  ? 60   SER B CB    1 
ATOM   3911  O OG    . SER B  1 60  ? 94.330  126.026 -123.123 1.00 31.98  ? 60   SER B OG    1 
ATOM   3912  N N     . HIS B  1 61  ? 91.476  127.203 -122.156 1.00 35.34  ? 61   HIS B N     1 
ATOM   3913  C CA    . HIS B  1 61  ? 90.377  126.749 -121.335 1.00 35.33  ? 61   HIS B CA    1 
ATOM   3914  C C     . HIS B  1 61  ? 89.138  127.587 -121.642 1.00 35.86  ? 61   HIS B C     1 
ATOM   3915  O O     . HIS B  1 61  ? 88.016  127.072 -121.662 1.00 35.04  ? 61   HIS B O     1 
ATOM   3916  C CB    . HIS B  1 61  ? 90.748  126.836 -119.851 1.00 34.09  ? 61   HIS B CB    1 
ATOM   3917  C CG    . HIS B  1 61  ? 89.588  126.605 -118.942 1.00 32.09  ? 61   HIS B CG    1 
ATOM   3918  N ND1   . HIS B  1 61  ? 88.970  127.626 -118.251 1.00 31.51  ? 61   HIS B ND1   1 
ATOM   3919  C CD2   . HIS B  1 61  ? 88.860  125.492 -118.704 1.00 30.33  ? 61   HIS B CD2   1 
ATOM   3920  C CE1   . HIS B  1 61  ? 87.908  127.151 -117.628 1.00 31.52  ? 61   HIS B CE1   1 
ATOM   3921  N NE2   . HIS B  1 61  ? 87.819  125.858 -117.888 1.00 31.63  ? 61   HIS B NE2   1 
ATOM   3922  N N     . TYR B  1 62  ? 89.351  128.879 -121.886 1.00 36.59  ? 62   TYR B N     1 
ATOM   3923  C CA    . TYR B  1 62  ? 88.257  129.772 -122.201 1.00 37.18  ? 62   TYR B CA    1 
ATOM   3924  C C     . TYR B  1 62  ? 87.743  129.458 -123.605 1.00 37.12  ? 62   TYR B C     1 
ATOM   3925  O O     . TYR B  1 62  ? 86.541  129.528 -123.860 1.00 36.85  ? 62   TYR B O     1 
ATOM   3926  C CB    . TYR B  1 62  ? 88.706  131.224 -122.068 1.00 37.72  ? 62   TYR B CB    1 
ATOM   3927  C CG    . TYR B  1 62  ? 88.867  131.668 -120.629 1.00 41.86  ? 62   TYR B CG    1 
ATOM   3928  C CD1   . TYR B  1 62  ? 88.033  131.163 -119.622 1.00 43.75  ? 62   TYR B CD1   1 
ATOM   3929  C CD2   . TYR B  1 62  ? 89.789  132.655 -120.276 1.00 43.53  ? 62   TYR B CD2   1 
ATOM   3930  C CE1   . TYR B  1 62  ? 88.107  131.635 -118.306 1.00 44.47  ? 62   TYR B CE1   1 
ATOM   3931  C CE2   . TYR B  1 62  ? 89.865  133.136 -118.957 1.00 45.62  ? 62   TYR B CE2   1 
ATOM   3932  C CZ    . TYR B  1 62  ? 89.022  132.621 -117.985 1.00 45.99  ? 62   TYR B CZ    1 
ATOM   3933  O OH    . TYR B  1 62  ? 89.088  133.096 -116.690 1.00 50.95  ? 62   TYR B OH    1 
ATOM   3934  N N     . TYR B  1 63  ? 88.646  129.094 -124.510 1.00 36.84  ? 63   TYR B N     1 
ATOM   3935  C CA    . TYR B  1 63  ? 88.230  128.738 -125.861 1.00 38.31  ? 63   TYR B CA    1 
ATOM   3936  C C     . TYR B  1 63  ? 87.331  127.507 -125.725 1.00 38.12  ? 63   TYR B C     1 
ATOM   3937  O O     . TYR B  1 63  ? 86.284  127.413 -126.362 1.00 37.43  ? 63   TYR B O     1 
ATOM   3938  C CB    . TYR B  1 63  ? 89.446  128.410 -126.752 1.00 38.51  ? 63   TYR B CB    1 
ATOM   3939  C CG    . TYR B  1 63  ? 89.056  127.759 -128.069 1.00 40.02  ? 63   TYR B CG    1 
ATOM   3940  C CD1   . TYR B  1 63  ? 88.443  128.501 -129.099 1.00 41.35  ? 63   TYR B CD1   1 
ATOM   3941  C CD2   . TYR B  1 63  ? 89.229  126.390 -128.261 1.00 40.88  ? 63   TYR B CD2   1 
ATOM   3942  C CE1   . TYR B  1 63  ? 88.006  127.887 -130.280 1.00 40.57  ? 63   TYR B CE1   1 
ATOM   3943  C CE2   . TYR B  1 63  ? 88.798  125.764 -129.430 1.00 42.23  ? 63   TYR B CE2   1 
ATOM   3944  C CZ    . TYR B  1 63  ? 88.185  126.514 -130.433 1.00 43.26  ? 63   TYR B CZ    1 
ATOM   3945  O OH    . TYR B  1 63  ? 87.736  125.861 -131.562 1.00 45.72  ? 63   TYR B OH    1 
ATOM   3946  N N     . HIS B  1 64  ? 87.753  126.573 -124.878 1.00 37.62  ? 64   HIS B N     1 
ATOM   3947  C CA    . HIS B  1 64  ? 86.994  125.358 -124.641 1.00 38.95  ? 64   HIS B CA    1 
ATOM   3948  C C     . HIS B  1 64  ? 85.643  125.628 -123.999 1.00 39.90  ? 64   HIS B C     1 
ATOM   3949  O O     . HIS B  1 64  ? 84.651  125.004 -124.354 1.00 40.77  ? 64   HIS B O     1 
ATOM   3950  C CB    . HIS B  1 64  ? 87.761  124.398 -123.744 1.00 39.87  ? 64   HIS B CB    1 
ATOM   3951  C CG    . HIS B  1 64  ? 86.977  123.179 -123.383 1.00 42.14  ? 64   HIS B CG    1 
ATOM   3952  N ND1   . HIS B  1 64  ? 87.094  122.543 -122.165 1.00 42.96  ? 64   HIS B ND1   1 
ATOM   3953  C CD2   . HIS B  1 64  ? 86.036  122.497 -124.077 1.00 41.03  ? 64   HIS B CD2   1 
ATOM   3954  C CE1   . HIS B  1 64  ? 86.253  121.523 -122.125 1.00 42.78  ? 64   HIS B CE1   1 
ATOM   3955  N NE2   . HIS B  1 64  ? 85.600  121.476 -123.273 1.00 42.04  ? 64   HIS B NE2   1 
ATOM   3956  N N     . MET B  1 65  ? 85.596  126.531 -123.030 1.00 40.80  ? 65   MET B N     1 
ATOM   3957  C CA    . MET B  1 65  ? 84.321  126.831 -122.388 1.00 41.06  ? 65   MET B CA    1 
ATOM   3958  C C     . MET B  1 65  ? 83.366  127.526 -123.370 1.00 40.77  ? 65   MET B C     1 
ATOM   3959  O O     . MET B  1 65  ? 82.151  127.357 -123.285 1.00 40.85  ? 65   MET B O     1 
ATOM   3960  C CB    . MET B  1 65  ? 84.534  127.713 -121.150 1.00 40.94  ? 65   MET B CB    1 
ATOM   3961  C CG    . MET B  1 65  ? 85.398  127.082 -120.058 1.00 41.17  ? 65   MET B CG    1 
ATOM   3962  S SD    . MET B  1 65  ? 84.700  125.595 -119.218 1.00 44.40  ? 65   MET B SD    1 
ATOM   3963  C CE    . MET B  1 65  ? 85.186  124.206 -120.319 1.00 38.23  ? 65   MET B CE    1 
ATOM   3964  N N     . ALA B  1 66  ? 83.922  128.296 -124.305 1.00 39.27  ? 66   ALA B N     1 
ATOM   3965  C CA    . ALA B  1 66  ? 83.123  129.028 -125.291 1.00 38.46  ? 66   ALA B CA    1 
ATOM   3966  C C     . ALA B  1 66  ? 82.711  128.179 -126.500 1.00 38.91  ? 66   ALA B C     1 
ATOM   3967  O O     . ALA B  1 66  ? 81.541  128.170 -126.898 1.00 37.59  ? 66   ALA B O     1 
ATOM   3968  C CB    . ALA B  1 66  ? 83.888  130.249 -125.767 1.00 36.45  ? 66   ALA B CB    1 
ATOM   3969  N N     . HIS B  1 67  ? 83.684  127.478 -127.079 1.00 38.79  ? 67   HIS B N     1 
ATOM   3970  C CA    . HIS B  1 67  ? 83.453  126.630 -128.240 1.00 40.83  ? 67   HIS B CA    1 
ATOM   3971  C C     . HIS B  1 67  ? 82.707  125.358 -127.826 1.00 42.03  ? 67   HIS B C     1 
ATOM   3972  O O     . HIS B  1 67  ? 81.929  124.773 -128.601 1.00 41.37  ? 67   HIS B O     1 
ATOM   3973  C CB    . HIS B  1 67  ? 84.803  126.316 -128.893 1.00 41.24  ? 67   HIS B CB    1 
ATOM   3974  C CG    . HIS B  1 67  ? 84.756  125.255 -129.949 1.00 42.79  ? 67   HIS B CG    1 
ATOM   3975  N ND1   . HIS B  1 67  ? 84.732  123.907 -129.651 1.00 42.88  ? 67   HIS B ND1   1 
ATOM   3976  C CD2   . HIS B  1 67  ? 84.786  125.341 -131.299 1.00 41.51  ? 67   HIS B CD2   1 
ATOM   3977  C CE1   . HIS B  1 67  ? 84.757  123.209 -130.771 1.00 41.59  ? 67   HIS B CE1   1 
ATOM   3978  N NE2   . HIS B  1 67  ? 84.790  124.055 -131.784 1.00 43.69  ? 67   HIS B NE2   1 
ATOM   3979  N N     . GLY B  1 68  ? 82.942  124.954 -126.584 1.00 41.80  ? 68   GLY B N     1 
ATOM   3980  C CA    . GLY B  1 68  ? 82.294  123.779 -126.047 1.00 41.38  ? 68   GLY B CA    1 
ATOM   3981  C C     . GLY B  1 68  ? 80.866  124.102 -125.666 1.00 41.79  ? 68   GLY B C     1 
ATOM   3982  O O     . GLY B  1 68  ? 80.255  125.011 -126.213 1.00 42.20  ? 68   GLY B O     1 
ATOM   3983  N N     . THR B  1 69  ? 80.345  123.375 -124.694 1.00 41.35  ? 69   THR B N     1 
ATOM   3984  C CA    . THR B  1 69  ? 78.982  123.561 -124.270 1.00 42.69  ? 69   THR B CA    1 
ATOM   3985  C C     . THR B  1 69  ? 78.768  124.287 -122.943 1.00 41.81  ? 69   THR B C     1 
ATOM   3986  O O     . THR B  1 69  ? 77.628  124.613 -122.574 1.00 41.01  ? 69   THR B O     1 
ATOM   3987  C CB    . THR B  1 69  ? 78.296  122.208 -124.195 1.00 45.48  ? 69   THR B CB    1 
ATOM   3988  O OG1   . THR B  1 69  ? 77.014  122.358 -123.575 1.00 50.95  ? 69   THR B OG1   1 
ATOM   3989  C CG2   . THR B  1 69  ? 79.138  121.244 -123.401 1.00 46.44  ? 69   THR B CG2   1 
ATOM   3990  N N     . ASP B  1 70  ? 79.848  124.558 -122.223 1.00 40.71  ? 70   ASP B N     1 
ATOM   3991  C CA    . ASP B  1 70  ? 79.692  125.225 -120.952 1.00 39.94  ? 70   ASP B CA    1 
ATOM   3992  C C     . ASP B  1 70  ? 78.999  126.573 -121.042 1.00 39.61  ? 70   ASP B C     1 
ATOM   3993  O O     . ASP B  1 70  ? 78.048  126.825 -120.307 1.00 39.20  ? 70   ASP B O     1 
ATOM   3994  C CB    . ASP B  1 70  ? 81.026  125.418 -120.251 1.00 39.38  ? 70   ASP B CB    1 
ATOM   3995  C CG    . ASP B  1 70  ? 80.852  126.018 -118.870 1.00 39.68  ? 70   ASP B CG    1 
ATOM   3996  O OD1   . ASP B  1 70  ? 80.494  125.278 -117.922 1.00 39.54  ? 70   ASP B OD1   1 
ATOM   3997  O OD2   . ASP B  1 70  ? 81.039  127.239 -118.739 1.00 38.06  ? 70   ASP B OD2   1 
ATOM   3998  N N     . PHE B  1 71  ? 79.464  127.434 -121.943 1.00 39.38  ? 71   PHE B N     1 
ATOM   3999  C CA    . PHE B  1 71  ? 78.884  128.773 -122.076 1.00 38.88  ? 71   PHE B CA    1 
ATOM   4000  C C     . PHE B  1 71  ? 77.433  128.820 -122.490 1.00 37.80  ? 71   PHE B C     1 
ATOM   4001  O O     . PHE B  1 71  ? 76.692  129.709 -122.062 1.00 36.99  ? 71   PHE B O     1 
ATOM   4002  C CB    . PHE B  1 71  ? 79.728  129.632 -123.021 1.00 38.98  ? 71   PHE B CB    1 
ATOM   4003  C CG    . PHE B  1 71  ? 80.755  130.465 -122.315 1.00 38.69  ? 71   PHE B CG    1 
ATOM   4004  C CD1   . PHE B  1 71  ? 81.337  130.023 -121.119 1.00 39.12  ? 71   PHE B CD1   1 
ATOM   4005  C CD2   . PHE B  1 71  ? 81.158  131.679 -122.844 1.00 37.72  ? 71   PHE B CD2   1 
ATOM   4006  C CE1   . PHE B  1 71  ? 82.301  130.787 -120.472 1.00 38.40  ? 71   PHE B CE1   1 
ATOM   4007  C CE2   . PHE B  1 71  ? 82.129  132.450 -122.200 1.00 37.84  ? 71   PHE B CE2   1 
ATOM   4008  C CZ    . PHE B  1 71  ? 82.698  132.009 -121.020 1.00 37.02  ? 71   PHE B CZ    1 
ATOM   4009  N N     . ALA B  1 72  ? 77.025  127.865 -123.316 1.00 36.52  ? 72   ALA B N     1 
ATOM   4010  C CA    . ALA B  1 72  ? 75.634  127.802 -123.745 1.00 36.82  ? 72   ALA B CA    1 
ATOM   4011  C C     . ALA B  1 72  ? 74.720  127.459 -122.559 1.00 36.47  ? 72   ALA B C     1 
ATOM   4012  O O     . ALA B  1 72  ? 73.619  127.988 -122.442 1.00 36.44  ? 72   ALA B O     1 
ATOM   4013  C CB    . ALA B  1 72  ? 75.474  126.767 -124.862 1.00 35.67  ? 72   ALA B CB    1 
ATOM   4014  N N     . SER B  1 73  ? 75.178  126.588 -121.671 1.00 36.56  ? 73   SER B N     1 
ATOM   4015  C CA    . SER B  1 73  ? 74.353  126.225 -120.525 1.00 38.43  ? 73   SER B CA    1 
ATOM   4016  C C     . SER B  1 73  ? 74.154  127.408 -119.587 1.00 38.03  ? 73   SER B C     1 
ATOM   4017  O O     . SER B  1 73  ? 73.296  127.360 -118.699 1.00 37.62  ? 73   SER B O     1 
ATOM   4018  C CB    . SER B  1 73  ? 75.005  125.107 -119.732 1.00 38.94  ? 73   SER B CB    1 
ATOM   4019  O OG    . SER B  1 73  ? 76.149  125.620 -119.063 1.00 40.24  ? 73   SER B OG    1 
ATOM   4020  N N     . ARG B  1 74  ? 74.941  128.460 -119.791 1.00 38.17  ? 74   ARG B N     1 
ATOM   4021  C CA    . ARG B  1 74  ? 74.879  129.666 -118.949 1.00 41.03  ? 74   ARG B CA    1 
ATOM   4022  C C     . ARG B  1 74  ? 74.092  130.833 -119.534 1.00 41.84  ? 74   ARG B C     1 
ATOM   4023  O O     . ARG B  1 74  ? 74.008  131.903 -118.923 1.00 40.68  ? 74   ARG B O     1 
ATOM   4024  C CB    . ARG B  1 74  ? 76.297  130.159 -118.630 1.00 40.31  ? 74   ARG B CB    1 
ATOM   4025  C CG    . ARG B  1 74  ? 77.051  129.252 -117.714 1.00 39.48  ? 74   ARG B CG    1 
ATOM   4026  C CD    . ARG B  1 74  ? 78.524  129.491 -117.787 1.00 39.96  ? 74   ARG B CD    1 
ATOM   4027  N NE    . ARG B  1 74  ? 79.198  128.349 -117.196 1.00 40.31  ? 74   ARG B NE    1 
ATOM   4028  C CZ    . ARG B  1 74  ? 79.145  128.061 -115.907 1.00 42.06  ? 74   ARG B CZ    1 
ATOM   4029  N NH1   . ARG B  1 74  ? 78.455  128.845 -115.080 1.00 41.36  ? 74   ARG B NH1   1 
ATOM   4030  N NH2   . ARG B  1 74  ? 79.768  126.987 -115.450 1.00 42.97  ? 74   ARG B NH2   1 
ATOM   4031  N N     . GLY B  1 75  ? 73.525  130.630 -120.718 1.00 43.88  ? 75   GLY B N     1 
ATOM   4032  C CA    . GLY B  1 75  ? 72.767  131.696 -121.343 1.00 44.57  ? 75   GLY B CA    1 
ATOM   4033  C C     . GLY B  1 75  ? 73.655  132.595 -122.186 1.00 44.58  ? 75   GLY B C     1 
ATOM   4034  O O     . GLY B  1 75  ? 73.252  133.696 -122.558 1.00 44.40  ? 75   GLY B O     1 
ATOM   4035  N N     . ILE B  1 76  ? 74.874  132.148 -122.468 1.00 43.87  ? 76   ILE B N     1 
ATOM   4036  C CA    . ILE B  1 76  ? 75.766  132.930 -123.310 1.00 44.73  ? 76   ILE B CA    1 
ATOM   4037  C C     . ILE B  1 76  ? 75.786  132.196 -124.653 1.00 47.11  ? 76   ILE B C     1 
ATOM   4038  O O     . ILE B  1 76  ? 76.700  131.424 -124.939 1.00 47.34  ? 76   ILE B O     1 
ATOM   4039  C CB    . ILE B  1 76  ? 77.181  133.011 -122.700 1.00 42.57  ? 76   ILE B CB    1 
ATOM   4040  C CG1   . ILE B  1 76  ? 77.083  133.559 -121.276 1.00 40.47  ? 76   ILE B CG1   1 
ATOM   4041  C CG2   . ILE B  1 76  ? 78.065  133.941 -123.513 1.00 38.14  ? 76   ILE B CG2   1 
ATOM   4042  C CD1   . ILE B  1 76  ? 78.363  133.422 -120.482 1.00 39.19  ? 76   ILE B CD1   1 
ATOM   4043  N N     . GLU B  1 77  ? 74.753  132.433 -125.464 1.00 49.74  ? 77   GLU B N     1 
ATOM   4044  C CA    . GLU B  1 77  ? 74.617  131.781 -126.771 1.00 51.87  ? 77   GLU B CA    1 
ATOM   4045  C C     . GLU B  1 77  ? 75.399  132.505 -127.855 1.00 51.57  ? 77   GLU B C     1 
ATOM   4046  O O     . GLU B  1 77  ? 75.311  133.722 -127.997 1.00 50.23  ? 77   GLU B O     1 
ATOM   4047  C CB    . GLU B  1 77  ? 73.144  131.709 -127.180 1.00 53.01  ? 77   GLU B CB    1 
ATOM   4048  C CG    . GLU B  1 77  ? 72.199  131.510 -126.015 1.00 56.30  ? 77   GLU B CG    1 
ATOM   4049  C CD    . GLU B  1 77  ? 70.771  131.241 -126.458 1.00 58.89  ? 77   GLU B CD    1 
ATOM   4050  O OE1   . GLU B  1 77  ? 70.266  131.962 -127.352 1.00 59.13  ? 77   GLU B OE1   1 
ATOM   4051  O OE2   . GLU B  1 77  ? 70.151  130.311 -125.897 1.00 59.30  ? 77   GLU B OE2   1 
ATOM   4052  N N     . MET B  1 78  ? 76.152  131.741 -128.634 1.00 52.83  ? 78   MET B N     1 
ATOM   4053  C CA    . MET B  1 78  ? 76.962  132.321 -129.687 1.00 55.19  ? 78   MET B CA    1 
ATOM   4054  C C     . MET B  1 78  ? 76.822  131.480 -130.929 1.00 55.80  ? 78   MET B C     1 
ATOM   4055  O O     . MET B  1 78  ? 76.808  130.256 -130.853 1.00 55.70  ? 78   MET B O     1 
ATOM   4056  C CB    . MET B  1 78  ? 78.408  132.385 -129.211 1.00 55.58  ? 78   MET B CB    1 
ATOM   4057  C CG    . MET B  1 78  ? 78.471  132.911 -127.789 1.00 56.31  ? 78   MET B CG    1 
ATOM   4058  S SD    . MET B  1 78  ? 80.077  132.899 -127.046 1.00 58.10  ? 78   MET B SD    1 
ATOM   4059  C CE    . MET B  1 78  ? 80.479  131.161 -127.129 1.00 56.87  ? 78   MET B CE    1 
ATOM   4060  N N     . SER B  1 79  ? 76.716  132.145 -132.070 1.00 57.71  ? 79   SER B N     1 
ATOM   4061  C CA    . SER B  1 79  ? 76.533  131.447 -133.333 1.00 59.86  ? 79   SER B CA    1 
ATOM   4062  C C     . SER B  1 79  ? 77.713  130.572 -133.708 1.00 59.75  ? 79   SER B C     1 
ATOM   4063  O O     . SER B  1 79  ? 77.592  129.349 -133.749 1.00 59.52  ? 79   SER B O     1 
ATOM   4064  C CB    . SER B  1 79  ? 76.242  132.450 -134.456 1.00 61.19  ? 79   SER B CB    1 
ATOM   4065  O OG    . SER B  1 79  ? 75.157  133.297 -134.110 1.00 62.58  ? 79   SER B OG    1 
ATOM   4066  N N     . GLU B  1 80  ? 78.848  131.196 -133.991 1.00 59.84  ? 80   GLU B N     1 
ATOM   4067  C CA    . GLU B  1 80  ? 80.040  130.452 -134.369 1.00 60.83  ? 80   GLU B CA    1 
ATOM   4068  C C     . GLU B  1 80  ? 81.198  130.864 -133.492 1.00 59.00  ? 80   GLU B C     1 
ATOM   4069  O O     . GLU B  1 80  ? 81.347  132.034 -133.175 1.00 59.75  ? 80   GLU B O     1 
ATOM   4070  C CB    . GLU B  1 80  ? 80.414  130.722 -135.827 1.00 64.54  ? 80   GLU B CB    1 
ATOM   4071  C CG    . GLU B  1 80  ? 79.623  129.938 -136.887 1.00 70.53  ? 80   GLU B CG    1 
ATOM   4072  C CD    . GLU B  1 80  ? 80.160  128.518 -137.145 1.00 73.38  ? 80   GLU B CD    1 
ATOM   4073  O OE1   . GLU B  1 80  ? 81.381  128.362 -137.405 1.00 74.75  ? 80   GLU B OE1   1 
ATOM   4074  O OE2   . GLU B  1 80  ? 79.354  127.556 -137.105 1.00 74.65  ? 80   GLU B OE2   1 
ATOM   4075  N N     . VAL B  1 81  ? 82.019  129.897 -133.108 1.00 56.77  ? 81   VAL B N     1 
ATOM   4076  C CA    . VAL B  1 81  ? 83.175  130.165 -132.270 1.00 54.37  ? 81   VAL B CA    1 
ATOM   4077  C C     . VAL B  1 81  ? 84.418  129.647 -132.967 1.00 53.29  ? 81   VAL B C     1 
ATOM   4078  O O     . VAL B  1 81  ? 84.630  128.446 -133.080 1.00 52.73  ? 81   VAL B O     1 
ATOM   4079  C CB    . VAL B  1 81  ? 83.036  129.485 -130.897 1.00 54.37  ? 81   VAL B CB    1 
ATOM   4080  C CG1   . VAL B  1 81  ? 84.320  129.628 -130.117 1.00 54.09  ? 81   VAL B CG1   1 
ATOM   4081  C CG2   . VAL B  1 81  ? 81.899  130.119 -130.123 1.00 53.65  ? 81   VAL B CG2   1 
ATOM   4082  N N     . ARG B  1 82  ? 85.248  130.569 -133.428 1.00 53.44  ? 82   ARG B N     1 
ATOM   4083  C CA    . ARG B  1 82  ? 86.454  130.194 -134.141 1.00 54.13  ? 82   ARG B CA    1 
ATOM   4084  C C     . ARG B  1 82  ? 87.749  130.539 -133.405 1.00 52.50  ? 82   ARG B C     1 
ATOM   4085  O O     . ARG B  1 82  ? 87.829  131.535 -132.675 1.00 52.50  ? 82   ARG B O     1 
ATOM   4086  C CB    . ARG B  1 82  ? 86.434  130.832 -135.541 1.00 57.12  ? 82   ARG B CB    1 
ATOM   4087  C CG    . ARG B  1 82  ? 85.519  130.112 -136.531 1.00 60.75  ? 82   ARG B CG    1 
ATOM   4088  C CD    . ARG B  1 82  ? 85.184  130.981 -137.743 1.00 65.32  ? 82   ARG B CD    1 
ATOM   4089  N NE    . ARG B  1 82  ? 84.080  131.913 -137.478 1.00 69.15  ? 82   ARG B NE    1 
ATOM   4090  C CZ    . ARG B  1 82  ? 82.807  131.694 -137.813 1.00 70.01  ? 82   ARG B CZ    1 
ATOM   4091  N NH1   . ARG B  1 82  ? 82.466  130.571 -138.435 1.00 70.03  ? 82   ARG B NH1   1 
ATOM   4092  N NH2   . ARG B  1 82  ? 81.871  132.598 -137.527 1.00 70.34  ? 82   ARG B NH2   1 
ATOM   4093  N N     . LEU B  1 83  ? 88.761  129.699 -133.601 1.00 50.16  ? 83   LEU B N     1 
ATOM   4094  C CA    . LEU B  1 83  ? 90.049  129.905 -132.958 1.00 49.27  ? 83   LEU B CA    1 
ATOM   4095  C C     . LEU B  1 83  ? 91.070  130.692 -133.778 1.00 48.97  ? 83   LEU B C     1 
ATOM   4096  O O     . LEU B  1 83  ? 91.640  130.182 -134.740 1.00 49.57  ? 83   LEU B O     1 
ATOM   4097  C CB    . LEU B  1 83  ? 90.694  128.565 -132.577 1.00 48.62  ? 83   LEU B CB    1 
ATOM   4098  C CG    . LEU B  1 83  ? 92.123  128.744 -132.032 1.00 48.95  ? 83   LEU B CG    1 
ATOM   4099  C CD1   . LEU B  1 83  ? 92.061  129.423 -130.665 1.00 47.84  ? 83   LEU B CD1   1 
ATOM   4100  C CD2   . LEU B  1 83  ? 92.837  127.419 -131.935 1.00 47.61  ? 83   LEU B CD2   1 
ATOM   4101  N N     . ASN B  1 84  ? 91.315  131.933 -133.389 1.00 47.43  ? 84   ASN B N     1 
ATOM   4102  C CA    . ASN B  1 84  ? 92.316  132.737 -134.066 1.00 45.88  ? 84   ASN B CA    1 
ATOM   4103  C C     . ASN B  1 84  ? 93.643  132.422 -133.342 1.00 45.51  ? 84   ASN B C     1 
ATOM   4104  O O     . ASN B  1 84  ? 94.063  133.145 -132.435 1.00 44.93  ? 84   ASN B O     1 
ATOM   4105  C CB    . ASN B  1 84  ? 91.952  134.219 -133.941 1.00 44.59  ? 84   ASN B CB    1 
ATOM   4106  C CG    . ASN B  1 84  ? 92.842  135.114 -134.769 1.00 43.27  ? 84   ASN B CG    1 
ATOM   4107  O OD1   . ASN B  1 84  ? 93.864  134.683 -135.308 1.00 41.89  ? 84   ASN B OD1   1 
ATOM   4108  N ND2   . ASN B  1 84  ? 92.463  136.377 -134.860 1.00 42.95  ? 84   ASN B ND2   1 
ATOM   4109  N N     . LEU B  1 85  ? 94.288  131.325 -133.725 1.00 44.93  ? 85   LEU B N     1 
ATOM   4110  C CA    . LEU B  1 85  ? 95.534  130.946 -133.081 1.00 46.28  ? 85   LEU B CA    1 
ATOM   4111  C C     . LEU B  1 85  ? 96.556  132.082 -133.031 1.00 47.29  ? 85   LEU B C     1 
ATOM   4112  O O     . LEU B  1 85  ? 97.295  132.221 -132.049 1.00 47.46  ? 85   LEU B O     1 
ATOM   4113  C CB    . LEU B  1 85  ? 96.148  129.722 -133.767 1.00 45.10  ? 85   LEU B CB    1 
ATOM   4114  C CG    . LEU B  1 85  ? 97.391  129.117 -133.081 1.00 46.82  ? 85   LEU B CG    1 
ATOM   4115  C CD1   . LEU B  1 85  ? 97.063  128.691 -131.642 1.00 46.67  ? 85   LEU B CD1   1 
ATOM   4116  C CD2   . LEU B  1 85  ? 97.882  127.909 -133.860 1.00 45.75  ? 85   LEU B CD2   1 
ATOM   4117  N N     . ASP B  1 86  ? 96.582  132.901 -134.079 1.00 48.43  ? 86   ASP B N     1 
ATOM   4118  C CA    . ASP B  1 86  ? 97.525  134.019 -134.168 1.00 48.32  ? 86   ASP B CA    1 
ATOM   4119  C C     . ASP B  1 86  ? 97.402  135.004 -133.026 1.00 46.80  ? 86   ASP B C     1 
ATOM   4120  O O     . ASP B  1 86  ? 98.398  135.458 -132.463 1.00 45.00  ? 86   ASP B O     1 
ATOM   4121  C CB    . ASP B  1 86  ? 97.338  134.768 -135.491 1.00 51.72  ? 86   ASP B CB    1 
ATOM   4122  C CG    . ASP B  1 86  ? 97.951  134.035 -136.662 1.00 56.31  ? 86   ASP B CG    1 
ATOM   4123  O OD1   . ASP B  1 86  ? 99.205  133.960 -136.708 1.00 56.50  ? 86   ASP B OD1   1 
ATOM   4124  O OD2   . ASP B  1 86  ? 97.180  133.530 -137.523 1.00 58.97  ? 86   ASP B OD2   1 
ATOM   4125  N N     . LYS B  1 87  ? 96.166  135.341 -132.697 1.00 47.34  ? 87   LYS B N     1 
ATOM   4126  C CA    . LYS B  1 87  ? 95.904  136.292 -131.631 1.00 48.57  ? 87   LYS B CA    1 
ATOM   4127  C C     . LYS B  1 87  ? 96.088  135.668 -130.239 1.00 47.21  ? 87   LYS B C     1 
ATOM   4128  O O     . LYS B  1 87  ? 96.514  136.349 -129.299 1.00 45.72  ? 87   LYS B O     1 
ATOM   4129  C CB    . LYS B  1 87  ? 94.496  136.870 -131.792 1.00 50.26  ? 87   LYS B CB    1 
ATOM   4130  C CG    . LYS B  1 87  ? 94.293  138.170 -131.053 1.00 54.97  ? 87   LYS B CG    1 
ATOM   4131  C CD    . LYS B  1 87  ? 92.978  138.831 -131.452 1.00 60.95  ? 87   LYS B CD    1 
ATOM   4132  C CE    . LYS B  1 87  ? 93.038  139.512 -132.832 1.00 63.13  ? 87   LYS B CE    1 
ATOM   4133  N NZ    . LYS B  1 87  ? 93.657  140.881 -132.774 1.00 64.51  ? 87   LYS B NZ    1 
ATOM   4134  N N     . MET B  1 88  ? 95.780  134.377 -130.114 1.00 45.65  ? 88   MET B N     1 
ATOM   4135  C CA    . MET B  1 88  ? 95.937  133.698 -128.840 1.00 44.36  ? 88   MET B CA    1 
ATOM   4136  C C     . MET B  1 88  ? 97.424  133.701 -128.486 1.00 44.86  ? 88   MET B C     1 
ATOM   4137  O O     . MET B  1 88  ? 97.786  133.865 -127.315 1.00 44.22  ? 88   MET B O     1 
ATOM   4138  C CB    . MET B  1 88  ? 95.403  132.269 -128.922 1.00 43.42  ? 88   MET B CB    1 
ATOM   4139  C CG    . MET B  1 88  ? 95.267  131.586 -127.578 1.00 40.70  ? 88   MET B CG    1 
ATOM   4140  S SD    . MET B  1 88  ? 94.443  129.979 -127.630 1.00 40.72  ? 88   MET B SD    1 
ATOM   4141  C CE    . MET B  1 88  ? 92.742  130.474 -127.580 1.00 35.66  ? 88   MET B CE    1 
ATOM   4142  N N     . MET B  1 89  ? 98.290  133.536 -129.489 1.00 44.21  ? 89   MET B N     1 
ATOM   4143  C CA    . MET B  1 89  ? 99.734  133.560 -129.231 1.00 43.64  ? 89   MET B CA    1 
ATOM   4144  C C     . MET B  1 89  ? 100.147 134.991 -128.904 1.00 44.46  ? 89   MET B C     1 
ATOM   4145  O O     . MET B  1 89  ? 101.034 135.223 -128.074 1.00 44.93  ? 89   MET B O     1 
ATOM   4146  C CB    . MET B  1 89  ? 100.526 133.077 -130.447 1.00 42.40  ? 89   MET B CB    1 
ATOM   4147  C CG    . MET B  1 89  ? 100.447 131.571 -130.723 1.00 42.29  ? 89   MET B CG    1 
ATOM   4148  S SD    . MET B  1 89  ? 101.271 130.492 -129.505 1.00 38.40  ? 89   MET B SD    1 
ATOM   4149  C CE    . MET B  1 89  ? 100.757 128.932 -130.088 1.00 36.46  ? 89   MET B CE    1 
ATOM   4150  N N     . GLU B  1 90  ? 99.507  135.954 -129.561 1.00 44.04  ? 90   GLU B N     1 
ATOM   4151  C CA    . GLU B  1 90  ? 99.821  137.337 -129.306 1.00 45.24  ? 90   GLU B CA    1 
ATOM   4152  C C     . GLU B  1 90  ? 99.626  137.658 -127.817 1.00 44.07  ? 90   GLU B C     1 
ATOM   4153  O O     . GLU B  1 90  ? 100.547 138.148 -127.166 1.00 43.23  ? 90   GLU B O     1 
ATOM   4154  C CB    . GLU B  1 90  ? 98.954  138.232 -130.179 1.00 48.90  ? 90   GLU B CB    1 
ATOM   4155  C CG    . GLU B  1 90  ? 98.858  139.658 -129.674 1.00 53.96  ? 90   GLU B CG    1 
ATOM   4156  C CD    . GLU B  1 90  ? 98.172  140.565 -130.663 1.00 56.32  ? 90   GLU B CD    1 
ATOM   4157  O OE1   . GLU B  1 90  ? 97.024  140.259 -131.051 1.00 57.79  ? 90   GLU B OE1   1 
ATOM   4158  O OE2   . GLU B  1 90  ? 98.785  141.582 -131.052 1.00 58.98  ? 90   GLU B OE2   1 
ATOM   4159  N N     . GLN B  1 91  ? 98.436  137.371 -127.288 1.00 42.71  ? 91   GLN B N     1 
ATOM   4160  C CA    . GLN B  1 91  ? 98.117  137.605 -125.873 1.00 41.20  ? 91   GLN B CA    1 
ATOM   4161  C C     . GLN B  1 91  ? 99.224  137.014 -124.995 1.00 40.30  ? 91   GLN B C     1 
ATOM   4162  O O     . GLN B  1 91  ? 99.663  137.632 -124.021 1.00 39.87  ? 91   GLN B O     1 
ATOM   4163  C CB    . GLN B  1 91  ? 96.767  136.959 -125.543 1.00 41.89  ? 91   GLN B CB    1 
ATOM   4164  C CG    . GLN B  1 91  ? 96.141  137.339 -124.197 1.00 42.00  ? 91   GLN B CG    1 
ATOM   4165  C CD    . GLN B  1 91  ? 96.923  136.804 -123.007 1.00 43.03  ? 91   GLN B CD    1 
ATOM   4166  O OE1   . GLN B  1 91  ? 97.389  135.666 -123.028 1.00 43.70  ? 91   GLN B OE1   1 
ATOM   4167  N NE2   . GLN B  1 91  ? 97.062  137.620 -121.960 1.00 42.16  ? 91   GLN B NE2   1 
ATOM   4168  N N     . LYS B  1 92  ? 99.662  135.813 -125.360 1.00 39.21  ? 92   LYS B N     1 
ATOM   4169  C CA    . LYS B  1 92  ? 100.741 135.122 -124.674 1.00 38.21  ? 92   LYS B CA    1 
ATOM   4170  C C     . LYS B  1 92  ? 101.987 136.000 -124.763 1.00 39.22  ? 92   LYS B C     1 
ATOM   4171  O O     . LYS B  1 92  ? 102.526 136.419 -123.747 1.00 40.23  ? 92   LYS B O     1 
ATOM   4172  C CB    . LYS B  1 92  ? 101.022 133.768 -125.344 1.00 35.77  ? 92   LYS B CB    1 
ATOM   4173  C CG    . LYS B  1 92  ? 102.286 133.087 -124.845 1.00 35.28  ? 92   LYS B CG    1 
ATOM   4174  C CD    . LYS B  1 92  ? 102.805 131.993 -125.775 1.00 35.74  ? 92   LYS B CD    1 
ATOM   4175  C CE    . LYS B  1 92  ? 103.441 132.547 -127.053 1.00 34.98  ? 92   LYS B CE    1 
ATOM   4176  N NZ    . LYS B  1 92  ? 104.255 131.545 -127.809 1.00 31.93  ? 92   LYS B NZ    1 
ATOM   4177  N N     . SER B  1 93  ? 102.435 136.271 -125.991 1.00 40.81  ? 93   SER B N     1 
ATOM   4178  C CA    . SER B  1 93  ? 103.619 137.104 -126.252 1.00 40.00  ? 93   SER B CA    1 
ATOM   4179  C C     . SER B  1 93  ? 103.644 138.419 -125.508 1.00 39.85  ? 93   SER B C     1 
ATOM   4180  O O     . SER B  1 93  ? 104.700 138.850 -125.050 1.00 41.38  ? 93   SER B O     1 
ATOM   4181  C CB    . SER B  1 93  ? 103.745 137.412 -127.739 1.00 38.67  ? 93   SER B CB    1 
ATOM   4182  O OG    . SER B  1 93  ? 104.112 136.245 -128.434 1.00 40.59  ? 93   SER B OG    1 
ATOM   4183  N N     . THR B  1 94  ? 102.489 139.067 -125.418 1.00 39.78  ? 94   THR B N     1 
ATOM   4184  C CA    . THR B  1 94  ? 102.375 140.342 -124.725 1.00 41.20  ? 94   THR B CA    1 
ATOM   4185  C C     . THR B  1 94  ? 102.758 140.164 -123.266 1.00 42.09  ? 94   THR B C     1 
ATOM   4186  O O     . THR B  1 94  ? 103.684 140.813 -122.760 1.00 42.76  ? 94   THR B O     1 
ATOM   4187  C CB    . THR B  1 94  ? 100.947 140.862 -124.785 1.00 41.84  ? 94   THR B CB    1 
ATOM   4188  O OG1   . THR B  1 94  ? 100.549 140.963 -126.153 1.00 44.59  ? 94   THR B OG1   1 
ATOM   4189  C CG2   . THR B  1 94  ? 100.848 142.228 -124.139 1.00 40.45  ? 94   THR B CG2   1 
ATOM   4190  N N     . ALA B  1 95  ? 102.029 139.283 -122.594 1.00 41.20  ? 95   ALA B N     1 
ATOM   4191  C CA    . ALA B  1 95  ? 102.288 138.991 -121.199 1.00 40.40  ? 95   ALA B CA    1 
ATOM   4192  C C     . ALA B  1 95  ? 103.791 138.787 -120.962 1.00 40.16  ? 95   ALA B C     1 
ATOM   4193  O O     . ALA B  1 95  ? 104.386 139.381 -120.044 1.00 38.45  ? 95   ALA B O     1 
ATOM   4194  C CB    . ALA B  1 95  ? 101.508 137.754 -120.788 1.00 38.71  ? 95   ALA B CB    1 
ATOM   4195  N N     . VAL B  1 96  ? 104.406 137.973 -121.812 1.00 39.36  ? 96   VAL B N     1 
ATOM   4196  C CA    . VAL B  1 96  ? 105.822 137.686 -121.654 1.00 40.33  ? 96   VAL B CA    1 
ATOM   4197  C C     . VAL B  1 96  ? 106.644 138.944 -121.789 1.00 42.05  ? 96   VAL B C     1 
ATOM   4198  O O     . VAL B  1 96  ? 107.470 139.240 -120.917 1.00 43.39  ? 96   VAL B O     1 
ATOM   4199  C CB    . VAL B  1 96  ? 106.305 136.635 -122.667 1.00 38.23  ? 96   VAL B CB    1 
ATOM   4200  C CG1   . VAL B  1 96  ? 107.805 136.388 -122.502 1.00 35.91  ? 96   VAL B CG1   1 
ATOM   4201  C CG2   . VAL B  1 96  ? 105.532 135.348 -122.462 1.00 37.06  ? 96   VAL B CG2   1 
ATOM   4202  N N     . LYS B  1 97  ? 106.406 139.690 -122.864 1.00 42.12  ? 97   LYS B N     1 
ATOM   4203  C CA    . LYS B  1 97  ? 107.136 140.922 -123.098 1.00 43.85  ? 97   LYS B CA    1 
ATOM   4204  C C     . LYS B  1 97  ? 107.014 141.872 -121.894 1.00 43.79  ? 97   LYS B C     1 
ATOM   4205  O O     . LYS B  1 97  ? 108.022 142.353 -121.366 1.00 43.47  ? 97   LYS B O     1 
ATOM   4206  C CB    . LYS B  1 97  ? 106.638 141.591 -124.388 1.00 45.28  ? 97   LYS B CB    1 
ATOM   4207  C CG    . LYS B  1 97  ? 107.267 142.944 -124.652 1.00 48.11  ? 97   LYS B CG    1 
ATOM   4208  C CD    . LYS B  1 97  ? 107.180 143.339 -126.118 1.00 52.95  ? 97   LYS B CD    1 
ATOM   4209  C CE    . LYS B  1 97  ? 107.973 144.620 -126.390 1.00 54.88  ? 97   LYS B CE    1 
ATOM   4210  N NZ    . LYS B  1 97  ? 109.382 144.565 -125.845 1.00 57.56  ? 97   LYS B NZ    1 
ATOM   4211  N N     . ALA B  1 98  ? 105.782 142.118 -121.450 1.00 43.51  ? 98   ALA B N     1 
ATOM   4212  C CA    . ALA B  1 98  ? 105.534 142.997 -120.311 1.00 41.81  ? 98   ALA B CA    1 
ATOM   4213  C C     . ALA B  1 98  ? 106.341 142.571 -119.093 1.00 42.33  ? 98   ALA B C     1 
ATOM   4214  O O     . ALA B  1 98  ? 107.064 143.377 -118.508 1.00 45.04  ? 98   ALA B O     1 
ATOM   4215  C CB    . ALA B  1 98  ? 104.070 142.999 -119.964 1.00 40.43  ? 98   ALA B CB    1 
ATOM   4216  N N     . LEU B  1 99  ? 106.221 141.305 -118.710 1.00 40.99  ? 99   LEU B N     1 
ATOM   4217  C CA    . LEU B  1 99  ? 106.936 140.804 -117.547 1.00 40.08  ? 99   LEU B CA    1 
ATOM   4218  C C     . LEU B  1 99  ? 108.449 140.848 -117.689 1.00 40.10  ? 99   LEU B C     1 
ATOM   4219  O O     . LEU B  1 99  ? 109.151 141.002 -116.698 1.00 38.82  ? 99   LEU B O     1 
ATOM   4220  C CB    . LEU B  1 99  ? 106.478 139.377 -117.213 1.00 38.46  ? 99   LEU B CB    1 
ATOM   4221  C CG    . LEU B  1 99  ? 105.080 139.296 -116.607 1.00 37.03  ? 99   LEU B CG    1 
ATOM   4222  C CD1   . LEU B  1 99  ? 104.775 137.861 -116.198 1.00 36.25  ? 99   LEU B CD1   1 
ATOM   4223  C CD2   . LEU B  1 99  ? 104.996 140.242 -115.415 1.00 36.26  ? 99   LEU B CD2   1 
ATOM   4224  N N     . THR B  1 100 ? 108.954 140.711 -118.912 1.00 40.88  ? 100  THR B N     1 
ATOM   4225  C CA    . THR B  1 100 ? 110.398 140.757 -119.106 1.00 41.52  ? 100  THR B CA    1 
ATOM   4226  C C     . THR B  1 100 ? 110.884 142.184 -118.918 1.00 40.92  ? 100  THR B C     1 
ATOM   4227  O O     . THR B  1 100 ? 111.962 142.415 -118.380 1.00 40.67  ? 100  THR B O     1 
ATOM   4228  C CB    . THR B  1 100 ? 110.831 140.247 -120.515 1.00 42.08  ? 100  THR B CB    1 
ATOM   4229  O OG1   . THR B  1 100 ? 110.259 141.061 -121.550 1.00 44.10  ? 100  THR B OG1   1 
ATOM   4230  C CG2   . THR B  1 100 ? 110.396 138.821 -120.697 1.00 42.93  ? 100  THR B CG2   1 
ATOM   4231  N N     . GLY B  1 101 ? 110.074 143.140 -119.356 1.00 40.35  ? 101  GLY B N     1 
ATOM   4232  C CA    . GLY B  1 101 ? 110.449 144.529 -119.219 1.00 39.73  ? 101  GLY B CA    1 
ATOM   4233  C C     . GLY B  1 101 ? 110.365 144.938 -117.770 1.00 40.41  ? 101  GLY B C     1 
ATOM   4234  O O     . GLY B  1 101 ? 111.094 145.818 -117.310 1.00 39.00  ? 101  GLY B O     1 
ATOM   4235  N N     . GLY B  1 102 ? 109.456 144.277 -117.058 1.00 41.48  ? 102  GLY B N     1 
ATOM   4236  C CA    . GLY B  1 102 ? 109.247 144.545 -115.648 1.00 42.57  ? 102  GLY B CA    1 
ATOM   4237  C C     . GLY B  1 102 ? 110.479 144.215 -114.846 1.00 42.72  ? 102  GLY B C     1 
ATOM   4238  O O     . GLY B  1 102 ? 110.729 144.818 -113.817 1.00 43.09  ? 102  GLY B O     1 
ATOM   4239  N N     . ILE B  1 103 ? 111.251 143.246 -115.318 1.00 44.11  ? 103  ILE B N     1 
ATOM   4240  C CA    . ILE B  1 103 ? 112.478 142.870 -114.632 1.00 46.59  ? 103  ILE B CA    1 
ATOM   4241  C C     . ILE B  1 103 ? 113.579 143.845 -115.002 1.00 48.09  ? 103  ILE B C     1 
ATOM   4242  O O     . ILE B  1 103 ? 114.549 144.004 -114.260 1.00 49.46  ? 103  ILE B O     1 
ATOM   4243  C CB    . ILE B  1 103 ? 112.927 141.439 -114.987 1.00 45.95  ? 103  ILE B CB    1 
ATOM   4244  C CG1   . ILE B  1 103 ? 111.891 140.443 -114.452 1.00 45.53  ? 103  ILE B CG1   1 
ATOM   4245  C CG2   . ILE B  1 103 ? 114.312 141.160 -114.394 1.00 45.50  ? 103  ILE B CG2   1 
ATOM   4246  C CD1   . ILE B  1 103 ? 112.243 139.002 -114.677 1.00 46.01  ? 103  ILE B CD1   1 
ATOM   4247  N N     . ALA B  1 104 ? 113.426 144.494 -116.152 1.00 48.82  ? 104  ALA B N     1 
ATOM   4248  C CA    . ALA B  1 104 ? 114.394 145.482 -116.600 1.00 49.33  ? 104  ALA B CA    1 
ATOM   4249  C C     . ALA B  1 104 ? 114.203 146.696 -115.689 1.00 50.07  ? 104  ALA B C     1 
ATOM   4250  O O     . ALA B  1 104 ? 115.167 147.287 -115.196 1.00 49.69  ? 104  ALA B O     1 
ATOM   4251  C CB    . ALA B  1 104 ? 114.126 145.858 -118.065 1.00 48.93  ? 104  ALA B CB    1 
ATOM   4252  N N     . HIS B  1 105 ? 112.946 147.051 -115.449 1.00 51.36  ? 105  HIS B N     1 
ATOM   4253  C CA    . HIS B  1 105 ? 112.647 148.194 -114.602 1.00 53.15  ? 105  HIS B CA    1 
ATOM   4254  C C     . HIS B  1 105 ? 113.050 147.939 -113.154 1.00 52.50  ? 105  HIS B C     1 
ATOM   4255  O O     . HIS B  1 105 ? 113.616 148.807 -112.490 1.00 52.73  ? 105  HIS B O     1 
ATOM   4256  C CB    . HIS B  1 105 ? 111.163 148.530 -114.652 1.00 55.66  ? 105  HIS B CB    1 
ATOM   4257  C CG    . HIS B  1 105 ? 110.805 149.701 -113.799 1.00 60.02  ? 105  HIS B CG    1 
ATOM   4258  N ND1   . HIS B  1 105 ? 111.121 150.998 -114.151 1.00 62.56  ? 105  HIS B ND1   1 
ATOM   4259  C CD2   . HIS B  1 105 ? 110.245 149.767 -112.568 1.00 61.31  ? 105  HIS B CD2   1 
ATOM   4260  C CE1   . HIS B  1 105 ? 110.775 151.812 -113.169 1.00 63.53  ? 105  HIS B CE1   1 
ATOM   4261  N NE2   . HIS B  1 105 ? 110.241 151.091 -112.196 1.00 63.17  ? 105  HIS B NE2   1 
ATOM   4262  N N     . LEU B  1 106 ? 112.737 146.744 -112.673 1.00 51.30  ? 106  LEU B N     1 
ATOM   4263  C CA    . LEU B  1 106 ? 113.069 146.355 -111.319 1.00 50.66  ? 106  LEU B CA    1 
ATOM   4264  C C     . LEU B  1 106 ? 114.580 146.357 -111.104 1.00 50.47  ? 106  LEU B C     1 
ATOM   4265  O O     . LEU B  1 106 ? 115.061 146.862 -110.094 1.00 50.34  ? 106  LEU B O     1 
ATOM   4266  C CB    . LEU B  1 106 ? 112.491 144.962 -111.011 1.00 51.02  ? 106  LEU B CB    1 
ATOM   4267  C CG    . LEU B  1 106 ? 110.971 144.869 -110.810 1.00 50.11  ? 106  LEU B CG    1 
ATOM   4268  C CD1   . LEU B  1 106 ? 110.520 143.403 -110.798 1.00 48.67  ? 106  LEU B CD1   1 
ATOM   4269  C CD2   . LEU B  1 106 ? 110.602 145.579 -109.515 1.00 48.18  ? 106  LEU B CD2   1 
ATOM   4270  N N     . PHE B  1 107 ? 115.330 145.786 -112.042 1.00 50.76  ? 107  PHE B N     1 
ATOM   4271  C CA    . PHE B  1 107 ? 116.786 145.754 -111.909 1.00 50.81  ? 107  PHE B CA    1 
ATOM   4272  C C     . PHE B  1 107 ? 117.253 147.200 -111.846 1.00 51.01  ? 107  PHE B C     1 
ATOM   4273  O O     . PHE B  1 107 ? 118.123 147.550 -111.048 1.00 50.26  ? 107  PHE B O     1 
ATOM   4274  C CB    . PHE B  1 107 ? 117.443 145.038 -113.105 1.00 50.11  ? 107  PHE B CB    1 
ATOM   4275  C CG    . PHE B  1 107 ? 117.737 143.558 -112.877 1.00 49.85  ? 107  PHE B CG    1 
ATOM   4276  C CD1   . PHE B  1 107 ? 117.228 142.877 -111.769 1.00 49.10  ? 107  PHE B CD1   1 
ATOM   4277  C CD2   . PHE B  1 107 ? 118.505 142.842 -113.801 1.00 48.72  ? 107  PHE B CD2   1 
ATOM   4278  C CE1   . PHE B  1 107 ? 117.481 141.511 -111.592 1.00 48.24  ? 107  PHE B CE1   1 
ATOM   4279  C CE2   . PHE B  1 107 ? 118.761 141.480 -113.632 1.00 47.17  ? 107  PHE B CE2   1 
ATOM   4280  C CZ    . PHE B  1 107 ? 118.251 140.814 -112.531 1.00 47.96  ? 107  PHE B CZ    1 
ATOM   4281  N N     . LYS B  1 108 ? 116.645 148.035 -112.680 1.00 51.33  ? 108  LYS B N     1 
ATOM   4282  C CA    . LYS B  1 108 ? 116.978 149.451 -112.733 1.00 52.72  ? 108  LYS B CA    1 
ATOM   4283  C C     . LYS B  1 108 ? 116.684 150.125 -111.397 1.00 52.21  ? 108  LYS B C     1 
ATOM   4284  O O     . LYS B  1 108 ? 117.549 150.761 -110.797 1.00 52.08  ? 108  LYS B O     1 
ATOM   4285  C CB    . LYS B  1 108 ? 116.177 150.116 -113.853 1.00 54.30  ? 108  LYS B CB    1 
ATOM   4286  C CG    . LYS B  1 108 ? 116.467 151.593 -114.046 1.00 58.20  ? 108  LYS B CG    1 
ATOM   4287  C CD    . LYS B  1 108 ? 116.226 152.012 -115.500 1.00 60.97  ? 108  LYS B CD    1 
ATOM   4288  C CE    . LYS B  1 108 ? 117.145 151.226 -116.461 1.00 62.34  ? 108  LYS B CE    1 
ATOM   4289  N NZ    . LYS B  1 108 ? 116.943 151.577 -117.905 1.00 63.59  ? 108  LYS B NZ    1 
ATOM   4290  N N     . GLN B  1 109 ? 115.455 149.947 -110.934 1.00 52.02  ? 109  GLN B N     1 
ATOM   4291  C CA    . GLN B  1 109 ? 114.984 150.523 -109.683 1.00 52.26  ? 109  GLN B CA    1 
ATOM   4292  C C     . GLN B  1 109 ? 115.843 150.171 -108.478 1.00 53.07  ? 109  GLN B C     1 
ATOM   4293  O O     . GLN B  1 109 ? 116.022 150.983 -107.569 1.00 53.65  ? 109  GLN B O     1 
ATOM   4294  C CB    . GLN B  1 109 ? 113.558 150.069 -109.430 1.00 51.87  ? 109  GLN B CB    1 
ATOM   4295  C CG    . GLN B  1 109 ? 112.985 150.376 -108.063 1.00 51.93  ? 109  GLN B CG    1 
ATOM   4296  C CD    . GLN B  1 109 ? 111.578 149.829 -107.920 1.00 52.12  ? 109  GLN B CD    1 
ATOM   4297  O OE1   . GLN B  1 109 ? 110.762 149.944 -108.858 1.00 51.57  ? 109  GLN B OE1   1 
ATOM   4298  N NE2   . GLN B  1 109 ? 111.296 149.207 -106.803 1.00 50.37  ? 109  GLN B NE2   1 
ATOM   4299  N N     . ASN B  1 110 ? 116.387 148.965 -108.463 1.00 53.81  ? 110  ASN B N     1 
ATOM   4300  C CA    . ASN B  1 110 ? 117.226 148.542 -107.351 1.00 54.82  ? 110  ASN B CA    1 
ATOM   4301  C C     . ASN B  1 110 ? 118.703 148.707 -107.696 1.00 55.33  ? 110  ASN B C     1 
ATOM   4302  O O     . ASN B  1 110 ? 119.579 148.159 -107.028 1.00 54.73  ? 110  ASN B O     1 
ATOM   4303  C CB    . ASN B  1 110 ? 116.909 147.086 -106.994 1.00 54.91  ? 110  ASN B CB    1 
ATOM   4304  C CG    . ASN B  1 110 ? 115.494 146.912 -106.488 1.00 54.73  ? 110  ASN B CG    1 
ATOM   4305  O OD1   . ASN B  1 110 ? 115.175 147.269 -105.349 1.00 54.26  ? 110  ASN B OD1   1 
ATOM   4306  N ND2   . ASN B  1 110 ? 114.629 146.377 -107.339 1.00 54.66  ? 110  ASN B ND2   1 
ATOM   4307  N N     . LYS B  1 111 ? 118.965 149.475 -108.746 1.00 56.48  ? 111  LYS B N     1 
ATOM   4308  C CA    . LYS B  1 111 ? 120.327 149.732 -109.197 1.00 57.37  ? 111  LYS B CA    1 
ATOM   4309  C C     . LYS B  1 111 ? 121.179 148.476 -109.304 1.00 56.21  ? 111  LYS B C     1 
ATOM   4310  O O     . LYS B  1 111 ? 122.294 148.408 -108.794 1.00 56.06  ? 111  LYS B O     1 
ATOM   4311  C CB    . LYS B  1 111 ? 121.017 150.756 -108.286 1.00 59.40  ? 111  LYS B CB    1 
ATOM   4312  C CG    . LYS B  1 111 ? 120.286 152.092 -108.197 1.00 61.92  ? 111  LYS B CG    1 
ATOM   4313  C CD    . LYS B  1 111 ? 121.085 153.107 -107.389 1.00 64.52  ? 111  LYS B CD    1 
ATOM   4314  C CE    . LYS B  1 111 ? 120.235 154.305 -106.992 1.00 64.96  ? 111  LYS B CE    1 
ATOM   4315  N NZ    . LYS B  1 111 ? 119.210 153.918 -105.977 1.00 66.14  ? 111  LYS B NZ    1 
ATOM   4316  N N     . VAL B  1 112 ? 120.623 147.471 -109.964 1.00 55.88  ? 112  VAL B N     1 
ATOM   4317  C CA    . VAL B  1 112 ? 121.330 146.232 -110.212 1.00 54.09  ? 112  VAL B CA    1 
ATOM   4318  C C     . VAL B  1 112 ? 121.929 146.433 -111.602 1.00 54.13  ? 112  VAL B C     1 
ATOM   4319  O O     . VAL B  1 112 ? 121.257 146.909 -112.525 1.00 53.72  ? 112  VAL B O     1 
ATOM   4320  C CB    . VAL B  1 112 ? 120.371 145.018 -110.209 1.00 52.52  ? 112  VAL B CB    1 
ATOM   4321  C CG1   . VAL B  1 112 ? 121.090 143.772 -110.709 1.00 51.47  ? 112  VAL B CG1   1 
ATOM   4322  C CG2   . VAL B  1 112 ? 119.843 144.788 -108.807 1.00 51.37  ? 112  VAL B CG2   1 
ATOM   4323  N N     . VAL B  1 113 ? 123.200 146.089 -111.745 1.00 54.31  ? 113  VAL B N     1 
ATOM   4324  C CA    . VAL B  1 113 ? 123.875 146.251 -113.019 1.00 54.08  ? 113  VAL B CA    1 
ATOM   4325  C C     . VAL B  1 113 ? 123.688 145.052 -113.949 1.00 53.93  ? 113  VAL B C     1 
ATOM   4326  O O     . VAL B  1 113 ? 124.125 143.936 -113.654 1.00 52.16  ? 113  VAL B O     1 
ATOM   4327  C CB    . VAL B  1 113 ? 125.360 146.497 -112.796 1.00 54.29  ? 113  VAL B CB    1 
ATOM   4328  C CG1   . VAL B  1 113 ? 126.043 146.710 -114.126 1.00 54.06  ? 113  VAL B CG1   1 
ATOM   4329  C CG2   . VAL B  1 113 ? 125.545 147.712 -111.888 1.00 53.41  ? 113  VAL B CG2   1 
ATOM   4330  N N     . HIS B  1 114 ? 123.052 145.311 -115.087 1.00 53.90  ? 114  HIS B N     1 
ATOM   4331  C CA    . HIS B  1 114 ? 122.767 144.278 -116.080 1.00 54.02  ? 114  HIS B CA    1 
ATOM   4332  C C     . HIS B  1 114 ? 123.818 144.156 -117.187 1.00 54.58  ? 114  HIS B C     1 
ATOM   4333  O O     . HIS B  1 114 ? 123.960 145.036 -118.030 1.00 54.92  ? 114  HIS B O     1 
ATOM   4334  C CB    . HIS B  1 114 ? 121.368 144.538 -116.675 1.00 51.77  ? 114  HIS B CB    1 
ATOM   4335  C CG    . HIS B  1 114 ? 120.981 143.626 -117.803 1.00 48.92  ? 114  HIS B CG    1 
ATOM   4336  N ND1   . HIS B  1 114 ? 121.689 142.492 -118.140 1.00 47.72  ? 114  HIS B ND1   1 
ATOM   4337  C CD2   . HIS B  1 114 ? 119.951 143.698 -118.678 1.00 46.32  ? 114  HIS B CD2   1 
ATOM   4338  C CE1   . HIS B  1 114 ? 121.115 141.909 -119.177 1.00 46.38  ? 114  HIS B CE1   1 
ATOM   4339  N NE2   . HIS B  1 114 ? 120.059 142.622 -119.522 1.00 46.06  ? 114  HIS B NE2   1 
ATOM   4340  N N     . VAL B  1 115 ? 124.547 143.046 -117.159 1.00 55.73  ? 115  VAL B N     1 
ATOM   4341  C CA    . VAL B  1 115 ? 125.568 142.743 -118.146 1.00 57.79  ? 115  VAL B CA    1 
ATOM   4342  C C     . VAL B  1 115 ? 124.992 141.727 -119.136 1.00 60.46  ? 115  VAL B C     1 
ATOM   4343  O O     . VAL B  1 115 ? 124.591 140.635 -118.734 1.00 60.78  ? 115  VAL B O     1 
ATOM   4344  C CB    . VAL B  1 115 ? 126.797 142.131 -117.470 1.00 57.20  ? 115  VAL B CB    1 
ATOM   4345  C CG1   . VAL B  1 115 ? 127.745 141.597 -118.504 1.00 56.50  ? 115  VAL B CG1   1 
ATOM   4346  C CG2   . VAL B  1 115 ? 127.482 143.170 -116.617 1.00 57.37  ? 115  VAL B CG2   1 
ATOM   4347  N N     . ASN B  1 116 ? 124.969 142.081 -120.423 1.00 63.43  ? 116  ASN B N     1 
ATOM   4348  C CA    . ASN B  1 116 ? 124.425 141.216 -121.493 1.00 65.06  ? 116  ASN B CA    1 
ATOM   4349  C C     . ASN B  1 116 ? 125.483 140.340 -122.185 1.00 65.50  ? 116  ASN B C     1 
ATOM   4350  O O     . ASN B  1 116 ? 126.080 140.759 -123.179 1.00 66.51  ? 116  ASN B O     1 
ATOM   4351  C CB    . ASN B  1 116 ? 123.739 142.098 -122.551 1.00 66.80  ? 116  ASN B CB    1 
ATOM   4352  C CG    . ASN B  1 116 ? 122.901 141.302 -123.539 1.00 68.80  ? 116  ASN B CG    1 
ATOM   4353  O OD1   . ASN B  1 116 ? 123.313 140.239 -124.016 1.00 70.24  ? 116  ASN B OD1   1 
ATOM   4354  N ND2   . ASN B  1 116 ? 121.719 141.827 -123.867 1.00 69.01  ? 116  ASN B ND2   1 
ATOM   4355  N N     . GLY B  1 117 ? 125.701 139.125 -121.686 1.00 65.07  ? 117  GLY B N     1 
ATOM   4356  C CA    . GLY B  1 117 ? 126.698 138.255 -122.290 1.00 64.85  ? 117  GLY B CA    1 
ATOM   4357  C C     . GLY B  1 117 ? 126.797 136.876 -121.665 1.00 65.28  ? 117  GLY B C     1 
ATOM   4358  O O     . GLY B  1 117 ? 126.178 136.615 -120.640 1.00 66.46  ? 117  GLY B O     1 
ATOM   4359  N N     . TYR B  1 118 ? 127.576 135.986 -122.273 1.00 64.96  ? 118  TYR B N     1 
ATOM   4360  C CA    . TYR B  1 118 ? 127.731 134.632 -121.751 1.00 64.66  ? 118  TYR B CA    1 
ATOM   4361  C C     . TYR B  1 118 ? 128.850 134.629 -120.729 1.00 64.94  ? 118  TYR B C     1 
ATOM   4362  O O     . TYR B  1 118 ? 130.029 134.671 -121.076 1.00 65.18  ? 118  TYR B O     1 
ATOM   4363  C CB    . TYR B  1 118 ? 128.048 133.657 -122.887 1.00 65.19  ? 118  TYR B CB    1 
ATOM   4364  C CG    . TYR B  1 118 ? 127.911 132.186 -122.524 1.00 65.51  ? 118  TYR B CG    1 
ATOM   4365  C CD1   . TYR B  1 118 ? 128.900 131.528 -121.788 1.00 66.24  ? 118  TYR B CD1   1 
ATOM   4366  C CD2   . TYR B  1 118 ? 126.794 131.451 -122.925 1.00 65.61  ? 118  TYR B CD2   1 
ATOM   4367  C CE1   . TYR B  1 118 ? 128.783 130.173 -121.461 1.00 66.49  ? 118  TYR B CE1   1 
ATOM   4368  C CE2   . TYR B  1 118 ? 126.664 130.099 -122.601 1.00 66.45  ? 118  TYR B CE2   1 
ATOM   4369  C CZ    . TYR B  1 118 ? 127.661 129.470 -121.871 1.00 66.52  ? 118  TYR B CZ    1 
ATOM   4370  O OH    . TYR B  1 118 ? 127.526 128.142 -121.554 1.00 66.93  ? 118  TYR B OH    1 
ATOM   4371  N N     . GLY B  1 119 ? 128.473 134.579 -119.460 1.00 64.85  ? 119  GLY B N     1 
ATOM   4372  C CA    . GLY B  1 119 ? 129.463 134.606 -118.405 1.00 64.55  ? 119  GLY B CA    1 
ATOM   4373  C C     . GLY B  1 119 ? 130.228 133.325 -118.169 1.00 64.41  ? 119  GLY B C     1 
ATOM   4374  O O     . GLY B  1 119 ? 129.775 132.230 -118.514 1.00 64.25  ? 119  GLY B O     1 
ATOM   4375  N N     . LYS B  1 120 ? 131.407 133.484 -117.577 1.00 63.91  ? 120  LYS B N     1 
ATOM   4376  C CA    . LYS B  1 120 ? 132.271 132.369 -117.241 1.00 64.63  ? 120  LYS B CA    1 
ATOM   4377  C C     . LYS B  1 120 ? 133.111 132.724 -116.007 1.00 64.54  ? 120  LYS B C     1 
ATOM   4378  O O     . LYS B  1 120 ? 133.602 133.845 -115.878 1.00 63.60  ? 120  LYS B O     1 
ATOM   4379  C CB    . LYS B  1 120 ? 133.179 132.012 -118.429 1.00 64.10  ? 120  LYS B CB    1 
ATOM   4380  C CG    . LYS B  1 120 ? 134.194 130.927 -118.098 1.00 65.22  ? 120  LYS B CG    1 
ATOM   4381  C CD    . LYS B  1 120 ? 134.792 130.266 -119.330 1.00 65.56  ? 120  LYS B CD    1 
ATOM   4382  C CE    . LYS B  1 120 ? 135.671 129.086 -118.910 1.00 66.44  ? 120  LYS B CE    1 
ATOM   4383  N NZ    . LYS B  1 120 ? 136.072 128.192 -120.035 1.00 67.24  ? 120  LYS B NZ    1 
ATOM   4384  N N     . ILE B  1 121 ? 133.245 131.784 -115.079 1.00 64.88  ? 121  ILE B N     1 
ATOM   4385  C CA    . ILE B  1 121 ? 134.057 132.051 -113.903 1.00 65.94  ? 121  ILE B CA    1 
ATOM   4386  C C     . ILE B  1 121 ? 135.506 131.927 -114.351 1.00 66.02  ? 121  ILE B C     1 
ATOM   4387  O O     . ILE B  1 121 ? 136.024 130.822 -114.542 1.00 66.34  ? 121  ILE B O     1 
ATOM   4388  C CB    . ILE B  1 121 ? 133.765 131.058 -112.757 1.00 65.97  ? 121  ILE B CB    1 
ATOM   4389  C CG1   . ILE B  1 121 ? 132.327 131.259 -112.270 1.00 66.24  ? 121  ILE B CG1   1 
ATOM   4390  C CG2   . ILE B  1 121 ? 134.756 131.267 -111.605 1.00 64.41  ? 121  ILE B CG2   1 
ATOM   4391  C CD1   . ILE B  1 121 ? 131.922 130.338 -111.134 1.00 65.77  ? 121  ILE B CD1   1 
ATOM   4392  N N     . THR B  1 122 ? 136.138 133.079 -114.546 1.00 65.56  ? 122  THR B N     1 
ATOM   4393  C CA    . THR B  1 122 ? 137.521 133.146 -114.988 1.00 64.25  ? 122  THR B CA    1 
ATOM   4394  C C     . THR B  1 122 ? 138.476 133.195 -113.807 1.00 64.73  ? 122  THR B C     1 
ATOM   4395  O O     . THR B  1 122 ? 139.585 132.679 -113.873 1.00 65.41  ? 122  THR B O     1 
ATOM   4396  C CB    . THR B  1 122 ? 137.724 134.367 -115.873 1.00 62.81  ? 122  THR B CB    1 
ATOM   4397  O OG1   . THR B  1 122 ? 137.139 135.516 -115.250 1.00 61.33  ? 122  THR B OG1   1 
ATOM   4398  C CG2   . THR B  1 122 ? 137.060 134.145 -117.213 1.00 61.80  ? 122  THR B CG2   1 
ATOM   4399  N N     . GLY B  1 123 ? 138.033 133.806 -112.719 1.00 65.39  ? 123  GLY B N     1 
ATOM   4400  C CA    . GLY B  1 123 ? 138.858 133.894 -111.530 1.00 66.17  ? 123  GLY B CA    1 
ATOM   4401  C C     . GLY B  1 123 ? 137.984 133.688 -110.313 1.00 66.73  ? 123  GLY B C     1 
ATOM   4402  O O     . GLY B  1 123 ? 136.808 134.042 -110.347 1.00 66.64  ? 123  GLY B O     1 
ATOM   4403  N N     . LYS B  1 124 ? 138.548 133.119 -109.248 1.00 67.34  ? 124  LYS B N     1 
ATOM   4404  C CA    . LYS B  1 124 ? 137.800 132.860 -108.021 1.00 68.18  ? 124  LYS B CA    1 
ATOM   4405  C C     . LYS B  1 124 ? 137.106 134.088 -107.454 1.00 67.55  ? 124  LYS B C     1 
ATOM   4406  O O     . LYS B  1 124 ? 136.292 133.982 -106.540 1.00 67.29  ? 124  LYS B O     1 
ATOM   4407  C CB    . LYS B  1 124 ? 138.700 132.240 -106.954 1.00 70.11  ? 124  LYS B CB    1 
ATOM   4408  C CG    . LYS B  1 124 ? 139.028 130.769 -107.207 1.00 73.35  ? 124  LYS B CG    1 
ATOM   4409  C CD    . LYS B  1 124 ? 139.584 130.087 -105.958 1.00 74.71  ? 124  LYS B CD    1 
ATOM   4410  C CE    . LYS B  1 124 ? 139.679 128.572 -106.154 1.00 75.88  ? 124  LYS B CE    1 
ATOM   4411  N NZ    . LYS B  1 124 ? 140.044 127.865 -104.888 1.00 75.27  ? 124  LYS B NZ    1 
ATOM   4412  N N     . ASN B  1 125 ? 137.438 135.256 -107.984 1.00 66.79  ? 125  ASN B N     1 
ATOM   4413  C CA    . ASN B  1 125 ? 136.795 136.491 -107.557 1.00 66.44  ? 125  ASN B CA    1 
ATOM   4414  C C     . ASN B  1 125 ? 136.550 137.294 -108.803 1.00 66.35  ? 125  ASN B C     1 
ATOM   4415  O O     . ASN B  1 125 ? 136.329 138.501 -108.749 1.00 66.09  ? 125  ASN B O     1 
ATOM   4416  C CB    . ASN B  1 125 ? 137.681 137.288 -106.603 1.00 66.68  ? 125  ASN B CB    1 
ATOM   4417  C CG    . ASN B  1 125 ? 137.689 136.720 -105.206 1.00 66.65  ? 125  ASN B CG    1 
ATOM   4418  O OD1   . ASN B  1 125 ? 138.505 135.841 -104.881 1.00 68.03  ? 125  ASN B OD1   1 
ATOM   4419  N ND2   . ASN B  1 125 ? 136.783 137.187 -104.379 1.00 66.07  ? 125  ASN B ND2   1 
ATOM   4420  N N     . GLN B  1 126 ? 136.568 136.598 -109.930 1.00 66.68  ? 126  GLN B N     1 
ATOM   4421  C CA    . GLN B  1 126 ? 136.370 137.239 -111.209 1.00 67.63  ? 126  GLN B CA    1 
ATOM   4422  C C     . GLN B  1 126 ? 135.460 136.452 -112.152 1.00 67.22  ? 126  GLN B C     1 
ATOM   4423  O O     . GLN B  1 126 ? 135.480 135.220 -112.183 1.00 66.02  ? 126  GLN B O     1 
ATOM   4424  C CB    . GLN B  1 126 ? 137.732 137.455 -111.857 1.00 69.10  ? 126  GLN B CB    1 
ATOM   4425  C CG    . GLN B  1 126 ? 137.686 137.926 -113.293 1.00 72.10  ? 126  GLN B CG    1 
ATOM   4426  C CD    . GLN B  1 126 ? 138.978 137.626 -114.023 1.00 74.05  ? 126  GLN B CD    1 
ATOM   4427  O OE1   . GLN B  1 126 ? 139.004 137.540 -115.252 1.00 74.97  ? 126  GLN B OE1   1 
ATOM   4428  N NE2   . GLN B  1 126 ? 140.064 137.467 -113.267 1.00 75.18  ? 126  GLN B NE2   1 
ATOM   4429  N N     . VAL B  1 127 ? 134.667 137.188 -112.923 1.00 67.25  ? 127  VAL B N     1 
ATOM   4430  C CA    . VAL B  1 127 ? 133.760 136.599 -113.896 1.00 67.50  ? 127  VAL B CA    1 
ATOM   4431  C C     . VAL B  1 127 ? 133.835 137.456 -115.156 1.00 67.45  ? 127  VAL B C     1 
ATOM   4432  O O     . VAL B  1 127 ? 133.623 138.664 -115.106 1.00 67.39  ? 127  VAL B O     1 
ATOM   4433  C CB    . VAL B  1 127 ? 132.303 136.570 -113.370 1.00 67.84  ? 127  VAL B CB    1 
ATOM   4434  C CG1   . VAL B  1 127 ? 131.384 135.986 -114.416 1.00 66.82  ? 127  VAL B CG1   1 
ATOM   4435  C CG2   . VAL B  1 127 ? 132.223 135.737 -112.096 1.00 68.38  ? 127  VAL B CG2   1 
ATOM   4436  N N     . THR B  1 128 ? 134.153 136.816 -116.277 1.00 67.81  ? 128  THR B N     1 
ATOM   4437  C CA    . THR B  1 128 ? 134.281 137.494 -117.560 1.00 67.86  ? 128  THR B CA    1 
ATOM   4438  C C     . THR B  1 128 ? 133.100 137.154 -118.444 1.00 68.94  ? 128  THR B C     1 
ATOM   4439  O O     . THR B  1 128 ? 132.858 135.984 -118.735 1.00 68.78  ? 128  THR B O     1 
ATOM   4440  C CB    . THR B  1 128 ? 135.554 137.050 -118.287 1.00 67.29  ? 128  THR B CB    1 
ATOM   4441  O OG1   . THR B  1 128 ? 136.685 137.212 -117.417 1.00 65.30  ? 128  THR B OG1   1 
ATOM   4442  C CG2   . THR B  1 128 ? 135.743 137.866 -119.555 1.00 65.37  ? 128  THR B CG2   1 
ATOM   4443  N N     . ALA B  1 129 ? 132.384 138.178 -118.891 1.00 70.20  ? 129  ALA B N     1 
ATOM   4444  C CA    . ALA B  1 129 ? 131.207 137.983 -119.734 1.00 71.58  ? 129  ALA B CA    1 
ATOM   4445  C C     . ALA B  1 129 ? 131.439 138.294 -121.214 1.00 72.45  ? 129  ALA B C     1 
ATOM   4446  O O     . ALA B  1 129 ? 131.428 139.457 -121.619 1.00 72.51  ? 129  ALA B O     1 
ATOM   4447  C CB    . ALA B  1 129 ? 130.059 138.832 -119.201 1.00 71.47  ? 129  ALA B CB    1 
ATOM   4448  N N     . THR B  1 130 ? 131.612 137.250 -122.022 1.00 73.40  ? 130  THR B N     1 
ATOM   4449  C CA    . THR B  1 130 ? 131.856 137.420 -123.452 1.00 74.09  ? 130  THR B CA    1 
ATOM   4450  C C     . THR B  1 130 ? 130.591 137.658 -124.258 1.00 74.45  ? 130  THR B C     1 
ATOM   4451  O O     . THR B  1 130 ? 129.837 136.734 -124.534 1.00 73.52  ? 130  THR B O     1 
ATOM   4452  C CB    . THR B  1 130 ? 132.571 136.203 -124.034 1.00 73.68  ? 130  THR B CB    1 
ATOM   4453  O OG1   . THR B  1 130 ? 133.681 135.866 -123.197 1.00 73.97  ? 130  THR B OG1   1 
ATOM   4454  C CG2   . THR B  1 130 ? 133.078 136.507 -125.436 1.00 73.57  ? 130  THR B CG2   1 
ATOM   4455  N N     . LYS B  1 131 ? 130.376 138.908 -124.647 1.00 76.18  ? 131  LYS B N     1 
ATOM   4456  C CA    . LYS B  1 131 ? 129.201 139.274 -125.423 1.00 78.16  ? 131  LYS B CA    1 
ATOM   4457  C C     . LYS B  1 131 ? 129.091 138.535 -126.748 1.00 78.90  ? 131  LYS B C     1 
ATOM   4458  O O     . LYS B  1 131 ? 129.892 137.652 -127.067 1.00 78.89  ? 131  LYS B O     1 
ATOM   4459  C CB    . LYS B  1 131 ? 129.175 140.785 -125.693 1.00 79.47  ? 131  LYS B CB    1 
ATOM   4460  C CG    . LYS B  1 131 ? 128.885 141.647 -124.470 1.00 81.27  ? 131  LYS B CG    1 
ATOM   4461  C CD    . LYS B  1 131 ? 128.604 143.096 -124.857 1.00 82.54  ? 131  LYS B CD    1 
ATOM   4462  C CE    . LYS B  1 131 ? 129.836 143.797 -125.447 1.00 84.20  ? 131  LYS B CE    1 
ATOM   4463  N NZ    . LYS B  1 131 ? 130.948 144.002 -124.467 1.00 84.73  ? 131  LYS B NZ    1 
ATOM   4464  N N     . ALA B  1 132 ? 128.081 138.917 -127.518 1.00 79.42  ? 132  ALA B N     1 
ATOM   4465  C CA    . ALA B  1 132 ? 127.828 138.310 -128.809 1.00 80.53  ? 132  ALA B CA    1 
ATOM   4466  C C     . ALA B  1 132 ? 128.966 138.606 -129.789 1.00 81.03  ? 132  ALA B C     1 
ATOM   4467  O O     . ALA B  1 132 ? 129.613 137.696 -130.312 1.00 80.79  ? 132  ALA B O     1 
ATOM   4468  C CB    . ALA B  1 132 ? 126.503 138.832 -129.359 1.00 80.47  ? 132  ALA B CB    1 
ATOM   4469  N N     . ASP B  1 133 ? 129.205 139.892 -130.014 1.00 81.73  ? 133  ASP B N     1 
ATOM   4470  C CA    . ASP B  1 133 ? 130.233 140.362 -130.935 1.00 82.14  ? 133  ASP B CA    1 
ATOM   4471  C C     . ASP B  1 133 ? 131.667 140.075 -130.503 1.00 81.52  ? 133  ASP B C     1 
ATOM   4472  O O     . ASP B  1 133 ? 132.604 140.630 -131.083 1.00 81.73  ? 133  ASP B O     1 
ATOM   4473  C CB    . ASP B  1 133 ? 130.080 141.866 -131.131 1.00 83.72  ? 133  ASP B CB    1 
ATOM   4474  C CG    . ASP B  1 133 ? 130.047 142.614 -129.812 1.00 85.51  ? 133  ASP B CG    1 
ATOM   4475  O OD1   . ASP B  1 133 ? 129.030 142.488 -129.098 1.00 86.98  ? 133  ASP B OD1   1 
ATOM   4476  O OD2   . ASP B  1 133 ? 131.033 143.309 -129.477 1.00 86.16  ? 133  ASP B OD2   1 
ATOM   4477  N N     . GLY B  1 134 ? 131.844 139.226 -129.495 1.00 80.14  ? 134  GLY B N     1 
ATOM   4478  C CA    . GLY B  1 134 ? 133.186 138.914 -129.030 1.00 78.13  ? 134  GLY B CA    1 
ATOM   4479  C C     . GLY B  1 134 ? 133.708 139.876 -127.968 1.00 76.79  ? 134  GLY B C     1 
ATOM   4480  O O     . GLY B  1 134 ? 134.567 139.502 -127.163 1.00 76.11  ? 134  GLY B O     1 
ATOM   4481  N N     . GLY B  1 135 ? 133.197 141.109 -127.968 1.00 75.54  ? 135  GLY B N     1 
ATOM   4482  C CA    . GLY B  1 135 ? 133.624 142.092 -126.987 1.00 74.54  ? 135  GLY B CA    1 
ATOM   4483  C C     . GLY B  1 135 ? 133.380 141.554 -125.591 1.00 74.04  ? 135  GLY B C     1 
ATOM   4484  O O     . GLY B  1 135 ? 132.390 140.866 -125.370 1.00 73.78  ? 135  GLY B O     1 
ATOM   4485  N N     . THR B  1 136 ? 134.264 141.857 -124.644 1.00 73.49  ? 136  THR B N     1 
ATOM   4486  C CA    . THR B  1 136 ? 134.091 141.350 -123.290 1.00 73.13  ? 136  THR B CA    1 
ATOM   4487  C C     . THR B  1 136 ? 133.777 142.383 -122.209 1.00 73.19  ? 136  THR B C     1 
ATOM   4488  O O     . THR B  1 136 ? 133.512 143.556 -122.483 1.00 74.00  ? 136  THR B O     1 
ATOM   4489  C CB    . THR B  1 136 ? 135.329 140.561 -122.828 1.00 73.27  ? 136  THR B CB    1 
ATOM   4490  O OG1   . THR B  1 136 ? 136.444 141.452 -122.708 1.00 74.15  ? 136  THR B OG1   1 
ATOM   4491  C CG2   . THR B  1 136 ? 135.652 139.448 -123.820 1.00 73.11  ? 136  THR B CG2   1 
ATOM   4492  N N     . GLN B  1 137 ? 133.799 141.905 -120.970 1.00 72.35  ? 137  GLN B N     1 
ATOM   4493  C CA    . GLN B  1 137 ? 133.541 142.717 -119.799 1.00 71.29  ? 137  GLN B CA    1 
ATOM   4494  C C     . GLN B  1 137 ? 133.948 141.885 -118.609 1.00 70.84  ? 137  GLN B C     1 
ATOM   4495  O O     . GLN B  1 137 ? 133.368 140.837 -118.351 1.00 70.35  ? 137  GLN B O     1 
ATOM   4496  C CB    . GLN B  1 137 ? 132.067 143.062 -119.689 1.00 71.00  ? 137  GLN B CB    1 
ATOM   4497  C CG    . GLN B  1 137 ? 131.738 143.761 -118.400 1.00 71.31  ? 137  GLN B CG    1 
ATOM   4498  C CD    . GLN B  1 137 ? 132.433 145.096 -118.278 1.00 71.99  ? 137  GLN B CD    1 
ATOM   4499  O OE1   . GLN B  1 137 ? 132.164 146.019 -119.053 1.00 72.00  ? 137  GLN B OE1   1 
ATOM   4500  N NE2   . GLN B  1 137 ? 133.338 145.211 -117.306 1.00 71.19  ? 137  GLN B NE2   1 
ATOM   4501  N N     . VAL B  1 138 ? 134.966 142.338 -117.894 1.00 70.68  ? 138  VAL B N     1 
ATOM   4502  C CA    . VAL B  1 138 ? 135.425 141.594 -116.743 1.00 70.80  ? 138  VAL B CA    1 
ATOM   4503  C C     . VAL B  1 138 ? 134.762 142.129 -115.489 1.00 71.04  ? 138  VAL B C     1 
ATOM   4504  O O     . VAL B  1 138 ? 134.416 143.312 -115.409 1.00 70.26  ? 138  VAL B O     1 
ATOM   4505  C CB    . VAL B  1 138 ? 136.961 141.668 -116.600 1.00 70.90  ? 138  VAL B CB    1 
ATOM   4506  C CG1   . VAL B  1 138 ? 137.409 140.944 -115.328 1.00 69.68  ? 138  VAL B CG1   1 
ATOM   4507  C CG2   . VAL B  1 138 ? 137.617 141.041 -117.827 1.00 70.10  ? 138  VAL B CG2   1 
ATOM   4508  N N     . ILE B  1 139 ? 134.574 141.239 -114.520 1.00 70.81  ? 139  ILE B N     1 
ATOM   4509  C CA    . ILE B  1 139 ? 133.946 141.610 -113.268 1.00 70.84  ? 139  ILE B CA    1 
ATOM   4510  C C     . ILE B  1 139 ? 134.627 140.981 -112.069 1.00 70.90  ? 139  ILE B C     1 
ATOM   4511  O O     . ILE B  1 139 ? 134.677 139.753 -111.929 1.00 70.75  ? 139  ILE B O     1 
ATOM   4512  C CB    . ILE B  1 139 ? 132.475 141.195 -113.237 1.00 71.18  ? 139  ILE B CB    1 
ATOM   4513  C CG1   . ILE B  1 139 ? 131.752 141.768 -114.454 1.00 71.96  ? 139  ILE B CG1   1 
ATOM   4514  C CG2   . ILE B  1 139 ? 131.828 141.699 -111.959 1.00 70.36  ? 139  ILE B CG2   1 
ATOM   4515  C CD1   . ILE B  1 139 ? 130.327 141.300 -114.595 1.00 73.04  ? 139  ILE B CD1   1 
ATOM   4516  N N     . ASP B  1 140 ? 135.160 141.840 -111.209 1.00 70.52  ? 140  ASP B N     1 
ATOM   4517  C CA    . ASP B  1 140 ? 135.803 141.378 -109.997 1.00 69.73  ? 140  ASP B CA    1 
ATOM   4518  C C     . ASP B  1 140 ? 134.780 141.511 -108.902 1.00 68.05  ? 140  ASP B C     1 
ATOM   4519  O O     . ASP B  1 140 ? 134.115 142.538 -108.745 1.00 67.05  ? 140  ASP B O     1 
ATOM   4520  C CB    . ASP B  1 140 ? 137.064 142.183 -109.701 1.00 71.18  ? 140  ASP B CB    1 
ATOM   4521  C CG    . ASP B  1 140 ? 138.246 141.686 -110.499 1.00 72.55  ? 140  ASP B CG    1 
ATOM   4522  O OD1   . ASP B  1 140 ? 138.706 140.553 -110.216 1.00 73.54  ? 140  ASP B OD1   1 
ATOM   4523  O OD2   . ASP B  1 140 ? 138.697 142.409 -111.416 1.00 72.98  ? 140  ASP B OD2   1 
ATOM   4524  N N     . THR B  1 141 ? 134.644 140.438 -108.151 1.00 66.32  ? 141  THR B N     1 
ATOM   4525  C CA    . THR B  1 141 ? 133.653 140.414 -107.123 1.00 64.96  ? 141  THR B CA    1 
ATOM   4526  C C     . THR B  1 141 ? 134.096 139.559 -105.962 1.00 64.28  ? 141  THR B C     1 
ATOM   4527  O O     . THR B  1 141 ? 135.005 138.736 -106.069 1.00 63.05  ? 141  THR B O     1 
ATOM   4528  C CB    . THR B  1 141 ? 132.352 139.866 -107.706 1.00 65.13  ? 141  THR B CB    1 
ATOM   4529  O OG1   . THR B  1 141 ? 131.351 139.778 -106.687 1.00 64.87  ? 141  THR B OG1   1 
ATOM   4530  C CG2   . THR B  1 141 ? 132.600 138.498 -108.306 1.00 64.98  ? 141  THR B CG2   1 
ATOM   4531  N N     . LYS B  1 142 ? 133.428 139.776 -104.843 1.00 63.91  ? 142  LYS B N     1 
ATOM   4532  C CA    . LYS B  1 142 ? 133.705 139.058 -103.617 1.00 63.97  ? 142  LYS B CA    1 
ATOM   4533  C C     . LYS B  1 142 ? 132.996 137.706 -103.684 1.00 62.74  ? 142  LYS B C     1 
ATOM   4534  O O     . LYS B  1 142 ? 133.551 136.668 -103.315 1.00 62.26  ? 142  LYS B O     1 
ATOM   4535  C CB    . LYS B  1 142 ? 133.185 139.893 -102.441 1.00 65.01  ? 142  LYS B CB    1 
ATOM   4536  C CG    . LYS B  1 142 ? 133.404 141.394 -102.654 1.00 66.19  ? 142  LYS B CG    1 
ATOM   4537  C CD    . LYS B  1 142 ? 133.001 142.242 -101.461 1.00 67.92  ? 142  LYS B CD    1 
ATOM   4538  C CE    . LYS B  1 142 ? 133.321 143.712 -101.726 1.00 68.81  ? 142  LYS B CE    1 
ATOM   4539  N NZ    . LYS B  1 142 ? 134.764 143.909 -102.038 1.00 69.80  ? 142  LYS B NZ    1 
ATOM   4540  N N     . ASN B  1 143 ? 131.765 137.730 -104.179 1.00 60.90  ? 143  ASN B N     1 
ATOM   4541  C CA    . ASN B  1 143 ? 130.976 136.519 -104.289 1.00 58.29  ? 143  ASN B CA    1 
ATOM   4542  C C     . ASN B  1 143 ? 130.426 136.308 -105.689 1.00 56.65  ? 143  ASN B C     1 
ATOM   4543  O O     . ASN B  1 143 ? 130.137 137.261 -106.416 1.00 56.00  ? 143  ASN B O     1 
ATOM   4544  C CB    . ASN B  1 143 ? 129.821 136.571 -103.294 1.00 56.82  ? 143  ASN B CB    1 
ATOM   4545  C CG    . ASN B  1 143 ? 130.288 136.830 -101.886 1.00 54.14  ? 143  ASN B CG    1 
ATOM   4546  O OD1   . ASN B  1 143 ? 130.926 135.986 -101.265 1.00 52.91  ? 143  ASN B OD1   1 
ATOM   4547  N ND2   . ASN B  1 143 ? 129.981 138.008 -101.377 1.00 54.57  ? 143  ASN B ND2   1 
ATOM   4548  N N     . ILE B  1 144 ? 130.307 135.037 -106.055 1.00 55.73  ? 144  ILE B N     1 
ATOM   4549  C CA    . ILE B  1 144 ? 129.753 134.637 -107.338 1.00 54.08  ? 144  ILE B CA    1 
ATOM   4550  C C     . ILE B  1 144 ? 128.582 133.699 -107.019 1.00 52.27  ? 144  ILE B C     1 
ATOM   4551  O O     . ILE B  1 144 ? 128.734 132.718 -106.275 1.00 50.45  ? 144  ILE B O     1 
ATOM   4552  C CB    . ILE B  1 144 ? 130.768 133.860 -108.210 1.00 54.95  ? 144  ILE B CB    1 
ATOM   4553  C CG1   . ILE B  1 144 ? 132.048 134.668 -108.407 1.00 54.65  ? 144  ILE B CG1   1 
ATOM   4554  C CG2   . ILE B  1 144 ? 130.145 133.562 -109.564 1.00 54.91  ? 144  ILE B CG2   1 
ATOM   4555  C CD1   . ILE B  1 144 ? 133.150 133.877 -109.086 1.00 54.18  ? 144  ILE B CD1   1 
ATOM   4556  N N     . LEU B  1 145 ? 127.413 134.030 -107.562 1.00 50.77  ? 145  LEU B N     1 
ATOM   4557  C CA    . LEU B  1 145 ? 126.210 133.230 -107.372 1.00 47.96  ? 145  LEU B CA    1 
ATOM   4558  C C     . LEU B  1 145 ? 125.781 132.675 -108.714 1.00 46.48  ? 145  LEU B C     1 
ATOM   4559  O O     . LEU B  1 145 ? 125.309 133.418 -109.575 1.00 44.28  ? 145  LEU B O     1 
ATOM   4560  C CB    . LEU B  1 145 ? 125.071 134.074 -106.786 1.00 47.97  ? 145  LEU B CB    1 
ATOM   4561  C CG    . LEU B  1 145 ? 123.716 133.371 -106.571 1.00 49.39  ? 145  LEU B CG    1 
ATOM   4562  C CD1   . LEU B  1 145 ? 123.900 132.161 -105.669 1.00 49.42  ? 145  LEU B CD1   1 
ATOM   4563  C CD2   . LEU B  1 145 ? 122.697 134.333 -105.957 1.00 49.53  ? 145  LEU B CD2   1 
ATOM   4564  N N     . ILE B  1 146 ? 125.972 131.370 -108.881 1.00 45.15  ? 146  ILE B N     1 
ATOM   4565  C CA    . ILE B  1 146 ? 125.591 130.656 -110.095 1.00 45.27  ? 146  ILE B CA    1 
ATOM   4566  C C     . ILE B  1 146 ? 124.085 130.321 -110.071 1.00 45.55  ? 146  ILE B C     1 
ATOM   4567  O O     . ILE B  1 146 ? 123.633 129.575 -109.191 1.00 46.28  ? 146  ILE B O     1 
ATOM   4568  C CB    . ILE B  1 146 ? 126.368 129.316 -110.209 1.00 45.38  ? 146  ILE B CB    1 
ATOM   4569  C CG1   . ILE B  1 146 ? 127.876 129.576 -110.198 1.00 44.93  ? 146  ILE B CG1   1 
ATOM   4570  C CG2   . ILE B  1 146 ? 125.952 128.566 -111.478 1.00 44.26  ? 146  ILE B CG2   1 
ATOM   4571  C CD1   . ILE B  1 146 ? 128.703 128.315 -110.211 1.00 42.95  ? 146  ILE B CD1   1 
ATOM   4572  N N     . ALA B  1 147 ? 123.325 130.875 -111.022 1.00 45.24  ? 147  ALA B N     1 
ATOM   4573  C CA    . ALA B  1 147 ? 121.872 130.633 -111.150 1.00 44.84  ? 147  ALA B CA    1 
ATOM   4574  C C     . ALA B  1 147 ? 121.564 130.371 -112.626 1.00 44.20  ? 147  ALA B C     1 
ATOM   4575  O O     . ALA B  1 147 ? 120.605 130.901 -113.189 1.00 42.26  ? 147  ALA B O     1 
ATOM   4576  C CB    . ALA B  1 147 ? 121.075 131.849 -110.657 1.00 44.69  ? 147  ALA B CB    1 
ATOM   4577  N N     . THR B  1 148 ? 122.395 129.526 -113.226 1.00 44.06  ? 148  THR B N     1 
ATOM   4578  C CA    . THR B  1 148 ? 122.303 129.181 -114.630 1.00 43.64  ? 148  THR B CA    1 
ATOM   4579  C C     . THR B  1 148 ? 121.082 128.349 -115.052 1.00 44.17  ? 148  THR B C     1 
ATOM   4580  O O     . THR B  1 148 ? 120.738 128.308 -116.231 1.00 44.54  ? 148  THR B O     1 
ATOM   4581  C CB    . THR B  1 148 ? 123.616 128.512 -115.075 1.00 42.72  ? 148  THR B CB    1 
ATOM   4582  O OG1   . THR B  1 148 ? 124.028 127.551 -114.099 1.00 42.80  ? 148  THR B OG1   1 
ATOM   4583  C CG2   . THR B  1 148 ? 124.703 129.545 -115.180 1.00 42.29  ? 148  THR B CG2   1 
ATOM   4584  N N     . GLY B  1 149 ? 120.425 127.694 -114.104 1.00 42.96  ? 149  GLY B N     1 
ATOM   4585  C CA    . GLY B  1 149 ? 119.232 126.931 -114.439 1.00 42.41  ? 149  GLY B CA    1 
ATOM   4586  C C     . GLY B  1 149 ? 119.365 125.597 -115.166 1.00 42.08  ? 149  GLY B C     1 
ATOM   4587  O O     . GLY B  1 149 ? 120.251 124.790 -114.885 1.00 41.84  ? 149  GLY B O     1 
ATOM   4588  N N     . SER B  1 150 ? 118.478 125.366 -116.127 1.00 41.48  ? 150  SER B N     1 
ATOM   4589  C CA    . SER B  1 150 ? 118.485 124.109 -116.857 1.00 42.19  ? 150  SER B CA    1 
ATOM   4590  C C     . SER B  1 150 ? 118.139 124.246 -118.325 1.00 41.44  ? 150  SER B C     1 
ATOM   4591  O O     . SER B  1 150 ? 117.897 125.336 -118.822 1.00 39.32  ? 150  SER B O     1 
ATOM   4592  C CB    . SER B  1 150 ? 117.461 123.177 -116.229 1.00 43.79  ? 150  SER B CB    1 
ATOM   4593  O OG    . SER B  1 150 ? 116.177 123.773 -116.323 1.00 45.23  ? 150  SER B OG    1 
ATOM   4594  N N     . GLU B  1 151 ? 118.092 123.102 -118.999 1.00 42.77  ? 151  GLU B N     1 
ATOM   4595  C CA    . GLU B  1 151 ? 117.727 123.034 -120.415 1.00 44.31  ? 151  GLU B CA    1 
ATOM   4596  C C     . GLU B  1 151 ? 116.947 121.728 -120.644 1.00 44.37  ? 151  GLU B C     1 
ATOM   4597  O O     . GLU B  1 151 ? 116.914 120.865 -119.765 1.00 44.50  ? 151  GLU B O     1 
ATOM   4598  C CB    . GLU B  1 151 ? 118.980 123.046 -121.297 1.00 42.77  ? 151  GLU B CB    1 
ATOM   4599  C CG    . GLU B  1 151 ? 119.905 121.881 -121.015 1.00 42.92  ? 151  GLU B CG    1 
ATOM   4600  C CD    . GLU B  1 151 ? 121.059 121.773 -122.000 1.00 43.17  ? 151  GLU B CD    1 
ATOM   4601  O OE1   . GLU B  1 151 ? 121.189 122.631 -122.903 1.00 44.27  ? 151  GLU B OE1   1 
ATOM   4602  O OE2   . GLU B  1 151 ? 121.845 120.820 -121.860 1.00 43.12  ? 151  GLU B OE2   1 
ATOM   4603  N N     . VAL B  1 152 ? 116.323 121.598 -121.817 1.00 44.41  ? 152  VAL B N     1 
ATOM   4604  C CA    . VAL B  1 152 ? 115.572 120.397 -122.174 1.00 43.51  ? 152  VAL B CA    1 
ATOM   4605  C C     . VAL B  1 152 ? 116.529 119.212 -122.253 1.00 45.10  ? 152  VAL B C     1 
ATOM   4606  O O     . VAL B  1 152 ? 117.582 119.291 -122.890 1.00 45.87  ? 152  VAL B O     1 
ATOM   4607  C CB    . VAL B  1 152 ? 114.882 120.529 -123.571 1.00 42.52  ? 152  VAL B CB    1 
ATOM   4608  C CG1   . VAL B  1 152 ? 114.334 119.179 -124.014 1.00 38.36  ? 152  VAL B CG1   1 
ATOM   4609  C CG2   . VAL B  1 152 ? 113.771 121.571 -123.525 1.00 40.46  ? 152  VAL B CG2   1 
ATOM   4610  N N     . THR B  1 153 ? 116.165 118.121 -121.593 1.00 45.86  ? 153  THR B N     1 
ATOM   4611  C CA    . THR B  1 153 ? 116.960 116.900 -121.624 1.00 45.95  ? 153  THR B CA    1 
ATOM   4612  C C     . THR B  1 153 ? 116.658 116.217 -122.960 1.00 46.01  ? 153  THR B C     1 
ATOM   4613  O O     . THR B  1 153 ? 115.537 115.791 -123.192 1.00 45.44  ? 153  THR B O     1 
ATOM   4614  C CB    . THR B  1 153 ? 116.511 115.949 -120.528 1.00 45.38  ? 153  THR B CB    1 
ATOM   4615  O OG1   . THR B  1 153 ? 116.670 116.580 -119.258 1.00 46.95  ? 153  THR B OG1   1 
ATOM   4616  C CG2   . THR B  1 153 ? 117.302 114.666 -120.587 1.00 44.20  ? 153  THR B CG2   1 
ATOM   4617  N N     . PRO B  1 154 ? 117.644 116.089 -123.850 1.00 47.34  ? 154  PRO B N     1 
ATOM   4618  C CA    . PRO B  1 154 ? 117.283 115.429 -125.108 1.00 49.09  ? 154  PRO B CA    1 
ATOM   4619  C C     . PRO B  1 154 ? 117.063 113.909 -125.002 1.00 48.97  ? 154  PRO B C     1 
ATOM   4620  O O     . PRO B  1 154 ? 117.376 113.275 -123.997 1.00 48.83  ? 154  PRO B O     1 
ATOM   4621  C CB    . PRO B  1 154 ? 118.443 115.805 -126.039 1.00 47.80  ? 154  PRO B CB    1 
ATOM   4622  C CG    . PRO B  1 154 ? 119.604 115.819 -125.106 1.00 48.98  ? 154  PRO B CG    1 
ATOM   4623  C CD    . PRO B  1 154 ? 119.048 116.537 -123.872 1.00 48.90  ? 154  PRO B CD    1 
ATOM   4624  N N     . PHE B  1 155 ? 116.486 113.349 -126.051 1.00 49.92  ? 155  PHE B N     1 
ATOM   4625  C CA    . PHE B  1 155 ? 116.214 111.927 -126.131 1.00 50.87  ? 155  PHE B CA    1 
ATOM   4626  C C     . PHE B  1 155 ? 117.179 111.461 -127.213 1.00 51.99  ? 155  PHE B C     1 
ATOM   4627  O O     . PHE B  1 155 ? 117.043 111.852 -128.368 1.00 51.97  ? 155  PHE B O     1 
ATOM   4628  C CB    . PHE B  1 155 ? 114.773 111.731 -126.593 1.00 51.54  ? 155  PHE B CB    1 
ATOM   4629  C CG    . PHE B  1 155 ? 114.267 110.325 -126.471 1.00 52.73  ? 155  PHE B CG    1 
ATOM   4630  C CD1   . PHE B  1 155 ? 115.026 109.250 -126.913 1.00 53.79  ? 155  PHE B CD1   1 
ATOM   4631  C CD2   . PHE B  1 155 ? 113.003 110.082 -125.948 1.00 52.36  ? 155  PHE B CD2   1 
ATOM   4632  C CE1   . PHE B  1 155 ? 114.532 107.953 -126.838 1.00 54.20  ? 155  PHE B CE1   1 
ATOM   4633  C CE2   . PHE B  1 155 ? 112.499 108.799 -125.866 1.00 52.75  ? 155  PHE B CE2   1 
ATOM   4634  C CZ    . PHE B  1 155 ? 113.263 107.728 -126.312 1.00 53.60  ? 155  PHE B CZ    1 
ATOM   4635  N N     . PRO B  1 156 ? 118.181 110.644 -126.858 1.00 53.78  ? 156  PRO B N     1 
ATOM   4636  C CA    . PRO B  1 156 ? 119.131 110.176 -127.875 1.00 55.14  ? 156  PRO B CA    1 
ATOM   4637  C C     . PRO B  1 156 ? 118.410 109.500 -129.043 1.00 55.61  ? 156  PRO B C     1 
ATOM   4638  O O     . PRO B  1 156 ? 117.427 108.780 -128.842 1.00 54.70  ? 156  PRO B O     1 
ATOM   4639  C CB    . PRO B  1 156 ? 120.012 109.201 -127.098 1.00 55.59  ? 156  PRO B CB    1 
ATOM   4640  C CG    . PRO B  1 156 ? 119.036 108.618 -126.110 1.00 55.55  ? 156  PRO B CG    1 
ATOM   4641  C CD    . PRO B  1 156 ? 118.340 109.877 -125.611 1.00 54.63  ? 156  PRO B CD    1 
ATOM   4642  N N     . GLY B  1 157 ? 118.905 109.739 -130.257 1.00 55.73  ? 157  GLY B N     1 
ATOM   4643  C CA    . GLY B  1 157 ? 118.292 109.161 -131.439 1.00 55.44  ? 157  GLY B CA    1 
ATOM   4644  C C     . GLY B  1 157 ? 117.295 110.121 -132.066 1.00 55.74  ? 157  GLY B C     1 
ATOM   4645  O O     . GLY B  1 157 ? 117.266 110.306 -133.283 1.00 55.81  ? 157  GLY B O     1 
ATOM   4646  N N     . ILE B  1 158 ? 116.476 110.745 -131.226 1.00 55.43  ? 158  ILE B N     1 
ATOM   4647  C CA    . ILE B  1 158 ? 115.477 111.691 -131.699 1.00 54.44  ? 158  ILE B CA    1 
ATOM   4648  C C     . ILE B  1 158 ? 116.032 113.098 -131.611 1.00 54.23  ? 158  ILE B C     1 
ATOM   4649  O O     . ILE B  1 158 ? 116.433 113.545 -130.543 1.00 55.21  ? 158  ILE B O     1 
ATOM   4650  C CB    . ILE B  1 158 ? 114.212 111.614 -130.852 1.00 53.50  ? 158  ILE B CB    1 
ATOM   4651  C CG1   . ILE B  1 158 ? 113.646 110.198 -130.903 1.00 53.54  ? 158  ILE B CG1   1 
ATOM   4652  C CG2   . ILE B  1 158 ? 113.196 112.602 -131.366 1.00 53.63  ? 158  ILE B CG2   1 
ATOM   4653  C CD1   . ILE B  1 158 ? 112.478 109.982 -129.984 1.00 52.64  ? 158  ILE B CD1   1 
ATOM   4654  N N     . THR B  1 159 ? 116.050 113.801 -132.735 1.00 54.34  ? 159  THR B N     1 
ATOM   4655  C CA    . THR B  1 159 ? 116.573 115.162 -132.758 1.00 53.45  ? 159  THR B CA    1 
ATOM   4656  C C     . THR B  1 159 ? 115.478 116.224 -132.893 1.00 53.08  ? 159  THR B C     1 
ATOM   4657  O O     . THR B  1 159 ? 114.695 116.229 -133.845 1.00 52.44  ? 159  THR B O     1 
ATOM   4658  C CB    . THR B  1 159 ? 117.611 115.342 -133.897 1.00 53.51  ? 159  THR B CB    1 
ATOM   4659  O OG1   . THR B  1 159 ? 118.670 114.387 -133.732 1.00 52.53  ? 159  THR B OG1   1 
ATOM   4660  C CG2   . THR B  1 159 ? 118.198 116.754 -133.864 1.00 52.85  ? 159  THR B CG2   1 
ATOM   4661  N N     . ILE B  1 160 ? 115.453 117.129 -131.923 1.00 52.48  ? 160  ILE B N     1 
ATOM   4662  C CA    . ILE B  1 160 ? 114.480 118.204 -131.867 1.00 51.85  ? 160  ILE B CA    1 
ATOM   4663  C C     . ILE B  1 160 ? 114.818 119.326 -132.834 1.00 52.08  ? 160  ILE B C     1 
ATOM   4664  O O     . ILE B  1 160 ? 115.854 119.973 -132.696 1.00 52.06  ? 160  ILE B O     1 
ATOM   4665  C CB    . ILE B  1 160 ? 114.416 118.771 -130.439 1.00 51.50  ? 160  ILE B CB    1 
ATOM   4666  C CG1   . ILE B  1 160 ? 113.908 117.678 -129.497 1.00 51.00  ? 160  ILE B CG1   1 
ATOM   4667  C CG2   . ILE B  1 160 ? 113.551 120.023 -130.404 1.00 50.35  ? 160  ILE B CG2   1 
ATOM   4668  C CD1   . ILE B  1 160 ? 114.072 117.985 -128.029 1.00 51.76  ? 160  ILE B CD1   1 
ATOM   4669  N N     . ASP B  1 161 ? 113.945 119.556 -133.811 1.00 51.35  ? 161  ASP B N     1 
ATOM   4670  C CA    . ASP B  1 161 ? 114.177 120.618 -134.776 1.00 51.41  ? 161  ASP B CA    1 
ATOM   4671  C C     . ASP B  1 161 ? 113.290 121.831 -134.482 1.00 51.03  ? 161  ASP B C     1 
ATOM   4672  O O     . ASP B  1 161 ? 113.373 122.847 -135.172 1.00 52.32  ? 161  ASP B O     1 
ATOM   4673  C CB    . ASP B  1 161 ? 113.933 120.118 -136.206 1.00 51.94  ? 161  ASP B CB    1 
ATOM   4674  C CG    . ASP B  1 161 ? 112.493 119.707 -136.452 1.00 55.30  ? 161  ASP B CG    1 
ATOM   4675  O OD1   . ASP B  1 161 ? 111.608 120.039 -135.628 1.00 54.86  ? 161  ASP B OD1   1 
ATOM   4676  O OD2   . ASP B  1 161 ? 112.239 119.057 -137.493 1.00 57.92  ? 161  ASP B OD2   1 
ATOM   4677  N N     . GLU B  1 162 ? 112.442 121.706 -133.462 1.00 48.73  ? 162  GLU B N     1 
ATOM   4678  C CA    . GLU B  1 162 ? 111.527 122.759 -133.009 1.00 46.84  ? 162  GLU B CA    1 
ATOM   4679  C C     . GLU B  1 162 ? 110.527 123.236 -134.041 1.00 46.71  ? 162  GLU B C     1 
ATOM   4680  O O     . GLU B  1 162 ? 109.908 124.296 -133.903 1.00 45.31  ? 162  GLU B O     1 
ATOM   4681  C CB    . GLU B  1 162 ? 112.315 123.941 -132.440 1.00 45.52  ? 162  GLU B CB    1 
ATOM   4682  C CG    . GLU B  1 162 ? 113.158 123.571 -131.221 1.00 43.88  ? 162  GLU B CG    1 
ATOM   4683  C CD    . GLU B  1 162 ? 112.344 123.381 -129.940 1.00 44.35  ? 162  GLU B CD    1 
ATOM   4684  O OE1   . GLU B  1 162 ? 111.101 123.185 -130.011 1.00 42.04  ? 162  GLU B OE1   1 
ATOM   4685  O OE2   . GLU B  1 162 ? 112.970 123.424 -128.855 1.00 41.37  ? 162  GLU B OE2   1 
ATOM   4686  N N     . ASP B  1 163 ? 110.366 122.419 -135.071 1.00 47.42  ? 163  ASP B N     1 
ATOM   4687  C CA    . ASP B  1 163 ? 109.424 122.699 -136.132 1.00 47.96  ? 163  ASP B CA    1 
ATOM   4688  C C     . ASP B  1 163 ? 108.339 121.652 -136.034 1.00 47.03  ? 163  ASP B C     1 
ATOM   4689  O O     . ASP B  1 163 ? 107.195 121.965 -135.702 1.00 45.90  ? 163  ASP B O     1 
ATOM   4690  C CB    . ASP B  1 163 ? 110.104 122.608 -137.506 1.00 50.60  ? 163  ASP B CB    1 
ATOM   4691  C CG    . ASP B  1 163 ? 109.109 122.332 -138.651 1.00 51.86  ? 163  ASP B CG    1 
ATOM   4692  O OD1   . ASP B  1 163 ? 108.081 123.037 -138.755 1.00 50.94  ? 163  ASP B OD1   1 
ATOM   4693  O OD2   . ASP B  1 163 ? 109.362 121.405 -139.451 1.00 54.62  ? 163  ASP B OD2   1 
ATOM   4694  N N     . THR B  1 164 ? 108.716 120.405 -136.303 1.00 45.91  ? 164  THR B N     1 
ATOM   4695  C CA    . THR B  1 164 ? 107.772 119.291 -136.281 1.00 44.90  ? 164  THR B CA    1 
ATOM   4696  C C     . THR B  1 164 ? 108.050 118.356 -135.101 1.00 42.54  ? 164  THR B C     1 
ATOM   4697  O O     . THR B  1 164 ? 107.144 117.720 -134.566 1.00 42.52  ? 164  THR B O     1 
ATOM   4698  C CB    . THR B  1 164 ? 107.837 118.527 -137.627 1.00 45.67  ? 164  THR B CB    1 
ATOM   4699  O OG1   . THR B  1 164 ? 106.964 117.398 -137.582 1.00 48.92  ? 164  THR B OG1   1 
ATOM   4700  C CG2   . THR B  1 164 ? 109.252 118.066 -137.915 1.00 45.10  ? 164  THR B CG2   1 
ATOM   4701  N N     . ILE B  1 165 ? 109.317 118.265 -134.720 1.00 41.10  ? 165  ILE B N     1 
ATOM   4702  C CA    . ILE B  1 165 ? 109.735 117.474 -133.562 1.00 39.97  ? 165  ILE B CA    1 
ATOM   4703  C C     . ILE B  1 165 ? 110.210 118.554 -132.598 1.00 38.92  ? 165  ILE B C     1 
ATOM   4704  O O     . ILE B  1 165 ? 111.324 119.060 -132.710 1.00 38.09  ? 165  ILE B O     1 
ATOM   4705  C CB    . ILE B  1 165 ? 110.902 116.534 -133.879 1.00 38.72  ? 165  ILE B CB    1 
ATOM   4706  C CG1   . ILE B  1 165 ? 110.439 115.445 -134.835 1.00 39.04  ? 165  ILE B CG1   1 
ATOM   4707  C CG2   . ILE B  1 165 ? 111.409 115.886 -132.604 1.00 38.53  ? 165  ILE B CG2   1 
ATOM   4708  C CD1   . ILE B  1 165 ? 111.534 114.509 -135.248 1.00 38.76  ? 165  ILE B CD1   1 
ATOM   4709  N N     . VAL B  1 166 ? 109.345 118.905 -131.657 1.00 38.60  ? 166  VAL B N     1 
ATOM   4710  C CA    . VAL B  1 166 ? 109.625 119.973 -130.711 1.00 37.42  ? 166  VAL B CA    1 
ATOM   4711  C C     . VAL B  1 166 ? 109.858 119.617 -129.246 1.00 37.35  ? 166  VAL B C     1 
ATOM   4712  O O     . VAL B  1 166 ? 109.754 118.469 -128.826 1.00 37.99  ? 166  VAL B O     1 
ATOM   4713  C CB    . VAL B  1 166 ? 108.488 120.983 -130.744 1.00 36.79  ? 166  VAL B CB    1 
ATOM   4714  C CG1   . VAL B  1 166 ? 108.261 121.446 -132.172 1.00 35.93  ? 166  VAL B CG1   1 
ATOM   4715  C CG2   . VAL B  1 166 ? 107.228 120.357 -130.160 1.00 33.70  ? 166  VAL B CG2   1 
ATOM   4716  N N     . SER B  1 167 ? 110.195 120.645 -128.481 1.00 37.41  ? 167  SER B N     1 
ATOM   4717  C CA    . SER B  1 167 ? 110.402 120.528 -127.051 1.00 35.56  ? 167  SER B CA    1 
ATOM   4718  C C     . SER B  1 167 ? 109.316 121.464 -126.570 1.00 35.38  ? 167  SER B C     1 
ATOM   4719  O O     . SER B  1 167 ? 108.520 121.954 -127.371 1.00 34.84  ? 167  SER B O     1 
ATOM   4720  C CB    . SER B  1 167 ? 111.760 121.087 -126.632 1.00 34.21  ? 167  SER B CB    1 
ATOM   4721  O OG    . SER B  1 167 ? 111.773 122.499 -126.749 1.00 32.49  ? 167  SER B OG    1 
ATOM   4722  N N     . SER B  1 168 ? 109.291 121.728 -125.272 1.00 35.67  ? 168  SER B N     1 
ATOM   4723  C CA    . SER B  1 168 ? 108.294 122.624 -124.714 1.00 34.60  ? 168  SER B CA    1 
ATOM   4724  C C     . SER B  1 168 ? 108.362 124.017 -125.353 1.00 33.49  ? 168  SER B C     1 
ATOM   4725  O O     . SER B  1 168 ? 107.343 124.700 -125.459 1.00 31.36  ? 168  SER B O     1 
ATOM   4726  C CB    . SER B  1 168 ? 108.499 122.712 -123.209 1.00 34.04  ? 168  SER B CB    1 
ATOM   4727  O OG    . SER B  1 168 ? 109.871 122.697 -122.905 1.00 33.12  ? 168  SER B OG    1 
ATOM   4728  N N     . THR B  1 169 ? 109.560 124.421 -125.782 1.00 33.66  ? 169  THR B N     1 
ATOM   4729  C CA    . THR B  1 169 ? 109.758 125.732 -126.403 1.00 35.95  ? 169  THR B CA    1 
ATOM   4730  C C     . THR B  1 169 ? 109.044 125.840 -127.753 1.00 37.24  ? 169  THR B C     1 
ATOM   4731  O O     . THR B  1 169 ? 108.365 126.838 -128.035 1.00 35.65  ? 169  THR B O     1 
ATOM   4732  C CB    . THR B  1 169 ? 111.249 126.046 -126.628 1.00 36.56  ? 169  THR B CB    1 
ATOM   4733  O OG1   . THR B  1 169 ? 111.924 126.118 -125.367 1.00 37.02  ? 169  THR B OG1   1 
ATOM   4734  C CG2   . THR B  1 169 ? 111.394 127.387 -127.361 1.00 35.66  ? 169  THR B CG2   1 
ATOM   4735  N N     . GLY B  1 170 ? 109.228 124.821 -128.592 1.00 38.14  ? 170  GLY B N     1 
ATOM   4736  C CA    . GLY B  1 170 ? 108.568 124.806 -129.880 1.00 39.26  ? 170  GLY B CA    1 
ATOM   4737  C C     . GLY B  1 170 ? 107.078 124.548 -129.692 1.00 40.10  ? 170  GLY B C     1 
ATOM   4738  O O     . GLY B  1 170 ? 106.255 125.023 -130.470 1.00 41.53  ? 170  GLY B O     1 
ATOM   4739  N N     . ALA B  1 171 ? 106.719 123.805 -128.648 1.00 39.64  ? 171  ALA B N     1 
ATOM   4740  C CA    . ALA B  1 171 ? 105.318 123.479 -128.406 1.00 38.62  ? 171  ALA B CA    1 
ATOM   4741  C C     . ALA B  1 171 ? 104.529 124.722 -128.007 1.00 39.17  ? 171  ALA B C     1 
ATOM   4742  O O     . ALA B  1 171 ? 103.329 124.832 -128.305 1.00 38.44  ? 171  ALA B O     1 
ATOM   4743  C CB    . ALA B  1 171 ? 105.208 122.386 -127.331 1.00 36.04  ? 171  ALA B CB    1 
ATOM   4744  N N     . LEU B  1 172 ? 105.216 125.664 -127.357 1.00 39.28  ? 172  LEU B N     1 
ATOM   4745  C CA    . LEU B  1 172 ? 104.599 126.916 -126.917 1.00 39.94  ? 172  LEU B CA    1 
ATOM   4746  C C     . LEU B  1 172 ? 104.382 127.883 -128.063 1.00 40.66  ? 172  LEU B C     1 
ATOM   4747  O O     . LEU B  1 172 ? 103.714 128.909 -127.897 1.00 39.77  ? 172  LEU B O     1 
ATOM   4748  C CB    . LEU B  1 172 ? 105.459 127.584 -125.842 1.00 40.14  ? 172  LEU B CB    1 
ATOM   4749  C CG    . LEU B  1 172 ? 105.334 126.918 -124.462 1.00 41.41  ? 172  LEU B CG    1 
ATOM   4750  C CD1   . LEU B  1 172 ? 106.367 127.473 -123.483 1.00 42.31  ? 172  LEU B CD1   1 
ATOM   4751  C CD2   . LEU B  1 172 ? 103.912 127.130 -123.939 1.00 39.42  ? 172  LEU B CD2   1 
ATOM   4752  N N     . SER B  1 173 ? 104.935 127.541 -129.230 1.00 42.16  ? 173  SER B N     1 
ATOM   4753  C CA    . SER B  1 173 ? 104.818 128.381 -130.418 1.00 42.96  ? 173  SER B CA    1 
ATOM   4754  C C     . SER B  1 173 ? 104.527 127.618 -131.717 1.00 44.51  ? 173  SER B C     1 
ATOM   4755  O O     . SER B  1 173 ? 105.067 127.923 -132.780 1.00 45.29  ? 173  SER B O     1 
ATOM   4756  C CB    . SER B  1 173 ? 106.082 129.229 -130.571 1.00 42.10  ? 173  SER B CB    1 
ATOM   4757  O OG    . SER B  1 173 ? 106.176 130.206 -129.536 1.00 42.51  ? 173  SER B OG    1 
ATOM   4758  N N     . LEU B  1 174 ? 103.677 126.605 -131.632 1.00 46.16  ? 174  LEU B N     1 
ATOM   4759  C CA    . LEU B  1 174 ? 103.311 125.867 -132.838 1.00 47.57  ? 174  LEU B CA    1 
ATOM   4760  C C     . LEU B  1 174 ? 102.540 126.838 -133.737 1.00 47.86  ? 174  LEU B C     1 
ATOM   4761  O O     . LEU B  1 174 ? 101.629 127.532 -133.260 1.00 46.20  ? 174  LEU B O     1 
ATOM   4762  C CB    . LEU B  1 174 ? 102.416 124.674 -132.489 1.00 46.63  ? 174  LEU B CB    1 
ATOM   4763  C CG    . LEU B  1 174 ? 103.134 123.525 -131.801 1.00 46.95  ? 174  LEU B CG    1 
ATOM   4764  C CD1   . LEU B  1 174 ? 102.137 122.441 -131.408 1.00 46.56  ? 174  LEU B CD1   1 
ATOM   4765  C CD2   . LEU B  1 174 ? 104.208 122.997 -132.749 1.00 46.76  ? 174  LEU B CD2   1 
ATOM   4766  N N     . LYS B  1 175 ? 102.896 126.881 -135.025 1.00 48.25  ? 175  LYS B N     1 
ATOM   4767  C CA    . LYS B  1 175 ? 102.237 127.785 -135.982 1.00 48.66  ? 175  LYS B CA    1 
ATOM   4768  C C     . LYS B  1 175 ? 100.808 127.361 -136.366 1.00 46.61  ? 175  LYS B C     1 
ATOM   4769  O O     . LYS B  1 175 ? 99.974  128.192 -136.699 1.00 46.05  ? 175  LYS B O     1 
ATOM   4770  C CB    . LYS B  1 175 ? 103.097 127.928 -137.255 1.00 50.28  ? 175  LYS B CB    1 
ATOM   4771  C CG    . LYS B  1 175 ? 104.543 128.375 -136.997 1.00 54.36  ? 175  LYS B CG    1 
ATOM   4772  C CD    . LYS B  1 175 ? 104.599 129.762 -136.346 1.00 57.89  ? 175  LYS B CD    1 
ATOM   4773  C CE    . LYS B  1 175 ? 105.935 130.000 -135.615 1.00 60.37  ? 175  LYS B CE    1 
ATOM   4774  N NZ    . LYS B  1 175 ? 105.918 131.237 -134.762 1.00 60.40  ? 175  LYS B NZ    1 
ATOM   4775  N N     . LYS B  1 176 ? 100.521 126.072 -136.300 1.00 45.38  ? 176  LYS B N     1 
ATOM   4776  C CA    . LYS B  1 176 ? 99.206  125.575 -136.663 1.00 44.85  ? 176  LYS B CA    1 
ATOM   4777  C C     . LYS B  1 176 ? 98.837  124.476 -135.671 1.00 43.31  ? 176  LYS B C     1 
ATOM   4778  O O     . LYS B  1 176 ? 99.708  123.737 -135.217 1.00 41.66  ? 176  LYS B O     1 
ATOM   4779  C CB    . LYS B  1 176 ? 99.261  125.020 -138.095 1.00 47.49  ? 176  LYS B CB    1 
ATOM   4780  C CG    . LYS B  1 176 ? 97.934  124.533 -138.673 1.00 52.34  ? 176  LYS B CG    1 
ATOM   4781  C CD    . LYS B  1 176 ? 98.030  124.143 -140.187 1.00 56.33  ? 176  LYS B CD    1 
ATOM   4782  C CE    . LYS B  1 176 ? 98.713  122.779 -140.481 1.00 57.18  ? 176  LYS B CE    1 
ATOM   4783  N NZ    . LYS B  1 176 ? 100.187 122.793 -140.244 1.00 57.06  ? 176  LYS B NZ    1 
ATOM   4784  N N     . VAL B  1 177 ? 97.559  124.374 -135.319 1.00 41.52  ? 177  VAL B N     1 
ATOM   4785  C CA    . VAL B  1 177 ? 97.136  123.330 -134.398 1.00 41.33  ? 177  VAL B CA    1 
ATOM   4786  C C     . VAL B  1 177 ? 97.382  121.987 -135.085 1.00 41.25  ? 177  VAL B C     1 
ATOM   4787  O O     . VAL B  1 177 ? 96.906  121.768 -136.195 1.00 41.47  ? 177  VAL B O     1 
ATOM   4788  C CB    . VAL B  1 177 ? 95.628  123.426 -134.069 1.00 40.10  ? 177  VAL B CB    1 
ATOM   4789  C CG1   . VAL B  1 177 ? 95.246  122.314 -133.139 1.00 39.14  ? 177  VAL B CG1   1 
ATOM   4790  C CG2   . VAL B  1 177 ? 95.300  124.756 -133.453 1.00 38.27  ? 177  VAL B CG2   1 
ATOM   4791  N N     . PRO B  1 178 ? 98.128  121.075 -134.438 1.00 42.08  ? 178  PRO B N     1 
ATOM   4792  C CA    . PRO B  1 178 ? 98.383  119.775 -135.073 1.00 42.05  ? 178  PRO B CA    1 
ATOM   4793  C C     . PRO B  1 178 ? 97.099  118.943 -135.150 1.00 42.67  ? 178  PRO B C     1 
ATOM   4794  O O     . PRO B  1 178 ? 96.176  119.131 -134.361 1.00 42.06  ? 178  PRO B O     1 
ATOM   4795  C CB    . PRO B  1 178 ? 99.417  119.112 -134.153 1.00 41.90  ? 178  PRO B CB    1 
ATOM   4796  C CG    . PRO B  1 178 ? 99.940  120.224 -133.269 1.00 43.09  ? 178  PRO B CG    1 
ATOM   4797  C CD    . PRO B  1 178 ? 98.756  121.153 -133.106 1.00 41.90  ? 178  PRO B CD    1 
ATOM   4798  N N     . GLU B  1 179 ? 97.036  118.024 -136.104 1.00 43.39  ? 179  GLU B N     1 
ATOM   4799  C CA    . GLU B  1 179 ? 95.862  117.186 -136.220 1.00 43.73  ? 179  GLU B CA    1 
ATOM   4800  C C     . GLU B  1 179 ? 96.021  116.098 -135.173 1.00 42.70  ? 179  GLU B C     1 
ATOM   4801  O O     . GLU B  1 179 ? 95.123  115.853 -134.372 1.00 41.99  ? 179  GLU B O     1 
ATOM   4802  C CB    . GLU B  1 179 ? 95.770  116.560 -137.612 1.00 46.09  ? 179  GLU B CB    1 
ATOM   4803  C CG    . GLU B  1 179 ? 94.418  115.923 -137.890 1.00 50.27  ? 179  GLU B CG    1 
ATOM   4804  C CD    . GLU B  1 179 ? 94.390  115.143 -139.188 1.00 54.07  ? 179  GLU B CD    1 
ATOM   4805  O OE1   . GLU B  1 179 ? 94.759  115.733 -140.230 1.00 56.41  ? 179  GLU B OE1   1 
ATOM   4806  O OE2   . GLU B  1 179 ? 93.997  113.949 -139.168 1.00 55.04  ? 179  GLU B OE2   1 
ATOM   4807  N N     . LYS B  1 180 ? 97.168  115.439 -135.196 1.00 41.11  ? 180  LYS B N     1 
ATOM   4808  C CA    . LYS B  1 180 ? 97.450  114.395 -134.233 1.00 41.81  ? 180  LYS B CA    1 
ATOM   4809  C C     . LYS B  1 180 ? 98.798  114.737 -133.614 1.00 41.18  ? 180  LYS B C     1 
ATOM   4810  O O     . LYS B  1 180 ? 99.730  115.120 -134.321 1.00 40.52  ? 180  LYS B O     1 
ATOM   4811  C CB    . LYS B  1 180 ? 97.475  113.022 -134.905 1.00 41.29  ? 180  LYS B CB    1 
ATOM   4812  C CG    . LYS B  1 180 ? 97.891  111.919 -133.968 1.00 44.99  ? 180  LYS B CG    1 
ATOM   4813  C CD    . LYS B  1 180 ? 97.464  110.552 -134.447 1.00 47.16  ? 180  LYS B CD    1 
ATOM   4814  C CE    . LYS B  1 180 ? 97.777  109.497 -133.389 1.00 49.85  ? 180  LYS B CE    1 
ATOM   4815  N NZ    . LYS B  1 180 ? 97.469  108.120 -133.883 1.00 51.98  ? 180  LYS B NZ    1 
ATOM   4816  N N     . MET B  1 181 ? 98.885  114.628 -132.290 1.00 41.20  ? 181  MET B N     1 
ATOM   4817  C CA    . MET B  1 181 ? 100.116 114.960 -131.562 1.00 40.53  ? 181  MET B CA    1 
ATOM   4818  C C     . MET B  1 181 ? 100.466 113.928 -130.509 1.00 38.97  ? 181  MET B C     1 
ATOM   4819  O O     . MET B  1 181 ? 99.611  113.490 -129.741 1.00 38.83  ? 181  MET B O     1 
ATOM   4820  C CB    . MET B  1 181 ? 99.988  116.334 -130.879 1.00 41.81  ? 181  MET B CB    1 
ATOM   4821  C CG    . MET B  1 181 ? 101.269 116.816 -130.158 1.00 44.56  ? 181  MET B CG    1 
ATOM   4822  S SD    . MET B  1 181 ? 101.148 118.424 -129.281 1.00 43.54  ? 181  MET B SD    1 
ATOM   4823  C CE    . MET B  1 181 ? 101.425 117.939 -127.604 1.00 45.89  ? 181  MET B CE    1 
ATOM   4824  N N     . VAL B  1 182 ? 101.743 113.559 -130.481 1.00 37.96  ? 182  VAL B N     1 
ATOM   4825  C CA    . VAL B  1 182 ? 102.265 112.596 -129.523 1.00 36.50  ? 182  VAL B CA    1 
ATOM   4826  C C     . VAL B  1 182 ? 103.259 113.272 -128.567 1.00 35.88  ? 182  VAL B C     1 
ATOM   4827  O O     . VAL B  1 182 ? 104.182 113.974 -129.005 1.00 34.88  ? 182  VAL B O     1 
ATOM   4828  C CB    . VAL B  1 182 ? 102.965 111.418 -130.248 1.00 37.40  ? 182  VAL B CB    1 
ATOM   4829  C CG1   . VAL B  1 182 ? 103.650 110.502 -129.242 1.00 37.01  ? 182  VAL B CG1   1 
ATOM   4830  C CG2   . VAL B  1 182 ? 101.943 110.625 -131.042 1.00 36.31  ? 182  VAL B CG2   1 
ATOM   4831  N N     . VAL B  1 183 ? 103.038 113.078 -127.261 1.00 35.51  ? 183  VAL B N     1 
ATOM   4832  C CA    . VAL B  1 183 ? 103.903 113.621 -126.207 1.00 33.56  ? 183  VAL B CA    1 
ATOM   4833  C C     . VAL B  1 183 ? 104.656 112.496 -125.537 1.00 32.79  ? 183  VAL B C     1 
ATOM   4834  O O     . VAL B  1 183 ? 104.049 111.539 -125.080 1.00 31.24  ? 183  VAL B O     1 
ATOM   4835  C CB    . VAL B  1 183 ? 103.123 114.325 -125.076 1.00 33.27  ? 183  VAL B CB    1 
ATOM   4836  C CG1   . VAL B  1 183 ? 104.109 114.990 -124.117 1.00 31.83  ? 183  VAL B CG1   1 
ATOM   4837  C CG2   . VAL B  1 183 ? 102.160 115.349 -125.646 1.00 32.47  ? 183  VAL B CG2   1 
ATOM   4838  N N     . ILE B  1 184 ? 105.978 112.608 -125.495 1.00 33.52  ? 184  ILE B N     1 
ATOM   4839  C CA    . ILE B  1 184 ? 106.801 111.604 -124.825 1.00 34.51  ? 184  ILE B CA    1 
ATOM   4840  C C     . ILE B  1 184 ? 106.962 112.155 -123.414 1.00 35.03  ? 184  ILE B C     1 
ATOM   4841  O O     . ILE B  1 184 ? 107.524 113.236 -123.247 1.00 35.87  ? 184  ILE B O     1 
ATOM   4842  C CB    . ILE B  1 184 ? 108.216 111.476 -125.441 1.00 34.02  ? 184  ILE B CB    1 
ATOM   4843  C CG1   . ILE B  1 184 ? 108.116 111.202 -126.937 1.00 36.60  ? 184  ILE B CG1   1 
ATOM   4844  C CG2   . ILE B  1 184 ? 108.978 110.336 -124.781 1.00 33.32  ? 184  ILE B CG2   1 
ATOM   4845  C CD1   . ILE B  1 184 ? 109.467 111.078 -127.632 1.00 34.48  ? 184  ILE B CD1   1 
ATOM   4846  N N     . GLY B  1 185 ? 106.453 111.426 -122.417 1.00 35.60  ? 185  GLY B N     1 
ATOM   4847  C CA    . GLY B  1 185 ? 106.538 111.865 -121.027 1.00 36.76  ? 185  GLY B CA    1 
ATOM   4848  C C     . GLY B  1 185 ? 105.290 112.575 -120.501 1.00 37.14  ? 185  GLY B C     1 
ATOM   4849  O O     . GLY B  1 185 ? 104.900 113.622 -121.027 1.00 37.65  ? 185  GLY B O     1 
ATOM   4850  N N     . ALA B  1 186 ? 104.686 112.029 -119.445 1.00 35.74  ? 186  ALA B N     1 
ATOM   4851  C CA    . ALA B  1 186 ? 103.478 112.604 -118.867 1.00 34.45  ? 186  ALA B CA    1 
ATOM   4852  C C     . ALA B  1 186 ? 103.719 113.283 -117.530 1.00 34.59  ? 186  ALA B C     1 
ATOM   4853  O O     . ALA B  1 186 ? 102.966 113.073 -116.571 1.00 34.10  ? 186  ALA B O     1 
ATOM   4854  C CB    . ALA B  1 186 ? 102.414 111.535 -118.715 1.00 31.73  ? 186  ALA B CB    1 
ATOM   4855  N N     . GLY B  1 187 ? 104.781 114.080 -117.468 1.00 33.77  ? 187  GLY B N     1 
ATOM   4856  C CA    . GLY B  1 187 ? 105.072 114.823 -116.255 1.00 32.56  ? 187  GLY B CA    1 
ATOM   4857  C C     . GLY B  1 187 ? 104.224 116.078 -116.367 1.00 31.88  ? 187  GLY B C     1 
ATOM   4858  O O     . GLY B  1 187 ? 103.497 116.239 -117.352 1.00 31.72  ? 187  GLY B O     1 
ATOM   4859  N N     . VAL B  1 188 ? 104.312 116.966 -115.386 1.00 30.90  ? 188  VAL B N     1 
ATOM   4860  C CA    . VAL B  1 188 ? 103.528 118.200 -115.382 1.00 30.59  ? 188  VAL B CA    1 
ATOM   4861  C C     . VAL B  1 188 ? 103.582 119.015 -116.683 1.00 31.04  ? 188  VAL B C     1 
ATOM   4862  O O     . VAL B  1 188 ? 102.559 119.439 -117.213 1.00 29.54  ? 188  VAL B O     1 
ATOM   4863  C CB    . VAL B  1 188 ? 103.953 119.098 -114.156 1.00 30.94  ? 188  VAL B CB    1 
ATOM   4864  C CG1   . VAL B  1 188 ? 103.327 120.494 -114.230 1.00 27.44  ? 188  VAL B CG1   1 
ATOM   4865  C CG2   . VAL B  1 188 ? 103.514 118.401 -112.854 1.00 30.86  ? 188  VAL B CG2   1 
ATOM   4866  N N     . ILE B  1 189 ? 104.779 119.221 -117.207 1.00 31.86  ? 189  ILE B N     1 
ATOM   4867  C CA    . ILE B  1 189 ? 104.938 120.019 -118.408 1.00 31.28  ? 189  ILE B CA    1 
ATOM   4868  C C     . ILE B  1 189 ? 104.251 119.432 -119.642 1.00 32.83  ? 189  ILE B C     1 
ATOM   4869  O O     . ILE B  1 189 ? 103.592 120.152 -120.409 1.00 33.35  ? 189  ILE B O     1 
ATOM   4870  C CB    . ILE B  1 189 ? 106.430 120.230 -118.684 1.00 29.85  ? 189  ILE B CB    1 
ATOM   4871  C CG1   . ILE B  1 189 ? 107.042 120.994 -117.507 1.00 30.01  ? 189  ILE B CG1   1 
ATOM   4872  C CG2   . ILE B  1 189 ? 106.632 120.955 -120.013 1.00 28.47  ? 189  ILE B CG2   1 
ATOM   4873  C CD1   . ILE B  1 189 ? 108.531 121.275 -117.643 1.00 29.83  ? 189  ILE B CD1   1 
ATOM   4874  N N     . GLY B  1 190 ? 104.398 118.127 -119.827 1.00 31.95  ? 190  GLY B N     1 
ATOM   4875  C CA    . GLY B  1 190 ? 103.800 117.484 -120.977 1.00 32.34  ? 190  GLY B CA    1 
ATOM   4876  C C     . GLY B  1 190 ? 102.292 117.377 -120.888 1.00 32.87  ? 190  GLY B C     1 
ATOM   4877  O O     . GLY B  1 190 ? 101.605 117.400 -121.914 1.00 32.39  ? 190  GLY B O     1 
ATOM   4878  N N     . VAL B  1 191 ? 101.776 117.261 -119.666 1.00 31.71  ? 191  VAL B N     1 
ATOM   4879  C CA    . VAL B  1 191 ? 100.342 117.149 -119.478 1.00 30.51  ? 191  VAL B CA    1 
ATOM   4880  C C     . VAL B  1 191 ? 99.724  118.499 -119.741 1.00 30.77  ? 191  VAL B C     1 
ATOM   4881  O O     . VAL B  1 191 ? 98.693  118.602 -120.399 1.00 30.71  ? 191  VAL B O     1 
ATOM   4882  C CB    . VAL B  1 191 ? 99.991  116.689 -118.058 1.00 31.30  ? 191  VAL B CB    1 
ATOM   4883  C CG1   . VAL B  1 191 ? 98.479  116.629 -117.901 1.00 30.21  ? 191  VAL B CG1   1 
ATOM   4884  C CG2   . VAL B  1 191 ? 100.598 115.313 -117.783 1.00 29.31  ? 191  VAL B CG2   1 
ATOM   4885  N N     . GLU B  1 192 ? 100.366 119.541 -119.231 1.00 30.60  ? 192  GLU B N     1 
ATOM   4886  C CA    . GLU B  1 192 ? 99.873  120.884 -119.460 1.00 30.73  ? 192  GLU B CA    1 
ATOM   4887  C C     . GLU B  1 192 ? 99.898  121.195 -120.961 1.00 32.24  ? 192  GLU B C     1 
ATOM   4888  O O     . GLU B  1 192 ? 98.881  121.621 -121.517 1.00 32.51  ? 192  GLU B O     1 
ATOM   4889  C CB    . GLU B  1 192 ? 100.706 121.931 -118.690 1.00 29.56  ? 192  GLU B CB    1 
ATOM   4890  C CG    . GLU B  1 192 ? 100.539 121.900 -117.162 1.00 30.66  ? 192  GLU B CG    1 
ATOM   4891  C CD    . GLU B  1 192 ? 101.290 123.024 -116.441 1.00 31.64  ? 192  GLU B CD    1 
ATOM   4892  O OE1   . GLU B  1 192 ? 102.239 123.572 -117.038 1.00 33.40  ? 192  GLU B OE1   1 
ATOM   4893  O OE2   . GLU B  1 192 ? 100.941 123.349 -115.280 1.00 30.63  ? 192  GLU B OE2   1 
ATOM   4894  N N     . LEU B  1 193 ? 101.042 120.969 -121.622 1.00 33.51  ? 193  LEU B N     1 
ATOM   4895  C CA    . LEU B  1 193 ? 101.165 121.270 -123.063 1.00 34.46  ? 193  LEU B CA    1 
ATOM   4896  C C     . LEU B  1 193 ? 100.228 120.418 -123.902 1.00 35.55  ? 193  LEU B C     1 
ATOM   4897  O O     . LEU B  1 193 ? 99.641  120.902 -124.881 1.00 36.22  ? 193  LEU B O     1 
ATOM   4898  C CB    . LEU B  1 193 ? 102.620 121.110 -123.541 1.00 33.52  ? 193  LEU B CB    1 
ATOM   4899  C CG    . LEU B  1 193 ? 103.554 122.185 -122.944 1.00 34.87  ? 193  LEU B CG    1 
ATOM   4900  C CD1   . LEU B  1 193 ? 104.997 121.916 -123.368 1.00 35.17  ? 193  LEU B CD1   1 
ATOM   4901  C CD2   . LEU B  1 193 ? 103.109 123.591 -123.377 1.00 32.55  ? 193  LEU B CD2   1 
ATOM   4902  N N     . GLY B  1 194 ? 100.075 119.155 -123.499 1.00 36.07  ? 194  GLY B N     1 
ATOM   4903  C CA    . GLY B  1 194 ? 99.176  118.247 -124.188 1.00 34.49  ? 194  GLY B CA    1 
ATOM   4904  C C     . GLY B  1 194 ? 97.731  118.712 -124.059 1.00 34.25  ? 194  GLY B C     1 
ATOM   4905  O O     . GLY B  1 194 ? 96.972  118.700 -125.025 1.00 36.24  ? 194  GLY B O     1 
ATOM   4906  N N     . SER B  1 195 ? 97.339  119.156 -122.875 1.00 32.62  ? 195  SER B N     1 
ATOM   4907  C CA    . SER B  1 195 ? 95.970  119.596 -122.688 1.00 31.59  ? 195  SER B CA    1 
ATOM   4908  C C     . SER B  1 195 ? 95.636  120.865 -123.462 1.00 31.44  ? 195  SER B C     1 
ATOM   4909  O O     . SER B  1 195 ? 94.507  121.044 -123.922 1.00 30.04  ? 195  SER B O     1 
ATOM   4910  C CB    . SER B  1 195 ? 95.694  119.803 -121.204 1.00 30.76  ? 195  SER B CB    1 
ATOM   4911  O OG    . SER B  1 195 ? 94.318  120.020 -120.973 1.00 32.71  ? 195  SER B OG    1 
ATOM   4912  N N     . VAL B  1 196 ? 96.611  121.760 -123.581 1.00 31.82  ? 196  VAL B N     1 
ATOM   4913  C CA    . VAL B  1 196 ? 96.431  123.009 -124.321 1.00 31.87  ? 196  VAL B CA    1 
ATOM   4914  C C     . VAL B  1 196 ? 96.072  122.696 -125.801 1.00 33.03  ? 196  VAL B C     1 
ATOM   4915  O O     . VAL B  1 196 ? 95.072  123.179 -126.353 1.00 32.08  ? 196  VAL B O     1 
ATOM   4916  C CB    . VAL B  1 196 ? 97.740  123.867 -124.241 1.00 31.09  ? 196  VAL B CB    1 
ATOM   4917  C CG1   . VAL B  1 196 ? 97.756  124.942 -125.348 1.00 31.14  ? 196  VAL B CG1   1 
ATOM   4918  C CG2   . VAL B  1 196 ? 97.842  124.529 -122.853 1.00 27.78  ? 196  VAL B CG2   1 
ATOM   4919  N N     . TRP B  1 197 ? 96.877  121.858 -126.437 1.00 33.83  ? 197  TRP B N     1 
ATOM   4920  C CA    . TRP B  1 197 ? 96.608  121.518 -127.821 1.00 34.31  ? 197  TRP B CA    1 
ATOM   4921  C C     . TRP B  1 197 ? 95.381  120.624 -127.982 1.00 33.50  ? 197  TRP B C     1 
ATOM   4922  O O     . TRP B  1 197 ? 94.691  120.701 -128.991 1.00 34.20  ? 197  TRP B O     1 
ATOM   4923  C CB    . TRP B  1 197 ? 97.875  120.920 -128.457 1.00 33.44  ? 197  TRP B CB    1 
ATOM   4924  C CG    . TRP B  1 197 ? 98.939  121.981 -128.564 1.00 33.82  ? 197  TRP B CG    1 
ATOM   4925  C CD1   . TRP B  1 197 ? 100.084 122.089 -127.826 1.00 33.64  ? 197  TRP B CD1   1 
ATOM   4926  C CD2   . TRP B  1 197 ? 98.882  123.159 -129.387 1.00 34.93  ? 197  TRP B CD2   1 
ATOM   4927  N NE1   . TRP B  1 197 ? 100.743 123.265 -128.131 1.00 32.75  ? 197  TRP B NE1   1 
ATOM   4928  C CE2   . TRP B  1 197 ? 100.026 123.939 -129.085 1.00 34.82  ? 197  TRP B CE2   1 
ATOM   4929  C CE3   . TRP B  1 197 ? 97.969  123.633 -130.354 1.00 33.99  ? 197  TRP B CE3   1 
ATOM   4930  C CZ2   . TRP B  1 197 ? 100.283 125.170 -129.715 1.00 34.95  ? 197  TRP B CZ2   1 
ATOM   4931  C CZ3   . TRP B  1 197 ? 98.226  124.851 -130.976 1.00 34.27  ? 197  TRP B CZ3   1 
ATOM   4932  C CH2   . TRP B  1 197 ? 99.376  125.606 -130.653 1.00 33.55  ? 197  TRP B CH2   1 
ATOM   4933  N N     . GLN B  1 198 ? 95.099  119.793 -126.986 1.00 32.41  ? 198  GLN B N     1 
ATOM   4934  C CA    . GLN B  1 198 ? 93.927  118.941 -127.061 1.00 33.68  ? 198  GLN B CA    1 
ATOM   4935  C C     . GLN B  1 198 ? 92.742  119.886 -127.160 1.00 34.89  ? 198  GLN B C     1 
ATOM   4936  O O     . GLN B  1 198 ? 91.959  119.795 -128.086 1.00 37.40  ? 198  GLN B O     1 
ATOM   4937  C CB    . GLN B  1 198 ? 93.814  118.040 -125.815 1.00 34.11  ? 198  GLN B CB    1 
ATOM   4938  C CG    . GLN B  1 198 ? 92.695  116.962 -125.846 1.00 32.35  ? 198  GLN B CG    1 
ATOM   4939  C CD    . GLN B  1 198 ? 91.297  117.514 -125.540 1.00 34.11  ? 198  GLN B CD    1 
ATOM   4940  O OE1   . GLN B  1 198 ? 91.124  118.325 -124.621 1.00 31.96  ? 198  GLN B OE1   1 
ATOM   4941  N NE2   . GLN B  1 198 ? 90.291  117.057 -126.293 1.00 31.72  ? 198  GLN B NE2   1 
ATOM   4942  N N     . ARG B  1 199 ? 92.626  120.811 -126.216 1.00 35.92  ? 199  ARG B N     1 
ATOM   4943  C CA    . ARG B  1 199 ? 91.548  121.794 -126.210 1.00 37.46  ? 199  ARG B CA    1 
ATOM   4944  C C     . ARG B  1 199 ? 91.345  122.533 -127.526 1.00 38.38  ? 199  ARG B C     1 
ATOM   4945  O O     . ARG B  1 199 ? 90.209  122.830 -127.919 1.00 38.76  ? 199  ARG B O     1 
ATOM   4946  C CB    . ARG B  1 199 ? 91.813  122.846 -125.148 1.00 38.54  ? 199  ARG B CB    1 
ATOM   4947  C CG    . ARG B  1 199 ? 91.665  122.364 -123.735 1.00 40.51  ? 199  ARG B CG    1 
ATOM   4948  C CD    . ARG B  1 199 ? 92.243  123.396 -122.808 1.00 42.12  ? 199  ARG B CD    1 
ATOM   4949  N NE    . ARG B  1 199 ? 92.259  122.938 -121.426 1.00 42.91  ? 199  ARG B NE    1 
ATOM   4950  C CZ    . ARG B  1 199 ? 92.894  123.565 -120.445 1.00 42.46  ? 199  ARG B CZ    1 
ATOM   4951  N NH1   . ARG B  1 199 ? 93.569  124.679 -120.699 1.00 40.46  ? 199  ARG B NH1   1 
ATOM   4952  N NH2   . ARG B  1 199 ? 92.848  123.075 -119.213 1.00 43.10  ? 199  ARG B NH2   1 
ATOM   4953  N N     . LEU B  1 200 ? 92.453  122.850 -128.184 1.00 37.70  ? 200  LEU B N     1 
ATOM   4954  C CA    . LEU B  1 200 ? 92.408  123.577 -129.434 1.00 37.90  ? 200  LEU B CA    1 
ATOM   4955  C C     . LEU B  1 200 ? 92.067  122.781 -130.689 1.00 39.58  ? 200  LEU B C     1 
ATOM   4956  O O     . LEU B  1 200 ? 91.811  123.376 -131.736 1.00 39.85  ? 200  LEU B O     1 
ATOM   4957  C CB    . LEU B  1 200 ? 93.720  124.320 -129.639 1.00 36.87  ? 200  LEU B CB    1 
ATOM   4958  C CG    . LEU B  1 200 ? 93.997  125.364 -128.553 1.00 35.18  ? 200  LEU B CG    1 
ATOM   4959  C CD1   . LEU B  1 200 ? 95.297  126.070 -128.859 1.00 32.81  ? 200  LEU B CD1   1 
ATOM   4960  C CD2   . LEU B  1 200 ? 92.866  126.359 -128.494 1.00 34.55  ? 200  LEU B CD2   1 
ATOM   4961  N N     . GLY B  1 201 ? 92.062  121.452 -130.619 1.00 40.47  ? 201  GLY B N     1 
ATOM   4962  C CA    . GLY B  1 201 ? 91.694  120.697 -131.809 1.00 40.55  ? 201  GLY B CA    1 
ATOM   4963  C C     . GLY B  1 201 ? 92.451  119.418 -132.106 1.00 41.49  ? 201  GLY B C     1 
ATOM   4964  O O     . GLY B  1 201 ? 91.945  118.544 -132.824 1.00 42.76  ? 201  GLY B O     1 
ATOM   4965  N N     . ALA B  1 202 ? 93.653  119.303 -131.551 1.00 39.72  ? 202  ALA B N     1 
ATOM   4966  C CA    . ALA B  1 202 ? 94.501  118.143 -131.767 1.00 38.33  ? 202  ALA B CA    1 
ATOM   4967  C C     . ALA B  1 202 ? 94.081  116.855 -131.057 1.00 38.14  ? 202  ALA B C     1 
ATOM   4968  O O     . ALA B  1 202 ? 93.444  116.863 -129.997 1.00 37.14  ? 202  ALA B O     1 
ATOM   4969  C CB    . ALA B  1 202 ? 95.947  118.489 -131.385 1.00 37.28  ? 202  ALA B CB    1 
ATOM   4970  N N     . ASP B  1 203 ? 94.456  115.748 -131.688 1.00 37.70  ? 203  ASP B N     1 
ATOM   4971  C CA    . ASP B  1 203 ? 94.218  114.417 -131.183 1.00 37.48  ? 203  ASP B CA    1 
ATOM   4972  C C     . ASP B  1 203 ? 95.513  114.187 -130.427 1.00 36.56  ? 203  ASP B C     1 
ATOM   4973  O O     . ASP B  1 203 ? 96.590  114.046 -131.016 1.00 35.98  ? 203  ASP B O     1 
ATOM   4974  C CB    . ASP B  1 203 ? 94.096  113.417 -132.334 1.00 40.14  ? 203  ASP B CB    1 
ATOM   4975  C CG    . ASP B  1 203 ? 93.927  111.986 -131.852 1.00 42.22  ? 203  ASP B CG    1 
ATOM   4976  O OD1   . ASP B  1 203 ? 94.871  111.446 -131.239 1.00 44.27  ? 203  ASP B OD1   1 
ATOM   4977  O OD2   . ASP B  1 203 ? 92.847  111.398 -132.080 1.00 44.36  ? 203  ASP B OD2   1 
ATOM   4978  N N     . VAL B  1 204 ? 95.402  114.147 -129.113 1.00 35.07  ? 204  VAL B N     1 
ATOM   4979  C CA    . VAL B  1 204 ? 96.569  113.984 -128.300 1.00 33.76  ? 204  VAL B CA    1 
ATOM   4980  C C     . VAL B  1 204 ? 96.678  112.671 -127.518 1.00 32.17  ? 204  VAL B C     1 
ATOM   4981  O O     . VAL B  1 204 ? 95.726  112.169 -126.931 1.00 31.76  ? 204  VAL B O     1 
ATOM   4982  C CB    . VAL B  1 204 ? 96.703  115.216 -127.350 1.00 35.12  ? 204  VAL B CB    1 
ATOM   4983  C CG1   . VAL B  1 204 ? 97.994  115.146 -126.559 1.00 33.56  ? 204  VAL B CG1   1 
ATOM   4984  C CG2   . VAL B  1 204 ? 96.681  116.516 -128.178 1.00 34.52  ? 204  VAL B CG2   1 
ATOM   4985  N N     . THR B  1 205 ? 97.873  112.107 -127.563 1.00 30.88  ? 205  THR B N     1 
ATOM   4986  C CA    . THR B  1 205 ? 98.185  110.891 -126.855 1.00 30.45  ? 205  THR B CA    1 
ATOM   4987  C C     . THR B  1 205 ? 99.553  111.121 -126.234 1.00 31.34  ? 205  THR B C     1 
ATOM   4988  O O     . THR B  1 205 ? 100.490 111.511 -126.935 1.00 30.18  ? 205  THR B O     1 
ATOM   4989  C CB    . THR B  1 205 ? 98.292  109.677 -127.777 1.00 28.75  ? 205  THR B CB    1 
ATOM   4990  O OG1   . THR B  1 205 ? 97.071  109.503 -128.512 1.00 31.96  ? 205  THR B OG1   1 
ATOM   4991  C CG2   . THR B  1 205 ? 98.551  108.449 -126.946 1.00 28.39  ? 205  THR B CG2   1 
ATOM   4992  N N     . ALA B  1 206 ? 99.654  110.922 -124.917 1.00 31.01  ? 206  ALA B N     1 
ATOM   4993  C CA    . ALA B  1 206 ? 100.930 111.062 -124.214 1.00 30.28  ? 206  ALA B CA    1 
ATOM   4994  C C     . ALA B  1 206 ? 101.426 109.646 -123.911 1.00 30.36  ? 206  ALA B C     1 
ATOM   4995  O O     . ALA B  1 206 ? 100.641 108.809 -123.458 1.00 28.49  ? 206  ALA B O     1 
ATOM   4996  C CB    . ALA B  1 206 ? 100.743 111.828 -122.917 1.00 29.56  ? 206  ALA B CB    1 
ATOM   4997  N N     . VAL B  1 207 ? 102.707 109.378 -124.177 1.00 30.10  ? 207  VAL B N     1 
ATOM   4998  C CA    . VAL B  1 207 ? 103.286 108.065 -123.923 1.00 30.86  ? 207  VAL B CA    1 
ATOM   4999  C C     . VAL B  1 207 ? 104.194 108.177 -122.704 1.00 32.76  ? 207  VAL B C     1 
ATOM   5000  O O     . VAL B  1 207 ? 105.183 108.921 -122.719 1.00 33.35  ? 207  VAL B O     1 
ATOM   5001  C CB    . VAL B  1 207 ? 104.092 107.559 -125.141 1.00 30.52  ? 207  VAL B CB    1 
ATOM   5002  C CG1   . VAL B  1 207 ? 104.773 106.250 -124.811 1.00 30.48  ? 207  VAL B CG1   1 
ATOM   5003  C CG2   . VAL B  1 207 ? 103.168 107.353 -126.329 1.00 30.72  ? 207  VAL B CG2   1 
ATOM   5004  N N     . GLU B  1 208 ? 103.852 107.426 -121.654 1.00 34.08  ? 208  GLU B N     1 
ATOM   5005  C CA    . GLU B  1 208 ? 104.582 107.444 -120.378 1.00 33.56  ? 208  GLU B CA    1 
ATOM   5006  C C     . GLU B  1 208 ? 105.124 106.110 -119.934 1.00 34.38  ? 208  GLU B C     1 
ATOM   5007  O O     . GLU B  1 208 ? 104.404 105.117 -119.852 1.00 35.15  ? 208  GLU B O     1 
ATOM   5008  C CB    . GLU B  1 208 ? 103.687 107.968 -119.247 1.00 33.62  ? 208  GLU B CB    1 
ATOM   5009  C CG    . GLU B  1 208 ? 104.345 107.914 -117.875 1.00 31.45  ? 208  GLU B CG    1 
ATOM   5010  C CD    . GLU B  1 208 ? 105.624 108.724 -117.838 1.00 32.08  ? 208  GLU B CD    1 
ATOM   5011  O OE1   . GLU B  1 208 ? 105.573 109.905 -118.236 1.00 32.75  ? 208  GLU B OE1   1 
ATOM   5012  O OE2   . GLU B  1 208 ? 106.674 108.193 -117.415 1.00 33.60  ? 208  GLU B OE2   1 
ATOM   5013  N N     . PHE B  1 209 ? 106.397 106.119 -119.588 1.00 35.93  ? 209  PHE B N     1 
ATOM   5014  C CA    . PHE B  1 209 ? 107.073 104.930 -119.132 1.00 37.91  ? 209  PHE B CA    1 
ATOM   5015  C C     . PHE B  1 209 ? 106.552 104.423 -117.802 1.00 36.46  ? 209  PHE B C     1 
ATOM   5016  O O     . PHE B  1 209 ? 106.457 103.223 -117.592 1.00 35.56  ? 209  PHE B O     1 
ATOM   5017  C CB    . PHE B  1 209 ? 108.549 105.221 -118.979 1.00 41.72  ? 209  PHE B CB    1 
ATOM   5018  C CG    . PHE B  1 209 ? 109.364 104.014 -118.637 1.00 46.02  ? 209  PHE B CG    1 
ATOM   5019  C CD1   . PHE B  1 209 ? 109.742 103.106 -119.628 1.00 46.85  ? 209  PHE B CD1   1 
ATOM   5020  C CD2   . PHE B  1 209 ? 109.775 103.794 -117.333 1.00 46.60  ? 209  PHE B CD2   1 
ATOM   5021  C CE1   . PHE B  1 209 ? 110.528 101.995 -119.318 1.00 48.62  ? 209  PHE B CE1   1 
ATOM   5022  C CE2   . PHE B  1 209 ? 110.556 102.693 -117.015 1.00 48.78  ? 209  PHE B CE2   1 
ATOM   5023  C CZ    . PHE B  1 209 ? 110.936 101.790 -118.009 1.00 48.30  ? 209  PHE B CZ    1 
ATOM   5024  N N     . LEU B  1 210 ? 106.258 105.352 -116.899 1.00 36.12  ? 210  LEU B N     1 
ATOM   5025  C CA    . LEU B  1 210 ? 105.764 105.018 -115.577 1.00 34.77  ? 210  LEU B CA    1 
ATOM   5026  C C     . LEU B  1 210 ? 104.270 104.752 -115.657 1.00 34.71  ? 210  LEU B C     1 
ATOM   5027  O O     . LEU B  1 210 ? 103.657 105.023 -116.695 1.00 36.69  ? 210  LEU B O     1 
ATOM   5028  C CB    . LEU B  1 210 ? 106.078 106.168 -114.633 1.00 35.25  ? 210  LEU B CB    1 
ATOM   5029  C CG    . LEU B  1 210 ? 107.578 106.472 -114.501 1.00 34.54  ? 210  LEU B CG    1 
ATOM   5030  C CD1   . LEU B  1 210 ? 107.739 107.805 -113.803 1.00 33.80  ? 210  LEU B CD1   1 
ATOM   5031  C CD2   . LEU B  1 210 ? 108.307 105.354 -113.740 1.00 29.94  ? 210  LEU B CD2   1 
ATOM   5032  N N     . GLY B  1 211 ? 103.691 104.219 -114.577 1.00 32.31  ? 211  GLY B N     1 
ATOM   5033  C CA    . GLY B  1 211 ? 102.273 103.881 -114.546 1.00 29.49  ? 211  GLY B CA    1 
ATOM   5034  C C     . GLY B  1 211 ? 101.281 104.924 -114.051 1.00 29.92  ? 211  GLY B C     1 
ATOM   5035  O O     . GLY B  1 211 ? 100.156 104.595 -113.663 1.00 31.23  ? 211  GLY B O     1 
ATOM   5036  N N     . HIS B  1 212 ? 101.676 106.186 -114.054 1.00 28.46  ? 212  HIS B N     1 
ATOM   5037  C CA    . HIS B  1 212 ? 100.779 107.244 -113.613 1.00 27.98  ? 212  HIS B CA    1 
ATOM   5038  C C     . HIS B  1 212 ? 101.244 108.525 -114.266 1.00 29.92  ? 212  HIS B C     1 
ATOM   5039  O O     . HIS B  1 212 ? 102.396 108.633 -114.687 1.00 29.79  ? 212  HIS B O     1 
ATOM   5040  C CB    . HIS B  1 212 ? 100.862 107.451 -112.105 1.00 27.04  ? 212  HIS B CB    1 
ATOM   5041  C CG    . HIS B  1 212 ? 102.178 108.010 -111.668 1.00 25.79  ? 212  HIS B CG    1 
ATOM   5042  N ND1   . HIS B  1 212 ? 103.308 107.232 -111.563 1.00 24.58  ? 212  HIS B ND1   1 
ATOM   5043  C CD2   . HIS B  1 212 ? 102.587 109.287 -111.472 1.00 24.55  ? 212  HIS B CD2   1 
ATOM   5044  C CE1   . HIS B  1 212 ? 104.355 108.003 -111.332 1.00 23.64  ? 212  HIS B CE1   1 
ATOM   5045  N NE2   . HIS B  1 212 ? 103.945 109.256 -111.273 1.00 24.52  ? 212  HIS B NE2   1 
ATOM   5046  N N     . VAL B  1 213 ? 100.354 109.510 -114.302 1.00 30.82  ? 213  VAL B N     1 
ATOM   5047  C CA    . VAL B  1 213 ? 100.663 110.804 -114.897 1.00 30.95  ? 213  VAL B CA    1 
ATOM   5048  C C     . VAL B  1 213 ? 101.014 111.815 -113.789 1.00 30.68  ? 213  VAL B C     1 
ATOM   5049  O O     . VAL B  1 213 ? 100.792 111.558 -112.617 1.00 31.17  ? 213  VAL B O     1 
ATOM   5050  C CB    . VAL B  1 213 ? 99.424  111.320 -115.724 1.00 31.50  ? 213  VAL B CB    1 
ATOM   5051  C CG1   . VAL B  1 213 ? 98.884  110.219 -116.636 1.00 29.49  ? 213  VAL B CG1   1 
ATOM   5052  C CG2   . VAL B  1 213 ? 98.314  111.746 -114.801 1.00 33.63  ? 213  VAL B CG2   1 
ATOM   5053  N N     . GLY B  1 214 ? 101.589 112.953 -114.159 1.00 30.93  ? 214  GLY B N     1 
ATOM   5054  C CA    . GLY B  1 214 ? 101.871 113.978 -113.171 1.00 29.58  ? 214  GLY B CA    1 
ATOM   5055  C C     . GLY B  1 214 ? 103.251 114.108 -112.587 1.00 30.19  ? 214  GLY B C     1 
ATOM   5056  O O     . GLY B  1 214 ? 103.510 114.998 -111.772 1.00 30.08  ? 214  GLY B O     1 
ATOM   5057  N N     . GLY B  1 215 ? 104.140 113.214 -112.986 1.00 31.66  ? 215  GLY B N     1 
ATOM   5058  C CA    . GLY B  1 215 ? 105.496 113.284 -112.495 1.00 31.49  ? 215  GLY B CA    1 
ATOM   5059  C C     . GLY B  1 215 ? 105.698 112.649 -111.136 1.00 34.12  ? 215  GLY B C     1 
ATOM   5060  O O     . GLY B  1 215 ? 104.866 111.873 -110.646 1.00 31.67  ? 215  GLY B O     1 
ATOM   5061  N N     . VAL B  1 216 ? 106.830 112.999 -110.534 1.00 34.48  ? 216  VAL B N     1 
ATOM   5062  C CA    . VAL B  1 216 ? 107.233 112.468 -109.250 1.00 34.70  ? 216  VAL B CA    1 
ATOM   5063  C C     . VAL B  1 216 ? 106.591 113.191 -108.096 1.00 34.55  ? 216  VAL B C     1 
ATOM   5064  O O     . VAL B  1 216 ? 106.345 114.391 -108.167 1.00 35.34  ? 216  VAL B O     1 
ATOM   5065  C CB    . VAL B  1 216 ? 108.760 112.567 -109.079 1.00 36.40  ? 216  VAL B CB    1 
ATOM   5066  C CG1   . VAL B  1 216 ? 109.163 112.076 -107.690 1.00 37.15  ? 216  VAL B CG1   1 
ATOM   5067  C CG2   . VAL B  1 216 ? 109.457 111.742 -110.151 1.00 35.57  ? 216  VAL B CG2   1 
ATOM   5068  N N     . GLY B  1 217 ? 106.313 112.449 -107.032 1.00 33.00  ? 217  GLY B N     1 
ATOM   5069  C CA    . GLY B  1 217 ? 105.739 113.064 -105.862 1.00 31.50  ? 217  GLY B CA    1 
ATOM   5070  C C     . GLY B  1 217 ? 104.240 113.245 -105.818 1.00 32.08  ? 217  GLY B C     1 
ATOM   5071  O O     . GLY B  1 217 ? 103.681 113.491 -104.743 1.00 32.09  ? 217  GLY B O     1 
ATOM   5072  N N     . ILE B  1 218 ? 103.568 113.147 -106.960 1.00 29.87  ? 218  ILE B N     1 
ATOM   5073  C CA    . ILE B  1 218 ? 102.124 113.309 -106.945 1.00 26.91  ? 218  ILE B CA    1 
ATOM   5074  C C     . ILE B  1 218 ? 101.530 112.117 -106.197 1.00 27.56  ? 218  ILE B C     1 
ATOM   5075  O O     . ILE B  1 218 ? 102.103 111.020 -106.157 1.00 27.43  ? 218  ILE B O     1 
ATOM   5076  C CB    . ILE B  1 218 ? 101.544 113.374 -108.393 1.00 24.03  ? 218  ILE B CB    1 
ATOM   5077  C CG1   . ILE B  1 218 ? 100.095 113.893 -108.380 1.00 21.64  ? 218  ILE B CG1   1 
ATOM   5078  C CG2   . ILE B  1 218 ? 101.615 112.007 -109.033 1.00 21.46  ? 218  ILE B CG2   1 
ATOM   5079  C CD1   . ILE B  1 218 ? 99.515  114.136 -109.762 1.00 20.41  ? 218  ILE B CD1   1 
ATOM   5080  N N     . ASP B  1 219 ? 100.389 112.343 -105.568 1.00 28.21  ? 219  ASP B N     1 
ATOM   5081  C CA    . ASP B  1 219 ? 99.716  111.266 -104.862 1.00 27.06  ? 219  ASP B CA    1 
ATOM   5082  C C     . ASP B  1 219 ? 99.034  110.388 -105.928 1.00 26.36  ? 219  ASP B C     1 
ATOM   5083  O O     . ASP B  1 219 ? 98.310  110.906 -106.777 1.00 24.44  ? 219  ASP B O     1 
ATOM   5084  C CB    . ASP B  1 219 ? 98.667  111.841 -103.885 1.00 24.38  ? 219  ASP B CB    1 
ATOM   5085  C CG    . ASP B  1 219 ? 97.940  110.757 -103.102 1.00 24.84  ? 219  ASP B CG    1 
ATOM   5086  O OD1   . ASP B  1 219 ? 98.547  110.164 -102.178 1.00 26.54  ? 219  ASP B OD1   1 
ATOM   5087  O OD2   . ASP B  1 219 ? 96.766  110.480 -103.423 1.00 25.06  ? 219  ASP B OD2   1 
ATOM   5088  N N     . MET B  1 220 ? 99.263  109.072 -105.869 1.00 27.67  ? 220  MET B N     1 
ATOM   5089  C CA    . MET B  1 220 ? 98.665  108.118 -106.823 1.00 30.39  ? 220  MET B CA    1 
ATOM   5090  C C     . MET B  1 220 ? 97.140  108.151 -106.968 1.00 29.57  ? 220  MET B C     1 
ATOM   5091  O O     . MET B  1 220 ? 96.639  108.157 -108.079 1.00 31.63  ? 220  MET B O     1 
ATOM   5092  C CB    . MET B  1 220 ? 99.091  106.678 -106.511 1.00 32.24  ? 220  MET B CB    1 
ATOM   5093  C CG    . MET B  1 220 ? 100.566 106.361 -106.816 1.00 36.71  ? 220  MET B CG    1 
ATOM   5094  S SD    . MET B  1 220 ? 101.047 106.724 -108.536 1.00 40.98  ? 220  MET B SD    1 
ATOM   5095  C CE    . MET B  1 220 ? 99.817  105.660 -109.430 1.00 38.85  ? 220  MET B CE    1 
ATOM   5096  N N     . GLU B  1 221 ? 96.394  108.150 -105.872 1.00 28.46  ? 221  GLU B N     1 
ATOM   5097  C CA    . GLU B  1 221 ? 94.946  108.219 -105.998 1.00 28.27  ? 221  GLU B CA    1 
ATOM   5098  C C     . GLU B  1 221 ? 94.564  109.482 -106.785 1.00 29.69  ? 221  GLU B C     1 
ATOM   5099  O O     . GLU B  1 221 ? 93.696  109.443 -107.661 1.00 29.83  ? 221  GLU B O     1 
ATOM   5100  C CB    . GLU B  1 221 ? 94.292  108.252 -104.623 1.00 27.87  ? 221  GLU B CB    1 
ATOM   5101  C CG    . GLU B  1 221 ? 92.800  108.514 -104.651 1.00 29.35  ? 221  GLU B CG    1 
ATOM   5102  C CD    . GLU B  1 221 ? 92.153  108.505 -103.255 1.00 31.21  ? 221  GLU B CD    1 
ATOM   5103  O OE1   . GLU B  1 221 ? 92.862  108.747 -102.254 1.00 32.37  ? 221  GLU B OE1   1 
ATOM   5104  O OE2   . GLU B  1 221 ? 90.927  108.274 -103.173 1.00 30.90  ? 221  GLU B OE2   1 
ATOM   5105  N N     . ILE B  1 222 ? 95.214  110.597 -106.458 1.00 28.28  ? 222  ILE B N     1 
ATOM   5106  C CA    . ILE B  1 222 ? 94.980  111.868 -107.130 1.00 27.98  ? 222  ILE B CA    1 
ATOM   5107  C C     . ILE B  1 222 ? 95.383  111.748 -108.617 1.00 27.76  ? 222  ILE B C     1 
ATOM   5108  O O     . ILE B  1 222 ? 94.692  112.258 -109.492 1.00 28.20  ? 222  ILE B O     1 
ATOM   5109  C CB    . ILE B  1 222 ? 95.829  113.001 -106.469 1.00 27.38  ? 222  ILE B CB    1 
ATOM   5110  C CG1   . ILE B  1 222 ? 95.308  113.324 -105.075 1.00 24.26  ? 222  ILE B CG1   1 
ATOM   5111  C CG2   . ILE B  1 222 ? 95.858  114.221 -107.361 1.00 26.50  ? 222  ILE B CG2   1 
ATOM   5112  C CD1   . ILE B  1 222 ? 94.040  114.104 -105.052 1.00 25.29  ? 222  ILE B CD1   1 
ATOM   5113  N N     . SER B  1 223 ? 96.501  111.078 -108.890 1.00 28.10  ? 223  SER B N     1 
ATOM   5114  C CA    . SER B  1 223 ? 96.981  110.896 -110.253 1.00 30.19  ? 223  SER B CA    1 
ATOM   5115  C C     . SER B  1 223 ? 95.965  110.118 -111.088 1.00 31.39  ? 223  SER B C     1 
ATOM   5116  O O     . SER B  1 223 ? 95.589  110.533 -112.186 1.00 31.33  ? 223  SER B O     1 
ATOM   5117  C CB    . SER B  1 223 ? 98.319  110.158 -110.243 1.00 29.48  ? 223  SER B CB    1 
ATOM   5118  O OG    . SER B  1 223 ? 98.842  110.039 -111.562 1.00 29.35  ? 223  SER B OG    1 
ATOM   5119  N N     . LYS B  1 224 ? 95.537  108.982 -110.555 1.00 33.53  ? 224  LYS B N     1 
ATOM   5120  C CA    . LYS B  1 224 ? 94.553  108.140 -111.208 1.00 35.05  ? 224  LYS B CA    1 
ATOM   5121  C C     . LYS B  1 224 ? 93.278  108.926 -111.518 1.00 33.83  ? 224  LYS B C     1 
ATOM   5122  O O     . LYS B  1 224 ? 92.806  108.897 -112.648 1.00 34.46  ? 224  LYS B O     1 
ATOM   5123  C CB    . LYS B  1 224 ? 94.211  106.934 -110.327 1.00 38.50  ? 224  LYS B CB    1 
ATOM   5124  C CG    . LYS B  1 224 ? 95.324  105.873 -110.194 1.00 45.54  ? 224  LYS B CG    1 
ATOM   5125  C CD    . LYS B  1 224 ? 95.448  104.986 -111.462 1.00 50.72  ? 224  LYS B CD    1 
ATOM   5126  C CE    . LYS B  1 224 ? 96.626  105.384 -112.399 1.00 52.61  ? 224  LYS B CE    1 
ATOM   5127  N NZ    . LYS B  1 224 ? 96.507  104.749 -113.775 1.00 51.58  ? 224  LYS B NZ    1 
ATOM   5128  N N     . ASN B  1 225 ? 92.719  109.625 -110.536 1.00 32.28  ? 225  ASN B N     1 
ATOM   5129  C CA    . ASN B  1 225 ? 91.493  110.392 -110.774 1.00 33.10  ? 225  ASN B CA    1 
ATOM   5130  C C     . ASN B  1 225 ? 91.691  111.528 -111.770 1.00 33.52  ? 225  ASN B C     1 
ATOM   5131  O O     . ASN B  1 225 ? 90.755  111.890 -112.480 1.00 35.10  ? 225  ASN B O     1 
ATOM   5132  C CB    . ASN B  1 225 ? 90.944  110.975 -109.477 1.00 33.68  ? 225  ASN B CB    1 
ATOM   5133  C CG    . ASN B  1 225 ? 90.466  109.905 -108.525 1.00 37.41  ? 225  ASN B CG    1 
ATOM   5134  O OD1   . ASN B  1 225 ? 90.317  108.737 -108.919 1.00 41.88  ? 225  ASN B OD1   1 
ATOM   5135  N ND2   . ASN B  1 225 ? 90.209  110.285 -107.272 1.00 33.82  ? 225  ASN B ND2   1 
ATOM   5136  N N     . PHE B  1 226 ? 92.911  112.073 -111.805 1.00 31.26  ? 226  PHE B N     1 
ATOM   5137  C CA    . PHE B  1 226 ? 93.299  113.164 -112.693 1.00 29.31  ? 226  PHE B CA    1 
ATOM   5138  C C     . PHE B  1 226 ? 93.350  112.633 -114.140 1.00 29.37  ? 226  PHE B C     1 
ATOM   5139  O O     . PHE B  1 226 ? 92.821  113.250 -115.069 1.00 28.61  ? 226  PHE B O     1 
ATOM   5140  C CB    . PHE B  1 226 ? 94.668  113.724 -112.225 1.00 26.51  ? 226  PHE B CB    1 
ATOM   5141  C CG    . PHE B  1 226 ? 95.241  114.833 -113.101 1.00 24.16  ? 226  PHE B CG    1 
ATOM   5142  C CD1   . PHE B  1 226 ? 94.465  115.914 -113.498 1.00 24.06  ? 226  PHE B CD1   1 
ATOM   5143  C CD2   . PHE B  1 226 ? 96.585  114.807 -113.484 1.00 22.02  ? 226  PHE B CD2   1 
ATOM   5144  C CE1   . PHE B  1 226 ? 95.024  116.953 -114.263 1.00 23.19  ? 226  PHE B CE1   1 
ATOM   5145  C CE2   . PHE B  1 226 ? 97.148  115.834 -114.240 1.00 19.22  ? 226  PHE B CE2   1 
ATOM   5146  C CZ    . PHE B  1 226 ? 96.370  116.906 -114.631 1.00 21.00  ? 226  PHE B CZ    1 
ATOM   5147  N N     . GLN B  1 227 ? 93.984  111.482 -114.320 1.00 29.44  ? 227  GLN B N     1 
ATOM   5148  C CA    . GLN B  1 227 ? 94.069  110.857 -115.630 1.00 30.65  ? 227  GLN B CA    1 
ATOM   5149  C C     . GLN B  1 227 ? 92.651  110.535 -116.170 1.00 31.36  ? 227  GLN B C     1 
ATOM   5150  O O     . GLN B  1 227 ? 92.359  110.723 -117.360 1.00 29.11  ? 227  GLN B O     1 
ATOM   5151  C CB    . GLN B  1 227 ? 94.871  109.569 -115.505 1.00 31.25  ? 227  GLN B CB    1 
ATOM   5152  C CG    . GLN B  1 227 ? 94.906  108.739 -116.778 1.00 31.36  ? 227  GLN B CG    1 
ATOM   5153  C CD    . GLN B  1 227 ? 95.562  107.398 -116.585 1.00 31.56  ? 227  GLN B CD    1 
ATOM   5154  O OE1   . GLN B  1 227 ? 96.090  107.097 -115.519 1.00 32.87  ? 227  GLN B OE1   1 
ATOM   5155  N NE2   . GLN B  1 227 ? 95.534  106.581 -117.620 1.00 30.80  ? 227  GLN B NE2   1 
ATOM   5156  N N     . ARG B  1 228 ? 91.788  110.054 -115.278 1.00 32.87  ? 228  ARG B N     1 
ATOM   5157  C CA    . ARG B  1 228 ? 90.422  109.679 -115.619 1.00 33.80  ? 228  ARG B CA    1 
ATOM   5158  C C     . ARG B  1 228 ? 89.650  110.838 -116.194 1.00 34.01  ? 228  ARG B C     1 
ATOM   5159  O O     . ARG B  1 228 ? 88.917  110.708 -117.184 1.00 36.02  ? 228  ARG B O     1 
ATOM   5160  C CB    . ARG B  1 228 ? 89.668  109.177 -114.376 1.00 37.54  ? 228  ARG B CB    1 
ATOM   5161  C CG    . ARG B  1 228 ? 89.345  107.721 -114.386 1.00 43.65  ? 228  ARG B CG    1 
ATOM   5162  C CD    . ARG B  1 228 ? 90.620  106.976 -114.065 1.00 49.73  ? 228  ARG B CD    1 
ATOM   5163  N NE    . ARG B  1 228 ? 90.571  106.076 -112.904 1.00 55.30  ? 228  ARG B NE    1 
ATOM   5164  C CZ    . ARG B  1 228 ? 89.710  106.157 -111.885 1.00 57.34  ? 228  ARG B CZ    1 
ATOM   5165  N NH1   . ARG B  1 228 ? 88.764  107.115 -111.842 1.00 58.13  ? 228  ARG B NH1   1 
ATOM   5166  N NH2   . ARG B  1 228 ? 89.799  105.253 -110.906 1.00 57.82  ? 228  ARG B NH2   1 
ATOM   5167  N N     . ILE B  1 229 ? 89.838  111.988 -115.566 1.00 32.08  ? 229  ILE B N     1 
ATOM   5168  C CA    . ILE B  1 229 ? 89.160  113.206 -115.974 1.00 30.25  ? 229  ILE B CA    1 
ATOM   5169  C C     . ILE B  1 229 ? 89.712  113.725 -117.297 1.00 30.62  ? 229  ILE B C     1 
ATOM   5170  O O     . ILE B  1 229 ? 88.961  114.123 -118.197 1.00 32.27  ? 229  ILE B O     1 
ATOM   5171  C CB    . ILE B  1 229 ? 89.288  114.284 -114.855 1.00 29.44  ? 229  ILE B CB    1 
ATOM   5172  C CG1   . ILE B  1 229 ? 88.580  113.782 -113.593 1.00 27.43  ? 229  ILE B CG1   1 
ATOM   5173  C CG2   . ILE B  1 229 ? 88.698  115.631 -115.295 1.00 27.25  ? 229  ILE B CG2   1 
ATOM   5174  C CD1   . ILE B  1 229 ? 88.695  114.709 -112.378 1.00 27.00  ? 229  ILE B CD1   1 
ATOM   5175  N N     . LEU B  1 230 ? 91.030  113.696 -117.425 1.00 30.06  ? 230  LEU B N     1 
ATOM   5176  C CA    . LEU B  1 230 ? 91.664  114.155 -118.651 1.00 30.23  ? 230  LEU B CA    1 
ATOM   5177  C C     . LEU B  1 230 ? 91.270  113.243 -119.807 1.00 31.07  ? 230  LEU B C     1 
ATOM   5178  O O     . LEU B  1 230 ? 90.981  113.727 -120.902 1.00 32.92  ? 230  LEU B O     1 
ATOM   5179  C CB    . LEU B  1 230 ? 93.202  114.207 -118.505 1.00 28.01  ? 230  LEU B CB    1 
ATOM   5180  C CG    . LEU B  1 230 ? 93.769  115.318 -117.607 1.00 27.84  ? 230  LEU B CG    1 
ATOM   5181  C CD1   . LEU B  1 230 ? 95.286  115.209 -117.538 1.00 26.94  ? 230  LEU B CD1   1 
ATOM   5182  C CD2   . LEU B  1 230 ? 93.361  116.679 -118.142 1.00 24.27  ? 230  LEU B CD2   1 
ATOM   5183  N N     . GLN B  1 231 ? 91.230  111.936 -119.555 1.00 30.32  ? 231  GLN B N     1 
ATOM   5184  C CA    . GLN B  1 231 ? 90.875  110.981 -120.591 1.00 30.83  ? 231  GLN B CA    1 
ATOM   5185  C C     . GLN B  1 231 ? 89.493  111.251 -121.157 1.00 32.32  ? 231  GLN B C     1 
ATOM   5186  O O     . GLN B  1 231 ? 89.307  111.191 -122.389 1.00 32.77  ? 231  GLN B O     1 
ATOM   5187  C CB    . GLN B  1 231 ? 90.998  109.540 -120.067 1.00 29.94  ? 231  GLN B CB    1 
ATOM   5188  C CG    . GLN B  1 231 ? 92.435  109.022 -120.115 1.00 28.87  ? 231  GLN B CG    1 
ATOM   5189  C CD    . GLN B  1 231 ? 92.641  107.672 -119.438 1.00 32.29  ? 231  GLN B CD    1 
ATOM   5190  O OE1   . GLN B  1 231 ? 93.701  107.056 -119.584 1.00 33.07  ? 231  GLN B OE1   1 
ATOM   5191  N NE2   . GLN B  1 231 ? 91.638  107.209 -118.688 1.00 32.64  ? 231  GLN B NE2   1 
ATOM   5192  N N     . LYS B  1 232 ? 88.543  111.588 -120.278 1.00 31.74  ? 232  LYS B N     1 
ATOM   5193  C CA    . LYS B  1 232 ? 87.176  111.895 -120.716 1.00 35.21  ? 232  LYS B CA    1 
ATOM   5194  C C     . LYS B  1 232 ? 87.097  113.285 -121.382 1.00 35.76  ? 232  LYS B C     1 
ATOM   5195  O O     . LYS B  1 232 ? 86.038  113.708 -121.861 1.00 36.24  ? 232  LYS B O     1 
ATOM   5196  C CB    . LYS B  1 232 ? 86.168  111.839 -119.545 1.00 36.75  ? 232  LYS B CB    1 
ATOM   5197  C CG    . LYS B  1 232 ? 86.079  110.464 -118.845 1.00 42.05  ? 232  LYS B CG    1 
ATOM   5198  C CD    . LYS B  1 232 ? 85.110  110.432 -117.605 1.00 44.79  ? 232  LYS B CD    1 
ATOM   5199  C CE    . LYS B  1 232 ? 85.148  109.061 -116.849 1.00 46.96  ? 232  LYS B CE    1 
ATOM   5200  N NZ    . LYS B  1 232 ? 84.310  108.934 -115.589 1.00 46.83  ? 232  LYS B NZ    1 
ATOM   5201  N N     . GLN B  1 233 ? 88.211  114.005 -121.389 1.00 33.86  ? 233  GLN B N     1 
ATOM   5202  C CA    . GLN B  1 233 ? 88.249  115.298 -122.023 1.00 31.89  ? 233  GLN B CA    1 
ATOM   5203  C C     . GLN B  1 233 ? 88.754  115.075 -123.444 1.00 31.96  ? 233  GLN B C     1 
ATOM   5204  O O     . GLN B  1 233 ? 88.590  115.920 -124.328 1.00 29.97  ? 233  GLN B O     1 
ATOM   5205  C CB    . GLN B  1 233 ? 89.181  116.204 -121.262 1.00 31.25  ? 233  GLN B CB    1 
ATOM   5206  C CG    . GLN B  1 233 ? 88.487  117.108 -120.276 1.00 31.84  ? 233  GLN B CG    1 
ATOM   5207  C CD    . GLN B  1 233 ? 89.488  117.917 -119.478 1.00 32.49  ? 233  GLN B CD    1 
ATOM   5208  O OE1   . GLN B  1 233 ? 90.635  118.130 -119.907 1.00 30.57  ? 233  GLN B OE1   1 
ATOM   5209  N NE2   . GLN B  1 233 ? 89.064  118.379 -118.317 1.00 31.13  ? 233  GLN B NE2   1 
ATOM   5210  N N     . GLY B  1 234 ? 89.359  113.913 -123.660 1.00 31.06  ? 234  GLY B N     1 
ATOM   5211  C CA    . GLY B  1 234 ? 89.844  113.586 -124.981 1.00 31.63  ? 234  GLY B CA    1 
ATOM   5212  C C     . GLY B  1 234 ? 91.319  113.305 -124.988 1.00 32.36  ? 234  GLY B C     1 
ATOM   5213  O O     . GLY B  1 234 ? 91.867  112.854 -125.982 1.00 32.77  ? 234  GLY B O     1 
ATOM   5214  N N     . PHE B  1 235 ? 91.956  113.582 -123.862 1.00 32.98  ? 235  PHE B N     1 
ATOM   5215  C CA    . PHE B  1 235 ? 93.379  113.377 -123.696 1.00 32.77  ? 235  PHE B CA    1 
ATOM   5216  C C     . PHE B  1 235 ? 93.613  111.889 -123.474 1.00 33.78  ? 235  PHE B C     1 
ATOM   5217  O O     . PHE B  1 235 ? 93.143  111.318 -122.505 1.00 34.28  ? 235  PHE B O     1 
ATOM   5218  C CB    . PHE B  1 235 ? 93.843  114.188 -122.487 1.00 33.43  ? 235  PHE B CB    1 
ATOM   5219  C CG    . PHE B  1 235 ? 95.300  114.552 -122.506 1.00 31.49  ? 235  PHE B CG    1 
ATOM   5220  C CD1   . PHE B  1 235 ? 96.247  113.681 -123.047 1.00 31.88  ? 235  PHE B CD1   1 
ATOM   5221  C CD2   . PHE B  1 235 ? 95.732  115.731 -121.907 1.00 30.38  ? 235  PHE B CD2   1 
ATOM   5222  C CE1   . PHE B  1 235 ? 97.620  113.971 -122.991 1.00 32.06  ? 235  PHE B CE1   1 
ATOM   5223  C CE2   . PHE B  1 235 ? 97.090  116.040 -121.838 1.00 31.66  ? 235  PHE B CE2   1 
ATOM   5224  C CZ    . PHE B  1 235 ? 98.044  115.156 -122.381 1.00 32.49  ? 235  PHE B CZ    1 
ATOM   5225  N N     . LYS B  1 236 ? 94.351  111.261 -124.371 1.00 34.80  ? 236  LYS B N     1 
ATOM   5226  C CA    . LYS B  1 236 ? 94.599  109.830 -124.266 1.00 36.15  ? 236  LYS B CA    1 
ATOM   5227  C C     . LYS B  1 236 ? 95.979  109.580 -123.715 1.00 35.58  ? 236  LYS B C     1 
ATOM   5228  O O     . LYS B  1 236 ? 96.910  110.366 -123.945 1.00 35.81  ? 236  LYS B O     1 
ATOM   5229  C CB    . LYS B  1 236 ? 94.462  109.159 -125.644 1.00 38.04  ? 236  LYS B CB    1 
ATOM   5230  C CG    . LYS B  1 236 ? 93.073  109.295 -126.273 1.00 40.38  ? 236  LYS B CG    1 
ATOM   5231  C CD    . LYS B  1 236 ? 93.035  108.768 -127.721 1.00 43.77  ? 236  LYS B CD    1 
ATOM   5232  C CE    . LYS B  1 236 ? 93.728  109.714 -128.728 1.00 46.56  ? 236  LYS B CE    1 
ATOM   5233  N NZ    . LYS B  1 236 ? 92.953  110.978 -128.983 1.00 46.67  ? 236  LYS B NZ    1 
ATOM   5234  N N     . PHE B  1 237 ? 96.125  108.464 -123.017 1.00 33.92  ? 237  PHE B N     1 
ATOM   5235  C CA    . PHE B  1 237 ? 97.400  108.136 -122.410 1.00 33.40  ? 237  PHE B CA    1 
ATOM   5236  C C     . PHE B  1 237 ? 97.774  106.700 -122.617 1.00 34.27  ? 237  PHE B C     1 
ATOM   5237  O O     . PHE B  1 237 ? 96.917  105.828 -122.666 1.00 37.09  ? 237  PHE B O     1 
ATOM   5238  C CB    . PHE B  1 237 ? 97.343  108.379 -120.893 1.00 34.10  ? 237  PHE B CB    1 
ATOM   5239  C CG    . PHE B  1 237 ? 97.227  109.824 -120.499 1.00 32.10  ? 237  PHE B CG    1 
ATOM   5240  C CD1   . PHE B  1 237 ? 98.353  110.651 -120.506 1.00 31.27  ? 237  PHE B CD1   1 
ATOM   5241  C CD2   . PHE B  1 237 ? 96.001  110.353 -120.102 1.00 31.66  ? 237  PHE B CD2   1 
ATOM   5242  C CE1   . PHE B  1 237 ? 98.274  111.983 -120.123 1.00 30.32  ? 237  PHE B CE1   1 
ATOM   5243  C CE2   . PHE B  1 237 ? 95.899  111.690 -119.714 1.00 33.17  ? 237  PHE B CE2   1 
ATOM   5244  C CZ    . PHE B  1 237 ? 97.051  112.512 -119.725 1.00 31.66  ? 237  PHE B CZ    1 
ATOM   5245  N N     . LYS B  1 238 ? 99.071  106.463 -122.719 1.00 34.36  ? 238  LYS B N     1 
ATOM   5246  C CA    . LYS B  1 238 ? 99.615  105.127 -122.841 1.00 34.57  ? 238  LYS B CA    1 
ATOM   5247  C C     . LYS B  1 238 ? 100.709 105.000 -121.766 1.00 35.05  ? 238  LYS B C     1 
ATOM   5248  O O     . LYS B  1 238 ? 101.879 105.354 -121.965 1.00 33.48  ? 238  LYS B O     1 
ATOM   5249  C CB    . LYS B  1 238 ? 100.154 104.879 -124.255 1.00 36.28  ? 238  LYS B CB    1 
ATOM   5250  C CG    . LYS B  1 238 ? 99.054  104.534 -125.228 1.00 38.97  ? 238  LYS B CG    1 
ATOM   5251  C CD    . LYS B  1 238 ? 99.580  104.057 -126.569 1.00 43.85  ? 238  LYS B CD    1 
ATOM   5252  C CE    . LYS B  1 238 ? 98.501  103.206 -127.268 1.00 48.07  ? 238  LYS B CE    1 
ATOM   5253  N NZ    . LYS B  1 238 ? 98.735  102.966 -128.737 1.00 50.31  ? 238  LYS B NZ    1 
ATOM   5254  N N     . LEU B  1 239 ? 100.290 104.501 -120.608 1.00 35.54  ? 239  LEU B N     1 
ATOM   5255  C CA    . LEU B  1 239 ? 101.168 104.338 -119.460 1.00 36.89  ? 239  LEU B CA    1 
ATOM   5256  C C     . LEU B  1 239 ? 101.959 103.042 -119.533 1.00 36.99  ? 239  LEU B C     1 
ATOM   5257  O O     . LEU B  1 239 ? 101.524 102.088 -120.154 1.00 37.05  ? 239  LEU B O     1 
ATOM   5258  C CB    . LEU B  1 239 ? 100.322 104.383 -118.172 1.00 37.31  ? 239  LEU B CB    1 
ATOM   5259  C CG    . LEU B  1 239 ? 99.392  105.597 -118.049 1.00 36.74  ? 239  LEU B CG    1 
ATOM   5260  C CD1   . LEU B  1 239 ? 98.748  105.671 -116.684 1.00 36.20  ? 239  LEU B CD1   1 
ATOM   5261  C CD2   . LEU B  1 239 ? 100.209 106.848 -118.293 1.00 37.37  ? 239  LEU B CD2   1 
ATOM   5262  N N     . ASN B  1 240 ? 103.129 103.008 -118.907 1.00 38.31  ? 240  ASN B N     1 
ATOM   5263  C CA    . ASN B  1 240 ? 103.947 101.804 -118.927 1.00 39.31  ? 240  ASN B CA    1 
ATOM   5264  C C     . ASN B  1 240 ? 104.361 101.445 -120.339 1.00 40.53  ? 240  ASN B C     1 
ATOM   5265  O O     . ASN B  1 240 ? 104.426 100.272 -120.693 1.00 41.00  ? 240  ASN B O     1 
ATOM   5266  C CB    . ASN B  1 240 ? 103.168 100.637 -118.340 1.00 39.68  ? 240  ASN B CB    1 
ATOM   5267  C CG    . ASN B  1 240 ? 102.681 100.922 -116.947 1.00 40.97  ? 240  ASN B CG    1 
ATOM   5268  O OD1   . ASN B  1 240 ? 103.470 101.208 -116.063 1.00 40.77  ? 240  ASN B OD1   1 
ATOM   5269  N ND2   . ASN B  1 240 ? 101.372 100.854 -116.744 1.00 42.14  ? 240  ASN B ND2   1 
ATOM   5270  N N     . THR B  1 241 ? 104.633 102.466 -121.141 1.00 42.25  ? 241  THR B N     1 
ATOM   5271  C CA    . THR B  1 241 ? 105.039 102.294 -122.527 1.00 43.38  ? 241  THR B CA    1 
ATOM   5272  C C     . THR B  1 241 ? 106.341 103.033 -122.760 1.00 46.50  ? 241  THR B C     1 
ATOM   5273  O O     . THR B  1 241 ? 106.459 104.226 -122.457 1.00 47.11  ? 241  THR B O     1 
ATOM   5274  C CB    . THR B  1 241 ? 103.993 102.870 -123.483 1.00 42.79  ? 241  THR B CB    1 
ATOM   5275  O OG1   . THR B  1 241 ? 102.709 102.298 -123.198 1.00 42.18  ? 241  THR B OG1   1 
ATOM   5276  C CG2   . THR B  1 241 ? 104.374 102.570 -124.909 1.00 41.87  ? 241  THR B CG2   1 
ATOM   5277  N N     . LYS B  1 242 ? 107.317 102.313 -123.296 1.00 49.41  ? 242  LYS B N     1 
ATOM   5278  C CA    . LYS B  1 242 ? 108.634 102.857 -123.607 1.00 52.38  ? 242  LYS B CA    1 
ATOM   5279  C C     . LYS B  1 242 ? 108.657 103.314 -125.068 1.00 54.28  ? 242  LYS B C     1 
ATOM   5280  O O     . LYS B  1 242 ? 108.198 102.594 -125.954 1.00 54.88  ? 242  LYS B O     1 
ATOM   5281  C CB    . LYS B  1 242 ? 109.677 101.765 -123.368 1.00 53.09  ? 242  LYS B CB    1 
ATOM   5282  C CG    . LYS B  1 242 ? 111.059 102.019 -123.907 1.00 54.82  ? 242  LYS B CG    1 
ATOM   5283  C CD    . LYS B  1 242 ? 111.973 100.846 -123.540 1.00 59.17  ? 242  LYS B CD    1 
ATOM   5284  C CE    . LYS B  1 242 ? 111.371 99.472  -123.935 1.00 62.42  ? 242  LYS B CE    1 
ATOM   5285  N NZ    . LYS B  1 242 ? 112.139 98.263  -123.431 1.00 63.77  ? 242  LYS B NZ    1 
ATOM   5286  N N     . VAL B  1 243 ? 109.162 104.513 -125.329 1.00 55.79  ? 243  VAL B N     1 
ATOM   5287  C CA    . VAL B  1 243 ? 109.228 104.981 -126.701 1.00 57.67  ? 243  VAL B CA    1 
ATOM   5288  C C     . VAL B  1 243 ? 110.594 104.589 -127.263 1.00 59.71  ? 243  VAL B C     1 
ATOM   5289  O O     . VAL B  1 243 ? 111.603 105.190 -126.913 1.00 61.02  ? 243  VAL B O     1 
ATOM   5290  C CB    . VAL B  1 243 ? 109.044 106.504 -126.774 1.00 56.97  ? 243  VAL B CB    1 
ATOM   5291  C CG1   . VAL B  1 243 ? 109.227 106.986 -128.194 1.00 56.60  ? 243  VAL B CG1   1 
ATOM   5292  C CG2   . VAL B  1 243 ? 107.668 106.872 -126.296 1.00 56.13  ? 243  VAL B CG2   1 
ATOM   5293  N N     . THR B  1 244 ? 110.622 103.566 -128.115 1.00 61.59  ? 244  THR B N     1 
ATOM   5294  C CA    . THR B  1 244 ? 111.861 103.081 -128.726 1.00 63.02  ? 244  THR B CA    1 
ATOM   5295  C C     . THR B  1 244 ? 112.605 104.177 -129.480 1.00 63.35  ? 244  THR B C     1 
ATOM   5296  O O     . THR B  1 244 ? 113.732 104.537 -129.135 1.00 64.09  ? 244  THR B O     1 
ATOM   5297  C CB    . THR B  1 244 ? 111.571 101.948 -129.714 1.00 63.75  ? 244  THR B CB    1 
ATOM   5298  O OG1   . THR B  1 244 ? 110.947 100.865 -129.019 1.00 65.56  ? 244  THR B OG1   1 
ATOM   5299  C CG2   . THR B  1 244 ? 112.859 101.466 -130.368 1.00 66.10  ? 244  THR B CG2   1 
ATOM   5300  N N     . GLY B  1 245 ? 111.968 104.687 -130.526 1.00 62.97  ? 245  GLY B N     1 
ATOM   5301  C CA    . GLY B  1 245 ? 112.562 105.733 -131.328 1.00 62.02  ? 245  GLY B CA    1 
ATOM   5302  C C     . GLY B  1 245 ? 111.467 106.339 -132.169 1.00 61.58  ? 245  GLY B C     1 
ATOM   5303  O O     . GLY B  1 245 ? 110.291 106.020 -131.981 1.00 61.53  ? 245  GLY B O     1 
ATOM   5304  N N     . ALA B  1 246 ? 111.841 107.206 -133.101 1.00 60.95  ? 246  ALA B N     1 
ATOM   5305  C CA    . ALA B  1 246 ? 110.851 107.842 -133.957 1.00 60.56  ? 246  ALA B CA    1 
ATOM   5306  C C     . ALA B  1 246 ? 111.495 108.375 -135.231 1.00 59.81  ? 246  ALA B C     1 
ATOM   5307  O O     . ALA B  1 246 ? 112.635 108.835 -135.204 1.00 59.87  ? 246  ALA B O     1 
ATOM   5308  C CB    . ALA B  1 246 ? 110.162 108.966 -133.196 1.00 60.01  ? 246  ALA B CB    1 
ATOM   5309  N N     . THR B  1 247 ? 110.765 108.327 -136.340 1.00 58.57  ? 247  THR B N     1 
ATOM   5310  C CA    . THR B  1 247 ? 111.311 108.796 -137.613 1.00 57.64  ? 247  THR B CA    1 
ATOM   5311  C C     . THR B  1 247 ? 110.399 109.749 -138.381 1.00 55.93  ? 247  THR B C     1 
ATOM   5312  O O     . THR B  1 247 ? 109.184 109.582 -138.408 1.00 55.32  ? 247  THR B O     1 
ATOM   5313  C CB    . THR B  1 247 ? 111.648 107.600 -138.532 1.00 57.61  ? 247  THR B CB    1 
ATOM   5314  O OG1   . THR B  1 247 ? 110.465 106.824 -138.745 1.00 58.43  ? 247  THR B OG1   1 
ATOM   5315  C CG2   . THR B  1 247 ? 112.696 106.706 -137.892 1.00 57.04  ? 247  THR B CG2   1 
ATOM   5316  N N     . LYS B  1 248 ? 111.002 110.753 -139.004 1.00 55.89  ? 248  LYS B N     1 
ATOM   5317  C CA    . LYS B  1 248 ? 110.250 111.714 -139.792 1.00 57.00  ? 248  LYS B CA    1 
ATOM   5318  C C     . LYS B  1 248 ? 110.171 111.126 -141.207 1.00 56.36  ? 248  LYS B C     1 
ATOM   5319  O O     . LYS B  1 248 ? 111.199 110.812 -141.811 1.00 56.52  ? 248  LYS B O     1 
ATOM   5320  C CB    . LYS B  1 248 ? 110.958 113.084 -139.799 1.00 58.81  ? 248  LYS B CB    1 
ATOM   5321  C CG    . LYS B  1 248 ? 110.118 114.209 -140.427 1.00 62.05  ? 248  LYS B CG    1 
ATOM   5322  C CD    . LYS B  1 248 ? 110.767 115.592 -140.316 1.00 63.76  ? 248  LYS B CD    1 
ATOM   5323  C CE    . LYS B  1 248 ? 110.005 116.631 -141.160 1.00 65.37  ? 248  LYS B CE    1 
ATOM   5324  N NZ    . LYS B  1 248 ? 108.567 116.773 -140.757 1.00 65.70  ? 248  LYS B NZ    1 
ATOM   5325  N N     . LYS B  1 249 ? 108.952 110.962 -141.720 1.00 54.27  ? 249  LYS B N     1 
ATOM   5326  C CA    . LYS B  1 249 ? 108.742 110.381 -143.045 1.00 51.95  ? 249  LYS B CA    1 
ATOM   5327  C C     . LYS B  1 249 ? 108.657 111.441 -144.131 1.00 51.08  ? 249  LYS B C     1 
ATOM   5328  O O     . LYS B  1 249 ? 108.252 112.579 -143.874 1.00 49.80  ? 249  LYS B O     1 
ATOM   5329  C CB    . LYS B  1 249 ? 107.470 109.517 -143.032 1.00 50.65  ? 249  LYS B CB    1 
ATOM   5330  C CG    . LYS B  1 249 ? 107.482 108.507 -141.883 1.00 48.30  ? 249  LYS B CG    1 
ATOM   5331  C CD    . LYS B  1 249 ? 106.358 107.502 -141.946 1.00 45.66  ? 249  LYS B CD    1 
ATOM   5332  C CE    . LYS B  1 249 ? 105.024 108.118 -141.621 1.00 43.15  ? 249  LYS B CE    1 
ATOM   5333  N NZ    . LYS B  1 249 ? 103.982 107.063 -141.676 1.00 42.25  ? 249  LYS B NZ    1 
ATOM   5334  N N     . SER B  1 250 ? 109.040 111.050 -145.346 1.00 50.16  ? 250  SER B N     1 
ATOM   5335  C CA    . SER B  1 250 ? 109.041 111.943 -146.509 1.00 49.10  ? 250  SER B CA    1 
ATOM   5336  C C     . SER B  1 250 ? 107.729 112.677 -146.751 1.00 47.55  ? 250  SER B C     1 
ATOM   5337  O O     . SER B  1 250 ? 107.721 113.715 -147.401 1.00 47.38  ? 250  SER B O     1 
ATOM   5338  C CB    . SER B  1 250 ? 109.430 111.170 -147.778 1.00 49.47  ? 250  SER B CB    1 
ATOM   5339  O OG    . SER B  1 250 ? 108.472 110.184 -148.119 1.00 50.31  ? 250  SER B OG    1 
ATOM   5340  N N     . ASP B  1 251 ? 106.630 112.143 -146.227 1.00 46.35  ? 251  ASP B N     1 
ATOM   5341  C CA    . ASP B  1 251 ? 105.310 112.753 -146.386 1.00 45.59  ? 251  ASP B CA    1 
ATOM   5342  C C     . ASP B  1 251 ? 105.026 113.741 -145.254 1.00 44.43  ? 251  ASP B C     1 
ATOM   5343  O O     . ASP B  1 251 ? 103.896 114.208 -145.083 1.00 41.62  ? 251  ASP B O     1 
ATOM   5344  C CB    . ASP B  1 251 ? 104.239 111.661 -146.392 1.00 47.74  ? 251  ASP B CB    1 
ATOM   5345  C CG    . ASP B  1 251 ? 104.152 110.912 -145.057 1.00 50.73  ? 251  ASP B CG    1 
ATOM   5346  O OD1   . ASP B  1 251 ? 105.148 110.916 -144.288 1.00 51.10  ? 251  ASP B OD1   1 
ATOM   5347  O OD2   . ASP B  1 251 ? 103.092 110.304 -144.786 1.00 51.37  ? 251  ASP B OD2   1 
ATOM   5348  N N     . GLY B  1 252 ? 106.064 114.052 -144.484 1.00 43.93  ? 252  GLY B N     1 
ATOM   5349  C CA    . GLY B  1 252 ? 105.911 114.967 -143.364 1.00 45.15  ? 252  GLY B CA    1 
ATOM   5350  C C     . GLY B  1 252 ? 105.500 114.298 -142.055 1.00 44.91  ? 252  GLY B C     1 
ATOM   5351  O O     . GLY B  1 252 ? 105.873 114.763 -140.978 1.00 44.93  ? 252  GLY B O     1 
ATOM   5352  N N     . LYS B  1 253 ? 104.738 113.209 -142.144 1.00 44.17  ? 253  LYS B N     1 
ATOM   5353  C CA    . LYS B  1 253 ? 104.283 112.489 -140.960 1.00 43.80  ? 253  LYS B CA    1 
ATOM   5354  C C     . LYS B  1 253 ? 105.434 111.980 -140.091 1.00 43.42  ? 253  LYS B C     1 
ATOM   5355  O O     . LYS B  1 253 ? 106.584 111.903 -140.532 1.00 43.30  ? 253  LYS B O     1 
ATOM   5356  C CB    . LYS B  1 253 ? 103.405 111.310 -141.371 1.00 46.05  ? 253  LYS B CB    1 
ATOM   5357  C CG    . LYS B  1 253 ? 102.122 111.700 -142.090 1.00 47.73  ? 253  LYS B CG    1 
ATOM   5358  C CD    . LYS B  1 253 ? 101.100 112.266 -141.129 1.00 48.69  ? 253  LYS B CD    1 
ATOM   5359  C CE    . LYS B  1 253 ? 100.137 113.144 -141.879 1.00 51.25  ? 253  LYS B CE    1 
ATOM   5360  N NZ    . LYS B  1 253 ? 100.927 114.146 -142.691 1.00 52.56  ? 253  LYS B NZ    1 
ATOM   5361  N N     . ILE B  1 254 ? 105.115 111.638 -138.845 1.00 42.61  ? 254  ILE B N     1 
ATOM   5362  C CA    . ILE B  1 254 ? 106.110 111.134 -137.909 1.00 41.69  ? 254  ILE B CA    1 
ATOM   5363  C C     . ILE B  1 254 ? 105.651 109.815 -137.293 1.00 41.25  ? 254  ILE B C     1 
ATOM   5364  O O     . ILE B  1 254 ? 104.529 109.716 -136.776 1.00 41.37  ? 254  ILE B O     1 
ATOM   5365  C CB    . ILE B  1 254 ? 106.367 112.160 -136.792 1.00 42.30  ? 254  ILE B CB    1 
ATOM   5366  C CG1   . ILE B  1 254 ? 106.924 113.441 -137.403 1.00 43.08  ? 254  ILE B CG1   1 
ATOM   5367  C CG2   . ILE B  1 254 ? 107.335 111.593 -135.759 1.00 40.15  ? 254  ILE B CG2   1 
ATOM   5368  C CD1   . ILE B  1 254 ? 107.030 114.599 -136.436 1.00 42.77  ? 254  ILE B CD1   1 
ATOM   5369  N N     . ASP B  1 255 ? 106.522 108.813 -137.370 1.00 39.31  ? 255  ASP B N     1 
ATOM   5370  C CA    . ASP B  1 255 ? 106.252 107.485 -136.830 1.00 40.51  ? 255  ASP B CA    1 
ATOM   5371  C C     . ASP B  1 255 ? 106.989 107.311 -135.505 1.00 40.96  ? 255  ASP B C     1 
ATOM   5372  O O     . ASP B  1 255 ? 108.216 107.446 -135.451 1.00 41.02  ? 255  ASP B O     1 
ATOM   5373  C CB    . ASP B  1 255 ? 106.722 106.404 -137.813 1.00 41.49  ? 255  ASP B CB    1 
ATOM   5374  C CG    . ASP B  1 255 ? 105.611 105.913 -138.737 1.00 42.66  ? 255  ASP B CG    1 
ATOM   5375  O OD1   . ASP B  1 255 ? 104.617 106.642 -138.948 1.00 42.80  ? 255  ASP B OD1   1 
ATOM   5376  O OD2   . ASP B  1 255 ? 105.745 104.789 -139.265 1.00 44.36  ? 255  ASP B OD2   1 
ATOM   5377  N N     . VAL B  1 256 ? 106.246 107.010 -134.442 1.00 39.88  ? 256  VAL B N     1 
ATOM   5378  C CA    . VAL B  1 256 ? 106.850 106.828 -133.125 1.00 39.55  ? 256  VAL B CA    1 
ATOM   5379  C C     . VAL B  1 256 ? 106.771 105.363 -132.715 1.00 40.06  ? 256  VAL B C     1 
ATOM   5380  O O     . VAL B  1 256 ? 105.678 104.801 -132.601 1.00 40.54  ? 256  VAL B O     1 
ATOM   5381  C CB    . VAL B  1 256 ? 106.126 107.655 -132.027 1.00 38.96  ? 256  VAL B CB    1 
ATOM   5382  C CG1   . VAL B  1 256 ? 106.976 107.690 -130.782 1.00 37.40  ? 256  VAL B CG1   1 
ATOM   5383  C CG2   . VAL B  1 256 ? 105.842 109.049 -132.501 1.00 35.90  ? 256  VAL B CG2   1 
ATOM   5384  N N     . SER B  1 257 ? 107.916 104.740 -132.480 1.00 39.61  ? 257  SER B N     1 
ATOM   5385  C CA    . SER B  1 257 ? 107.895 103.342 -132.091 1.00 40.99  ? 257  SER B CA    1 
ATOM   5386  C C     . SER B  1 257 ? 107.763 103.181 -130.597 1.00 40.52  ? 257  SER B C     1 
ATOM   5387  O O     . SER B  1 257 ? 108.405 103.897 -129.831 1.00 39.86  ? 257  SER B O     1 
ATOM   5388  C CB    . SER B  1 257 ? 109.150 102.645 -132.590 1.00 42.10  ? 257  SER B CB    1 
ATOM   5389  O OG    . SER B  1 257 ? 109.145 102.632 -134.006 1.00 44.77  ? 257  SER B OG    1 
ATOM   5390  N N     . ILE B  1 258 ? 106.917 102.240 -130.191 1.00 40.79  ? 258  ILE B N     1 
ATOM   5391  C CA    . ILE B  1 258 ? 106.683 101.982 -128.777 1.00 41.92  ? 258  ILE B CA    1 
ATOM   5392  C C     . ILE B  1 258 ? 106.489 100.508 -128.426 1.00 43.42  ? 258  ILE B C     1 
ATOM   5393  O O     . ILE B  1 258 ? 106.055 99.706  -129.253 1.00 42.73  ? 258  ILE B O     1 
ATOM   5394  C CB    . ILE B  1 258 ? 105.437 102.751 -128.253 1.00 40.91  ? 258  ILE B CB    1 
ATOM   5395  C CG1   . ILE B  1 258 ? 104.172 102.201 -128.921 1.00 40.24  ? 258  ILE B CG1   1 
ATOM   5396  C CG2   . ILE B  1 258 ? 105.606 104.258 -128.480 1.00 37.50  ? 258  ILE B CG2   1 
ATOM   5397  C CD1   . ILE B  1 258 ? 102.891 102.736 -128.320 1.00 40.68  ? 258  ILE B CD1   1 
ATOM   5398  N N     . GLU B  1 259 ? 106.824 100.178 -127.177 1.00 45.97  ? 259  GLU B N     1 
ATOM   5399  C CA    . GLU B  1 259 ? 106.678 98.831  -126.625 1.00 48.06  ? 259  GLU B CA    1 
ATOM   5400  C C     . GLU B  1 259 ? 106.248 99.018  -125.201 1.00 48.14  ? 259  GLU B C     1 
ATOM   5401  O O     . GLU B  1 259 ? 106.275 100.123 -124.674 1.00 49.43  ? 259  GLU B O     1 
ATOM   5402  C CB    . GLU B  1 259 ? 107.991 98.067  -126.516 1.00 49.98  ? 259  GLU B CB    1 
ATOM   5403  C CG    . GLU B  1 259 ? 108.993 98.205  -127.609 1.00 54.59  ? 259  GLU B CG    1 
ATOM   5404  C CD    . GLU B  1 259 ? 110.164 97.291  -127.335 1.00 57.78  ? 259  GLU B CD    1 
ATOM   5405  O OE1   . GLU B  1 259 ? 109.960 96.054  -127.348 1.00 59.61  ? 259  GLU B OE1   1 
ATOM   5406  O OE2   . GLU B  1 259 ? 111.275 97.797  -127.080 1.00 59.52  ? 259  GLU B OE2   1 
ATOM   5407  N N     . ALA B  1 260 ? 105.893 97.917  -124.562 1.00 47.87  ? 260  ALA B N     1 
ATOM   5408  C CA    . ALA B  1 260 ? 105.510 97.955  -123.171 1.00 46.73  ? 260  ALA B CA    1 
ATOM   5409  C C     . ALA B  1 260 ? 106.816 98.171  -122.409 1.00 46.88  ? 260  ALA B C     1 
ATOM   5410  O O     . ALA B  1 260 ? 107.880 97.760  -122.865 1.00 46.72  ? 260  ALA B O     1 
ATOM   5411  C CB    . ALA B  1 260 ? 104.879 96.638  -122.786 1.00 46.30  ? 260  ALA B CB    1 
ATOM   5412  N N     . ALA B  1 261 ? 106.749 98.828  -121.262 1.00 47.22  ? 261  ALA B N     1 
ATOM   5413  C CA    . ALA B  1 261 ? 107.958 99.060  -120.490 1.00 48.42  ? 261  ALA B CA    1 
ATOM   5414  C C     . ALA B  1 261 ? 108.630 97.718  -120.176 1.00 49.89  ? 261  ALA B C     1 
ATOM   5415  O O     . ALA B  1 261 ? 109.856 97.595  -120.237 1.00 50.68  ? 261  ALA B O     1 
ATOM   5416  C CB    . ALA B  1 261 ? 107.622 99.796  -119.208 1.00 47.87  ? 261  ALA B CB    1 
ATOM   5417  N N     . SER B  1 262 ? 107.825 96.712  -119.850 1.00 51.13  ? 262  SER B N     1 
ATOM   5418  C CA    . SER B  1 262 ? 108.349 95.381  -119.544 1.00 52.64  ? 262  SER B CA    1 
ATOM   5419  C C     . SER B  1 262 ? 108.677 94.608  -120.834 1.00 53.37  ? 262  SER B C     1 
ATOM   5420  O O     . SER B  1 262 ? 108.716 93.370  -120.832 1.00 53.58  ? 262  SER B O     1 
ATOM   5421  C CB    . SER B  1 262 ? 107.328 94.586  -118.726 1.00 52.77  ? 262  SER B CB    1 
ATOM   5422  O OG    . SER B  1 262 ? 106.111 94.435  -119.446 1.00 53.53  ? 262  SER B OG    1 
ATOM   5423  N N     . GLY B  1 263 ? 108.891 95.346  -121.927 1.00 53.16  ? 263  GLY B N     1 
ATOM   5424  C CA    . GLY B  1 263 ? 109.217 94.743  -123.209 1.00 51.75  ? 263  GLY B CA    1 
ATOM   5425  C C     . GLY B  1 263 ? 108.070 94.087  -123.973 1.00 51.08  ? 263  GLY B C     1 
ATOM   5426  O O     . GLY B  1 263 ? 107.100 93.594  -123.380 1.00 50.71  ? 263  GLY B O     1 
ATOM   5427  N N     . GLY B  1 264 ? 108.186 94.083  -125.302 1.00 50.13  ? 264  GLY B N     1 
ATOM   5428  C CA    . GLY B  1 264 ? 107.167 93.476  -126.140 1.00 49.20  ? 264  GLY B CA    1 
ATOM   5429  C C     . GLY B  1 264 ? 106.039 94.421  -126.485 1.00 48.70  ? 264  GLY B C     1 
ATOM   5430  O O     . GLY B  1 264 ? 106.128 95.617  -126.224 1.00 48.58  ? 264  GLY B O     1 
ATOM   5431  N N     . LYS B  1 265 ? 104.974 93.882  -127.068 1.00 48.11  ? 265  LYS B N     1 
ATOM   5432  C CA    . LYS B  1 265 ? 103.824 94.680  -127.464 1.00 48.47  ? 265  LYS B CA    1 
ATOM   5433  C C     . LYS B  1 265 ? 104.260 95.858  -128.346 1.00 48.02  ? 265  LYS B C     1 
ATOM   5434  O O     . LYS B  1 265 ? 103.851 96.998  -128.142 1.00 47.85  ? 265  LYS B O     1 
ATOM   5435  C CB    . LYS B  1 265 ? 103.081 95.181  -126.219 1.00 50.75  ? 265  LYS B CB    1 
ATOM   5436  C CG    . LYS B  1 265 ? 101.753 95.900  -126.507 1.00 52.90  ? 265  LYS B CG    1 
ATOM   5437  C CD    . LYS B  1 265 ? 101.035 96.275  -125.209 1.00 55.01  ? 265  LYS B CD    1 
ATOM   5438  C CE    . LYS B  1 265 ? 99.878  97.268  -125.421 1.00 56.48  ? 265  LYS B CE    1 
ATOM   5439  N NZ    . LYS B  1 265 ? 98.692  96.708  -126.129 1.00 56.14  ? 265  LYS B NZ    1 
ATOM   5440  N N     . ALA B  1 266 ? 105.092 95.570  -129.338 1.00 46.87  ? 266  ALA B N     1 
ATOM   5441  C CA    . ALA B  1 266 ? 105.579 96.603  -130.245 1.00 46.53  ? 266  ALA B CA    1 
ATOM   5442  C C     . ALA B  1 266 ? 104.451 97.280  -131.006 1.00 46.05  ? 266  ALA B C     1 
ATOM   5443  O O     . ALA B  1 266 ? 103.586 96.627  -131.579 1.00 47.93  ? 266  ALA B O     1 
ATOM   5444  C CB    . ALA B  1 266 ? 106.574 96.008  -131.242 1.00 44.57  ? 266  ALA B CB    1 
ATOM   5445  N N     . GLU B  1 267 ? 104.435 98.598  -131.002 1.00 44.32  ? 267  GLU B N     1 
ATOM   5446  C CA    . GLU B  1 267 ? 103.415 99.285  -131.755 1.00 42.04  ? 267  GLU B CA    1 
ATOM   5447  C C     . GLU B  1 267 ? 104.047 100.523 -132.357 1.00 40.57  ? 267  GLU B C     1 
ATOM   5448  O O     . GLU B  1 267 ? 105.190 100.875 -132.051 1.00 39.16  ? 267  GLU B O     1 
ATOM   5449  C CB    . GLU B  1 267 ? 102.233 99.676  -130.870 1.00 43.01  ? 267  GLU B CB    1 
ATOM   5450  C CG    . GLU B  1 267 ? 101.514 98.528  -130.203 1.00 44.84  ? 267  GLU B CG    1 
ATOM   5451  C CD    . GLU B  1 267 ? 100.282 98.996  -129.419 1.00 48.43  ? 267  GLU B CD    1 
ATOM   5452  O OE1   . GLU B  1 267 ? 100.359 100.042 -128.744 1.00 48.15  ? 267  GLU B OE1   1 
ATOM   5453  O OE2   . GLU B  1 267 ? 99.230  98.316  -129.459 1.00 50.03  ? 267  GLU B OE2   1 
ATOM   5454  N N     . VAL B  1 268 ? 103.302 101.165 -133.242 1.00 39.00  ? 268  VAL B N     1 
ATOM   5455  C CA    . VAL B  1 268 ? 103.764 102.379 -133.882 1.00 38.39  ? 268  VAL B CA    1 
ATOM   5456  C C     . VAL B  1 268 ? 102.628 103.387 -133.919 1.00 38.56  ? 268  VAL B C     1 
ATOM   5457  O O     . VAL B  1 268 ? 101.488 103.035 -134.241 1.00 38.00  ? 268  VAL B O     1 
ATOM   5458  C CB    . VAL B  1 268 ? 104.262 102.113 -135.331 1.00 38.18  ? 268  VAL B CB    1 
ATOM   5459  C CG1   . VAL B  1 268 ? 104.478 103.434 -136.060 1.00 36.53  ? 268  VAL B CG1   1 
ATOM   5460  C CG2   . VAL B  1 268 ? 105.581 101.316 -135.301 1.00 36.89  ? 268  VAL B CG2   1 
ATOM   5461  N N     . ILE B  1 269 ? 102.946 104.631 -133.556 1.00 38.82  ? 269  ILE B N     1 
ATOM   5462  C CA    . ILE B  1 269 ? 101.977 105.720 -133.570 1.00 39.58  ? 269  ILE B CA    1 
ATOM   5463  C C     . ILE B  1 269 ? 102.435 106.797 -134.549 1.00 39.51  ? 269  ILE B C     1 
ATOM   5464  O O     . ILE B  1 269 ? 103.604 107.191 -134.547 1.00 39.65  ? 269  ILE B O     1 
ATOM   5465  C CB    . ILE B  1 269 ? 101.802 106.388 -132.182 1.00 40.83  ? 269  ILE B CB    1 
ATOM   5466  C CG1   . ILE B  1 269 ? 101.309 105.365 -131.149 1.00 41.35  ? 269  ILE B CG1   1 
ATOM   5467  C CG2   . ILE B  1 269 ? 100.804 107.536 -132.299 1.00 39.97  ? 269  ILE B CG2   1 
ATOM   5468  C CD1   . ILE B  1 269 ? 100.003 104.655 -131.521 1.00 42.32  ? 269  ILE B CD1   1 
ATOM   5469  N N     . THR B  1 270 ? 101.514 107.256 -135.395 1.00 39.67  ? 270  THR B N     1 
ATOM   5470  C CA    . THR B  1 270 ? 101.822 108.298 -136.373 1.00 39.20  ? 270  THR B CA    1 
ATOM   5471  C C     . THR B  1 270 ? 101.144 109.616 -135.971 1.00 39.11  ? 270  THR B C     1 
ATOM   5472  O O     . THR B  1 270 ? 99.964  109.644 -135.622 1.00 38.58  ? 270  THR B O     1 
ATOM   5473  C CB    . THR B  1 270 ? 101.359 107.903 -137.816 1.00 38.52  ? 270  THR B CB    1 
ATOM   5474  O OG1   . THR B  1 270 ? 101.817 106.581 -138.135 1.00 37.63  ? 270  THR B OG1   1 
ATOM   5475  C CG2   . THR B  1 270 ? 101.946 108.866 -138.837 1.00 36.32  ? 270  THR B CG2   1 
ATOM   5476  N N     . CYS B  1 271 ? 101.901 110.707 -136.017 1.00 39.41  ? 271  CYS B N     1 
ATOM   5477  C CA    . CYS B  1 271 ? 101.364 112.019 -135.654 1.00 38.90  ? 271  CYS B CA    1 
ATOM   5478  C C     . CYS B  1 271 ? 101.986 113.096 -136.547 1.00 38.09  ? 271  CYS B C     1 
ATOM   5479  O O     . CYS B  1 271 ? 102.887 112.816 -137.337 1.00 37.68  ? 271  CYS B O     1 
ATOM   5480  C CB    . CYS B  1 271 ? 101.686 112.308 -134.192 1.00 38.21  ? 271  CYS B CB    1 
ATOM   5481  S SG    . CYS B  1 271 ? 103.478 112.346 -133.927 1.00 36.68  ? 271  CYS B SG    1 
ATOM   5482  N N     . ASP B  1 272 ? 101.499 114.324 -136.418 1.00 39.07  ? 272  ASP B N     1 
ATOM   5483  C CA    . ASP B  1 272 ? 102.013 115.448 -137.212 1.00 39.56  ? 272  ASP B CA    1 
ATOM   5484  C C     . ASP B  1 272 ? 103.074 116.231 -136.434 1.00 38.65  ? 272  ASP B C     1 
ATOM   5485  O O     . ASP B  1 272 ? 103.945 116.880 -137.012 1.00 38.53  ? 272  ASP B O     1 
ATOM   5486  C CB    . ASP B  1 272 ? 100.862 116.374 -137.610 1.00 40.14  ? 272  ASP B CB    1 
ATOM   5487  C CG    . ASP B  1 272 ? 99.786  115.652 -138.402 1.00 43.44  ? 272  ASP B CG    1 
ATOM   5488  O OD1   . ASP B  1 272 ? 99.964  115.443 -139.628 1.00 42.89  ? 272  ASP B OD1   1 
ATOM   5489  O OD2   . ASP B  1 272 ? 98.761  115.278 -137.789 1.00 45.44  ? 272  ASP B OD2   1 
ATOM   5490  N N     . VAL B  1 273 ? 103.002 116.148 -135.113 1.00 38.33  ? 273  VAL B N     1 
ATOM   5491  C CA    . VAL B  1 273 ? 103.956 116.826 -134.250 1.00 36.83  ? 273  VAL B CA    1 
ATOM   5492  C C     . VAL B  1 273 ? 104.325 115.931 -133.082 1.00 37.02  ? 273  VAL B C     1 
ATOM   5493  O O     . VAL B  1 273 ? 103.474 115.256 -132.494 1.00 35.20  ? 273  VAL B O     1 
ATOM   5494  C CB    . VAL B  1 273 ? 103.380 118.155 -133.720 1.00 36.60  ? 273  VAL B CB    1 
ATOM   5495  C CG1   . VAL B  1 273 ? 104.231 118.695 -132.610 1.00 33.95  ? 273  VAL B CG1   1 
ATOM   5496  C CG2   . VAL B  1 273 ? 103.320 119.164 -134.850 1.00 35.45  ? 273  VAL B CG2   1 
ATOM   5497  N N     . LEU B  1 274 ? 105.618 115.909 -132.778 1.00 36.92  ? 274  LEU B N     1 
ATOM   5498  C CA    . LEU B  1 274 ? 106.143 115.133 -131.667 1.00 35.95  ? 274  LEU B CA    1 
ATOM   5499  C C     . LEU B  1 274 ? 106.792 116.077 -130.659 1.00 35.26  ? 274  LEU B C     1 
ATOM   5500  O O     . LEU B  1 274 ? 107.696 116.841 -131.003 1.00 34.89  ? 274  LEU B O     1 
ATOM   5501  C CB    . LEU B  1 274 ? 107.176 114.124 -132.160 1.00 34.76  ? 274  LEU B CB    1 
ATOM   5502  C CG    . LEU B  1 274 ? 107.779 113.228 -131.074 1.00 35.35  ? 274  LEU B CG    1 
ATOM   5503  C CD1   . LEU B  1 274 ? 106.688 112.374 -130.416 1.00 33.60  ? 274  LEU B CD1   1 
ATOM   5504  C CD2   . LEU B  1 274 ? 108.833 112.335 -131.692 1.00 33.59  ? 274  LEU B CD2   1 
ATOM   5505  N N     . LEU B  1 275 ? 106.306 116.013 -129.419 1.00 35.31  ? 275  LEU B N     1 
ATOM   5506  C CA    . LEU B  1 275 ? 106.810 116.826 -128.314 1.00 33.57  ? 275  LEU B CA    1 
ATOM   5507  C C     . LEU B  1 275 ? 107.604 115.912 -127.395 1.00 34.21  ? 275  LEU B C     1 
ATOM   5508  O O     . LEU B  1 275 ? 107.070 115.005 -126.762 1.00 33.86  ? 275  LEU B O     1 
ATOM   5509  C CB    . LEU B  1 275 ? 105.661 117.457 -127.535 1.00 32.89  ? 275  LEU B CB    1 
ATOM   5510  C CG    . LEU B  1 275 ? 105.903 117.975 -126.106 1.00 33.79  ? 275  LEU B CG    1 
ATOM   5511  C CD1   . LEU B  1 275 ? 107.066 118.950 -126.049 1.00 31.85  ? 275  LEU B CD1   1 
ATOM   5512  C CD2   . LEU B  1 275 ? 104.638 118.636 -125.611 1.00 32.85  ? 275  LEU B CD2   1 
ATOM   5513  N N     . VAL B  1 276 ? 108.903 116.149 -127.336 1.00 34.94  ? 276  VAL B N     1 
ATOM   5514  C CA    . VAL B  1 276 ? 109.794 115.348 -126.501 1.00 37.09  ? 276  VAL B CA    1 
ATOM   5515  C C     . VAL B  1 276 ? 109.878 116.134 -125.174 1.00 38.81  ? 276  VAL B C     1 
ATOM   5516  O O     . VAL B  1 276 ? 110.414 117.264 -125.086 1.00 40.09  ? 276  VAL B O     1 
ATOM   5517  C CB    . VAL B  1 276 ? 111.161 115.237 -127.110 1.00 36.25  ? 276  VAL B CB    1 
ATOM   5518  C CG1   . VAL B  1 276 ? 112.054 114.388 -126.234 1.00 33.50  ? 276  VAL B CG1   1 
ATOM   5519  C CG2   . VAL B  1 276 ? 110.979 114.689 -128.464 1.00 35.61  ? 276  VAL B CG2   1 
ATOM   5520  N N     . CYS B  1 277 ? 109.254 115.554 -124.153 1.00 39.70  ? 277  CYS B N     1 
ATOM   5521  C CA    . CYS B  1 277 ? 109.158 116.188 -122.835 1.00 40.96  ? 277  CYS B CA    1 
ATOM   5522  C C     . CYS B  1 277 ? 109.578 115.248 -121.757 1.00 40.42  ? 277  CYS B C     1 
ATOM   5523  O O     . CYS B  1 277 ? 108.808 114.944 -120.862 1.00 41.01  ? 277  CYS B O     1 
ATOM   5524  C CB    . CYS B  1 277 ? 107.723 116.520 -122.555 1.00 42.27  ? 277  CYS B CB    1 
ATOM   5525  S SG    . CYS B  1 277 ? 107.510 118.141 -121.957 1.00 49.98  ? 277  CYS B SG    1 
ATOM   5526  N N     . ILE B  1 278 ? 110.779 114.720 -121.855 1.00 40.37  ? 278  ILE B N     1 
ATOM   5527  C CA    . ILE B  1 278 ? 111.207 113.775 -120.839 1.00 39.49  ? 278  ILE B CA    1 
ATOM   5528  C C     . ILE B  1 278 ? 112.051 114.386 -119.734 1.00 39.91  ? 278  ILE B C     1 
ATOM   5529  O O     . ILE B  1 278 ? 112.982 113.768 -119.200 1.00 40.82  ? 278  ILE B O     1 
ATOM   5530  C CB    . ILE B  1 278 ? 111.994 112.641 -121.489 1.00 39.85  ? 278  ILE B CB    1 
ATOM   5531  C CG1   . ILE B  1 278 ? 113.295 113.197 -122.097 1.00 40.61  ? 278  ILE B CG1   1 
ATOM   5532  C CG2   . ILE B  1 278 ? 111.170 111.997 -122.458 1.00 38.84  ? 278  ILE B CG2   1 
ATOM   5533  C CD1   . ILE B  1 278 ? 114.394 112.145 -122.338 1.00 39.03  ? 278  ILE B CD1   1 
ATOM   5534  N N     . GLY B  1 279 ? 111.736 115.616 -119.399 1.00 39.09  ? 279  GLY B N     1 
ATOM   5535  C CA    . GLY B  1 279 ? 112.466 116.282 -118.343 1.00 38.40  ? 279  GLY B CA    1 
ATOM   5536  C C     . GLY B  1 279 ? 113.456 117.365 -118.717 1.00 37.51  ? 279  GLY B C     1 
ATOM   5537  O O     . GLY B  1 279 ? 113.697 117.646 -119.890 1.00 36.26  ? 279  GLY B O     1 
ATOM   5538  N N     . ARG B  1 280 ? 114.036 117.962 -117.681 1.00 37.28  ? 280  ARG B N     1 
ATOM   5539  C CA    . ARG B  1 280 ? 115.022 119.010 -117.829 1.00 37.66  ? 280  ARG B CA    1 
ATOM   5540  C C     . ARG B  1 280 ? 116.220 118.641 -116.954 1.00 40.10  ? 280  ARG B C     1 
ATOM   5541  O O     . ARG B  1 280 ? 116.116 117.816 -116.028 1.00 41.23  ? 280  ARG B O     1 
ATOM   5542  C CB    . ARG B  1 280 ? 114.434 120.349 -117.400 1.00 35.00  ? 280  ARG B CB    1 
ATOM   5543  C CG    . ARG B  1 280 ? 113.283 120.824 -118.264 1.00 33.91  ? 280  ARG B CG    1 
ATOM   5544  C CD    . ARG B  1 280 ? 112.737 122.144 -117.756 1.00 34.75  ? 280  ARG B CD    1 
ATOM   5545  N NE    . ARG B  1 280 ? 113.708 123.216 -117.931 1.00 37.09  ? 280  ARG B NE    1 
ATOM   5546  C CZ    . ARG B  1 280 ? 114.038 123.739 -119.109 1.00 38.57  ? 280  ARG B CZ    1 
ATOM   5547  N NH1   . ARG B  1 280 ? 113.465 123.294 -120.222 1.00 37.10  ? 280  ARG B NH1   1 
ATOM   5548  N NH2   . ARG B  1 280 ? 114.960 124.691 -119.179 1.00 38.75  ? 280  ARG B NH2   1 
ATOM   5549  N N     . ARG B  1 281 ? 117.360 119.249 -117.266 1.00 40.02  ? 281  ARG B N     1 
ATOM   5550  C CA    . ARG B  1 281 ? 118.599 119.001 -116.539 1.00 39.71  ? 281  ARG B CA    1 
ATOM   5551  C C     . ARG B  1 281 ? 119.359 120.299 -116.275 1.00 38.64  ? 281  ARG B C     1 
ATOM   5552  O O     . ARG B  1 281 ? 119.219 121.285 -117.003 1.00 36.31  ? 281  ARG B O     1 
ATOM   5553  C CB    . ARG B  1 281 ? 119.478 118.070 -117.352 1.00 39.76  ? 281  ARG B CB    1 
ATOM   5554  C CG    . ARG B  1 281 ? 119.786 118.629 -118.726 1.00 40.62  ? 281  ARG B CG    1 
ATOM   5555  C CD    . ARG B  1 281 ? 120.617 117.654 -119.501 1.00 42.63  ? 281  ARG B CD    1 
ATOM   5556  N NE    . ARG B  1 281 ? 121.138 118.209 -120.742 1.00 43.71  ? 281  ARG B NE    1 
ATOM   5557  C CZ    . ARG B  1 281 ? 121.780 117.487 -121.657 1.00 44.99  ? 281  ARG B CZ    1 
ATOM   5558  N NH1   . ARG B  1 281 ? 121.974 116.176 -121.468 1.00 42.71  ? 281  ARG B NH1   1 
ATOM   5559  N NH2   . ARG B  1 281 ? 122.238 118.077 -122.756 1.00 43.78  ? 281  ARG B NH2   1 
ATOM   5560  N N     . PRO B  1 282 ? 120.185 120.310 -115.227 1.00 39.26  ? 282  PRO B N     1 
ATOM   5561  C CA    . PRO B  1 282 ? 120.943 121.528 -114.919 1.00 40.55  ? 282  PRO B CA    1 
ATOM   5562  C C     . PRO B  1 282 ? 121.904 121.979 -116.033 1.00 42.08  ? 282  PRO B C     1 
ATOM   5563  O O     . PRO B  1 282 ? 122.578 121.167 -116.665 1.00 41.14  ? 282  PRO B O     1 
ATOM   5564  C CB    . PRO B  1 282 ? 121.643 121.177 -113.599 1.00 39.95  ? 282  PRO B CB    1 
ATOM   5565  C CG    . PRO B  1 282 ? 121.658 119.649 -113.581 1.00 38.71  ? 282  PRO B CG    1 
ATOM   5566  C CD    . PRO B  1 282 ? 120.345 119.285 -114.180 1.00 37.91  ? 282  PRO B CD    1 
ATOM   5567  N N     . PHE B  1 283 ? 121.941 123.282 -116.275 1.00 43.76  ? 283  PHE B N     1 
ATOM   5568  C CA    . PHE B  1 283 ? 122.798 123.846 -117.306 1.00 47.03  ? 283  PHE B CA    1 
ATOM   5569  C C     . PHE B  1 283 ? 124.053 124.470 -116.694 1.00 48.54  ? 283  PHE B C     1 
ATOM   5570  O O     . PHE B  1 283 ? 123.966 125.358 -115.859 1.00 48.58  ? 283  PHE B O     1 
ATOM   5571  C CB    . PHE B  1 283 ? 122.017 124.902 -118.086 1.00 47.50  ? 283  PHE B CB    1 
ATOM   5572  C CG    . PHE B  1 283 ? 122.689 125.352 -119.345 1.00 50.54  ? 283  PHE B CG    1 
ATOM   5573  C CD1   . PHE B  1 283 ? 123.788 126.203 -119.307 1.00 50.83  ? 283  PHE B CD1   1 
ATOM   5574  C CD2   . PHE B  1 283 ? 122.210 124.930 -120.589 1.00 52.63  ? 283  PHE B CD2   1 
ATOM   5575  C CE1   . PHE B  1 283 ? 124.403 126.629 -120.493 1.00 50.36  ? 283  PHE B CE1   1 
ATOM   5576  C CE2   . PHE B  1 283 ? 122.818 125.349 -121.778 1.00 51.43  ? 283  PHE B CE2   1 
ATOM   5577  C CZ    . PHE B  1 283 ? 123.916 126.200 -121.725 1.00 50.07  ? 283  PHE B CZ    1 
ATOM   5578  N N     . THR B  1 284 ? 125.220 123.999 -117.114 1.00 51.13  ? 284  THR B N     1 
ATOM   5579  C CA    . THR B  1 284 ? 126.480 124.524 -116.604 1.00 54.17  ? 284  THR B CA    1 
ATOM   5580  C C     . THR B  1 284 ? 127.595 124.611 -117.654 1.00 56.68  ? 284  THR B C     1 
ATOM   5581  O O     . THR B  1 284 ? 128.716 124.981 -117.326 1.00 56.47  ? 284  THR B O     1 
ATOM   5582  C CB    . THR B  1 284 ? 126.982 123.657 -115.454 1.00 53.17  ? 284  THR B CB    1 
ATOM   5583  O OG1   . THR B  1 284 ? 126.707 122.288 -115.755 1.00 53.53  ? 284  THR B OG1   1 
ATOM   5584  C CG2   . THR B  1 284 ? 126.301 124.024 -114.166 1.00 53.09  ? 284  THR B CG2   1 
ATOM   5585  N N     . LYS B  1 285 ? 127.277 124.285 -118.907 1.00 60.17  ? 285  LYS B N     1 
ATOM   5586  C CA    . LYS B  1 285 ? 128.248 124.291 -120.007 1.00 63.13  ? 285  LYS B CA    1 
ATOM   5587  C C     . LYS B  1 285 ? 129.190 125.501 -120.045 1.00 64.90  ? 285  LYS B C     1 
ATOM   5588  O O     . LYS B  1 285 ? 128.759 126.646 -119.888 1.00 64.67  ? 285  LYS B O     1 
ATOM   5589  C CB    . LYS B  1 285 ? 127.522 124.159 -121.363 1.00 63.06  ? 285  LYS B CB    1 
ATOM   5590  C CG    . LYS B  1 285 ? 128.473 124.042 -122.559 1.00 65.65  ? 285  LYS B CG    1 
ATOM   5591  C CD    . LYS B  1 285 ? 127.766 123.775 -123.885 1.00 66.88  ? 285  LYS B CD    1 
ATOM   5592  C CE    . LYS B  1 285 ? 126.798 124.894 -124.240 1.00 68.34  ? 285  LYS B CE    1 
ATOM   5593  N NZ    . LYS B  1 285 ? 127.454 126.236 -124.306 1.00 68.54  ? 285  LYS B NZ    1 
ATOM   5594  N N     . ASN B  1 286 ? 130.478 125.219 -120.254 1.00 67.16  ? 286  ASN B N     1 
ATOM   5595  C CA    . ASN B  1 286 ? 131.531 126.233 -120.334 1.00 68.97  ? 286  ASN B CA    1 
ATOM   5596  C C     . ASN B  1 286 ? 131.380 127.356 -119.330 1.00 70.00  ? 286  ASN B C     1 
ATOM   5597  O O     . ASN B  1 286 ? 131.417 128.533 -119.691 1.00 70.18  ? 286  ASN B O     1 
ATOM   5598  C CB    . ASN B  1 286 ? 131.598 126.841 -121.742 1.00 68.85  ? 286  ASN B CB    1 
ATOM   5599  C CG    . ASN B  1 286 ? 131.856 125.807 -122.811 1.00 69.08  ? 286  ASN B CG    1 
ATOM   5600  O OD1   . ASN B  1 286 ? 132.589 124.836 -122.591 1.00 69.83  ? 286  ASN B OD1   1 
ATOM   5601  N ND2   . ASN B  1 286 ? 131.267 126.014 -123.985 1.00 68.83  ? 286  ASN B ND2   1 
ATOM   5602  N N     . LEU B  1 287 ? 131.181 126.996 -118.073 1.00 71.15  ? 287  LEU B N     1 
ATOM   5603  C CA    . LEU B  1 287 ? 131.038 128.007 -117.043 1.00 72.28  ? 287  LEU B CA    1 
ATOM   5604  C C     . LEU B  1 287 ? 132.389 128.170 -116.360 1.00 73.08  ? 287  LEU B C     1 
ATOM   5605  O O     . LEU B  1 287 ? 132.656 129.173 -115.689 1.00 73.03  ? 287  LEU B O     1 
ATOM   5606  C CB    . LEU B  1 287 ? 129.977 127.573 -116.039 1.00 72.50  ? 287  LEU B CB    1 
ATOM   5607  C CG    . LEU B  1 287 ? 129.339 128.657 -115.157 1.00 72.17  ? 287  LEU B CG    1 
ATOM   5608  C CD1   . LEU B  1 287 ? 128.741 129.736 -116.047 1.00 72.08  ? 287  LEU B CD1   1 
ATOM   5609  C CD2   . LEU B  1 287 ? 128.266 128.050 -114.250 1.00 71.57  ? 287  LEU B CD2   1 
ATOM   5610  N N     . GLY B  1 288 ? 133.249 127.184 -116.578 1.00 73.79  ? 288  GLY B N     1 
ATOM   5611  C CA    . GLY B  1 288 ? 134.575 127.231 -115.996 1.00 74.94  ? 288  GLY B CA    1 
ATOM   5612  C C     . GLY B  1 288 ? 134.703 126.366 -114.764 1.00 75.67  ? 288  GLY B C     1 
ATOM   5613  O O     . GLY B  1 288 ? 135.755 126.326 -114.133 1.00 76.71  ? 288  GLY B O     1 
ATOM   5614  N N     . LEU B  1 289 ? 133.631 125.674 -114.408 1.00 75.87  ? 289  LEU B N     1 
ATOM   5615  C CA    . LEU B  1 289 ? 133.671 124.807 -113.243 1.00 76.51  ? 289  LEU B CA    1 
ATOM   5616  C C     . LEU B  1 289 ? 134.557 123.622 -113.574 1.00 77.44  ? 289  LEU B C     1 
ATOM   5617  O O     . LEU B  1 289 ? 135.336 123.159 -112.740 1.00 77.11  ? 289  LEU B O     1 
ATOM   5618  C CB    . LEU B  1 289 ? 132.277 124.285 -112.916 1.00 75.96  ? 289  LEU B CB    1 
ATOM   5619  C CG    . LEU B  1 289 ? 131.128 125.281 -112.882 1.00 75.21  ? 289  LEU B CG    1 
ATOM   5620  C CD1   . LEU B  1 289 ? 129.848 124.534 -112.592 1.00 75.53  ? 289  LEU B CD1   1 
ATOM   5621  C CD2   . LEU B  1 289 ? 131.382 126.329 -111.830 1.00 74.61  ? 289  LEU B CD2   1 
ATOM   5622  N N     . GLU B  1 290 ? 134.410 123.132 -114.805 1.00 78.99  ? 290  GLU B N     1 
ATOM   5623  C CA    . GLU B  1 290 ? 135.166 121.987 -115.291 1.00 79.70  ? 290  GLU B CA    1 
ATOM   5624  C C     . GLU B  1 290 ? 136.636 122.276 -115.057 1.00 80.28  ? 290  GLU B C     1 
ATOM   5625  O O     . GLU B  1 290 ? 137.450 121.369 -114.893 1.00 80.85  ? 290  GLU B O     1 
ATOM   5626  C CB    . GLU B  1 290 ? 134.910 121.786 -116.796 1.00 79.89  ? 290  GLU B CB    1 
ATOM   5627  C CG    . GLU B  1 290 ? 133.438 121.865 -117.215 1.00 78.91  ? 290  GLU B CG    1 
ATOM   5628  C CD    . GLU B  1 290 ? 133.094 123.154 -117.951 1.00 78.36  ? 290  GLU B CD    1 
ATOM   5629  O OE1   . GLU B  1 290 ? 133.424 124.250 -117.446 1.00 75.57  ? 290  GLU B OE1   1 
ATOM   5630  O OE2   . GLU B  1 290 ? 132.482 123.064 -119.038 1.00 78.88  ? 290  GLU B OE2   1 
ATOM   5631  N N     . GLU B  1 291 ? 136.948 123.564 -115.012 1.00 80.74  ? 291  GLU B N     1 
ATOM   5632  C CA    . GLU B  1 291 ? 138.307 124.054 -114.845 1.00 80.67  ? 291  GLU B CA    1 
ATOM   5633  C C     . GLU B  1 291 ? 138.604 124.494 -113.402 1.00 79.33  ? 291  GLU B C     1 
ATOM   5634  O O     . GLU B  1 291 ? 139.675 124.229 -112.857 1.00 79.55  ? 291  GLU B O     1 
ATOM   5635  C CB    . GLU B  1 291 ? 138.485 125.213 -115.842 1.00 82.39  ? 291  GLU B CB    1 
ATOM   5636  C CG    . GLU B  1 291 ? 139.877 125.771 -115.997 1.00 85.09  ? 291  GLU B CG    1 
ATOM   5637  C CD    . GLU B  1 291 ? 140.370 126.412 -114.723 1.00 87.08  ? 291  GLU B CD    1 
ATOM   5638  O OE1   . GLU B  1 291 ? 139.547 127.063 -114.043 1.00 86.82  ? 291  GLU B OE1   1 
ATOM   5639  O OE2   . GLU B  1 291 ? 141.573 126.270 -114.404 1.00 88.39  ? 291  GLU B OE2   1 
ATOM   5640  N N     . LEU B  1 292 ? 137.624 125.149 -112.794 1.00 78.16  ? 292  LEU B N     1 
ATOM   5641  C CA    . LEU B  1 292 ? 137.693 125.695 -111.435 1.00 75.99  ? 292  LEU B CA    1 
ATOM   5642  C C     . LEU B  1 292 ? 137.779 124.704 -110.260 1.00 74.73  ? 292  LEU B C     1 
ATOM   5643  O O     . LEU B  1 292 ? 138.074 125.103 -109.134 1.00 73.39  ? 292  LEU B O     1 
ATOM   5644  C CB    . LEU B  1 292 ? 136.482 126.612 -111.253 1.00 75.75  ? 292  LEU B CB    1 
ATOM   5645  C CG    . LEU B  1 292 ? 136.182 127.364 -109.969 1.00 75.39  ? 292  LEU B CG    1 
ATOM   5646  C CD1   . LEU B  1 292 ? 137.254 128.393 -109.702 1.00 75.65  ? 292  LEU B CD1   1 
ATOM   5647  C CD2   . LEU B  1 292 ? 134.831 128.037 -110.123 1.00 74.53  ? 292  LEU B CD2   1 
ATOM   5648  N N     . GLY B  1 293 ? 137.511 123.426 -110.510 1.00 73.99  ? 293  GLY B N     1 
ATOM   5649  C CA    . GLY B  1 293 ? 137.572 122.444 -109.438 1.00 73.12  ? 293  GLY B CA    1 
ATOM   5650  C C     . GLY B  1 293 ? 136.216 122.037 -108.879 1.00 72.45  ? 293  GLY B C     1 
ATOM   5651  O O     . GLY B  1 293 ? 136.127 121.251 -107.925 1.00 72.81  ? 293  GLY B O     1 
ATOM   5652  N N     . ILE B  1 294 ? 135.156 122.579 -109.470 1.00 71.09  ? 294  ILE B N     1 
ATOM   5653  C CA    . ILE B  1 294 ? 133.797 122.274 -109.046 1.00 69.03  ? 294  ILE B CA    1 
ATOM   5654  C C     . ILE B  1 294 ? 133.320 121.008 -109.748 1.00 67.50  ? 294  ILE B C     1 
ATOM   5655  O O     . ILE B  1 294 ? 132.964 121.034 -110.922 1.00 66.06  ? 294  ILE B O     1 
ATOM   5656  C CB    . ILE B  1 294 ? 132.842 123.424 -109.408 1.00 68.92  ? 294  ILE B CB    1 
ATOM   5657  C CG1   . ILE B  1 294 ? 133.318 124.728 -108.768 1.00 68.66  ? 294  ILE B CG1   1 
ATOM   5658  C CG2   . ILE B  1 294 ? 131.441 123.098 -108.940 1.00 69.16  ? 294  ILE B CG2   1 
ATOM   5659  C CD1   . ILE B  1 294 ? 133.295 124.714 -107.268 1.00 68.91  ? 294  ILE B CD1   1 
ATOM   5660  N N     . GLU B  1 295 ? 133.329 119.895 -109.028 1.00 67.29  ? 295  GLU B N     1 
ATOM   5661  C CA    . GLU B  1 295 ? 132.882 118.625 -109.594 1.00 66.96  ? 295  GLU B CA    1 
ATOM   5662  C C     . GLU B  1 295 ? 131.366 118.511 -109.470 1.00 65.43  ? 295  GLU B C     1 
ATOM   5663  O O     . GLU B  1 295 ? 130.823 118.714 -108.383 1.00 65.23  ? 295  GLU B O     1 
ATOM   5664  C CB    . GLU B  1 295 ? 133.509 117.446 -108.852 1.00 68.40  ? 295  GLU B CB    1 
ATOM   5665  C CG    . GLU B  1 295 ? 135.007 117.307 -108.994 1.00 71.98  ? 295  GLU B CG    1 
ATOM   5666  C CD    . GLU B  1 295 ? 135.497 115.992 -108.420 1.00 74.79  ? 295  GLU B CD    1 
ATOM   5667  O OE1   . GLU B  1 295 ? 135.247 115.730 -107.219 1.00 75.76  ? 295  GLU B OE1   1 
ATOM   5668  O OE2   . GLU B  1 295 ? 136.127 115.213 -109.172 1.00 76.43  ? 295  GLU B OE2   1 
ATOM   5669  N N     . LEU B  1 296 ? 130.692 118.183 -110.573 1.00 62.47  ? 296  LEU B N     1 
ATOM   5670  C CA    . LEU B  1 296 ? 129.239 118.023 -110.571 1.00 59.39  ? 296  LEU B CA    1 
ATOM   5671  C C     . LEU B  1 296 ? 128.877 116.640 -110.034 1.00 58.85  ? 296  LEU B C     1 
ATOM   5672  O O     . LEU B  1 296 ? 129.741 115.767 -109.945 1.00 58.73  ? 296  LEU B O     1 
ATOM   5673  C CB    . LEU B  1 296 ? 128.696 118.166 -111.986 1.00 56.72  ? 296  LEU B CB    1 
ATOM   5674  C CG    . LEU B  1 296 ? 128.972 119.492 -112.679 1.00 56.30  ? 296  LEU B CG    1 
ATOM   5675  C CD1   . LEU B  1 296 ? 128.523 119.398 -114.119 1.00 54.78  ? 296  LEU B CD1   1 
ATOM   5676  C CD2   . LEU B  1 296 ? 128.256 120.621 -111.953 1.00 55.31  ? 296  LEU B CD2   1 
ATOM   5677  N N     . ASP B  1 297 ? 127.611 116.443 -109.663 1.00 58.25  ? 297  ASP B N     1 
ATOM   5678  C CA    . ASP B  1 297 ? 127.163 115.140 -109.160 1.00 57.61  ? 297  ASP B CA    1 
ATOM   5679  C C     . ASP B  1 297 ? 126.819 114.335 -110.399 1.00 56.84  ? 297  ASP B C     1 
ATOM   5680  O O     . ASP B  1 297 ? 126.905 114.855 -111.506 1.00 56.20  ? 297  ASP B O     1 
ATOM   5681  C CB    . ASP B  1 297 ? 125.947 115.289 -108.216 1.00 58.83  ? 297  ASP B CB    1 
ATOM   5682  C CG    . ASP B  1 297 ? 124.644 115.629 -108.942 1.00 59.96  ? 297  ASP B CG    1 
ATOM   5683  O OD1   . ASP B  1 297 ? 124.659 115.962 -110.141 1.00 61.14  ? 297  ASP B OD1   1 
ATOM   5684  O OD2   . ASP B  1 297 ? 123.584 115.569 -108.293 1.00 59.99  ? 297  ASP B OD2   1 
ATOM   5685  N N     . PRO B  1 298 ? 126.421 113.065 -110.246 1.00 56.99  ? 298  PRO B N     1 
ATOM   5686  C CA    . PRO B  1 298 ? 126.102 112.301 -111.457 1.00 56.61  ? 298  PRO B CA    1 
ATOM   5687  C C     . PRO B  1 298 ? 124.996 112.885 -112.347 1.00 55.99  ? 298  PRO B C     1 
ATOM   5688  O O     . PRO B  1 298 ? 124.980 112.636 -113.552 1.00 57.05  ? 298  PRO B O     1 
ATOM   5689  C CB    . PRO B  1 298 ? 125.756 110.922 -110.906 1.00 56.34  ? 298  PRO B CB    1 
ATOM   5690  C CG    . PRO B  1 298 ? 125.141 111.247 -109.577 1.00 57.86  ? 298  PRO B CG    1 
ATOM   5691  C CD    . PRO B  1 298 ? 126.083 112.297 -109.034 1.00 57.07  ? 298  PRO B CD    1 
ATOM   5692  N N     . ARG B  1 299 ? 124.086 113.666 -111.766 1.00 54.93  ? 299  ARG B N     1 
ATOM   5693  C CA    . ARG B  1 299 ? 122.990 114.271 -112.531 1.00 53.03  ? 299  ARG B CA    1 
ATOM   5694  C C     . ARG B  1 299 ? 123.329 115.630 -113.140 1.00 50.94  ? 299  ARG B C     1 
ATOM   5695  O O     . ARG B  1 299 ? 122.487 116.257 -113.775 1.00 50.48  ? 299  ARG B O     1 
ATOM   5696  C CB    . ARG B  1 299 ? 121.745 114.404 -111.650 1.00 54.33  ? 299  ARG B CB    1 
ATOM   5697  C CG    . ARG B  1 299 ? 121.089 113.079 -111.293 1.00 55.60  ? 299  ARG B CG    1 
ATOM   5698  C CD    . ARG B  1 299 ? 119.925 113.286 -110.339 1.00 57.03  ? 299  ARG B CD    1 
ATOM   5699  N NE    . ARG B  1 299 ? 118.895 114.132 -110.929 1.00 59.73  ? 299  ARG B NE    1 
ATOM   5700  C CZ    . ARG B  1 299 ? 117.819 114.557 -110.274 1.00 61.26  ? 299  ARG B CZ    1 
ATOM   5701  N NH1   . ARG B  1 299 ? 117.648 114.206 -109.005 1.00 61.19  ? 299  ARG B NH1   1 
ATOM   5702  N NH2   . ARG B  1 299 ? 116.916 115.329 -110.882 1.00 61.29  ? 299  ARG B NH2   1 
ATOM   5703  N N     . GLY B  1 300 ? 124.568 116.073 -112.947 1.00 49.45  ? 300  GLY B N     1 
ATOM   5704  C CA    . GLY B  1 300 ? 125.010 117.345 -113.487 1.00 46.74  ? 300  GLY B CA    1 
ATOM   5705  C C     . GLY B  1 300 ? 124.704 118.535 -112.601 1.00 46.04  ? 300  GLY B C     1 
ATOM   5706  O O     . GLY B  1 300 ? 124.766 119.675 -113.055 1.00 44.52  ? 300  GLY B O     1 
ATOM   5707  N N     . ARG B  1 301 ? 124.371 118.283 -111.339 1.00 45.47  ? 301  ARG B N     1 
ATOM   5708  C CA    . ARG B  1 301 ? 124.062 119.373 -110.424 1.00 46.32  ? 301  ARG B CA    1 
ATOM   5709  C C     . ARG B  1 301 ? 125.293 119.817 -109.646 1.00 46.20  ? 301  ARG B C     1 
ATOM   5710  O O     . ARG B  1 301 ? 126.219 119.036 -109.421 1.00 45.87  ? 301  ARG B O     1 
ATOM   5711  C CB    . ARG B  1 301 ? 122.968 118.972 -109.425 1.00 46.98  ? 301  ARG B CB    1 
ATOM   5712  C CG    . ARG B  1 301 ? 121.545 118.915 -109.962 1.00 48.45  ? 301  ARG B CG    1 
ATOM   5713  C CD    . ARG B  1 301 ? 121.156 117.511 -110.391 1.00 52.37  ? 301  ARG B CD    1 
ATOM   5714  N NE    . ARG B  1 301 ? 121.257 116.526 -109.308 1.00 54.82  ? 301  ARG B NE    1 
ATOM   5715  C CZ    . ARG B  1 301 ? 120.340 116.337 -108.360 1.00 55.18  ? 301  ARG B CZ    1 
ATOM   5716  N NH1   . ARG B  1 301 ? 119.228 117.063 -108.342 1.00 55.51  ? 301  ARG B NH1   1 
ATOM   5717  N NH2   . ARG B  1 301 ? 120.537 115.419 -107.424 1.00 55.39  ? 301  ARG B NH2   1 
ATOM   5718  N N     . ILE B  1 302 ? 125.292 121.082 -109.239 1.00 45.48  ? 302  ILE B N     1 
ATOM   5719  C CA    . ILE B  1 302 ? 126.387 121.629 -108.467 1.00 44.32  ? 302  ILE B CA    1 
ATOM   5720  C C     . ILE B  1 302 ? 126.160 121.350 -106.983 1.00 44.79  ? 302  ILE B C     1 
ATOM   5721  O O     . ILE B  1 302 ? 125.179 121.813 -106.404 1.00 43.80  ? 302  ILE B O     1 
ATOM   5722  C CB    . ILE B  1 302 ? 126.481 123.125 -108.655 1.00 43.29  ? 302  ILE B CB    1 
ATOM   5723  C CG1   . ILE B  1 302 ? 126.529 123.453 -110.139 1.00 41.85  ? 302  ILE B CG1   1 
ATOM   5724  C CG2   . ILE B  1 302 ? 127.710 123.648 -107.937 1.00 43.97  ? 302  ILE B CG2   1 
ATOM   5725  C CD1   . ILE B  1 302 ? 126.659 124.922 -110.431 1.00 42.76  ? 302  ILE B CD1   1 
ATOM   5726  N N     . PRO B  1 303 ? 127.063 120.581 -106.349 1.00 45.04  ? 303  PRO B N     1 
ATOM   5727  C CA    . PRO B  1 303 ? 126.909 120.272 -104.925 1.00 45.55  ? 303  PRO B CA    1 
ATOM   5728  C C     . PRO B  1 303 ? 127.063 121.526 -104.071 1.00 46.28  ? 303  PRO B C     1 
ATOM   5729  O O     . PRO B  1 303 ? 127.978 122.327 -104.284 1.00 46.39  ? 303  PRO B O     1 
ATOM   5730  C CB    . PRO B  1 303 ? 128.020 119.250 -104.672 1.00 45.68  ? 303  PRO B CB    1 
ATOM   5731  C CG    . PRO B  1 303 ? 128.159 118.564 -106.000 1.00 44.04  ? 303  PRO B CG    1 
ATOM   5732  C CD    . PRO B  1 303 ? 128.128 119.755 -106.938 1.00 44.96  ? 303  PRO B CD    1 
ATOM   5733  N N     . VAL B  1 304 ? 126.153 121.703 -103.118 1.00 46.39  ? 304  VAL B N     1 
ATOM   5734  C CA    . VAL B  1 304 ? 126.190 122.865 -102.236 1.00 45.89  ? 304  VAL B CA    1 
ATOM   5735  C C     . VAL B  1 304 ? 125.839 122.442 -100.822 1.00 46.57  ? 304  VAL B C     1 
ATOM   5736  O O     . VAL B  1 304 ? 125.252 121.379 -100.609 1.00 46.31  ? 304  VAL B O     1 
ATOM   5737  C CB    . VAL B  1 304 ? 125.181 123.990 -102.673 1.00 44.34  ? 304  VAL B CB    1 
ATOM   5738  C CG1   . VAL B  1 304 ? 125.469 124.439 -104.086 1.00 43.36  ? 304  VAL B CG1   1 
ATOM   5739  C CG2   . VAL B  1 304 ? 123.753 123.505 -102.547 1.00 43.99  ? 304  VAL B CG2   1 
ATOM   5740  N N     . ASN B  1 305 ? 126.209 123.277 -99.857  1.00 47.32  ? 305  ASN B N     1 
ATOM   5741  C CA    . ASN B  1 305 ? 125.903 122.996 -98.470  1.00 48.51  ? 305  ASN B CA    1 
ATOM   5742  C C     . ASN B  1 305 ? 124.603 123.712 -98.109  1.00 48.75  ? 305  ASN B C     1 
ATOM   5743  O O     . ASN B  1 305 ? 123.886 124.176 -98.993  1.00 50.16  ? 305  ASN B O     1 
ATOM   5744  C CB    . ASN B  1 305 ? 127.045 123.454 -97.558  1.00 49.25  ? 305  ASN B CB    1 
ATOM   5745  C CG    . ASN B  1 305 ? 127.320 124.940 -97.658  1.00 49.05  ? 305  ASN B CG    1 
ATOM   5746  O OD1   . ASN B  1 305 ? 126.432 125.740 -97.951  1.00 49.66  ? 305  ASN B OD1   1 
ATOM   5747  N ND2   . ASN B  1 305 ? 128.552 125.319 -97.387  1.00 48.45  ? 305  ASN B ND2   1 
ATOM   5748  N N     . THR B  1 306 ? 124.306 123.816 -96.817  1.00 49.31  ? 306  THR B N     1 
ATOM   5749  C CA    . THR B  1 306 ? 123.064 124.452 -96.379  1.00 50.00  ? 306  THR B CA    1 
ATOM   5750  C C     . THR B  1 306 ? 122.975 125.974 -96.528  1.00 50.11  ? 306  THR B C     1 
ATOM   5751  O O     . THR B  1 306 ? 121.935 126.556 -96.238  1.00 49.08  ? 306  THR B O     1 
ATOM   5752  C CB    . THR B  1 306 ? 122.719 124.070 -94.915  1.00 50.10  ? 306  THR B CB    1 
ATOM   5753  O OG1   . THR B  1 306 ? 123.753 124.526 -94.036  1.00 51.96  ? 306  THR B OG1   1 
ATOM   5754  C CG2   . THR B  1 306 ? 122.574 122.553 -94.782  1.00 49.34  ? 306  THR B CG2   1 
ATOM   5755  N N     . ARG B  1 307 ? 124.061 126.608 -96.968  1.00 50.62  ? 307  ARG B N     1 
ATOM   5756  C CA    . ARG B  1 307 ? 124.077 128.052 -97.189  1.00 51.18  ? 307  ARG B CA    1 
ATOM   5757  C C     . ARG B  1 307 ? 124.176 128.301 -98.695  1.00 51.30  ? 307  ARG B C     1 
ATOM   5758  O O     . ARG B  1 307 ? 124.329 129.429 -99.159  1.00 49.60  ? 307  ARG B O     1 
ATOM   5759  C CB    . ARG B  1 307 ? 125.255 128.704 -96.459  1.00 51.60  ? 307  ARG B CB    1 
ATOM   5760  C CG    . ARG B  1 307 ? 125.179 128.540 -94.941  1.00 52.17  ? 307  ARG B CG    1 
ATOM   5761  C CD    . ARG B  1 307 ? 126.231 129.357 -94.197  1.00 54.50  ? 307  ARG B CD    1 
ATOM   5762  N NE    . ARG B  1 307 ? 125.903 130.782 -94.070  1.00 57.56  ? 307  ARG B NE    1 
ATOM   5763  C CZ    . ARG B  1 307 ? 124.916 131.272 -93.312  1.00 58.97  ? 307  ARG B CZ    1 
ATOM   5764  N NH1   . ARG B  1 307 ? 124.136 130.459 -92.600  1.00 59.02  ? 307  ARG B NH1   1 
ATOM   5765  N NH2   . ARG B  1 307 ? 124.719 132.585 -93.248  1.00 57.81  ? 307  ARG B NH2   1 
ATOM   5766  N N     . PHE B  1 308 ? 124.065 127.211 -99.438  1.00 53.02  ? 308  PHE B N     1 
ATOM   5767  C CA    . PHE B  1 308 ? 124.114 127.223 -100.890 1.00 54.46  ? 308  PHE B CA    1 
ATOM   5768  C C     . PHE B  1 308 ? 125.454 127.570 -101.521 1.00 55.49  ? 308  PHE B C     1 
ATOM   5769  O O     . PHE B  1 308 ? 125.517 128.092 -102.630 1.00 55.52  ? 308  PHE B O     1 
ATOM   5770  C CB    . PHE B  1 308 ? 123.010 128.135 -101.437 1.00 53.86  ? 308  PHE B CB    1 
ATOM   5771  C CG    . PHE B  1 308 ? 121.637 127.570 -101.254 1.00 52.45  ? 308  PHE B CG    1 
ATOM   5772  C CD1   . PHE B  1 308 ? 120.894 127.859 -100.113 1.00 52.26  ? 308  PHE B CD1   1 
ATOM   5773  C CD2   . PHE B  1 308 ? 121.123 126.664 -102.179 1.00 51.56  ? 308  PHE B CD2   1 
ATOM   5774  C CE1   . PHE B  1 308 ? 119.656 127.245 -99.891  1.00 50.87  ? 308  PHE B CE1   1 
ATOM   5775  C CE2   . PHE B  1 308 ? 119.892 126.048 -101.965 1.00 50.49  ? 308  PHE B CE2   1 
ATOM   5776  C CZ    . PHE B  1 308 ? 119.160 126.338 -100.816 1.00 51.09  ? 308  PHE B CZ    1 
ATOM   5777  N N     . GLN B  1 309 ? 126.534 127.260 -100.820 1.00 57.40  ? 309  GLN B N     1 
ATOM   5778  C CA    . GLN B  1 309 ? 127.851 127.539 -101.361 1.00 59.27  ? 309  GLN B CA    1 
ATOM   5779  C C     . GLN B  1 309 ? 128.577 126.259 -101.760 1.00 58.86  ? 309  GLN B C     1 
ATOM   5780  O O     . GLN B  1 309 ? 128.474 125.225 -101.099 1.00 57.14  ? 309  GLN B O     1 
ATOM   5781  C CB    . GLN B  1 309 ? 128.678 128.364 -100.359 1.00 60.60  ? 309  GLN B CB    1 
ATOM   5782  C CG    . GLN B  1 309 ? 128.917 127.698 -99.020  1.00 63.09  ? 309  GLN B CG    1 
ATOM   5783  C CD    . GLN B  1 309 ? 129.569 128.634 -98.011  1.00 63.94  ? 309  GLN B CD    1 
ATOM   5784  O OE1   . GLN B  1 309 ? 129.888 128.238 -96.886  1.00 63.35  ? 309  GLN B OE1   1 
ATOM   5785  N NE2   . GLN B  1 309 ? 129.765 129.886 -98.412  1.00 64.49  ? 309  GLN B NE2   1 
ATOM   5786  N N     . THR B  1 310 ? 129.303 126.355 -102.864 1.00 60.10  ? 310  THR B N     1 
ATOM   5787  C CA    . THR B  1 310 ? 130.059 125.244 -103.422 1.00 62.38  ? 310  THR B CA    1 
ATOM   5788  C C     . THR B  1 310 ? 131.300 124.888 -102.607 1.00 63.76  ? 310  THR B C     1 
ATOM   5789  O O     . THR B  1 310 ? 131.398 125.213 -101.423 1.00 63.63  ? 310  THR B O     1 
ATOM   5790  C CB    . THR B  1 310 ? 130.510 125.590 -104.835 1.00 61.79  ? 310  THR B CB    1 
ATOM   5791  O OG1   . THR B  1 310 ? 131.623 126.491 -104.771 1.00 60.75  ? 310  THR B OG1   1 
ATOM   5792  C CG2   . THR B  1 310 ? 129.378 126.276 -105.581 1.00 61.11  ? 310  THR B CG2   1 
ATOM   5793  N N     . LYS B  1 311 ? 132.238 124.200 -103.256 1.00 65.37  ? 311  LYS B N     1 
ATOM   5794  C CA    . LYS B  1 311 ? 133.497 123.823 -102.619 1.00 66.23  ? 311  LYS B CA    1 
ATOM   5795  C C     . LYS B  1 311 ? 134.192 125.147 -102.293 1.00 65.47  ? 311  LYS B C     1 
ATOM   5796  O O     . LYS B  1 311 ? 134.688 125.344 -101.186 1.00 65.66  ? 311  LYS B O     1 
ATOM   5797  C CB    . LYS B  1 311 ? 134.362 122.984 -103.581 1.00 68.41  ? 311  LYS B CB    1 
ATOM   5798  C CG    . LYS B  1 311 ? 134.637 121.548 -103.104 1.00 70.76  ? 311  LYS B CG    1 
ATOM   5799  C CD    . LYS B  1 311 ? 135.488 120.736 -104.106 1.00 73.13  ? 311  LYS B CD    1 
ATOM   5800  C CE    . LYS B  1 311 ? 135.741 119.292 -103.606 1.00 74.27  ? 311  LYS B CE    1 
ATOM   5801  N NZ    . LYS B  1 311 ? 136.465 118.401 -104.577 1.00 74.55  ? 311  LYS B NZ    1 
ATOM   5802  N N     . ILE B  1 312 ? 134.207 126.046 -103.276 1.00 64.85  ? 312  ILE B N     1 
ATOM   5803  C CA    . ILE B  1 312 ? 134.789 127.381 -103.145 1.00 64.38  ? 312  ILE B CA    1 
ATOM   5804  C C     . ILE B  1 312 ? 133.798 128.229 -102.335 1.00 64.00  ? 312  ILE B C     1 
ATOM   5805  O O     . ILE B  1 312 ? 132.756 128.636 -102.851 1.00 64.60  ? 312  ILE B O     1 
ATOM   5806  C CB    . ILE B  1 312 ? 134.996 128.035 -104.535 1.00 65.02  ? 312  ILE B CB    1 
ATOM   5807  C CG1   . ILE B  1 312 ? 136.224 127.446 -105.237 1.00 65.02  ? 312  ILE B CG1   1 
ATOM   5808  C CG2   . ILE B  1 312 ? 135.169 129.527 -104.381 1.00 65.61  ? 312  ILE B CG2   1 
ATOM   5809  C CD1   . ILE B  1 312 ? 136.124 125.983 -105.571 1.00 65.24  ? 312  ILE B CD1   1 
ATOM   5810  N N     . PRO B  1 313 ? 134.134 128.535 -101.066 1.00 63.32  ? 313  PRO B N     1 
ATOM   5811  C CA    . PRO B  1 313 ? 133.319 129.315 -100.127 1.00 62.04  ? 313  PRO B CA    1 
ATOM   5812  C C     . PRO B  1 313 ? 132.675 130.630 -100.561 1.00 60.63  ? 313  PRO B C     1 
ATOM   5813  O O     . PRO B  1 313 ? 131.715 131.074 -99.931  1.00 60.67  ? 313  PRO B O     1 
ATOM   5814  C CB    . PRO B  1 313 ? 134.253 129.493 -98.931  1.00 62.30  ? 313  PRO B CB    1 
ATOM   5815  C CG    . PRO B  1 313 ? 135.583 129.542 -99.572  1.00 63.38  ? 313  PRO B CG    1 
ATOM   5816  C CD    . PRO B  1 313 ? 135.506 128.401 -100.544 1.00 63.50  ? 313  PRO B CD    1 
ATOM   5817  N N     . ASN B  1 314 ? 133.169 131.266 -101.614 1.00 58.69  ? 314  ASN B N     1 
ATOM   5818  C CA    . ASN B  1 314 ? 132.550 132.522 -102.023 1.00 57.39  ? 314  ASN B CA    1 
ATOM   5819  C C     . ASN B  1 314 ? 131.729 132.346 -103.294 1.00 56.43  ? 314  ASN B C     1 
ATOM   5820  O O     . ASN B  1 314 ? 131.196 133.315 -103.847 1.00 54.66  ? 314  ASN B O     1 
ATOM   5821  C CB    . ASN B  1 314 ? 133.610 133.608 -102.220 1.00 57.73  ? 314  ASN B CB    1 
ATOM   5822  C CG    . ASN B  1 314 ? 134.517 133.325 -103.390 1.00 57.42  ? 314  ASN B CG    1 
ATOM   5823  O OD1   . ASN B  1 314 ? 135.196 132.304 -103.425 1.00 57.61  ? 314  ASN B OD1   1 
ATOM   5824  N ND2   . ASN B  1 314 ? 134.532 134.232 -104.361 1.00 57.14  ? 314  ASN B ND2   1 
ATOM   5825  N N     . ILE B  1 315 ? 131.629 131.101 -103.746 1.00 55.96  ? 315  ILE B N     1 
ATOM   5826  C CA    . ILE B  1 315 ? 130.860 130.780 -104.939 1.00 55.71  ? 315  ILE B CA    1 
ATOM   5827  C C     . ILE B  1 315 ? 129.645 129.948 -104.536 1.00 55.09  ? 315  ILE B C     1 
ATOM   5828  O O     . ILE B  1 315 ? 129.778 128.874 -103.949 1.00 54.62  ? 315  ILE B O     1 
ATOM   5829  C CB    . ILE B  1 315 ? 131.717 130.000 -105.968 1.00 55.76  ? 315  ILE B CB    1 
ATOM   5830  C CG1   . ILE B  1 315 ? 132.858 130.882 -106.478 1.00 55.18  ? 315  ILE B CG1   1 
ATOM   5831  C CG2   . ILE B  1 315 ? 130.865 129.576 -107.143 1.00 55.51  ? 315  ILE B CG2   1 
ATOM   5832  C CD1   . ILE B  1 315 ? 133.743 130.205 -107.505 1.00 54.63  ? 315  ILE B CD1   1 
ATOM   5833  N N     . TYR B  1 316 ? 128.460 130.468 -104.844 1.00 54.95  ? 316  TYR B N     1 
ATOM   5834  C CA    . TYR B  1 316 ? 127.200 129.797 -104.521 1.00 53.66  ? 316  TYR B CA    1 
ATOM   5835  C C     . TYR B  1 316 ? 126.428 129.420 -105.787 1.00 51.82  ? 316  TYR B C     1 
ATOM   5836  O O     . TYR B  1 316 ? 126.661 129.964 -106.872 1.00 51.49  ? 316  TYR B O     1 
ATOM   5837  C CB    . TYR B  1 316 ? 126.292 130.699 -103.665 1.00 55.09  ? 316  TYR B CB    1 
ATOM   5838  C CG    . TYR B  1 316 ? 126.933 131.334 -102.447 1.00 56.23  ? 316  TYR B CG    1 
ATOM   5839  C CD1   . TYR B  1 316 ? 127.937 132.298 -102.586 1.00 56.98  ? 316  TYR B CD1   1 
ATOM   5840  C CD2   . TYR B  1 316 ? 126.516 130.993 -101.156 1.00 56.01  ? 316  TYR B CD2   1 
ATOM   5841  C CE1   . TYR B  1 316 ? 128.508 132.910 -101.474 1.00 57.46  ? 316  TYR B CE1   1 
ATOM   5842  C CE2   . TYR B  1 316 ? 127.082 131.602 -100.031 1.00 56.80  ? 316  TYR B CE2   1 
ATOM   5843  C CZ    . TYR B  1 316 ? 128.078 132.565 -100.200 1.00 57.57  ? 316  TYR B CZ    1 
ATOM   5844  O OH    . TYR B  1 316 ? 128.624 133.218 -99.117  1.00 56.16  ? 316  TYR B OH    1 
ATOM   5845  N N     . ALA B  1 317 ? 125.490 128.495 -105.614 1.00 49.72  ? 317  ALA B N     1 
ATOM   5846  C CA    . ALA B  1 317 ? 124.637 128.006 -106.689 1.00 47.04  ? 317  ALA B CA    1 
ATOM   5847  C C     . ALA B  1 317 ? 123.253 127.739 -106.114 1.00 45.49  ? 317  ALA B C     1 
ATOM   5848  O O     . ALA B  1 317 ? 123.121 127.168 -105.030 1.00 44.73  ? 317  ALA B O     1 
ATOM   5849  C CB    . ALA B  1 317 ? 125.220 126.729 -107.275 1.00 47.85  ? 317  ALA B CB    1 
ATOM   5850  N N     . ILE B  1 318 ? 122.224 128.167 -106.839 1.00 43.34  ? 318  ILE B N     1 
ATOM   5851  C CA    . ILE B  1 318 ? 120.846 127.984 -106.392 1.00 40.97  ? 318  ILE B CA    1 
ATOM   5852  C C     . ILE B  1 318 ? 119.941 127.633 -107.574 1.00 40.35  ? 318  ILE B C     1 
ATOM   5853  O O     . ILE B  1 318 ? 120.372 127.694 -108.718 1.00 39.24  ? 318  ILE B O     1 
ATOM   5854  C CB    . ILE B  1 318 ? 120.304 129.280 -105.723 1.00 39.53  ? 318  ILE B CB    1 
ATOM   5855  C CG1   . ILE B  1 318 ? 120.411 130.458 -106.687 1.00 39.80  ? 318  ILE B CG1   1 
ATOM   5856  C CG2   . ILE B  1 318 ? 121.079 129.598 -104.469 1.00 39.76  ? 318  ILE B CG2   1 
ATOM   5857  C CD1   . ILE B  1 318 ? 119.113 130.841 -107.313 1.00 39.96  ? 318  ILE B CD1   1 
ATOM   5858  N N     . GLY B  1 319 ? 118.701 127.240 -107.291 1.00 38.46  ? 319  GLY B N     1 
ATOM   5859  C CA    . GLY B  1 319 ? 117.754 126.951 -108.356 1.00 38.68  ? 319  GLY B CA    1 
ATOM   5860  C C     . GLY B  1 319 ? 117.824 125.627 -109.085 1.00 37.97  ? 319  GLY B C     1 
ATOM   5861  O O     . GLY B  1 319 ? 118.189 124.608 -108.511 1.00 37.73  ? 319  GLY B O     1 
ATOM   5862  N N     . ASP B  1 320 ? 117.469 125.644 -110.367 1.00 37.12  ? 320  ASP B N     1 
ATOM   5863  C CA    . ASP B  1 320 ? 117.490 124.414 -111.158 1.00 36.99  ? 320  ASP B CA    1 
ATOM   5864  C C     . ASP B  1 320 ? 118.856 123.750 -111.314 1.00 36.34  ? 320  ASP B C     1 
ATOM   5865  O O     . ASP B  1 320 ? 118.929 122.569 -111.643 1.00 37.14  ? 320  ASP B O     1 
ATOM   5866  C CB    . ASP B  1 320 ? 116.889 124.653 -112.544 1.00 35.68  ? 320  ASP B CB    1 
ATOM   5867  C CG    . ASP B  1 320 ? 115.361 124.644 -112.546 1.00 34.38  ? 320  ASP B CG    1 
ATOM   5868  O OD1   . ASP B  1 320 ? 114.728 124.471 -111.493 1.00 32.23  ? 320  ASP B OD1   1 
ATOM   5869  O OD2   . ASP B  1 320 ? 114.782 124.824 -113.630 1.00 36.55  ? 320  ASP B OD2   1 
ATOM   5870  N N     . VAL B  1 321 ? 119.936 124.482 -111.058 1.00 38.03  ? 321  VAL B N     1 
ATOM   5871  C CA    . VAL B  1 321 ? 121.282 123.908 -111.202 1.00 38.88  ? 321  VAL B CA    1 
ATOM   5872  C C     . VAL B  1 321 ? 121.745 123.139 -109.968 1.00 38.78  ? 321  VAL B C     1 
ATOM   5873  O O     . VAL B  1 321 ? 122.849 122.575 -109.928 1.00 38.96  ? 321  VAL B O     1 
ATOM   5874  C CB    . VAL B  1 321 ? 122.336 124.985 -111.513 1.00 39.51  ? 321  VAL B CB    1 
ATOM   5875  C CG1   . VAL B  1 321 ? 122.719 125.748 -110.244 1.00 39.03  ? 321  VAL B CG1   1 
ATOM   5876  C CG2   . VAL B  1 321 ? 123.547 124.322 -112.149 1.00 41.75  ? 321  VAL B CG2   1 
ATOM   5877  N N     . VAL B  1 322 ? 120.862 123.102 -108.980 1.00 38.64  ? 322  VAL B N     1 
ATOM   5878  C CA    . VAL B  1 322 ? 121.109 122.442 -107.710 1.00 37.94  ? 322  VAL B CA    1 
ATOM   5879  C C     . VAL B  1 322 ? 119.978 121.445 -107.392 1.00 37.85  ? 322  VAL B C     1 
ATOM   5880  O O     . VAL B  1 322 ? 118.926 121.459 -108.045 1.00 37.37  ? 322  VAL B O     1 
ATOM   5881  C CB    . VAL B  1 322 ? 121.236 123.531 -106.613 1.00 37.25  ? 322  VAL B CB    1 
ATOM   5882  C CG1   . VAL B  1 322 ? 120.985 122.963 -105.249 1.00 40.07  ? 322  VAL B CG1   1 
ATOM   5883  C CG2   . VAL B  1 322 ? 122.632 124.156 -106.694 1.00 37.86  ? 322  VAL B CG2   1 
ATOM   5884  N N     . ALA B  1 323 ? 120.220 120.575 -106.410 1.00 36.27  ? 323  ALA B N     1 
ATOM   5885  C CA    . ALA B  1 323 ? 119.259 119.570 -105.975 1.00 35.69  ? 323  ALA B CA    1 
ATOM   5886  C C     . ALA B  1 323 ? 117.982 120.214 -105.427 1.00 36.60  ? 323  ALA B C     1 
ATOM   5887  O O     . ALA B  1 323 ? 117.974 121.402 -105.078 1.00 37.32  ? 323  ALA B O     1 
ATOM   5888  C CB    . ALA B  1 323 ? 119.888 118.676 -104.915 1.00 33.09  ? 323  ALA B CB    1 
ATOM   5889  N N     . GLY B  1 324 ? 116.916 119.413 -105.340 1.00 35.58  ? 324  GLY B N     1 
ATOM   5890  C CA    . GLY B  1 324 ? 115.630 119.898 -104.867 1.00 35.29  ? 324  GLY B CA    1 
ATOM   5891  C C     . GLY B  1 324 ? 114.662 120.011 -106.039 1.00 35.67  ? 324  GLY B C     1 
ATOM   5892  O O     . GLY B  1 324 ? 115.090 120.002 -107.195 1.00 34.99  ? 324  GLY B O     1 
ATOM   5893  N N     . PRO B  1 325 ? 113.351 120.125 -105.788 1.00 35.40  ? 325  PRO B N     1 
ATOM   5894  C CA    . PRO B  1 325 ? 112.438 120.229 -106.924 1.00 34.74  ? 325  PRO B CA    1 
ATOM   5895  C C     . PRO B  1 325 ? 112.821 121.359 -107.841 1.00 35.61  ? 325  PRO B C     1 
ATOM   5896  O O     . PRO B  1 325 ? 113.192 122.427 -107.373 1.00 36.95  ? 325  PRO B O     1 
ATOM   5897  C CB    . PRO B  1 325 ? 111.087 120.461 -106.263 1.00 34.83  ? 325  PRO B CB    1 
ATOM   5898  C CG    . PRO B  1 325 ? 111.453 121.161 -105.012 1.00 36.32  ? 325  PRO B CG    1 
ATOM   5899  C CD    . PRO B  1 325 ? 112.641 120.381 -104.528 1.00 34.47  ? 325  PRO B CD    1 
ATOM   5900  N N     . MET B  1 326 ? 112.730 121.113 -109.149 1.00 36.62  ? 326  MET B N     1 
ATOM   5901  C CA    . MET B  1 326 ? 113.049 122.108 -110.172 1.00 36.12  ? 326  MET B CA    1 
ATOM   5902  C C     . MET B  1 326 ? 111.848 122.963 -110.537 1.00 35.46  ? 326  MET B C     1 
ATOM   5903  O O     . MET B  1 326 ? 111.294 122.824 -111.625 1.00 36.15  ? 326  MET B O     1 
ATOM   5904  C CB    . MET B  1 326 ? 113.575 121.427 -111.433 1.00 36.53  ? 326  MET B CB    1 
ATOM   5905  C CG    . MET B  1 326 ? 114.927 120.787 -111.229 1.00 38.78  ? 326  MET B CG    1 
ATOM   5906  S SD    . MET B  1 326 ? 115.365 119.719 -112.595 1.00 40.03  ? 326  MET B SD    1 
ATOM   5907  C CE    . MET B  1 326 ? 115.610 120.943 -113.804 1.00 38.61  ? 326  MET B CE    1 
ATOM   5908  N N     . LEU B  1 327 ? 111.482 123.855 -109.616 1.00 34.28  ? 327  LEU B N     1 
ATOM   5909  C CA    . LEU B  1 327 ? 110.367 124.781 -109.752 1.00 31.36  ? 327  LEU B CA    1 
ATOM   5910  C C     . LEU B  1 327 ? 110.849 126.227 -109.550 1.00 31.14  ? 327  LEU B C     1 
ATOM   5911  O O     . LEU B  1 327 ? 111.813 126.474 -108.837 1.00 30.86  ? 327  LEU B O     1 
ATOM   5912  C CB    . LEU B  1 327 ? 109.301 124.433 -108.716 1.00 29.55  ? 327  LEU B CB    1 
ATOM   5913  C CG    . LEU B  1 327 ? 108.744 123.023 -108.834 1.00 30.76  ? 327  LEU B CG    1 
ATOM   5914  C CD1   . LEU B  1 327 ? 107.921 122.696 -107.620 1.00 30.78  ? 327  LEU B CD1   1 
ATOM   5915  C CD2   . LEU B  1 327 ? 107.898 122.920 -110.099 1.00 31.78  ? 327  LEU B CD2   1 
ATOM   5916  N N     . ALA B  1 328 ? 110.165 127.177 -110.176 1.00 30.69  ? 328  ALA B N     1 
ATOM   5917  C CA    . ALA B  1 328 ? 110.514 128.588 -110.068 1.00 31.28  ? 328  ALA B CA    1 
ATOM   5918  C C     . ALA B  1 328 ? 110.478 129.139 -108.623 1.00 31.86  ? 328  ALA B C     1 
ATOM   5919  O O     . ALA B  1 328 ? 111.407 129.827 -108.188 1.00 31.43  ? 328  ALA B O     1 
ATOM   5920  C CB    . ALA B  1 328 ? 109.585 129.425 -110.986 1.00 29.80  ? 328  ALA B CB    1 
ATOM   5921  N N     . HIS B  1 329 ? 109.416 128.843 -107.877 1.00 32.28  ? 329  HIS B N     1 
ATOM   5922  C CA    . HIS B  1 329 ? 109.334 129.362 -106.524 1.00 31.50  ? 329  HIS B CA    1 
ATOM   5923  C C     . HIS B  1 329 ? 110.385 128.762 -105.616 1.00 31.99  ? 329  HIS B C     1 
ATOM   5924  O O     . HIS B  1 329 ? 110.796 129.384 -104.648 1.00 32.31  ? 329  HIS B O     1 
ATOM   5925  C CB    . HIS B  1 329 ? 107.921 129.189 -105.939 1.00 31.63  ? 329  HIS B CB    1 
ATOM   5926  C CG    . HIS B  1 329 ? 107.318 127.839 -106.171 1.00 33.49  ? 329  HIS B CG    1 
ATOM   5927  N ND1   . HIS B  1 329 ? 106.807 127.449 -107.388 1.00 33.96  ? 329  HIS B ND1   1 
ATOM   5928  C CD2   . HIS B  1 329 ? 107.133 126.792 -105.334 1.00 32.36  ? 329  HIS B CD2   1 
ATOM   5929  C CE1   . HIS B  1 329 ? 106.331 126.221 -107.289 1.00 34.21  ? 329  HIS B CE1   1 
ATOM   5930  N NE2   . HIS B  1 329 ? 106.517 125.801 -106.052 1.00 31.51  ? 329  HIS B NE2   1 
ATOM   5931  N N     . LYS B  1 330 ? 110.838 127.558 -105.928 1.00 33.08  ? 330  LYS B N     1 
ATOM   5932  C CA    . LYS B  1 330 ? 111.885 126.920 -105.125 1.00 33.83  ? 330  LYS B CA    1 
ATOM   5933  C C     . LYS B  1 330 ? 113.234 127.618 -105.378 1.00 34.73  ? 330  LYS B C     1 
ATOM   5934  O O     . LYS B  1 330 ? 114.084 127.718 -104.488 1.00 33.64  ? 330  LYS B O     1 
ATOM   5935  C CB    . LYS B  1 330 ? 111.993 125.427 -105.485 1.00 33.20  ? 330  LYS B CB    1 
ATOM   5936  C CG    . LYS B  1 330 ? 113.126 124.665 -104.791 1.00 31.93  ? 330  LYS B CG    1 
ATOM   5937  C CD    . LYS B  1 330 ? 114.444 124.890 -105.483 1.00 30.32  ? 330  LYS B CD    1 
ATOM   5938  C CE    . LYS B  1 330 ? 115.380 123.751 -105.193 1.00 31.60  ? 330  LYS B CE    1 
ATOM   5939  N NZ    . LYS B  1 330 ? 116.556 123.820 -106.095 1.00 31.61  ? 330  LYS B NZ    1 
ATOM   5940  N N     . ALA B  1 331 ? 113.404 128.092 -106.609 1.00 35.42  ? 331  ALA B N     1 
ATOM   5941  C CA    . ALA B  1 331 ? 114.613 128.775 -107.030 1.00 35.93  ? 331  ALA B CA    1 
ATOM   5942  C C     . ALA B  1 331 ? 114.622 130.194 -106.489 1.00 36.75  ? 331  ALA B C     1 
ATOM   5943  O O     . ALA B  1 331 ? 115.672 130.732 -106.131 1.00 35.44  ? 331  ALA B O     1 
ATOM   5944  C CB    . ALA B  1 331 ? 114.688 128.799 -108.547 1.00 36.77  ? 331  ALA B CB    1 
ATOM   5945  N N     . GLU B  1 332 ? 113.449 130.812 -106.458 1.00 38.50  ? 332  GLU B N     1 
ATOM   5946  C CA    . GLU B  1 332 ? 113.359 132.159 -105.928 1.00 40.78  ? 332  GLU B CA    1 
ATOM   5947  C C     . GLU B  1 332 ? 113.659 132.160 -104.415 1.00 41.79  ? 332  GLU B C     1 
ATOM   5948  O O     . GLU B  1 332 ? 114.506 132.936 -103.942 1.00 41.54  ? 332  GLU B O     1 
ATOM   5949  C CB    . GLU B  1 332 ? 111.980 132.745 -106.191 1.00 40.56  ? 332  GLU B CB    1 
ATOM   5950  C CG    . GLU B  1 332 ? 111.638 132.836 -107.656 1.00 44.02  ? 332  GLU B CG    1 
ATOM   5951  C CD    . GLU B  1 332 ? 110.446 133.728 -107.901 1.00 46.02  ? 332  GLU B CD    1 
ATOM   5952  O OE1   . GLU B  1 332 ? 109.703 133.990 -106.927 1.00 46.35  ? 332  GLU B OE1   1 
ATOM   5953  O OE2   . GLU B  1 332 ? 110.247 134.160 -109.060 1.00 48.11  ? 332  GLU B OE2   1 
ATOM   5954  N N     . ASP B  1 333 ? 112.993 131.282 -103.660 1.00 41.67  ? 333  ASP B N     1 
ATOM   5955  C CA    . ASP B  1 333 ? 113.223 131.225 -102.215 1.00 42.56  ? 333  ASP B CA    1 
ATOM   5956  C C     . ASP B  1 333 ? 114.699 130.977 -101.888 1.00 41.08  ? 333  ASP B C     1 
ATOM   5957  O O     . ASP B  1 333 ? 115.263 131.621 -101.008 1.00 40.19  ? 333  ASP B O     1 
ATOM   5958  C CB    . ASP B  1 333 ? 112.340 130.149 -101.562 1.00 44.07  ? 333  ASP B CB    1 
ATOM   5959  C CG    . ASP B  1 333 ? 110.901 130.619 -101.330 1.00 46.14  ? 333  ASP B CG    1 
ATOM   5960  O OD1   . ASP B  1 333 ? 110.222 131.096 -102.277 1.00 47.39  ? 333  ASP B OD1   1 
ATOM   5961  O OD2   . ASP B  1 333 ? 110.440 130.490 -100.184 1.00 47.65  ? 333  ASP B OD2   1 
ATOM   5962  N N     . GLU B  1 334 ? 115.320 130.051 -102.608 1.00 39.88  ? 334  GLU B N     1 
ATOM   5963  C CA    . GLU B  1 334 ? 116.730 129.740 -102.397 1.00 39.76  ? 334  GLU B CA    1 
ATOM   5964  C C     . GLU B  1 334 ? 117.634 130.940 -102.688 1.00 39.64  ? 334  GLU B C     1 
ATOM   5965  O O     . GLU B  1 334 ? 118.643 131.142 -102.019 1.00 39.32  ? 334  GLU B O     1 
ATOM   5966  C CB    . GLU B  1 334 ? 117.158 128.558 -103.277 1.00 37.43  ? 334  GLU B CB    1 
ATOM   5967  C CG    . GLU B  1 334 ? 116.535 127.250 -102.874 1.00 35.22  ? 334  GLU B CG    1 
ATOM   5968  C CD    . GLU B  1 334 ? 116.968 126.120 -103.762 1.00 34.68  ? 334  GLU B CD    1 
ATOM   5969  O OE1   . GLU B  1 334 ? 117.174 126.360 -104.969 1.00 34.65  ? 334  GLU B OE1   1 
ATOM   5970  O OE2   . GLU B  1 334 ? 117.079 124.986 -103.265 1.00 33.22  ? 334  GLU B OE2   1 
ATOM   5971  N N     . GLY B  1 335 ? 117.271 131.720 -103.698 1.00 41.23  ? 335  GLY B N     1 
ATOM   5972  C CA    . GLY B  1 335 ? 118.060 132.882 -104.053 1.00 41.89  ? 335  GLY B CA    1 
ATOM   5973  C C     . GLY B  1 335 ? 118.038 133.894 -102.927 1.00 42.43  ? 335  GLY B C     1 
ATOM   5974  O O     . GLY B  1 335 ? 119.091 134.396 -102.512 1.00 42.26  ? 335  GLY B O     1 
ATOM   5975  N N     . ILE B  1 336 ? 116.839 134.188 -102.427 1.00 41.84  ? 336  ILE B N     1 
ATOM   5976  C CA    . ILE B  1 336 ? 116.690 135.148 -101.352 1.00 41.80  ? 336  ILE B CA    1 
ATOM   5977  C C     . ILE B  1 336 ? 117.392 134.747 -100.055 1.00 42.33  ? 336  ILE B C     1 
ATOM   5978  O O     . ILE B  1 336 ? 118.091 135.553 -99.437  1.00 41.84  ? 336  ILE B O     1 
ATOM   5979  C CB    . ILE B  1 336 ? 115.218 135.414 -101.083 1.00 42.22  ? 336  ILE B CB    1 
ATOM   5980  C CG1   . ILE B  1 336 ? 114.758 136.530 -102.014 1.00 42.94  ? 336  ILE B CG1   1 
ATOM   5981  C CG2   . ILE B  1 336 ? 114.991 135.761 -99.612  1.00 40.56  ? 336  ILE B CG2   1 
ATOM   5982  C CD1   . ILE B  1 336 ? 113.353 136.998 -101.761 1.00 45.60  ? 336  ILE B CD1   1 
ATOM   5983  N N     . ILE B  1 337 ? 117.223 133.500 -99.646  1.00 42.63  ? 337  ILE B N     1 
ATOM   5984  C CA    . ILE B  1 337 ? 117.857 133.051 -98.427  1.00 42.42  ? 337  ILE B CA    1 
ATOM   5985  C C     . ILE B  1 337 ? 119.364 132.934 -98.598  1.00 42.66  ? 337  ILE B C     1 
ATOM   5986  O O     . ILE B  1 337 ? 120.108 133.008 -97.621  1.00 42.79  ? 337  ILE B O     1 
ATOM   5987  C CB    . ILE B  1 337 ? 117.278 131.706 -97.965  1.00 43.34  ? 337  ILE B CB    1 
ATOM   5988  C CG1   . ILE B  1 337 ? 117.579 130.613 -98.981  1.00 43.51  ? 337  ILE B CG1   1 
ATOM   5989  C CG2   . ILE B  1 337 ? 115.775 131.814 -97.836  1.00 41.75  ? 337  ILE B CG2   1 
ATOM   5990  C CD1   . ILE B  1 337 ? 117.053 129.269 -98.530  1.00 43.63  ? 337  ILE B CD1   1 
ATOM   5991  N N     . CYS B  1 338 ? 119.822 132.759 -99.832  1.00 41.50  ? 338  CYS B N     1 
ATOM   5992  C CA    . CYS B  1 338 ? 121.250 132.655 -100.062 1.00 41.36  ? 338  CYS B CA    1 
ATOM   5993  C C     . CYS B  1 338 ? 121.905 134.031 -99.947  1.00 42.25  ? 338  CYS B C     1 
ATOM   5994  O O     . CYS B  1 338 ? 122.907 134.171 -99.246  1.00 42.02  ? 338  CYS B O     1 
ATOM   5995  C CB    . CYS B  1 338 ? 121.548 132.041 -101.427 1.00 41.87  ? 338  CYS B CB    1 
ATOM   5996  S SG    . CYS B  1 338 ? 123.316 132.016 -101.844 1.00 41.19  ? 338  CYS B SG    1 
ATOM   5997  N N     . VAL B  1 339 ? 121.376 135.047 -100.627 1.00 41.90  ? 339  VAL B N     1 
ATOM   5998  C CA    . VAL B  1 339 ? 121.983 136.363 -100.480 1.00 43.35  ? 339  VAL B CA    1 
ATOM   5999  C C     . VAL B  1 339 ? 121.778 136.817 -99.031  1.00 45.78  ? 339  VAL B C     1 
ATOM   6000  O O     . VAL B  1 339 ? 122.659 137.460 -98.457  1.00 46.48  ? 339  VAL B O     1 
ATOM   6001  C CB    . VAL B  1 339 ? 121.402 137.428 -101.443 1.00 40.13  ? 339  VAL B CB    1 
ATOM   6002  C CG1   . VAL B  1 339 ? 121.639 136.997 -102.840 1.00 41.36  ? 339  VAL B CG1   1 
ATOM   6003  C CG2   . VAL B  1 339 ? 119.930 137.653 -101.189 1.00 41.49  ? 339  VAL B CG2   1 
ATOM   6004  N N     . GLU B  1 340 ? 120.629 136.482 -98.434  1.00 47.12  ? 340  GLU B N     1 
ATOM   6005  C CA    . GLU B  1 340 ? 120.380 136.853 -97.038  1.00 48.07  ? 340  GLU B CA    1 
ATOM   6006  C C     . GLU B  1 340 ? 121.432 136.148 -96.191  1.00 49.41  ? 340  GLU B C     1 
ATOM   6007  O O     . GLU B  1 340 ? 121.904 136.681 -95.186  1.00 49.98  ? 340  GLU B O     1 
ATOM   6008  C CB    . GLU B  1 340 ? 118.993 136.412 -96.566  1.00 47.34  ? 340  GLU B CB    1 
ATOM   6009  C CG    . GLU B  1 340 ? 117.837 137.309 -96.983  1.00 47.26  ? 340  GLU B CG    1 
ATOM   6010  C CD    . GLU B  1 340 ? 116.521 136.890 -96.332  1.00 46.70  ? 340  GLU B CD    1 
ATOM   6011  O OE1   . GLU B  1 340 ? 116.466 135.779 -95.760  1.00 46.26  ? 340  GLU B OE1   1 
ATOM   6012  O OE2   . GLU B  1 340 ? 115.541 137.665 -96.400  1.00 47.54  ? 340  GLU B OE2   1 
ATOM   6013  N N     . GLY B  1 341 ? 121.794 134.939 -96.602  1.00 50.68  ? 341  GLY B N     1 
ATOM   6014  C CA    . GLY B  1 341 ? 122.804 134.196 -95.875  1.00 51.42  ? 341  GLY B CA    1 
ATOM   6015  C C     . GLY B  1 341 ? 124.148 134.865 -96.064  1.00 51.81  ? 341  GLY B C     1 
ATOM   6016  O O     . GLY B  1 341 ? 125.013 134.803 -95.190  1.00 52.48  ? 341  GLY B O     1 
ATOM   6017  N N     . MET B  1 342 ? 124.320 135.503 -97.217  1.00 51.27  ? 342  MET B N     1 
ATOM   6018  C CA    . MET B  1 342 ? 125.555 136.200 -97.521  1.00 52.12  ? 342  MET B CA    1 
ATOM   6019  C C     . MET B  1 342 ? 125.695 137.342 -96.527  1.00 53.00  ? 342  MET B C     1 
ATOM   6020  O O     . MET B  1 342 ? 126.741 137.516 -95.909  1.00 54.39  ? 342  MET B O     1 
ATOM   6021  C CB    . MET B  1 342 ? 125.531 136.756 -98.952  1.00 52.33  ? 342  MET B CB    1 
ATOM   6022  C CG    . MET B  1 342 ? 125.865 135.752 -100.058 1.00 50.87  ? 342  MET B CG    1 
ATOM   6023  S SD    . MET B  1 342 ? 125.871 136.567 -101.690 1.00 51.05  ? 342  MET B SD    1 
ATOM   6024  C CE    . MET B  1 342 ? 125.208 135.330 -102.742 1.00 48.94  ? 342  MET B CE    1 
ATOM   6025  N N     . ALA B  1 343 ? 124.626 138.108 -96.363  1.00 52.76  ? 343  ALA B N     1 
ATOM   6026  C CA    . ALA B  1 343 ? 124.638 139.231 -95.448  1.00 52.78  ? 343  ALA B CA    1 
ATOM   6027  C C     . ALA B  1 343 ? 124.660 138.842 -93.966  1.00 54.00  ? 343  ALA B C     1 
ATOM   6028  O O     . ALA B  1 343 ? 124.473 139.687 -93.095  1.00 53.24  ? 343  ALA B O     1 
ATOM   6029  C CB    . ALA B  1 343 ? 123.463 140.118 -95.732  1.00 52.76  ? 343  ALA B CB    1 
ATOM   6030  N N     . GLY B  1 344 ? 124.861 137.564 -93.671  1.00 55.37  ? 344  GLY B N     1 
ATOM   6031  C CA    . GLY B  1 344 ? 124.945 137.167 -92.278  1.00 57.40  ? 344  GLY B CA    1 
ATOM   6032  C C     . GLY B  1 344 ? 123.810 136.399 -91.634  1.00 59.35  ? 344  GLY B C     1 
ATOM   6033  O O     . GLY B  1 344 ? 124.038 135.658 -90.675  1.00 59.17  ? 344  GLY B O     1 
ATOM   6034  N N     . GLY B  1 345 ? 122.592 136.562 -92.138  1.00 61.26  ? 345  GLY B N     1 
ATOM   6035  C CA    . GLY B  1 345 ? 121.466 135.860 -91.545  1.00 61.87  ? 345  GLY B CA    1 
ATOM   6036  C C     . GLY B  1 345 ? 121.564 134.344 -91.574  1.00 62.23  ? 345  GLY B C     1 
ATOM   6037  O O     . GLY B  1 345 ? 122.547 133.769 -92.055  1.00 61.77  ? 345  GLY B O     1 
ATOM   6038  N N     . ALA B  1 346 ? 120.537 133.695 -91.030  1.00 62.83  ? 346  ALA B N     1 
ATOM   6039  C CA    . ALA B  1 346 ? 120.465 132.239 -91.020  1.00 62.88  ? 346  ALA B CA    1 
ATOM   6040  C C     . ALA B  1 346 ? 119.939 131.817 -92.400  1.00 62.74  ? 346  ALA B C     1 
ATOM   6041  O O     . ALA B  1 346 ? 119.352 132.629 -93.131  1.00 62.07  ? 346  ALA B O     1 
ATOM   6042  C CB    . ALA B  1 346 ? 119.509 131.766 -89.914  1.00 62.32  ? 346  ALA B CB    1 
ATOM   6043  N N     . VAL B  1 347 ? 120.164 130.561 -92.770  1.00 61.80  ? 347  VAL B N     1 
ATOM   6044  C CA    . VAL B  1 347 ? 119.684 130.064 -94.058  1.00 61.44  ? 347  VAL B CA    1 
ATOM   6045  C C     . VAL B  1 347 ? 118.954 128.755 -93.775  1.00 61.76  ? 347  VAL B C     1 
ATOM   6046  O O     . VAL B  1 347 ? 119.545 127.810 -93.247  1.00 62.82  ? 347  VAL B O     1 
ATOM   6047  C CB    . VAL B  1 347 ? 120.855 129.824 -95.044  1.00 60.36  ? 347  VAL B CB    1 
ATOM   6048  C CG1   . VAL B  1 347 ? 120.312 129.453 -96.408  1.00 60.41  ? 347  VAL B CG1   1 
ATOM   6049  C CG2   . VAL B  1 347 ? 121.702 131.069 -95.165  1.00 58.29  ? 347  VAL B CG2   1 
ATOM   6050  N N     . HIS B  1 348 ? 117.671 128.691 -94.110  1.00 61.09  ? 348  HIS B N     1 
ATOM   6051  C CA    . HIS B  1 348 ? 116.928 127.482 -93.811  1.00 61.14  ? 348  HIS B CA    1 
ATOM   6052  C C     . HIS B  1 348 ? 115.743 127.243 -94.730  1.00 58.92  ? 348  HIS B C     1 
ATOM   6053  O O     . HIS B  1 348 ? 114.835 128.067 -94.826  1.00 58.15  ? 348  HIS B O     1 
ATOM   6054  C CB    . HIS B  1 348 ? 116.454 127.533 -92.350  1.00 65.56  ? 348  HIS B CB    1 
ATOM   6055  C CG    . HIS B  1 348 ? 116.110 126.193 -91.765  1.00 71.37  ? 348  HIS B CG    1 
ATOM   6056  N ND1   . HIS B  1 348 ? 114.927 125.533 -92.038  1.00 73.18  ? 348  HIS B ND1   1 
ATOM   6057  C CD2   . HIS B  1 348 ? 116.795 125.393 -90.907  1.00 73.48  ? 348  HIS B CD2   1 
ATOM   6058  C CE1   . HIS B  1 348 ? 114.897 124.389 -91.374  1.00 74.53  ? 348  HIS B CE1   1 
ATOM   6059  N NE2   . HIS B  1 348 ? 116.018 124.280 -90.680  1.00 75.15  ? 348  HIS B NE2   1 
ATOM   6060  N N     . ILE B  1 349 ? 115.763 126.103 -95.413  1.00 57.02  ? 349  ILE B N     1 
ATOM   6061  C CA    . ILE B  1 349 ? 114.674 125.730 -96.300  1.00 53.89  ? 349  ILE B CA    1 
ATOM   6062  C C     . ILE B  1 349 ? 114.345 124.256 -96.155  1.00 52.53  ? 349  ILE B C     1 
ATOM   6063  O O     . ILE B  1 349 ? 115.235 123.418 -96.032  1.00 50.65  ? 349  ILE B O     1 
ATOM   6064  C CB    . ILE B  1 349 ? 115.000 126.019 -97.776  1.00 52.83  ? 349  ILE B CB    1 
ATOM   6065  C CG1   . ILE B  1 349 ? 113.794 125.652 -98.628  1.00 52.82  ? 349  ILE B CG1   1 
ATOM   6066  C CG2   . ILE B  1 349 ? 116.215 125.223 -98.225  1.00 51.89  ? 349  ILE B CG2   1 
ATOM   6067  C CD1   . ILE B  1 349 ? 113.815 126.255 -99.996  1.00 53.93  ? 349  ILE B CD1   1 
ATOM   6068  N N     . ASP B  1 350 ? 113.048 123.964 -96.146  1.00 52.68  ? 350  ASP B N     1 
ATOM   6069  C CA    . ASP B  1 350 ? 112.542 122.598 -96.042  1.00 52.88  ? 350  ASP B CA    1 
ATOM   6070  C C     . ASP B  1 350 ? 111.786 122.312 -97.341  1.00 52.28  ? 350  ASP B C     1 
ATOM   6071  O O     . ASP B  1 350 ? 110.660 122.774 -97.519  1.00 52.17  ? 350  ASP B O     1 
ATOM   6072  C CB    . ASP B  1 350 ? 111.585 122.477 -94.857  1.00 53.38  ? 350  ASP B CB    1 
ATOM   6073  C CG    . ASP B  1 350 ? 111.288 121.038 -94.493  1.00 54.09  ? 350  ASP B CG    1 
ATOM   6074  O OD1   . ASP B  1 350 ? 111.567 120.119 -95.304  1.00 53.36  ? 350  ASP B OD1   1 
ATOM   6075  O OD2   . ASP B  1 350 ? 110.762 120.832 -93.379  1.00 54.83  ? 350  ASP B OD2   1 
ATOM   6076  N N     . TYR B  1 351 ? 112.403 121.558 -98.245  1.00 51.34  ? 351  TYR B N     1 
ATOM   6077  C CA    . TYR B  1 351 ? 111.770 121.260 -99.521  1.00 50.74  ? 351  TYR B CA    1 
ATOM   6078  C C     . TYR B  1 351 ? 110.480 120.477 -99.377  1.00 49.36  ? 351  TYR B C     1 
ATOM   6079  O O     . TYR B  1 351 ? 109.806 120.192 -100.363 1.00 49.82  ? 351  TYR B O     1 
ATOM   6080  C CB    . TYR B  1 351 ? 112.746 120.523 -100.449 1.00 51.25  ? 351  TYR B CB    1 
ATOM   6081  C CG    . TYR B  1 351 ? 114.006 121.316 -100.707 1.00 54.69  ? 351  TYR B CG    1 
ATOM   6082  C CD1   . TYR B  1 351 ? 113.946 122.623 -101.202 1.00 54.12  ? 351  TYR B CD1   1 
ATOM   6083  C CD2   . TYR B  1 351 ? 115.257 120.796 -100.377 1.00 57.13  ? 351  TYR B CD2   1 
ATOM   6084  C CE1   . TYR B  1 351 ? 115.093 123.394 -101.351 1.00 54.66  ? 351  TYR B CE1   1 
ATOM   6085  C CE2   . TYR B  1 351 ? 116.418 121.563 -100.522 1.00 58.29  ? 351  TYR B CE2   1 
ATOM   6086  C CZ    . TYR B  1 351 ? 116.324 122.866 -101.009 1.00 57.36  ? 351  TYR B CZ    1 
ATOM   6087  O OH    . TYR B  1 351 ? 117.466 123.630 -101.135 1.00 58.65  ? 351  TYR B OH    1 
ATOM   6088  N N     . ASN B  1 352 ? 110.134 120.134 -98.146  1.00 48.69  ? 352  ASN B N     1 
ATOM   6089  C CA    . ASN B  1 352 ? 108.907 119.388 -97.884  1.00 47.51  ? 352  ASN B CA    1 
ATOM   6090  C C     . ASN B  1 352 ? 107.723 120.362 -97.917  1.00 45.82  ? 352  ASN B C     1 
ATOM   6091  O O     . ASN B  1 352 ? 106.578 119.970 -98.137  1.00 44.22  ? 352  ASN B O     1 
ATOM   6092  C CB    . ASN B  1 352 ? 108.991 118.711 -96.512  1.00 47.94  ? 352  ASN B CB    1 
ATOM   6093  C CG    . ASN B  1 352 ? 107.828 117.769 -96.245  1.00 50.33  ? 352  ASN B CG    1 
ATOM   6094  O OD1   . ASN B  1 352 ? 107.668 116.745 -96.925  1.00 50.95  ? 352  ASN B OD1   1 
ATOM   6095  N ND2   . ASN B  1 352 ? 107.007 118.109 -95.251  1.00 48.12  ? 352  ASN B ND2   1 
ATOM   6096  N N     . CYS B  1 353 ? 108.022 121.640 -97.723  1.00 43.82  ? 353  CYS B N     1 
ATOM   6097  C CA    . CYS B  1 353 ? 106.999 122.667 -97.700  1.00 41.26  ? 353  CYS B CA    1 
ATOM   6098  C C     . CYS B  1 353 ? 106.841 123.407 -99.042  1.00 39.37  ? 353  CYS B C     1 
ATOM   6099  O O     . CYS B  1 353 ? 106.001 124.303 -99.180  1.00 38.97  ? 353  CYS B O     1 
ATOM   6100  C CB    . CYS B  1 353 ? 107.296 123.618 -96.531  1.00 42.28  ? 353  CYS B CB    1 
ATOM   6101  S SG    . CYS B  1 353 ? 107.357 122.767 -94.867  1.00 48.40  ? 353  CYS B SG    1 
ATOM   6102  N N     . VAL B  1 354 ? 107.631 122.995 -100.033 1.00 36.98  ? 354  VAL B N     1 
ATOM   6103  C CA    . VAL B  1 354 ? 107.589 123.557 -101.389 1.00 35.85  ? 354  VAL B CA    1 
ATOM   6104  C C     . VAL B  1 354 ? 106.446 122.903 -102.153 1.00 33.99  ? 354  VAL B C     1 
ATOM   6105  O O     . VAL B  1 354 ? 106.465 121.696 -102.393 1.00 34.05  ? 354  VAL B O     1 
ATOM   6106  C CB    . VAL B  1 354 ? 108.891 123.260 -102.160 1.00 37.42  ? 354  VAL B CB    1 
ATOM   6107  C CG1   . VAL B  1 354 ? 108.703 123.543 -103.628 1.00 37.12  ? 354  VAL B CG1   1 
ATOM   6108  C CG2   . VAL B  1 354 ? 110.033 124.089 -101.599 1.00 38.54  ? 354  VAL B CG2   1 
ATOM   6109  N N     . PRO B  1 355 ? 105.440 123.691 -102.560 1.00 32.86  ? 355  PRO B N     1 
ATOM   6110  C CA    . PRO B  1 355 ? 104.305 123.117 -103.291 1.00 31.62  ? 355  PRO B CA    1 
ATOM   6111  C C     . PRO B  1 355 ? 104.540 122.862 -104.782 1.00 30.61  ? 355  PRO B C     1 
ATOM   6112  O O     . PRO B  1 355 ? 105.520 123.341 -105.359 1.00 30.79  ? 355  PRO B O     1 
ATOM   6113  C CB    . PRO B  1 355 ? 103.187 124.126 -103.018 1.00 30.40  ? 355  PRO B CB    1 
ATOM   6114  C CG    . PRO B  1 355 ? 103.900 125.406 -102.991 1.00 31.22  ? 355  PRO B CG    1 
ATOM   6115  C CD    . PRO B  1 355 ? 105.189 125.106 -102.230 1.00 31.40  ? 355  PRO B CD    1 
ATOM   6116  N N     . SER B  1 356 ? 103.640 122.068 -105.365 1.00 29.46  ? 356  SER B N     1 
ATOM   6117  C CA    . SER B  1 356 ? 103.642 121.687 -106.779 1.00 29.57  ? 356  SER B CA    1 
ATOM   6118  C C     . SER B  1 356 ? 102.257 121.947 -107.331 1.00 29.64  ? 356  SER B C     1 
ATOM   6119  O O     . SER B  1 356 ? 101.268 121.564 -106.726 1.00 29.69  ? 356  SER B O     1 
ATOM   6120  C CB    . SER B  1 356 ? 103.953 120.202 -106.963 1.00 29.52  ? 356  SER B CB    1 
ATOM   6121  O OG    . SER B  1 356 ? 105.294 119.907 -106.625 1.00 33.10  ? 356  SER B OG    1 
ATOM   6122  N N     . VAL B  1 357 ? 102.189 122.597 -108.485 1.00 30.80  ? 357  VAL B N     1 
ATOM   6123  C CA    . VAL B  1 357 ? 100.913 122.913 -109.109 1.00 29.86  ? 357  VAL B CA    1 
ATOM   6124  C C     . VAL B  1 357 ? 100.902 122.527 -110.586 1.00 30.23  ? 357  VAL B C     1 
ATOM   6125  O O     . VAL B  1 357 ? 101.897 122.691 -111.299 1.00 29.46  ? 357  VAL B O     1 
ATOM   6126  C CB    . VAL B  1 357 ? 100.582 124.425 -109.005 1.00 29.36  ? 357  VAL B CB    1 
ATOM   6127  C CG1   . VAL B  1 357 ? 99.178  124.699 -109.578 1.00 28.72  ? 357  VAL B CG1   1 
ATOM   6128  C CG2   . VAL B  1 357 ? 100.670 124.875 -107.583 1.00 27.07  ? 357  VAL B CG2   1 
ATOM   6129  N N     . ILE B  1 358 ? 99.754  122.009 -111.017 1.00 30.49  ? 358  ILE B N     1 
ATOM   6130  C CA    . ILE B  1 358 ? 99.507  121.593 -112.393 1.00 29.14  ? 358  ILE B CA    1 
ATOM   6131  C C     . ILE B  1 358 ? 98.358  122.482 -112.812 1.00 28.04  ? 358  ILE B C     1 
ATOM   6132  O O     . ILE B  1 358 ? 97.264  122.388 -112.261 1.00 27.21  ? 358  ILE B O     1 
ATOM   6133  C CB    . ILE B  1 358 ? 99.101  120.114 -112.454 1.00 30.56  ? 358  ILE B CB    1 
ATOM   6134  C CG1   . ILE B  1 358 ? 100.189 119.265 -111.789 1.00 31.48  ? 358  ILE B CG1   1 
ATOM   6135  C CG2   . ILE B  1 358 ? 98.902  119.696 -113.907 1.00 31.33  ? 358  ILE B CG2   1 
ATOM   6136  C CD1   . ILE B  1 358 ? 100.267 117.818 -112.253 1.00 29.08  ? 358  ILE B CD1   1 
ATOM   6137  N N     . TYR B  1 359 ? 98.604  123.347 -113.785 1.00 28.11  ? 359  TYR B N     1 
ATOM   6138  C CA    . TYR B  1 359 ? 97.586  124.318 -114.177 1.00 28.86  ? 359  TYR B CA    1 
ATOM   6139  C C     . TYR B  1 359 ? 96.538  123.966 -115.208 1.00 28.63  ? 359  TYR B C     1 
ATOM   6140  O O     . TYR B  1 359 ? 95.945  124.841 -115.826 1.00 28.61  ? 359  TYR B O     1 
ATOM   6141  C CB    . TYR B  1 359 ? 98.263  125.625 -114.561 1.00 28.18  ? 359  TYR B CB    1 
ATOM   6142  C CG    . TYR B  1 359 ? 99.005  126.238 -113.407 1.00 28.18  ? 359  TYR B CG    1 
ATOM   6143  C CD1   . TYR B  1 359 ? 100.273 125.762 -113.050 1.00 27.36  ? 359  TYR B CD1   1 
ATOM   6144  C CD2   . TYR B  1 359 ? 98.466  127.330 -112.693 1.00 27.23  ? 359  TYR B CD2   1 
ATOM   6145  C CE1   . TYR B  1 359 ? 101.003 126.356 -112.027 1.00 27.03  ? 359  TYR B CE1   1 
ATOM   6146  C CE2   . TYR B  1 359 ? 99.189  127.937 -111.668 1.00 28.00  ? 359  TYR B CE2   1 
ATOM   6147  C CZ    . TYR B  1 359 ? 100.474 127.445 -111.345 1.00 28.29  ? 359  TYR B CZ    1 
ATOM   6148  O OH    . TYR B  1 359 ? 101.280 128.071 -110.419 1.00 29.06  ? 359  TYR B OH    1 
ATOM   6149  N N     . THR B  1 360 ? 96.300  122.676 -115.374 1.00 29.25  ? 360  THR B N     1 
ATOM   6150  C CA    . THR B  1 360 ? 95.275  122.188 -116.279 1.00 29.17  ? 360  THR B CA    1 
ATOM   6151  C C     . THR B  1 360 ? 93.936  122.637 -115.696 1.00 29.82  ? 360  THR B C     1 
ATOM   6152  O O     . THR B  1 360 ? 93.868  123.507 -114.812 1.00 29.44  ? 360  THR B O     1 
ATOM   6153  C CB    . THR B  1 360 ? 95.282  120.645 -116.315 1.00 29.57  ? 360  THR B CB    1 
ATOM   6154  O OG1   . THR B  1 360 ? 95.480  120.149 -114.977 1.00 28.03  ? 360  THR B OG1   1 
ATOM   6155  C CG2   . THR B  1 360 ? 96.390  120.122 -117.225 1.00 24.71  ? 360  THR B CG2   1 
ATOM   6156  N N     . HIS B  1 361 ? 92.868  122.045 -116.206 1.00 29.26  ? 361  HIS B N     1 
ATOM   6157  C CA    . HIS B  1 361 ? 91.542  122.329 -115.698 1.00 30.04  ? 361  HIS B CA    1 
ATOM   6158  C C     . HIS B  1 361 ? 90.854  120.995 -115.803 1.00 28.96  ? 361  HIS B C     1 
ATOM   6159  O O     . HIS B  1 361 ? 90.535  120.555 -116.893 1.00 30.84  ? 361  HIS B O     1 
ATOM   6160  C CB    . HIS B  1 361 ? 90.811  123.361 -116.547 1.00 31.65  ? 361  HIS B CB    1 
ATOM   6161  C CG    . HIS B  1 361 ? 89.660  123.992 -115.838 1.00 34.25  ? 361  HIS B CG    1 
ATOM   6162  N ND1   . HIS B  1 361 ? 89.743  125.237 -115.245 1.00 35.34  ? 361  HIS B ND1   1 
ATOM   6163  C CD2   . HIS B  1 361 ? 88.429  123.511 -115.542 1.00 35.09  ? 361  HIS B CD2   1 
ATOM   6164  C CE1   . HIS B  1 361 ? 88.610  125.493 -114.611 1.00 36.38  ? 361  HIS B CE1   1 
ATOM   6165  N NE2   . HIS B  1 361 ? 87.797  124.462 -114.775 1.00 37.45  ? 361  HIS B NE2   1 
ATOM   6166  N N     . PRO B  1 362 ? 90.613  120.323 -114.672 1.00 28.69  ? 362  PRO B N     1 
ATOM   6167  C CA    . PRO B  1 362 ? 90.922  120.709 -113.290 1.00 26.74  ? 362  PRO B CA    1 
ATOM   6168  C C     . PRO B  1 362 ? 92.398  120.890 -112.996 1.00 26.34  ? 362  PRO B C     1 
ATOM   6169  O O     . PRO B  1 362 ? 93.247  120.297 -113.635 1.00 25.41  ? 362  PRO B O     1 
ATOM   6170  C CB    . PRO B  1 362 ? 90.346  119.555 -112.486 1.00 28.05  ? 362  PRO B CB    1 
ATOM   6171  C CG    . PRO B  1 362 ? 90.687  118.375 -113.377 1.00 26.38  ? 362  PRO B CG    1 
ATOM   6172  C CD    . PRO B  1 362 ? 90.328  118.876 -114.759 1.00 26.88  ? 362  PRO B CD    1 
ATOM   6173  N N     . GLU B  1 363 ? 92.683  121.724 -112.007 1.00 28.21  ? 363  GLU B N     1 
ATOM   6174  C CA    . GLU B  1 363 ? 94.037  121.972 -111.567 1.00 28.19  ? 363  GLU B CA    1 
ATOM   6175  C C     . GLU B  1 363 ? 94.400  120.892 -110.564 1.00 28.04  ? 363  GLU B C     1 
ATOM   6176  O O     . GLU B  1 363 ? 93.526  120.215 -110.028 1.00 29.08  ? 363  GLU B O     1 
ATOM   6177  C CB    . GLU B  1 363 ? 94.126  123.329 -110.882 1.00 30.13  ? 363  GLU B CB    1 
ATOM   6178  C CG    . GLU B  1 363 ? 93.988  124.486 -111.826 1.00 31.24  ? 363  GLU B CG    1 
ATOM   6179  C CD    . GLU B  1 363 ? 94.025  125.806 -111.121 1.00 31.15  ? 363  GLU B CD    1 
ATOM   6180  O OE1   . GLU B  1 363 ? 93.963  125.834 -109.864 1.00 33.24  ? 363  GLU B OE1   1 
ATOM   6181  O OE2   . GLU B  1 363 ? 94.100  126.818 -111.835 1.00 31.21  ? 363  GLU B OE2   1 
ATOM   6182  N N     . VAL B  1 364 ? 95.695  120.726 -110.327 1.00 27.00  ? 364  VAL B N     1 
ATOM   6183  C CA    . VAL B  1 364 ? 96.182  119.747 -109.360 1.00 25.24  ? 364  VAL B CA    1 
ATOM   6184  C C     . VAL B  1 364 ? 97.233  120.465 -108.519 1.00 24.40  ? 364  VAL B C     1 
ATOM   6185  O O     . VAL B  1 364 ? 98.103  121.137 -109.060 1.00 24.01  ? 364  VAL B O     1 
ATOM   6186  C CB    . VAL B  1 364 ? 96.847  118.501 -110.043 1.00 25.06  ? 364  VAL B CB    1 
ATOM   6187  C CG1   . VAL B  1 364 ? 96.991  117.361 -109.021 1.00 21.81  ? 364  VAL B CG1   1 
ATOM   6188  C CG2   . VAL B  1 364 ? 96.051  118.049 -111.248 1.00 21.75  ? 364  VAL B CG2   1 
ATOM   6189  N N     . ALA B  1 365 ? 97.146  120.348 -107.200 1.00 23.82  ? 365  ALA B N     1 
ATOM   6190  C CA    . ALA B  1 365 ? 98.131  121.004 -106.351 1.00 23.56  ? 365  ALA B CA    1 
ATOM   6191  C C     . ALA B  1 365 ? 98.376  120.217 -105.072 1.00 22.87  ? 365  ALA B C     1 
ATOM   6192  O O     . ALA B  1 365 ? 97.471  119.626 -104.500 1.00 19.53  ? 365  ALA B O     1 
ATOM   6193  C CB    . ALA B  1 365 ? 97.693  122.457 -106.020 1.00 22.06  ? 365  ALA B CB    1 
ATOM   6194  N N     . TRP B  1 366 ? 99.625  120.190 -104.641 1.00 22.96  ? 366  TRP B N     1 
ATOM   6195  C CA    . TRP B  1 366 ? 99.932  119.477 -103.441 1.00 22.63  ? 366  TRP B CA    1 
ATOM   6196  C C     . TRP B  1 366 ? 101.156 120.031 -102.767 1.00 23.66  ? 366  TRP B C     1 
ATOM   6197  O O     . TRP B  1 366 ? 101.974 120.721 -103.368 1.00 23.91  ? 366  TRP B O     1 
ATOM   6198  C CB    . TRP B  1 366 ? 100.082 117.976 -103.727 1.00 22.69  ? 366  TRP B CB    1 
ATOM   6199  C CG    . TRP B  1 366 ? 101.282 117.592 -104.533 1.00 23.30  ? 366  TRP B CG    1 
ATOM   6200  C CD1   . TRP B  1 366 ? 102.507 117.211 -104.055 1.00 23.13  ? 366  TRP B CD1   1 
ATOM   6201  C CD2   . TRP B  1 366 ? 101.357 117.490 -105.952 1.00 21.30  ? 366  TRP B CD2   1 
ATOM   6202  N NE1   . TRP B  1 366 ? 103.335 116.871 -105.093 1.00 22.81  ? 366  TRP B NE1   1 
ATOM   6203  C CE2   . TRP B  1 366 ? 102.654 117.034 -106.270 1.00 23.07  ? 366  TRP B CE2   1 
ATOM   6204  C CE3   . TRP B  1 366 ? 100.456 117.737 -106.986 1.00 23.14  ? 366  TRP B CE3   1 
ATOM   6205  C CZ2   . TRP B  1 366 ? 103.068 116.816 -107.582 1.00 22.11  ? 366  TRP B CZ2   1 
ATOM   6206  C CZ3   . TRP B  1 366 ? 100.868 117.524 -108.299 1.00 24.53  ? 366  TRP B CZ3   1 
ATOM   6207  C CH2   . TRP B  1 366 ? 102.164 117.066 -108.582 1.00 23.21  ? 366  TRP B CH2   1 
ATOM   6208  N N     . VAL B  1 367 ? 101.240 119.747 -101.479 1.00 23.50  ? 367  VAL B N     1 
ATOM   6209  C CA    . VAL B  1 367 ? 102.345 120.171 -100.666 1.00 22.53  ? 367  VAL B CA    1 
ATOM   6210  C C     . VAL B  1 367 ? 102.409 119.159 -99.542  1.00 23.34  ? 367  VAL B C     1 
ATOM   6211  O O     . VAL B  1 367 ? 101.383 118.741 -98.984  1.00 22.26  ? 367  VAL B O     1 
ATOM   6212  C CB    . VAL B  1 367 ? 102.136 121.610 -100.123 1.00 21.46  ? 367  VAL B CB    1 
ATOM   6213  C CG1   . VAL B  1 367 ? 100.985 121.637 -99.153  1.00 21.27  ? 367  VAL B CG1   1 
ATOM   6214  C CG2   . VAL B  1 367 ? 103.421 122.119 -99.476  1.00 20.72  ? 367  VAL B CG2   1 
ATOM   6215  N N     . GLY B  1 368 ? 103.621 118.733 -99.236  1.00 24.39  ? 368  GLY B N     1 
ATOM   6216  C CA    . GLY B  1 368 ? 103.778 117.768 -98.182  1.00 25.98  ? 368  GLY B CA    1 
ATOM   6217  C C     . GLY B  1 368 ? 103.958 116.379 -98.737  1.00 27.68  ? 368  GLY B C     1 
ATOM   6218  O O     . GLY B  1 368 ? 104.526 116.189 -99.818  1.00 28.77  ? 368  GLY B O     1 
ATOM   6219  N N     . LYS B  1 369 ? 103.440 115.400 -98.003  1.00 27.91  ? 369  LYS B N     1 
ATOM   6220  C CA    . LYS B  1 369 ? 103.588 114.020 -98.397  1.00 27.32  ? 369  LYS B CA    1 
ATOM   6221  C C     . LYS B  1 369 ? 102.397 113.301 -98.963  1.00 25.95  ? 369  LYS B C     1 
ATOM   6222  O O     . LYS B  1 369 ? 101.248 113.568 -98.623  1.00 24.78  ? 369  LYS B O     1 
ATOM   6223  C CB    . LYS B  1 369 ? 104.179 113.234 -97.223  1.00 27.76  ? 369  LYS B CB    1 
ATOM   6224  C CG    . LYS B  1 369 ? 105.598 113.656 -96.998  1.00 30.03  ? 369  LYS B CG    1 
ATOM   6225  C CD    . LYS B  1 369 ? 106.236 113.069 -95.802  1.00 32.51  ? 369  LYS B CD    1 
ATOM   6226  C CE    . LYS B  1 369 ? 107.679 113.537 -95.758  1.00 33.46  ? 369  LYS B CE    1 
ATOM   6227  N NZ    . LYS B  1 369 ? 108.364 112.943 -94.593  1.00 38.49  ? 369  LYS B NZ    1 
ATOM   6228  N N     . SER B  1 370 ? 102.720 112.379 -99.850  1.00 25.70  ? 370  SER B N     1 
ATOM   6229  C CA    . SER B  1 370 ? 101.748 111.533 -100.510 1.00 26.78  ? 370  SER B CA    1 
ATOM   6230  C C     . SER B  1 370 ? 101.484 110.344 -99.605  1.00 26.91  ? 370  SER B C     1 
ATOM   6231  O O     . SER B  1 370 ? 102.266 110.052 -98.701  1.00 27.43  ? 370  SER B O     1 
ATOM   6232  C CB    . SER B  1 370 ? 102.327 110.998 -101.817 1.00 25.63  ? 370  SER B CB    1 
ATOM   6233  O OG    . SER B  1 370 ? 103.321 110.023 -101.547 1.00 25.29  ? 370  SER B OG    1 
ATOM   6234  N N     . GLU B  1 371 ? 100.390 109.646 -99.862  1.00 27.36  ? 371  GLU B N     1 
ATOM   6235  C CA    . GLU B  1 371 ? 100.087 108.462 -99.087  1.00 27.55  ? 371  GLU B CA    1 
ATOM   6236  C C     . GLU B  1 371 ? 101.184 107.380 -99.255  1.00 27.49  ? 371  GLU B C     1 
ATOM   6237  O O     . GLU B  1 371 ? 101.553 106.695 -98.288  1.00 28.30  ? 371  GLU B O     1 
ATOM   6238  C CB    . GLU B  1 371 ? 98.736  107.926 -99.506  1.00 25.89  ? 371  GLU B CB    1 
ATOM   6239  C CG    . GLU B  1 371 ? 97.867  107.803 -98.336  1.00 28.01  ? 371  GLU B CG    1 
ATOM   6240  C CD    . GLU B  1 371 ? 96.600  107.105 -98.626  1.00 25.85  ? 371  GLU B CD    1 
ATOM   6241  O OE1   . GLU B  1 371 ? 95.764  107.670 -99.346  1.00 26.48  ? 371  GLU B OE1   1 
ATOM   6242  O OE2   . GLU B  1 371 ? 96.456  105.984 -98.124  1.00 25.99  ? 371  GLU B OE2   1 
ATOM   6243  N N     . GLU B  1 372 ? 101.712 107.259 -100.473 1.00 27.08  ? 372  GLU B N     1 
ATOM   6244  C CA    . GLU B  1 372 ? 102.768 106.288 -100.802 1.00 28.26  ? 372  GLU B CA    1 
ATOM   6245  C C     . GLU B  1 372 ? 103.981 106.594 -99.931  1.00 29.25  ? 372  GLU B C     1 
ATOM   6246  O O     . GLU B  1 372 ? 104.644 105.686 -99.417  1.00 29.64  ? 372  GLU B O     1 
ATOM   6247  C CB    . GLU B  1 372 ? 103.155 106.366 -102.302 1.00 25.50  ? 372  GLU B CB    1 
ATOM   6248  C CG    . GLU B  1 372 ? 102.070 105.890 -103.305 1.00 25.45  ? 372  GLU B CG    1 
ATOM   6249  C CD    . GLU B  1 372 ? 100.723 106.644 -103.181 1.00 28.19  ? 372  GLU B CD    1 
ATOM   6250  O OE1   . GLU B  1 372 ? 100.719 107.890 -103.270 1.00 29.85  ? 372  GLU B OE1   1 
ATOM   6251  O OE2   . GLU B  1 372 ? 99.665  105.994 -102.987 1.00 27.70  ? 372  GLU B OE2   1 
ATOM   6252  N N     . GLN B  1 373 ? 104.249 107.883 -99.754  1.00 29.95  ? 373  GLN B N     1 
ATOM   6253  C CA    . GLN B  1 373 ? 105.363 108.319 -98.933  1.00 30.84  ? 373  GLN B CA    1 
ATOM   6254  C C     . GLN B  1 373 ? 105.119 108.001 -97.467  1.00 29.76  ? 373  GLN B C     1 
ATOM   6255  O O     . GLN B  1 373 ? 106.011 107.526 -96.776  1.00 29.20  ? 373  GLN B O     1 
ATOM   6256  C CB    . GLN B  1 373 ? 105.595 109.821 -99.097  1.00 32.08  ? 373  GLN B CB    1 
ATOM   6257  C CG    . GLN B  1 373 ? 106.225 110.169 -100.412 1.00 35.19  ? 373  GLN B CG    1 
ATOM   6258  C CD    . GLN B  1 373 ? 106.496 111.651 -100.545 1.00 38.53  ? 373  GLN B CD    1 
ATOM   6259  O OE1   . GLN B  1 373 ? 105.584 112.445 -100.827 1.00 36.56  ? 373  GLN B OE1   1 
ATOM   6260  N NE2   . GLN B  1 373 ? 107.762 112.042 -100.323 1.00 38.42  ? 373  GLN B NE2   1 
ATOM   6261  N N     . LEU B  1 374 ? 103.918 108.268 -96.981  1.00 29.38  ? 374  LEU B N     1 
ATOM   6262  C CA    . LEU B  1 374 ? 103.657 107.973 -95.586  1.00 29.85  ? 374  LEU B CA    1 
ATOM   6263  C C     . LEU B  1 374 ? 103.784 106.470 -95.359  1.00 31.05  ? 374  LEU B C     1 
ATOM   6264  O O     . LEU B  1 374 ? 104.407 106.049 -94.380  1.00 30.45  ? 374  LEU B O     1 
ATOM   6265  C CB    . LEU B  1 374 ? 102.272 108.449 -95.167  1.00 26.68  ? 374  LEU B CB    1 
ATOM   6266  C CG    . LEU B  1 374 ? 102.044 109.952 -95.220  1.00 24.98  ? 374  LEU B CG    1 
ATOM   6267  C CD1   . LEU B  1 374 ? 100.623 110.250 -94.765  1.00 23.64  ? 374  LEU B CD1   1 
ATOM   6268  C CD2   . LEU B  1 374 ? 103.080 110.665 -94.349  1.00 23.56  ? 374  LEU B CD2   1 
ATOM   6269  N N     . LYS B  1 375 ? 103.212 105.666 -96.260  1.00 30.93  ? 375  LYS B N     1 
ATOM   6270  C CA    . LYS B  1 375 ? 103.284 104.208 -96.104  1.00 32.98  ? 375  LYS B CA    1 
ATOM   6271  C C     . LYS B  1 375 ? 104.711 103.703 -96.118  1.00 32.52  ? 375  LYS B C     1 
ATOM   6272  O O     . LYS B  1 375 ? 105.099 102.859 -95.296  1.00 32.55  ? 375  LYS B O     1 
ATOM   6273  C CB    . LYS B  1 375 ? 102.475 103.489 -97.191  1.00 32.73  ? 375  LYS B CB    1 
ATOM   6274  C CG    . LYS B  1 375 ? 100.997 103.380 -96.894  1.00 35.26  ? 375  LYS B CG    1 
ATOM   6275  C CD    . LYS B  1 375 ? 100.258 102.951 -98.130  1.00 38.62  ? 375  LYS B CD    1 
ATOM   6276  C CE    . LYS B  1 375 ? 98.769  102.873 -97.896  1.00 42.23  ? 375  LYS B CE    1 
ATOM   6277  N NZ    . LYS B  1 375 ? 98.045  103.053 -99.198  1.00 46.94  ? 375  LYS B NZ    1 
ATOM   6278  N N     . GLU B  1 376 ? 105.491 104.238 -97.044  1.00 32.78  ? 376  GLU B N     1 
ATOM   6279  C CA    . GLU B  1 376 ? 106.882 103.855 -97.187  1.00 35.27  ? 376  GLU B CA    1 
ATOM   6280  C C     . GLU B  1 376 ? 107.668 104.138 -95.890  1.00 35.05  ? 376  GLU B C     1 
ATOM   6281  O O     . GLU B  1 376 ? 108.557 103.366 -95.515  1.00 34.19  ? 376  GLU B O     1 
ATOM   6282  C CB    . GLU B  1 376 ? 107.468 104.610 -98.385  1.00 36.82  ? 376  GLU B CB    1 
ATOM   6283  C CG    . GLU B  1 376 ? 108.894 104.247 -98.799  1.00 43.98  ? 376  GLU B CG    1 
ATOM   6284  C CD    . GLU B  1 376 ? 109.182 102.735 -98.887  1.00 48.21  ? 376  GLU B CD    1 
ATOM   6285  O OE1   . GLU B  1 376 ? 108.273 101.930 -99.234  1.00 49.97  ? 376  GLU B OE1   1 
ATOM   6286  O OE2   . GLU B  1 376 ? 110.350 102.362 -98.615  1.00 48.69  ? 376  GLU B OE2   1 
ATOM   6287  N N     . GLU B  1 377 ? 107.302 105.218 -95.195  1.00 34.91  ? 377  GLU B N     1 
ATOM   6288  C CA    . GLU B  1 377 ? 107.967 105.628 -93.959  1.00 35.39  ? 377  GLU B CA    1 
ATOM   6289  C C     . GLU B  1 377 ? 107.353 105.041 -92.684  1.00 34.26  ? 377  GLU B C     1 
ATOM   6290  O O     . GLU B  1 377 ? 107.827 105.331 -91.584  1.00 33.80  ? 377  GLU B O     1 
ATOM   6291  C CB    . GLU B  1 377 ? 107.980 107.167 -93.852  1.00 38.45  ? 377  GLU B CB    1 
ATOM   6292  C CG    . GLU B  1 377 ? 108.870 107.911 -94.885  1.00 42.46  ? 377  GLU B CG    1 
ATOM   6293  C CD    . GLU B  1 377 ? 108.448 109.379 -95.080  1.00 46.67  ? 377  GLU B CD    1 
ATOM   6294  O OE1   . GLU B  1 377 ? 107.969 109.985 -94.093  1.00 48.52  ? 377  GLU B OE1   1 
ATOM   6295  O OE2   . GLU B  1 377 ? 108.598 109.935 -96.204  1.00 47.95  ? 377  GLU B OE2   1 
ATOM   6296  N N     . GLY B  1 378 ? 106.304 104.230 -92.827  1.00 32.94  ? 378  GLY B N     1 
ATOM   6297  C CA    . GLY B  1 378 ? 105.652 103.643 -91.668  1.00 31.00  ? 378  GLY B CA    1 
ATOM   6298  C C     . GLY B  1 378 ? 104.902 104.605 -90.751  1.00 31.59  ? 378  GLY B C     1 
ATOM   6299  O O     . GLY B  1 378 ? 104.737 104.348 -89.555  1.00 30.87  ? 378  GLY B O     1 
ATOM   6300  N N     . ILE B  1 379 ? 104.437 105.720 -91.306  1.00 32.04  ? 379  ILE B N     1 
ATOM   6301  C CA    . ILE B  1 379 ? 103.694 106.708 -90.538  1.00 31.62  ? 379  ILE B CA    1 
ATOM   6302  C C     . ILE B  1 379 ? 102.249 106.268 -90.313  1.00 32.02  ? 379  ILE B C     1 
ATOM   6303  O O     . ILE B  1 379 ? 101.596 105.743 -91.220  1.00 31.41  ? 379  ILE B O     1 
ATOM   6304  C CB    . ILE B  1 379 ? 103.671 108.053 -91.267  1.00 30.51  ? 379  ILE B CB    1 
ATOM   6305  C CG1   . ILE B  1 379 ? 105.089 108.487 -91.601  1.00 30.70  ? 379  ILE B CG1   1 
ATOM   6306  C CG2   . ILE B  1 379 ? 103.019 109.093 -90.394  1.00 30.44  ? 379  ILE B CG2   1 
ATOM   6307  C CD1   . ILE B  1 379 ? 105.952 108.743 -90.371  1.00 31.50  ? 379  ILE B CD1   1 
ATOM   6308  N N     . GLU B  1 380 ? 101.751 106.477 -89.105  1.00 31.85  ? 380  GLU B N     1 
ATOM   6309  C CA    . GLU B  1 380 ? 100.378 106.119 -88.803  1.00 34.55  ? 380  GLU B CA    1 
ATOM   6310  C C     . GLU B  1 380 ? 99.519  107.391 -89.068  1.00 33.51  ? 380  GLU B C     1 
ATOM   6311  O O     . GLU B  1 380 ? 99.527  108.342 -88.285  1.00 32.67  ? 380  GLU B O     1 
ATOM   6312  C CB    . GLU B  1 380 ? 100.311 105.620 -87.344  1.00 38.38  ? 380  GLU B CB    1 
ATOM   6313  C CG    . GLU B  1 380 ? 98.906  105.418 -86.743  1.00 45.18  ? 380  GLU B CG    1 
ATOM   6314  C CD    . GLU B  1 380 ? 98.171  104.152 -87.190  1.00 49.03  ? 380  GLU B CD    1 
ATOM   6315  O OE1   . GLU B  1 380 ? 98.096  103.866 -88.412  1.00 51.07  ? 380  GLU B OE1   1 
ATOM   6316  O OE2   . GLU B  1 380 ? 97.637  103.453 -86.299  1.00 51.22  ? 380  GLU B OE2   1 
ATOM   6317  N N     . TYR B  1 381 ? 98.797  107.406 -90.189  1.00 31.70  ? 381  TYR B N     1 
ATOM   6318  C CA    . TYR B  1 381 ? 97.987  108.567 -90.549  1.00 31.66  ? 381  TYR B CA    1 
ATOM   6319  C C     . TYR B  1 381 ? 96.499  108.329 -90.736  1.00 31.21  ? 381  TYR B C     1 
ATOM   6320  O O     . TYR B  1 381 ? 96.012  107.189 -90.761  1.00 30.12  ? 381  TYR B O     1 
ATOM   6321  C CB    . TYR B  1 381 ? 98.497  109.201 -91.838  1.00 32.98  ? 381  TYR B CB    1 
ATOM   6322  C CG    . TYR B  1 381 ? 98.417  108.259 -93.017  1.00 34.55  ? 381  TYR B CG    1 
ATOM   6323  C CD1   . TYR B  1 381 ? 99.363  107.243 -93.188  1.00 34.30  ? 381  TYR B CD1   1 
ATOM   6324  C CD2   . TYR B  1 381 ? 97.376  108.352 -93.938  1.00 34.47  ? 381  TYR B CD2   1 
ATOM   6325  C CE1   . TYR B  1 381 ? 99.268  106.339 -94.253  1.00 35.09  ? 381  TYR B CE1   1 
ATOM   6326  C CE2   . TYR B  1 381 ? 97.275  107.453 -95.003  1.00 35.89  ? 381  TYR B CE2   1 
ATOM   6327  C CZ    . TYR B  1 381 ? 98.221  106.448 -95.154  1.00 35.61  ? 381  TYR B CZ    1 
ATOM   6328  O OH    . TYR B  1 381 ? 98.102  105.561 -96.201  1.00 36.57  ? 381  TYR B OH    1 
ATOM   6329  N N     . LYS B  1 382 ? 95.795  109.448 -90.888  1.00 30.72  ? 382  LYS B N     1 
ATOM   6330  C CA    . LYS B  1 382 ? 94.353  109.472 -91.092  1.00 30.53  ? 382  LYS B CA    1 
ATOM   6331  C C     . LYS B  1 382 ? 94.106  110.214 -92.398  1.00 29.52  ? 382  LYS B C     1 
ATOM   6332  O O     . LYS B  1 382 ? 94.853  111.121 -92.745  1.00 29.87  ? 382  LYS B O     1 
ATOM   6333  C CB    . LYS B  1 382 ? 93.670  110.233 -89.961  1.00 32.12  ? 382  LYS B CB    1 
ATOM   6334  C CG    . LYS B  1 382 ? 94.274  110.010 -88.587  1.00 33.40  ? 382  LYS B CG    1 
ATOM   6335  C CD    . LYS B  1 382 ? 93.637  110.939 -87.563  1.00 33.88  ? 382  LYS B CD    1 
ATOM   6336  C CE    . LYS B  1 382 ? 93.996  112.403 -87.774  1.00 31.98  ? 382  LYS B CE    1 
ATOM   6337  N NZ    . LYS B  1 382 ? 93.262  113.191 -86.747  1.00 34.09  ? 382  LYS B NZ    1 
ATOM   6338  N N     . VAL B  1 383 ? 93.041  109.852 -93.104  1.00 27.73  ? 383  VAL B N     1 
ATOM   6339  C CA    . VAL B  1 383 ? 92.731  110.485 -94.376  1.00 25.46  ? 383  VAL B CA    1 
ATOM   6340  C C     . VAL B  1 383 ? 91.402  111.208 -94.333  1.00 26.25  ? 383  VAL B C     1 
ATOM   6341  O O     . VAL B  1 383 ? 90.427  110.684 -93.824  1.00 27.95  ? 383  VAL B O     1 
ATOM   6342  C CB    . VAL B  1 383 ? 92.657  109.450 -95.525  1.00 22.75  ? 383  VAL B CB    1 
ATOM   6343  C CG1   . VAL B  1 383 ? 92.580  110.161 -96.856  1.00 22.59  ? 383  VAL B CG1   1 
ATOM   6344  C CG2   . VAL B  1 383 ? 93.856  108.529 -95.488  1.00 19.22  ? 383  VAL B CG2   1 
ATOM   6345  N N     . GLY B  1 384 ? 91.375  112.419 -94.874  1.00 25.97  ? 384  GLY B N     1 
ATOM   6346  C CA    . GLY B  1 384 ? 90.151  113.180 -94.931  1.00 24.43  ? 384  GLY B CA    1 
ATOM   6347  C C     . GLY B  1 384 ? 89.952  113.528 -96.393  1.00 25.32  ? 384  GLY B C     1 
ATOM   6348  O O     . GLY B  1 384 ? 90.845  114.094 -97.028  1.00 24.23  ? 384  GLY B O     1 
ATOM   6349  N N     . LYS B  1 385 ? 88.795  113.171 -96.943  1.00 24.40  ? 385  LYS B N     1 
ATOM   6350  C CA    . LYS B  1 385 ? 88.520  113.467 -98.337  1.00 23.52  ? 385  LYS B CA    1 
ATOM   6351  C C     . LYS B  1 385 ? 87.239  114.242 -98.429  1.00 23.12  ? 385  LYS B C     1 
ATOM   6352  O O     . LYS B  1 385 ? 86.315  113.976 -97.690  1.00 24.28  ? 385  LYS B O     1 
ATOM   6353  C CB    . LYS B  1 385 ? 88.347  112.193 -99.144  1.00 23.08  ? 385  LYS B CB    1 
ATOM   6354  C CG    . LYS B  1 385 ? 89.571  111.346 -99.299  1.00 26.09  ? 385  LYS B CG    1 
ATOM   6355  C CD    . LYS B  1 385 ? 89.159  110.093 -100.040 1.00 28.69  ? 385  LYS B CD    1 
ATOM   6356  C CE    . LYS B  1 385 ? 90.302  109.137 -100.197 1.00 31.29  ? 385  LYS B CE    1 
ATOM   6357  N NZ    . LYS B  1 385 ? 89.875  107.934 -100.977 1.00 33.58  ? 385  LYS B NZ    1 
ATOM   6358  N N     . PHE B  1 386 ? 87.191  115.203 -99.341  1.00 22.09  ? 386  PHE B N     1 
ATOM   6359  C CA    . PHE B  1 386 ? 85.987  115.996 -99.578  1.00 22.45  ? 386  PHE B CA    1 
ATOM   6360  C C     . PHE B  1 386 ? 85.875  116.319 -101.077 1.00 24.12  ? 386  PHE B C     1 
ATOM   6361  O O     . PHE B  1 386 ? 86.757  116.975 -101.645 1.00 25.01  ? 386  PHE B O     1 
ATOM   6362  C CB    . PHE B  1 386 ? 85.998  117.300 -98.786  1.00 19.00  ? 386  PHE B CB    1 
ATOM   6363  C CG    . PHE B  1 386 ? 84.669  118.008 -98.812  1.00 18.01  ? 386  PHE B CG    1 
ATOM   6364  C CD1   . PHE B  1 386 ? 83.643  117.637 -97.932  1.00 16.15  ? 386  PHE B CD1   1 
ATOM   6365  C CD2   . PHE B  1 386 ? 84.406  118.984 -99.773  1.00 17.94  ? 386  PHE B CD2   1 
ATOM   6366  C CE1   . PHE B  1 386 ? 82.359  118.232 -98.015  1.00 17.90  ? 386  PHE B CE1   1 
ATOM   6367  C CE2   . PHE B  1 386 ? 83.134  119.586 -99.874  1.00 17.97  ? 386  PHE B CE2   1 
ATOM   6368  C CZ    . PHE B  1 386 ? 82.112  119.205 -98.990  1.00 18.99  ? 386  PHE B CZ    1 
ATOM   6369  N N     . PRO B  1 387 ? 84.764  115.914 -101.726 1.00 23.77  ? 387  PRO B N     1 
ATOM   6370  C CA    . PRO B  1 387 ? 84.583  116.158 -103.160 1.00 23.47  ? 387  PRO B CA    1 
ATOM   6371  C C     . PRO B  1 387 ? 84.041  117.544 -103.501 1.00 24.54  ? 387  PRO B C     1 
ATOM   6372  O O     . PRO B  1 387 ? 83.131  118.046 -102.820 1.00 24.53  ? 387  PRO B O     1 
ATOM   6373  C CB    . PRO B  1 387 ? 83.628  115.042 -103.551 1.00 21.92  ? 387  PRO B CB    1 
ATOM   6374  C CG    . PRO B  1 387 ? 82.657  115.075 -102.391 1.00 23.96  ? 387  PRO B CG    1 
ATOM   6375  C CD    . PRO B  1 387 ? 83.510  115.412 -101.137 1.00 23.89  ? 387  PRO B CD    1 
ATOM   6376  N N     . PHE B  1 388 ? 84.599  118.156 -104.553 1.00 24.33  ? 388  PHE B N     1 
ATOM   6377  C CA    . PHE B  1 388 ? 84.153  119.490 -104.960 1.00 26.11  ? 388  PHE B CA    1 
ATOM   6378  C C     . PHE B  1 388 ? 82.719  119.461 -105.398 1.00 26.36  ? 388  PHE B C     1 
ATOM   6379  O O     . PHE B  1 388 ? 82.133  120.486 -105.647 1.00 27.57  ? 388  PHE B O     1 
ATOM   6380  C CB    . PHE B  1 388 ? 85.006  120.068 -106.100 1.00 25.48  ? 388  PHE B CB    1 
ATOM   6381  C CG    . PHE B  1 388 ? 86.262  120.739 -105.625 1.00 24.66  ? 388  PHE B CG    1 
ATOM   6382  C CD1   . PHE B  1 388 ? 86.201  121.941 -104.911 1.00 26.38  ? 388  PHE B CD1   1 
ATOM   6383  C CD2   . PHE B  1 388 ? 87.491  120.125 -105.789 1.00 22.51  ? 388  PHE B CD2   1 
ATOM   6384  C CE1   . PHE B  1 388 ? 87.352  122.508 -104.362 1.00 23.96  ? 388  PHE B CE1   1 
ATOM   6385  C CE2   . PHE B  1 388 ? 88.632  120.681 -105.252 1.00 23.03  ? 388  PHE B CE2   1 
ATOM   6386  C CZ    . PHE B  1 388 ? 88.566  121.876 -104.532 1.00 21.50  ? 388  PHE B CZ    1 
ATOM   6387  N N     . ALA B  1 389 ? 82.142  118.280 -105.468 1.00 26.93  ? 389  ALA B N     1 
ATOM   6388  C CA    . ALA B  1 389 ? 80.770  118.182 -105.908 1.00 28.27  ? 389  ALA B CA    1 
ATOM   6389  C C     . ALA B  1 389 ? 79.774  118.553 -104.803 1.00 28.38  ? 389  ALA B C     1 
ATOM   6390  O O     . ALA B  1 389 ? 78.573  118.744 -105.067 1.00 26.79  ? 389  ALA B O     1 
ATOM   6391  C CB    . ALA B  1 389 ? 80.505  116.790 -106.410 1.00 28.34  ? 389  ALA B CB    1 
ATOM   6392  N N     . ALA B  1 390 ? 80.287  118.656 -103.572 1.00 27.36  ? 390  ALA B N     1 
ATOM   6393  C CA    . ALA B  1 390 ? 79.480  118.999 -102.407 1.00 24.72  ? 390  ALA B CA    1 
ATOM   6394  C C     . ALA B  1 390 ? 79.835  120.394 -101.923 1.00 26.57  ? 390  ALA B C     1 
ATOM   6395  O O     . ALA B  1 390 ? 79.320  120.837 -100.885 1.00 28.15  ? 390  ALA B O     1 
ATOM   6396  C CB    . ALA B  1 390 ? 79.731  118.011 -101.301 1.00 24.15  ? 390  ALA B CB    1 
ATOM   6397  N N     . ASN B  1 391 ? 80.729  121.069 -102.654 1.00 26.12  ? 391  ASN B N     1 
ATOM   6398  C CA    . ASN B  1 391 ? 81.162  122.412 -102.313 1.00 26.54  ? 391  ASN B CA    1 
ATOM   6399  C C     . ASN B  1 391 ? 80.236  123.424 -102.938 1.00 27.53  ? 391  ASN B C     1 
ATOM   6400  O O     . ASN B  1 391 ? 79.953  123.381 -104.122 1.00 30.45  ? 391  ASN B O     1 
ATOM   6401  C CB    . ASN B  1 391 ? 82.587  122.676 -102.770 1.00 25.80  ? 391  ASN B CB    1 
ATOM   6402  C CG    . ASN B  1 391 ? 83.016  124.124 -102.514 1.00 26.52  ? 391  ASN B CG    1 
ATOM   6403  O OD1   . ASN B  1 391 ? 82.921  124.967 -103.401 1.00 27.25  ? 391  ASN B OD1   1 
ATOM   6404  N ND2   . ASN B  1 391 ? 83.460  124.417 -101.286 1.00 24.51  ? 391  ASN B ND2   1 
ATOM   6405  N N     . SER B  1 392 ? 79.778  124.362 -102.133 1.00 28.14  ? 392  SER B N     1 
ATOM   6406  C CA    . SER B  1 392 ? 78.827  125.327 -102.610 1.00 28.62  ? 392  SER B CA    1 
ATOM   6407  C C     . SER B  1 392 ? 79.303  126.197 -103.735 1.00 29.34  ? 392  SER B C     1 
ATOM   6408  O O     . SER B  1 392 ? 78.544  126.459 -104.670 1.00 30.22  ? 392  SER B O     1 
ATOM   6409  C CB    . SER B  1 392 ? 78.332  126.174 -101.447 1.00 29.65  ? 392  SER B CB    1 
ATOM   6410  O OG    . SER B  1 392 ? 77.518  125.369 -100.614 1.00 32.17  ? 392  SER B OG    1 
ATOM   6411  N N     . ARG B  1 393 ? 80.547  126.652 -103.677 1.00 28.56  ? 393  ARG B N     1 
ATOM   6412  C CA    . ARG B  1 393 ? 80.996  127.506 -104.753 1.00 28.15  ? 393  ARG B CA    1 
ATOM   6413  C C     . ARG B  1 393 ? 81.196  126.702 -106.038 1.00 27.89  ? 393  ARG B C     1 
ATOM   6414  O O     . ARG B  1 393 ? 80.854  127.161 -107.120 1.00 26.44  ? 393  ARG B O     1 
ATOM   6415  C CB    . ARG B  1 393 ? 82.279  128.249 -104.379 1.00 27.69  ? 393  ARG B CB    1 
ATOM   6416  C CG    . ARG B  1 393 ? 82.539  129.389 -105.338 1.00 30.28  ? 393  ARG B CG    1 
ATOM   6417  C CD    . ARG B  1 393 ? 83.704  130.274 -104.975 1.00 32.80  ? 393  ARG B CD    1 
ATOM   6418  N NE    . ARG B  1 393 ? 83.690  131.456 -105.836 1.00 34.08  ? 393  ARG B NE    1 
ATOM   6419  C CZ    . ARG B  1 393 ? 84.605  132.418 -105.825 1.00 36.04  ? 393  ARG B CZ    1 
ATOM   6420  N NH1   . ARG B  1 393 ? 85.637  132.355 -104.994 1.00 38.93  ? 393  ARG B NH1   1 
ATOM   6421  N NH2   . ARG B  1 393 ? 84.481  133.461 -106.635 1.00 35.52  ? 393  ARG B NH2   1 
ATOM   6422  N N     . ALA B  1 394 ? 81.735  125.497 -105.909 1.00 27.74  ? 394  ALA B N     1 
ATOM   6423  C CA    . ALA B  1 394 ? 81.984  124.647 -107.057 1.00 28.70  ? 394  ALA B CA    1 
ATOM   6424  C C     . ALA B  1 394 ? 80.673  124.344 -107.802 1.00 30.86  ? 394  ALA B C     1 
ATOM   6425  O O     . ALA B  1 394 ? 80.588  124.452 -109.042 1.00 29.69  ? 394  ALA B O     1 
ATOM   6426  C CB    . ALA B  1 394 ? 82.638  123.362 -106.599 1.00 27.27  ? 394  ALA B CB    1 
ATOM   6427  N N     . LYS B  1 395 ? 79.661  123.957 -107.026 1.00 30.87  ? 395  LYS B N     1 
ATOM   6428  C CA    . LYS B  1 395 ? 78.346  123.644 -107.556 1.00 32.56  ? 395  LYS B CA    1 
ATOM   6429  C C     . LYS B  1 395 ? 77.682  124.892 -108.162 1.00 33.30  ? 395  LYS B C     1 
ATOM   6430  O O     . LYS B  1 395 ? 77.075  124.821 -109.222 1.00 32.97  ? 395  LYS B O     1 
ATOM   6431  C CB    . LYS B  1 395 ? 77.480  123.048 -106.445 1.00 31.67  ? 395  LYS B CB    1 
ATOM   6432  C CG    . LYS B  1 395 ? 76.081  122.727 -106.867 1.00 33.12  ? 395  LYS B CG    1 
ATOM   6433  C CD    . LYS B  1 395 ? 76.056  121.810 -108.070 1.00 34.11  ? 395  LYS B CD    1 
ATOM   6434  C CE    . LYS B  1 395 ? 76.118  120.363 -107.660 1.00 34.71  ? 395  LYS B CE    1 
ATOM   6435  N NZ    . LYS B  1 395 ? 75.912  119.476 -108.839 1.00 35.44  ? 395  LYS B NZ    1 
ATOM   6436  N N     . THR B  1 396 ? 77.802  126.034 -107.493 1.00 33.72  ? 396  THR B N     1 
ATOM   6437  C CA    . THR B  1 396 ? 77.216  127.253 -108.022 1.00 35.41  ? 396  THR B CA    1 
ATOM   6438  C C     . THR B  1 396 ? 77.878  127.623 -109.349 1.00 35.47  ? 396  THR B C     1 
ATOM   6439  O O     . THR B  1 396 ? 77.213  128.147 -110.248 1.00 34.82  ? 396  THR B O     1 
ATOM   6440  C CB    . THR B  1 396 ? 77.401  128.431 -107.071 1.00 37.25  ? 396  THR B CB    1 
ATOM   6441  O OG1   . THR B  1 396 ? 76.962  128.075 -105.755 1.00 40.95  ? 396  THR B OG1   1 
ATOM   6442  C CG2   . THR B  1 396 ? 76.612  129.601 -107.556 1.00 37.63  ? 396  THR B CG2   1 
ATOM   6443  N N     . ASN B  1 397 ? 79.186  127.363 -109.455 1.00 34.20  ? 397  ASN B N     1 
ATOM   6444  C CA    . ASN B  1 397 ? 79.936  127.670 -110.664 1.00 32.94  ? 397  ASN B CA    1 
ATOM   6445  C C     . ASN B  1 397 ? 79.760  126.588 -111.711 1.00 31.88  ? 397  ASN B C     1 
ATOM   6446  O O     . ASN B  1 397 ? 80.274  126.721 -112.812 1.00 32.89  ? 397  ASN B O     1 
ATOM   6447  C CB    . ASN B  1 397 ? 81.457  127.807 -110.391 1.00 32.98  ? 397  ASN B CB    1 
ATOM   6448  C CG    . ASN B  1 397 ? 81.843  129.081 -109.611 1.00 35.48  ? 397  ASN B CG    1 
ATOM   6449  O OD1   . ASN B  1 397 ? 81.113  130.074 -109.583 1.00 36.15  ? 397  ASN B OD1   1 
ATOM   6450  N ND2   . ASN B  1 397 ? 83.022  129.047 -108.984 1.00 36.33  ? 397  ASN B ND2   1 
ATOM   6451  N N     . ALA B  1 398 ? 79.055  125.515 -111.372 1.00 31.50  ? 398  ALA B N     1 
ATOM   6452  C CA    . ALA B  1 398 ? 78.874  124.392 -112.297 1.00 31.62  ? 398  ALA B CA    1 
ATOM   6453  C C     . ALA B  1 398 ? 80.222  123.948 -112.886 1.00 31.55  ? 398  ALA B C     1 
ATOM   6454  O O     . ALA B  1 398 ? 80.398  123.840 -114.104 1.00 31.38  ? 398  ALA B O     1 
ATOM   6455  C CB    . ALA B  1 398 ? 77.903  124.762 -113.412 1.00 33.03  ? 398  ALA B CB    1 
ATOM   6456  N N     . ASP B  1 399 ? 81.160  123.693 -111.981 1.00 32.76  ? 399  ASP B N     1 
ATOM   6457  C CA    . ASP B  1 399 ? 82.527  123.248 -112.267 1.00 32.79  ? 399  ASP B CA    1 
ATOM   6458  C C     . ASP B  1 399 ? 82.872  122.490 -110.993 1.00 33.72  ? 399  ASP B C     1 
ATOM   6459  O O     . ASP B  1 399 ? 83.430  123.064 -110.051 1.00 33.69  ? 399  ASP B O     1 
ATOM   6460  C CB    . ASP B  1 399 ? 83.456  124.451 -112.416 1.00 33.98  ? 399  ASP B CB    1 
ATOM   6461  C CG    . ASP B  1 399 ? 84.894  124.055 -112.725 1.00 36.28  ? 399  ASP B CG    1 
ATOM   6462  O OD1   . ASP B  1 399 ? 85.181  122.845 -112.959 1.00 38.53  ? 399  ASP B OD1   1 
ATOM   6463  O OD2   . ASP B  1 399 ? 85.742  124.975 -112.735 1.00 35.94  ? 399  ASP B OD2   1 
ATOM   6464  N N     . THR B  1 400 ? 82.536  121.204 -110.972 1.00 33.00  ? 400  THR B N     1 
ATOM   6465  C CA    . THR B  1 400 ? 82.734  120.391 -109.792 1.00 31.86  ? 400  THR B CA    1 
ATOM   6466  C C     . THR B  1 400 ? 83.635  119.152 -109.862 1.00 31.44  ? 400  THR B C     1 
ATOM   6467  O O     . THR B  1 400 ? 83.508  118.290 -109.029 1.00 30.63  ? 400  THR B O     1 
ATOM   6468  C CB    . THR B  1 400 ? 81.356  119.943 -109.264 1.00 33.06  ? 400  THR B CB    1 
ATOM   6469  O OG1   . THR B  1 400 ? 80.678  119.218 -110.296 1.00 34.53  ? 400  THR B OG1   1 
ATOM   6470  C CG2   . THR B  1 400 ? 80.497  121.139 -108.863 1.00 29.67  ? 400  THR B CG2   1 
ATOM   6471  N N     . ASP B  1 401 ? 84.534  119.035 -110.832 1.00 32.36  ? 401  ASP B N     1 
ATOM   6472  C CA    . ASP B  1 401 ? 85.402  117.848 -110.872 1.00 31.81  ? 401  ASP B CA    1 
ATOM   6473  C C     . ASP B  1 401 ? 86.298  117.779 -109.624 1.00 30.84  ? 401  ASP B C     1 
ATOM   6474  O O     . ASP B  1 401 ? 86.583  118.803 -109.003 1.00 29.76  ? 401  ASP B O     1 
ATOM   6475  C CB    . ASP B  1 401 ? 86.361  117.873 -112.082 1.00 34.63  ? 401  ASP B CB    1 
ATOM   6476  C CG    . ASP B  1 401 ? 85.659  117.715 -113.422 1.00 38.86  ? 401  ASP B CG    1 
ATOM   6477  O OD1   . ASP B  1 401 ? 84.514  117.201 -113.473 1.00 39.46  ? 401  ASP B OD1   1 
ATOM   6478  O OD2   . ASP B  1 401 ? 86.283  118.092 -114.444 1.00 40.06  ? 401  ASP B OD2   1 
ATOM   6479  N N     . GLY B  1 402 ? 86.723  116.569 -109.261 1.00 27.68  ? 402  GLY B N     1 
ATOM   6480  C CA    . GLY B  1 402 ? 87.659  116.401 -108.167 1.00 26.10  ? 402  GLY B CA    1 
ATOM   6481  C C     . GLY B  1 402 ? 87.305  116.426 -106.693 1.00 25.23  ? 402  GLY B C     1 
ATOM   6482  O O     . GLY B  1 402 ? 86.156  116.370 -106.289 1.00 24.97  ? 402  GLY B O     1 
ATOM   6483  N N     . MET B  1 403 ? 88.348  116.524 -105.880 1.00 24.74  ? 403  MET B N     1 
ATOM   6484  C CA    . MET B  1 403 ? 88.190  116.519 -104.431 1.00 24.15  ? 403  MET B CA    1 
ATOM   6485  C C     . MET B  1 403 ? 89.442  117.086 -103.747 1.00 22.54  ? 403  MET B C     1 
ATOM   6486  O O     . MET B  1 403 ? 90.468  117.348 -104.381 1.00 21.36  ? 403  MET B O     1 
ATOM   6487  C CB    . MET B  1 403 ? 88.023  115.072 -103.945 1.00 24.17  ? 403  MET B CB    1 
ATOM   6488  C CG    . MET B  1 403 ? 89.384  114.350 -103.884 1.00 26.30  ? 403  MET B CG    1 
ATOM   6489  S SD    . MET B  1 403 ? 89.339  112.599 -103.618 1.00 34.51  ? 403  MET B SD    1 
ATOM   6490  C CE    . MET B  1 403 ? 91.022  112.141 -103.345 1.00 30.40  ? 403  MET B CE    1 
ATOM   6491  N N     . VAL B  1 404 ? 89.327  117.259 -102.434 1.00 21.93  ? 404  VAL B N     1 
ATOM   6492  C CA    . VAL B  1 404 ? 90.430  117.684 -101.597 1.00 18.93  ? 404  VAL B CA    1 
ATOM   6493  C C     . VAL B  1 404 ? 90.743  116.453 -100.726 1.00 21.09  ? 404  VAL B C     1 
ATOM   6494  O O     . VAL B  1 404 ? 89.851  115.786 -100.204 1.00 18.51  ? 404  VAL B O     1 
ATOM   6495  C CB    . VAL B  1 404 ? 90.064  118.870 -100.679 1.00 17.16  ? 404  VAL B CB    1 
ATOM   6496  C CG1   . VAL B  1 404 ? 91.199  119.119 -99.696  1.00 16.53  ? 404  VAL B CG1   1 
ATOM   6497  C CG2   . VAL B  1 404 ? 89.831  120.129 -101.499 1.00 11.24  ? 404  VAL B CG2   1 
ATOM   6498  N N     . LYS B  1 405 ? 92.030  116.154 -100.594 1.00 23.68  ? 405  LYS B N     1 
ATOM   6499  C CA    . LYS B  1 405 ? 92.501  115.031 -99.798  1.00 25.10  ? 405  LYS B CA    1 
ATOM   6500  C C     . LYS B  1 405 ? 93.558  115.446 -98.771  1.00 26.09  ? 405  LYS B C     1 
ATOM   6501  O O     . LYS B  1 405 ? 94.624  115.960 -99.131  1.00 29.44  ? 405  LYS B O     1 
ATOM   6502  C CB    . LYS B  1 405 ? 93.095  113.963 -100.708 1.00 25.14  ? 405  LYS B CB    1 
ATOM   6503  C CG    . LYS B  1 405 ? 93.593  112.746 -99.959  1.00 24.93  ? 405  LYS B CG    1 
ATOM   6504  C CD    . LYS B  1 405 ? 94.275  111.819 -100.916 1.00 25.95  ? 405  LYS B CD    1 
ATOM   6505  C CE    . LYS B  1 405 ? 94.739  110.572 -100.249 1.00 26.44  ? 405  LYS B CE    1 
ATOM   6506  N NZ    . LYS B  1 405 ? 95.284  109.664 -101.285 1.00 27.30  ? 405  LYS B NZ    1 
ATOM   6507  N N     . ILE B  1 406 ? 93.267  115.189 -97.497  1.00 26.05  ? 406  ILE B N     1 
ATOM   6508  C CA    . ILE B  1 406 ? 94.166  115.513 -96.398  1.00 22.01  ? 406  ILE B CA    1 
ATOM   6509  C C     . ILE B  1 406 ? 94.724  114.265 -95.693  1.00 23.27  ? 406  ILE B C     1 
ATOM   6510  O O     . ILE B  1 406 ? 94.013  113.290 -95.451  1.00 22.70  ? 406  ILE B O     1 
ATOM   6511  C CB    . ILE B  1 406 ? 93.433  116.388 -95.362  1.00 21.61  ? 406  ILE B CB    1 
ATOM   6512  C CG1   . ILE B  1 406 ? 92.966  117.684 -96.044  1.00 19.88  ? 406  ILE B CG1   1 
ATOM   6513  C CG2   . ILE B  1 406 ? 94.332  116.649 -94.134  1.00 16.57  ? 406  ILE B CG2   1 
ATOM   6514  C CD1   . ILE B  1 406 ? 94.083  118.604 -96.457  1.00 20.98  ? 406  ILE B CD1   1 
ATOM   6515  N N     . LEU B  1 407 ? 96.018  114.304 -95.391  1.00 22.83  ? 407  LEU B N     1 
ATOM   6516  C CA    . LEU B  1 407 ? 96.700  113.235 -94.673  1.00 21.15  ? 407  LEU B CA    1 
ATOM   6517  C C     . LEU B  1 407 ? 97.164  113.844 -93.341  1.00 20.57  ? 407  LEU B C     1 
ATOM   6518  O O     . LEU B  1 407 ? 97.891  114.844 -93.308  1.00 22.33  ? 407  LEU B O     1 
ATOM   6519  C CB    . LEU B  1 407 ? 97.874  112.729 -95.505  1.00 20.50  ? 407  LEU B CB    1 
ATOM   6520  C CG    . LEU B  1 407 ? 97.472  112.244 -96.918  1.00 19.89  ? 407  LEU B CG    1 
ATOM   6521  C CD1   . LEU B  1 407 ? 98.694  112.049 -97.746  1.00 18.52  ? 407  LEU B CD1   1 
ATOM   6522  C CD2   . LEU B  1 407 ? 96.711  110.933 -96.855  1.00 21.86  ? 407  LEU B CD2   1 
ATOM   6523  N N     . GLY B  1 408 ? 96.687  113.280 -92.243  1.00 21.08  ? 408  GLY B N     1 
ATOM   6524  C CA    . GLY B  1 408 ? 97.036  113.781 -90.922  1.00 21.46  ? 408  GLY B CA    1 
ATOM   6525  C C     . GLY B  1 408 ? 97.686  112.700 -90.085  1.00 24.02  ? 408  GLY B C     1 
ATOM   6526  O O     . GLY B  1 408 ? 97.376  111.518 -90.242  1.00 24.21  ? 408  GLY B O     1 
ATOM   6527  N N     . GLN B  1 409 ? 98.613  113.088 -89.217  1.00 25.65  ? 409  GLN B N     1 
ATOM   6528  C CA    . GLN B  1 409 ? 99.271  112.119 -88.359  1.00 27.91  ? 409  GLN B CA    1 
ATOM   6529  C C     . GLN B  1 409 ? 98.284  111.746 -87.271  1.00 28.08  ? 409  GLN B C     1 
ATOM   6530  O O     . GLN B  1 409 ? 97.760  112.614 -86.596  1.00 27.98  ? 409  GLN B O     1 
ATOM   6531  C CB    . GLN B  1 409 ? 100.500 112.735 -87.729  1.00 30.79  ? 409  GLN B CB    1 
ATOM   6532  C CG    . GLN B  1 409 ? 101.414 111.761 -87.042  1.00 37.48  ? 409  GLN B CG    1 
ATOM   6533  C CD    . GLN B  1 409 ? 102.830 112.297 -87.014  1.00 42.83  ? 409  GLN B CD    1 
ATOM   6534  O OE1   . GLN B  1 409 ? 103.068 113.405 -86.537  1.00 45.99  ? 409  GLN B OE1   1 
ATOM   6535  N NE2   . GLN B  1 409 ? 103.776 111.527 -87.542  1.00 44.56  ? 409  GLN B NE2   1 
ATOM   6536  N N     . LYS B  1 410 ? 98.041  110.452 -87.110  1.00 29.65  ? 410  LYS B N     1 
ATOM   6537  C CA    . LYS B  1 410 ? 97.110  109.924 -86.120  1.00 32.23  ? 410  LYS B CA    1 
ATOM   6538  C C     . LYS B  1 410 ? 97.322  110.445 -84.692  1.00 32.94  ? 410  LYS B C     1 
ATOM   6539  O O     . LYS B  1 410 ? 96.368  110.795 -84.004  1.00 33.06  ? 410  LYS B O     1 
ATOM   6540  C CB    . LYS B  1 410 ? 97.191  108.386 -86.131  1.00 34.92  ? 410  LYS B CB    1 
ATOM   6541  C CG    . LYS B  1 410 ? 96.290  107.633 -85.152  1.00 36.60  ? 410  LYS B CG    1 
ATOM   6542  C CD    . LYS B  1 410 ? 94.995  107.173 -85.805  1.00 42.29  ? 410  LYS B CD    1 
ATOM   6543  C CE    . LYS B  1 410 ? 95.239  106.211 -86.993  1.00 44.27  ? 410  LYS B CE    1 
ATOM   6544  N NZ    . LYS B  1 410 ? 94.013  105.984 -87.844  1.00 42.47  ? 410  LYS B NZ    1 
ATOM   6545  N N     . SER B  1 411 ? 98.568  110.524 -84.255  1.00 32.59  ? 411  SER B N     1 
ATOM   6546  C CA    . SER B  1 411 ? 98.852  110.941 -82.890  1.00 34.14  ? 411  SER B CA    1 
ATOM   6547  C C     . SER B  1 411 ? 98.727  112.414 -82.563  1.00 34.36  ? 411  SER B C     1 
ATOM   6548  O O     . SER B  1 411 ? 98.243  112.772 -81.489  1.00 35.56  ? 411  SER B O     1 
ATOM   6549  C CB    . SER B  1 411 ? 100.255 110.500 -82.513  1.00 33.76  ? 411  SER B CB    1 
ATOM   6550  O OG    . SER B  1 411 ? 101.165 110.994 -83.471  1.00 35.44  ? 411  SER B OG    1 
ATOM   6551  N N     . THR B  1 412 ? 99.180  113.272 -83.473  1.00 33.54  ? 412  THR B N     1 
ATOM   6552  C CA    . THR B  1 412 ? 99.149  114.711 -83.229  1.00 31.40  ? 412  THR B CA    1 
ATOM   6553  C C     . THR B  1 412 ? 98.144  115.508 -84.043  1.00 30.19  ? 412  THR B C     1 
ATOM   6554  O O     . THR B  1 412 ? 97.985  116.704 -83.817  1.00 30.18  ? 412  THR B O     1 
ATOM   6555  C CB    . THR B  1 412 ? 100.522 115.305 -83.491  1.00 31.59  ? 412  THR B CB    1 
ATOM   6556  O OG1   . THR B  1 412 ? 100.850 115.155 -84.879  1.00 30.00  ? 412  THR B OG1   1 
ATOM   6557  C CG2   . THR B  1 412 ? 101.555 114.577 -82.658  1.00 32.97  ? 412  THR B CG2   1 
ATOM   6558  N N     . ASP B  1 413 ? 97.478  114.846 -84.985  1.00 27.13  ? 413  ASP B N     1 
ATOM   6559  C CA    . ASP B  1 413 ? 96.506  115.482 -85.879  1.00 26.94  ? 413  ASP B CA    1 
ATOM   6560  C C     . ASP B  1 413 ? 97.185  116.527 -86.805  1.00 24.49  ? 413  ASP B C     1 
ATOM   6561  O O     . ASP B  1 413 ? 96.537  117.323 -87.480  1.00 22.53  ? 413  ASP B O     1 
ATOM   6562  C CB    . ASP B  1 413 ? 95.320  116.077 -85.082  1.00 26.57  ? 413  ASP B CB    1 
ATOM   6563  C CG    . ASP B  1 413 ? 94.155  116.494 -85.983  1.00 29.38  ? 413  ASP B CG    1 
ATOM   6564  O OD1   . ASP B  1 413 ? 93.915  115.827 -87.014  1.00 30.71  ? 413  ASP B OD1   1 
ATOM   6565  O OD2   . ASP B  1 413 ? 93.464  117.485 -85.668  1.00 32.69  ? 413  ASP B OD2   1 
ATOM   6566  N N     . ARG B  1 414 ? 98.509  116.476 -86.850  1.00 23.68  ? 414  ARG B N     1 
ATOM   6567  C CA    . ARG B  1 414 ? 99.280  117.358 -87.697  1.00 22.91  ? 414  ARG B CA    1 
ATOM   6568  C C     . ARG B  1 414 ? 99.035  117.043 -89.184  1.00 22.98  ? 414  ARG B C     1 
ATOM   6569  O O     . ARG B  1 414 ? 98.977  115.873 -89.622  1.00 21.98  ? 414  ARG B O     1 
ATOM   6570  C CB    . ARG B  1 414 ? 100.761 117.213 -87.365  1.00 23.35  ? 414  ARG B CB    1 
ATOM   6571  C CG    . ARG B  1 414 ? 101.698 118.169 -88.093  1.00 30.33  ? 414  ARG B CG    1 
ATOM   6572  C CD    . ARG B  1 414 ? 103.040 118.231 -87.354  1.00 36.61  ? 414  ARG B CD    1 
ATOM   6573  N NE    . ARG B  1 414 ? 104.024 119.110 -87.986  1.00 40.66  ? 414  ARG B NE    1 
ATOM   6574  C CZ    . ARG B  1 414 ? 105.171 119.486 -87.418  1.00 42.53  ? 414  ARG B CZ    1 
ATOM   6575  N NH1   . ARG B  1 414 ? 105.477 119.058 -86.197  1.00 43.27  ? 414  ARG B NH1   1 
ATOM   6576  N NH2   . ARG B  1 414 ? 106.014 120.287 -88.073  1.00 42.52  ? 414  ARG B NH2   1 
ATOM   6577  N N     . VAL B  1 415 ? 98.873  118.101 -89.958  1.00 21.09  ? 415  VAL B N     1 
ATOM   6578  C CA    . VAL B  1 415 ? 98.674  117.951 -91.381  1.00 22.59  ? 415  VAL B CA    1 
ATOM   6579  C C     . VAL B  1 415 ? 100.005 117.511 -92.010  1.00 24.57  ? 415  VAL B C     1 
ATOM   6580  O O     . VAL B  1 415 ? 100.966 118.275 -92.032  1.00 23.93  ? 415  VAL B O     1 
ATOM   6581  C CB    . VAL B  1 415 ? 98.246  119.263 -91.997  1.00 20.08  ? 415  VAL B CB    1 
ATOM   6582  C CG1   . VAL B  1 415 ? 98.111  119.099 -93.459  1.00 17.57  ? 415  VAL B CG1   1 
ATOM   6583  C CG2   . VAL B  1 415 ? 96.945  119.729 -91.356  1.00 19.64  ? 415  VAL B CG2   1 
ATOM   6584  N N     . LEU B  1 416 ? 100.060 116.279 -92.517  1.00 24.36  ? 416  LEU B N     1 
ATOM   6585  C CA    . LEU B  1 416 ? 101.290 115.789 -93.122  1.00 25.01  ? 416  LEU B CA    1 
ATOM   6586  C C     . LEU B  1 416 ? 101.324 116.031 -94.640  1.00 26.11  ? 416  LEU B C     1 
ATOM   6587  O O     . LEU B  1 416 ? 102.400 116.155 -95.257  1.00 27.04  ? 416  LEU B O     1 
ATOM   6588  C CB    . LEU B  1 416 ? 101.470 114.293 -92.805  1.00 23.30  ? 416  LEU B CB    1 
ATOM   6589  C CG    . LEU B  1 416 ? 101.525 113.945 -91.298  1.00 23.09  ? 416  LEU B CG    1 
ATOM   6590  C CD1   . LEU B  1 416 ? 101.638 112.420 -91.089  1.00 19.81  ? 416  LEU B CD1   1 
ATOM   6591  C CD2   . LEU B  1 416 ? 102.708 114.678 -90.642  1.00 18.46  ? 416  LEU B CD2   1 
ATOM   6592  N N     . GLY B  1 417 ? 100.145 116.124 -95.247  1.00 25.79  ? 417  GLY B N     1 
ATOM   6593  C CA    . GLY B  1 417 ? 100.094 116.330 -96.678  1.00 22.26  ? 417  GLY B CA    1 
ATOM   6594  C C     . GLY B  1 417 ? 98.745  116.807 -97.113  1.00 21.09  ? 417  GLY B C     1 
ATOM   6595  O O     . GLY B  1 417 ? 97.745  116.401 -96.568  1.00 19.60  ? 417  GLY B O     1 
ATOM   6596  N N     . ALA B  1 418 ? 98.732  117.687 -98.104  1.00 22.38  ? 418  ALA B N     1 
ATOM   6597  C CA    . ALA B  1 418 ? 97.498  118.226 -98.651  1.00 22.71  ? 418  ALA B CA    1 
ATOM   6598  C C     . ALA B  1 418 ? 97.514  117.999 -100.170 1.00 23.03  ? 418  ALA B C     1 
ATOM   6599  O O     . ALA B  1 418 ? 98.525  118.267 -100.820 1.00 20.48  ? 418  ALA B O     1 
ATOM   6600  C CB    . ALA B  1 418 ? 97.380  119.726 -98.315  1.00 20.74  ? 418  ALA B CB    1 
ATOM   6601  N N     . HIS B  1 419 ? 96.391  117.499 -100.711 1.00 24.13  ? 419  HIS B N     1 
ATOM   6602  C CA    . HIS B  1 419 ? 96.244  117.202 -102.146 1.00 23.01  ? 419  HIS B CA    1 
ATOM   6603  C C     . HIS B  1 419 ? 94.896  117.660 -102.670 1.00 23.90  ? 419  HIS B C     1 
ATOM   6604  O O     . HIS B  1 419 ? 93.841  117.272 -102.172 1.00 24.34  ? 419  HIS B O     1 
ATOM   6605  C CB    . HIS B  1 419 ? 96.405  115.708 -102.389 1.00 23.95  ? 419  HIS B CB    1 
ATOM   6606  C CG    . HIS B  1 419 ? 97.662  115.160 -101.817 1.00 25.85  ? 419  HIS B CG    1 
ATOM   6607  N ND1   . HIS B  1 419 ? 98.831  115.076 -102.540 1.00 26.47  ? 419  HIS B ND1   1 
ATOM   6608  C CD2   . HIS B  1 419 ? 97.962  114.758 -100.559 1.00 25.82  ? 419  HIS B CD2   1 
ATOM   6609  C CE1   . HIS B  1 419 ? 99.798  114.641 -101.752 1.00 26.79  ? 419  HIS B CE1   1 
ATOM   6610  N NE2   . HIS B  1 419 ? 99.297  114.442 -100.546 1.00 26.77  ? 419  HIS B NE2   1 
ATOM   6611  N N     . ILE B  1 420 ? 94.948  118.475 -103.711 1.00 24.51  ? 420  ILE B N     1 
ATOM   6612  C CA    . ILE B  1 420 ? 93.758  119.044 -104.322 1.00 25.07  ? 420  ILE B CA    1 
ATOM   6613  C C     . ILE B  1 420 ? 93.653  118.778 -105.821 1.00 25.82  ? 420  ILE B C     1 
ATOM   6614  O O     . ILE B  1 420 ? 94.560  119.116 -106.583 1.00 26.52  ? 420  ILE B O     1 
ATOM   6615  C CB    . ILE B  1 420 ? 93.754  120.572 -104.115 1.00 23.14  ? 420  ILE B CB    1 
ATOM   6616  C CG1   . ILE B  1 420 ? 94.057  120.866 -102.649 1.00 22.18  ? 420  ILE B CG1   1 
ATOM   6617  C CG2   . ILE B  1 420 ? 92.422  121.178 -104.555 1.00 20.50  ? 420  ILE B CG2   1 
ATOM   6618  C CD1   . ILE B  1 420 ? 94.639  122.219 -102.441 1.00 23.96  ? 420  ILE B CD1   1 
ATOM   6619  N N     . LEU B  1 421 ? 92.538  118.176 -106.227 1.00 25.90  ? 421  LEU B N     1 
ATOM   6620  C CA    . LEU B  1 421 ? 92.255  117.908 -107.634 1.00 25.85  ? 421  LEU B CA    1 
ATOM   6621  C C     . LEU B  1 421 ? 90.938  118.616 -107.873 1.00 26.63  ? 421  LEU B C     1 
ATOM   6622  O O     . LEU B  1 421 ? 89.922  118.216 -107.330 1.00 27.51  ? 421  LEU B O     1 
ATOM   6623  C CB    . LEU B  1 421 ? 92.065  116.418 -107.910 1.00 27.13  ? 421  LEU B CB    1 
ATOM   6624  C CG    . LEU B  1 421 ? 91.533  116.037 -109.309 1.00 26.73  ? 421  LEU B CG    1 
ATOM   6625  C CD1   . LEU B  1 421 ? 92.486  116.504 -110.398 1.00 24.66  ? 421  LEU B CD1   1 
ATOM   6626  C CD2   . LEU B  1 421 ? 91.359  114.536 -109.385 1.00 25.26  ? 421  LEU B CD2   1 
ATOM   6627  N N     . GLY B  1 422 ? 90.969  119.686 -108.661 1.00 26.75  ? 422  GLY B N     1 
ATOM   6628  C CA    . GLY B  1 422 ? 89.767  120.433 -108.936 1.00 26.07  ? 422  GLY B CA    1 
ATOM   6629  C C     . GLY B  1 422 ? 89.989  121.921 -109.136 1.00 26.83  ? 422  GLY B C     1 
ATOM   6630  O O     . GLY B  1 422 ? 91.113  122.378 -109.340 1.00 28.44  ? 422  GLY B O     1 
ATOM   6631  N N     . PRO B  1 423 ? 88.912  122.713 -109.072 1.00 25.49  ? 423  PRO B N     1 
ATOM   6632  C CA    . PRO B  1 423 ? 89.047  124.157 -109.258 1.00 25.80  ? 423  PRO B CA    1 
ATOM   6633  C C     . PRO B  1 423 ? 89.763  124.867 -108.122 1.00 28.27  ? 423  PRO B C     1 
ATOM   6634  O O     . PRO B  1 423 ? 89.585  124.514 -106.942 1.00 30.34  ? 423  PRO B O     1 
ATOM   6635  C CB    . PRO B  1 423 ? 87.597  124.625 -109.380 1.00 24.21  ? 423  PRO B CB    1 
ATOM   6636  C CG    . PRO B  1 423 ? 86.863  123.660 -108.490 1.00 23.72  ? 423  PRO B CG    1 
ATOM   6637  C CD    . PRO B  1 423 ? 87.504  122.334 -108.831 1.00 23.81  ? 423  PRO B CD    1 
ATOM   6638  N N     . GLY B  1 424 ? 90.564  125.864 -108.489 1.00 27.23  ? 424  GLY B N     1 
ATOM   6639  C CA    . GLY B  1 424 ? 91.263  126.673 -107.511 1.00 27.89  ? 424  GLY B CA    1 
ATOM   6640  C C     . GLY B  1 424 ? 92.411  126.043 -106.746 1.00 27.78  ? 424  GLY B C     1 
ATOM   6641  O O     . GLY B  1 424 ? 92.906  126.625 -105.786 1.00 25.52  ? 424  GLY B O     1 
ATOM   6642  N N     . ALA B  1 425 ? 92.842  124.870 -107.190 1.00 27.51  ? 425  ALA B N     1 
ATOM   6643  C CA    . ALA B  1 425 ? 93.923  124.147 -106.535 1.00 27.07  ? 425  ALA B CA    1 
ATOM   6644  C C     . ALA B  1 425 ? 95.209  124.956 -106.375 1.00 26.68  ? 425  ALA B C     1 
ATOM   6645  O O     . ALA B  1 425 ? 95.818  124.966 -105.290 1.00 26.81  ? 425  ALA B O     1 
ATOM   6646  C CB    . ALA B  1 425 ? 94.213  122.832 -107.313 1.00 27.01  ? 425  ALA B CB    1 
ATOM   6647  N N     . GLY B  1 426 ? 95.608  125.622 -107.460 1.00 25.15  ? 426  GLY B N     1 
ATOM   6648  C CA    . GLY B  1 426 ? 96.836  126.401 -107.472 1.00 25.85  ? 426  GLY B CA    1 
ATOM   6649  C C     . GLY B  1 426 ? 96.942  127.462 -106.407 1.00 24.68  ? 426  GLY B C     1 
ATOM   6650  O O     . GLY B  1 426 ? 98.007  127.689 -105.826 1.00 24.78  ? 426  GLY B O     1 
ATOM   6651  N N     . GLU B  1 427 ? 95.826  128.128 -106.152 1.00 24.32  ? 427  GLU B N     1 
ATOM   6652  C CA    . GLU B  1 427 ? 95.811  129.158 -105.136 1.00 25.10  ? 427  GLU B CA    1 
ATOM   6653  C C     . GLU B  1 427 ? 95.641  128.496 -103.792 1.00 25.18  ? 427  GLU B C     1 
ATOM   6654  O O     . GLU B  1 427 ? 96.365  128.777 -102.854 1.00 28.30  ? 427  GLU B O     1 
ATOM   6655  C CB    . GLU B  1 427 ? 94.671  130.138 -105.378 1.00 23.10  ? 427  GLU B CB    1 
ATOM   6656  C CG    . GLU B  1 427 ? 94.808  130.934 -106.673 1.00 22.62  ? 427  GLU B CG    1 
ATOM   6657  C CD    . GLU B  1 427 ? 96.139  131.681 -106.797 1.00 22.69  ? 427  GLU B CD    1 
ATOM   6658  O OE1   . GLU B  1 427 ? 96.700  132.134 -105.776 1.00 23.56  ? 427  GLU B OE1   1 
ATOM   6659  O OE2   . GLU B  1 427 ? 96.620  131.826 -107.936 1.00 26.07  ? 427  GLU B OE2   1 
ATOM   6660  N N     . MET B  1 428 ? 94.690  127.583 -103.723 1.00 25.97  ? 428  MET B N     1 
ATOM   6661  C CA    . MET B  1 428 ? 94.376  126.861 -102.497 1.00 26.62  ? 428  MET B CA    1 
ATOM   6662  C C     . MET B  1 428 ? 95.579  126.236 -101.763 1.00 26.82  ? 428  MET B C     1 
ATOM   6663  O O     . MET B  1 428 ? 95.654  126.282 -100.527 1.00 25.76  ? 428  MET B O     1 
ATOM   6664  C CB    . MET B  1 428 ? 93.347  125.773 -102.810 1.00 27.40  ? 428  MET B CB    1 
ATOM   6665  C CG    . MET B  1 428 ? 92.564  125.325 -101.606 1.00 29.69  ? 428  MET B CG    1 
ATOM   6666  S SD    . MET B  1 428 ? 91.430  123.994 -101.948 1.00 31.70  ? 428  MET B SD    1 
ATOM   6667  C CE    . MET B  1 428 ? 90.199  124.805 -102.971 1.00 27.97  ? 428  MET B CE    1 
ATOM   6668  N N     . VAL B  1 429 ? 96.519  125.683 -102.530 1.00 25.74  ? 429  VAL B N     1 
ATOM   6669  C CA    . VAL B  1 429 ? 97.670  125.011 -101.962 1.00 24.79  ? 429  VAL B CA    1 
ATOM   6670  C C     . VAL B  1 429 ? 98.540  125.899 -101.098 1.00 25.36  ? 429  VAL B C     1 
ATOM   6671  O O     . VAL B  1 429 ? 99.318  125.440 -100.250 1.00 24.16  ? 429  VAL B O     1 
ATOM   6672  C CB    . VAL B  1 429 ? 98.521  124.354 -103.069 1.00 25.31  ? 429  VAL B CB    1 
ATOM   6673  C CG1   . VAL B  1 429 ? 99.264  125.403 -103.879 1.00 23.24  ? 429  VAL B CG1   1 
ATOM   6674  C CG2   . VAL B  1 429 ? 99.448  123.350 -102.440 1.00 22.22  ? 429  VAL B CG2   1 
ATOM   6675  N N     . ASN B  1 430 ? 98.389  127.191 -101.296 1.00 24.67  ? 430  ASN B N     1 
ATOM   6676  C CA    . ASN B  1 430 ? 99.170  128.110 -100.505 1.00 26.33  ? 430  ASN B CA    1 
ATOM   6677  C C     . ASN B  1 430 ? 98.585  128.266 -99.117  1.00 26.71  ? 430  ASN B C     1 
ATOM   6678  O O     . ASN B  1 430 ? 99.276  128.699 -98.197  1.00 27.33  ? 430  ASN B O     1 
ATOM   6679  C CB    . ASN B  1 430 ? 99.316  129.418 -101.246 1.00 25.99  ? 430  ASN B CB    1 
ATOM   6680  C CG    . ASN B  1 430 ? 99.989  129.215 -102.565 1.00 26.79  ? 430  ASN B CG    1 
ATOM   6681  O OD1   . ASN B  1 430 ? 99.443  129.535 -103.619 1.00 31.11  ? 430  ASN B OD1   1 
ATOM   6682  N ND2   . ASN B  1 430 ? 101.181 128.663 -102.522 1.00 26.62  ? 430  ASN B ND2   1 
ATOM   6683  N N     . GLU B  1 431 ? 97.316  127.914 -98.941  1.00 26.77  ? 431  GLU B N     1 
ATOM   6684  C CA    . GLU B  1 431 ? 96.762  127.974 -97.604  1.00 25.52  ? 431  GLU B CA    1 
ATOM   6685  C C     . GLU B  1 431 ? 97.369  126.732 -96.918  1.00 25.75  ? 431  GLU B C     1 
ATOM   6686  O O     . GLU B  1 431 ? 97.679  126.765 -95.738  1.00 25.46  ? 431  GLU B O     1 
ATOM   6687  C CB    . GLU B  1 431 ? 95.242  127.881 -97.627  1.00 25.21  ? 431  GLU B CB    1 
ATOM   6688  C CG    . GLU B  1 431 ? 94.642  128.185 -96.276  1.00 27.70  ? 431  GLU B CG    1 
ATOM   6689  C CD    . GLU B  1 431 ? 93.174  127.810 -96.152  1.00 28.94  ? 431  GLU B CD    1 
ATOM   6690  O OE1   . GLU B  1 431 ? 92.394  128.133 -97.071  1.00 30.13  ? 431  GLU B OE1   1 
ATOM   6691  O OE2   . GLU B  1 431 ? 92.793  127.203 -95.122  1.00 29.85  ? 431  GLU B OE2   1 
ATOM   6692  N N     . ALA B  1 432 ? 97.574  125.646 -97.675  1.00 25.87  ? 432  ALA B N     1 
ATOM   6693  C CA    . ALA B  1 432 ? 98.168  124.436 -97.112  1.00 24.64  ? 432  ALA B CA    1 
ATOM   6694  C C     . ALA B  1 432 ? 99.661  124.641 -96.775  1.00 24.37  ? 432  ALA B C     1 
ATOM   6695  O O     . ALA B  1 432 ? 100.135 124.146 -95.761  1.00 23.84  ? 432  ALA B O     1 
ATOM   6696  C CB    . ALA B  1 432 ? 97.998  123.281 -98.067  1.00 22.62  ? 432  ALA B CB    1 
ATOM   6697  N N     . ALA B  1 433 ? 100.400 125.353 -97.622  1.00 22.71  ? 433  ALA B N     1 
ATOM   6698  C CA    . ALA B  1 433 ? 101.807 125.629 -97.327  1.00 22.82  ? 433  ALA B CA    1 
ATOM   6699  C C     . ALA B  1 433 ? 101.949 126.407 -96.003  1.00 23.24  ? 433  ALA B C     1 
ATOM   6700  O O     . ALA B  1 433 ? 102.848 126.130 -95.204  1.00 22.58  ? 433  ALA B O     1 
ATOM   6701  C CB    . ALA B  1 433 ? 102.439 126.427 -98.455  1.00 22.96  ? 433  ALA B CB    1 
ATOM   6702  N N     . LEU B  1 434 ? 101.054 127.370 -95.775  1.00 23.52  ? 434  LEU B N     1 
ATOM   6703  C CA    . LEU B  1 434 ? 101.072 128.163 -94.545  1.00 24.55  ? 434  LEU B CA    1 
ATOM   6704  C C     . LEU B  1 434 ? 100.847 127.280 -93.326  1.00 24.37  ? 434  LEU B C     1 
ATOM   6705  O O     . LEU B  1 434 ? 101.552 127.395 -92.344  1.00 24.95  ? 434  LEU B O     1 
ATOM   6706  C CB    . LEU B  1 434 ? 100.008 129.268 -94.588  1.00 24.65  ? 434  LEU B CB    1 
ATOM   6707  C CG    . LEU B  1 434 ? 99.888  130.198 -93.363  1.00 23.56  ? 434  LEU B CG    1 
ATOM   6708  C CD1   . LEU B  1 434 ? 101.258 130.679 -92.901  1.00 27.10  ? 434  LEU B CD1   1 
ATOM   6709  C CD2   . LEU B  1 434 ? 99.055  131.389 -93.721  1.00 21.82  ? 434  LEU B CD2   1 
ATOM   6710  N N     . ALA B  1 435 ? 99.865  126.392 -93.413  1.00 25.36  ? 435  ALA B N     1 
ATOM   6711  C CA    . ALA B  1 435 ? 99.547  125.449 -92.339  1.00 25.05  ? 435  ALA B CA    1 
ATOM   6712  C C     . ALA B  1 435 ? 100.744 124.548 -92.056  1.00 26.13  ? 435  ALA B C     1 
ATOM   6713  O O     . ALA B  1 435 ? 101.134 124.350 -90.909  1.00 27.59  ? 435  ALA B O     1 
ATOM   6714  C CB    . ALA B  1 435 ? 98.357  124.596 -92.734  1.00 22.95  ? 435  ALA B CB    1 
ATOM   6715  N N     . LEU B  1 436 ? 101.322 123.998 -93.113  1.00 26.23  ? 436  LEU B N     1 
ATOM   6716  C CA    . LEU B  1 436 ? 102.473 123.136 -92.972  1.00 26.53  ? 436  LEU B CA    1 
ATOM   6717  C C     . LEU B  1 436 ? 103.610 123.811 -92.239  1.00 27.48  ? 436  LEU B C     1 
ATOM   6718  O O     . LEU B  1 436 ? 104.279 123.201 -91.397  1.00 26.14  ? 436  LEU B O     1 
ATOM   6719  C CB    . LEU B  1 436 ? 102.983 122.692 -94.342  1.00 25.48  ? 436  LEU B CB    1 
ATOM   6720  C CG    . LEU B  1 436 ? 102.391 121.436 -94.986  1.00 28.14  ? 436  LEU B CG    1 
ATOM   6721  C CD1   . LEU B  1 436 ? 103.528 120.505 -95.349  1.00 28.65  ? 436  LEU B CD1   1 
ATOM   6722  C CD2   . LEU B  1 436 ? 101.446 120.726 -94.049  1.00 28.63  ? 436  LEU B CD2   1 
ATOM   6723  N N     . GLU B  1 437 ? 103.828 125.075 -92.584  1.00 29.21  ? 437  GLU B N     1 
ATOM   6724  C CA    . GLU B  1 437 ? 104.911 125.862 -92.007  1.00 30.77  ? 437  GLU B CA    1 
ATOM   6725  C C     . GLU B  1 437 ? 104.825 126.006 -90.500  1.00 29.00  ? 437  GLU B C     1 
ATOM   6726  O O     . GLU B  1 437 ? 105.853 126.085 -89.838  1.00 28.04  ? 437  GLU B O     1 
ATOM   6727  C CB    . GLU B  1 437 ? 104.970 127.252 -92.658  1.00 35.13  ? 437  GLU B CB    1 
ATOM   6728  C CG    . GLU B  1 437 ? 106.406 127.818 -92.823  1.00 40.47  ? 437  GLU B CG    1 
ATOM   6729  C CD    . GLU B  1 437 ? 107.258 127.082 -93.873  1.00 42.00  ? 437  GLU B CD    1 
ATOM   6730  O OE1   . GLU B  1 437 ? 106.878 127.066 -95.080  1.00 44.79  ? 437  GLU B OE1   1 
ATOM   6731  O OE2   . GLU B  1 437 ? 108.315 126.536 -93.486  1.00 40.01  ? 437  GLU B OE2   1 
ATOM   6732  N N     . TYR B  1 438 ? 103.613 126.043 -89.954  1.00 28.93  ? 438  TYR B N     1 
ATOM   6733  C CA    . TYR B  1 438 ? 103.462 126.148 -88.495  1.00 29.92  ? 438  TYR B CA    1 
ATOM   6734  C C     . TYR B  1 438 ? 103.264 124.818 -87.789  1.00 27.63  ? 438  TYR B C     1 
ATOM   6735  O O     . TYR B  1 438 ? 103.168 124.792 -86.562  1.00 28.42  ? 438  TYR B O     1 
ATOM   6736  C CB    . TYR B  1 438 ? 102.280 127.041 -88.113  1.00 32.34  ? 438  TYR B CB    1 
ATOM   6737  C CG    . TYR B  1 438 ? 102.471 128.510 -88.410  1.00 35.35  ? 438  TYR B CG    1 
ATOM   6738  C CD1   . TYR B  1 438 ? 103.415 129.274 -87.723  1.00 35.77  ? 438  TYR B CD1   1 
ATOM   6739  C CD2   . TYR B  1 438 ? 101.667 129.145 -89.352  1.00 35.35  ? 438  TYR B CD2   1 
ATOM   6740  C CE1   . TYR B  1 438 ? 103.535 130.643 -87.971  1.00 37.64  ? 438  TYR B CE1   1 
ATOM   6741  C CE2   . TYR B  1 438 ? 101.782 130.489 -89.602  1.00 37.17  ? 438  TYR B CE2   1 
ATOM   6742  C CZ    . TYR B  1 438 ? 102.704 131.235 -88.912  1.00 37.77  ? 438  TYR B CZ    1 
ATOM   6743  O OH    . TYR B  1 438 ? 102.729 132.587 -89.148  1.00 41.69  ? 438  TYR B OH    1 
ATOM   6744  N N     . GLY B  1 439 ? 103.196 123.729 -88.555  1.00 25.04  ? 439  GLY B N     1 
ATOM   6745  C CA    . GLY B  1 439 ? 102.974 122.424 -87.968  1.00 22.69  ? 439  GLY B CA    1 
ATOM   6746  C C     . GLY B  1 439 ? 101.521 122.268 -87.513  1.00 22.52  ? 439  GLY B C     1 
ATOM   6747  O O     . GLY B  1 439 ? 101.188 121.482 -86.598  1.00 20.98  ? 439  GLY B O     1 
ATOM   6748  N N     . ALA B  1 440 ? 100.653 123.014 -88.186  1.00 20.98  ? 440  ALA B N     1 
ATOM   6749  C CA    . ALA B  1 440 ? 99.217  123.031 -87.896  1.00 21.40  ? 440  ALA B CA    1 
ATOM   6750  C C     . ALA B  1 440 ? 98.518  121.688 -88.001  1.00 19.95  ? 440  ALA B C     1 
ATOM   6751  O O     . ALA B  1 440 ? 98.912  120.810 -88.755  1.00 21.53  ? 440  ALA B O     1 
ATOM   6752  C CB    . ALA B  1 440 ? 98.529  124.035 -88.809  1.00 19.77  ? 440  ALA B CB    1 
ATOM   6753  N N     . SER B  1 441 ? 97.452  121.554 -87.243  1.00 19.89  ? 441  SER B N     1 
ATOM   6754  C CA    . SER B  1 441 ? 96.673  120.335 -87.233  1.00 20.55  ? 441  SER B CA    1 
ATOM   6755  C C     . SER B  1 441 ? 95.462  120.440 -88.187  1.00 21.35  ? 441  SER B C     1 
ATOM   6756  O O     . SER B  1 441 ? 95.087  121.535 -88.638  1.00 19.41  ? 441  SER B O     1 
ATOM   6757  C CB    . SER B  1 441 ? 96.174  120.083 -85.812  1.00 19.34  ? 441  SER B CB    1 
ATOM   6758  O OG    . SER B  1 441 ? 95.047  120.901 -85.566  1.00 23.19  ? 441  SER B OG    1 
ATOM   6759  N N     . CYS B  1 442 ? 94.865  119.292 -88.498  1.00 21.43  ? 442  CYS B N     1 
ATOM   6760  C CA    . CYS B  1 442 ? 93.671  119.267 -89.329  1.00 22.21  ? 442  CYS B CA    1 
ATOM   6761  C C     . CYS B  1 442 ? 92.593  119.996 -88.547  1.00 22.38  ? 442  CYS B C     1 
ATOM   6762  O O     . CYS B  1 442 ? 91.782  120.712 -89.119  1.00 23.67  ? 442  CYS B O     1 
ATOM   6763  C CB    . CYS B  1 442 ? 93.223  117.832 -89.596  1.00 20.67  ? 442  CYS B CB    1 
ATOM   6764  S SG    . CYS B  1 442 ? 94.483  116.857 -90.357  1.00 25.09  ? 442  CYS B SG    1 
ATOM   6765  N N     . GLU B  1 443 ? 92.578  119.824 -87.227  1.00 22.82  ? 443  GLU B N     1 
ATOM   6766  C CA    . GLU B  1 443 ? 91.575  120.525 -86.439  1.00 21.44  ? 443  GLU B CA    1 
ATOM   6767  C C     . GLU B  1 443 ? 91.852  122.014 -86.486  1.00 20.28  ? 443  GLU B C     1 
ATOM   6768  O O     . GLU B  1 443 ? 90.920  122.798 -86.576  1.00 20.40  ? 443  GLU B O     1 
ATOM   6769  C CB    . GLU B  1 443 ? 91.529  120.006 -85.000  1.00 22.03  ? 443  GLU B CB    1 
ATOM   6770  C CG    . GLU B  1 443 ? 90.757  120.897 -84.072  1.00 22.60  ? 443  GLU B CG    1 
ATOM   6771  C CD    . GLU B  1 443 ? 90.643  120.325 -82.671  1.00 26.36  ? 443  GLU B CD    1 
ATOM   6772  O OE1   . GLU B  1 443 ? 91.449  119.450 -82.295  1.00 28.32  ? 443  GLU B OE1   1 
ATOM   6773  O OE2   . GLU B  1 443 ? 89.752  120.760 -81.918  1.00 28.83  ? 443  GLU B OE2   1 
ATOM   6774  N N     . ASP B  1 444 ? 93.126  122.408 -86.461  1.00 19.78  ? 444  ASP B N     1 
ATOM   6775  C CA    . ASP B  1 444 ? 93.448  123.827 -86.547  1.00 21.33  ? 444  ASP B CA    1 
ATOM   6776  C C     . ASP B  1 444 ? 92.719  124.455 -87.752  1.00 21.81  ? 444  ASP B C     1 
ATOM   6777  O O     . ASP B  1 444 ? 92.000  125.433 -87.619  1.00 23.09  ? 444  ASP B O     1 
ATOM   6778  C CB    . ASP B  1 444 ? 94.954  124.049 -86.743  1.00 21.57  ? 444  ASP B CB    1 
ATOM   6779  C CG    . ASP B  1 444 ? 95.752  123.988 -85.459  1.00 21.28  ? 444  ASP B CG    1 
ATOM   6780  O OD1   . ASP B  1 444 ? 95.168  124.048 -84.357  1.00 19.64  ? 444  ASP B OD1   1 
ATOM   6781  O OD2   . ASP B  1 444 ? 96.994  123.897 -85.571  1.00 23.56  ? 444  ASP B OD2   1 
ATOM   6782  N N     . ILE B  1 445 ? 92.919  123.872 -88.929  1.00 21.93  ? 445  ILE B N     1 
ATOM   6783  C CA    . ILE B  1 445 ? 92.318  124.364 -90.155  1.00 23.34  ? 445  ILE B CA    1 
ATOM   6784  C C     . ILE B  1 445 ? 90.791  124.296 -90.161  1.00 24.75  ? 445  ILE B C     1 
ATOM   6785  O O     . ILE B  1 445 ? 90.125  125.198 -90.649  1.00 26.43  ? 445  ILE B O     1 
ATOM   6786  C CB    . ILE B  1 445 ? 92.883  123.583 -91.352  1.00 23.48  ? 445  ILE B CB    1 
ATOM   6787  C CG1   . ILE B  1 445 ? 94.379  123.883 -91.478  1.00 22.00  ? 445  ILE B CG1   1 
ATOM   6788  C CG2   . ILE B  1 445 ? 92.108  123.912 -92.636  1.00 23.19  ? 445  ILE B CG2   1 
ATOM   6789  C CD1   . ILE B  1 445 ? 95.092  122.929 -92.373  1.00 20.96  ? 445  ILE B CD1   1 
ATOM   6790  N N     . ALA B  1 446 ? 90.247  123.222 -89.610  1.00 25.65  ? 446  ALA B N     1 
ATOM   6791  C CA    . ALA B  1 446 ? 88.805  123.014 -89.545  1.00 25.05  ? 446  ALA B CA    1 
ATOM   6792  C C     . ALA B  1 446 ? 88.061  124.060 -88.703  1.00 24.45  ? 446  ALA B C     1 
ATOM   6793  O O     . ALA B  1 446 ? 86.896  124.361 -88.960  1.00 23.96  ? 446  ALA B O     1 
ATOM   6794  C CB    . ALA B  1 446 ? 88.531  121.624 -88.996  1.00 23.20  ? 446  ALA B CB    1 
ATOM   6795  N N     . ARG B  1 447 ? 88.729  124.602 -87.694  1.00 23.88  ? 447  ARG B N     1 
ATOM   6796  C CA    . ARG B  1 447 ? 88.074  125.587 -86.851  1.00 23.72  ? 447  ARG B CA    1 
ATOM   6797  C C     . ARG B  1 447 ? 88.291  127.013 -87.337  1.00 24.22  ? 447  ARG B C     1 
ATOM   6798  O O     . ARG B  1 447 ? 87.700  127.952 -86.789  1.00 23.94  ? 447  ARG B O     1 
ATOM   6799  C CB    . ARG B  1 447 ? 88.517  125.415 -85.404  1.00 22.38  ? 447  ARG B CB    1 
ATOM   6800  C CG    . ARG B  1 447 ? 87.994  124.132 -84.801  1.00 20.88  ? 447  ARG B CG    1 
ATOM   6801  C CD    . ARG B  1 447 ? 88.415  123.913 -83.369  1.00 22.59  ? 447  ARG B CD    1 
ATOM   6802  N NE    . ARG B  1 447 ? 87.855  122.650 -82.881  1.00 25.10  ? 447  ARG B NE    1 
ATOM   6803  C CZ    . ARG B  1 447 ? 86.584  122.472 -82.524  1.00 25.91  ? 447  ARG B CZ    1 
ATOM   6804  N NH1   . ARG B  1 447 ? 85.712  123.486 -82.576  1.00 25.51  ? 447  ARG B NH1   1 
ATOM   6805  N NH2   . ARG B  1 447 ? 86.180  121.268 -82.155  1.00 24.40  ? 447  ARG B NH2   1 
ATOM   6806  N N     . VAL B  1 448 ? 89.122  127.170 -88.376  1.00 23.60  ? 448  VAL B N     1 
ATOM   6807  C CA    . VAL B  1 448 ? 89.352  128.489 -88.961  1.00 23.48  ? 448  VAL B CA    1 
ATOM   6808  C C     . VAL B  1 448 ? 88.141  128.842 -89.842  1.00 23.90  ? 448  VAL B C     1 
ATOM   6809  O O     . VAL B  1 448 ? 87.743  128.064 -90.704  1.00 22.39  ? 448  VAL B O     1 
ATOM   6810  C CB    . VAL B  1 448 ? 90.623  128.528 -89.836  1.00 24.80  ? 448  VAL B CB    1 
ATOM   6811  C CG1   . VAL B  1 448 ? 90.611  129.790 -90.673  1.00 22.39  ? 448  VAL B CG1   1 
ATOM   6812  C CG2   . VAL B  1 448 ? 91.898  128.469 -88.952  1.00 23.66  ? 448  VAL B CG2   1 
ATOM   6813  N N     . CYS B  1 449 ? 87.560  130.012 -89.615  1.00 24.64  ? 449  CYS B N     1 
ATOM   6814  C CA    . CYS B  1 449 ? 86.394  130.446 -90.369  1.00 27.97  ? 449  CYS B CA    1 
ATOM   6815  C C     . CYS B  1 449 ? 86.688  130.801 -91.836  1.00 28.65  ? 449  CYS B C     1 
ATOM   6816  O O     . CYS B  1 449 ? 87.315  131.813 -92.133  1.00 28.92  ? 449  CYS B O     1 
ATOM   6817  C CB    . CYS B  1 449 ? 85.743  131.637 -89.661  1.00 30.73  ? 449  CYS B CB    1 
ATOM   6818  S SG    . CYS B  1 449 ? 84.059  132.065 -90.186  1.00 34.97  ? 449  CYS B SG    1 
ATOM   6819  N N     . HIS B  1 450 ? 86.239  129.945 -92.752  1.00 27.88  ? 450  HIS B N     1 
ATOM   6820  C CA    . HIS B  1 450 ? 86.429  130.182 -94.173  1.00 24.95  ? 450  HIS B CA    1 
ATOM   6821  C C     . HIS B  1 450 ? 85.171  130.841 -94.715  1.00 24.73  ? 450  HIS B C     1 
ATOM   6822  O O     . HIS B  1 450 ? 84.063  130.537 -94.287  1.00 25.38  ? 450  HIS B O     1 
ATOM   6823  C CB    . HIS B  1 450 ? 86.657  128.876 -94.910  1.00 24.40  ? 450  HIS B CB    1 
ATOM   6824  C CG    . HIS B  1 450 ? 87.969  128.226 -94.615  1.00 24.06  ? 450  HIS B CG    1 
ATOM   6825  N ND1   . HIS B  1 450 ? 88.322  127.799 -93.355  1.00 23.60  ? 450  HIS B ND1   1 
ATOM   6826  C CD2   . HIS B  1 450 ? 88.998  127.892 -95.431  1.00 23.35  ? 450  HIS B CD2   1 
ATOM   6827  C CE1   . HIS B  1 450 ? 89.513  127.230 -93.410  1.00 25.28  ? 450  HIS B CE1   1 
ATOM   6828  N NE2   . HIS B  1 450 ? 89.944  127.273 -94.658  1.00 21.50  ? 450  HIS B NE2   1 
ATOM   6829  N N     . ALA B  1 451 ? 85.354  131.755 -95.650  1.00 24.94  ? 451  ALA B N     1 
ATOM   6830  C CA    . ALA B  1 451 ? 84.248  132.468 -96.252  1.00 23.46  ? 451  ALA B CA    1 
ATOM   6831  C C     . ALA B  1 451 ? 83.315  131.518 -96.999  1.00 25.01  ? 451  ALA B C     1 
ATOM   6832  O O     . ALA B  1 451 ? 83.768  130.584 -97.654  1.00 25.81  ? 451  ALA B O     1 
ATOM   6833  C CB    . ALA B  1 451 ? 84.788  133.506 -97.194  1.00 20.58  ? 451  ALA B CB    1 
ATOM   6834  N N     . HIS B  1 452 ? 82.010  131.755 -96.877  1.00 26.08  ? 452  HIS B N     1 
ATOM   6835  C CA    . HIS B  1 452 ? 80.999  130.958 -97.566  1.00 25.91  ? 452  HIS B CA    1 
ATOM   6836  C C     . HIS B  1 452 ? 80.274  131.889 -98.529  1.00 26.36  ? 452  HIS B C     1 
ATOM   6837  O O     . HIS B  1 452 ? 79.753  132.928 -98.135  1.00 27.15  ? 452  HIS B O     1 
ATOM   6838  C CB    . HIS B  1 452 ? 79.960  130.371 -96.593  1.00 27.06  ? 452  HIS B CB    1 
ATOM   6839  C CG    . HIS B  1 452 ? 78.913  129.525 -97.266  1.00 27.62  ? 452  HIS B CG    1 
ATOM   6840  N ND1   . HIS B  1 452 ? 79.101  128.189 -97.544  1.00 25.42  ? 452  HIS B ND1   1 
ATOM   6841  C CD2   . HIS B  1 452 ? 77.705  129.848 -97.797  1.00 27.15  ? 452  HIS B CD2   1 
ATOM   6842  C CE1   . HIS B  1 452 ? 78.062  127.727 -98.218  1.00 25.54  ? 452  HIS B CE1   1 
ATOM   6843  N NE2   . HIS B  1 452 ? 77.201  128.714 -98.386  1.00 26.15  ? 452  HIS B NE2   1 
ATOM   6844  N N     . PRO B  1 453 ? 80.186  131.499 -99.798  1.00 26.91  ? 453  PRO B N     1 
ATOM   6845  C CA    . PRO B  1 453 ? 80.744  130.230 -100.304 1.00 26.83  ? 453  PRO B CA    1 
ATOM   6846  C C     . PRO B  1 453 ? 82.062  130.374 -101.050 1.00 26.39  ? 453  PRO B C     1 
ATOM   6847  O O     . PRO B  1 453 ? 82.192  131.236 -101.910 1.00 26.26  ? 453  PRO B O     1 
ATOM   6848  C CB    . PRO B  1 453 ? 79.657  129.725 -101.234 1.00 25.32  ? 453  PRO B CB    1 
ATOM   6849  C CG    . PRO B  1 453 ? 79.171  131.043 -101.875 1.00 28.08  ? 453  PRO B CG    1 
ATOM   6850  C CD    . PRO B  1 453 ? 79.175  132.054 -100.716 1.00 25.51  ? 453  PRO B CD    1 
ATOM   6851  N N     . THR B  1 454 ? 83.033  129.531 -100.714 1.00 26.16  ? 454  THR B N     1 
ATOM   6852  C CA    . THR B  1 454 ? 84.314  129.537 -101.415 1.00 26.91  ? 454  THR B CA    1 
ATOM   6853  C C     . THR B  1 454 ? 84.803  128.102 -101.576 1.00 28.12  ? 454  THR B C     1 
ATOM   6854  O O     . THR B  1 454 ? 84.344  127.189 -100.866 1.00 27.42  ? 454  THR B O     1 
ATOM   6855  C CB    . THR B  1 454 ? 85.439  130.338 -100.688 1.00 25.88  ? 454  THR B CB    1 
ATOM   6856  O OG1   . THR B  1 454 ? 85.798  129.691 -99.459  1.00 23.42  ? 454  THR B OG1   1 
ATOM   6857  C CG2   . THR B  1 454 ? 85.001  131.757 -100.432 1.00 23.23  ? 454  THR B CG2   1 
ATOM   6858  N N     . LEU B  1 455 ? 85.717  127.916 -102.526 1.00 26.33  ? 455  LEU B N     1 
ATOM   6859  C CA    . LEU B  1 455 ? 86.307  126.614 -102.778 1.00 26.27  ? 455  LEU B CA    1 
ATOM   6860  C C     . LEU B  1 455 ? 87.128  126.175 -101.566 1.00 25.46  ? 455  LEU B C     1 
ATOM   6861  O O     . LEU B  1 455 ? 87.216  124.972 -101.271 1.00 24.37  ? 455  LEU B O     1 
ATOM   6862  C CB    . LEU B  1 455 ? 87.213  126.664 -104.022 1.00 26.67  ? 455  LEU B CB    1 
ATOM   6863  C CG    . LEU B  1 455 ? 86.543  127.110 -105.332 1.00 27.18  ? 455  LEU B CG    1 
ATOM   6864  C CD1   . LEU B  1 455 ? 87.587  127.329 -106.465 1.00 25.13  ? 455  LEU B CD1   1 
ATOM   6865  C CD2   . LEU B  1 455 ? 85.474  126.072 -105.674 1.00 24.15  ? 455  LEU B CD2   1 
ATOM   6866  N N     . SER B  1 456 ? 87.735  127.153 -100.887 1.00 25.88  ? 456  SER B N     1 
ATOM   6867  C CA    . SER B  1 456 ? 88.558  126.896 -99.708  1.00 25.37  ? 456  SER B CA    1 
ATOM   6868  C C     . SER B  1 456 ? 87.771  126.046 -98.699  1.00 25.25  ? 456  SER B C     1 
ATOM   6869  O O     . SER B  1 456 ? 88.343  125.370 -97.832  1.00 28.10  ? 456  SER B O     1 
ATOM   6870  C CB    . SER B  1 456 ? 89.009  128.222 -99.054  1.00 26.35  ? 456  SER B CB    1 
ATOM   6871  O OG    . SER B  1 456 ? 88.039  128.759 -98.163  1.00 26.55  ? 456  SER B OG    1 
ATOM   6872  N N     . GLU B  1 457 ? 86.458  126.047 -98.835  1.00 23.24  ? 457  GLU B N     1 
ATOM   6873  C CA    . GLU B  1 457 ? 85.649  125.290 -97.917  1.00 24.04  ? 457  GLU B CA    1 
ATOM   6874  C C     . GLU B  1 457 ? 85.797  123.788 -98.112  1.00 23.32  ? 457  GLU B C     1 
ATOM   6875  O O     . GLU B  1 457 ? 85.520  123.018 -97.203  1.00 22.86  ? 457  GLU B O     1 
ATOM   6876  C CB    . GLU B  1 457 ? 84.186  125.706 -98.044  1.00 26.13  ? 457  GLU B CB    1 
ATOM   6877  C CG    . GLU B  1 457 ? 83.847  127.049 -97.412  1.00 26.55  ? 457  GLU B CG    1 
ATOM   6878  C CD    . GLU B  1 457 ? 82.362  127.365 -97.525  1.00 29.58  ? 457  GLU B CD    1 
ATOM   6879  O OE1   . GLU B  1 457 ? 81.891  127.573 -98.663  1.00 32.55  ? 457  GLU B OE1   1 
ATOM   6880  O OE2   . GLU B  1 457 ? 81.659  127.386 -96.486  1.00 33.00  ? 457  GLU B OE2   1 
ATOM   6881  N N     . ALA B  1 458 ? 86.233  123.368 -99.291  1.00 23.82  ? 458  ALA B N     1 
ATOM   6882  C CA    . ALA B  1 458 ? 86.427  121.944 -99.553  1.00 24.83  ? 458  ALA B CA    1 
ATOM   6883  C C     . ALA B  1 458 ? 87.641  121.490 -98.741  1.00 24.79  ? 458  ALA B C     1 
ATOM   6884  O O     . ALA B  1 458 ? 87.700  120.368 -98.237  1.00 24.95  ? 458  ALA B O     1 
ATOM   6885  C CB    . ALA B  1 458 ? 86.682  121.715 -101.030 1.00 22.00  ? 458  ALA B CB    1 
ATOM   6886  N N     . PHE B  1 459 ? 88.599  122.407 -98.641  1.00 24.95  ? 459  PHE B N     1 
ATOM   6887  C CA    . PHE B  1 459 ? 89.850  122.212 -97.942  1.00 23.48  ? 459  PHE B CA    1 
ATOM   6888  C C     . PHE B  1 459 ? 89.540  122.140 -96.465  1.00 23.80  ? 459  PHE B C     1 
ATOM   6889  O O     . PHE B  1 459 ? 90.007  121.254 -95.745  1.00 23.92  ? 459  PHE B O     1 
ATOM   6890  C CB    . PHE B  1 459 ? 90.774  123.393 -98.229  1.00 21.12  ? 459  PHE B CB    1 
ATOM   6891  C CG    . PHE B  1 459 ? 92.126  123.269 -97.604  1.00 21.49  ? 459  PHE B CG    1 
ATOM   6892  C CD1   . PHE B  1 459 ? 93.015  122.297 -98.047  1.00 21.99  ? 459  PHE B CD1   1 
ATOM   6893  C CD2   . PHE B  1 459 ? 92.507  124.105 -96.551  1.00 21.19  ? 459  PHE B CD2   1 
ATOM   6894  C CE1   . PHE B  1 459 ? 94.264  122.148 -97.454  1.00 23.35  ? 459  PHE B CE1   1 
ATOM   6895  C CE2   . PHE B  1 459 ? 93.753  123.969 -95.948  1.00 22.47  ? 459  PHE B CE2   1 
ATOM   6896  C CZ    . PHE B  1 459 ? 94.635  122.988 -96.399  1.00 21.92  ? 459  PHE B CZ    1 
ATOM   6897  N N     . ARG B  1 460 ? 88.739  123.087 -96.019  1.00 23.11  ? 460  ARG B N     1 
ATOM   6898  C CA    . ARG B  1 460 ? 88.366  123.122 -94.628  1.00 24.51  ? 460  ARG B CA    1 
ATOM   6899  C C     . ARG B  1 460 ? 87.620  121.828 -94.210  1.00 23.42  ? 460  ARG B C     1 
ATOM   6900  O O     . ARG B  1 460 ? 87.902  121.244 -93.160  1.00 20.50  ? 460  ARG B O     1 
ATOM   6901  C CB    . ARG B  1 460 ? 87.504  124.360 -94.351  1.00 26.14  ? 460  ARG B CB    1 
ATOM   6902  C CG    . ARG B  1 460 ? 87.033  124.419 -92.906  1.00 28.67  ? 460  ARG B CG    1 
ATOM   6903  C CD    . ARG B  1 460 ? 85.939  125.454 -92.671  1.00 29.84  ? 460  ARG B CD    1 
ATOM   6904  N NE    . ARG B  1 460 ? 85.750  125.643 -91.232  1.00 34.08  ? 460  ARG B NE    1 
ATOM   6905  C CZ    . ARG B  1 460 ? 85.065  126.638 -90.675  1.00 34.94  ? 460  ARG B CZ    1 
ATOM   6906  N NH1   . ARG B  1 460 ? 84.487  127.557 -91.455  1.00 35.15  ? 460  ARG B NH1   1 
ATOM   6907  N NH2   . ARG B  1 460 ? 84.965  126.710 -89.338  1.00 36.08  ? 460  ARG B NH2   1 
ATOM   6908  N N     . GLU B  1 461 ? 86.679  121.388 -95.044  1.00 23.60  ? 461  GLU B N     1 
ATOM   6909  C CA    . GLU B  1 461 ? 85.892  120.181 -94.765  1.00 23.00  ? 461  GLU B CA    1 
ATOM   6910  C C     . GLU B  1 461 ? 86.724  118.912 -94.818  1.00 23.51  ? 461  GLU B C     1 
ATOM   6911  O O     . GLU B  1 461 ? 86.482  117.971 -94.048  1.00 22.54  ? 461  GLU B O     1 
ATOM   6912  C CB    . GLU B  1 461 ? 84.721  120.069 -95.742  1.00 21.74  ? 461  GLU B CB    1 
ATOM   6913  C CG    . GLU B  1 461 ? 83.586  121.047 -95.483  1.00 21.44  ? 461  GLU B CG    1 
ATOM   6914  C CD    . GLU B  1 461 ? 82.403  120.431 -94.769  1.00 21.49  ? 461  GLU B CD    1 
ATOM   6915  O OE1   . GLU B  1 461 ? 82.550  119.930 -93.645  1.00 26.81  ? 461  GLU B OE1   1 
ATOM   6916  O OE2   . GLU B  1 461 ? 81.316  120.446 -95.337  1.00 24.58  ? 461  GLU B OE2   1 
ATOM   6917  N N     . ALA B  1 462 ? 87.700  118.875 -95.726  1.00 23.66  ? 462  ALA B N     1 
ATOM   6918  C CA    . ALA B  1 462 ? 88.566  117.701 -95.827  1.00 25.39  ? 462  ALA B CA    1 
ATOM   6919  C C     . ALA B  1 462 ? 89.403  117.553 -94.530  1.00 25.43  ? 462  ALA B C     1 
ATOM   6920  O O     . ALA B  1 462 ? 89.711  116.443 -94.073  1.00 25.64  ? 462  ALA B O     1 
ATOM   6921  C CB    . ALA B  1 462 ? 89.485  117.819 -97.059  1.00 25.40  ? 462  ALA B CB    1 
ATOM   6922  N N     . ASN B  1 463 ? 89.763  118.687 -93.949  1.00 23.76  ? 463  ASN B N     1 
ATOM   6923  C CA    . ASN B  1 463 ? 90.538  118.700 -92.728  1.00 22.75  ? 463  ASN B CA    1 
ATOM   6924  C C     . ASN B  1 463 ? 89.674  118.221 -91.570  1.00 23.59  ? 463  ASN B C     1 
ATOM   6925  O O     . ASN B  1 463 ? 90.130  117.465 -90.704  1.00 24.33  ? 463  ASN B O     1 
ATOM   6926  C CB    . ASN B  1 463 ? 91.073  120.107 -92.478  1.00 19.25  ? 463  ASN B CB    1 
ATOM   6927  C CG    . ASN B  1 463 ? 92.439  120.303 -93.074  1.00 19.61  ? 463  ASN B CG    1 
ATOM   6928  O OD1   . ASN B  1 463 ? 93.424  119.844 -92.508  1.00 20.17  ? 463  ASN B OD1   1 
ATOM   6929  N ND2   . ASN B  1 463 ? 92.513  120.956 -94.238  1.00 16.97  ? 463  ASN B ND2   1 
ATOM   6930  N N     . LEU B  1 464 ? 88.418  118.654 -91.576  1.00 23.21  ? 464  LEU B N     1 
ATOM   6931  C CA    . LEU B  1 464 ? 87.475  118.271 -90.540  1.00 23.89  ? 464  LEU B CA    1 
ATOM   6932  C C     . LEU B  1 464 ? 87.268  116.750 -90.614  1.00 24.39  ? 464  LEU B C     1 
ATOM   6933  O O     . LEU B  1 464 ? 87.228  116.065 -89.594  1.00 26.89  ? 464  LEU B O     1 
ATOM   6934  C CB    . LEU B  1 464 ? 86.150  119.036 -90.723  1.00 21.72  ? 464  LEU B CB    1 
ATOM   6935  C CG    . LEU B  1 464 ? 85.001  118.683 -89.761  1.00 22.20  ? 464  LEU B CG    1 
ATOM   6936  C CD1   . LEU B  1 464 ? 85.421  118.926 -88.298  1.00 19.40  ? 464  LEU B CD1   1 
ATOM   6937  C CD2   . LEU B  1 464 ? 83.771  119.482 -90.125  1.00 16.75  ? 464  LEU B CD2   1 
ATOM   6938  N N     . ALA B  1 465 ? 87.173  116.229 -91.832  1.00 24.02  ? 465  ALA B N     1 
ATOM   6939  C CA    . ALA B  1 465 ? 86.997  114.808 -92.025  1.00 22.27  ? 465  ALA B CA    1 
ATOM   6940  C C     . ALA B  1 465 ? 88.191  114.104 -91.412  1.00 22.37  ? 465  ALA B C     1 
ATOM   6941  O O     . ALA B  1 465 ? 88.027  113.176 -90.622  1.00 23.05  ? 465  ALA B O     1 
ATOM   6942  C CB    . ALA B  1 465 ? 86.884  114.477 -93.503  1.00 19.96  ? 465  ALA B CB    1 
ATOM   6943  N N     . ALA B  1 466 ? 89.390  114.558 -91.760  1.00 23.55  ? 466  ALA B N     1 
ATOM   6944  C CA    . ALA B  1 466 ? 90.625  113.966 -91.237  1.00 25.07  ? 466  ALA B CA    1 
ATOM   6945  C C     . ALA B  1 466 ? 90.721  114.027 -89.708  1.00 26.76  ? 466  ALA B C     1 
ATOM   6946  O O     . ALA B  1 466 ? 91.059  113.043 -89.055  1.00 27.38  ? 466  ALA B O     1 
ATOM   6947  C CB    . ALA B  1 466 ? 91.847  114.661 -91.845  1.00 21.26  ? 466  ALA B CB    1 
ATOM   6948  N N     . SER B  1 467 ? 90.409  115.185 -89.142  1.00 27.73  ? 467  SER B N     1 
ATOM   6949  C CA    . SER B  1 467 ? 90.514  115.368 -87.708  1.00 29.94  ? 467  SER B CA    1 
ATOM   6950  C C     . SER B  1 467 ? 89.462  114.618 -86.891  1.00 32.31  ? 467  SER B C     1 
ATOM   6951  O O     . SER B  1 467 ? 89.800  113.795 -86.043  1.00 32.43  ? 467  SER B O     1 
ATOM   6952  C CB    . SER B  1 467 ? 90.460  116.871 -87.391  1.00 28.74  ? 467  SER B CB    1 
ATOM   6953  O OG    . SER B  1 467 ? 90.574  117.134 -86.012  1.00 30.08  ? 467  SER B OG    1 
ATOM   6954  N N     . PHE B  1 468 ? 88.192  114.905 -87.176  1.00 34.45  ? 468  PHE B N     1 
ATOM   6955  C CA    . PHE B  1 468 ? 87.039  114.356 -86.466  1.00 35.03  ? 468  PHE B CA    1 
ATOM   6956  C C     . PHE B  1 468 ? 86.450  113.057 -87.039  1.00 35.61  ? 468  PHE B C     1 
ATOM   6957  O O     . PHE B  1 468 ? 85.782  112.309 -86.322  1.00 36.06  ? 468  PHE B O     1 
ATOM   6958  C CB    . PHE B  1 468 ? 85.993  115.477 -86.418  1.00 38.03  ? 468  PHE B CB    1 
ATOM   6959  C CG    . PHE B  1 468 ? 84.650  115.089 -85.845  1.00 40.75  ? 468  PHE B CG    1 
ATOM   6960  C CD1   . PHE B  1 468 ? 84.421  115.121 -84.464  1.00 41.13  ? 468  PHE B CD1   1 
ATOM   6961  C CD2   . PHE B  1 468 ? 83.580  114.780 -86.703  1.00 39.34  ? 468  PHE B CD2   1 
ATOM   6962  C CE1   . PHE B  1 468 ? 83.137  114.855 -83.949  1.00 41.94  ? 468  PHE B CE1   1 
ATOM   6963  C CE2   . PHE B  1 468 ? 82.299  114.514 -86.210  1.00 39.13  ? 468  PHE B CE2   1 
ATOM   6964  C CZ    . PHE B  1 468 ? 82.070  114.550 -84.838  1.00 41.49  ? 468  PHE B CZ    1 
ATOM   6965  N N     . GLY B  1 469 ? 86.706  112.780 -88.318  1.00 34.87  ? 469  GLY B N     1 
ATOM   6966  C CA    . GLY B  1 469 ? 86.165  111.577 -88.941  1.00 31.79  ? 469  GLY B CA    1 
ATOM   6967  C C     . GLY B  1 469 ? 85.026  111.823 -89.936  1.00 31.07  ? 469  GLY B C     1 
ATOM   6968  O O     . GLY B  1 469 ? 84.778  111.017 -90.811  1.00 31.35  ? 469  GLY B O     1 
ATOM   6969  N N     . LYS B  1 470 ? 84.337  112.946 -89.812  1.00 30.65  ? 470  LYS B N     1 
ATOM   6970  C CA    . LYS B  1 470 ? 83.223  113.267 -90.686  1.00 30.21  ? 470  LYS B CA    1 
ATOM   6971  C C     . LYS B  1 470 ? 83.241  114.733 -91.053  1.00 29.07  ? 470  LYS B C     1 
ATOM   6972  O O     . LYS B  1 470 ? 83.672  115.546 -90.256  1.00 27.61  ? 470  LYS B O     1 
ATOM   6973  C CB    . LYS B  1 470 ? 81.898  113.004 -89.962  1.00 31.62  ? 470  LYS B CB    1 
ATOM   6974  C CG    . LYS B  1 470 ? 81.565  111.557 -89.656  1.00 34.98  ? 470  LYS B CG    1 
ATOM   6975  C CD    . LYS B  1 470 ? 80.221  111.457 -88.911  1.00 35.33  ? 470  LYS B CD    1 
ATOM   6976  C CE    . LYS B  1 470 ? 79.669  110.029 -88.921  1.00 36.10  ? 470  LYS B CE    1 
ATOM   6977  N NZ    . LYS B  1 470 ? 78.402  109.856 -88.139  1.00 38.98  ? 470  LYS B NZ    1 
ATOM   6978  N N     . SER B  1 471 ? 82.770  115.059 -92.258  1.00 29.13  ? 471  SER B N     1 
ATOM   6979  C CA    . SER B  1 471 ? 82.615  116.461 -92.713  1.00 28.97  ? 471  SER B CA    1 
ATOM   6980  C C     . SER B  1 471 ? 81.160  116.806 -92.402  1.00 26.98  ? 471  SER B C     1 
ATOM   6981  O O     . SER B  1 471 ? 80.406  115.957 -91.954  1.00 26.78  ? 471  SER B O     1 
ATOM   6982  C CB    . SER B  1 471 ? 82.739  116.600 -94.229  1.00 29.25  ? 471  SER B CB    1 
ATOM   6983  O OG    . SER B  1 471 ? 84.005  116.180 -94.671  1.00 40.92  ? 471  SER B OG    1 
ATOM   6984  N N     . ILE B  1 472 ? 80.762  118.040 -92.657  1.00 25.98  ? 472  ILE B N     1 
ATOM   6985  C CA    . ILE B  1 472 ? 79.370  118.431 -92.471  1.00 24.62  ? 472  ILE B CA    1 
ATOM   6986  C C     . ILE B  1 472 ? 78.569  118.163 -93.766  1.00 26.52  ? 472  ILE B C     1 
ATOM   6987  O O     . ILE B  1 472 ? 77.513  117.515 -93.752  1.00 25.36  ? 472  ILE B O     1 
ATOM   6988  C CB    . ILE B  1 472 ? 79.224  119.945 -92.177  1.00 23.02  ? 472  ILE B CB    1 
ATOM   6989  C CG1   . ILE B  1 472 ? 79.852  120.298 -90.823  1.00 22.80  ? 472  ILE B CG1   1 
ATOM   6990  C CG2   . ILE B  1 472 ? 77.752  120.339 -92.229  1.00 18.11  ? 472  ILE B CG2   1 
ATOM   6991  C CD1   . ILE B  1 472 ? 79.233  119.581 -89.622  1.00 22.37  ? 472  ILE B CD1   1 
ATOM   6992  N N     . ASN B  1 473 ? 79.100  118.664 -94.885  1.00 27.71  ? 473  ASN B N     1 
ATOM   6993  C CA    . ASN B  1 473 ? 78.430  118.586 -96.172  1.00 27.52  ? 473  ASN B CA    1 
ATOM   6994  C C     . ASN B  1 473 ? 78.593  117.343 -97.037  1.00 29.38  ? 473  ASN B C     1 
ATOM   6995  O O     . ASN B  1 473 ? 78.108  117.283 -98.175  1.00 30.17  ? 473  ASN B O     1 
ATOM   6996  C CB    . ASN B  1 473 ? 78.745  119.871 -96.935  1.00 25.43  ? 473  ASN B CB    1 
ATOM   6997  C CG    . ASN B  1 473 ? 78.044  121.077 -96.314  1.00 26.96  ? 473  ASN B CG    1 
ATOM   6998  O OD1   . ASN B  1 473 ? 76.820  121.238 -96.436  1.00 26.69  ? 473  ASN B OD1   1 
ATOM   6999  N ND2   . ASN B  1 473 ? 78.804  121.908 -95.616  1.00 26.01  ? 473  ASN B ND2   1 
ATOM   7000  N N     . PHE B  1 474 ? 79.233  116.332 -96.474  1.00 30.10  ? 474  PHE B N     1 
ATOM   7001  C CA    . PHE B  1 474 ? 79.413  115.084 -97.173  1.00 31.79  ? 474  PHE B CA    1 
ATOM   7002  C C     . PHE B  1 474 ? 79.656  114.038 -96.110  1.00 32.89  ? 474  PHE B C     1 
ATOM   7003  O O     . PHE B  1 474 ? 79.202  112.892 -96.285  1.00 33.40  ? 474  PHE B O     1 
ATOM   7004  C CB    . PHE B  1 474 ? 80.592  115.166 -98.149  1.00 32.29  ? 474  PHE B CB    1 
ATOM   7005  C CG    . PHE B  1 474 ? 80.720  113.956 -99.047  1.00 33.66  ? 474  PHE B CG    1 
ATOM   7006  C CD1   . PHE B  1 474 ? 79.867  113.785 -100.146 1.00 32.08  ? 474  PHE B CD1   1 
ATOM   7007  C CD2   . PHE B  1 474 ? 81.668  112.956 -98.767  1.00 32.54  ? 474  PHE B CD2   1 
ATOM   7008  C CE1   . PHE B  1 474 ? 79.952  112.637 -100.948 1.00 31.65  ? 474  PHE B CE1   1 
ATOM   7009  C CE2   . PHE B  1 474 ? 81.755  111.807 -99.565  1.00 31.96  ? 474  PHE B CE2   1 
ATOM   7010  C CZ    . PHE B  1 474 ? 80.894  111.647 -100.659 1.00 31.69  ? 474  PHE B CZ    1 
ATOM   7011  O OXT   . PHE B  1 474 ? 80.300  114.391 -95.102  1.00 37.31  ? 474  PHE B OXT   1 
ATOM   7012  N N     . PRO C  1 4   ? 224.398 147.431 -120.169 1.00 76.48  ? 4    PRO C N     1 
ATOM   7013  C CA    . PRO C  1 4   ? 224.628 146.558 -118.978 1.00 76.78  ? 4    PRO C CA    1 
ATOM   7014  C C     . PRO C  1 4   ? 223.809 147.010 -117.760 1.00 76.92  ? 4    PRO C C     1 
ATOM   7015  O O     . PRO C  1 4   ? 224.219 147.911 -117.033 1.00 77.43  ? 4    PRO C O     1 
ATOM   7016  C CB    . PRO C  1 4   ? 226.120 146.608 -118.687 1.00 75.98  ? 4    PRO C CB    1 
ATOM   7017  C CG    . PRO C  1 4   ? 226.676 146.895 -120.091 1.00 76.74  ? 4    PRO C CG    1 
ATOM   7018  C CD    . PRO C  1 4   ? 225.686 147.893 -120.714 1.00 76.31  ? 4    PRO C CD    1 
ATOM   7019  N N     . ILE C  1 5   ? 222.661 146.361 -117.544 1.00 77.03  ? 5    ILE C N     1 
ATOM   7020  C CA    . ILE C  1 5   ? 221.726 146.676 -116.448 1.00 76.85  ? 5    ILE C CA    1 
ATOM   7021  C C     . ILE C  1 5   ? 221.974 145.927 -115.128 1.00 76.12  ? 5    ILE C C     1 
ATOM   7022  O O     . ILE C  1 5   ? 222.419 144.781 -115.131 1.00 76.29  ? 5    ILE C O     1 
ATOM   7023  C CB    . ILE C  1 5   ? 220.260 146.384 -116.881 1.00 77.55  ? 5    ILE C CB    1 
ATOM   7024  C CG1   . ILE C  1 5   ? 219.998 146.960 -118.278 1.00 77.88  ? 5    ILE C CG1   1 
ATOM   7025  C CG2   . ILE C  1 5   ? 219.281 146.943 -115.853 1.00 77.77  ? 5    ILE C CG2   1 
ATOM   7026  C CD1   . ILE C  1 5   ? 220.319 148.445 -118.437 1.00 78.13  ? 5    ILE C CD1   1 
ATOM   7027  N N     . ASP C  1 6   ? 221.655 146.577 -114.008 1.00 75.34  ? 6    ASP C N     1 
ATOM   7028  C CA    . ASP C  1 6   ? 221.842 145.998 -112.670 1.00 75.05  ? 6    ASP C CA    1 
ATOM   7029  C C     . ASP C  1 6   ? 220.509 145.707 -112.005 1.00 73.58  ? 6    ASP C C     1 
ATOM   7030  O O     . ASP C  1 6   ? 219.541 146.435 -112.227 1.00 73.59  ? 6    ASP C O     1 
ATOM   7031  C CB    . ASP C  1 6   ? 222.625 146.959 -111.776 1.00 76.96  ? 6    ASP C CB    1 
ATOM   7032  C CG    . ASP C  1 6   ? 224.047 147.149 -112.240 1.00 79.15  ? 6    ASP C CG    1 
ATOM   7033  O OD1   . ASP C  1 6   ? 224.869 146.231 -112.012 1.00 79.22  ? 6    ASP C OD1   1 
ATOM   7034  O OD2   . ASP C  1 6   ? 224.337 148.209 -112.844 1.00 80.55  ? 6    ASP C OD2   1 
ATOM   7035  N N     . ALA C  1 7   ? 220.461 144.664 -111.174 1.00 71.29  ? 7    ALA C N     1 
ATOM   7036  C CA    . ALA C  1 7   ? 219.213 144.301 -110.503 1.00 67.96  ? 7    ALA C CA    1 
ATOM   7037  C C     . ALA C  1 7   ? 219.328 143.416 -109.261 1.00 65.67  ? 7    ALA C C     1 
ATOM   7038  O O     . ALA C  1 7   ? 220.346 142.754 -109.039 1.00 63.79  ? 7    ALA C O     1 
ATOM   7039  C CB    . ALA C  1 7   ? 218.289 143.632 -111.503 1.00 68.45  ? 7    ALA C CB    1 
ATOM   7040  N N     . ASP C  1 8   ? 218.253 143.415 -108.467 1.00 63.56  ? 8    ASP C N     1 
ATOM   7041  C CA    . ASP C  1 8   ? 218.150 142.609 -107.248 1.00 62.10  ? 8    ASP C CA    1 
ATOM   7042  C C     . ASP C  1 8   ? 217.505 141.259 -107.600 1.00 60.58  ? 8    ASP C C     1 
ATOM   7043  O O     . ASP C  1 8   ? 217.981 140.188 -107.209 1.00 58.67  ? 8    ASP C O     1 
ATOM   7044  C CB    . ASP C  1 8   ? 217.273 143.312 -106.203 1.00 62.55  ? 8    ASP C CB    1 
ATOM   7045  C CG    . ASP C  1 8   ? 217.876 144.613 -105.692 1.00 63.87  ? 8    ASP C CG    1 
ATOM   7046  O OD1   . ASP C  1 8   ? 218.991 144.592 -105.122 1.00 65.19  ? 8    ASP C OD1   1 
ATOM   7047  O OD2   . ASP C  1 8   ? 217.221 145.662 -105.852 1.00 63.89  ? 8    ASP C OD2   1 
ATOM   7048  N N     . VAL C  1 9   ? 216.405 141.331 -108.342 1.00 59.63  ? 9    VAL C N     1 
ATOM   7049  C CA    . VAL C  1 9   ? 215.682 140.141 -108.761 1.00 57.86  ? 9    VAL C CA    1 
ATOM   7050  C C     . VAL C  1 9   ? 215.443 140.154 -110.272 1.00 55.77  ? 9    VAL C C     1 
ATOM   7051  O O     . VAL C  1 9   ? 214.909 141.116 -110.824 1.00 53.12  ? 9    VAL C O     1 
ATOM   7052  C CB    . VAL C  1 9   ? 214.318 140.028 -108.019 1.00 58.32  ? 9    VAL C CB    1 
ATOM   7053  C CG1   . VAL C  1 9   ? 213.523 138.843 -108.551 1.00 58.55  ? 9    VAL C CG1   1 
ATOM   7054  C CG2   . VAL C  1 9   ? 214.552 139.864 -106.529 1.00 57.59  ? 9    VAL C CG2   1 
ATOM   7055  N N     . THR C  1 10  ? 215.863 139.081 -110.933 1.00 54.72  ? 10   THR C N     1 
ATOM   7056  C CA    . THR C  1 10  ? 215.673 138.958 -112.370 1.00 54.78  ? 10   THR C CA    1 
ATOM   7057  C C     . THR C  1 10  ? 214.876 137.692 -112.675 1.00 54.08  ? 10   THR C C     1 
ATOM   7058  O O     . THR C  1 10  ? 215.358 136.578 -112.476 1.00 53.06  ? 10   THR C O     1 
ATOM   7059  C CB    . THR C  1 10  ? 217.024 138.927 -113.119 1.00 54.42  ? 10   THR C CB    1 
ATOM   7060  O OG1   . THR C  1 10  ? 217.651 140.207 -113.004 1.00 55.19  ? 10   THR C OG1   1 
ATOM   7061  C CG2   . THR C  1 10  ? 216.816 138.625 -114.600 1.00 54.75  ? 10   THR C CG2   1 
ATOM   7062  N N     . VAL C  1 11  ? 213.644 137.887 -113.149 1.00 53.93  ? 11   VAL C N     1 
ATOM   7063  C CA    . VAL C  1 11  ? 212.734 136.791 -113.477 1.00 52.10  ? 11   VAL C CA    1 
ATOM   7064  C C     . VAL C  1 11  ? 212.714 136.443 -114.970 1.00 51.07  ? 11   VAL C C     1 
ATOM   7065  O O     . VAL C  1 11  ? 212.370 137.276 -115.815 1.00 50.05  ? 11   VAL C O     1 
ATOM   7066  C CB    . VAL C  1 11  ? 211.289 137.124 -113.051 1.00 52.10  ? 11   VAL C CB    1 
ATOM   7067  C CG1   . VAL C  1 11  ? 210.403 135.902 -113.253 1.00 52.24  ? 11   VAL C CG1   1 
ATOM   7068  C CG2   . VAL C  1 11  ? 211.249 137.571 -111.594 1.00 52.11  ? 11   VAL C CG2   1 
ATOM   7069  N N     . ILE C  1 12  ? 213.084 135.206 -115.287 1.00 49.48  ? 12   ILE C N     1 
ATOM   7070  C CA    . ILE C  1 12  ? 213.082 134.751 -116.671 1.00 48.07  ? 12   ILE C CA    1 
ATOM   7071  C C     . ILE C  1 12  ? 211.738 134.070 -116.969 1.00 46.45  ? 12   ILE C C     1 
ATOM   7072  O O     . ILE C  1 12  ? 211.506 132.937 -116.559 1.00 46.29  ? 12   ILE C O     1 
ATOM   7073  C CB    . ILE C  1 12  ? 214.254 133.766 -116.929 1.00 47.93  ? 12   ILE C CB    1 
ATOM   7074  C CG1   . ILE C  1 12  ? 215.573 134.378 -116.425 1.00 46.69  ? 12   ILE C CG1   1 
ATOM   7075  C CG2   . ILE C  1 12  ? 214.367 133.473 -118.428 1.00 47.44  ? 12   ILE C CG2   1 
ATOM   7076  C CD1   . ILE C  1 12  ? 216.775 133.427 -116.445 1.00 45.16  ? 12   ILE C CD1   1 
ATOM   7077  N N     . GLY C  1 13  ? 210.851 134.789 -117.654 1.00 44.95  ? 13   GLY C N     1 
ATOM   7078  C CA    . GLY C  1 13  ? 209.539 134.262 -117.997 1.00 43.43  ? 13   GLY C CA    1 
ATOM   7079  C C     . GLY C  1 13  ? 208.397 135.131 -117.492 1.00 42.38  ? 13   GLY C C     1 
ATOM   7080  O O     . GLY C  1 13  ? 208.355 135.476 -116.317 1.00 41.99  ? 13   GLY C O     1 
ATOM   7081  N N     . SER C  1 14  ? 207.465 135.488 -118.369 1.00 42.07  ? 14   SER C N     1 
ATOM   7082  C CA    . SER C  1 14  ? 206.339 136.331 -117.964 1.00 43.00  ? 14   SER C CA    1 
ATOM   7083  C C     . SER C  1 14  ? 205.013 135.575 -117.888 1.00 42.70  ? 14   SER C C     1 
ATOM   7084  O O     . SER C  1 14  ? 203.943 136.140 -118.138 1.00 42.23  ? 14   SER C O     1 
ATOM   7085  C CB    . SER C  1 14  ? 206.189 137.522 -118.913 1.00 42.59  ? 14   SER C CB    1 
ATOM   7086  O OG    . SER C  1 14  ? 205.851 137.102 -120.223 1.00 45.44  ? 14   SER C OG    1 
ATOM   7087  N N     . GLY C  1 15  ? 205.101 134.293 -117.551 1.00 41.99  ? 15   GLY C N     1 
ATOM   7088  C CA    . GLY C  1 15  ? 203.913 133.478 -117.421 1.00 40.87  ? 15   GLY C CA    1 
ATOM   7089  C C     . GLY C  1 15  ? 203.255 133.764 -116.089 1.00 39.94  ? 15   GLY C C     1 
ATOM   7090  O O     . GLY C  1 15  ? 203.715 134.638 -115.352 1.00 39.90  ? 15   GLY C O     1 
ATOM   7091  N N     . PRO C  1 16  ? 202.184 133.037 -115.746 1.00 38.98  ? 16   PRO C N     1 
ATOM   7092  C CA    . PRO C  1 16  ? 201.464 133.229 -114.488 1.00 38.65  ? 16   PRO C CA    1 
ATOM   7093  C C     . PRO C  1 16  ? 202.386 133.335 -113.272 1.00 37.88  ? 16   PRO C C     1 
ATOM   7094  O O     . PRO C  1 16  ? 202.158 134.155 -112.392 1.00 36.68  ? 16   PRO C O     1 
ATOM   7095  C CB    . PRO C  1 16  ? 200.561 132.006 -114.434 1.00 39.74  ? 16   PRO C CB    1 
ATOM   7096  C CG    . PRO C  1 16  ? 200.272 131.759 -115.874 1.00 38.08  ? 16   PRO C CG    1 
ATOM   7097  C CD    . PRO C  1 16  ? 201.627 131.893 -116.484 1.00 38.63  ? 16   PRO C CD    1 
ATOM   7098  N N     . GLY C  1 17  ? 203.427 132.510 -113.227 1.00 36.88  ? 17   GLY C N     1 
ATOM   7099  C CA    . GLY C  1 17  ? 204.342 132.563 -112.101 1.00 36.93  ? 17   GLY C CA    1 
ATOM   7100  C C     . GLY C  1 17  ? 205.355 133.697 -112.170 1.00 37.17  ? 17   GLY C C     1 
ATOM   7101  O O     . GLY C  1 17  ? 205.562 134.434 -111.201 1.00 34.43  ? 17   GLY C O     1 
ATOM   7102  N N     . GLY C  1 18  ? 205.986 133.841 -113.330 1.00 36.70  ? 18   GLY C N     1 
ATOM   7103  C CA    . GLY C  1 18  ? 206.978 134.877 -113.499 1.00 36.22  ? 18   GLY C CA    1 
ATOM   7104  C C     . GLY C  1 18  ? 206.485 136.304 -113.350 1.00 35.70  ? 18   GLY C C     1 
ATOM   7105  O O     . GLY C  1 18  ? 207.049 137.078 -112.581 1.00 35.27  ? 18   GLY C O     1 
ATOM   7106  N N     . TYR C  1 19  ? 205.437 136.656 -114.080 1.00 35.52  ? 19   TYR C N     1 
ATOM   7107  C CA    . TYR C  1 19  ? 204.908 138.010 -114.031 1.00 36.21  ? 19   TYR C CA    1 
ATOM   7108  C C     . TYR C  1 19  ? 204.282 138.380 -112.693 1.00 36.31  ? 19   TYR C C     1 
ATOM   7109  O O     . TYR C  1 19  ? 204.255 139.539 -112.326 1.00 36.11  ? 19   TYR C O     1 
ATOM   7110  C CB    . TYR C  1 19  ? 203.928 138.216 -115.191 1.00 36.38  ? 19   TYR C CB    1 
ATOM   7111  C CG    . TYR C  1 19  ? 202.471 138.215 -114.822 1.00 37.11  ? 19   TYR C CG    1 
ATOM   7112  C CD1   . TYR C  1 19  ? 201.861 139.361 -114.310 1.00 39.06  ? 19   TYR C CD1   1 
ATOM   7113  C CD2   . TYR C  1 19  ? 201.685 137.093 -115.031 1.00 36.47  ? 19   TYR C CD2   1 
ATOM   7114  C CE1   . TYR C  1 19  ? 200.494 139.386 -114.019 1.00 38.89  ? 19   TYR C CE1   1 
ATOM   7115  C CE2   . TYR C  1 19  ? 200.324 137.105 -114.750 1.00 37.68  ? 19   TYR C CE2   1 
ATOM   7116  C CZ    . TYR C  1 19  ? 199.725 138.251 -114.247 1.00 38.59  ? 19   TYR C CZ    1 
ATOM   7117  O OH    . TYR C  1 19  ? 198.360 138.274 -114.002 1.00 38.48  ? 19   TYR C OH    1 
ATOM   7118  N N     . VAL C  1 20  ? 203.769 137.400 -111.961 1.00 38.29  ? 20   VAL C N     1 
ATOM   7119  C CA    . VAL C  1 20  ? 203.194 137.678 -110.638 1.00 38.48  ? 20   VAL C CA    1 
ATOM   7120  C C     . VAL C  1 20  ? 204.355 137.806 -109.662 1.00 38.85  ? 20   VAL C C     1 
ATOM   7121  O O     . VAL C  1 20  ? 204.290 138.588 -108.716 1.00 38.71  ? 20   VAL C O     1 
ATOM   7122  C CB    . VAL C  1 20  ? 202.234 136.538 -110.158 1.00 38.98  ? 20   VAL C CB    1 
ATOM   7123  C CG1   . VAL C  1 20  ? 201.907 136.676 -108.660 1.00 37.37  ? 20   VAL C CG1   1 
ATOM   7124  C CG2   . VAL C  1 20  ? 200.948 136.594 -110.967 1.00 38.16  ? 20   VAL C CG2   1 
ATOM   7125  N N     . ALA C  1 21  ? 205.414 137.032 -109.914 1.00 39.72  ? 21   ALA C N     1 
ATOM   7126  C CA    . ALA C  1 21  ? 206.624 137.045 -109.091 1.00 39.84  ? 21   ALA C CA    1 
ATOM   7127  C C     . ALA C  1 21  ? 207.272 138.401 -109.244 1.00 41.02  ? 21   ALA C C     1 
ATOM   7128  O O     . ALA C  1 21  ? 207.572 139.080 -108.266 1.00 40.36  ? 21   ALA C O     1 
ATOM   7129  C CB    . ALA C  1 21  ? 207.591 135.971 -109.550 1.00 37.13  ? 21   ALA C CB    1 
ATOM   7130  N N     . ALA C  1 22  ? 207.484 138.785 -110.495 1.00 42.87  ? 22   ALA C N     1 
ATOM   7131  C CA    . ALA C  1 22  ? 208.098 140.058 -110.810 1.00 43.21  ? 22   ALA C CA    1 
ATOM   7132  C C     . ALA C  1 22  ? 207.364 141.197 -110.098 1.00 43.23  ? 22   ALA C C     1 
ATOM   7133  O O     . ALA C  1 22  ? 207.964 141.933 -109.306 1.00 43.50  ? 22   ALA C O     1 
ATOM   7134  C CB    . ALA C  1 22  ? 208.100 140.267 -112.330 1.00 42.65  ? 22   ALA C CB    1 
ATOM   7135  N N     . ILE C  1 23  ? 206.067 141.323 -110.369 1.00 43.30  ? 23   ILE C N     1 
ATOM   7136  C CA    . ILE C  1 23  ? 205.233 142.362 -109.759 1.00 43.06  ? 23   ILE C CA    1 
ATOM   7137  C C     . ILE C  1 23  ? 205.368 142.382 -108.244 1.00 43.51  ? 23   ILE C C     1 
ATOM   7138  O O     . ILE C  1 23  ? 205.675 143.422 -107.664 1.00 43.95  ? 23   ILE C O     1 
ATOM   7139  C CB    . ILE C  1 23  ? 203.737 142.171 -110.109 1.00 41.94  ? 23   ILE C CB    1 
ATOM   7140  C CG1   . ILE C  1 23  ? 203.515 142.443 -111.596 1.00 41.26  ? 23   ILE C CG1   1 
ATOM   7141  C CG2   . ILE C  1 23  ? 202.878 143.084 -109.254 1.00 40.93  ? 23   ILE C CG2   1 
ATOM   7142  C CD1   . ILE C  1 23  ? 202.114 142.171 -112.072 1.00 38.91  ? 23   ILE C CD1   1 
ATOM   7143  N N     . LYS C  1 24  ? 205.132 141.234 -107.611 1.00 44.63  ? 24   LYS C N     1 
ATOM   7144  C CA    . LYS C  1 24  ? 205.223 141.109 -106.148 1.00 46.27  ? 24   LYS C CA    1 
ATOM   7145  C C     . LYS C  1 24  ? 206.646 141.403 -105.636 1.00 46.67  ? 24   LYS C C     1 
ATOM   7146  O O     . LYS C  1 24  ? 206.828 141.824 -104.487 1.00 47.02  ? 24   LYS C O     1 
ATOM   7147  C CB    . LYS C  1 24  ? 204.743 139.703 -105.707 1.00 44.77  ? 24   LYS C CB    1 
ATOM   7148  C CG    . LYS C  1 24  ? 205.062 139.280 -104.264 1.00 44.60  ? 24   LYS C CG    1 
ATOM   7149  C CD    . LYS C  1 24  ? 204.534 140.208 -103.174 1.00 43.80  ? 24   LYS C CD    1 
ATOM   7150  C CE    . LYS C  1 24  ? 203.043 140.081 -102.957 1.00 44.79  ? 24   LYS C CE    1 
ATOM   7151  N NZ    . LYS C  1 24  ? 202.596 140.815 -101.728 1.00 41.54  ? 24   LYS C NZ    1 
ATOM   7152  N N     . ALA C  1 25  ? 207.641 141.192 -106.497 1.00 46.51  ? 25   ALA C N     1 
ATOM   7153  C CA    . ALA C  1 25  ? 209.033 141.454 -106.149 1.00 46.87  ? 25   ALA C CA    1 
ATOM   7154  C C     . ALA C  1 25  ? 209.260 142.966 -106.064 1.00 47.01  ? 25   ALA C C     1 
ATOM   7155  O O     . ALA C  1 25  ? 209.841 143.466 -105.099 1.00 46.23  ? 25   ALA C O     1 
ATOM   7156  C CB    . ALA C  1 25  ? 209.961 140.846 -107.196 1.00 47.30  ? 25   ALA C CB    1 
ATOM   7157  N N     . ALA C  1 26  ? 208.789 143.693 -107.072 1.00 46.87  ? 26   ALA C N     1 
ATOM   7158  C CA    . ALA C  1 26  ? 208.955 145.141 -107.088 1.00 47.28  ? 26   ALA C CA    1 
ATOM   7159  C C     . ALA C  1 26  ? 208.185 145.800 -105.942 1.00 47.66  ? 26   ALA C C     1 
ATOM   7160  O O     . ALA C  1 26  ? 208.651 146.785 -105.360 1.00 48.00  ? 26   ALA C O     1 
ATOM   7161  C CB    . ALA C  1 26  ? 208.505 145.712 -108.436 1.00 45.98  ? 26   ALA C CB    1 
ATOM   7162  N N     . GLN C  1 27  ? 207.018 145.247 -105.611 1.00 48.89  ? 27   GLN C N     1 
ATOM   7163  C CA    . GLN C  1 27  ? 206.184 145.784 -104.535 1.00 50.13  ? 27   GLN C CA    1 
ATOM   7164  C C     . GLN C  1 27  ? 206.794 145.561 -103.155 1.00 50.27  ? 27   GLN C C     1 
ATOM   7165  O O     . GLN C  1 27  ? 206.369 146.175 -102.181 1.00 50.71  ? 27   GLN C O     1 
ATOM   7166  C CB    . GLN C  1 27  ? 204.798 145.139 -104.529 1.00 50.48  ? 27   GLN C CB    1 
ATOM   7167  C CG    . GLN C  1 27  ? 203.958 145.300 -105.770 1.00 51.00  ? 27   GLN C CG    1 
ATOM   7168  C CD    . GLN C  1 27  ? 202.588 144.672 -105.568 1.00 51.28  ? 27   GLN C CD    1 
ATOM   7169  O OE1   . GLN C  1 27  ? 202.459 143.668 -104.864 1.00 50.54  ? 27   GLN C OE1   1 
ATOM   7170  N NE2   . GLN C  1 27  ? 201.566 145.255 -106.179 1.00 50.23  ? 27   GLN C NE2   1 
ATOM   7171  N N     . LEU C  1 28  ? 207.767 144.664 -103.073 1.00 50.99  ? 28   LEU C N     1 
ATOM   7172  C CA    . LEU C  1 28  ? 208.420 144.362 -101.808 1.00 51.67  ? 28   LEU C CA    1 
ATOM   7173  C C     . LEU C  1 28  ? 209.667 145.220 -101.582 1.00 51.55  ? 28   LEU C C     1 
ATOM   7174  O O     . LEU C  1 28  ? 210.177 145.294 -100.461 1.00 51.18  ? 28   LEU C O     1 
ATOM   7175  C CB    . LEU C  1 28  ? 208.790 142.874 -101.754 1.00 51.81  ? 28   LEU C CB    1 
ATOM   7176  C CG    . LEU C  1 28  ? 207.635 141.887 -101.610 1.00 52.45  ? 28   LEU C CG    1 
ATOM   7177  C CD1   . LEU C  1 28  ? 208.166 140.467 -101.556 1.00 51.70  ? 28   LEU C CD1   1 
ATOM   7178  C CD2   . LEU C  1 28  ? 206.864 142.218 -100.341 1.00 51.99  ? 28   LEU C CD2   1 
ATOM   7179  N N     . GLY C  1 29  ? 210.140 145.865 -102.650 1.00 51.25  ? 29   GLY C N     1 
ATOM   7180  C CA    . GLY C  1 29  ? 211.323 146.713 -102.572 1.00 51.71  ? 29   GLY C CA    1 
ATOM   7181  C C     . GLY C  1 29  ? 212.536 146.119 -103.270 1.00 51.63  ? 29   GLY C C     1 
ATOM   7182  O O     . GLY C  1 29  ? 213.622 146.017 -102.695 1.00 52.13  ? 29   GLY C O     1 
ATOM   7183  N N     . PHE C  1 30  ? 212.344 145.720 -104.519 1.00 51.61  ? 30   PHE C N     1 
ATOM   7184  C CA    . PHE C  1 30  ? 213.406 145.120 -105.311 1.00 51.38  ? 30   PHE C CA    1 
ATOM   7185  C C     . PHE C  1 30  ? 213.443 145.753 -106.691 1.00 51.99  ? 30   PHE C C     1 
ATOM   7186  O O     . PHE C  1 30  ? 212.393 146.100 -107.260 1.00 51.45  ? 30   PHE C O     1 
ATOM   7187  C CB    . PHE C  1 30  ? 213.160 143.620 -105.505 1.00 50.41  ? 30   PHE C CB    1 
ATOM   7188  C CG    . PHE C  1 30  ? 213.467 142.769 -104.303 1.00 49.91  ? 30   PHE C CG    1 
ATOM   7189  C CD1   . PHE C  1 30  ? 214.756 142.685 -103.801 1.00 49.59  ? 30   PHE C CD1   1 
ATOM   7190  C CD2   . PHE C  1 30  ? 212.472 141.986 -103.720 1.00 49.48  ? 30   PHE C CD2   1 
ATOM   7191  C CE1   . PHE C  1 30  ? 215.054 141.831 -102.742 1.00 49.22  ? 30   PHE C CE1   1 
ATOM   7192  C CE2   . PHE C  1 30  ? 212.757 141.132 -102.661 1.00 48.75  ? 30   PHE C CE2   1 
ATOM   7193  C CZ    . PHE C  1 30  ? 214.055 141.051 -102.170 1.00 49.40  ? 30   PHE C CZ    1 
ATOM   7194  N N     . LYS C  1 31  ? 214.652 145.913 -107.221 1.00 52.01  ? 31   LYS C N     1 
ATOM   7195  C CA    . LYS C  1 31  ? 214.811 146.431 -108.571 1.00 52.49  ? 31   LYS C CA    1 
ATOM   7196  C C     . LYS C  1 31  ? 214.555 145.146 -109.345 1.00 50.41  ? 31   LYS C C     1 
ATOM   7197  O O     . LYS C  1 31  ? 215.359 144.214 -109.282 1.00 48.26  ? 31   LYS C O     1 
ATOM   7198  C CB    . LYS C  1 31  ? 216.239 146.948 -108.803 1.00 54.34  ? 31   LYS C CB    1 
ATOM   7199  C CG    . LYS C  1 31  ? 216.454 147.520 -110.199 1.00 57.94  ? 31   LYS C CG    1 
ATOM   7200  C CD    . LYS C  1 31  ? 217.448 148.699 -110.237 1.00 61.88  ? 31   LYS C CD    1 
ATOM   7201  C CE    . LYS C  1 31  ? 218.900 148.292 -109.948 1.00 64.49  ? 31   LYS C CE    1 
ATOM   7202  N NZ    . LYS C  1 31  ? 219.899 149.347 -110.348 1.00 65.93  ? 31   LYS C NZ    1 
ATOM   7203  N N     . THR C  1 32  ? 213.423 145.093 -110.045 1.00 49.66  ? 32   THR C N     1 
ATOM   7204  C CA    . THR C  1 32  ? 213.024 143.885 -110.766 1.00 48.55  ? 32   THR C CA    1 
ATOM   7205  C C     . THR C  1 32  ? 212.990 143.937 -112.290 1.00 49.08  ? 32   THR C C     1 
ATOM   7206  O O     . THR C  1 32  ? 212.367 144.812 -112.914 1.00 48.12  ? 32   THR C O     1 
ATOM   7207  C CB    . THR C  1 32  ? 211.645 143.386 -110.261 1.00 47.53  ? 32   THR C CB    1 
ATOM   7208  O OG1   . THR C  1 32  ? 211.671 143.289 -108.832 1.00 45.40  ? 32   THR C OG1   1 
ATOM   7209  C CG2   . THR C  1 32  ? 211.324 142.017 -110.837 1.00 47.72  ? 32   THR C CG2   1 
ATOM   7210  N N     . VAL C  1 33  ? 213.665 142.952 -112.869 1.00 49.50  ? 33   VAL C N     1 
ATOM   7211  C CA    . VAL C  1 33  ? 213.775 142.796 -114.307 1.00 50.30  ? 33   VAL C CA    1 
ATOM   7212  C C     . VAL C  1 33  ? 213.120 141.483 -114.724 1.00 50.22  ? 33   VAL C C     1 
ATOM   7213  O O     . VAL C  1 33  ? 213.353 140.438 -114.117 1.00 50.14  ? 33   VAL C O     1 
ATOM   7214  C CB    . VAL C  1 33  ? 215.267 142.794 -114.730 1.00 51.08  ? 33   VAL C CB    1 
ATOM   7215  C CG1   . VAL C  1 33  ? 215.414 142.420 -116.194 1.00 50.44  ? 33   VAL C CG1   1 
ATOM   7216  C CG2   . VAL C  1 33  ? 215.862 144.170 -114.477 1.00 50.52  ? 33   VAL C CG2   1 
ATOM   7217  N N     . CYS C  1 34  ? 212.286 141.544 -115.754 1.00 50.49  ? 34   CYS C N     1 
ATOM   7218  C CA    . CYS C  1 34  ? 211.606 140.358 -116.253 1.00 49.42  ? 34   CYS C CA    1 
ATOM   7219  C C     . CYS C  1 34  ? 211.945 140.156 -117.725 1.00 48.94  ? 34   CYS C C     1 
ATOM   7220  O O     . CYS C  1 34  ? 211.784 141.062 -118.539 1.00 47.82  ? 34   CYS C O     1 
ATOM   7221  C CB    . CYS C  1 34  ? 210.090 140.511 -116.070 1.00 51.10  ? 34   CYS C CB    1 
ATOM   7222  S SG    . CYS C  1 34  ? 209.099 139.049 -116.501 1.00 51.94  ? 34   CYS C SG    1 
ATOM   7223  N N     . ILE C  1 35  ? 212.401 138.953 -118.052 1.00 49.50  ? 35   ILE C N     1 
ATOM   7224  C CA    . ILE C  1 35  ? 212.789 138.589 -119.412 1.00 51.20  ? 35   ILE C CA    1 
ATOM   7225  C C     . ILE C  1 35  ? 211.758 137.692 -120.122 1.00 52.09  ? 35   ILE C C     1 
ATOM   7226  O O     . ILE C  1 35  ? 211.354 136.663 -119.588 1.00 52.56  ? 35   ILE C O     1 
ATOM   7227  C CB    . ILE C  1 35  ? 214.155 137.857 -119.389 1.00 51.23  ? 35   ILE C CB    1 
ATOM   7228  C CG1   . ILE C  1 35  ? 215.175 138.707 -118.630 1.00 50.28  ? 35   ILE C CG1   1 
ATOM   7229  C CG2   . ILE C  1 35  ? 214.631 137.587 -120.809 1.00 50.83  ? 35   ILE C CG2   1 
ATOM   7230  C CD1   . ILE C  1 35  ? 216.462 138.003 -118.307 1.00 50.68  ? 35   ILE C CD1   1 
ATOM   7231  N N     . GLU C  1 36  ? 211.341 138.077 -121.329 1.00 52.39  ? 36   GLU C N     1 
ATOM   7232  C CA    . GLU C  1 36  ? 210.363 137.296 -122.090 1.00 52.12  ? 36   GLU C CA    1 
ATOM   7233  C C     . GLU C  1 36  ? 210.809 137.131 -123.541 1.00 52.95  ? 36   GLU C C     1 
ATOM   7234  O O     . GLU C  1 36  ? 211.032 138.126 -124.232 1.00 53.94  ? 36   GLU C O     1 
ATOM   7235  C CB    . GLU C  1 36  ? 208.983 137.977 -122.040 1.00 51.71  ? 36   GLU C CB    1 
ATOM   7236  C CG    . GLU C  1 36  ? 207.871 137.213 -122.756 1.00 51.08  ? 36   GLU C CG    1 
ATOM   7237  C CD    . GLU C  1 36  ? 207.783 135.751 -122.314 1.00 52.44  ? 36   GLU C CD    1 
ATOM   7238  O OE1   . GLU C  1 36  ? 207.541 135.489 -121.115 1.00 52.32  ? 36   GLU C OE1   1 
ATOM   7239  O OE2   . GLU C  1 36  ? 207.959 134.859 -123.167 1.00 50.90  ? 36   GLU C OE2   1 
ATOM   7240  N N     . LYS C  1 37  ? 210.927 135.877 -123.990 1.00 53.18  ? 37   LYS C N     1 
ATOM   7241  C CA    . LYS C  1 37  ? 211.349 135.532 -125.356 1.00 52.80  ? 37   LYS C CA    1 
ATOM   7242  C C     . LYS C  1 37  ? 210.258 135.665 -126.434 1.00 53.61  ? 37   LYS C C     1 
ATOM   7243  O O     . LYS C  1 37  ? 210.572 135.729 -127.624 1.00 54.10  ? 37   LYS C O     1 
ATOM   7244  C CB    . LYS C  1 37  ? 211.896 134.099 -125.389 1.00 50.99  ? 37   LYS C CB    1 
ATOM   7245  C CG    . LYS C  1 37  ? 210.848 133.037 -125.112 1.00 50.55  ? 37   LYS C CG    1 
ATOM   7246  C CD    . LYS C  1 37  ? 211.402 131.636 -125.310 1.00 51.12  ? 37   LYS C CD    1 
ATOM   7247  C CE    . LYS C  1 37  ? 210.383 130.568 -124.946 1.00 50.65  ? 37   LYS C CE    1 
ATOM   7248  N NZ    . LYS C  1 37  ? 209.171 130.639 -125.801 1.00 51.19  ? 37   LYS C NZ    1 
ATOM   7249  N N     . ASN C  1 38  ? 208.985 135.692 -126.037 1.00 54.42  ? 38   ASN C N     1 
ATOM   7250  C CA    . ASN C  1 38  ? 207.896 135.820 -127.011 1.00 54.96  ? 38   ASN C CA    1 
ATOM   7251  C C     . ASN C  1 38  ? 207.527 137.267 -127.221 1.00 54.31  ? 38   ASN C C     1 
ATOM   7252  O O     . ASN C  1 38  ? 208.009 138.137 -126.509 1.00 54.00  ? 38   ASN C O     1 
ATOM   7253  C CB    . ASN C  1 38  ? 206.659 135.041 -126.571 1.00 56.42  ? 38   ASN C CB    1 
ATOM   7254  C CG    . ASN C  1 38  ? 206.950 133.576 -126.382 1.00 58.19  ? 38   ASN C CG    1 
ATOM   7255  O OD1   . ASN C  1 38  ? 207.869 133.039 -127.005 1.00 57.80  ? 38   ASN C OD1   1 
ATOM   7256  N ND2   . ASN C  1 38  ? 206.169 132.913 -125.524 1.00 58.04  ? 38   ASN C ND2   1 
ATOM   7257  N N     . GLU C  1 39  ? 206.664 137.530 -128.192 1.00 54.34  ? 39   GLU C N     1 
ATOM   7258  C CA    . GLU C  1 39  ? 206.304 138.902 -128.476 1.00 55.10  ? 39   GLU C CA    1 
ATOM   7259  C C     . GLU C  1 39  ? 205.222 139.512 -127.609 1.00 54.03  ? 39   GLU C C     1 
ATOM   7260  O O     . GLU C  1 39  ? 204.754 140.620 -127.884 1.00 55.02  ? 39   GLU C O     1 
ATOM   7261  C CB    . GLU C  1 39  ? 205.954 139.051 -129.948 1.00 57.52  ? 39   GLU C CB    1 
ATOM   7262  C CG    . GLU C  1 39  ? 204.977 138.032 -130.472 1.00 62.27  ? 39   GLU C CG    1 
ATOM   7263  C CD    . GLU C  1 39  ? 204.896 138.074 -131.993 1.00 64.74  ? 39   GLU C CD    1 
ATOM   7264  O OE1   . GLU C  1 39  ? 205.823 137.552 -132.657 1.00 65.88  ? 39   GLU C OE1   1 
ATOM   7265  O OE2   . GLU C  1 39  ? 203.916 138.645 -132.526 1.00 66.12  ? 39   GLU C OE2   1 
ATOM   7266  N N     . THR C  1 40  ? 204.820 138.795 -126.566 1.00 52.14  ? 40   THR C N     1 
ATOM   7267  C CA    . THR C  1 40  ? 203.819 139.304 -125.626 1.00 49.29  ? 40   THR C CA    1 
ATOM   7268  C C     . THR C  1 40  ? 204.148 138.771 -124.249 1.00 47.16  ? 40   THR C C     1 
ATOM   7269  O O     . THR C  1 40  ? 204.972 137.880 -124.106 1.00 46.22  ? 40   THR C O     1 
ATOM   7270  C CB    . THR C  1 40  ? 202.373 138.878 -125.985 1.00 48.80  ? 40   THR C CB    1 
ATOM   7271  O OG1   . THR C  1 40  ? 202.346 137.478 -126.277 1.00 47.72  ? 40   THR C OG1   1 
ATOM   7272  C CG2   . THR C  1 40  ? 201.842 139.685 -127.167 1.00 46.27  ? 40   THR C CG2   1 
ATOM   7273  N N     . LEU C  1 41  ? 203.519 139.332 -123.234 1.00 45.76  ? 41   LEU C N     1 
ATOM   7274  C CA    . LEU C  1 41  ? 203.757 138.875 -121.878 1.00 46.00  ? 41   LEU C CA    1 
ATOM   7275  C C     . LEU C  1 41  ? 202.586 137.984 -121.503 1.00 46.29  ? 41   LEU C C     1 
ATOM   7276  O O     . LEU C  1 41  ? 201.564 138.003 -122.195 1.00 47.11  ? 41   LEU C O     1 
ATOM   7277  C CB    . LEU C  1 41  ? 203.811 140.065 -120.933 1.00 45.75  ? 41   LEU C CB    1 
ATOM   7278  C CG    . LEU C  1 41  ? 204.919 141.069 -121.204 1.00 45.12  ? 41   LEU C CG    1 
ATOM   7279  C CD1   . LEU C  1 41  ? 204.708 142.332 -120.367 1.00 44.89  ? 41   LEU C CD1   1 
ATOM   7280  C CD2   . LEU C  1 41  ? 206.250 140.395 -120.913 1.00 44.14  ? 41   LEU C CD2   1 
ATOM   7281  N N     . GLY C  1 42  ? 202.731 137.199 -120.433 1.00 45.26  ? 42   GLY C N     1 
ATOM   7282  C CA    . GLY C  1 42  ? 201.633 136.346 -119.999 1.00 45.34  ? 42   GLY C CA    1 
ATOM   7283  C C     . GLY C  1 42  ? 201.771 134.836 -120.138 1.00 45.12  ? 42   GLY C C     1 
ATOM   7284  O O     . GLY C  1 42  ? 200.856 134.102 -119.741 1.00 45.99  ? 42   GLY C O     1 
ATOM   7285  N N     . GLY C  1 43  ? 202.883 134.379 -120.716 1.00 43.38  ? 43   GLY C N     1 
ATOM   7286  C CA    . GLY C  1 43  ? 203.144 132.957 -120.883 1.00 40.41  ? 43   GLY C CA    1 
ATOM   7287  C C     . GLY C  1 43  ? 202.127 132.080 -121.591 1.00 39.49  ? 43   GLY C C     1 
ATOM   7288  O O     . GLY C  1 43  ? 201.301 132.552 -122.361 1.00 39.67  ? 43   GLY C O     1 
ATOM   7289  N N     . THR C  1 44  ? 202.199 130.781 -121.321 1.00 39.41  ? 44   THR C N     1 
ATOM   7290  C CA    . THR C  1 44  ? 201.292 129.796 -121.907 1.00 38.78  ? 44   THR C CA    1 
ATOM   7291  C C     . THR C  1 44  ? 199.811 130.046 -121.622 1.00 38.73  ? 44   THR C C     1 
ATOM   7292  O O     . THR C  1 44  ? 198.977 129.991 -122.518 1.00 38.74  ? 44   THR C O     1 
ATOM   7293  C CB    . THR C  1 44  ? 201.647 128.415 -121.388 1.00 39.99  ? 44   THR C CB    1 
ATOM   7294  O OG1   . THR C  1 44  ? 202.927 128.046 -121.902 1.00 41.34  ? 44   THR C OG1   1 
ATOM   7295  C CG2   . THR C  1 44  ? 200.612 127.389 -121.809 1.00 42.20  ? 44   THR C CG2   1 
ATOM   7296  N N     . CYS C  1 45  ? 199.494 130.316 -120.365 1.00 38.30  ? 45   CYS C N     1 
ATOM   7297  C CA    . CYS C  1 45  ? 198.131 130.562 -119.939 1.00 38.99  ? 45   CYS C CA    1 
ATOM   7298  C C     . CYS C  1 45  ? 197.416 131.688 -120.663 1.00 39.77  ? 45   CYS C C     1 
ATOM   7299  O O     . CYS C  1 45  ? 196.280 131.529 -121.111 1.00 40.34  ? 45   CYS C O     1 
ATOM   7300  C CB    . CYS C  1 45  ? 198.148 130.858 -118.463 1.00 39.08  ? 45   CYS C CB    1 
ATOM   7301  S SG    . CYS C  1 45  ? 196.582 131.044 -117.561 1.00 44.17  ? 45   CYS C SG    1 
ATOM   7302  N N     . LEU C  1 46  ? 198.064 132.839 -120.767 1.00 40.10  ? 46   LEU C N     1 
ATOM   7303  C CA    . LEU C  1 46  ? 197.428 133.970 -121.419 1.00 40.56  ? 46   LEU C CA    1 
ATOM   7304  C C     . LEU C  1 46  ? 197.350 133.862 -122.951 1.00 40.65  ? 46   LEU C C     1 
ATOM   7305  O O     . LEU C  1 46  ? 196.310 134.144 -123.562 1.00 38.94  ? 46   LEU C O     1 
ATOM   7306  C CB    . LEU C  1 46  ? 198.164 135.250 -121.053 1.00 41.67  ? 46   LEU C CB    1 
ATOM   7307  C CG    . LEU C  1 46  ? 197.325 136.508 -120.817 1.00 43.41  ? 46   LEU C CG    1 
ATOM   7308  C CD1   . LEU C  1 46  ? 198.262 137.679 -120.681 1.00 43.61  ? 46   LEU C CD1   1 
ATOM   7309  C CD2   . LEU C  1 46  ? 196.360 136.758 -121.959 1.00 44.94  ? 46   LEU C CD2   1 
ATOM   7310  N N     . ASN C  1 47  ? 198.445 133.425 -123.564 1.00 40.85  ? 47   ASN C N     1 
ATOM   7311  C CA    . ASN C  1 47  ? 198.524 133.346 -125.018 1.00 41.79  ? 47   ASN C CA    1 
ATOM   7312  C C     . ASN C  1 47  ? 198.004 132.079 -125.714 1.00 41.77  ? 47   ASN C C     1 
ATOM   7313  O O     . ASN C  1 47  ? 197.247 132.185 -126.671 1.00 42.46  ? 47   ASN C O     1 
ATOM   7314  C CB    . ASN C  1 47  ? 199.973 133.659 -125.441 1.00 41.48  ? 47   ASN C CB    1 
ATOM   7315  C CG    . ASN C  1 47  ? 200.476 134.985 -124.859 1.00 42.07  ? 47   ASN C CG    1 
ATOM   7316  O OD1   . ASN C  1 47  ? 199.981 136.061 -125.210 1.00 43.72  ? 47   ASN C OD1   1 
ATOM   7317  N ND2   . ASN C  1 47  ? 201.454 134.910 -123.965 1.00 41.53  ? 47   ASN C ND2   1 
ATOM   7318  N N     . VAL C  1 48  ? 198.389 130.895 -125.242 1.00 41.01  ? 48   VAL C N     1 
ATOM   7319  C CA    . VAL C  1 48  ? 197.942 129.642 -125.863 1.00 39.29  ? 48   VAL C CA    1 
ATOM   7320  C C     . VAL C  1 48  ? 197.357 128.626 -124.880 1.00 38.68  ? 48   VAL C C     1 
ATOM   7321  O O     . VAL C  1 48  ? 197.353 127.424 -125.152 1.00 37.60  ? 48   VAL C O     1 
ATOM   7322  C CB    . VAL C  1 48  ? 199.102 128.950 -126.606 1.00 39.59  ? 48   VAL C CB    1 
ATOM   7323  C CG1   . VAL C  1 48  ? 199.501 129.777 -127.832 1.00 39.19  ? 48   VAL C CG1   1 
ATOM   7324  C CG2   . VAL C  1 48  ? 200.280 128.755 -125.659 1.00 37.10  ? 48   VAL C CG2   1 
ATOM   7325  N N     . GLY C  1 49  ? 196.846 129.106 -123.752 1.00 38.09  ? 49   GLY C N     1 
ATOM   7326  C CA    . GLY C  1 49  ? 196.307 128.196 -122.764 1.00 37.22  ? 49   GLY C CA    1 
ATOM   7327  C C     . GLY C  1 49  ? 194.971 128.537 -122.139 1.00 37.75  ? 49   GLY C C     1 
ATOM   7328  O O     . GLY C  1 49  ? 193.953 128.568 -122.832 1.00 38.08  ? 49   GLY C O     1 
ATOM   7329  N N     . CYS C  1 50  ? 194.985 128.793 -120.827 1.00 37.44  ? 50   CYS C N     1 
ATOM   7330  C CA    . CYS C  1 50  ? 193.780 129.102 -120.058 1.00 36.23  ? 50   CYS C CA    1 
ATOM   7331  C C     . CYS C  1 50  ? 192.842 130.142 -120.654 1.00 35.91  ? 50   CYS C C     1 
ATOM   7332  O O     . CYS C  1 50  ? 191.646 129.913 -120.810 1.00 35.62  ? 50   CYS C O     1 
ATOM   7333  C CB    . CYS C  1 50  ? 194.094 129.640 -118.656 1.00 38.43  ? 50   CYS C CB    1 
ATOM   7334  S SG    . CYS C  1 50  ? 195.575 129.254 -117.679 1.00 40.50  ? 50   CYS C SG    1 
ATOM   7335  N N     . ILE C  1 51  ? 193.379 131.318 -120.936 1.00 34.74  ? 51   ILE C N     1 
ATOM   7336  C CA    . ILE C  1 51  ? 192.544 132.386 -121.426 1.00 34.25  ? 51   ILE C CA    1 
ATOM   7337  C C     . ILE C  1 51  ? 191.851 132.085 -122.746 1.00 33.59  ? 51   ILE C C     1 
ATOM   7338  O O     . ILE C  1 51  ? 190.619 132.071 -122.790 1.00 34.84  ? 51   ILE C O     1 
ATOM   7339  C CB    . ILE C  1 51  ? 193.345 133.705 -121.452 1.00 35.36  ? 51   ILE C CB    1 
ATOM   7340  C CG1   . ILE C  1 51  ? 194.002 133.908 -120.074 1.00 36.64  ? 51   ILE C CG1   1 
ATOM   7341  C CG2   . ILE C  1 51  ? 192.419 134.889 -121.734 1.00 34.11  ? 51   ILE C CG2   1 
ATOM   7342  C CD1   . ILE C  1 51  ? 193.023 133.762 -118.838 1.00 33.06  ? 51   ILE C CD1   1 
ATOM   7343  N N     . PRO C  1 52  ? 192.611 131.829 -123.832 1.00 31.46  ? 52   PRO C N     1 
ATOM   7344  C CA    . PRO C  1 52  ? 191.919 131.535 -125.084 1.00 30.86  ? 52   PRO C CA    1 
ATOM   7345  C C     . PRO C  1 52  ? 191.007 130.291 -124.979 1.00 31.26  ? 52   PRO C C     1 
ATOM   7346  O O     . PRO C  1 52  ? 189.935 130.248 -125.588 1.00 29.61  ? 52   PRO C O     1 
ATOM   7347  C CB    . PRO C  1 52  ? 193.066 131.368 -126.081 1.00 30.95  ? 52   PRO C CB    1 
ATOM   7348  C CG    . PRO C  1 52  ? 194.202 130.881 -125.230 1.00 29.61  ? 52   PRO C CG    1 
ATOM   7349  C CD    . PRO C  1 52  ? 194.072 131.755 -124.012 1.00 31.69  ? 52   PRO C CD    1 
ATOM   7350  N N     . SER C  1 53  ? 191.401 129.294 -124.193 1.00 30.85  ? 53   SER C N     1 
ATOM   7351  C CA    . SER C  1 53  ? 190.536 128.127 -124.083 1.00 33.62  ? 53   SER C CA    1 
ATOM   7352  C C     . SER C  1 53  ? 189.203 128.415 -123.309 1.00 32.93  ? 53   SER C C     1 
ATOM   7353  O O     . SER C  1 53  ? 188.119 127.989 -123.742 1.00 33.66  ? 53   SER C O     1 
ATOM   7354  C CB    . SER C  1 53  ? 191.312 126.915 -123.499 1.00 33.11  ? 53   SER C CB    1 
ATOM   7355  O OG    . SER C  1 53  ? 191.520 127.006 -122.105 1.00 33.83  ? 53   SER C OG    1 
ATOM   7356  N N     . LYS C  1 54  ? 189.260 129.149 -122.201 1.00 31.05  ? 54   LYS C N     1 
ATOM   7357  C CA    . LYS C  1 54  ? 188.041 129.456 -121.465 1.00 30.45  ? 54   LYS C CA    1 
ATOM   7358  C C     . LYS C  1 54  ? 187.125 130.363 -122.305 1.00 30.80  ? 54   LYS C C     1 
ATOM   7359  O O     . LYS C  1 54  ? 185.907 130.311 -122.151 1.00 31.20  ? 54   LYS C O     1 
ATOM   7360  C CB    . LYS C  1 54  ? 188.356 130.137 -120.118 1.00 30.60  ? 54   LYS C CB    1 
ATOM   7361  C CG    . LYS C  1 54  ? 188.413 129.240 -118.853 1.00 30.06  ? 54   LYS C CG    1 
ATOM   7362  C CD    . LYS C  1 54  ? 189.717 128.426 -118.726 1.00 30.53  ? 54   LYS C CD    1 
ATOM   7363  C CE    . LYS C  1 54  ? 189.646 127.128 -119.540 1.00 29.52  ? 54   LYS C CE    1 
ATOM   7364  N NZ    . LYS C  1 54  ? 190.838 126.265 -119.393 1.00 29.08  ? 54   LYS C NZ    1 
ATOM   7365  N N     . ALA C  1 55  ? 187.695 131.197 -123.176 1.00 30.81  ? 55   ALA C N     1 
ATOM   7366  C CA    . ALA C  1 55  ? 186.871 132.073 -124.038 1.00 31.11  ? 55   ALA C CA    1 
ATOM   7367  C C     . ALA C  1 55  ? 186.081 131.195 -125.007 1.00 31.12  ? 55   ALA C C     1 
ATOM   7368  O O     . ALA C  1 55  ? 184.850 131.316 -125.124 1.00 31.15  ? 55   ALA C O     1 
ATOM   7369  C CB    . ALA C  1 55  ? 187.746 133.064 -124.828 1.00 30.92  ? 55   ALA C CB    1 
ATOM   7370  N N     . LEU C  1 56  ? 186.791 130.295 -125.686 1.00 31.31  ? 56   LEU C N     1 
ATOM   7371  C CA    . LEU C  1 56  ? 186.149 129.380 -126.623 1.00 31.57  ? 56   LEU C CA    1 
ATOM   7372  C C     . LEU C  1 56  ? 185.132 128.508 -125.898 1.00 32.05  ? 56   LEU C C     1 
ATOM   7373  O O     . LEU C  1 56  ? 184.034 128.285 -126.405 1.00 33.40  ? 56   LEU C O     1 
ATOM   7374  C CB    . LEU C  1 56  ? 187.193 128.526 -127.361 1.00 29.86  ? 56   LEU C CB    1 
ATOM   7375  C CG    . LEU C  1 56  ? 188.126 129.289 -128.332 1.00 30.17  ? 56   LEU C CG    1 
ATOM   7376  C CD1   . LEU C  1 56  ? 188.997 128.298 -129.138 1.00 28.43  ? 56   LEU C CD1   1 
ATOM   7377  C CD2   . LEU C  1 56  ? 187.304 130.151 -129.280 1.00 24.72  ? 56   LEU C CD2   1 
ATOM   7378  N N     . LEU C  1 57  ? 185.482 128.014 -124.712 1.00 32.08  ? 57   LEU C N     1 
ATOM   7379  C CA    . LEU C  1 57  ? 184.526 127.214 -123.939 1.00 31.29  ? 57   LEU C CA    1 
ATOM   7380  C C     . LEU C  1 57  ? 183.248 128.011 -123.658 1.00 30.93  ? 57   LEU C C     1 
ATOM   7381  O O     . LEU C  1 57  ? 182.143 127.514 -123.835 1.00 32.56  ? 57   LEU C O     1 
ATOM   7382  C CB    . LEU C  1 57  ? 185.138 126.761 -122.616 1.00 27.25  ? 57   LEU C CB    1 
ATOM   7383  C CG    . LEU C  1 57  ? 186.052 125.554 -122.723 1.00 26.03  ? 57   LEU C CG    1 
ATOM   7384  C CD1   . LEU C  1 57  ? 187.065 125.618 -121.636 1.00 23.81  ? 57   LEU C CD1   1 
ATOM   7385  C CD2   . LEU C  1 57  ? 185.248 124.275 -122.650 1.00 26.81  ? 57   LEU C CD2   1 
ATOM   7386  N N     . ASN C  1 58  ? 183.404 129.255 -123.235 1.00 30.13  ? 58   ASN C N     1 
ATOM   7387  C CA    . ASN C  1 58  ? 182.261 130.093 -122.925 1.00 31.33  ? 58   ASN C CA    1 
ATOM   7388  C C     . ASN C  1 58  ? 181.417 130.425 -124.162 1.00 31.74  ? 58   ASN C C     1 
ATOM   7389  O O     . ASN C  1 58  ? 180.193 130.376 -124.122 1.00 30.99  ? 58   ASN C O     1 
ATOM   7390  C CB    . ASN C  1 58  ? 182.750 131.383 -122.240 1.00 32.32  ? 58   ASN C CB    1 
ATOM   7391  C CG    . ASN C  1 58  ? 181.626 132.159 -121.590 1.00 35.79  ? 58   ASN C CG    1 
ATOM   7392  O OD1   . ASN C  1 58  ? 181.443 133.351 -121.857 1.00 37.86  ? 58   ASN C OD1   1 
ATOM   7393  N ND2   . ASN C  1 58  ? 180.860 131.488 -120.723 1.00 37.75  ? 58   ASN C ND2   1 
ATOM   7394  N N     . ASN C  1 59  ? 182.067 130.753 -125.269 1.00 33.05  ? 59   ASN C N     1 
ATOM   7395  C CA    . ASN C  1 59  ? 181.325 131.096 -126.477 1.00 34.91  ? 59   ASN C CA    1 
ATOM   7396  C C     . ASN C  1 59  ? 180.619 129.908 -127.108 1.00 35.15  ? 59   ASN C C     1 
ATOM   7397  O O     . ASN C  1 59  ? 179.514 130.026 -127.649 1.00 34.66  ? 59   ASN C O     1 
ATOM   7398  C CB    . ASN C  1 59  ? 182.249 131.737 -127.520 1.00 36.06  ? 59   ASN C CB    1 
ATOM   7399  C CG    . ASN C  1 59  ? 182.803 133.082 -127.072 1.00 35.74  ? 59   ASN C CG    1 
ATOM   7400  O OD1   . ASN C  1 59  ? 182.145 133.826 -126.335 1.00 36.47  ? 59   ASN C OD1   1 
ATOM   7401  N ND2   . ASN C  1 59  ? 184.008 133.408 -127.536 1.00 33.58  ? 59   ASN C ND2   1 
ATOM   7402  N N     . SER C  1 60  ? 181.271 128.761 -127.033 1.00 35.81  ? 60   SER C N     1 
ATOM   7403  C CA    . SER C  1 60  ? 180.725 127.554 -127.608 1.00 35.63  ? 60   SER C CA    1 
ATOM   7404  C C     . SER C  1 60  ? 179.584 127.057 -126.744 1.00 35.40  ? 60   SER C C     1 
ATOM   7405  O O     . SER C  1 60  ? 178.690 126.398 -127.221 1.00 34.85  ? 60   SER C O     1 
ATOM   7406  C CB    . SER C  1 60  ? 181.814 126.472 -127.724 1.00 35.56  ? 60   SER C CB    1 
ATOM   7407  O OG    . SER C  1 60  ? 182.361 126.120 -126.463 1.00 36.46  ? 60   SER C OG    1 
ATOM   7408  N N     . HIS C  1 61  ? 179.598 127.379 -125.463 1.00 36.01  ? 61   HIS C N     1 
ATOM   7409  C CA    . HIS C  1 61  ? 178.528 126.890 -124.629 1.00 36.28  ? 61   HIS C CA    1 
ATOM   7410  C C     . HIS C  1 61  ? 177.268 127.676 -125.004 1.00 37.04  ? 61   HIS C C     1 
ATOM   7411  O O     . HIS C  1 61  ? 176.194 127.094 -125.149 1.00 36.62  ? 61   HIS C O     1 
ATOM   7412  C CB    . HIS C  1 61  ? 178.860 126.995 -123.112 1.00 34.47  ? 61   HIS C CB    1 
ATOM   7413  C CG    . HIS C  1 61  ? 177.644 126.807 -122.239 1.00 33.16  ? 61   HIS C CG    1 
ATOM   7414  N ND1   . HIS C  1 61  ? 176.960 127.796 -121.562 1.00 32.16  ? 61   HIS C ND1   1 
ATOM   7415  C CD2   . HIS C  1 61  ? 176.933 125.667 -122.065 1.00 30.82  ? 61   HIS C CD2   1 
ATOM   7416  C CE1   . HIS C  1 61  ? 175.874 127.257 -121.001 1.00 31.99  ? 61   HIS C CE1   1 
ATOM   7417  N NE2   . HIS C  1 61  ? 175.849 125.974 -121.299 1.00 31.05  ? 61   HIS C NE2   1 
ATOM   7418  N N     . TYR C  1 62  ? 177.409 128.987 -125.195 1.00 37.99  ? 62   TYR C N     1 
ATOM   7419  C CA    . TYR C  1 62  ? 176.276 129.825 -125.557 1.00 38.94  ? 62   TYR C CA    1 
ATOM   7420  C C     . TYR C  1 62  ? 175.771 129.502 -126.968 1.00 38.83  ? 62   TYR C C     1 
ATOM   7421  O O     . TYR C  1 62  ? 174.565 129.563 -127.227 1.00 38.25  ? 62   TYR C O     1 
ATOM   7422  C CB    . TYR C  1 62  ? 176.650 131.298 -125.411 1.00 39.18  ? 62   TYR C CB    1 
ATOM   7423  C CG    . TYR C  1 62  ? 176.776 131.707 -123.957 1.00 41.98  ? 62   TYR C CG    1 
ATOM   7424  C CD1   . TYR C  1 62  ? 175.925 131.166 -122.988 1.00 43.05  ? 62   TYR C CD1   1 
ATOM   7425  C CD2   . TYR C  1 62  ? 177.688 132.681 -123.552 1.00 41.83  ? 62   TYR C CD2   1 
ATOM   7426  C CE1   . TYR C  1 62  ? 175.973 131.593 -121.657 1.00 43.29  ? 62   TYR C CE1   1 
ATOM   7427  C CE2   . TYR C  1 62  ? 177.737 133.113 -122.214 1.00 43.41  ? 62   TYR C CE2   1 
ATOM   7428  C CZ    . TYR C  1 62  ? 176.875 132.564 -121.280 1.00 43.67  ? 62   TYR C CZ    1 
ATOM   7429  O OH    . TYR C  1 62  ? 176.887 132.986 -119.964 1.00 47.45  ? 62   TYR C OH    1 
ATOM   7430  N N     . TYR C  1 63  ? 176.675 129.155 -127.880 1.00 38.31  ? 63   TYR C N     1 
ATOM   7431  C CA    . TYR C  1 63  ? 176.238 128.787 -129.220 1.00 39.29  ? 63   TYR C CA    1 
ATOM   7432  C C     . TYR C  1 63  ? 175.328 127.550 -129.074 1.00 38.90  ? 63   TYR C C     1 
ATOM   7433  O O     . TYR C  1 63  ? 174.301 127.451 -129.738 1.00 37.87  ? 63   TYR C O     1 
ATOM   7434  C CB    . TYR C  1 63  ? 177.437 128.457 -130.126 1.00 38.97  ? 63   TYR C CB    1 
ATOM   7435  C CG    . TYR C  1 63  ? 177.043 127.781 -131.429 1.00 41.54  ? 63   TYR C CG    1 
ATOM   7436  C CD1   . TYR C  1 63  ? 176.344 128.480 -132.433 1.00 42.62  ? 63   TYR C CD1   1 
ATOM   7437  C CD2   . TYR C  1 63  ? 177.324 126.430 -131.648 1.00 42.17  ? 63   TYR C CD2   1 
ATOM   7438  C CE1   . TYR C  1 63  ? 175.937 127.845 -133.613 1.00 41.39  ? 63   TYR C CE1   1 
ATOM   7439  C CE2   . TYR C  1 63  ? 176.919 125.787 -132.821 1.00 42.31  ? 63   TYR C CE2   1 
ATOM   7440  C CZ    . TYR C  1 63  ? 176.229 126.498 -133.793 1.00 43.13  ? 63   TYR C CZ    1 
ATOM   7441  O OH    . TYR C  1 63  ? 175.825 125.839 -134.932 1.00 46.66  ? 63   TYR C OH    1 
ATOM   7442  N N     . HIS C  1 64  ? 175.708 126.627 -128.185 1.00 38.87  ? 64   HIS C N     1 
ATOM   7443  C CA    . HIS C  1 64  ? 174.931 125.411 -127.950 1.00 39.05  ? 64   HIS C CA    1 
ATOM   7444  C C     . HIS C  1 64  ? 173.580 125.659 -127.300 1.00 39.61  ? 64   HIS C C     1 
ATOM   7445  O O     . HIS C  1 64  ? 172.630 124.948 -127.594 1.00 39.44  ? 64   HIS C O     1 
ATOM   7446  C CB    . HIS C  1 64  ? 175.705 124.413 -127.092 1.00 38.21  ? 64   HIS C CB    1 
ATOM   7447  C CG    . HIS C  1 64  ? 174.932 123.170 -126.766 1.00 40.19  ? 64   HIS C CG    1 
ATOM   7448  N ND1   . HIS C  1 64  ? 175.219 122.379 -125.674 1.00 40.91  ? 64   HIS C ND1   1 
ATOM   7449  C CD2   . HIS C  1 64  ? 173.880 122.581 -127.385 1.00 39.17  ? 64   HIS C CD2   1 
ATOM   7450  C CE1   . HIS C  1 64  ? 174.379 121.360 -125.634 1.00 40.14  ? 64   HIS C CE1   1 
ATOM   7451  N NE2   . HIS C  1 64  ? 173.556 121.460 -126.661 1.00 39.96  ? 64   HIS C NE2   1 
ATOM   7452  N N     . MET C  1 65  ? 173.491 126.636 -126.403 1.00 40.87  ? 65   MET C N     1 
ATOM   7453  C CA    . MET C  1 65  ? 172.215 126.940 -125.767 1.00 42.10  ? 65   MET C CA    1 
ATOM   7454  C C     . MET C  1 65  ? 171.289 127.654 -126.779 1.00 41.92  ? 65   MET C C     1 
ATOM   7455  O O     . MET C  1 65  ? 170.070 127.493 -126.732 1.00 41.08  ? 65   MET C O     1 
ATOM   7456  C CB    . MET C  1 65  ? 172.422 127.822 -124.520 1.00 44.80  ? 65   MET C CB    1 
ATOM   7457  C CG    . MET C  1 65  ? 173.347 127.242 -123.450 1.00 47.88  ? 65   MET C CG    1 
ATOM   7458  S SD    . MET C  1 65  ? 172.878 125.583 -122.905 1.00 53.36  ? 65   MET C SD    1 
ATOM   7459  C CE    . MET C  1 65  ? 172.423 125.861 -121.177 1.00 54.25  ? 65   MET C CE    1 
ATOM   7460  N N     . ALA C  1 66  ? 171.878 128.432 -127.690 1.00 41.01  ? 66   ALA C N     1 
ATOM   7461  C CA    . ALA C  1 66  ? 171.122 129.165 -128.708 1.00 41.23  ? 66   ALA C CA    1 
ATOM   7462  C C     . ALA C  1 66  ? 170.759 128.288 -129.916 1.00 41.70  ? 66   ALA C C     1 
ATOM   7463  O O     . ALA C  1 66  ? 169.654 128.365 -130.453 1.00 40.35  ? 66   ALA C O     1 
ATOM   7464  C CB    . ALA C  1 66  ? 171.927 130.372 -129.191 1.00 39.34  ? 66   ALA C CB    1 
ATOM   7465  N N     . HIS C  1 67  ? 171.701 127.447 -130.324 1.00 41.34  ? 67   HIS C N     1 
ATOM   7466  C CA    . HIS C  1 67  ? 171.522 126.578 -131.470 1.00 42.62  ? 67   HIS C CA    1 
ATOM   7467  C C     . HIS C  1 67  ? 170.720 125.306 -131.114 1.00 42.78  ? 67   HIS C C     1 
ATOM   7468  O O     . HIS C  1 67  ? 169.935 124.796 -131.925 1.00 42.19  ? 67   HIS C O     1 
ATOM   7469  C CB    . HIS C  1 67  ? 172.886 126.219 -132.034 1.00 43.13  ? 67   HIS C CB    1 
ATOM   7470  C CG    . HIS C  1 67  ? 172.841 125.258 -133.196 1.00 45.22  ? 67   HIS C CG    1 
ATOM   7471  N ND1   . HIS C  1 67  ? 172.858 123.880 -133.118 1.00 44.59  ? 67   HIS C ND1   1 
ATOM   7472  C CD2   . HIS C  1 67  ? 172.803 125.567 -134.514 1.00 44.57  ? 67   HIS C CD2   1 
ATOM   7473  C CE1   . HIS C  1 67  ? 172.844 123.384 -134.358 1.00 45.20  ? 67   HIS C CE1   1 
ATOM   7474  N NE2   . HIS C  1 67  ? 172.813 124.391 -135.205 1.00 46.96  ? 67   HIS C NE2   1 
ATOM   7475  N N     . GLY C  1 68  ? 170.888 124.829 -129.884 1.00 41.57  ? 68   GLY C N     1 
ATOM   7476  C CA    . GLY C  1 68  ? 170.173 123.652 -129.442 1.00 42.42  ? 68   GLY C CA    1 
ATOM   7477  C C     . GLY C  1 68  ? 168.762 124.000 -129.009 1.00 43.70  ? 68   GLY C C     1 
ATOM   7478  O O     . GLY C  1 68  ? 168.152 124.957 -129.481 1.00 44.56  ? 68   GLY C O     1 
ATOM   7479  N N     . THR C  1 69  ? 168.256 123.233 -128.062 1.00 44.34  ? 69   THR C N     1 
ATOM   7480  C CA    . THR C  1 69  ? 166.908 123.409 -127.585 1.00 45.69  ? 69   THR C CA    1 
ATOM   7481  C C     . THR C  1 69  ? 166.729 124.241 -126.320 1.00 43.96  ? 69   THR C C     1 
ATOM   7482  O O     . THR C  1 69  ? 165.605 124.597 -125.954 1.00 43.13  ? 69   THR C O     1 
ATOM   7483  C CB    . THR C  1 69  ? 166.291 122.032 -127.373 1.00 48.75  ? 69   THR C CB    1 
ATOM   7484  O OG1   . THR C  1 69  ? 164.949 122.178 -126.886 1.00 54.60  ? 69   THR C OG1   1 
ATOM   7485  C CG2   . THR C  1 69  ? 167.136 121.230 -126.388 1.00 51.13  ? 69   THR C CG2   1 
ATOM   7486  N N     . ASP C  1 70  ? 167.830 124.571 -125.662 1.00 43.13  ? 70   ASP C N     1 
ATOM   7487  C CA    . ASP C  1 70  ? 167.755 125.333 -124.430 1.00 42.71  ? 70   ASP C CA    1 
ATOM   7488  C C     . ASP C  1 70  ? 167.036 126.671 -124.506 1.00 41.87  ? 70   ASP C C     1 
ATOM   7489  O O     . ASP C  1 70  ? 166.065 126.900 -123.789 1.00 41.63  ? 70   ASP C O     1 
ATOM   7490  C CB    . ASP C  1 70  ? 169.147 125.557 -123.851 1.00 44.02  ? 70   ASP C CB    1 
ATOM   7491  C CG    . ASP C  1 70  ? 169.105 126.323 -122.546 1.00 44.41  ? 70   ASP C CG    1 
ATOM   7492  O OD1   . ASP C  1 70  ? 168.656 125.762 -121.527 1.00 43.12  ? 70   ASP C OD1   1 
ATOM   7493  O OD2   . ASP C  1 70  ? 169.507 127.497 -122.548 1.00 47.31  ? 70   ASP C OD2   1 
ATOM   7494  N N     . PHE C  1 71  ? 167.515 127.565 -125.356 1.00 41.60  ? 71   PHE C N     1 
ATOM   7495  C CA    . PHE C  1 71  ? 166.897 128.886 -125.476 1.00 41.13  ? 71   PHE C CA    1 
ATOM   7496  C C     . PHE C  1 71  ? 165.430 128.877 -125.893 1.00 40.04  ? 71   PHE C C     1 
ATOM   7497  O O     . PHE C  1 71  ? 164.649 129.733 -125.458 1.00 38.91  ? 71   PHE C O     1 
ATOM   7498  C CB    . PHE C  1 71  ? 167.712 129.756 -126.430 1.00 41.78  ? 71   PHE C CB    1 
ATOM   7499  C CG    . PHE C  1 71  ? 168.711 130.632 -125.740 1.00 42.10  ? 71   PHE C CG    1 
ATOM   7500  C CD1   . PHE C  1 71  ? 169.263 130.256 -124.520 1.00 42.78  ? 71   PHE C CD1   1 
ATOM   7501  C CD2   . PHE C  1 71  ? 169.112 131.829 -126.311 1.00 41.87  ? 71   PHE C CD2   1 
ATOM   7502  C CE1   . PHE C  1 71  ? 170.201 131.068 -123.884 1.00 42.47  ? 71   PHE C CE1   1 
ATOM   7503  C CE2   . PHE C  1 71  ? 170.050 132.643 -125.680 1.00 42.23  ? 71   PHE C CE2   1 
ATOM   7504  C CZ    . PHE C  1 71  ? 170.592 132.265 -124.472 1.00 40.88  ? 71   PHE C CZ    1 
ATOM   7505  N N     . ALA C  1 72  ? 165.057 127.920 -126.735 1.00 38.74  ? 72   ALA C N     1 
ATOM   7506  C CA    . ALA C  1 72  ? 163.665 127.813 -127.161 1.00 39.48  ? 72   ALA C CA    1 
ATOM   7507  C C     . ALA C  1 72  ? 162.805 127.544 -125.921 1.00 39.79  ? 72   ALA C C     1 
ATOM   7508  O O     . ALA C  1 72  ? 161.765 128.168 -125.715 1.00 41.07  ? 72   ALA C O     1 
ATOM   7509  C CB    . ALA C  1 72  ? 163.502 126.683 -128.174 1.00 36.79  ? 72   ALA C CB    1 
ATOM   7510  N N     . SER C  1 73  ? 163.251 126.631 -125.072 1.00 39.70  ? 73   SER C N     1 
ATOM   7511  C CA    . SER C  1 73  ? 162.481 126.320 -123.885 1.00 40.57  ? 73   SER C CA    1 
ATOM   7512  C C     . SER C  1 73  ? 162.265 127.518 -122.969 1.00 40.68  ? 73   SER C C     1 
ATOM   7513  O O     . SER C  1 73  ? 161.429 127.459 -122.067 1.00 40.57  ? 73   SER C O     1 
ATOM   7514  C CB    . SER C  1 73  ? 163.167 125.206 -123.097 1.00 42.10  ? 73   SER C CB    1 
ATOM   7515  O OG    . SER C  1 73  ? 164.361 125.667 -122.484 1.00 42.00  ? 73   SER C OG    1 
ATOM   7516  N N     . ARG C  1 74  ? 162.994 128.606 -123.208 1.00 41.16  ? 74   ARG C N     1 
ATOM   7517  C CA    . ARG C  1 74  ? 162.901 129.803 -122.353 1.00 42.34  ? 74   ARG C CA    1 
ATOM   7518  C C     . ARG C  1 74  ? 162.106 130.973 -122.891 1.00 42.48  ? 74   ARG C C     1 
ATOM   7519  O O     . ARG C  1 74  ? 162.097 132.047 -122.282 1.00 40.02  ? 74   ARG C O     1 
ATOM   7520  C CB    . ARG C  1 74  ? 164.302 130.309 -121.994 1.00 42.04  ? 74   ARG C CB    1 
ATOM   7521  C CG    . ARG C  1 74  ? 165.046 129.336 -121.115 1.00 40.88  ? 74   ARG C CG    1 
ATOM   7522  C CD    . ARG C  1 74  ? 166.516 129.627 -121.052 1.00 39.60  ? 74   ARG C CD    1 
ATOM   7523  N NE    . ARG C  1 74  ? 167.227 128.490 -120.471 1.00 38.24  ? 74   ARG C NE    1 
ATOM   7524  C CZ    . ARG C  1 74  ? 167.110 128.113 -119.205 1.00 38.21  ? 74   ARG C CZ    1 
ATOM   7525  N NH1   . ARG C  1 74  ? 166.311 128.789 -118.387 1.00 38.15  ? 74   ARG C NH1   1 
ATOM   7526  N NH2   . ARG C  1 74  ? 167.782 127.061 -118.763 1.00 38.32  ? 74   ARG C NH2   1 
ATOM   7527  N N     . GLY C  1 75  ? 161.442 130.758 -124.022 1.00 43.89  ? 75   GLY C N     1 
ATOM   7528  C CA    . GLY C  1 75  ? 160.666 131.821 -124.620 1.00 46.10  ? 75   GLY C CA    1 
ATOM   7529  C C     . GLY C  1 75  ? 161.545 132.698 -125.492 1.00 47.39  ? 75   GLY C C     1 
ATOM   7530  O O     . GLY C  1 75  ? 161.075 133.674 -126.058 1.00 48.68  ? 75   GLY C O     1 
ATOM   7531  N N     . ILE C  1 76  ? 162.828 132.376 -125.577 1.00 48.12  ? 76   ILE C N     1 
ATOM   7532  C CA    . ILE C  1 76  ? 163.736 133.133 -126.421 1.00 49.84  ? 76   ILE C CA    1 
ATOM   7533  C C     . ILE C  1 76  ? 163.647 132.372 -127.730 1.00 51.98  ? 76   ILE C C     1 
ATOM   7534  O O     . ILE C  1 76  ? 164.166 131.269 -127.819 1.00 51.89  ? 76   ILE C O     1 
ATOM   7535  C CB    . ILE C  1 76  ? 165.172 133.061 -125.890 1.00 49.03  ? 76   ILE C CB    1 
ATOM   7536  C CG1   . ILE C  1 76  ? 165.214 133.605 -124.466 1.00 48.67  ? 76   ILE C CG1   1 
ATOM   7537  C CG2   . ILE C  1 76  ? 166.108 133.859 -126.780 1.00 45.77  ? 76   ILE C CG2   1 
ATOM   7538  C CD1   . ILE C  1 76  ? 166.547 133.399 -123.791 1.00 47.98  ? 76   ILE C CD1   1 
ATOM   7539  N N     . GLU C  1 77  ? 162.974 132.937 -128.734 1.00 54.19  ? 77   GLU C N     1 
ATOM   7540  C CA    . GLU C  1 77  ? 162.810 132.240 -130.015 1.00 56.27  ? 77   GLU C CA    1 
ATOM   7541  C C     . GLU C  1 77  ? 163.643 132.764 -131.158 1.00 56.51  ? 77   GLU C C     1 
ATOM   7542  O O     . GLU C  1 77  ? 163.588 133.945 -131.499 1.00 56.33  ? 77   GLU C O     1 
ATOM   7543  C CB    . GLU C  1 77  ? 161.351 132.245 -130.445 1.00 57.88  ? 77   GLU C CB    1 
ATOM   7544  C CG    . GLU C  1 77  ? 160.418 131.651 -129.420 1.00 60.50  ? 77   GLU C CG    1 
ATOM   7545  C CD    . GLU C  1 77  ? 159.053 131.351 -129.992 1.00 61.93  ? 77   GLU C CD    1 
ATOM   7546  O OE1   . GLU C  1 77  ? 158.516 132.194 -130.752 1.00 62.45  ? 77   GLU C OE1   1 
ATOM   7547  O OE2   . GLU C  1 77  ? 158.514 130.274 -129.666 1.00 62.05  ? 77   GLU C OE2   1 
ATOM   7548  N N     . MET C  1 78  ? 164.391 131.853 -131.764 1.00 57.86  ? 78   MET C N     1 
ATOM   7549  C CA    . MET C  1 78  ? 165.274 132.180 -132.869 1.00 60.01  ? 78   MET C CA    1 
ATOM   7550  C C     . MET C  1 78  ? 164.877 131.528 -134.158 1.00 60.09  ? 78   MET C C     1 
ATOM   7551  O O     . MET C  1 78  ? 164.460 130.383 -134.177 1.00 59.72  ? 78   MET C O     1 
ATOM   7552  C CB    . MET C  1 78  ? 166.700 131.750 -132.562 1.00 60.90  ? 78   MET C CB    1 
ATOM   7553  C CG    . MET C  1 78  ? 167.568 132.871 -132.107 1.00 63.02  ? 78   MET C CG    1 
ATOM   7554  S SD    . MET C  1 78  ? 167.630 132.966 -130.349 1.00 62.93  ? 78   MET C SD    1 
ATOM   7555  C CE    . MET C  1 78  ? 168.883 131.762 -130.050 1.00 62.75  ? 78   MET C CE    1 
ATOM   7556  N N     . SER C  1 79  ? 165.048 132.263 -135.243 1.00 61.82  ? 79   SER C N     1 
ATOM   7557  C CA    . SER C  1 79  ? 164.724 131.766 -136.570 1.00 63.01  ? 79   SER C CA    1 
ATOM   7558  C C     . SER C  1 79  ? 165.778 130.737 -136.977 1.00 62.65  ? 79   SER C C     1 
ATOM   7559  O O     . SER C  1 79  ? 165.501 129.538 -137.107 1.00 62.29  ? 79   SER C O     1 
ATOM   7560  C CB    . SER C  1 79  ? 164.744 132.938 -137.540 1.00 64.43  ? 79   SER C CB    1 
ATOM   7561  O OG    . SER C  1 79  ? 165.990 133.617 -137.435 1.00 65.68  ? 79   SER C OG    1 
ATOM   7562  N N     . GLU C  1 80  ? 166.990 131.233 -137.179 1.00 61.79  ? 80   GLU C N     1 
ATOM   7563  C CA    . GLU C  1 80  ? 168.116 130.407 -137.565 1.00 62.22  ? 80   GLU C CA    1 
ATOM   7564  C C     . GLU C  1 80  ? 169.275 130.869 -136.706 1.00 60.19  ? 80   GLU C C     1 
ATOM   7565  O O     . GLU C  1 80  ? 169.348 132.036 -136.341 1.00 61.18  ? 80   GLU C O     1 
ATOM   7566  C CB    . GLU C  1 80  ? 168.462 130.619 -139.049 1.00 65.59  ? 80   GLU C CB    1 
ATOM   7567  C CG    . GLU C  1 80  ? 169.809 130.007 -139.459 1.00 70.78  ? 80   GLU C CG    1 
ATOM   7568  C CD    . GLU C  1 80  ? 170.524 130.755 -140.603 1.00 74.23  ? 80   GLU C CD    1 
ATOM   7569  O OE1   . GLU C  1 80  ? 170.606 132.010 -140.569 1.00 74.59  ? 80   GLU C OE1   1 
ATOM   7570  O OE2   . GLU C  1 80  ? 171.030 130.077 -141.530 1.00 75.84  ? 80   GLU C OE2   1 
ATOM   7571  N N     . VAL C  1 81  ? 170.169 129.954 -136.365 1.00 57.66  ? 81   VAL C N     1 
ATOM   7572  C CA    . VAL C  1 81  ? 171.336 130.299 -135.573 1.00 54.88  ? 81   VAL C CA    1 
ATOM   7573  C C     . VAL C  1 81  ? 172.530 129.725 -136.316 1.00 53.15  ? 81   VAL C C     1 
ATOM   7574  O O     . VAL C  1 81  ? 172.743 128.521 -136.332 1.00 52.53  ? 81   VAL C O     1 
ATOM   7575  C CB    . VAL C  1 81  ? 171.263 129.696 -134.140 1.00 55.10  ? 81   VAL C CB    1 
ATOM   7576  C CG1   . VAL C  1 81  ? 172.538 130.022 -133.370 1.00 54.20  ? 81   VAL C CG1   1 
ATOM   7577  C CG2   . VAL C  1 81  ? 170.048 130.244 -133.397 1.00 54.54  ? 81   VAL C CG2   1 
ATOM   7578  N N     . ARG C  1 82  ? 173.285 130.593 -136.970 1.00 52.51  ? 82   ARG C N     1 
ATOM   7579  C CA    . ARG C  1 82  ? 174.453 130.150 -137.710 1.00 52.47  ? 82   ARG C CA    1 
ATOM   7580  C C     . ARG C  1 82  ? 175.697 130.521 -136.917 1.00 51.30  ? 82   ARG C C     1 
ATOM   7581  O O     . ARG C  1 82  ? 175.684 131.453 -136.111 1.00 51.81  ? 82   ARG C O     1 
ATOM   7582  C CB    . ARG C  1 82  ? 174.504 130.781 -139.123 1.00 52.83  ? 82   ARG C CB    1 
ATOM   7583  C CG    . ARG C  1 82  ? 173.710 130.040 -140.182 0.00 53.45  ? 82   ARG C CG    1 
ATOM   7584  C CD    . ARG C  1 82  ? 174.274 130.336 -141.565 0.00 54.04  ? 82   ARG C CD    1 
ATOM   7585  N NE    . ARG C  1 82  ? 174.382 131.771 -141.815 0.00 54.58  ? 82   ARG C NE    1 
ATOM   7586  C CZ    . ARG C  1 82  ? 174.954 132.302 -142.890 0.00 54.86  ? 82   ARG C CZ    1 
ATOM   7587  N NH1   . ARG C  1 82  ? 175.477 131.518 -143.824 0.00 55.02  ? 82   ARG C NH1   1 
ATOM   7588  N NH2   . ARG C  1 82  ? 175.005 133.620 -143.033 0.00 55.02  ? 82   ARG C NH2   1 
ATOM   7589  N N     . LEU C  1 83  ? 176.765 129.768 -137.141 1.00 50.22  ? 83   LEU C N     1 
ATOM   7590  C CA    . LEU C  1 83  ? 178.032 129.998 -136.464 1.00 48.67  ? 83   LEU C CA    1 
ATOM   7591  C C     . LEU C  1 83  ? 178.961 130.856 -137.301 1.00 48.11  ? 83   LEU C C     1 
ATOM   7592  O O     . LEU C  1 83  ? 179.107 130.639 -138.502 1.00 48.83  ? 83   LEU C O     1 
ATOM   7593  C CB    . LEU C  1 83  ? 178.736 128.668 -136.180 1.00 47.52  ? 83   LEU C CB    1 
ATOM   7594  C CG    . LEU C  1 83  ? 180.179 128.846 -135.710 1.00 48.20  ? 83   LEU C CG    1 
ATOM   7595  C CD1   . LEU C  1 83  ? 180.164 129.421 -134.296 1.00 49.49  ? 83   LEU C CD1   1 
ATOM   7596  C CD2   . LEU C  1 83  ? 180.927 127.532 -135.747 1.00 46.84  ? 83   LEU C CD2   1 
ATOM   7597  N N     . ASN C  1 84  ? 179.587 131.832 -136.664 1.00 46.44  ? 84   ASN C N     1 
ATOM   7598  C CA    . ASN C  1 84  ? 180.538 132.684 -137.348 1.00 44.82  ? 84   ASN C CA    1 
ATOM   7599  C C     . ASN C  1 84  ? 181.856 132.435 -136.635 1.00 43.82  ? 84   ASN C C     1 
ATOM   7600  O O     . ASN C  1 84  ? 182.248 133.175 -135.740 1.00 43.80  ? 84   ASN C O     1 
ATOM   7601  C CB    . ASN C  1 84  ? 180.131 134.144 -137.226 1.00 44.63  ? 84   ASN C CB    1 
ATOM   7602  C CG    . ASN C  1 84  ? 180.974 135.045 -138.090 1.00 44.59  ? 84   ASN C CG    1 
ATOM   7603  O OD1   . ASN C  1 84  ? 181.933 134.596 -138.722 1.00 44.61  ? 84   ASN C OD1   1 
ATOM   7604  N ND2   . ASN C  1 84  ? 180.625 136.323 -138.124 1.00 43.24  ? 84   ASN C ND2   1 
ATOM   7605  N N     . LEU C  1 85  ? 182.527 131.367 -137.033 1.00 43.88  ? 85   LEU C N     1 
ATOM   7606  C CA    . LEU C  1 85  ? 183.782 130.978 -136.415 1.00 44.61  ? 85   LEU C CA    1 
ATOM   7607  C C     . LEU C  1 85  ? 184.759 132.139 -136.328 1.00 45.26  ? 85   LEU C C     1 
ATOM   7608  O O     . LEU C  1 85  ? 185.402 132.332 -135.301 1.00 46.21  ? 85   LEU C O     1 
ATOM   7609  C CB    . LEU C  1 85  ? 184.392 129.789 -137.179 1.00 43.41  ? 85   LEU C CB    1 
ATOM   7610  C CG    . LEU C  1 85  ? 185.510 128.911 -136.588 1.00 44.18  ? 85   LEU C CG    1 
ATOM   7611  C CD1   . LEU C  1 85  ? 186.829 129.648 -136.663 1.00 46.73  ? 85   LEU C CD1   1 
ATOM   7612  C CD2   . LEU C  1 85  ? 185.196 128.519 -135.150 1.00 44.22  ? 85   LEU C CD2   1 
ATOM   7613  N N     . ASP C  1 86  ? 184.853 132.930 -137.388 1.00 46.63  ? 86   ASP C N     1 
ATOM   7614  C CA    . ASP C  1 86  ? 185.776 134.057 -137.391 1.00 47.44  ? 86   ASP C CA    1 
ATOM   7615  C C     . ASP C  1 86  ? 185.490 135.056 -136.289 1.00 46.48  ? 86   ASP C C     1 
ATOM   7616  O O     . ASP C  1 86  ? 186.403 135.614 -135.698 1.00 45.12  ? 86   ASP C O     1 
ATOM   7617  C CB    . ASP C  1 86  ? 185.743 134.785 -138.737 1.00 50.47  ? 86   ASP C CB    1 
ATOM   7618  C CG    . ASP C  1 86  ? 186.269 133.936 -139.871 1.00 54.28  ? 86   ASP C CG    1 
ATOM   7619  O OD1   . ASP C  1 86  ? 187.259 133.183 -139.660 1.00 55.22  ? 86   ASP C OD1   1 
ATOM   7620  O OD2   . ASP C  1 86  ? 185.694 134.035 -140.980 1.00 56.94  ? 86   ASP C OD2   1 
ATOM   7621  N N     . LYS C  1 87  ? 184.213 135.282 -136.025 1.00 47.38  ? 87   LYS C N     1 
ATOM   7622  C CA    . LYS C  1 87  ? 183.792 136.229 -135.007 1.00 48.08  ? 87   LYS C CA    1 
ATOM   7623  C C     . LYS C  1 87  ? 184.024 135.693 -133.594 1.00 47.71  ? 87   LYS C C     1 
ATOM   7624  O O     . LYS C  1 87  ? 184.438 136.429 -132.682 1.00 47.62  ? 87   LYS C O     1 
ATOM   7625  C CB    . LYS C  1 87  ? 182.317 136.539 -135.206 1.00 50.51  ? 87   LYS C CB    1 
ATOM   7626  C CG    . LYS C  1 87  ? 181.776 137.593 -134.282 1.00 54.68  ? 87   LYS C CG    1 
ATOM   7627  C CD    . LYS C  1 87  ? 181.664 138.934 -134.978 1.00 60.19  ? 87   LYS C CD    1 
ATOM   7628  C CE    . LYS C  1 87  ? 183.008 139.433 -135.526 1.00 64.23  ? 87   LYS C CE    1 
ATOM   7629  N NZ    . LYS C  1 87  ? 183.419 138.813 -136.843 1.00 66.17  ? 87   LYS C NZ    1 
ATOM   7630  N N     . MET C  1 88  ? 183.745 134.409 -133.415 1.00 45.77  ? 88   MET C N     1 
ATOM   7631  C CA    . MET C  1 88  ? 183.921 133.781 -132.119 1.00 44.01  ? 88   MET C CA    1 
ATOM   7632  C C     . MET C  1 88  ? 185.392 133.861 -131.763 1.00 43.65  ? 88   MET C C     1 
ATOM   7633  O O     . MET C  1 88  ? 185.737 134.131 -130.611 1.00 43.08  ? 88   MET C O     1 
ATOM   7634  C CB    . MET C  1 88  ? 183.478 132.319 -132.177 1.00 42.62  ? 88   MET C CB    1 
ATOM   7635  C CG    . MET C  1 88  ? 183.329 131.646 -130.833 1.00 40.90  ? 88   MET C CG    1 
ATOM   7636  S SD    . MET C  1 88  ? 182.501 130.064 -130.975 1.00 40.56  ? 88   MET C SD    1 
ATOM   7637  C CE    . MET C  1 88  ? 180.710 130.579 -130.925 1.00 37.13  ? 88   MET C CE    1 
ATOM   7638  N N     . MET C  1 89  ? 186.251 133.635 -132.760 1.00 42.84  ? 89   MET C N     1 
ATOM   7639  C CA    . MET C  1 89  ? 187.700 133.659 -132.561 1.00 43.46  ? 89   MET C CA    1 
ATOM   7640  C C     . MET C  1 89  ? 188.171 135.055 -132.233 1.00 44.68  ? 89   MET C C     1 
ATOM   7641  O O     . MET C  1 89  ? 189.095 135.255 -131.437 1.00 45.32  ? 89   MET C O     1 
ATOM   7642  C CB    . MET C  1 89  ? 188.433 133.162 -133.809 1.00 42.38  ? 89   MET C CB    1 
ATOM   7643  C CG    . MET C  1 89  ? 188.364 131.651 -134.050 1.00 42.27  ? 89   MET C CG    1 
ATOM   7644  S SD    . MET C  1 89  ? 189.209 130.677 -132.786 1.00 39.68  ? 89   MET C SD    1 
ATOM   7645  C CE    . MET C  1 89  ? 189.136 129.048 -133.457 1.00 35.80  ? 89   MET C CE    1 
ATOM   7646  N N     . GLU C  1 90  ? 187.529 136.027 -132.855 1.00 45.21  ? 90   GLU C N     1 
ATOM   7647  C CA    . GLU C  1 90  ? 187.887 137.401 -132.613 1.00 47.39  ? 90   GLU C CA    1 
ATOM   7648  C C     . GLU C  1 90  ? 187.668 137.738 -131.148 1.00 46.29  ? 90   GLU C C     1 
ATOM   7649  O O     . GLU C  1 90  ? 188.543 138.306 -130.504 1.00 46.16  ? 90   GLU C O     1 
ATOM   7650  C CB    . GLU C  1 90  ? 187.050 138.314 -133.485 1.00 49.98  ? 90   GLU C CB    1 
ATOM   7651  C CG    . GLU C  1 90  ? 187.273 139.773 -133.208 1.00 54.82  ? 90   GLU C CG    1 
ATOM   7652  C CD    . GLU C  1 90  ? 186.382 140.617 -134.062 1.00 57.61  ? 90   GLU C CD    1 
ATOM   7653  O OE1   . GLU C  1 90  ? 186.051 140.152 -135.175 1.00 59.59  ? 90   GLU C OE1   1 
ATOM   7654  O OE2   . GLU C  1 90  ? 186.022 141.733 -133.632 1.00 60.19  ? 90   GLU C OE2   1 
ATOM   7655  N N     . GLN C  1 91  ? 186.492 137.391 -130.634 1.00 45.84  ? 91   GLN C N     1 
ATOM   7656  C CA    . GLN C  1 91  ? 186.153 137.642 -129.235 1.00 45.27  ? 91   GLN C CA    1 
ATOM   7657  C C     . GLN C  1 91  ? 187.275 137.087 -128.363 1.00 45.00  ? 91   GLN C C     1 
ATOM   7658  O O     . GLN C  1 91  ? 187.707 137.723 -127.400 1.00 44.75  ? 91   GLN C O     1 
ATOM   7659  C CB    . GLN C  1 91  ? 184.818 136.964 -128.896 1.00 45.99  ? 91   GLN C CB    1 
ATOM   7660  C CG    . GLN C  1 91  ? 184.215 137.298 -127.520 1.00 46.70  ? 91   GLN C CG    1 
ATOM   7661  C CD    . GLN C  1 91  ? 184.968 136.658 -126.358 1.00 46.47  ? 91   GLN C CD    1 
ATOM   7662  O OE1   . GLN C  1 91  ? 185.301 135.478 -126.404 1.00 45.59  ? 91   GLN C OE1   1 
ATOM   7663  N NE2   . GLN C  1 91  ? 185.232 137.438 -125.311 1.00 45.69  ? 91   GLN C NE2   1 
ATOM   7664  N N     . LYS C  1 92  ? 187.745 135.899 -128.725 1.00 44.04  ? 92   LYS C N     1 
ATOM   7665  C CA    . LYS C  1 92  ? 188.830 135.244 -128.017 1.00 43.75  ? 92   LYS C CA    1 
ATOM   7666  C C     . LYS C  1 92  ? 190.095 136.107 -128.074 1.00 44.03  ? 92   LYS C C     1 
ATOM   7667  O O     . LYS C  1 92  ? 190.677 136.460 -127.043 1.00 44.56  ? 92   LYS C O     1 
ATOM   7668  C CB    . LYS C  1 92  ? 189.105 133.878 -128.652 1.00 41.82  ? 92   LYS C CB    1 
ATOM   7669  C CG    . LYS C  1 92  ? 190.323 133.173 -128.111 1.00 41.07  ? 92   LYS C CG    1 
ATOM   7670  C CD    . LYS C  1 92  ? 190.873 132.140 -129.099 1.00 42.59  ? 92   LYS C CD    1 
ATOM   7671  C CE    . LYS C  1 92  ? 191.490 132.777 -130.350 1.00 41.66  ? 92   LYS C CE    1 
ATOM   7672  N NZ    . LYS C  1 92  ? 192.427 131.871 -131.091 1.00 40.63  ? 92   LYS C NZ    1 
ATOM   7673  N N     . SER C  1 93  ? 190.515 136.435 -129.293 1.00 44.95  ? 93   SER C N     1 
ATOM   7674  C CA    . SER C  1 93  ? 191.711 137.245 -129.532 1.00 43.98  ? 93   SER C CA    1 
ATOM   7675  C C     . SER C  1 93  ? 191.704 138.550 -128.764 1.00 43.22  ? 93   SER C C     1 
ATOM   7676  O O     . SER C  1 93  ? 192.712 138.949 -128.190 1.00 42.82  ? 93   SER C O     1 
ATOM   7677  C CB    . SER C  1 93  ? 191.845 137.550 -131.023 1.00 42.32  ? 93   SER C CB    1 
ATOM   7678  O OG    . SER C  1 93  ? 192.192 136.382 -131.720 1.00 42.95  ? 93   SER C OG    1 
ATOM   7679  N N     . THR C  1 94  ? 190.556 139.213 -128.779 1.00 43.75  ? 94   THR C N     1 
ATOM   7680  C CA    . THR C  1 94  ? 190.393 140.476 -128.096 1.00 45.13  ? 94   THR C CA    1 
ATOM   7681  C C     . THR C  1 94  ? 190.729 140.323 -126.626 1.00 46.39  ? 94   THR C C     1 
ATOM   7682  O O     . THR C  1 94  ? 191.486 141.120 -126.062 1.00 48.53  ? 94   THR C O     1 
ATOM   7683  C CB    . THR C  1 94  ? 188.959 140.984 -128.238 1.00 44.32  ? 94   THR C CB    1 
ATOM   7684  O OG1   . THR C  1 94  ? 188.722 141.314 -129.610 1.00 45.97  ? 94   THR C OG1   1 
ATOM   7685  C CG2   . THR C  1 94  ? 188.733 142.216 -127.375 1.00 42.65  ? 94   THR C CG2   1 
ATOM   7686  N N     . ALA C  1 95  ? 190.174 139.285 -126.016 1.00 45.89  ? 95   ALA C N     1 
ATOM   7687  C CA    . ALA C  1 95  ? 190.401 139.021 -124.609 1.00 45.81  ? 95   ALA C CA    1 
ATOM   7688  C C     . ALA C  1 95  ? 191.879 138.801 -124.298 1.00 45.42  ? 95   ALA C C     1 
ATOM   7689  O O     . ALA C  1 95  ? 192.407 139.367 -123.333 1.00 44.22  ? 95   ALA C O     1 
ATOM   7690  C CB    . ALA C  1 95  ? 189.575 137.824 -124.172 1.00 45.90  ? 95   ALA C CB    1 
ATOM   7691  N N     . VAL C  1 96  ? 192.548 137.994 -125.117 1.00 44.39  ? 96   VAL C N     1 
ATOM   7692  C CA    . VAL C  1 96  ? 193.971 137.720 -124.903 1.00 44.49  ? 96   VAL C CA    1 
ATOM   7693  C C     . VAL C  1 96  ? 194.770 139.008 -125.003 1.00 45.65  ? 96   VAL C C     1 
ATOM   7694  O O     . VAL C  1 96  ? 195.562 139.325 -124.117 1.00 46.43  ? 96   VAL C O     1 
ATOM   7695  C CB    . VAL C  1 96  ? 194.501 136.687 -125.919 1.00 42.38  ? 96   VAL C CB    1 
ATOM   7696  C CG1   . VAL C  1 96  ? 196.007 136.503 -125.766 1.00 39.36  ? 96   VAL C CG1   1 
ATOM   7697  C CG2   . VAL C  1 96  ? 193.787 135.364 -125.693 1.00 41.36  ? 96   VAL C CG2   1 
ATOM   7698  N N     . LYS C  1 97  ? 194.539 139.750 -126.080 1.00 46.17  ? 97   LYS C N     1 
ATOM   7699  C CA    . LYS C  1 97  ? 195.205 141.028 -126.331 1.00 47.46  ? 97   LYS C CA    1 
ATOM   7700  C C     . LYS C  1 97  ? 195.069 141.945 -125.106 1.00 46.63  ? 97   LYS C C     1 
ATOM   7701  O O     . LYS C  1 97  ? 196.061 142.424 -124.547 1.00 45.97  ? 97   LYS C O     1 
ATOM   7702  C CB    . LYS C  1 97  ? 194.565 141.684 -127.571 1.00 49.14  ? 97   LYS C CB    1 
ATOM   7703  C CG    . LYS C  1 97  ? 194.978 143.119 -127.884 1.00 51.40  ? 97   LYS C CG    1 
ATOM   7704  C CD    . LYS C  1 97  ? 196.287 143.187 -128.658 1.00 54.77  ? 97   LYS C CD    1 
ATOM   7705  C CE    . LYS C  1 97  ? 196.231 144.237 -129.782 1.00 55.56  ? 97   LYS C CE    1 
ATOM   7706  N NZ    . LYS C  1 97  ? 195.831 145.606 -129.328 1.00 56.94  ? 97   LYS C NZ    1 
ATOM   7707  N N     . ALA C  1 98  ? 193.827 142.171 -124.691 1.00 45.31  ? 98   ALA C N     1 
ATOM   7708  C CA    . ALA C  1 98  ? 193.549 143.025 -123.554 1.00 43.77  ? 98   ALA C CA    1 
ATOM   7709  C C     . ALA C  1 98  ? 194.361 142.625 -122.326 1.00 43.34  ? 98   ALA C C     1 
ATOM   7710  O O     . ALA C  1 98  ? 195.067 143.451 -121.743 1.00 44.83  ? 98   ALA C O     1 
ATOM   7711  C CB    . ALA C  1 98  ? 192.075 142.990 -123.238 1.00 42.38  ? 98   ALA C CB    1 
ATOM   7712  N N     . LEU C  1 99  ? 194.267 141.361 -121.934 1.00 41.40  ? 99   LEU C N     1 
ATOM   7713  C CA    . LEU C  1 99  ? 194.992 140.894 -120.771 1.00 40.67  ? 99   LEU C CA    1 
ATOM   7714  C C     . LEU C  1 99  ? 196.510 140.974 -120.944 1.00 40.84  ? 99   LEU C C     1 
ATOM   7715  O O     . LEU C  1 99  ? 197.224 141.181 -119.974 1.00 42.70  ? 99   LEU C O     1 
ATOM   7716  C CB    . LEU C  1 99  ? 194.566 139.464 -120.416 1.00 39.25  ? 99   LEU C CB    1 
ATOM   7717  C CG    . LEU C  1 99  ? 193.131 139.284 -119.936 1.00 37.91  ? 99   LEU C CG    1 
ATOM   7718  C CD1   . LEU C  1 99  ? 192.954 137.873 -119.433 1.00 37.27  ? 99   LEU C CD1   1 
ATOM   7719  C CD2   . LEU C  1 99  ? 192.825 140.274 -118.837 1.00 36.22  ? 99   LEU C CD2   1 
ATOM   7720  N N     . THR C  1 100 ? 197.014 140.820 -122.162 1.00 40.64  ? 100  THR C N     1 
ATOM   7721  C CA    . THR C  1 100 ? 198.462 140.894 -122.372 1.00 40.89  ? 100  THR C CA    1 
ATOM   7722  C C     . THR C  1 100 ? 198.956 142.324 -122.191 1.00 41.27  ? 100  THR C C     1 
ATOM   7723  O O     . THR C  1 100 ? 200.044 142.562 -121.655 1.00 40.80  ? 100  THR C O     1 
ATOM   7724  C CB    . THR C  1 100 ? 198.866 140.411 -123.782 1.00 40.71  ? 100  THR C CB    1 
ATOM   7725  O OG1   . THR C  1 100 ? 198.103 141.114 -124.775 1.00 40.26  ? 100  THR C OG1   1 
ATOM   7726  C CG2   . THR C  1 100 ? 198.626 138.926 -123.917 1.00 41.05  ? 100  THR C CG2   1 
ATOM   7727  N N     . GLY C  1 101 ? 198.146 143.273 -122.652 1.00 41.38  ? 101  GLY C N     1 
ATOM   7728  C CA    . GLY C  1 101 ? 198.509 144.664 -122.524 1.00 41.46  ? 101  GLY C CA    1 
ATOM   7729  C C     . GLY C  1 101 ? 198.423 145.025 -121.065 1.00 42.22  ? 101  GLY C C     1 
ATOM   7730  O O     . GLY C  1 101 ? 199.164 145.880 -120.564 1.00 42.32  ? 101  GLY C O     1 
ATOM   7731  N N     . GLY C  1 102 ? 197.506 144.343 -120.386 1.00 42.60  ? 102  GLY C N     1 
ATOM   7732  C CA    . GLY C  1 102 ? 197.296 144.562 -118.968 1.00 43.00  ? 102  GLY C CA    1 
ATOM   7733  C C     . GLY C  1 102 ? 198.542 144.256 -118.174 1.00 42.96  ? 102  GLY C C     1 
ATOM   7734  O O     . GLY C  1 102 ? 198.844 144.933 -117.197 1.00 42.93  ? 102  GLY C O     1 
ATOM   7735  N N     . ILE C  1 103 ? 199.271 143.230 -118.590 1.00 43.44  ? 103  ILE C N     1 
ATOM   7736  C CA    . ILE C  1 103 ? 200.490 142.875 -117.890 1.00 45.58  ? 103  ILE C CA    1 
ATOM   7737  C C     . ILE C  1 103 ? 201.533 143.928 -118.196 1.00 47.12  ? 103  ILE C C     1 
ATOM   7738  O O     . ILE C  1 103 ? 202.350 144.264 -117.343 1.00 47.61  ? 103  ILE C O     1 
ATOM   7739  C CB    . ILE C  1 103 ? 201.007 141.482 -118.299 1.00 45.23  ? 103  ILE C CB    1 
ATOM   7740  C CG1   . ILE C  1 103 ? 199.968 140.424 -117.903 1.00 44.64  ? 103  ILE C CG1   1 
ATOM   7741  C CG2   . ILE C  1 103 ? 202.347 141.200 -117.619 1.00 42.73  ? 103  ILE C CG2   1 
ATOM   7742  C CD1   . ILE C  1 103 ? 200.433 139.003 -118.078 1.00 46.13  ? 103  ILE C CD1   1 
ATOM   7743  N N     . ALA C  1 104 ? 201.483 144.457 -119.415 1.00 48.29  ? 104  ALA C N     1 
ATOM   7744  C CA    . ALA C  1 104 ? 202.400 145.506 -119.838 1.00 49.18  ? 104  ALA C CA    1 
ATOM   7745  C C     . ALA C  1 104 ? 202.232 146.722 -118.900 1.00 50.30  ? 104  ALA C C     1 
ATOM   7746  O O     . ALA C  1 104 ? 203.209 147.284 -118.377 1.00 48.90  ? 104  ALA C O     1 
ATOM   7747  C CB    . ALA C  1 104 ? 202.092 145.898 -121.284 1.00 47.50  ? 104  ALA C CB    1 
ATOM   7748  N N     . HIS C  1 105 ? 200.980 147.108 -118.676 1.00 51.72  ? 105  HIS C N     1 
ATOM   7749  C CA    . HIS C  1 105 ? 200.686 148.240 -117.818 1.00 53.10  ? 105  HIS C CA    1 
ATOM   7750  C C     . HIS C  1 105 ? 201.060 147.955 -116.363 1.00 52.50  ? 105  HIS C C     1 
ATOM   7751  O O     . HIS C  1 105 ? 201.623 148.803 -115.679 1.00 52.67  ? 105  HIS C O     1 
ATOM   7752  C CB    . HIS C  1 105 ? 199.203 148.591 -117.918 1.00 55.31  ? 105  HIS C CB    1 
ATOM   7753  C CG    . HIS C  1 105 ? 198.802 149.746 -117.055 1.00 59.87  ? 105  HIS C CG    1 
ATOM   7754  N ND1   . HIS C  1 105 ? 199.144 151.051 -117.347 1.00 62.40  ? 105  HIS C ND1   1 
ATOM   7755  C CD2   . HIS C  1 105 ? 198.102 149.789 -115.895 1.00 60.21  ? 105  HIS C CD2   1 
ATOM   7756  C CE1   . HIS C  1 105 ? 198.669 151.847 -116.404 1.00 63.13  ? 105  HIS C CE1   1 
ATOM   7757  N NE2   . HIS C  1 105 ? 198.033 151.106 -115.512 1.00 61.85  ? 105  HIS C NE2   1 
ATOM   7758  N N     . LEU C  1 106 ? 200.752 146.757 -115.891 1.00 51.50  ? 106  LEU C N     1 
ATOM   7759  C CA    . LEU C  1 106 ? 201.064 146.407 -114.516 1.00 51.62  ? 106  LEU C CA    1 
ATOM   7760  C C     . LEU C  1 106 ? 202.559 146.423 -114.270 1.00 51.19  ? 106  LEU C C     1 
ATOM   7761  O O     . LEU C  1 106 ? 203.013 146.781 -113.184 1.00 50.93  ? 106  LEU C O     1 
ATOM   7762  C CB    . LEU C  1 106 ? 200.487 145.031 -114.175 1.00 51.09  ? 106  LEU C CB    1 
ATOM   7763  C CG    . LEU C  1 106 ? 198.963 144.981 -114.084 1.00 49.66  ? 106  LEU C CG    1 
ATOM   7764  C CD1   . LEU C  1 106 ? 198.507 143.540 -114.014 1.00 50.20  ? 106  LEU C CD1   1 
ATOM   7765  C CD2   . LEU C  1 106 ? 198.505 145.762 -112.877 1.00 48.10  ? 106  LEU C CD2   1 
ATOM   7766  N N     . PHE C  1 107 ? 203.320 146.022 -115.279 1.00 51.37  ? 107  PHE C N     1 
ATOM   7767  C CA    . PHE C  1 107 ? 204.775 146.010 -115.177 1.00 51.47  ? 107  PHE C CA    1 
ATOM   7768  C C     . PHE C  1 107 ? 205.261 147.463 -115.068 1.00 51.60  ? 107  PHE C C     1 
ATOM   7769  O O     . PHE C  1 107 ? 206.127 147.771 -114.244 1.00 50.42  ? 107  PHE C O     1 
ATOM   7770  C CB    . PHE C  1 107 ? 205.389 145.297 -116.402 1.00 50.23  ? 107  PHE C CB    1 
ATOM   7771  C CG    . PHE C  1 107 ? 205.696 143.819 -116.174 1.00 50.20  ? 107  PHE C CG    1 
ATOM   7772  C CD1   . PHE C  1 107 ? 205.094 143.109 -115.132 1.00 50.96  ? 107  PHE C CD1   1 
ATOM   7773  C CD2   . PHE C  1 107 ? 206.575 143.136 -117.015 1.00 49.47  ? 107  PHE C CD2   1 
ATOM   7774  C CE1   . PHE C  1 107 ? 205.363 141.748 -114.938 1.00 49.62  ? 107  PHE C CE1   1 
ATOM   7775  C CE2   . PHE C  1 107 ? 206.849 141.784 -116.830 1.00 48.28  ? 107  PHE C CE2   1 
ATOM   7776  C CZ    . PHE C  1 107 ? 206.244 141.088 -115.794 1.00 49.05  ? 107  PHE C CZ    1 
ATOM   7777  N N     . LYS C  1 108 ? 204.673 148.346 -115.876 1.00 51.27  ? 108  LYS C N     1 
ATOM   7778  C CA    . LYS C  1 108 ? 205.019 149.769 -115.871 1.00 52.41  ? 108  LYS C CA    1 
ATOM   7779  C C     . LYS C  1 108 ? 204.676 150.408 -114.531 1.00 52.06  ? 108  LYS C C     1 
ATOM   7780  O O     . LYS C  1 108 ? 205.491 151.105 -113.922 1.00 51.19  ? 108  LYS C O     1 
ATOM   7781  C CB    . LYS C  1 108 ? 204.259 150.509 -116.980 1.00 54.72  ? 108  LYS C CB    1 
ATOM   7782  C CG    . LYS C  1 108 ? 204.415 152.037 -116.936 1.00 57.79  ? 108  LYS C CG    1 
ATOM   7783  C CD    . LYS C  1 108 ? 203.649 152.769 -118.062 1.00 59.63  ? 108  LYS C CD    1 
ATOM   7784  C CE    . LYS C  1 108 ? 204.157 152.403 -119.471 1.00 61.03  ? 108  LYS C CE    1 
ATOM   7785  N NZ    . LYS C  1 108 ? 203.560 153.259 -120.559 1.00 61.08  ? 108  LYS C NZ    1 
ATOM   7786  N N     . GLN C  1 109 ? 203.449 150.165 -114.088 1.00 51.14  ? 109  GLN C N     1 
ATOM   7787  C CA    . GLN C  1 109 ? 202.952 150.689 -112.834 1.00 50.82  ? 109  GLN C CA    1 
ATOM   7788  C C     . GLN C  1 109 ? 203.869 150.356 -111.659 1.00 51.57  ? 109  GLN C C     1 
ATOM   7789  O O     . GLN C  1 109 ? 204.205 151.228 -110.870 1.00 51.75  ? 109  GLN C O     1 
ATOM   7790  C CB    . GLN C  1 109 ? 201.554 150.140 -112.594 1.00 49.48  ? 109  GLN C CB    1 
ATOM   7791  C CG    . GLN C  1 109 ? 200.950 150.459 -111.249 1.00 49.99  ? 109  GLN C CG    1 
ATOM   7792  C CD    . GLN C  1 109 ? 199.582 149.815 -111.088 1.00 49.97  ? 109  GLN C CD    1 
ATOM   7793  O OE1   . GLN C  1 109 ? 198.694 150.007 -111.921 1.00 49.71  ? 109  GLN C OE1   1 
ATOM   7794  N NE2   . GLN C  1 109 ? 199.409 149.045 -110.025 1.00 47.60  ? 109  GLN C NE2   1 
ATOM   7795  N N     . ASN C  1 110 ? 204.285 149.102 -111.549 1.00 52.95  ? 110  ASN C N     1 
ATOM   7796  C CA    . ASN C  1 110 ? 205.157 148.691 -110.450 1.00 54.93  ? 110  ASN C CA    1 
ATOM   7797  C C     . ASN C  1 110 ? 206.634 148.865 -110.806 1.00 55.80  ? 110  ASN C C     1 
ATOM   7798  O O     . ASN C  1 110 ? 207.526 148.380 -110.105 1.00 55.70  ? 110  ASN C O     1 
ATOM   7799  C CB    . ASN C  1 110 ? 204.872 147.230 -110.059 1.00 54.88  ? 110  ASN C CB    1 
ATOM   7800  C CG    . ASN C  1 110 ? 203.442 147.018 -109.613 1.00 54.68  ? 110  ASN C CG    1 
ATOM   7801  O OD1   . ASN C  1 110 ? 203.095 147.258 -108.454 1.00 54.58  ? 110  ASN C OD1   1 
ATOM   7802  N ND2   . ASN C  1 110 ? 202.594 146.582 -110.542 1.00 54.47  ? 110  ASN C ND2   1 
ATOM   7803  N N     . LYS C  1 111 ? 206.881 149.555 -111.910 1.00 57.09  ? 111  LYS C N     1 
ATOM   7804  C CA    . LYS C  1 111 ? 208.240 149.833 -112.363 1.00 58.67  ? 111  LYS C CA    1 
ATOM   7805  C C     . LYS C  1 111 ? 209.145 148.613 -112.571 1.00 57.84  ? 111  LYS C C     1 
ATOM   7806  O O     . LYS C  1 111 ? 210.324 148.613 -112.219 1.00 57.42  ? 111  LYS C O     1 
ATOM   7807  C CB    . LYS C  1 111 ? 208.904 150.851 -111.414 1.00 60.50  ? 111  LYS C CB    1 
ATOM   7808  C CG    . LYS C  1 111 ? 208.244 152.242 -111.456 1.00 63.09  ? 111  LYS C CG    1 
ATOM   7809  C CD    . LYS C  1 111 ? 208.910 153.259 -110.527 1.00 65.21  ? 111  LYS C CD    1 
ATOM   7810  C CE    . LYS C  1 111 ? 208.098 154.549 -110.460 1.00 66.11  ? 111  LYS C CE    1 
ATOM   7811  N NZ    . LYS C  1 111 ? 206.696 154.304 -109.992 1.00 67.75  ? 111  LYS C NZ    1 
ATOM   7812  N N     . VAL C  1 112 ? 208.581 147.570 -113.158 1.00 57.83  ? 112  VAL C N     1 
ATOM   7813  C CA    . VAL C  1 112 ? 209.354 146.379 -113.454 1.00 57.13  ? 112  VAL C CA    1 
ATOM   7814  C C     . VAL C  1 112 ? 209.967 146.625 -114.821 1.00 56.41  ? 112  VAL C C     1 
ATOM   7815  O O     . VAL C  1 112 ? 209.300 147.144 -115.720 1.00 56.47  ? 112  VAL C O     1 
ATOM   7816  C CB    . VAL C  1 112 ? 208.450 145.126 -113.522 1.00 57.27  ? 112  VAL C CB    1 
ATOM   7817  C CG1   . VAL C  1 112 ? 209.222 143.945 -114.129 1.00 55.62  ? 112  VAL C CG1   1 
ATOM   7818  C CG2   . VAL C  1 112 ? 207.929 144.794 -112.124 1.00 56.06  ? 112  VAL C CG2   1 
ATOM   7819  N N     . VAL C  1 113 ? 211.233 146.263 -114.984 1.00 55.90  ? 113  VAL C N     1 
ATOM   7820  C CA    . VAL C  1 113 ? 211.882 146.462 -116.268 1.00 55.42  ? 113  VAL C CA    1 
ATOM   7821  C C     . VAL C  1 113 ? 211.689 145.235 -117.145 1.00 55.13  ? 113  VAL C C     1 
ATOM   7822  O O     . VAL C  1 113 ? 212.092 144.133 -116.779 1.00 54.50  ? 113  VAL C O     1 
ATOM   7823  C CB    . VAL C  1 113 ? 213.383 146.734 -116.099 1.00 55.73  ? 113  VAL C CB    1 
ATOM   7824  C CG1   . VAL C  1 113 ? 214.011 146.947 -117.459 1.00 53.68  ? 113  VAL C CG1   1 
ATOM   7825  C CG2   . VAL C  1 113 ? 213.600 147.960 -115.199 1.00 53.95  ? 113  VAL C CG2   1 
ATOM   7826  N N     . HIS C  1 114 ? 211.073 145.441 -118.306 1.00 55.23  ? 114  HIS C N     1 
ATOM   7827  C CA    . HIS C  1 114 ? 210.797 144.357 -119.247 1.00 55.65  ? 114  HIS C CA    1 
ATOM   7828  C C     . HIS C  1 114 ? 211.836 144.228 -120.373 1.00 56.63  ? 114  HIS C C     1 
ATOM   7829  O O     . HIS C  1 114 ? 212.015 145.127 -121.190 1.00 55.54  ? 114  HIS C O     1 
ATOM   7830  C CB    . HIS C  1 114 ? 209.376 144.541 -119.806 1.00 53.95  ? 114  HIS C CB    1 
ATOM   7831  C CG    . HIS C  1 114 ? 209.051 143.673 -120.985 1.00 52.08  ? 114  HIS C CG    1 
ATOM   7832  N ND1   . HIS C  1 114 ? 209.675 142.467 -121.227 1.00 51.11  ? 114  HIS C ND1   1 
ATOM   7833  C CD2   . HIS C  1 114 ? 208.141 143.831 -121.975 1.00 49.20  ? 114  HIS C CD2   1 
ATOM   7834  C CE1   . HIS C  1 114 ? 209.165 141.922 -122.317 1.00 50.79  ? 114  HIS C CE1   1 
ATOM   7835  N NE2   . HIS C  1 114 ? 208.232 142.730 -122.789 1.00 49.88  ? 114  HIS C NE2   1 
ATOM   7836  N N     . VAL C  1 115 ? 212.514 143.085 -120.394 1.00 58.51  ? 115  VAL C N     1 
ATOM   7837  C CA    . VAL C  1 115 ? 213.545 142.791 -121.379 1.00 60.72  ? 115  VAL C CA    1 
ATOM   7838  C C     . VAL C  1 115 ? 213.079 141.776 -122.427 1.00 62.98  ? 115  VAL C C     1 
ATOM   7839  O O     . VAL C  1 115 ? 212.829 140.617 -122.098 1.00 63.63  ? 115  VAL C O     1 
ATOM   7840  C CB    . VAL C  1 115 ? 214.794 142.214 -120.688 1.00 60.48  ? 115  VAL C CB    1 
ATOM   7841  C CG1   . VAL C  1 115 ? 215.885 141.983 -121.706 1.00 60.03  ? 115  VAL C CG1   1 
ATOM   7842  C CG2   . VAL C  1 115 ? 215.263 143.152 -119.577 1.00 60.61  ? 115  VAL C CG2   1 
ATOM   7843  N N     . ASN C  1 116 ? 212.980 142.202 -123.687 1.00 65.00  ? 116  ASN C N     1 
ATOM   7844  C CA    . ASN C  1 116 ? 212.553 141.314 -124.775 1.00 66.26  ? 116  ASN C CA    1 
ATOM   7845  C C     . ASN C  1 116 ? 213.726 140.522 -125.353 1.00 66.09  ? 116  ASN C C     1 
ATOM   7846  O O     . ASN C  1 116 ? 214.513 141.056 -126.137 1.00 65.95  ? 116  ASN C O     1 
ATOM   7847  C CB    . ASN C  1 116 ? 211.906 142.125 -125.898 1.00 68.29  ? 116  ASN C CB    1 
ATOM   7848  C CG    . ASN C  1 116 ? 211.470 141.259 -127.065 1.00 70.91  ? 116  ASN C CG    1 
ATOM   7849  O OD1   . ASN C  1 116 ? 210.406 140.636 -127.033 1.00 71.76  ? 116  ASN C OD1   1 
ATOM   7850  N ND2   . ASN C  1 116 ? 212.304 141.202 -128.104 1.00 72.43  ? 116  ASN C ND2   1 
ATOM   7851  N N     . GLY C  1 117 ? 213.827 139.251 -124.969 1.00 66.06  ? 117  GLY C N     1 
ATOM   7852  C CA    . GLY C  1 117 ? 214.907 138.401 -125.445 1.00 66.19  ? 117  GLY C CA    1 
ATOM   7853  C C     . GLY C  1 117 ? 214.884 136.988 -124.879 1.00 66.72  ? 117  GLY C C     1 
ATOM   7854  O O     . GLY C  1 117 ? 214.021 136.643 -124.069 1.00 66.99  ? 117  GLY C O     1 
ATOM   7855  N N     . TYR C  1 118 ? 215.834 136.162 -125.305 1.00 66.95  ? 118  TYR C N     1 
ATOM   7856  C CA    . TYR C  1 118 ? 215.912 134.783 -124.836 1.00 67.35  ? 118  TYR C CA    1 
ATOM   7857  C C     . TYR C  1 118 ? 217.031 134.695 -123.809 1.00 67.79  ? 118  TYR C C     1 
ATOM   7858  O O     . TYR C  1 118 ? 218.193 134.495 -124.157 1.00 68.38  ? 118  TYR C O     1 
ATOM   7859  C CB    . TYR C  1 118 ? 216.190 133.846 -126.014 1.00 67.31  ? 118  TYR C CB    1 
ATOM   7860  C CG    . TYR C  1 118 ? 215.964 132.366 -125.749 1.00 68.50  ? 118  TYR C CG    1 
ATOM   7861  C CD1   . TYR C  1 118 ? 216.779 131.650 -124.866 1.00 69.28  ? 118  TYR C CD1   1 
ATOM   7862  C CD2   . TYR C  1 118 ? 214.948 131.672 -126.411 1.00 69.33  ? 118  TYR C CD2   1 
ATOM   7863  C CE1   . TYR C  1 118 ? 216.586 130.275 -124.657 1.00 69.84  ? 118  TYR C CE1   1 
ATOM   7864  C CE2   . TYR C  1 118 ? 214.746 130.305 -126.209 1.00 69.31  ? 118  TYR C CE2   1 
ATOM   7865  C CZ    . TYR C  1 118 ? 215.565 129.614 -125.335 1.00 69.84  ? 118  TYR C CZ    1 
ATOM   7866  O OH    . TYR C  1 118 ? 215.353 128.264 -125.152 1.00 70.40  ? 118  TYR C OH    1 
ATOM   7867  N N     . GLY C  1 119 ? 216.671 134.850 -122.540 1.00 67.62  ? 119  GLY C N     1 
ATOM   7868  C CA    . GLY C  1 119 ? 217.652 134.802 -121.477 1.00 67.20  ? 119  GLY C CA    1 
ATOM   7869  C C     . GLY C  1 119 ? 218.356 133.476 -121.246 1.00 67.25  ? 119  GLY C C     1 
ATOM   7870  O O     . GLY C  1 119 ? 217.790 132.399 -121.444 1.00 67.35  ? 119  GLY C O     1 
ATOM   7871  N N     . LYS C  1 120 ? 219.617 133.578 -120.836 1.00 67.08  ? 120  LYS C N     1 
ATOM   7872  C CA    . LYS C  1 120 ? 220.451 132.430 -120.517 1.00 67.38  ? 120  LYS C CA    1 
ATOM   7873  C C     . LYS C  1 120 ? 221.290 132.833 -119.314 1.00 67.73  ? 120  LYS C C     1 
ATOM   7874  O O     . LYS C  1 120 ? 221.893 133.904 -119.302 1.00 68.24  ? 120  LYS C O     1 
ATOM   7875  C CB    . LYS C  1 120 ? 221.372 132.059 -121.689 1.00 67.08  ? 120  LYS C CB    1 
ATOM   7876  C CG    . LYS C  1 120 ? 222.428 131.003 -121.329 1.00 67.44  ? 120  LYS C CG    1 
ATOM   7877  C CD    . LYS C  1 120 ? 223.081 130.355 -122.565 1.00 68.28  ? 120  LYS C CD    1 
ATOM   7878  C CE    . LYS C  1 120 ? 224.109 129.270 -122.173 1.00 69.12  ? 120  LYS C CE    1 
ATOM   7879  N NZ    . LYS C  1 120 ? 224.518 128.370 -123.303 1.00 67.76  ? 120  LYS C NZ    1 
ATOM   7880  N N     . ILE C  1 121 ? 221.302 131.998 -118.285 1.00 67.85  ? 121  ILE C N     1 
ATOM   7881  C CA    . ILE C  1 121 ? 222.099 132.304 -117.110 1.00 67.65  ? 121  ILE C CA    1 
ATOM   7882  C C     . ILE C  1 121 ? 223.548 132.135 -117.528 1.00 67.91  ? 121  ILE C C     1 
ATOM   7883  O O     . ILE C  1 121 ? 224.037 131.013 -117.690 1.00 68.42  ? 121  ILE C O     1 
ATOM   7884  C CB    . ILE C  1 121 ? 221.769 131.355 -115.945 1.00 67.01  ? 121  ILE C CB    1 
ATOM   7885  C CG1   . ILE C  1 121 ? 220.330 131.607 -115.484 1.00 66.54  ? 121  ILE C CG1   1 
ATOM   7886  C CG2   . ILE C  1 121 ? 222.751 131.563 -114.801 1.00 66.13  ? 121  ILE C CG2   1 
ATOM   7887  C CD1   . ILE C  1 121 ? 219.813 130.588 -114.494 1.00 66.30  ? 121  ILE C CD1   1 
ATOM   7888  N N     . THR C  1 122 ? 224.218 133.266 -117.722 1.00 67.83  ? 122  THR C N     1 
ATOM   7889  C CA    . THR C  1 122 ? 225.612 133.286 -118.143 1.00 67.27  ? 122  THR C CA    1 
ATOM   7890  C C     . THR C  1 122 ? 226.594 133.342 -116.974 1.00 67.20  ? 122  THR C C     1 
ATOM   7891  O O     . THR C  1 122 ? 227.775 133.032 -117.127 1.00 67.74  ? 122  THR C O     1 
ATOM   7892  C CB    . THR C  1 122 ? 225.860 134.472 -119.083 1.00 66.61  ? 122  THR C CB    1 
ATOM   7893  O OG1   . THR C  1 122 ? 225.406 135.679 -118.463 1.00 66.46  ? 122  THR C OG1   1 
ATOM   7894  C CG2   . THR C  1 122 ? 225.102 134.276 -120.385 1.00 65.78  ? 122  THR C CG2   1 
ATOM   7895  N N     . GLY C  1 123 ? 226.097 133.725 -115.806 1.00 67.06  ? 123  GLY C N     1 
ATOM   7896  C CA    . GLY C  1 123 ? 226.942 133.801 -114.633 1.00 66.80  ? 123  GLY C CA    1 
ATOM   7897  C C     . GLY C  1 123 ? 226.151 133.521 -113.373 1.00 66.79  ? 123  GLY C C     1 
ATOM   7898  O O     . GLY C  1 123 ? 224.975 133.847 -113.284 1.00 65.95  ? 123  GLY C O     1 
ATOM   7899  N N     . LYS C  1 124 ? 226.804 132.909 -112.396 1.00 67.72  ? 124  LYS C N     1 
ATOM   7900  C CA    . LYS C  1 124 ? 226.169 132.580 -111.134 1.00 67.75  ? 124  LYS C CA    1 
ATOM   7901  C C     . LYS C  1 124 ? 225.412 133.781 -110.569 1.00 67.47  ? 124  LYS C C     1 
ATOM   7902  O O     . LYS C  1 124 ? 224.593 133.628 -109.670 1.00 67.75  ? 124  LYS C O     1 
ATOM   7903  C CB    . LYS C  1 124 ? 227.235 132.098 -110.143 1.00 69.34  ? 124  LYS C CB    1 
ATOM   7904  C CG    . LYS C  1 124 ? 226.688 131.561 -108.828 1.00 71.90  ? 124  LYS C CG    1 
ATOM   7905  C CD    . LYS C  1 124 ? 227.802 131.048 -107.893 1.00 72.82  ? 124  LYS C CD    1 
ATOM   7906  C CE    . LYS C  1 124 ? 227.244 130.553 -106.544 1.00 74.30  ? 124  LYS C CE    1 
ATOM   7907  N NZ    . LYS C  1 124 ? 228.309 130.111 -105.582 1.00 74.25  ? 124  LYS C NZ    1 
ATOM   7908  N N     . ASN C  1 125 ? 225.681 134.972 -111.101 1.00 66.70  ? 125  ASN C N     1 
ATOM   7909  C CA    . ASN C  1 125 ? 225.015 136.191 -110.648 1.00 66.01  ? 125  ASN C CA    1 
ATOM   7910  C C     . ASN C  1 125 ? 224.707 137.093 -111.835 1.00 65.64  ? 125  ASN C C     1 
ATOM   7911  O O     . ASN C  1 125 ? 224.459 138.291 -111.695 1.00 64.84  ? 125  ASN C O     1 
ATOM   7912  C CB    . ASN C  1 125 ? 225.891 136.923 -109.627 1.00 65.87  ? 125  ASN C CB    1 
ATOM   7913  C CG    . ASN C  1 125 ? 225.657 136.441 -108.203 1.00 66.23  ? 125  ASN C CG    1 
ATOM   7914  O OD1   . ASN C  1 125 ? 224.694 136.845 -107.551 1.00 67.23  ? 125  ASN C OD1   1 
ATOM   7915  N ND2   . ASN C  1 125 ? 226.529 135.560 -107.719 1.00 66.70  ? 125  ASN C ND2   1 
ATOM   7916  N N     . GLN C  1 126 ? 224.714 136.495 -113.015 1.00 65.97  ? 126  GLN C N     1 
ATOM   7917  C CA    . GLN C  1 126 ? 224.431 137.239 -114.224 1.00 67.24  ? 126  GLN C CA    1 
ATOM   7918  C C     . GLN C  1 126 ? 223.516 136.483 -115.203 1.00 66.92  ? 126  GLN C C     1 
ATOM   7919  O O     . GLN C  1 126 ? 223.484 135.253 -115.234 1.00 66.54  ? 126  GLN C O     1 
ATOM   7920  C CB    . GLN C  1 126 ? 225.744 137.609 -114.901 1.00 69.10  ? 126  GLN C CB    1 
ATOM   7921  C CG    . GLN C  1 126 ? 225.568 138.373 -116.193 1.00 73.03  ? 126  GLN C CG    1 
ATOM   7922  C CD    . GLN C  1 126 ? 226.867 138.515 -116.962 1.00 75.42  ? 126  GLN C CD    1 
ATOM   7923  O OE1   . GLN C  1 126 ? 227.685 139.417 -116.679 1.00 76.86  ? 126  GLN C OE1   1 
ATOM   7924  N NE2   . GLN C  1 126 ? 227.081 137.631 -117.920 1.00 75.49  ? 126  GLN C NE2   1 
ATOM   7925  N N     . VAL C  1 127 ? 222.765 137.234 -115.999 1.00 66.31  ? 127  VAL C N     1 
ATOM   7926  C CA    . VAL C  1 127 ? 221.848 136.645 -116.965 1.00 65.85  ? 127  VAL C CA    1 
ATOM   7927  C C     . VAL C  1 127 ? 221.951 137.451 -118.251 1.00 65.93  ? 127  VAL C C     1 
ATOM   7928  O O     . VAL C  1 127 ? 221.911 138.677 -118.215 1.00 65.49  ? 127  VAL C O     1 
ATOM   7929  C CB    . VAL C  1 127 ? 220.388 136.708 -116.448 1.00 65.09  ? 127  VAL C CB    1 
ATOM   7930  C CG1   . VAL C  1 127 ? 219.458 135.979 -117.392 1.00 63.47  ? 127  VAL C CG1   1 
ATOM   7931  C CG2   . VAL C  1 127 ? 220.306 136.112 -115.062 1.00 64.60  ? 127  VAL C CG2   1 
ATOM   7932  N N     . THR C  1 128 ? 222.091 136.772 -119.385 1.00 66.58  ? 128  THR C N     1 
ATOM   7933  C CA    . THR C  1 128 ? 222.198 137.472 -120.659 1.00 67.36  ? 128  THR C CA    1 
ATOM   7934  C C     . THR C  1 128 ? 221.032 137.166 -121.584 1.00 68.75  ? 128  THR C C     1 
ATOM   7935  O O     . THR C  1 128 ? 220.896 136.034 -122.055 1.00 69.06  ? 128  THR C O     1 
ATOM   7936  C CB    . THR C  1 128 ? 223.475 137.091 -121.422 1.00 66.55  ? 128  THR C CB    1 
ATOM   7937  O OG1   . THR C  1 128 ? 224.614 137.207 -120.559 1.00 64.97  ? 128  THR C OG1   1 
ATOM   7938  C CG2   . THR C  1 128 ? 223.641 138.001 -122.633 1.00 64.91  ? 128  THR C CG2   1 
ATOM   7939  N N     . ALA C  1 129 ? 220.206 138.176 -121.851 1.00 69.73  ? 129  ALA C N     1 
ATOM   7940  C CA    . ALA C  1 129 ? 219.058 138.024 -122.744 1.00 71.70  ? 129  ALA C CA    1 
ATOM   7941  C C     . ALA C  1 129 ? 219.461 138.450 -124.158 1.00 72.91  ? 129  ALA C C     1 
ATOM   7942  O O     . ALA C  1 129 ? 219.945 139.560 -124.367 1.00 73.96  ? 129  ALA C O     1 
ATOM   7943  C CB    . ALA C  1 129 ? 217.892 138.871 -122.252 1.00 71.09  ? 129  ALA C CB    1 
ATOM   7944  N N     . THR C  1 130 ? 219.254 137.571 -125.130 1.00 74.10  ? 130  THR C N     1 
ATOM   7945  C CA    . THR C  1 130 ? 219.630 137.866 -126.504 1.00 74.84  ? 130  THR C CA    1 
ATOM   7946  C C     . THR C  1 130 ? 218.419 138.179 -127.367 1.00 75.77  ? 130  THR C C     1 
ATOM   7947  O O     . THR C  1 130 ? 217.680 137.280 -127.743 1.00 74.82  ? 130  THR C O     1 
ATOM   7948  C CB    . THR C  1 130 ? 220.386 136.677 -127.118 1.00 74.27  ? 130  THR C CB    1 
ATOM   7949  O OG1   . THR C  1 130 ? 221.384 136.222 -126.197 1.00 74.26  ? 130  THR C OG1   1 
ATOM   7950  C CG2   . THR C  1 130 ? 221.068 137.090 -128.406 1.00 74.51  ? 130  THR C CG2   1 
ATOM   7951  N N     . LYS C  1 131 ? 218.231 139.459 -127.684 1.00 77.79  ? 131  LYS C N     1 
ATOM   7952  C CA    . LYS C  1 131 ? 217.106 139.904 -128.506 1.00 79.59  ? 131  LYS C CA    1 
ATOM   7953  C C     . LYS C  1 131 ? 216.998 139.149 -129.822 1.00 80.60  ? 131  LYS C C     1 
ATOM   7954  O O     . LYS C  1 131 ? 217.881 138.367 -130.194 1.00 80.67  ? 131  LYS C O     1 
ATOM   7955  C CB    . LYS C  1 131 ? 217.204 141.409 -128.797 1.00 80.25  ? 131  LYS C CB    1 
ATOM   7956  C CG    . LYS C  1 131 ? 216.992 142.302 -127.586 1.00 81.77  ? 131  LYS C CG    1 
ATOM   7957  C CD    . LYS C  1 131 ? 217.445 143.724 -127.859 1.00 83.03  ? 131  LYS C CD    1 
ATOM   7958  C CE    . LYS C  1 131 ? 217.395 144.561 -126.589 1.00 84.71  ? 131  LYS C CE    1 
ATOM   7959  N NZ    . LYS C  1 131 ? 217.985 145.921 -126.778 1.00 85.68  ? 131  LYS C NZ    1 
ATOM   7960  N N     . ALA C  1 132 ? 215.899 139.397 -130.524 1.00 81.47  ? 132  ALA C N     1 
ATOM   7961  C CA    . ALA C  1 132 ? 215.632 138.754 -131.801 1.00 82.17  ? 132  ALA C CA    1 
ATOM   7962  C C     . ALA C  1 132 ? 216.701 139.118 -132.820 1.00 82.43  ? 132  ALA C C     1 
ATOM   7963  O O     . ALA C  1 132 ? 217.404 138.251 -133.349 1.00 82.15  ? 132  ALA C O     1 
ATOM   7964  C CB    . ALA C  1 132 ? 214.257 139.179 -132.311 1.00 82.42  ? 132  ALA C CB    1 
ATOM   7965  N N     . ASP C  1 133 ? 216.817 140.417 -133.078 1.00 82.68  ? 133  ASP C N     1 
ATOM   7966  C CA    . ASP C  1 133 ? 217.773 140.944 -134.043 1.00 81.98  ? 133  ASP C CA    1 
ATOM   7967  C C     . ASP C  1 133 ? 219.228 140.538 -133.829 1.00 81.16  ? 133  ASP C C     1 
ATOM   7968  O O     . ASP C  1 133 ? 220.077 140.888 -134.642 1.00 81.26  ? 133  ASP C O     1 
ATOM   7969  C CB    . ASP C  1 133 ? 217.677 142.472 -134.095 1.00 82.49  ? 133  ASP C CB    1 
ATOM   7970  C CG    . ASP C  1 133 ? 217.873 143.116 -132.740 1.00 83.69  ? 133  ASP C CG    1 
ATOM   7971  O OD1   . ASP C  1 133 ? 218.967 142.974 -132.150 1.00 83.36  ? 133  ASP C OD1   1 
ATOM   7972  O OD2   . ASP C  1 133 ? 216.923 143.769 -132.264 1.00 85.10  ? 133  ASP C OD2   1 
ATOM   7973  N N     . GLY C  1 134 ? 219.518 139.802 -132.755 1.00 80.09  ? 134  GLY C N     1 
ATOM   7974  C CA    . GLY C  1 134 ? 220.888 139.380 -132.490 1.00 77.95  ? 134  GLY C CA    1 
ATOM   7975  C C     . GLY C  1 134 ? 221.544 140.169 -131.367 1.00 76.88  ? 134  GLY C C     1 
ATOM   7976  O O     . GLY C  1 134 ? 222.491 139.702 -130.724 1.00 76.40  ? 134  GLY C O     1 
ATOM   7977  N N     . GLY C  1 135 ? 221.036 141.375 -131.135 1.00 76.05  ? 135  GLY C N     1 
ATOM   7978  C CA    . GLY C  1 135 ? 221.570 142.213 -130.082 1.00 75.79  ? 135  GLY C CA    1 
ATOM   7979  C C     . GLY C  1 135 ? 221.396 141.518 -128.750 1.00 75.61  ? 135  GLY C C     1 
ATOM   7980  O O     . GLY C  1 135 ? 220.523 140.669 -128.605 1.00 75.62  ? 135  GLY C O     1 
ATOM   7981  N N     . THR C  1 136 ? 222.223 141.865 -127.774 1.00 74.98  ? 136  THR C N     1 
ATOM   7982  C CA    . THR C  1 136 ? 222.123 141.238 -126.473 1.00 74.39  ? 136  THR C CA    1 
ATOM   7983  C C     . THR C  1 136 ? 221.712 142.240 -125.405 1.00 74.50  ? 136  THR C C     1 
ATOM   7984  O O     . THR C  1 136 ? 221.281 143.350 -125.711 1.00 75.29  ? 136  THR C O     1 
ATOM   7985  C CB    . THR C  1 136 ? 223.454 140.599 -126.076 1.00 74.29  ? 136  THR C CB    1 
ATOM   7986  O OG1   . THR C  1 136 ? 224.471 141.606 -126.036 1.00 74.84  ? 136  THR C OG1   1 
ATOM   7987  C CG2   . THR C  1 136 ? 223.840 139.530 -127.083 1.00 73.39  ? 136  THR C CG2   1 
ATOM   7988  N N     . GLN C  1 137 ? 221.840 141.831 -124.149 1.00 74.02  ? 137  GLN C N     1 
ATOM   7989  C CA    . GLN C  1 137 ? 221.493 142.671 -123.015 1.00 73.31  ? 137  GLN C CA    1 
ATOM   7990  C C     . GLN C  1 137 ? 221.938 141.941 -121.774 1.00 73.23  ? 137  GLN C C     1 
ATOM   7991  O O     . GLN C  1 137 ? 221.507 140.818 -121.525 1.00 73.51  ? 137  GLN C O     1 
ATOM   7992  C CB    . GLN C  1 137 ? 219.991 142.903 -122.944 1.00 73.00  ? 137  GLN C CB    1 
ATOM   7993  C CG    . GLN C  1 137 ? 219.589 143.740 -121.759 1.00 72.95  ? 137  GLN C CG    1 
ATOM   7994  C CD    . GLN C  1 137 ? 220.177 145.127 -121.818 1.00 73.91  ? 137  GLN C CD    1 
ATOM   7995  O OE1   . GLN C  1 137 ? 219.837 145.919 -122.701 1.00 73.93  ? 137  GLN C OE1   1 
ATOM   7996  N NE2   . GLN C  1 137 ? 221.071 145.433 -120.881 1.00 74.03  ? 137  GLN C NE2   1 
ATOM   7997  N N     . VAL C  1 138 ? 222.802 142.572 -120.994 1.00 73.01  ? 138  VAL C N     1 
ATOM   7998  C CA    . VAL C  1 138 ? 223.296 141.935 -119.789 1.00 72.84  ? 138  VAL C CA    1 
ATOM   7999  C C     . VAL C  1 138 ? 222.664 142.497 -118.528 1.00 72.40  ? 138  VAL C C     1 
ATOM   8000  O O     . VAL C  1 138 ? 222.412 143.701 -118.418 1.00 72.42  ? 138  VAL C O     1 
ATOM   8001  C CB    . VAL C  1 138 ? 224.817 142.053 -119.698 1.00 73.50  ? 138  VAL C CB    1 
ATOM   8002  C CG1   . VAL C  1 138 ? 225.327 141.325 -118.463 1.00 72.33  ? 138  VAL C CG1   1 
ATOM   8003  C CG2   . VAL C  1 138 ? 225.439 141.469 -120.960 1.00 74.18  ? 138  VAL C CG2   1 
ATOM   8004  N N     . ILE C  1 139 ? 222.411 141.597 -117.582 1.00 71.00  ? 139  ILE C N     1 
ATOM   8005  C CA    . ILE C  1 139 ? 221.788 141.948 -116.321 1.00 69.98  ? 139  ILE C CA    1 
ATOM   8006  C C     . ILE C  1 139 ? 222.537 141.305 -115.166 1.00 69.32  ? 139  ILE C C     1 
ATOM   8007  O O     . ILE C  1 139 ? 222.639 140.080 -115.093 1.00 68.97  ? 139  ILE C O     1 
ATOM   8008  C CB    . ILE C  1 139 ? 220.334 141.439 -116.247 1.00 70.30  ? 139  ILE C CB    1 
ATOM   8009  C CG1   . ILE C  1 139 ? 219.559 141.795 -117.521 1.00 71.44  ? 139  ILE C CG1   1 
ATOM   8010  C CG2   . ILE C  1 139 ? 219.657 142.032 -115.038 1.00 70.52  ? 139  ILE C CG2   1 
ATOM   8011  C CD1   . ILE C  1 139 ? 219.380 143.284 -117.758 1.00 72.90  ? 139  ILE C CD1   1 
ATOM   8012  N N     . ASP C  1 140 ? 223.068 142.123 -114.267 1.00 68.66  ? 140  ASP C N     1 
ATOM   8013  C CA    . ASP C  1 140 ? 223.766 141.584 -113.109 1.00 68.63  ? 140  ASP C CA    1 
ATOM   8014  C C     . ASP C  1 140 ? 222.749 141.570 -111.994 1.00 66.72  ? 140  ASP C C     1 
ATOM   8015  O O     . ASP C  1 140 ? 222.100 142.582 -111.708 1.00 65.79  ? 140  ASP C O     1 
ATOM   8016  C CB    . ASP C  1 140 ? 224.970 142.446 -112.732 1.00 70.72  ? 140  ASP C CB    1 
ATOM   8017  C CG    . ASP C  1 140 ? 226.021 142.463 -113.816 1.00 72.16  ? 140  ASP C CG    1 
ATOM   8018  O OD1   . ASP C  1 140 ? 226.376 141.362 -114.297 1.00 71.34  ? 140  ASP C OD1   1 
ATOM   8019  O OD2   . ASP C  1 140 ? 226.483 143.572 -114.181 1.00 73.48  ? 140  ASP C OD2   1 
ATOM   8020  N N     . THR C  1 141 ? 222.613 140.421 -111.356 1.00 64.64  ? 141  THR C N     1 
ATOM   8021  C CA    . THR C  1 141 ? 221.611 140.302 -110.330 1.00 62.90  ? 141  THR C CA    1 
ATOM   8022  C C     . THR C  1 141 ? 222.057 139.468 -109.138 1.00 62.64  ? 141  THR C C     1 
ATOM   8023  O O     . THR C  1 141 ? 222.898 138.581 -109.257 1.00 62.24  ? 141  THR C O     1 
ATOM   8024  C CB    . THR C  1 141 ? 220.339 139.715 -110.970 1.00 61.85  ? 141  THR C CB    1 
ATOM   8025  O OG1   . THR C  1 141 ? 219.304 139.612 -109.996 1.00 61.51  ? 141  THR C OG1   1 
ATOM   8026  C CG2   . THR C  1 141 ? 220.634 138.344 -111.570 1.00 61.37  ? 141  THR C CG2   1 
ATOM   8027  N N     . LYS C  1 142 ? 221.497 139.778 -107.977 1.00 62.79  ? 142  LYS C N     1 
ATOM   8028  C CA    . LYS C  1 142 ? 221.820 139.040 -106.767 1.00 64.25  ? 142  LYS C CA    1 
ATOM   8029  C C     . LYS C  1 142 ? 221.089 137.694 -106.795 1.00 64.24  ? 142  LYS C C     1 
ATOM   8030  O O     . LYS C  1 142 ? 221.629 136.665 -106.382 1.00 64.62  ? 142  LYS C O     1 
ATOM   8031  C CB    . LYS C  1 142 ? 221.399 139.846 -105.534 1.00 64.30  ? 142  LYS C CB    1 
ATOM   8032  C CG    . LYS C  1 142 ? 222.114 141.168 -105.417 1.00 65.40  ? 142  LYS C CG    1 
ATOM   8033  C CD    . LYS C  1 142 ? 221.476 142.048 -104.375 1.00 66.97  ? 142  LYS C CD    1 
ATOM   8034  C CE    . LYS C  1 142 ? 222.044 143.453 -104.466 1.00 68.34  ? 142  LYS C CE    1 
ATOM   8035  N NZ    . LYS C  1 142 ? 221.956 143.956 -105.868 1.00 68.45  ? 142  LYS C NZ    1 
ATOM   8036  N N     . ASN C  1 143 ? 219.856 137.711 -107.298 1.00 63.46  ? 143  ASN C N     1 
ATOM   8037  C CA    . ASN C  1 143 ? 219.045 136.501 -107.385 1.00 61.69  ? 143  ASN C CA    1 
ATOM   8038  C C     . ASN C  1 143 ? 218.498 136.279 -108.792 1.00 60.96  ? 143  ASN C C     1 
ATOM   8039  O O     . ASN C  1 143 ? 218.166 137.231 -109.505 1.00 61.36  ? 143  ASN C O     1 
ATOM   8040  C CB    . ASN C  1 143 ? 217.859 136.582 -106.424 1.00 60.68  ? 143  ASN C CB    1 
ATOM   8041  C CG    . ASN C  1 143 ? 218.277 136.820 -105.001 1.00 59.62  ? 143  ASN C CG    1 
ATOM   8042  O OD1   . ASN C  1 143 ? 218.966 136.004 -104.397 1.00 59.74  ? 143  ASN C OD1   1 
ATOM   8043  N ND2   . ASN C  1 143 ? 217.858 137.946 -104.451 1.00 59.44  ? 143  ASN C ND2   1 
ATOM   8044  N N     . ILE C  1 144 ? 218.405 135.012 -109.182 1.00 59.05  ? 144  ILE C N     1 
ATOM   8045  C CA    . ILE C  1 144 ? 217.855 134.660 -110.480 1.00 56.68  ? 144  ILE C CA    1 
ATOM   8046  C C     . ILE C  1 144 ? 216.636 133.762 -110.225 1.00 55.02  ? 144  ILE C C     1 
ATOM   8047  O O     . ILE C  1 144 ? 216.712 132.794 -109.458 1.00 54.18  ? 144  ILE C O     1 
ATOM   8048  C CB    . ILE C  1 144 ? 218.880 133.899 -111.361 1.00 57.45  ? 144  ILE C CB    1 
ATOM   8049  C CG1   . ILE C  1 144 ? 220.178 134.705 -111.486 1.00 56.26  ? 144  ILE C CG1   1 
ATOM   8050  C CG2   . ILE C  1 144 ? 218.280 133.647 -112.746 1.00 56.81  ? 144  ILE C CG2   1 
ATOM   8051  C CD1   . ILE C  1 144 ? 221.295 133.954 -112.206 1.00 55.00  ? 144  ILE C CD1   1 
ATOM   8052  N N     . LEU C  1 145 ? 215.511 134.109 -110.846 1.00 52.45  ? 145  LEU C N     1 
ATOM   8053  C CA    . LEU C  1 145 ? 214.278 133.345 -110.703 1.00 49.36  ? 145  LEU C CA    1 
ATOM   8054  C C     . LEU C  1 145 ? 213.820 132.784 -112.048 1.00 48.73  ? 145  LEU C C     1 
ATOM   8055  O O     . LEU C  1 145 ? 213.397 133.518 -112.946 1.00 48.12  ? 145  LEU C O     1 
ATOM   8056  C CB    . LEU C  1 145 ? 213.185 134.221 -110.101 1.00 47.92  ? 145  LEU C CB    1 
ATOM   8057  C CG    . LEU C  1 145 ? 211.814 133.566 -109.961 1.00 47.04  ? 145  LEU C CG    1 
ATOM   8058  C CD1   . LEU C  1 145 ? 211.902 132.402 -109.002 1.00 45.86  ? 145  LEU C CD1   1 
ATOM   8059  C CD2   . LEU C  1 145 ? 210.807 134.588 -109.473 1.00 48.18  ? 145  LEU C CD2   1 
ATOM   8060  N N     . ILE C  1 146 ? 213.931 131.466 -112.168 1.00 48.57  ? 146  ILE C N     1 
ATOM   8061  C CA    . ILE C  1 146 ? 213.552 130.721 -113.367 1.00 48.23  ? 146  ILE C CA    1 
ATOM   8062  C C     . ILE C  1 146 ? 212.044 130.436 -113.363 1.00 47.63  ? 146  ILE C C     1 
ATOM   8063  O O     . ILE C  1 146 ? 211.564 129.706 -112.488 1.00 47.33  ? 146  ILE C O     1 
ATOM   8064  C CB    . ILE C  1 146 ? 214.296 129.357 -113.397 1.00 49.50  ? 146  ILE C CB    1 
ATOM   8065  C CG1   . ILE C  1 146 ? 215.803 129.582 -113.235 1.00 50.48  ? 146  ILE C CG1   1 
ATOM   8066  C CG2   . ILE C  1 146 ? 213.996 128.609 -114.687 1.00 49.11  ? 146  ILE C CG2   1 
ATOM   8067  C CD1   . ILE C  1 146 ? 216.608 128.315 -113.034 1.00 50.13  ? 146  ILE C CD1   1 
ATOM   8068  N N     . ALA C  1 147 ? 211.309 131.015 -114.318 1.00 46.11  ? 147  ALA C N     1 
ATOM   8069  C CA    . ALA C  1 147 ? 209.856 130.803 -114.443 1.00 45.38  ? 147  ALA C CA    1 
ATOM   8070  C C     . ALA C  1 147 ? 209.564 130.507 -115.907 1.00 44.50  ? 147  ALA C C     1 
ATOM   8071  O O     . ALA C  1 147 ? 208.571 130.973 -116.472 1.00 42.84  ? 147  ALA C O     1 
ATOM   8072  C CB    . ALA C  1 147 ? 209.079 132.045 -113.988 1.00 43.94  ? 147  ALA C CB    1 
ATOM   8073  N N     . THR C  1 148 ? 210.442 129.699 -116.493 1.00 44.50  ? 148  THR C N     1 
ATOM   8074  C CA    . THR C  1 148 ? 210.393 129.322 -117.906 1.00 45.43  ? 148  THR C CA    1 
ATOM   8075  C C     . THR C  1 148 ? 209.243 128.442 -118.377 1.00 45.19  ? 148  THR C C     1 
ATOM   8076  O O     . THR C  1 148 ? 209.048 128.269 -119.576 1.00 45.09  ? 148  THR C O     1 
ATOM   8077  C CB    . THR C  1 148 ? 211.724 128.672 -118.327 1.00 46.36  ? 148  THR C CB    1 
ATOM   8078  O OG1   . THR C  1 148 ? 212.107 127.688 -117.357 1.00 46.70  ? 148  THR C OG1   1 
ATOM   8079  C CG2   . THR C  1 148 ? 212.818 129.720 -118.405 1.00 47.14  ? 148  THR C CG2   1 
ATOM   8080  N N     . GLY C  1 149 ? 208.505 127.870 -117.435 1.00 44.91  ? 149  GLY C N     1 
ATOM   8081  C CA    . GLY C  1 149 ? 207.353 127.054 -117.775 1.00 44.13  ? 149  GLY C CA    1 
ATOM   8082  C C     . GLY C  1 149 ? 207.534 125.735 -118.504 1.00 43.68  ? 149  GLY C C     1 
ATOM   8083  O O     . GLY C  1 149 ? 208.502 125.006 -118.304 1.00 43.45  ? 149  GLY C O     1 
ATOM   8084  N N     . SER C  1 150 ? 206.571 125.440 -119.369 1.00 44.06  ? 150  SER C N     1 
ATOM   8085  C CA    . SER C  1 150 ? 206.548 124.197 -120.132 1.00 44.28  ? 150  SER C CA    1 
ATOM   8086  C C     . SER C  1 150 ? 206.260 124.389 -121.624 1.00 44.19  ? 150  SER C C     1 
ATOM   8087  O O     . SER C  1 150 ? 206.132 125.512 -122.113 1.00 42.81  ? 150  SER C O     1 
ATOM   8088  C CB    . SER C  1 150 ? 205.466 123.292 -119.554 1.00 44.28  ? 150  SER C CB    1 
ATOM   8089  O OG    . SER C  1 150 ? 204.207 123.934 -119.672 1.00 42.98  ? 150  SER C OG    1 
ATOM   8090  N N     . GLU C  1 151 ? 206.148 123.259 -122.321 1.00 45.12  ? 151  GLU C N     1 
ATOM   8091  C CA    . GLU C  1 151 ? 205.838 123.202 -123.751 1.00 46.24  ? 151  GLU C CA    1 
ATOM   8092  C C     . GLU C  1 151 ? 205.053 121.910 -123.974 1.00 46.62  ? 151  GLU C C     1 
ATOM   8093  O O     . GLU C  1 151 ? 205.045 121.032 -123.104 1.00 46.15  ? 151  GLU C O     1 
ATOM   8094  C CB    . GLU C  1 151 ? 207.114 123.148 -124.584 1.00 46.47  ? 151  GLU C CB    1 
ATOM   8095  C CG    . GLU C  1 151 ? 207.979 121.943 -124.260 1.00 48.93  ? 151  GLU C CG    1 
ATOM   8096  C CD    . GLU C  1 151 ? 209.178 121.814 -125.184 1.00 49.83  ? 151  GLU C CD    1 
ATOM   8097  O OE1   . GLU C  1 151 ? 209.284 122.621 -126.128 1.00 50.30  ? 151  GLU C OE1   1 
ATOM   8098  O OE2   . GLU C  1 151 ? 210.009 120.905 -124.967 1.00 50.58  ? 151  GLU C OE2   1 
ATOM   8099  N N     . VAL C  1 152 ? 204.402 121.785 -125.130 1.00 46.62  ? 152  VAL C N     1 
ATOM   8100  C CA    . VAL C  1 152 ? 203.636 120.580 -125.425 1.00 45.25  ? 152  VAL C CA    1 
ATOM   8101  C C     . VAL C  1 152 ? 204.584 119.397 -125.482 1.00 46.36  ? 152  VAL C C     1 
ATOM   8102  O O     . VAL C  1 152 ? 205.698 119.510 -125.986 1.00 46.06  ? 152  VAL C O     1 
ATOM   8103  C CB    . VAL C  1 152 ? 202.904 120.687 -126.781 1.00 44.94  ? 152  VAL C CB    1 
ATOM   8104  C CG1   . VAL C  1 152 ? 202.243 119.362 -127.137 1.00 42.62  ? 152  VAL C CG1   1 
ATOM   8105  C CG2   . VAL C  1 152 ? 201.857 121.784 -126.713 1.00 45.26  ? 152  VAL C CG2   1 
ATOM   8106  N N     . THR C  1 153 ? 204.152 118.270 -124.927 1.00 47.66  ? 153  THR C N     1 
ATOM   8107  C CA    . THR C  1 153 ? 204.948 117.046 -124.948 1.00 47.73  ? 153  THR C CA    1 
ATOM   8108  C C     . THR C  1 153 ? 204.644 116.388 -126.294 1.00 47.75  ? 153  THR C C     1 
ATOM   8109  O O     . THR C  1 153 ? 203.509 116.002 -126.564 1.00 48.71  ? 153  THR C O     1 
ATOM   8110  C CB    . THR C  1 153 ? 204.523 116.081 -123.834 1.00 46.95  ? 153  THR C CB    1 
ATOM   8111  O OG1   . THR C  1 153 ? 204.637 116.737 -122.569 1.00 48.20  ? 153  THR C OG1   1 
ATOM   8112  C CG2   . THR C  1 153 ? 205.395 114.846 -123.839 1.00 44.93  ? 153  THR C CG2   1 
ATOM   8113  N N     . PRO C  1 154 ? 205.649 116.250 -127.155 1.00 47.33  ? 154  PRO C N     1 
ATOM   8114  C CA    . PRO C  1 154 ? 205.366 115.631 -128.446 1.00 49.20  ? 154  PRO C CA    1 
ATOM   8115  C C     . PRO C  1 154 ? 205.073 114.131 -128.377 1.00 49.30  ? 154  PRO C C     1 
ATOM   8116  O O     . PRO C  1 154 ? 205.441 113.448 -127.421 1.00 49.78  ? 154  PRO C O     1 
ATOM   8117  C CB    . PRO C  1 154 ? 206.624 115.952 -129.250 1.00 48.00  ? 154  PRO C CB    1 
ATOM   8118  C CG    . PRO C  1 154 ? 207.680 115.839 -128.212 1.00 48.64  ? 154  PRO C CG    1 
ATOM   8119  C CD    . PRO C  1 154 ? 207.080 116.563 -127.025 1.00 47.37  ? 154  PRO C CD    1 
ATOM   8120  N N     . PHE C  1 155 ? 204.384 113.634 -129.393 1.00 50.04  ? 155  PHE C N     1 
ATOM   8121  C CA    . PHE C  1 155 ? 204.067 112.224 -129.473 1.00 51.38  ? 155  PHE C CA    1 
ATOM   8122  C C     . PHE C  1 155 ? 205.030 111.688 -130.523 1.00 52.43  ? 155  PHE C C     1 
ATOM   8123  O O     . PHE C  1 155 ? 204.943 112.038 -131.697 1.00 51.85  ? 155  PHE C O     1 
ATOM   8124  C CB    . PHE C  1 155 ? 202.629 112.038 -129.933 1.00 52.29  ? 155  PHE C CB    1 
ATOM   8125  C CG    . PHE C  1 155 ? 202.125 110.627 -129.808 1.00 54.26  ? 155  PHE C CG    1 
ATOM   8126  C CD1   . PHE C  1 155 ? 202.896 109.551 -130.229 1.00 55.63  ? 155  PHE C CD1   1 
ATOM   8127  C CD2   . PHE C  1 155 ? 200.853 110.378 -129.303 1.00 55.31  ? 155  PHE C CD2   1 
ATOM   8128  C CE1   . PHE C  1 155 ? 202.405 108.246 -130.153 1.00 56.85  ? 155  PHE C CE1   1 
ATOM   8129  C CE2   . PHE C  1 155 ? 200.350 109.079 -129.221 1.00 56.46  ? 155  PHE C CE2   1 
ATOM   8130  C CZ    . PHE C  1 155 ? 201.127 108.011 -129.647 1.00 56.86  ? 155  PHE C CZ    1 
ATOM   8131  N N     . PRO C  1 156 ? 205.971 110.833 -130.114 1.00 53.91  ? 156  PRO C N     1 
ATOM   8132  C CA    . PRO C  1 156 ? 206.941 110.275 -131.065 1.00 54.54  ? 156  PRO C CA    1 
ATOM   8133  C C     . PRO C  1 156 ? 206.260 109.647 -132.275 1.00 54.59  ? 156  PRO C C     1 
ATOM   8134  O O     . PRO C  1 156 ? 205.231 108.970 -132.145 1.00 54.07  ? 156  PRO C O     1 
ATOM   8135  C CB    . PRO C  1 156 ? 207.692 109.244 -130.231 1.00 55.66  ? 156  PRO C CB    1 
ATOM   8136  C CG    . PRO C  1 156 ? 207.571 109.804 -128.812 1.00 56.12  ? 156  PRO C CG    1 
ATOM   8137  C CD    . PRO C  1 156 ? 206.127 110.224 -128.784 1.00 54.80  ? 156  PRO C CD    1 
ATOM   8138  N N     . GLY C  1 157 ? 206.837 109.879 -133.450 1.00 53.87  ? 157  GLY C N     1 
ATOM   8139  C CA    . GLY C  1 157 ? 206.271 109.333 -134.668 1.00 52.98  ? 157  GLY C CA    1 
ATOM   8140  C C     . GLY C  1 157 ? 205.144 110.174 -135.246 1.00 52.22  ? 157  GLY C C     1 
ATOM   8141  O O     . GLY C  1 157 ? 204.739 109.965 -136.383 1.00 51.61  ? 157  GLY C O     1 
ATOM   8142  N N     . ILE C  1 158 ? 204.615 111.115 -134.472 1.00 51.45  ? 158  ILE C N     1 
ATOM   8143  C CA    . ILE C  1 158 ? 203.543 111.960 -134.983 1.00 50.24  ? 158  ILE C CA    1 
ATOM   8144  C C     . ILE C  1 158 ? 203.966 113.402 -134.873 1.00 50.53  ? 158  ILE C C     1 
ATOM   8145  O O     . ILE C  1 158 ? 203.977 113.968 -133.785 1.00 52.51  ? 158  ILE C O     1 
ATOM   8146  C CB    . ILE C  1 158 ? 202.233 111.788 -134.205 1.00 48.62  ? 158  ILE C CB    1 
ATOM   8147  C CG1   . ILE C  1 158 ? 201.765 110.332 -134.270 1.00 47.77  ? 158  ILE C CG1   1 
ATOM   8148  C CG2   . ILE C  1 158 ? 201.181 112.710 -134.794 1.00 47.67  ? 158  ILE C CG2   1 
ATOM   8149  C CD1   . ILE C  1 158 ? 200.521 110.053 -133.446 1.00 45.55  ? 158  ILE C CD1   1 
ATOM   8150  N N     . THR C  1 159 ? 204.304 113.999 -136.008 1.00 50.69  ? 159  THR C N     1 
ATOM   8151  C CA    . THR C  1 159 ? 204.747 115.382 -136.046 1.00 49.78  ? 159  THR C CA    1 
ATOM   8152  C C     . THR C  1 159 ? 203.608 116.404 -136.123 1.00 49.66  ? 159  THR C C     1 
ATOM   8153  O O     . THR C  1 159 ? 202.780 116.373 -137.038 1.00 48.81  ? 159  THR C O     1 
ATOM   8154  C CB    . THR C  1 159 ? 205.718 115.596 -137.225 1.00 50.24  ? 159  THR C CB    1 
ATOM   8155  O OG1   . THR C  1 159 ? 206.828 114.692 -137.092 1.00 50.01  ? 159  THR C OG1   1 
ATOM   8156  C CG2   . THR C  1 159 ? 206.234 117.042 -137.242 1.00 49.53  ? 159  THR C CG2   1 
ATOM   8157  N N     . ILE C  1 160 ? 203.581 117.306 -135.143 1.00 49.37  ? 160  ILE C N     1 
ATOM   8158  C CA    . ILE C  1 160 ? 202.566 118.347 -135.075 1.00 49.12  ? 160  ILE C CA    1 
ATOM   8159  C C     . ILE C  1 160 ? 202.921 119.432 -136.084 1.00 49.75  ? 160  ILE C C     1 
ATOM   8160  O O     . ILE C  1 160 ? 204.019 119.985 -136.043 1.00 49.02  ? 160  ILE C O     1 
ATOM   8161  C CB    . ILE C  1 160 ? 202.494 118.964 -133.652 1.00 48.15  ? 160  ILE C CB    1 
ATOM   8162  C CG1   . ILE C  1 160 ? 202.086 117.882 -132.643 1.00 47.29  ? 160  ILE C CG1   1 
ATOM   8163  C CG2   . ILE C  1 160 ? 201.528 120.143 -133.640 1.00 46.90  ? 160  ILE C CG2   1 
ATOM   8164  C CD1   . ILE C  1 160 ? 202.126 118.319 -131.189 1.00 46.77  ? 160  ILE C CD1   1 
ATOM   8165  N N     . ASP C  1 161 ? 202.000 119.724 -136.998 1.00 50.29  ? 161  ASP C N     1 
ATOM   8166  C CA    . ASP C  1 161 ? 202.244 120.746 -138.004 1.00 50.69  ? 161  ASP C CA    1 
ATOM   8167  C C     . ASP C  1 161 ? 201.344 121.946 -137.797 1.00 50.55  ? 161  ASP C C     1 
ATOM   8168  O O     . ASP C  1 161 ? 201.353 122.879 -138.597 1.00 51.76  ? 161  ASP C O     1 
ATOM   8169  C CB    . ASP C  1 161 ? 202.051 120.183 -139.418 1.00 52.37  ? 161  ASP C CB    1 
ATOM   8170  C CG    . ASP C  1 161 ? 200.635 119.702 -139.680 1.00 54.64  ? 161  ASP C CG    1 
ATOM   8171  O OD1   . ASP C  1 161 ? 199.672 120.447 -139.390 1.00 54.34  ? 161  ASP C OD1   1 
ATOM   8172  O OD2   . ASP C  1 161 ? 200.487 118.577 -140.203 1.00 56.23  ? 161  ASP C OD2   1 
ATOM   8173  N N     . GLU C  1 162 ? 200.569 121.906 -136.718 1.00 49.28  ? 162  GLU C N     1 
ATOM   8174  C CA    . GLU C  1 162 ? 199.652 122.978 -136.340 1.00 47.57  ? 162  GLU C CA    1 
ATOM   8175  C C     . GLU C  1 162 ? 198.665 123.419 -137.415 1.00 47.22  ? 162  GLU C C     1 
ATOM   8176  O O     . GLU C  1 162 ? 198.085 124.506 -137.332 1.00 46.13  ? 162  GLU C O     1 
ATOM   8177  C CB    . GLU C  1 162 ? 200.445 124.176 -135.815 1.00 47.14  ? 162  GLU C CB    1 
ATOM   8178  C CG    . GLU C  1 162 ? 201.307 123.845 -134.591 1.00 46.63  ? 162  GLU C CG    1 
ATOM   8179  C CD    . GLU C  1 162 ? 200.497 123.556 -133.322 1.00 47.28  ? 162  GLU C CD    1 
ATOM   8180  O OE1   . GLU C  1 162 ? 199.240 123.480 -133.389 1.00 44.34  ? 162  GLU C OE1   1 
ATOM   8181  O OE2   . GLU C  1 162 ? 201.135 123.403 -132.253 1.00 44.20  ? 162  GLU C OE2   1 
ATOM   8182  N N     . ASP C  1 163 ? 198.479 122.556 -138.412 1.00 47.18  ? 163  ASP C N     1 
ATOM   8183  C CA    . ASP C  1 163 ? 197.531 122.795 -139.495 1.00 47.82  ? 163  ASP C CA    1 
ATOM   8184  C C     . ASP C  1 163 ? 196.374 121.799 -139.332 1.00 47.09  ? 163  ASP C C     1 
ATOM   8185  O O     . ASP C  1 163 ? 195.262 122.173 -138.943 1.00 44.93  ? 163  ASP C O     1 
ATOM   8186  C CB    . ASP C  1 163 ? 198.200 122.589 -140.860 1.00 49.79  ? 163  ASP C CB    1 
ATOM   8187  C CG    . ASP C  1 163 ? 197.211 122.665 -142.011 1.00 50.11  ? 163  ASP C CG    1 
ATOM   8188  O OD1   . ASP C  1 163 ? 196.425 123.632 -142.062 1.00 51.22  ? 163  ASP C OD1   1 
ATOM   8189  O OD2   . ASP C  1 163 ? 197.217 121.757 -142.862 1.00 52.40  ? 163  ASP C OD2   1 
ATOM   8190  N N     . THR C  1 164 ? 196.652 120.530 -139.634 1.00 47.05  ? 164  THR C N     1 
ATOM   8191  C CA    . THR C  1 164 ? 195.661 119.459 -139.505 1.00 45.87  ? 164  THR C CA    1 
ATOM   8192  C C     . THR C  1 164 ? 196.019 118.553 -138.337 1.00 43.68  ? 164  THR C C     1 
ATOM   8193  O O     . THR C  1 164 ? 195.143 117.958 -137.721 1.00 43.08  ? 164  THR C O     1 
ATOM   8194  C CB    . THR C  1 164 ? 195.558 118.634 -140.787 1.00 46.99  ? 164  THR C CB    1 
ATOM   8195  O OG1   . THR C  1 164 ? 196.869 118.206 -141.200 1.00 48.48  ? 164  THR C OG1   1 
ATOM   8196  C CG2   . THR C  1 164 ? 194.901 119.478 -141.866 1.00 46.57  ? 164  THR C CG2   1 
ATOM   8197  N N     . ILE C  1 165 ? 197.312 118.449 -138.055 1.00 42.03  ? 165  ILE C N     1 
ATOM   8198  C CA    . ILE C  1 165 ? 197.806 117.681 -136.922 1.00 41.84  ? 165  ILE C CA    1 
ATOM   8199  C C     . ILE C  1 165 ? 198.293 118.760 -135.938 1.00 41.72  ? 165  ILE C C     1 
ATOM   8200  O O     . ILE C  1 165 ? 199.448 119.201 -135.965 1.00 41.34  ? 165  ILE C O     1 
ATOM   8201  C CB    . ILE C  1 165 ? 198.949 116.737 -137.330 1.00 41.41  ? 165  ILE C CB    1 
ATOM   8202  C CG1   . ILE C  1 165 ? 198.415 115.696 -138.306 1.00 42.99  ? 165  ILE C CG1   1 
ATOM   8203  C CG2   . ILE C  1 165 ? 199.472 115.979 -136.121 1.00 41.54  ? 165  ILE C CG2   1 
ATOM   8204  C CD1   . ILE C  1 165 ? 199.481 114.839 -138.920 1.00 42.15  ? 165  ILE C CD1   1 
ATOM   8205  N N     . VAL C  1 166 ? 197.373 119.183 -135.078 1.00 41.07  ? 166  VAL C N     1 
ATOM   8206  C CA    . VAL C  1 166 ? 197.623 120.238 -134.106 1.00 39.45  ? 166  VAL C CA    1 
ATOM   8207  C C     . VAL C  1 166 ? 197.888 119.854 -132.652 1.00 38.83  ? 166  VAL C C     1 
ATOM   8208  O O     . VAL C  1 166 ? 197.717 118.709 -132.219 1.00 38.31  ? 166  VAL C O     1 
ATOM   8209  C CB    . VAL C  1 166 ? 196.443 121.212 -134.068 1.00 38.92  ? 166  VAL C CB    1 
ATOM   8210  C CG1   . VAL C  1 166 ? 196.086 121.658 -135.486 1.00 36.03  ? 166  VAL C CG1   1 
ATOM   8211  C CG2   . VAL C  1 166 ? 195.260 120.549 -133.360 1.00 34.75  ? 166  VAL C CG2   1 
ATOM   8212  N N     . SER C  1 167 ? 198.311 120.864 -131.907 1.00 37.60  ? 167  SER C N     1 
ATOM   8213  C CA    . SER C  1 167 ? 198.560 120.726 -130.488 1.00 36.68  ? 167  SER C CA    1 
ATOM   8214  C C     . SER C  1 167 ? 197.447 121.587 -129.937 1.00 35.88  ? 167  SER C C     1 
ATOM   8215  O O     . SER C  1 167 ? 196.591 122.058 -130.694 1.00 34.95  ? 167  SER C O     1 
ATOM   8216  C CB    . SER C  1 167 ? 199.910 121.332 -130.094 1.00 35.03  ? 167  SER C CB    1 
ATOM   8217  O OG    . SER C  1 167 ? 199.860 122.744 -130.099 1.00 31.70  ? 167  SER C OG    1 
ATOM   8218  N N     . SER C  1 168 ? 197.466 121.797 -128.628 1.00 35.33  ? 168  SER C N     1 
ATOM   8219  C CA    . SER C  1 168 ? 196.464 122.629 -127.987 1.00 34.00  ? 168  SER C CA    1 
ATOM   8220  C C     . SER C  1 168 ? 196.478 124.017 -128.621 1.00 32.98  ? 168  SER C C     1 
ATOM   8221  O O     . SER C  1 168 ? 195.447 124.684 -128.700 1.00 31.91  ? 168  SER C O     1 
ATOM   8222  C CB    . SER C  1 168 ? 196.755 122.714 -126.490 1.00 32.31  ? 168  SER C CB    1 
ATOM   8223  O OG    . SER C  1 168 ? 198.137 122.859 -126.262 1.00 33.42  ? 168  SER C OG    1 
ATOM   8224  N N     . THR C  1 169 ? 197.650 124.432 -129.095 1.00 33.41  ? 169  THR C N     1 
ATOM   8225  C CA    . THR C  1 169 ? 197.810 125.741 -129.722 1.00 34.54  ? 169  THR C CA    1 
ATOM   8226  C C     . THR C  1 169 ? 197.082 125.845 -131.076 1.00 34.78  ? 169  THR C C     1 
ATOM   8227  O O     . THR C  1 169 ? 196.356 126.817 -131.337 1.00 33.12  ? 169  THR C O     1 
ATOM   8228  C CB    . THR C  1 169 ? 199.308 126.081 -129.920 1.00 35.88  ? 169  THR C CB    1 
ATOM   8229  O OG1   . THR C  1 169 ? 199.960 126.120 -128.646 1.00 34.80  ? 169  THR C OG1   1 
ATOM   8230  C CG2   . THR C  1 169 ? 199.468 127.437 -130.620 1.00 34.39  ? 169  THR C CG2   1 
ATOM   8231  N N     . GLY C  1 170 ? 197.288 124.859 -131.943 1.00 35.10  ? 170  GLY C N     1 
ATOM   8232  C CA    . GLY C  1 170 ? 196.607 124.887 -133.221 1.00 35.96  ? 170  GLY C CA    1 
ATOM   8233  C C     . GLY C  1 170 ? 195.118 124.691 -132.988 1.00 37.27  ? 170  GLY C C     1 
ATOM   8234  O O     . GLY C  1 170 ? 194.280 125.309 -133.642 1.00 37.28  ? 170  GLY C O     1 
ATOM   8235  N N     . ALA C  1 171 ? 194.784 123.831 -132.032 1.00 37.53  ? 171  ALA C N     1 
ATOM   8236  C CA    . ALA C  1 171 ? 193.390 123.550 -131.726 1.00 37.38  ? 171  ALA C CA    1 
ATOM   8237  C C     . ALA C  1 171 ? 192.630 124.814 -131.334 1.00 37.44  ? 171  ALA C C     1 
ATOM   8238  O O     . ALA C  1 171 ? 191.427 124.925 -131.585 1.00 37.62  ? 171  ALA C O     1 
ATOM   8239  C CB    . ALA C  1 171 ? 193.301 122.505 -130.619 1.00 35.91  ? 171  ALA C CB    1 
ATOM   8240  N N     . LEU C  1 172 ? 193.324 125.778 -130.743 1.00 36.91  ? 172  LEU C N     1 
ATOM   8241  C CA    . LEU C  1 172 ? 192.650 127.000 -130.332 1.00 37.91  ? 172  LEU C CA    1 
ATOM   8242  C C     . LEU C  1 172 ? 192.433 127.991 -131.455 1.00 39.45  ? 172  LEU C C     1 
ATOM   8243  O O     . LEU C  1 172 ? 191.786 129.012 -131.259 1.00 39.62  ? 172  LEU C O     1 
ATOM   8244  C CB    . LEU C  1 172 ? 193.403 127.658 -129.178 1.00 36.05  ? 172  LEU C CB    1 
ATOM   8245  C CG    . LEU C  1 172 ? 193.207 126.979 -127.810 1.00 36.88  ? 172  LEU C CG    1 
ATOM   8246  C CD1   . LEU C  1 172 ? 194.300 127.403 -126.858 1.00 37.01  ? 172  LEU C CD1   1 
ATOM   8247  C CD2   . LEU C  1 172 ? 191.867 127.339 -127.233 1.00 34.03  ? 172  LEU C CD2   1 
ATOM   8248  N N     . SER C  1 173 ? 192.947 127.677 -132.641 1.00 42.21  ? 173  SER C N     1 
ATOM   8249  C CA    . SER C  1 173 ? 192.798 128.561 -133.793 1.00 44.69  ? 173  SER C CA    1 
ATOM   8250  C C     . SER C  1 173 ? 192.438 127.855 -135.122 1.00 46.89  ? 173  SER C C     1 
ATOM   8251  O O     . SER C  1 173 ? 192.882 128.256 -136.201 1.00 47.94  ? 173  SER C O     1 
ATOM   8252  C CB    . SER C  1 173 ? 194.071 129.384 -133.948 1.00 43.37  ? 173  SER C CB    1 
ATOM   8253  O OG    . SER C  1 173 ? 194.174 130.309 -132.882 1.00 45.09  ? 173  SER C OG    1 
ATOM   8254  N N     . LEU C  1 174 ? 191.634 126.800 -135.037 1.00 48.31  ? 174  LEU C N     1 
ATOM   8255  C CA    . LEU C  1 174 ? 191.207 126.070 -136.229 1.00 49.48  ? 174  LEU C CA    1 
ATOM   8256  C C     . LEU C  1 174 ? 190.383 127.018 -137.091 1.00 50.03  ? 174  LEU C C     1 
ATOM   8257  O O     . LEU C  1 174 ? 189.470 127.670 -136.588 1.00 50.23  ? 174  LEU C O     1 
ATOM   8258  C CB    . LEU C  1 174 ? 190.358 124.860 -135.827 1.00 48.13  ? 174  LEU C CB    1 
ATOM   8259  C CG    . LEU C  1 174 ? 191.003 123.474 -135.808 1.00 46.99  ? 174  LEU C CG    1 
ATOM   8260  C CD1   . LEU C  1 174 ? 192.446 123.548 -135.377 1.00 47.22  ? 174  LEU C CD1   1 
ATOM   8261  C CD2   . LEU C  1 174 ? 190.193 122.580 -134.880 1.00 45.63  ? 174  LEU C CD2   1 
ATOM   8262  N N     . LYS C  1 175 ? 190.697 127.086 -138.383 1.00 51.39  ? 175  LYS C N     1 
ATOM   8263  C CA    . LYS C  1 175 ? 190.000 127.984 -139.306 1.00 52.43  ? 175  LYS C CA    1 
ATOM   8264  C C     . LYS C  1 175 ? 188.601 127.538 -139.704 1.00 52.06  ? 175  LYS C C     1 
ATOM   8265  O O     . LYS C  1 175 ? 187.762 128.346 -140.097 1.00 51.51  ? 175  LYS C O     1 
ATOM   8266  C CB    . LYS C  1 175 ? 190.861 128.198 -140.555 1.00 54.07  ? 175  LYS C CB    1 
ATOM   8267  C CG    . LYS C  1 175 ? 192.055 129.121 -140.311 1.00 56.88  ? 175  LYS C CG    1 
ATOM   8268  C CD    . LYS C  1 175 ? 191.586 130.541 -139.953 1.00 60.08  ? 175  LYS C CD    1 
ATOM   8269  C CE    . LYS C  1 175 ? 192.750 131.444 -139.520 1.00 62.47  ? 175  LYS C CE    1 
ATOM   8270  N NZ    . LYS C  1 175 ? 193.477 130.938 -138.301 1.00 61.36  ? 175  LYS C NZ    1 
ATOM   8271  N N     . LYS C  1 176 ? 188.354 126.243 -139.599 1.00 52.62  ? 176  LYS C N     1 
ATOM   8272  C CA    . LYS C  1 176 ? 187.051 125.677 -139.935 1.00 53.51  ? 176  LYS C CA    1 
ATOM   8273  C C     . LYS C  1 176 ? 186.693 124.622 -138.893 1.00 51.71  ? 176  LYS C C     1 
ATOM   8274  O O     . LYS C  1 176 ? 187.571 124.010 -138.287 1.00 50.94  ? 176  LYS C O     1 
ATOM   8275  C CB    . LYS C  1 176 ? 187.086 125.014 -141.330 1.00 56.42  ? 176  LYS C CB    1 
ATOM   8276  C CG    . LYS C  1 176 ? 186.832 125.943 -142.526 1.00 61.36  ? 176  LYS C CG    1 
ATOM   8277  C CD    . LYS C  1 176 ? 185.342 126.288 -142.701 1.00 64.24  ? 176  LYS C CD    1 
ATOM   8278  C CE    . LYS C  1 176 ? 185.058 126.964 -144.058 1.00 65.53  ? 176  LYS C CE    1 
ATOM   8279  N NZ    . LYS C  1 176 ? 183.588 127.175 -144.306 1.00 66.25  ? 176  LYS C NZ    1 
ATOM   8280  N N     . VAL C  1 177 ? 185.405 124.416 -138.668 1.00 49.64  ? 177  VAL C N     1 
ATOM   8281  C CA    . VAL C  1 177 ? 184.995 123.388 -137.735 1.00 47.84  ? 177  VAL C CA    1 
ATOM   8282  C C     . VAL C  1 177 ? 185.313 122.066 -138.455 1.00 47.88  ? 177  VAL C C     1 
ATOM   8283  O O     . VAL C  1 177 ? 184.778 121.801 -139.532 1.00 47.99  ? 177  VAL C O     1 
ATOM   8284  C CB    . VAL C  1 177 ? 183.484 123.490 -137.452 1.00 46.14  ? 177  VAL C CB    1 
ATOM   8285  C CG1   . VAL C  1 177 ? 183.040 122.349 -136.568 1.00 44.74  ? 177  VAL C CG1   1 
ATOM   8286  C CG2   . VAL C  1 177 ? 183.175 124.825 -136.806 1.00 44.65  ? 177  VAL C CG2   1 
ATOM   8287  N N     . PRO C  1 178 ? 186.216 121.238 -137.898 1.00 47.45  ? 178  PRO C N     1 
ATOM   8288  C CA    . PRO C  1 178 ? 186.499 119.981 -138.605 1.00 47.10  ? 178  PRO C CA    1 
ATOM   8289  C C     . PRO C  1 178 ? 185.314 119.021 -138.561 1.00 47.15  ? 178  PRO C C     1 
ATOM   8290  O O     . PRO C  1 178 ? 184.540 119.027 -137.610 1.00 46.42  ? 178  PRO C O     1 
ATOM   8291  C CB    . PRO C  1 178 ? 187.728 119.440 -137.879 1.00 46.29  ? 178  PRO C CB    1 
ATOM   8292  C CG    . PRO C  1 178 ? 187.581 120.002 -136.485 1.00 46.73  ? 178  PRO C CG    1 
ATOM   8293  C CD    . PRO C  1 178 ? 187.102 121.409 -136.731 1.00 46.35  ? 178  PRO C CD    1 
ATOM   8294  N N     . GLU C  1 179 ? 185.164 118.197 -139.589 1.00 47.59  ? 179  GLU C N     1 
ATOM   8295  C CA    . GLU C  1 179 ? 184.054 117.268 -139.602 1.00 47.96  ? 179  GLU C CA    1 
ATOM   8296  C C     . GLU C  1 179 ? 184.289 116.208 -138.531 1.00 47.55  ? 179  GLU C C     1 
ATOM   8297  O O     . GLU C  1 179 ? 183.420 115.938 -137.695 1.00 46.19  ? 179  GLU C O     1 
ATOM   8298  C CB    . GLU C  1 179 ? 183.923 116.613 -140.970 1.00 50.32  ? 179  GLU C CB    1 
ATOM   8299  C CG    . GLU C  1 179 ? 182.543 116.006 -141.204 1.00 55.19  ? 179  GLU C CG    1 
ATOM   8300  C CD    . GLU C  1 179 ? 182.500 115.018 -142.369 1.00 58.36  ? 179  GLU C CD    1 
ATOM   8301  O OE1   . GLU C  1 179 ? 183.557 114.797 -143.008 1.00 59.95  ? 179  GLU C OE1   1 
ATOM   8302  O OE2   . GLU C  1 179 ? 181.408 114.459 -142.638 1.00 58.70  ? 179  GLU C OE2   1 
ATOM   8303  N N     . LYS C  1 180 ? 185.463 115.595 -138.567 1.00 46.49  ? 180  LYS C N     1 
ATOM   8304  C CA    . LYS C  1 180 ? 185.798 114.592 -137.578 1.00 47.08  ? 180  LYS C CA    1 
ATOM   8305  C C     . LYS C  1 180 ? 187.083 114.988 -136.917 1.00 46.13  ? 180  LYS C C     1 
ATOM   8306  O O     . LYS C  1 180 ? 187.995 115.476 -137.574 1.00 45.92  ? 180  LYS C O     1 
ATOM   8307  C CB    . LYS C  1 180 ? 185.970 113.209 -138.197 1.00 48.68  ? 180  LYS C CB    1 
ATOM   8308  C CG    . LYS C  1 180 ? 184.678 112.420 -138.293 1.00 52.18  ? 180  LYS C CG    1 
ATOM   8309  C CD    . LYS C  1 180 ? 184.915 110.896 -138.402 1.00 54.71  ? 180  LYS C CD    1 
ATOM   8310  C CE    . LYS C  1 180 ? 185.494 110.275 -137.122 1.00 55.30  ? 180  LYS C CE    1 
ATOM   8311  N NZ    . LYS C  1 180 ? 185.522 108.776 -137.189 1.00 57.06  ? 180  LYS C NZ    1 
ATOM   8312  N N     . MET C  1 181 ? 187.151 114.788 -135.607 1.00 44.87  ? 181  MET C N     1 
ATOM   8313  C CA    . MET C  1 181 ? 188.346 115.125 -134.872 1.00 42.44  ? 181  MET C CA    1 
ATOM   8314  C C     . MET C  1 181 ? 188.635 114.080 -133.811 1.00 40.78  ? 181  MET C C     1 
ATOM   8315  O O     . MET C  1 181 ? 187.758 113.673 -133.053 1.00 40.18  ? 181  MET C O     1 
ATOM   8316  C CB    . MET C  1 181 ? 188.221 116.508 -134.220 1.00 43.51  ? 181  MET C CB    1 
ATOM   8317  C CG    . MET C  1 181 ? 189.466 116.891 -133.387 1.00 46.40  ? 181  MET C CG    1 
ATOM   8318  S SD    . MET C  1 181 ? 189.482 118.508 -132.542 1.00 47.78  ? 181  MET C SD    1 
ATOM   8319  C CE    . MET C  1 181 ? 187.894 118.464 -131.708 1.00 49.40  ? 181  MET C CE    1 
ATOM   8320  N N     . VAL C  1 182 ? 189.882 113.636 -133.790 1.00 38.37  ? 182  VAL C N     1 
ATOM   8321  C CA    . VAL C  1 182 ? 190.329 112.669 -132.823 1.00 36.29  ? 182  VAL C CA    1 
ATOM   8322  C C     . VAL C  1 182 ? 191.253 113.437 -131.907 1.00 36.18  ? 182  VAL C C     1 
ATOM   8323  O O     . VAL C  1 182 ? 192.053 114.252 -132.366 1.00 34.52  ? 182  VAL C O     1 
ATOM   8324  C CB    . VAL C  1 182 ? 191.118 111.529 -133.479 1.00 35.59  ? 182  VAL C CB    1 
ATOM   8325  C CG1   . VAL C  1 182 ? 191.736 110.661 -132.419 1.00 34.64  ? 182  VAL C CG1   1 
ATOM   8326  C CG2   . VAL C  1 182 ? 190.208 110.704 -134.342 1.00 34.57  ? 182  VAL C CG2   1 
ATOM   8327  N N     . VAL C  1 183 ? 191.117 113.190 -130.607 1.00 36.59  ? 183  VAL C N     1 
ATOM   8328  C CA    . VAL C  1 183 ? 191.946 113.836 -129.596 1.00 35.06  ? 183  VAL C CA    1 
ATOM   8329  C C     . VAL C  1 183 ? 192.757 112.743 -128.942 1.00 34.60  ? 183  VAL C C     1 
ATOM   8330  O O     . VAL C  1 183 ? 192.201 111.741 -128.489 1.00 32.91  ? 183  VAL C O     1 
ATOM   8331  C CB    . VAL C  1 183 ? 191.110 114.493 -128.491 1.00 35.06  ? 183  VAL C CB    1 
ATOM   8332  C CG1   . VAL C  1 183 ? 192.032 115.078 -127.444 1.00 36.37  ? 183  VAL C CG1   1 
ATOM   8333  C CG2   . VAL C  1 183 ? 190.222 115.563 -129.067 1.00 34.13  ? 183  VAL C CG2   1 
ATOM   8334  N N     . ILE C  1 184 ? 194.072 112.914 -128.909 1.00 34.87  ? 184  ILE C N     1 
ATOM   8335  C CA    . ILE C  1 184 ? 194.895 111.907 -128.256 1.00 35.01  ? 184  ILE C CA    1 
ATOM   8336  C C     . ILE C  1 184 ? 195.061 112.394 -126.828 1.00 35.53  ? 184  ILE C C     1 
ATOM   8337  O O     . ILE C  1 184 ? 195.692 113.429 -126.610 1.00 35.38  ? 184  ILE C O     1 
ATOM   8338  C CB    . ILE C  1 184 ? 196.292 111.779 -128.883 1.00 34.03  ? 184  ILE C CB    1 
ATOM   8339  C CG1   . ILE C  1 184 ? 196.173 111.597 -130.399 1.00 36.08  ? 184  ILE C CG1   1 
ATOM   8340  C CG2   . ILE C  1 184 ? 197.027 110.596 -128.248 1.00 32.41  ? 184  ILE C CG2   1 
ATOM   8341  C CD1   . ILE C  1 184 ? 197.493 111.387 -131.129 1.00 33.45  ? 184  ILE C CD1   1 
ATOM   8342  N N     . GLY C  1 185 ? 194.477 111.656 -125.877 1.00 34.94  ? 185  GLY C N     1 
ATOM   8343  C CA    . GLY C  1 185 ? 194.546 112.014 -124.464 1.00 35.26  ? 185  GLY C CA    1 
ATOM   8344  C C     . GLY C  1 185 ? 193.255 112.623 -123.919 1.00 35.31  ? 185  GLY C C     1 
ATOM   8345  O O     . GLY C  1 185 ? 192.736 113.577 -124.511 1.00 35.65  ? 185  GLY C O     1 
ATOM   8346  N N     . ALA C  1 186 ? 192.747 112.088 -122.797 1.00 32.84  ? 186  ALA C N     1 
ATOM   8347  C CA    . ALA C  1 186 ? 191.508 112.568 -122.180 1.00 31.08  ? 186  ALA C CA    1 
ATOM   8348  C C     . ALA C  1 186 ? 191.755 113.304 -120.881 1.00 31.58  ? 186  ALA C C     1 
ATOM   8349  O O     . ALA C  1 186 ? 191.050 113.083 -119.892 1.00 30.41  ? 186  ALA C O     1 
ATOM   8350  C CB    . ALA C  1 186 ? 190.584 111.424 -121.918 1.00 31.64  ? 186  ALA C CB    1 
ATOM   8351  N N     . GLY C  1 187 ? 192.773 114.157 -120.884 1.00 31.24  ? 187  GLY C N     1 
ATOM   8352  C CA    . GLY C  1 187 ? 193.095 114.938 -119.710 1.00 31.47  ? 187  GLY C CA    1 
ATOM   8353  C C     . GLY C  1 187 ? 192.225 116.170 -119.770 1.00 32.31  ? 187  GLY C C     1 
ATOM   8354  O O     . GLY C  1 187 ? 191.396 116.300 -120.680 1.00 32.47  ? 187  GLY C O     1 
ATOM   8355  N N     . VAL C  1 188 ? 192.416 117.086 -118.830 1.00 32.03  ? 188  VAL C N     1 
ATOM   8356  C CA    . VAL C  1 188 ? 191.603 118.295 -118.784 1.00 31.82  ? 188  VAL C CA    1 
ATOM   8357  C C     . VAL C  1 188 ? 191.630 119.111 -120.069 1.00 31.23  ? 188  VAL C C     1 
ATOM   8358  O O     . VAL C  1 188 ? 190.593 119.504 -120.600 1.00 29.66  ? 188  VAL C O     1 
ATOM   8359  C CB    . VAL C  1 188 ? 192.046 119.195 -117.603 1.00 32.31  ? 188  VAL C CB    1 
ATOM   8360  C CG1   . VAL C  1 188 ? 191.171 120.449 -117.533 1.00 29.38  ? 188  VAL C CG1   1 
ATOM   8361  C CG2   . VAL C  1 188 ? 191.978 118.400 -116.304 1.00 29.71  ? 188  VAL C CG2   1 
ATOM   8362  N N     . ILE C  1 189 ? 192.832 119.371 -120.557 1.00 32.39  ? 189  ILE C N     1 
ATOM   8363  C CA    . ILE C  1 189 ? 192.996 120.158 -121.763 1.00 32.60  ? 189  ILE C CA    1 
ATOM   8364  C C     . ILE C  1 189 ? 192.306 119.499 -122.945 1.00 33.22  ? 189  ILE C C     1 
ATOM   8365  O O     . ILE C  1 189 ? 191.604 120.163 -123.718 1.00 33.46  ? 189  ILE C O     1 
ATOM   8366  C CB    . ILE C  1 189 ? 194.498 120.368 -122.076 1.00 32.41  ? 189  ILE C CB    1 
ATOM   8367  C CG1   . ILE C  1 189 ? 195.150 121.169 -120.941 1.00 30.63  ? 189  ILE C CG1   1 
ATOM   8368  C CG2   . ILE C  1 189 ? 194.661 121.071 -123.434 1.00 32.84  ? 189  ILE C CG2   1 
ATOM   8369  C CD1   . ILE C  1 189 ? 196.654 121.383 -121.095 1.00 30.95  ? 189  ILE C CD1   1 
ATOM   8370  N N     . GLY C  1 190 ? 192.491 118.187 -123.074 1.00 33.12  ? 190  GLY C N     1 
ATOM   8371  C CA    . GLY C  1 190 ? 191.889 117.466 -124.182 1.00 31.94  ? 190  GLY C CA    1 
ATOM   8372  C C     . GLY C  1 190 ? 190.373 117.445 -124.161 1.00 31.54  ? 190  GLY C C     1 
ATOM   8373  O O     . GLY C  1 190 ? 189.715 117.543 -125.208 1.00 30.68  ? 190  GLY C O     1 
ATOM   8374  N N     . VAL C  1 191 ? 189.819 117.319 -122.960 1.00 30.29  ? 191  VAL C N     1 
ATOM   8375  C CA    . VAL C  1 191 ? 188.384 117.271 -122.806 1.00 31.10  ? 191  VAL C CA    1 
ATOM   8376  C C     . VAL C  1 191 ? 187.784 118.625 -123.087 1.00 31.41  ? 191  VAL C C     1 
ATOM   8377  O O     . VAL C  1 191 ? 186.737 118.714 -123.724 1.00 31.21  ? 191  VAL C O     1 
ATOM   8378  C CB    . VAL C  1 191 ? 187.976 116.810 -121.382 1.00 31.17  ? 191  VAL C CB    1 
ATOM   8379  C CG1   . VAL C  1 191 ? 186.442 116.757 -121.262 1.00 28.59  ? 191  VAL C CG1   1 
ATOM   8380  C CG2   . VAL C  1 191 ? 188.585 115.446 -121.093 1.00 27.94  ? 191  VAL C CG2   1 
ATOM   8381  N N     . GLU C  1 192 ? 188.452 119.679 -122.626 1.00 32.21  ? 192  GLU C N     1 
ATOM   8382  C CA    . GLU C  1 192 ? 187.944 121.028 -122.851 1.00 33.65  ? 192  GLU C CA    1 
ATOM   8383  C C     . GLU C  1 192 ? 187.952 121.347 -124.347 1.00 33.80  ? 192  GLU C C     1 
ATOM   8384  O O     . GLU C  1 192 ? 186.922 121.704 -124.917 1.00 32.58  ? 192  GLU C O     1 
ATOM   8385  C CB    . GLU C  1 192 ? 188.774 122.079 -122.076 1.00 33.89  ? 192  GLU C CB    1 
ATOM   8386  C CG    . GLU C  1 192 ? 188.676 122.009 -120.527 1.00 35.82  ? 192  GLU C CG    1 
ATOM   8387  C CD    . GLU C  1 192 ? 189.460 123.133 -119.794 1.00 38.21  ? 192  GLU C CD    1 
ATOM   8388  O OE1   . GLU C  1 192 ? 190.504 123.586 -120.317 1.00 40.49  ? 192  GLU C OE1   1 
ATOM   8389  O OE2   . GLU C  1 192 ? 189.045 123.558 -118.683 1.00 38.78  ? 192  GLU C OE2   1 
ATOM   8390  N N     . LEU C  1 193 ? 189.108 121.188 -124.984 1.00 35.00  ? 193  LEU C N     1 
ATOM   8391  C CA    . LEU C  1 193 ? 189.229 121.482 -126.407 1.00 36.17  ? 193  LEU C CA    1 
ATOM   8392  C C     . LEU C  1 193 ? 188.291 120.583 -127.208 1.00 37.31  ? 193  LEU C C     1 
ATOM   8393  O O     . LEU C  1 193 ? 187.630 121.032 -128.158 1.00 37.86  ? 193  LEU C O     1 
ATOM   8394  C CB    . LEU C  1 193 ? 190.688 121.333 -126.855 1.00 35.83  ? 193  LEU C CB    1 
ATOM   8395  C CG    . LEU C  1 193 ? 191.597 122.437 -126.277 1.00 35.17  ? 193  LEU C CG    1 
ATOM   8396  C CD1   . LEU C  1 193 ? 193.050 122.088 -126.498 1.00 36.09  ? 193  LEU C CD1   1 
ATOM   8397  C CD2   . LEU C  1 193 ? 191.287 123.774 -126.919 1.00 35.80  ? 193  LEU C CD2   1 
ATOM   8398  N N     . GLY C  1 194 ? 188.199 119.321 -126.800 1.00 37.57  ? 194  GLY C N     1 
ATOM   8399  C CA    . GLY C  1 194 ? 187.300 118.406 -127.478 1.00 36.52  ? 194  GLY C CA    1 
ATOM   8400  C C     . GLY C  1 194 ? 185.841 118.830 -127.339 1.00 36.00  ? 194  GLY C C     1 
ATOM   8401  O O     . GLY C  1 194 ? 185.055 118.729 -128.277 1.00 36.80  ? 194  GLY C O     1 
ATOM   8402  N N     . SER C  1 195 ? 185.467 119.322 -126.169 1.00 35.08  ? 195  SER C N     1 
ATOM   8403  C CA    . SER C  1 195 ? 184.084 119.721 -125.967 1.00 34.23  ? 195  SER C CA    1 
ATOM   8404  C C     . SER C  1 195 ? 183.749 120.982 -126.770 1.00 34.34  ? 195  SER C C     1 
ATOM   8405  O O     . SER C  1 195 ? 182.613 121.141 -127.251 1.00 33.61  ? 195  SER C O     1 
ATOM   8406  C CB    . SER C  1 195 ? 183.817 119.936 -124.474 1.00 32.25  ? 195  SER C CB    1 
ATOM   8407  O OG    . SER C  1 195 ? 182.449 120.130 -124.224 1.00 30.03  ? 195  SER C OG    1 
ATOM   8408  N N     . VAL C  1 196 ? 184.744 121.864 -126.908 1.00 33.05  ? 196  VAL C N     1 
ATOM   8409  C CA    . VAL C  1 196 ? 184.598 123.112 -127.648 1.00 31.38  ? 196  VAL C CA    1 
ATOM   8410  C C     . VAL C  1 196 ? 184.223 122.828 -129.123 1.00 32.63  ? 196  VAL C C     1 
ATOM   8411  O O     . VAL C  1 196 ? 183.227 123.348 -129.663 1.00 31.57  ? 196  VAL C O     1 
ATOM   8412  C CB    . VAL C  1 196 ? 185.926 123.935 -127.600 1.00 31.23  ? 196  VAL C CB    1 
ATOM   8413  C CG1   . VAL C  1 196 ? 185.902 125.028 -128.665 1.00 31.01  ? 196  VAL C CG1   1 
ATOM   8414  C CG2   . VAL C  1 196 ? 186.118 124.573 -126.226 1.00 29.29  ? 196  VAL C CG2   1 
ATOM   8415  N N     . TRP C  1 197 ? 185.019 121.997 -129.779 1.00 32.32  ? 197  TRP C N     1 
ATOM   8416  C CA    . TRP C  1 197 ? 184.736 121.698 -131.158 1.00 32.61  ? 197  TRP C CA    1 
ATOM   8417  C C     . TRP C  1 197 ? 183.543 120.764 -131.307 1.00 33.09  ? 197  TRP C C     1 
ATOM   8418  O O     . TRP C  1 197 ? 182.853 120.801 -132.316 1.00 33.15  ? 197  TRP C O     1 
ATOM   8419  C CB    . TRP C  1 197 ? 185.991 121.152 -131.826 1.00 31.45  ? 197  TRP C CB    1 
ATOM   8420  C CG    . TRP C  1 197 ? 187.033 122.231 -131.954 1.00 31.73  ? 197  TRP C CG    1 
ATOM   8421  C CD1   . TRP C  1 197 ? 188.182 122.345 -131.235 1.00 30.95  ? 197  TRP C CD1   1 
ATOM   8422  C CD2   . TRP C  1 197 ? 186.972 123.402 -132.792 1.00 31.28  ? 197  TRP C CD2   1 
ATOM   8423  N NE1   . TRP C  1 197 ? 188.836 123.508 -131.560 1.00 29.18  ? 197  TRP C NE1   1 
ATOM   8424  C CE2   . TRP C  1 197 ? 188.116 124.177 -132.510 1.00 30.95  ? 197  TRP C CE2   1 
ATOM   8425  C CE3   . TRP C  1 197 ? 186.062 123.864 -133.755 1.00 30.11  ? 197  TRP C CE3   1 
ATOM   8426  C CZ2   . TRP C  1 197 ? 188.378 125.395 -133.151 1.00 30.13  ? 197  TRP C CZ2   1 
ATOM   8427  C CZ3   . TRP C  1 197 ? 186.325 125.066 -134.389 1.00 30.03  ? 197  TRP C CZ3   1 
ATOM   8428  C CH2   . TRP C  1 197 ? 187.478 125.819 -134.080 1.00 29.84  ? 197  TRP C CH2   1 
ATOM   8429  N N     . GLN C  1 198 ? 183.287 119.934 -130.304 1.00 32.77  ? 198  GLN C N     1 
ATOM   8430  C CA    . GLN C  1 198 ? 182.131 119.056 -130.377 1.00 33.23  ? 198  GLN C CA    1 
ATOM   8431  C C     . GLN C  1 198 ? 180.894 119.948 -130.519 1.00 34.34  ? 198  GLN C C     1 
ATOM   8432  O O     . GLN C  1 198 ? 180.107 119.773 -131.429 1.00 36.68  ? 198  GLN C O     1 
ATOM   8433  C CB    . GLN C  1 198 ? 182.037 118.183 -129.122 1.00 31.51  ? 198  GLN C CB    1 
ATOM   8434  C CG    . GLN C  1 198 ? 180.977 117.080 -129.180 1.00 30.77  ? 198  GLN C CG    1 
ATOM   8435  C CD    . GLN C  1 198 ? 179.570 117.571 -128.868 1.00 32.23  ? 198  GLN C CD    1 
ATOM   8436  O OE1   . GLN C  1 198 ? 179.377 118.402 -127.979 1.00 33.22  ? 198  GLN C OE1   1 
ATOM   8437  N NE2   . GLN C  1 198 ? 178.578 117.041 -129.579 1.00 29.29  ? 198  GLN C NE2   1 
ATOM   8438  N N     . ARG C  1 199 ? 180.745 120.921 -129.631 1.00 36.51  ? 199  ARG C N     1 
ATOM   8439  C CA    . ARG C  1 199 ? 179.625 121.859 -129.664 1.00 37.61  ? 199  ARG C CA    1 
ATOM   8440  C C     . ARG C  1 199 ? 179.477 122.640 -130.965 1.00 38.17  ? 199  ARG C C     1 
ATOM   8441  O O     . ARG C  1 199 ? 178.363 122.972 -131.378 1.00 36.91  ? 199  ARG C O     1 
ATOM   8442  C CB    . ARG C  1 199 ? 179.778 122.882 -128.556 1.00 38.10  ? 199  ARG C CB    1 
ATOM   8443  C CG    . ARG C  1 199 ? 179.847 122.291 -127.202 1.00 39.80  ? 199  ARG C CG    1 
ATOM   8444  C CD    . ARG C  1 199 ? 180.390 123.313 -126.263 1.00 41.29  ? 199  ARG C CD    1 
ATOM   8445  N NE    . ARG C  1 199 ? 180.213 122.910 -124.880 1.00 41.28  ? 199  ARG C NE    1 
ATOM   8446  C CZ    . ARG C  1 199 ? 180.782 123.541 -123.866 1.00 42.62  ? 199  ARG C CZ    1 
ATOM   8447  N NH1   . ARG C  1 199 ? 181.562 124.590 -124.106 1.00 40.66  ? 199  ARG C NH1   1 
ATOM   8448  N NH2   . ARG C  1 199 ? 180.557 123.135 -122.620 1.00 43.90  ? 199  ARG C NH2   1 
ATOM   8449  N N     . LEU C  1 200 ? 180.606 122.960 -131.586 1.00 38.27  ? 200  LEU C N     1 
ATOM   8450  C CA    . LEU C  1 200 ? 180.596 123.732 -132.819 1.00 38.82  ? 200  LEU C CA    1 
ATOM   8451  C C     . LEU C  1 200 ? 180.193 122.964 -134.067 1.00 40.27  ? 200  LEU C C     1 
ATOM   8452  O O     . LEU C  1 200 ? 180.053 123.556 -135.146 1.00 41.79  ? 200  LEU C O     1 
ATOM   8453  C CB    . LEU C  1 200 ? 181.952 124.388 -133.038 1.00 37.27  ? 200  LEU C CB    1 
ATOM   8454  C CG    . LEU C  1 200 ? 182.275 125.388 -131.929 1.00 36.17  ? 200  LEU C CG    1 
ATOM   8455  C CD1   . LEU C  1 200 ? 183.611 126.017 -132.227 1.00 34.48  ? 200  LEU C CD1   1 
ATOM   8456  C CD2   . LEU C  1 200 ? 181.167 126.434 -131.822 1.00 33.65  ? 200  LEU C CD2   1 
ATOM   8457  N N     . GLY C  1 201 ? 180.007 121.656 -133.925 1.00 40.19  ? 201  GLY C N     1 
ATOM   8458  C CA    . GLY C  1 201 ? 179.580 120.859 -135.057 1.00 40.10  ? 201  GLY C CA    1 
ATOM   8459  C C     . GLY C  1 201 ? 180.414 119.638 -135.381 1.00 40.34  ? 201  GLY C C     1 
ATOM   8460  O O     . GLY C  1 201 ? 179.986 118.802 -136.178 1.00 41.38  ? 201  GLY C O     1 
ATOM   8461  N N     . ALA C  1 202 ? 181.593 119.528 -134.777 1.00 39.34  ? 202  ALA C N     1 
ATOM   8462  C CA    . ALA C  1 202 ? 182.470 118.397 -135.031 1.00 38.67  ? 202  ALA C CA    1 
ATOM   8463  C C     . ALA C  1 202 ? 182.066 117.097 -134.330 1.00 39.18  ? 202  ALA C C     1 
ATOM   8464  O O     . ALA C  1 202 ? 181.417 117.083 -133.268 1.00 38.95  ? 202  ALA C O     1 
ATOM   8465  C CB    . ALA C  1 202 ? 183.901 118.751 -134.665 1.00 37.53  ? 202  ALA C CB    1 
ATOM   8466  N N     . ASP C  1 203 ? 182.450 116.007 -134.979 1.00 38.21  ? 203  ASP C N     1 
ATOM   8467  C CA    . ASP C  1 203 ? 182.207 114.675 -134.499 1.00 38.60  ? 203  ASP C CA    1 
ATOM   8468  C C     . ASP C  1 203 ? 183.506 114.373 -133.804 1.00 38.26  ? 203  ASP C C     1 
ATOM   8469  O O     . ASP C  1 203 ? 184.542 114.199 -134.452 1.00 38.69  ? 203  ASP C O     1 
ATOM   8470  C CB    . ASP C  1 203 ? 182.001 113.722 -135.670 1.00 40.90  ? 203  ASP C CB    1 
ATOM   8471  C CG    . ASP C  1 203 ? 181.997 112.272 -135.243 1.00 42.62  ? 203  ASP C CG    1 
ATOM   8472  O OD1   . ASP C  1 203 ? 183.069 111.781 -134.833 1.00 43.17  ? 203  ASP C OD1   1 
ATOM   8473  O OD2   . ASP C  1 203 ? 180.926 111.628 -135.313 1.00 45.42  ? 203  ASP C OD2   1 
ATOM   8474  N N     . VAL C  1 204 ? 183.448 114.311 -132.477 1.00 37.55  ? 204  VAL C N     1 
ATOM   8475  C CA    . VAL C  1 204 ? 184.641 114.086 -131.690 1.00 33.94  ? 204  VAL C CA    1 
ATOM   8476  C C     . VAL C  1 204 ? 184.784 112.767 -130.926 1.00 32.85  ? 204  VAL C C     1 
ATOM   8477  O O     . VAL C  1 204 ? 183.838 112.240 -130.344 1.00 31.77  ? 204  VAL C O     1 
ATOM   8478  C CB    . VAL C  1 204 ? 184.822 115.261 -130.705 1.00 35.38  ? 204  VAL C CB    1 
ATOM   8479  C CG1   . VAL C  1 204 ? 186.205 115.176 -130.029 1.00 32.71  ? 204  VAL C CG1   1 
ATOM   8480  C CG2   . VAL C  1 204 ? 184.633 116.596 -131.451 1.00 34.61  ? 204  VAL C CG2   1 
ATOM   8481  N N     . THR C  1 205 ? 186.004 112.254 -130.933 1.00 31.77  ? 205  THR C N     1 
ATOM   8482  C CA    . THR C  1 205 ? 186.329 111.040 -130.230 1.00 33.59  ? 205  THR C CA    1 
ATOM   8483  C C     . THR C  1 205 ? 187.715 111.202 -129.629 1.00 35.03  ? 205  THR C C     1 
ATOM   8484  O O     . THR C  1 205 ? 188.692 111.423 -130.348 1.00 36.18  ? 205  THR C O     1 
ATOM   8485  C CB    . THR C  1 205 ? 186.357 109.820 -131.160 1.00 33.90  ? 205  THR C CB    1 
ATOM   8486  O OG1   . THR C  1 205 ? 185.075 109.657 -131.783 1.00 38.18  ? 205  THR C OG1   1 
ATOM   8487  C CG2   . THR C  1 205 ? 186.687 108.578 -130.369 1.00 32.14  ? 205  THR C CG2   1 
ATOM   8488  N N     . ALA C  1 206 ? 187.804 111.108 -128.306 1.00 34.70  ? 206  ALA C N     1 
ATOM   8489  C CA    . ALA C  1 206 ? 189.095 111.211 -127.635 1.00 34.14  ? 206  ALA C CA    1 
ATOM   8490  C C     . ALA C  1 206 ? 189.541 109.788 -127.290 1.00 33.66  ? 206  ALA C C     1 
ATOM   8491  O O     . ALA C  1 206 ? 188.735 108.962 -126.850 1.00 31.52  ? 206  ALA C O     1 
ATOM   8492  C CB    . ALA C  1 206 ? 188.971 112.048 -126.381 1.00 33.65  ? 206  ALA C CB    1 
ATOM   8493  N N     . VAL C  1 207 ? 190.817 109.499 -127.515 1.00 33.10  ? 207  VAL C N     1 
ATOM   8494  C CA    . VAL C  1 207 ? 191.351 108.173 -127.237 1.00 33.39  ? 207  VAL C CA    1 
ATOM   8495  C C     . VAL C  1 207 ? 192.267 108.313 -126.034 1.00 33.79  ? 207  VAL C C     1 
ATOM   8496  O O     . VAL C  1 207 ? 193.187 109.135 -126.037 1.00 32.72  ? 207  VAL C O     1 
ATOM   8497  C CB    . VAL C  1 207 ? 192.105 107.605 -128.493 1.00 33.59  ? 207  VAL C CB    1 
ATOM   8498  C CG1   . VAL C  1 207 ? 192.886 106.348 -128.144 1.00 31.17  ? 207  VAL C CG1   1 
ATOM   8499  C CG2   . VAL C  1 207 ? 191.086 107.293 -129.609 1.00 32.31  ? 207  VAL C CG2   1 
ATOM   8500  N N     . GLU C  1 208 ? 191.998 107.502 -125.005 1.00 35.51  ? 208  GLU C N     1 
ATOM   8501  C CA    . GLU C  1 208 ? 192.739 107.544 -123.741 1.00 35.49  ? 208  GLU C CA    1 
ATOM   8502  C C     . GLU C  1 208 ? 193.299 106.220 -123.262 1.00 36.90  ? 208  GLU C C     1 
ATOM   8503  O O     . GLU C  1 208 ? 192.590 105.226 -123.159 1.00 37.17  ? 208  GLU C O     1 
ATOM   8504  C CB    . GLU C  1 208 ? 191.842 108.121 -122.645 1.00 35.16  ? 208  GLU C CB    1 
ATOM   8505  C CG    . GLU C  1 208 ? 192.447 108.092 -121.258 1.00 33.71  ? 208  GLU C CG    1 
ATOM   8506  C CD    . GLU C  1 208 ? 193.754 108.851 -121.196 1.00 34.02  ? 208  GLU C CD    1 
ATOM   8507  O OE1   . GLU C  1 208 ? 193.783 110.025 -121.634 1.00 35.06  ? 208  GLU C OE1   1 
ATOM   8508  O OE2   . GLU C  1 208 ? 194.748 108.274 -120.711 1.00 33.38  ? 208  GLU C OE2   1 
ATOM   8509  N N     . PHE C  1 209 ? 194.580 106.236 -122.926 1.00 37.88  ? 209  PHE C N     1 
ATOM   8510  C CA    . PHE C  1 209 ? 195.243 105.047 -122.463 1.00 38.59  ? 209  PHE C CA    1 
ATOM   8511  C C     . PHE C  1 209 ? 194.683 104.523 -121.157 1.00 38.79  ? 209  PHE C C     1 
ATOM   8512  O O     . PHE C  1 209 ? 194.464 103.334 -121.012 1.00 39.25  ? 209  PHE C O     1 
ATOM   8513  C CB    . PHE C  1 209 ? 196.711 105.335 -122.284 1.00 40.84  ? 209  PHE C CB    1 
ATOM   8514  C CG    . PHE C  1 209 ? 197.518 104.122 -121.938 1.00 45.02  ? 209  PHE C CG    1 
ATOM   8515  C CD1   . PHE C  1 209 ? 197.760 103.138 -122.892 1.00 45.18  ? 209  PHE C CD1   1 
ATOM   8516  C CD2   . PHE C  1 209 ? 198.074 103.980 -120.670 1.00 45.36  ? 209  PHE C CD2   1 
ATOM   8517  C CE1   . PHE C  1 209 ? 198.555 102.033 -122.589 1.00 47.18  ? 209  PHE C CE1   1 
ATOM   8518  C CE2   . PHE C  1 209 ? 198.868 102.882 -120.356 1.00 45.58  ? 209  PHE C CE2   1 
ATOM   8519  C CZ    . PHE C  1 209 ? 199.112 101.909 -121.312 1.00 46.07  ? 209  PHE C CZ    1 
ATOM   8520  N N     . LEU C  1 210 ? 194.482 105.424 -120.200 1.00 39.23  ? 210  LEU C N     1 
ATOM   8521  C CA    . LEU C  1 210 ? 193.972 105.073 -118.886 1.00 38.70  ? 210  LEU C CA    1 
ATOM   8522  C C     . LEU C  1 210 ? 192.481 104.783 -118.977 1.00 37.90  ? 210  LEU C C     1 
ATOM   8523  O O     . LEU C  1 210 ? 191.888 105.012 -120.024 1.00 39.26  ? 210  LEU C O     1 
ATOM   8524  C CB    . LEU C  1 210 ? 194.293 106.212 -117.910 1.00 39.05  ? 210  LEU C CB    1 
ATOM   8525  C CG    . LEU C  1 210 ? 195.823 106.387 -117.806 1.00 39.31  ? 210  LEU C CG    1 
ATOM   8526  C CD1   . LEU C  1 210 ? 196.171 107.712 -117.153 1.00 37.60  ? 210  LEU C CD1   1 
ATOM   8527  C CD2   . LEU C  1 210 ? 196.431 105.207 -117.035 1.00 37.63  ? 210  LEU C CD2   1 
ATOM   8528  N N     . GLY C  1 211 ? 191.880 104.277 -117.901 1.00 36.05  ? 211  GLY C N     1 
ATOM   8529  C CA    . GLY C  1 211 ? 190.468 103.926 -117.936 1.00 34.23  ? 211  GLY C CA    1 
ATOM   8530  C C     . GLY C  1 211 ? 189.465 104.954 -117.461 1.00 33.85  ? 211  GLY C C     1 
ATOM   8531  O O     . GLY C  1 211 ? 188.316 104.616 -117.195 1.00 33.85  ? 211  GLY C O     1 
ATOM   8532  N N     . HIS C  1 212 ? 189.887 106.209 -117.351 1.00 33.49  ? 212  HIS C N     1 
ATOM   8533  C CA    . HIS C  1 212 ? 189.004 107.289 -116.901 1.00 34.06  ? 212  HIS C CA    1 
ATOM   8534  C C     . HIS C  1 212 ? 189.426 108.609 -117.561 1.00 35.57  ? 212  HIS C C     1 
ATOM   8535  O O     . HIS C  1 212 ? 190.593 108.783 -117.909 1.00 36.58  ? 212  HIS C O     1 
ATOM   8536  C CB    . HIS C  1 212 ? 189.132 107.492 -115.393 1.00 32.51  ? 212  HIS C CB    1 
ATOM   8537  C CG    . HIS C  1 212 ? 190.488 107.980 -114.988 1.00 29.47  ? 212  HIS C CG    1 
ATOM   8538  N ND1   . HIS C  1 212 ? 191.575 107.142 -114.902 1.00 29.52  ? 212  HIS C ND1   1 
ATOM   8539  C CD2   . HIS C  1 212 ? 190.962 109.231 -114.767 1.00 29.58  ? 212  HIS C CD2   1 
ATOM   8540  C CE1   . HIS C  1 212 ? 192.661 107.850 -114.649 1.00 29.71  ? 212  HIS C CE1   1 
ATOM   8541  N NE2   . HIS C  1 212 ? 192.317 109.123 -114.564 1.00 29.75  ? 212  HIS C NE2   1 
ATOM   8542  N N     . VAL C  1 213 ? 188.488 109.548 -117.683 1.00 35.63  ? 213  VAL C N     1 
ATOM   8543  C CA    . VAL C  1 213 ? 188.770 110.854 -118.275 1.00 35.69  ? 213  VAL C CA    1 
ATOM   8544  C C     . VAL C  1 213 ? 189.025 111.875 -117.151 1.00 36.04  ? 213  VAL C C     1 
ATOM   8545  O O     . VAL C  1 213 ? 188.630 111.655 -116.011 1.00 38.06  ? 213  VAL C O     1 
ATOM   8546  C CB    . VAL C  1 213 ? 187.565 111.336 -119.144 1.00 36.13  ? 213  VAL C CB    1 
ATOM   8547  C CG1   . VAL C  1 213 ? 187.054 110.200 -120.027 1.00 34.53  ? 213  VAL C CG1   1 
ATOM   8548  C CG2   . VAL C  1 213 ? 186.447 111.827 -118.265 1.00 36.49  ? 213  VAL C CG2   1 
ATOM   8549  N N     . GLY C  1 214 ? 189.694 112.984 -117.457 1.00 36.16  ? 214  GLY C N     1 
ATOM   8550  C CA    . GLY C  1 214 ? 189.930 114.007 -116.442 1.00 34.59  ? 214  GLY C CA    1 
ATOM   8551  C C     . GLY C  1 214 ? 191.335 114.169 -115.886 1.00 34.57  ? 214  GLY C C     1 
ATOM   8552  O O     . GLY C  1 214 ? 191.596 115.042 -115.052 1.00 32.29  ? 214  GLY C O     1 
ATOM   8553  N N     . GLY C  1 215 ? 192.245 113.316 -116.331 1.00 34.94  ? 215  GLY C N     1 
ATOM   8554  C CA    . GLY C  1 215 ? 193.602 113.422 -115.853 1.00 35.32  ? 215  GLY C CA    1 
ATOM   8555  C C     . GLY C  1 215 ? 193.839 112.769 -114.515 1.00 35.74  ? 215  GLY C C     1 
ATOM   8556  O O     . GLY C  1 215 ? 193.056 111.940 -114.062 1.00 36.53  ? 215  GLY C O     1 
ATOM   8557  N N     . VAL C  1 216 ? 194.935 113.173 -113.890 1.00 35.89  ? 216  VAL C N     1 
ATOM   8558  C CA    . VAL C  1 216 ? 195.378 112.643 -112.616 1.00 34.99  ? 216  VAL C CA    1 
ATOM   8559  C C     . VAL C  1 216 ? 194.791 113.370 -111.433 1.00 34.51  ? 216  VAL C C     1 
ATOM   8560  O O     . VAL C  1 216 ? 194.709 114.595 -111.437 1.00 35.65  ? 216  VAL C O     1 
ATOM   8561  C CB    . VAL C  1 216 ? 196.912 112.747 -112.524 1.00 37.08  ? 216  VAL C CB    1 
ATOM   8562  C CG1   . VAL C  1 216 ? 197.409 112.371 -111.111 1.00 36.67  ? 216  VAL C CG1   1 
ATOM   8563  C CG2   . VAL C  1 216 ? 197.531 111.848 -113.572 1.00 35.79  ? 216  VAL C CG2   1 
ATOM   8564  N N     . GLY C  1 217 ? 194.391 112.613 -110.414 1.00 32.78  ? 217  GLY C N     1 
ATOM   8565  C CA    . GLY C  1 217 ? 193.860 113.227 -109.216 1.00 29.49  ? 217  GLY C CA    1 
ATOM   8566  C C     . GLY C  1 217 ? 192.366 113.335 -109.137 1.00 28.75  ? 217  GLY C C     1 
ATOM   8567  O O     . GLY C  1 217 ? 191.828 113.480 -108.062 1.00 29.57  ? 217  GLY C O     1 
ATOM   8568  N N     . ILE C  1 218 ? 191.687 113.262 -110.270 1.00 27.19  ? 218  ILE C N     1 
ATOM   8569  C CA    . ILE C  1 218 ? 190.242 113.348 -110.273 1.00 25.22  ? 218  ILE C CA    1 
ATOM   8570  C C     . ILE C  1 218 ? 189.645 112.119 -109.549 1.00 26.77  ? 218  ILE C C     1 
ATOM   8571  O O     . ILE C  1 218 ? 190.244 111.036 -109.503 1.00 27.81  ? 218  ILE C O     1 
ATOM   8572  C CB    . ILE C  1 218 ? 189.698 113.473 -111.744 1.00 22.68  ? 218  ILE C CB    1 
ATOM   8573  C CG1   . ILE C  1 218 ? 188.278 114.038 -111.741 1.00 21.84  ? 218  ILE C CG1   1 
ATOM   8574  C CG2   . ILE C  1 218 ? 189.690 112.132 -112.432 1.00 20.46  ? 218  ILE C CG2   1 
ATOM   8575  C CD1   . ILE C  1 218 ? 187.645 114.139 -113.115 1.00 19.52  ? 218  ILE C CD1   1 
ATOM   8576  N N     . ASP C  1 219 ? 188.477 112.306 -108.949 1.00 26.56  ? 219  ASP C N     1 
ATOM   8577  C CA    . ASP C  1 219 ? 187.805 111.227 -108.246 1.00 27.06  ? 219  ASP C CA    1 
ATOM   8578  C C     . ASP C  1 219 ? 187.126 110.355 -109.305 1.00 26.86  ? 219  ASP C C     1 
ATOM   8579  O O     . ASP C  1 219 ? 186.457 110.875 -110.204 1.00 26.72  ? 219  ASP C O     1 
ATOM   8580  C CB    . ASP C  1 219 ? 186.766 111.808 -107.258 1.00 24.24  ? 219  ASP C CB    1 
ATOM   8581  C CG    . ASP C  1 219 ? 186.072 110.734 -106.430 1.00 24.60  ? 219  ASP C CG    1 
ATOM   8582  O OD1   . ASP C  1 219 ? 186.725 110.118 -105.555 1.00 24.57  ? 219  ASP C OD1   1 
ATOM   8583  O OD2   . ASP C  1 219 ? 184.867 110.504 -106.657 1.00 25.38  ? 219  ASP C OD2   1 
ATOM   8584  N N     . MET C  1 220 ? 187.302 109.040 -109.200 1.00 27.80  ? 220  MET C N     1 
ATOM   8585  C CA    . MET C  1 220 ? 186.707 108.104 -110.166 1.00 29.95  ? 220  MET C CA    1 
ATOM   8586  C C     . MET C  1 220 ? 185.183 108.157 -110.316 1.00 29.13  ? 220  MET C C     1 
ATOM   8587  O O     . MET C  1 220 ? 184.676 108.088 -111.425 1.00 31.62  ? 220  MET C O     1 
ATOM   8588  C CB    . MET C  1 220 ? 187.118 106.660 -109.846 1.00 33.57  ? 220  MET C CB    1 
ATOM   8589  C CG    . MET C  1 220 ? 188.614 106.353 -110.020 1.00 36.05  ? 220  MET C CG    1 
ATOM   8590  S SD    . MET C  1 220 ? 189.225 106.785 -111.676 1.00 40.02  ? 220  MET C SD    1 
ATOM   8591  C CE    . MET C  1 220 ? 188.251 105.661 -112.653 1.00 38.94  ? 220  MET C CE    1 
ATOM   8592  N N     . GLU C  1 221 ? 184.437 108.263 -109.224 1.00 28.76  ? 221  GLU C N     1 
ATOM   8593  C CA    . GLU C  1 221 ? 182.992 108.332 -109.355 1.00 29.14  ? 221  GLU C CA    1 
ATOM   8594  C C     . GLU C  1 221 ? 182.625 109.609 -110.130 1.00 30.14  ? 221  GLU C C     1 
ATOM   8595  O O     . GLU C  1 221 ? 181.758 109.595 -111.016 1.00 29.92  ? 221  GLU C O     1 
ATOM   8596  C CB    . GLU C  1 221 ? 182.329 108.326 -107.984 1.00 27.02  ? 221  GLU C CB    1 
ATOM   8597  C CG    . GLU C  1 221 ? 180.834 108.532 -108.042 1.00 28.25  ? 221  GLU C CG    1 
ATOM   8598  C CD    . GLU C  1 221 ? 180.177 108.522 -106.658 1.00 32.05  ? 221  GLU C CD    1 
ATOM   8599  O OE1   . GLU C  1 221 ? 180.910 108.464 -105.639 1.00 33.70  ? 221  GLU C OE1   1 
ATOM   8600  O OE2   . GLU C  1 221 ? 178.926 108.574 -106.596 1.00 32.37  ? 221  GLU C OE2   1 
ATOM   8601  N N     . ILE C  1 222 ? 183.296 110.706 -109.787 1.00 28.77  ? 222  ILE C N     1 
ATOM   8602  C CA    . ILE C  1 222 ? 183.062 111.974 -110.460 1.00 29.15  ? 222  ILE C CA    1 
ATOM   8603  C C     . ILE C  1 222 ? 183.430 111.793 -111.950 1.00 29.67  ? 222  ILE C C     1 
ATOM   8604  O O     . ILE C  1 222 ? 182.660 112.137 -112.848 1.00 30.95  ? 222  ILE C O     1 
ATOM   8605  C CB    . ILE C  1 222 ? 183.930 113.113 -109.816 1.00 24.86  ? 222  ILE C CB    1 
ATOM   8606  C CG1   . ILE C  1 222 ? 183.423 113.432 -108.419 1.00 22.23  ? 222  ILE C CG1   1 
ATOM   8607  C CG2   . ILE C  1 222 ? 183.851 114.372 -110.657 1.00 23.60  ? 222  ILE C CG2   1 
ATOM   8608  C CD1   . ILE C  1 222 ? 182.086 114.109 -108.404 1.00 17.79  ? 222  ILE C CD1   1 
ATOM   8609  N N     . SER C  1 223 ? 184.615 111.249 -112.186 1.00 29.89  ? 223  SER C N     1 
ATOM   8610  C CA    . SER C  1 223 ? 185.130 110.983 -113.528 1.00 31.75  ? 223  SER C CA    1 
ATOM   8611  C C     . SER C  1 223 ? 184.123 110.212 -114.382 1.00 32.06  ? 223  SER C C     1 
ATOM   8612  O O     . SER C  1 223 ? 183.848 110.551 -115.535 1.00 31.06  ? 223  SER C O     1 
ATOM   8613  C CB    . SER C  1 223 ? 186.417 110.172 -113.393 1.00 31.55  ? 223  SER C CB    1 
ATOM   8614  O OG    . SER C  1 223 ? 186.968 109.825 -114.641 1.00 31.02  ? 223  SER C OG    1 
ATOM   8615  N N     . LYS C  1 224 ? 183.601 109.145 -113.798 1.00 33.34  ? 224  LYS C N     1 
ATOM   8616  C CA    . LYS C  1 224 ? 182.632 108.329 -114.473 1.00 34.22  ? 224  LYS C CA    1 
ATOM   8617  C C     . LYS C  1 224 ? 181.359 109.088 -114.829 1.00 32.74  ? 224  LYS C C     1 
ATOM   8618  O O     . LYS C  1 224 ? 180.865 108.972 -115.949 1.00 32.46  ? 224  LYS C O     1 
ATOM   8619  C CB    . LYS C  1 224 ? 182.279 107.123 -113.611 1.00 36.84  ? 224  LYS C CB    1 
ATOM   8620  C CG    . LYS C  1 224 ? 183.020 105.868 -113.997 1.00 44.00  ? 224  LYS C CG    1 
ATOM   8621  C CD    . LYS C  1 224 ? 184.529 106.003 -113.757 1.00 49.28  ? 224  LYS C CD    1 
ATOM   8622  C CE    . LYS C  1 224 ? 185.344 104.987 -114.592 1.00 52.99  ? 224  LYS C CE    1 
ATOM   8623  N NZ    . LYS C  1 224 ? 185.336 105.291 -116.077 1.00 54.83  ? 224  LYS C NZ    1 
ATOM   8624  N N     . ASN C  1 225 ? 180.820 109.856 -113.890 1.00 30.07  ? 225  ASN C N     1 
ATOM   8625  C CA    . ASN C  1 225 ? 179.584 110.569 -114.166 1.00 29.80  ? 225  ASN C CA    1 
ATOM   8626  C C     . ASN C  1 225 ? 179.769 111.680 -115.198 1.00 29.73  ? 225  ASN C C     1 
ATOM   8627  O O     . ASN C  1 225 ? 178.856 112.015 -115.955 1.00 29.54  ? 225  ASN C O     1 
ATOM   8628  C CB    . ASN C  1 225 ? 178.995 111.151 -112.878 1.00 31.19  ? 225  ASN C CB    1 
ATOM   8629  C CG    . ASN C  1 225 ? 178.543 110.078 -111.888 1.00 33.86  ? 225  ASN C CG    1 
ATOM   8630  O OD1   . ASN C  1 225 ? 178.167 108.964 -112.276 1.00 38.16  ? 225  ASN C OD1   1 
ATOM   8631  N ND2   . ASN C  1 225 ? 178.558 110.419 -110.605 1.00 33.24  ? 225  ASN C ND2   1 
ATOM   8632  N N     . PHE C  1 226 ? 180.973 112.237 -115.214 1.00 28.95  ? 226  PHE C N     1 
ATOM   8633  C CA    . PHE C  1 226 ? 181.348 113.311 -116.112 1.00 29.04  ? 226  PHE C CA    1 
ATOM   8634  C C     . PHE C  1 226 ? 181.415 112.755 -117.563 1.00 30.55  ? 226  PHE C C     1 
ATOM   8635  O O     . PHE C  1 226 ? 180.823 113.311 -118.505 1.00 30.39  ? 226  PHE C O     1 
ATOM   8636  C CB    . PHE C  1 226 ? 182.693 113.882 -115.598 1.00 26.70  ? 226  PHE C CB    1 
ATOM   8637  C CG    . PHE C  1 226 ? 183.323 114.940 -116.483 1.00 24.13  ? 226  PHE C CG    1 
ATOM   8638  C CD1   . PHE C  1 226 ? 182.590 116.022 -116.949 1.00 23.19  ? 226  PHE C CD1   1 
ATOM   8639  C CD2   . PHE C  1 226 ? 184.670 114.854 -116.829 1.00 22.30  ? 226  PHE C CD2   1 
ATOM   8640  C CE1   . PHE C  1 226 ? 183.190 116.992 -117.744 1.00 21.31  ? 226  PHE C CE1   1 
ATOM   8641  C CE2   . PHE C  1 226 ? 185.274 115.825 -117.626 1.00 19.15  ? 226  PHE C CE2   1 
ATOM   8642  C CZ    . PHE C  1 226 ? 184.533 116.887 -118.080 1.00 20.90  ? 226  PHE C CZ    1 
ATOM   8643  N N     . GLN C  1 227 ? 182.121 111.643 -117.722 1.00 30.75  ? 227  GLN C N     1 
ATOM   8644  C CA    . GLN C  1 227 ? 182.257 110.993 -119.012 1.00 30.93  ? 227  GLN C CA    1 
ATOM   8645  C C     . GLN C  1 227 ? 180.878 110.671 -119.546 1.00 32.47  ? 227  GLN C C     1 
ATOM   8646  O O     . GLN C  1 227 ? 180.571 110.905 -120.707 1.00 33.99  ? 227  GLN C O     1 
ATOM   8647  C CB    . GLN C  1 227 ? 183.040 109.690 -118.855 1.00 31.55  ? 227  GLN C CB    1 
ATOM   8648  C CG    . GLN C  1 227 ? 183.255 108.945 -120.135 1.00 31.82  ? 227  GLN C CG    1 
ATOM   8649  C CD    . GLN C  1 227 ? 183.739 107.533 -119.922 1.00 33.85  ? 227  GLN C CD    1 
ATOM   8650  O OE1   . GLN C  1 227 ? 184.333 107.206 -118.889 1.00 33.51  ? 227  GLN C OE1   1 
ATOM   8651  N NE2   . GLN C  1 227 ? 183.505 106.678 -120.917 1.00 34.39  ? 227  GLN C NE2   1 
ATOM   8652  N N     . ARG C  1 228 ? 180.047 110.130 -118.667 1.00 33.71  ? 228  ARG C N     1 
ATOM   8653  C CA    . ARG C  1 228 ? 178.698 109.720 -119.004 1.00 34.45  ? 228  ARG C CA    1 
ATOM   8654  C C     . ARG C  1 228 ? 177.860 110.885 -119.512 1.00 33.77  ? 228  ARG C C     1 
ATOM   8655  O O     . ARG C  1 228 ? 177.049 110.717 -120.410 1.00 36.59  ? 228  ARG C O     1 
ATOM   8656  C CB    . ARG C  1 228 ? 178.045 109.109 -117.770 1.00 37.33  ? 228  ARG C CB    1 
ATOM   8657  C CG    . ARG C  1 228 ? 177.095 107.964 -118.022 1.00 41.54  ? 228  ARG C CG    1 
ATOM   8658  C CD    . ARG C  1 228 ? 176.299 107.610 -116.760 1.00 46.01  ? 228  ARG C CD    1 
ATOM   8659  N NE    . ARG C  1 228 ? 177.136 107.332 -115.584 1.00 51.24  ? 228  ARG C NE    1 
ATOM   8660  C CZ    . ARG C  1 228 ? 178.085 106.395 -115.534 1.00 53.00  ? 228  ARG C CZ    1 
ATOM   8661  N NH1   . ARG C  1 228 ? 178.338 105.637 -116.592 1.00 52.76  ? 228  ARG C NH1   1 
ATOM   8662  N NH2   . ARG C  1 228 ? 178.775 106.203 -114.415 1.00 54.01  ? 228  ARG C NH2   1 
ATOM   8663  N N     . ILE C  1 229 ? 178.046 112.065 -118.938 1.00 31.60  ? 229  ILE C N     1 
ATOM   8664  C CA    . ILE C  1 229 ? 177.287 113.233 -119.350 1.00 29.42  ? 229  ILE C CA    1 
ATOM   8665  C C     . ILE C  1 229 ? 177.827 113.797 -120.658 1.00 29.40  ? 229  ILE C C     1 
ATOM   8666  O O     . ILE C  1 229 ? 177.073 114.254 -121.516 1.00 29.68  ? 229  ILE C O     1 
ATOM   8667  C CB    . ILE C  1 229 ? 177.347 114.319 -118.262 1.00 28.76  ? 229  ILE C CB    1 
ATOM   8668  C CG1   . ILE C  1 229 ? 176.581 113.850 -117.035 1.00 28.73  ? 229  ILE C CG1   1 
ATOM   8669  C CG2   . ILE C  1 229 ? 176.782 115.631 -118.771 1.00 26.50  ? 229  ILE C CG2   1 
ATOM   8670  C CD1   . ILE C  1 229 ? 176.884 114.693 -115.798 1.00 29.95  ? 229  ILE C CD1   1 
ATOM   8671  N N     . LEU C  1 230 ? 179.144 113.773 -120.795 1.00 29.17  ? 230  LEU C N     1 
ATOM   8672  C CA    . LEU C  1 230 ? 179.777 114.275 -121.993 1.00 29.10  ? 230  LEU C CA    1 
ATOM   8673  C C     . LEU C  1 230 ? 179.367 113.401 -123.168 1.00 30.46  ? 230  LEU C C     1 
ATOM   8674  O O     . LEU C  1 230 ? 179.127 113.907 -124.268 1.00 32.69  ? 230  LEU C O     1 
ATOM   8675  C CB    . LEU C  1 230 ? 181.305 114.282 -121.834 1.00 26.30  ? 230  LEU C CB    1 
ATOM   8676  C CG    . LEU C  1 230 ? 181.912 115.421 -121.001 1.00 26.17  ? 230  LEU C CG    1 
ATOM   8677  C CD1   . LEU C  1 230 ? 183.424 115.251 -120.869 1.00 23.51  ? 230  LEU C CD1   1 
ATOM   8678  C CD2   . LEU C  1 230 ? 181.592 116.754 -121.669 1.00 22.03  ? 230  LEU C CD2   1 
ATOM   8679  N N     . GLN C  1 231 ? 179.255 112.097 -122.919 1.00 30.45  ? 231  GLN C N     1 
ATOM   8680  C CA    . GLN C  1 231 ? 178.896 111.129 -123.947 1.00 30.20  ? 231  GLN C CA    1 
ATOM   8681  C C     . GLN C  1 231 ? 177.483 111.350 -124.469 1.00 30.85  ? 231  GLN C C     1 
ATOM   8682  O O     . GLN C  1 231 ? 177.241 111.216 -125.663 1.00 30.96  ? 231  GLN C O     1 
ATOM   8683  C CB    . GLN C  1 231 ? 179.104 109.699 -123.420 1.00 30.81  ? 231  GLN C CB    1 
ATOM   8684  C CG    . GLN C  1 231 ? 180.568 109.266 -123.530 1.00 31.67  ? 231  GLN C CG    1 
ATOM   8685  C CD    . GLN C  1 231 ? 180.822 107.887 -122.955 1.00 34.10  ? 231  GLN C CD    1 
ATOM   8686  O OE1   . GLN C  1 231 ? 181.843 107.243 -123.277 1.00 37.94  ? 231  GLN C OE1   1 
ATOM   8687  N NE2   . GLN C  1 231 ? 179.964 107.450 -122.081 1.00 36.96  ? 231  GLN C NE2   1 
ATOM   8688  N N     . LYS C  1 232 ? 176.553 111.715 -123.595 1.00 31.42  ? 232  LYS C N     1 
ATOM   8689  C CA    . LYS C  1 232 ? 175.193 111.992 -124.047 1.00 34.33  ? 232  LYS C CA    1 
ATOM   8690  C C     . LYS C  1 232 ? 175.132 113.371 -124.755 1.00 35.27  ? 232  LYS C C     1 
ATOM   8691  O O     . LYS C  1 232 ? 174.096 113.760 -125.309 1.00 36.23  ? 232  LYS C O     1 
ATOM   8692  C CB    . LYS C  1 232 ? 174.197 111.956 -122.875 1.00 35.68  ? 232  LYS C CB    1 
ATOM   8693  C CG    . LYS C  1 232 ? 174.004 110.563 -122.256 1.00 41.83  ? 232  LYS C CG    1 
ATOM   8694  C CD    . LYS C  1 232 ? 173.089 110.573 -121.010 1.00 44.47  ? 232  LYS C CD    1 
ATOM   8695  C CE    . LYS C  1 232 ? 173.193 109.248 -120.231 1.00 46.83  ? 232  LYS C CE    1 
ATOM   8696  N NZ    . LYS C  1 232 ? 172.294 109.127 -119.031 1.00 46.70  ? 232  LYS C NZ    1 
ATOM   8697  N N     . GLN C  1 233 ? 176.231 114.120 -124.718 1.00 34.14  ? 233  GLN C N     1 
ATOM   8698  C CA    . GLN C  1 233 ? 176.282 115.406 -125.392 1.00 32.69  ? 233  GLN C CA    1 
ATOM   8699  C C     . GLN C  1 233 ? 176.800 115.173 -126.823 1.00 32.48  ? 233  GLN C C     1 
ATOM   8700  O O     . GLN C  1 233 ? 176.640 116.013 -127.712 1.00 29.89  ? 233  GLN C O     1 
ATOM   8701  C CB    . GLN C  1 233 ? 177.206 116.362 -124.651 1.00 31.52  ? 233  GLN C CB    1 
ATOM   8702  C CG    . GLN C  1 233 ? 176.576 117.096 -123.482 1.00 31.03  ? 233  GLN C CG    1 
ATOM   8703  C CD    . GLN C  1 233 ? 177.612 117.957 -122.776 1.00 31.50  ? 233  GLN C CD    1 
ATOM   8704  O OE1   . GLN C  1 233 ? 178.789 117.949 -123.144 1.00 30.94  ? 233  GLN C OE1   1 
ATOM   8705  N NE2   . GLN C  1 233 ? 177.189 118.693 -121.765 1.00 31.10  ? 233  GLN C NE2   1 
ATOM   8706  N N     . GLY C  1 234 ? 177.423 114.017 -127.024 1.00 32.55  ? 234  GLY C N     1 
ATOM   8707  C CA    . GLY C  1 234 ? 177.921 113.663 -128.336 1.00 33.78  ? 234  GLY C CA    1 
ATOM   8708  C C     . GLY C  1 234 ? 179.402 113.370 -128.362 1.00 35.66  ? 234  GLY C C     1 
ATOM   8709  O O     . GLY C  1 234 ? 179.924 112.867 -129.364 1.00 37.21  ? 234  GLY C O     1 
ATOM   8710  N N     . PHE C  1 235 ? 180.074 113.699 -127.257 1.00 35.01  ? 235  PHE C N     1 
ATOM   8711  C CA    . PHE C  1 235 ? 181.506 113.508 -127.107 1.00 33.28  ? 235  PHE C CA    1 
ATOM   8712  C C     . PHE C  1 235 ? 181.765 112.016 -126.901 1.00 33.47  ? 235  PHE C C     1 
ATOM   8713  O O     . PHE C  1 235 ? 181.291 111.421 -125.952 1.00 33.01  ? 235  PHE C O     1 
ATOM   8714  C CB    . PHE C  1 235 ? 181.984 114.310 -125.890 1.00 33.57  ? 235  PHE C CB    1 
ATOM   8715  C CG    . PHE C  1 235 ? 183.454 114.598 -125.880 1.00 30.39  ? 235  PHE C CG    1 
ATOM   8716  C CD1   . PHE C  1 235 ? 184.351 113.703 -126.420 1.00 30.73  ? 235  PHE C CD1   1 
ATOM   8717  C CD2   . PHE C  1 235 ? 183.933 115.765 -125.307 1.00 30.89  ? 235  PHE C CD2   1 
ATOM   8718  C CE1   . PHE C  1 235 ? 185.718 113.958 -126.395 1.00 33.42  ? 235  PHE C CE1   1 
ATOM   8719  C CE2   . PHE C  1 235 ? 185.297 116.045 -125.266 1.00 30.09  ? 235  PHE C CE2   1 
ATOM   8720  C CZ    . PHE C  1 235 ? 186.195 115.146 -125.809 1.00 32.46  ? 235  PHE C CZ    1 
ATOM   8721  N N     . LYS C  1 236 ? 182.508 111.403 -127.799 1.00 33.91  ? 236  LYS C N     1 
ATOM   8722  C CA    . LYS C  1 236 ? 182.786 109.984 -127.660 1.00 34.87  ? 236  LYS C CA    1 
ATOM   8723  C C     . LYS C  1 236 ? 184.170 109.808 -127.099 1.00 34.26  ? 236  LYS C C     1 
ATOM   8724  O O     . LYS C  1 236 ? 185.056 110.642 -127.313 1.00 32.74  ? 236  LYS C O     1 
ATOM   8725  C CB    . LYS C  1 236 ? 182.726 109.265 -129.016 1.00 36.39  ? 236  LYS C CB    1 
ATOM   8726  C CG    . LYS C  1 236 ? 181.378 109.280 -129.689 1.00 38.78  ? 236  LYS C CG    1 
ATOM   8727  C CD    . LYS C  1 236 ? 181.466 108.718 -131.120 1.00 41.26  ? 236  LYS C CD    1 
ATOM   8728  C CE    . LYS C  1 236 ? 181.878 109.788 -132.149 1.00 43.75  ? 236  LYS C CE    1 
ATOM   8729  N NZ    . LYS C  1 236 ? 180.865 110.907 -132.243 1.00 44.17  ? 236  LYS C NZ    1 
ATOM   8730  N N     . PHE C  1 237 ? 184.351 108.679 -126.422 1.00 34.22  ? 237  PHE C N     1 
ATOM   8731  C CA    . PHE C  1 237 ? 185.613 108.329 -125.799 1.00 33.94  ? 237  PHE C CA    1 
ATOM   8732  C C     . PHE C  1 237 ? 185.943 106.857 -126.004 1.00 35.37  ? 237  PHE C C     1 
ATOM   8733  O O     . PHE C  1 237 ? 185.056 106.009 -126.048 1.00 36.11  ? 237  PHE C O     1 
ATOM   8734  C CB    . PHE C  1 237 ? 185.541 108.596 -124.281 1.00 32.98  ? 237  PHE C CB    1 
ATOM   8735  C CG    . PHE C  1 237 ? 185.427 110.044 -123.917 1.00 28.69  ? 237  PHE C CG    1 
ATOM   8736  C CD1   . PHE C  1 237 ? 186.558 110.831 -123.800 1.00 27.21  ? 237  PHE C CD1   1 
ATOM   8737  C CD2   . PHE C  1 237 ? 184.185 110.614 -123.669 1.00 28.99  ? 237  PHE C CD2   1 
ATOM   8738  C CE1   . PHE C  1 237 ? 186.461 112.164 -123.438 1.00 26.83  ? 237  PHE C CE1   1 
ATOM   8739  C CE2   . PHE C  1 237 ? 184.079 111.954 -123.306 1.00 28.71  ? 237  PHE C CE2   1 
ATOM   8740  C CZ    . PHE C  1 237 ? 185.227 112.726 -123.191 1.00 25.80  ? 237  PHE C CZ    1 
ATOM   8741  N N     . LYS C  1 238 ? 187.230 106.563 -126.123 1.00 36.17  ? 238  LYS C N     1 
ATOM   8742  C CA    . LYS C  1 238 ? 187.703 105.190 -126.248 1.00 37.20  ? 238  LYS C CA    1 
ATOM   8743  C C     . LYS C  1 238 ? 188.760 105.057 -125.139 1.00 36.88  ? 238  LYS C C     1 
ATOM   8744  O O     . LYS C  1 238 ? 189.927 105.424 -125.318 1.00 35.65  ? 238  LYS C O     1 
ATOM   8745  C CB    . LYS C  1 238 ? 188.308 104.920 -127.640 1.00 38.74  ? 238  LYS C CB    1 
ATOM   8746  C CG    . LYS C  1 238 ? 187.290 104.472 -128.689 1.00 42.47  ? 238  LYS C CG    1 
ATOM   8747  C CD    . LYS C  1 238 ? 187.974 103.772 -129.884 1.00 47.37  ? 238  LYS C CD    1 
ATOM   8748  C CE    . LYS C  1 238 ? 187.030 102.804 -130.642 1.00 49.59  ? 238  LYS C CE    1 
ATOM   8749  N NZ    . LYS C  1 238 ? 186.613 101.593 -129.835 1.00 50.69  ? 238  LYS C NZ    1 
ATOM   8750  N N     . LEU C  1 239 ? 188.326 104.561 -123.977 1.00 36.60  ? 239  LEU C N     1 
ATOM   8751  C CA    . LEU C  1 239 ? 189.210 104.414 -122.832 1.00 35.80  ? 239  LEU C CA    1 
ATOM   8752  C C     . LEU C  1 239 ? 190.030 103.144 -122.927 1.00 35.83  ? 239  LEU C C     1 
ATOM   8753  O O     . LEU C  1 239 ? 189.669 102.235 -123.647 1.00 36.32  ? 239  LEU C O     1 
ATOM   8754  C CB    . LEU C  1 239 ? 188.387 104.402 -121.535 1.00 35.33  ? 239  LEU C CB    1 
ATOM   8755  C CG    . LEU C  1 239 ? 187.367 105.513 -121.320 1.00 34.43  ? 239  LEU C CG    1 
ATOM   8756  C CD1   . LEU C  1 239 ? 186.985 105.631 -119.853 1.00 33.85  ? 239  LEU C CD1   1 
ATOM   8757  C CD2   . LEU C  1 239 ? 187.977 106.818 -121.784 1.00 35.48  ? 239  LEU C CD2   1 
ATOM   8758  N N     . ASN C  1 240 ? 191.140 103.076 -122.205 1.00 37.38  ? 240  ASN C N     1 
ATOM   8759  C CA    . ASN C  1 240 ? 191.967 101.871 -122.226 1.00 38.75  ? 240  ASN C CA    1 
ATOM   8760  C C     . ASN C  1 240 ? 192.377 101.493 -123.660 1.00 39.90  ? 240  ASN C C     1 
ATOM   8761  O O     . ASN C  1 240 ? 192.356 100.321 -124.042 1.00 40.89  ? 240  ASN C O     1 
ATOM   8762  C CB    . ASN C  1 240 ? 191.186 100.708 -121.587 1.00 39.42  ? 240  ASN C CB    1 
ATOM   8763  C CG    . ASN C  1 240 ? 190.841 100.949 -120.111 1.00 38.82  ? 240  ASN C CG    1 
ATOM   8764  O OD1   . ASN C  1 240 ? 191.717 100.983 -119.250 1.00 39.83  ? 240  ASN C OD1   1 
ATOM   8765  N ND2   . ASN C  1 240 ? 189.559 101.105 -119.826 1.00 38.20  ? 240  ASN C ND2   1 
ATOM   8766  N N     . THR C  1 241 ? 192.750 102.501 -124.440 1.00 40.47  ? 241  THR C N     1 
ATOM   8767  C CA    . THR C  1 241 ? 193.163 102.338 -125.825 1.00 40.70  ? 241  THR C CA    1 
ATOM   8768  C C     . THR C  1 241 ? 194.490 103.041 -126.040 1.00 43.53  ? 241  THR C C     1 
ATOM   8769  O O     . THR C  1 241 ? 194.693 104.182 -125.602 1.00 43.76  ? 241  THR C O     1 
ATOM   8770  C CB    . THR C  1 241 ? 192.145 102.961 -126.768 1.00 38.88  ? 241  THR C CB    1 
ATOM   8771  O OG1   . THR C  1 241 ? 190.845 102.450 -126.459 1.00 38.33  ? 241  THR C OG1   1 
ATOM   8772  C CG2   . THR C  1 241 ? 192.480 102.631 -128.204 1.00 38.86  ? 241  THR C CG2   1 
ATOM   8773  N N     . LYS C  1 242 ? 195.395 102.365 -126.723 1.00 45.52  ? 242  LYS C N     1 
ATOM   8774  C CA    . LYS C  1 242 ? 196.701 102.925 -126.992 1.00 48.91  ? 242  LYS C CA    1 
ATOM   8775  C C     . LYS C  1 242 ? 196.769 103.387 -128.452 1.00 50.88  ? 242  LYS C C     1 
ATOM   8776  O O     . LYS C  1 242 ? 196.444 102.630 -129.364 1.00 51.69  ? 242  LYS C O     1 
ATOM   8777  C CB    . LYS C  1 242 ? 197.752 101.844 -126.721 1.00 50.76  ? 242  LYS C CB    1 
ATOM   8778  C CG    . LYS C  1 242 ? 199.176 102.254 -126.980 1.00 53.63  ? 242  LYS C CG    1 
ATOM   8779  C CD    . LYS C  1 242 ? 200.108 101.058 -126.879 1.00 56.97  ? 242  LYS C CD    1 
ATOM   8780  C CE    . LYS C  1 242 ? 201.554 101.498 -127.132 1.00 60.16  ? 242  LYS C CE    1 
ATOM   8781  N NZ    . LYS C  1 242 ? 202.558 100.387 -127.021 1.00 62.56  ? 242  LYS C NZ    1 
ATOM   8782  N N     . VAL C  1 243 ? 197.155 104.632 -128.694 1.00 52.00  ? 243  VAL C N     1 
ATOM   8783  C CA    . VAL C  1 243 ? 197.281 105.067 -130.072 1.00 53.23  ? 243  VAL C CA    1 
ATOM   8784  C C     . VAL C  1 243 ? 198.683 104.678 -130.510 1.00 55.27  ? 243  VAL C C     1 
ATOM   8785  O O     . VAL C  1 243 ? 199.668 105.196 -129.980 1.00 56.62  ? 243  VAL C O     1 
ATOM   8786  C CB    . VAL C  1 243 ? 197.125 106.568 -130.222 1.00 52.91  ? 243  VAL C CB    1 
ATOM   8787  C CG1   . VAL C  1 243 ? 197.526 106.978 -131.631 1.00 52.66  ? 243  VAL C CG1   1 
ATOM   8788  C CG2   . VAL C  1 243 ? 195.691 106.964 -129.952 1.00 52.41  ? 243  VAL C CG2   1 
ATOM   8789  N N     . THR C  1 244 ? 198.773 103.758 -131.466 1.00 56.31  ? 244  THR C N     1 
ATOM   8790  C CA    . THR C  1 244 ? 200.061 103.277 -131.954 1.00 56.88  ? 244  THR C CA    1 
ATOM   8791  C C     . THR C  1 244 ? 200.721 104.270 -132.899 1.00 57.28  ? 244  THR C C     1 
ATOM   8792  O O     . THR C  1 244 ? 201.947 104.361 -132.958 1.00 58.21  ? 244  THR C O     1 
ATOM   8793  C CB    . THR C  1 244 ? 199.908 101.922 -132.684 1.00 56.92  ? 244  THR C CB    1 
ATOM   8794  O OG1   . THR C  1 244 ? 199.107 102.093 -133.860 1.00 58.96  ? 244  THR C OG1   1 
ATOM   8795  C CG2   . THR C  1 244 ? 199.235 100.911 -131.784 1.00 57.96  ? 244  THR C CG2   1 
ATOM   8796  N N     . GLY C  1 245 ? 199.906 105.015 -133.639 1.00 57.04  ? 245  GLY C N     1 
ATOM   8797  C CA    . GLY C  1 245 ? 200.451 105.980 -134.571 1.00 55.78  ? 245  GLY C CA    1 
ATOM   8798  C C     . GLY C  1 245 ? 199.389 106.625 -135.431 1.00 55.05  ? 245  GLY C C     1 
ATOM   8799  O O     . GLY C  1 245 ? 198.201 106.341 -135.288 1.00 54.81  ? 245  GLY C O     1 
ATOM   8800  N N     . ALA C  1 246 ? 199.819 107.503 -136.327 1.00 54.50  ? 246  ALA C N     1 
ATOM   8801  C CA    . ALA C  1 246 ? 198.886 108.187 -137.205 1.00 54.97  ? 246  ALA C CA    1 
ATOM   8802  C C     . ALA C  1 246 ? 199.574 108.674 -138.469 1.00 54.73  ? 246  ALA C C     1 
ATOM   8803  O O     . ALA C  1 246 ? 200.723 109.109 -138.438 1.00 54.26  ? 246  ALA C O     1 
ATOM   8804  C CB    . ALA C  1 246 ? 198.238 109.360 -136.470 1.00 54.76  ? 246  ALA C CB    1 
ATOM   8805  N N     . THR C  1 247 ? 198.856 108.606 -139.582 1.00 54.60  ? 247  THR C N     1 
ATOM   8806  C CA    . THR C  1 247 ? 199.413 109.038 -140.857 1.00 54.51  ? 247  THR C CA    1 
ATOM   8807  C C     . THR C  1 247 ? 198.423 109.898 -141.631 1.00 52.50  ? 247  THR C C     1 
ATOM   8808  O O     . THR C  1 247 ? 197.229 109.618 -141.660 1.00 50.49  ? 247  THR C O     1 
ATOM   8809  C CB    . THR C  1 247 ? 199.778 107.831 -141.734 1.00 55.05  ? 247  THR C CB    1 
ATOM   8810  O OG1   . THR C  1 247 ? 198.575 107.140 -142.086 1.00 56.70  ? 247  THR C OG1   1 
ATOM   8811  C CG2   . THR C  1 247 ? 200.697 106.861 -140.977 1.00 55.31  ? 247  THR C CG2   1 
ATOM   8812  N N     . LYS C  1 248 ? 198.930 110.954 -142.250 1.00 52.82  ? 248  LYS C N     1 
ATOM   8813  C CA    . LYS C  1 248 ? 198.076 111.822 -143.037 1.00 54.18  ? 248  LYS C CA    1 
ATOM   8814  C C     . LYS C  1 248 ? 198.057 111.216 -144.444 1.00 53.39  ? 248  LYS C C     1 
ATOM   8815  O O     . LYS C  1 248 ? 199.093 110.789 -144.952 1.00 52.59  ? 248  LYS C O     1 
ATOM   8816  C CB    . LYS C  1 248 ? 198.629 113.254 -143.072 1.00 55.66  ? 248  LYS C CB    1 
ATOM   8817  C CG    . LYS C  1 248 ? 197.569 114.269 -143.516 1.00 58.85  ? 248  LYS C CG    1 
ATOM   8818  C CD    . LYS C  1 248 ? 198.163 115.591 -144.000 1.00 61.05  ? 248  LYS C CD    1 
ATOM   8819  C CE    . LYS C  1 248 ? 197.091 116.491 -144.632 1.00 61.46  ? 248  LYS C CE    1 
ATOM   8820  N NZ    . LYS C  1 248 ? 196.058 116.920 -143.640 1.00 61.09  ? 248  LYS C NZ    1 
ATOM   8821  N N     . LYS C  1 249 ? 196.881 111.161 -145.059 1.00 52.18  ? 249  LYS C N     1 
ATOM   8822  C CA    . LYS C  1 249 ? 196.756 110.579 -146.389 1.00 51.22  ? 249  LYS C CA    1 
ATOM   8823  C C     . LYS C  1 249 ? 196.686 111.630 -147.492 1.00 50.47  ? 249  LYS C C     1 
ATOM   8824  O O     . LYS C  1 249 ? 196.386 112.801 -147.247 1.00 48.76  ? 249  LYS C O     1 
ATOM   8825  C CB    . LYS C  1 249 ? 195.529 109.659 -146.440 1.00 51.17  ? 249  LYS C CB    1 
ATOM   8826  C CG    . LYS C  1 249 ? 195.530 108.590 -145.332 1.00 50.84  ? 249  LYS C CG    1 
ATOM   8827  C CD    . LYS C  1 249 ? 194.348 107.621 -145.431 1.00 49.64  ? 249  LYS C CD    1 
ATOM   8828  C CE    . LYS C  1 249 ? 193.035 108.248 -145.007 1.00 47.19  ? 249  LYS C CE    1 
ATOM   8829  N NZ    . LYS C  1 249 ? 191.997 107.195 -144.950 1.00 47.20  ? 249  LYS C NZ    1 
ATOM   8830  N N     . SER C  1 250 ? 196.981 111.186 -148.710 1.00 50.65  ? 250  SER C N     1 
ATOM   8831  C CA    . SER C  1 250 ? 196.999 112.028 -149.910 1.00 49.83  ? 250  SER C CA    1 
ATOM   8832  C C     . SER C  1 250 ? 195.693 112.770 -150.169 1.00 48.89  ? 250  SER C C     1 
ATOM   8833  O O     . SER C  1 250 ? 195.660 113.741 -150.932 1.00 48.92  ? 250  SER C O     1 
ATOM   8834  C CB    . SER C  1 250 ? 197.325 111.170 -151.131 1.00 49.80  ? 250  SER C CB    1 
ATOM   8835  O OG    . SER C  1 250 ? 196.310 110.203 -151.345 1.00 50.00  ? 250  SER C OG    1 
ATOM   8836  N N     . ASP C  1 251 ? 194.616 112.302 -149.552 1.00 47.29  ? 251  ASP C N     1 
ATOM   8837  C CA    . ASP C  1 251 ? 193.315 112.929 -149.730 1.00 45.91  ? 251  ASP C CA    1 
ATOM   8838  C C     . ASP C  1 251 ? 193.071 113.970 -148.643 1.00 45.02  ? 251  ASP C C     1 
ATOM   8839  O O     . ASP C  1 251 ? 191.991 114.546 -148.558 1.00 43.62  ? 251  ASP C O     1 
ATOM   8840  C CB    . ASP C  1 251 ? 192.220 111.854 -149.704 1.00 46.79  ? 251  ASP C CB    1 
ATOM   8841  C CG    . ASP C  1 251 ? 192.130 111.126 -148.364 1.00 47.68  ? 251  ASP C CG    1 
ATOM   8842  O OD1   . ASP C  1 251 ? 193.162 110.985 -147.678 1.00 48.56  ? 251  ASP C OD1   1 
ATOM   8843  O OD2   . ASP C  1 251 ? 191.027 110.673 -148.003 1.00 48.26  ? 251  ASP C OD2   1 
ATOM   8844  N N     . GLY C  1 252 ? 194.095 114.210 -147.826 1.00 44.51  ? 252  GLY C N     1 
ATOM   8845  C CA    . GLY C  1 252 ? 193.989 115.167 -146.734 1.00 44.23  ? 252  GLY C CA    1 
ATOM   8846  C C     . GLY C  1 252 ? 193.596 114.531 -145.400 1.00 43.95  ? 252  GLY C C     1 
ATOM   8847  O O     . GLY C  1 252 ? 193.838 115.093 -144.334 1.00 44.04  ? 252  GLY C O     1 
ATOM   8848  N N     . LYS C  1 253 ? 193.001 113.345 -145.462 1.00 43.28  ? 253  LYS C N     1 
ATOM   8849  C CA    . LYS C  1 253 ? 192.555 112.630 -144.277 1.00 43.22  ? 253  LYS C CA    1 
ATOM   8850  C C     . LYS C  1 253 ? 193.665 112.127 -143.356 1.00 42.54  ? 253  LYS C C     1 
ATOM   8851  O O     . LYS C  1 253 ? 194.828 111.984 -143.747 1.00 42.29  ? 253  LYS C O     1 
ATOM   8852  C CB    . LYS C  1 253 ? 191.653 111.460 -144.699 1.00 45.75  ? 253  LYS C CB    1 
ATOM   8853  C CG    . LYS C  1 253 ? 190.310 111.889 -145.280 1.00 46.07  ? 253  LYS C CG    1 
ATOM   8854  C CD    . LYS C  1 253 ? 189.406 112.372 -144.177 1.00 49.35  ? 253  LYS C CD    1 
ATOM   8855  C CE    . LYS C  1 253 ? 188.091 112.853 -144.715 1.00 51.29  ? 253  LYS C CE    1 
ATOM   8856  N NZ    . LYS C  1 253 ? 188.297 114.105 -145.472 1.00 54.91  ? 253  LYS C NZ    1 
ATOM   8857  N N     . ILE C  1 254 ? 193.300 111.865 -142.111 1.00 41.98  ? 254  ILE C N     1 
ATOM   8858  C CA    . ILE C  1 254 ? 194.263 111.373 -141.150 1.00 41.16  ? 254  ILE C CA    1 
ATOM   8859  C C     . ILE C  1 254 ? 193.745 110.053 -140.626 1.00 40.45  ? 254  ILE C C     1 
ATOM   8860  O O     . ILE C  1 254 ? 192.579 109.948 -140.239 1.00 40.56  ? 254  ILE C O     1 
ATOM   8861  C CB    . ILE C  1 254 ? 194.428 112.347 -139.990 1.00 41.58  ? 254  ILE C CB    1 
ATOM   8862  C CG1   . ILE C  1 254 ? 194.721 113.740 -140.543 1.00 42.55  ? 254  ILE C CG1   1 
ATOM   8863  C CG2   . ILE C  1 254 ? 195.569 111.886 -139.082 1.00 40.65  ? 254  ILE C CG2   1 
ATOM   8864  C CD1   . ILE C  1 254 ? 194.611 114.865 -139.520 1.00 45.01  ? 254  ILE C CD1   1 
ATOM   8865  N N     . ASP C  1 255 ? 194.612 109.048 -140.650 1.00 39.04  ? 255  ASP C N     1 
ATOM   8866  C CA    . ASP C  1 255 ? 194.278 107.717 -140.170 1.00 40.38  ? 255  ASP C CA    1 
ATOM   8867  C C     . ASP C  1 255 ? 195.013 107.551 -138.850 1.00 40.70  ? 255  ASP C C     1 
ATOM   8868  O O     . ASP C  1 255 ? 196.238 107.726 -138.782 1.00 39.33  ? 255  ASP C O     1 
ATOM   8869  C CB    . ASP C  1 255 ? 194.737 106.636 -141.168 1.00 41.36  ? 255  ASP C CB    1 
ATOM   8870  C CG    . ASP C  1 255 ? 193.589 106.108 -142.070 1.00 43.44  ? 255  ASP C CG    1 
ATOM   8871  O OD1   . ASP C  1 255 ? 192.616 106.845 -142.363 1.00 43.22  ? 255  ASP C OD1   1 
ATOM   8872  O OD2   . ASP C  1 255 ? 193.675 104.936 -142.512 1.00 44.54  ? 255  ASP C OD2   1 
ATOM   8873  N N     . VAL C  1 256 ? 194.256 107.246 -137.800 1.00 40.12  ? 256  VAL C N     1 
ATOM   8874  C CA    . VAL C  1 256 ? 194.834 107.058 -136.478 1.00 41.28  ? 256  VAL C CA    1 
ATOM   8875  C C     . VAL C  1 256 ? 194.731 105.581 -136.110 1.00 41.38  ? 256  VAL C C     1 
ATOM   8876  O O     . VAL C  1 256 ? 193.644 105.004 -136.063 1.00 41.98  ? 256  VAL C O     1 
ATOM   8877  C CB    . VAL C  1 256 ? 194.104 107.918 -135.391 1.00 40.09  ? 256  VAL C CB    1 
ATOM   8878  C CG1   . VAL C  1 256 ? 194.806 107.771 -134.054 1.00 38.12  ? 256  VAL C CG1   1 
ATOM   8879  C CG2   . VAL C  1 256 ? 194.084 109.374 -135.791 1.00 39.04  ? 256  VAL C CG2   1 
ATOM   8880  N N     . SER C  1 257 ? 195.870 104.963 -135.865 1.00 41.32  ? 257  SER C N     1 
ATOM   8881  C CA    . SER C  1 257 ? 195.868 103.561 -135.502 1.00 44.46  ? 257  SER C CA    1 
ATOM   8882  C C     . SER C  1 257 ? 195.782 103.402 -133.994 1.00 44.69  ? 257  SER C C     1 
ATOM   8883  O O     . SER C  1 257 ? 196.489 104.084 -133.244 1.00 43.38  ? 257  SER C O     1 
ATOM   8884  C CB    . SER C  1 257 ? 197.128 102.892 -136.029 1.00 45.66  ? 257  SER C CB    1 
ATOM   8885  O OG    . SER C  1 257 ? 197.223 103.107 -137.426 1.00 50.13  ? 257  SER C OG    1 
ATOM   8886  N N     . ILE C  1 258 ? 194.906 102.505 -133.554 1.00 45.38  ? 258  ILE C N     1 
ATOM   8887  C CA    . ILE C  1 258 ? 194.727 102.267 -132.127 1.00 46.73  ? 258  ILE C CA    1 
ATOM   8888  C C     . ILE C  1 258 ? 194.595 100.782 -131.770 1.00 47.50  ? 258  ILE C C     1 
ATOM   8889  O O     . ILE C  1 258 ? 194.181 99.970  -132.591 1.00 46.75  ? 258  ILE C O     1 
ATOM   8890  C CB    . ILE C  1 258 ? 193.470 103.027 -131.573 1.00 46.46  ? 258  ILE C CB    1 
ATOM   8891  C CG1   . ILE C  1 258 ? 192.180 102.348 -132.058 1.00 45.49  ? 258  ILE C CG1   1 
ATOM   8892  C CG2   . ILE C  1 258 ? 193.513 104.507 -131.996 1.00 43.91  ? 258  ILE C CG2   1 
ATOM   8893  C CD1   . ILE C  1 258 ? 190.925 102.810 -131.334 1.00 43.90  ? 258  ILE C CD1   1 
ATOM   8894  N N     . GLU C  1 259 ? 194.976 100.447 -130.540 1.00 49.66  ? 259  GLU C N     1 
ATOM   8895  C CA    . GLU C  1 259 ? 194.888 99.083  -130.005 1.00 51.97  ? 259  GLU C CA    1 
ATOM   8896  C C     . GLU C  1 259 ? 194.340 99.194  -128.602 1.00 51.73  ? 259  GLU C C     1 
ATOM   8897  O O     . GLU C  1 259 ? 194.240 100.283 -128.048 1.00 52.61  ? 259  GLU C O     1 
ATOM   8898  C CB    . GLU C  1 259 ? 196.255 98.419  -129.866 1.00 54.31  ? 259  GLU C CB    1 
ATOM   8899  C CG    . GLU C  1 259 ? 197.000 98.099  -131.135 1.00 59.38  ? 259  GLU C CG    1 
ATOM   8900  C CD    . GLU C  1 259 ? 198.330 97.421  -130.840 1.00 62.15  ? 259  GLU C CD    1 
ATOM   8901  O OE1   . GLU C  1 259 ? 198.712 97.359  -129.648 1.00 63.35  ? 259  GLU C OE1   1 
ATOM   8902  O OE2   . GLU C  1 259 ? 198.995 96.957  -131.793 1.00 63.09  ? 259  GLU C OE2   1 
ATOM   8903  N N     . ALA C  1 260 ? 193.989 98.062  -128.016 1.00 51.04  ? 260  ALA C N     1 
ATOM   8904  C CA    . ALA C  1 260 ? 193.514 98.083  -126.648 1.00 49.29  ? 260  ALA C CA    1 
ATOM   8905  C C     . ALA C  1 260 ? 194.800 98.296  -125.859 1.00 48.62  ? 260  ALA C C     1 
ATOM   8906  O O     . ALA C  1 260 ? 195.873 97.894  -126.303 1.00 48.77  ? 260  ALA C O     1 
ATOM   8907  C CB    . ALA C  1 260 ? 192.878 96.752  -126.287 1.00 47.01  ? 260  ALA C CB    1 
ATOM   8908  N N     . ALA C  1 261 ? 194.712 98.943  -124.708 1.00 48.44  ? 261  ALA C N     1 
ATOM   8909  C CA    . ALA C  1 261 ? 195.905 99.164  -123.906 1.00 49.20  ? 261  ALA C CA    1 
ATOM   8910  C C     . ALA C  1 261 ? 196.593 97.822  -123.626 1.00 50.01  ? 261  ALA C C     1 
ATOM   8911  O O     . ALA C  1 261 ? 197.808 97.687  -123.772 1.00 50.37  ? 261  ALA C O     1 
ATOM   8912  C CB    . ALA C  1 261 ? 195.528 99.846  -122.598 1.00 48.83  ? 261  ALA C CB    1 
ATOM   8913  N N     . SER C  1 262 ? 195.799 96.831  -123.231 1.00 51.22  ? 262  SER C N     1 
ATOM   8914  C CA    . SER C  1 262 ? 196.302 95.494  -122.923 1.00 52.25  ? 262  SER C CA    1 
ATOM   8915  C C     . SER C  1 262 ? 196.616 94.691  -124.191 1.00 52.84  ? 262  SER C C     1 
ATOM   8916  O O     . SER C  1 262 ? 196.578 93.456  -124.162 1.00 53.43  ? 262  SER C O     1 
ATOM   8917  C CB    . SER C  1 262 ? 195.258 94.726  -122.115 1.00 52.19  ? 262  SER C CB    1 
ATOM   8918  O OG    . SER C  1 262 ? 194.112 94.437  -122.914 1.00 52.44  ? 262  SER C OG    1 
ATOM   8919  N N     . GLY C  1 263 ? 196.901 95.387  -125.294 1.00 52.42  ? 263  GLY C N     1 
ATOM   8920  C CA    . GLY C  1 263 ? 197.200 94.722  -126.555 1.00 50.05  ? 263  GLY C CA    1 
ATOM   8921  C C     . GLY C  1 263 ? 195.986 94.141  -127.278 1.00 49.08  ? 263  GLY C C     1 
ATOM   8922  O O     . GLY C  1 263 ? 195.003 93.739  -126.642 1.00 47.98  ? 263  GLY C O     1 
ATOM   8923  N N     . GLY C  1 264 ? 196.061 94.098  -128.611 1.00 48.57  ? 264  GLY C N     1 
ATOM   8924  C CA    . GLY C  1 264 ? 194.976 93.559  -129.417 1.00 48.13  ? 264  GLY C CA    1 
ATOM   8925  C C     . GLY C  1 264 ? 193.974 94.598  -129.881 1.00 47.98  ? 264  GLY C C     1 
ATOM   8926  O O     . GLY C  1 264 ? 194.212 95.804  -129.773 1.00 49.55  ? 264  GLY C O     1 
ATOM   8927  N N     . LYS C  1 265 ? 192.855 94.127  -130.411 1.00 47.00  ? 265  LYS C N     1 
ATOM   8928  C CA    . LYS C  1 265 ? 191.795 95.009  -130.882 1.00 46.98  ? 265  LYS C CA    1 
ATOM   8929  C C     . LYS C  1 265 ? 192.302 96.073  -131.856 1.00 45.80  ? 265  LYS C C     1 
ATOM   8930  O O     . LYS C  1 265 ? 191.807 97.193  -131.867 1.00 46.08  ? 265  LYS C O     1 
ATOM   8931  C CB    . LYS C  1 265 ? 191.111 95.682  -129.679 1.00 48.32  ? 265  LYS C CB    1 
ATOM   8932  C CG    . LYS C  1 265 ? 189.682 96.179  -129.933 1.00 50.29  ? 265  LYS C CG    1 
ATOM   8933  C CD    . LYS C  1 265 ? 188.990 96.591  -128.625 1.00 52.82  ? 265  LYS C CD    1 
ATOM   8934  C CE    . LYS C  1 265 ? 187.449 96.532  -128.704 1.00 53.35  ? 265  LYS C CE    1 
ATOM   8935  N NZ    . LYS C  1 265 ? 186.808 97.677  -129.418 1.00 55.02  ? 265  LYS C NZ    1 
ATOM   8936  N N     . ALA C  1 266 ? 193.281 95.727  -132.680 1.00 44.62  ? 266  ALA C N     1 
ATOM   8937  C CA    . ALA C  1 266 ? 193.812 96.695  -133.638 1.00 44.85  ? 266  ALA C CA    1 
ATOM   8938  C C     . ALA C  1 266 ? 192.714 97.324  -134.473 1.00 44.49  ? 266  ALA C C     1 
ATOM   8939  O O     . ALA C  1 266 ? 192.056 96.648  -135.255 1.00 47.40  ? 266  ALA C O     1 
ATOM   8940  C CB    . ALA C  1 266 ? 194.834 96.041  -134.565 1.00 42.75  ? 266  ALA C CB    1 
ATOM   8941  N N     . GLU C  1 267 ? 192.506 98.620  -134.295 1.00 44.14  ? 267  GLU C N     1 
ATOM   8942  C CA    . GLU C  1 267 ? 191.516 99.346  -135.078 1.00 43.10  ? 267  GLU C CA    1 
ATOM   8943  C C     . GLU C  1 267 ? 192.164 100.575 -135.729 1.00 41.54  ? 267  GLU C C     1 
ATOM   8944  O O     . GLU C  1 267 ? 193.347 100.859 -135.516 1.00 40.57  ? 267  GLU C O     1 
ATOM   8945  C CB    . GLU C  1 267 ? 190.349 99.789  -134.204 1.00 43.43  ? 267  GLU C CB    1 
ATOM   8946  C CG    . GLU C  1 267 ? 189.523 98.675  -133.629 1.00 45.31  ? 267  GLU C CG    1 
ATOM   8947  C CD    . GLU C  1 267 ? 188.510 99.213  -132.634 1.00 47.90  ? 267  GLU C CD    1 
ATOM   8948  O OE1   . GLU C  1 267 ? 188.948 99.835  -131.648 1.00 48.95  ? 267  GLU C OE1   1 
ATOM   8949  O OE2   . GLU C  1 267 ? 187.287 99.029  -132.822 1.00 50.57  ? 267  GLU C OE2   1 
ATOM   8950  N N     . VAL C  1 268 ? 191.382 101.288 -136.537 1.00 41.11  ? 268  VAL C N     1 
ATOM   8951  C CA    . VAL C  1 268 ? 191.851 102.493 -137.217 1.00 40.13  ? 268  VAL C CA    1 
ATOM   8952  C C     . VAL C  1 268 ? 190.736 103.525 -137.322 1.00 39.47  ? 268  VAL C C     1 
ATOM   8953  O O     . VAL C  1 268 ? 189.608 103.189 -137.681 1.00 38.54  ? 268  VAL C O     1 
ATOM   8954  C CB    . VAL C  1 268 ? 192.383 102.183 -138.654 1.00 40.03  ? 268  VAL C CB    1 
ATOM   8955  C CG1   . VAL C  1 268 ? 192.645 103.481 -139.419 1.00 38.26  ? 268  VAL C CG1   1 
ATOM   8956  C CG2   . VAL C  1 268 ? 193.671 101.380 -138.569 1.00 40.19  ? 268  VAL C CG2   1 
ATOM   8957  N N     . ILE C  1 269 ? 191.073 104.775 -136.991 1.00 39.96  ? 269  ILE C N     1 
ATOM   8958  C CA    . ILE C  1 269 ? 190.143 105.901 -137.049 1.00 39.98  ? 269  ILE C CA    1 
ATOM   8959  C C     . ILE C  1 269 ? 190.638 106.932 -138.046 1.00 40.25  ? 269  ILE C C     1 
ATOM   8960  O O     . ILE C  1 269 ? 191.840 107.215 -138.129 1.00 40.53  ? 269  ILE C O     1 
ATOM   8961  C CB    . ILE C  1 269 ? 190.023 106.638 -135.715 1.00 40.07  ? 269  ILE C CB    1 
ATOM   8962  C CG1   . ILE C  1 269 ? 189.637 105.673 -134.614 1.00 40.07  ? 269  ILE C CG1   1 
ATOM   8963  C CG2   . ILE C  1 269 ? 188.950 107.702 -135.807 1.00 38.90  ? 269  ILE C CG2   1 
ATOM   8964  C CD1   . ILE C  1 269 ? 189.575 106.351 -133.284 1.00 42.51  ? 269  ILE C CD1   1 
ATOM   8965  N N     . THR C  1 270 ? 189.694 107.500 -138.784 1.00 40.51  ? 270  THR C N     1 
ATOM   8966  C CA    . THR C  1 270 ? 189.985 108.513 -139.787 1.00 40.54  ? 270  THR C CA    1 
ATOM   8967  C C     . THR C  1 270 ? 189.261 109.780 -139.367 1.00 39.54  ? 270  THR C C     1 
ATOM   8968  O O     . THR C  1 270 ? 188.071 109.749 -139.045 1.00 38.80  ? 270  THR C O     1 
ATOM   8969  C CB    . THR C  1 270 ? 189.473 108.094 -141.196 1.00 41.83  ? 270  THR C CB    1 
ATOM   8970  O OG1   . THR C  1 270 ? 189.988 106.795 -141.534 1.00 42.16  ? 270  THR C OG1   1 
ATOM   8971  C CG2   . THR C  1 270 ? 189.919 109.109 -142.248 1.00 40.40  ? 270  THR C CG2   1 
ATOM   8972  N N     . CYS C  1 271 ? 189.990 110.889 -139.384 1.00 38.94  ? 271  CYS C N     1 
ATOM   8973  C CA    . CYS C  1 271 ? 189.457 112.197 -138.998 1.00 38.21  ? 271  CYS C CA    1 
ATOM   8974  C C     . CYS C  1 271 ? 190.080 113.310 -139.868 1.00 37.65  ? 271  CYS C C     1 
ATOM   8975  O O     . CYS C  1 271 ? 191.061 113.082 -140.591 1.00 38.36  ? 271  CYS C O     1 
ATOM   8976  C CB    . CYS C  1 271 ? 189.815 112.444 -137.537 1.00 38.14  ? 271  CYS C CB    1 
ATOM   8977  S SG    . CYS C  1 271 ? 191.638 112.361 -137.301 1.00 37.32  ? 271  CYS C SG    1 
ATOM   8978  N N     . ASP C  1 272 ? 189.531 114.516 -139.786 1.00 37.50  ? 272  ASP C N     1 
ATOM   8979  C CA    . ASP C  1 272 ? 190.076 115.641 -140.556 1.00 38.05  ? 272  ASP C CA    1 
ATOM   8980  C C     . ASP C  1 272 ? 191.133 116.408 -139.765 1.00 36.78  ? 272  ASP C C     1 
ATOM   8981  O O     . ASP C  1 272 ? 192.018 117.060 -140.317 1.00 35.83  ? 272  ASP C O     1 
ATOM   8982  C CB    . ASP C  1 272 ? 188.942 116.561 -140.983 1.00 38.94  ? 272  ASP C CB    1 
ATOM   8983  C CG    . ASP C  1 272 ? 187.917 115.832 -141.826 1.00 42.72  ? 272  ASP C CG    1 
ATOM   8984  O OD1   . ASP C  1 272 ? 188.274 115.431 -142.959 1.00 41.17  ? 272  ASP C OD1   1 
ATOM   8985  O OD2   . ASP C  1 272 ? 186.772 115.637 -141.345 1.00 45.69  ? 272  ASP C OD2   1 
ATOM   8986  N N     . VAL C  1 273 ? 191.054 116.288 -138.451 1.00 37.45  ? 273  VAL C N     1 
ATOM   8987  C CA    . VAL C  1 273 ? 191.993 116.964 -137.581 1.00 36.47  ? 273  VAL C CA    1 
ATOM   8988  C C     . VAL C  1 273 ? 192.403 116.077 -136.441 1.00 35.53  ? 273  VAL C C     1 
ATOM   8989  O O     . VAL C  1 273 ? 191.573 115.407 -135.835 1.00 35.50  ? 273  VAL C O     1 
ATOM   8990  C CB    . VAL C  1 273 ? 191.369 118.253 -137.022 1.00 35.95  ? 273  VAL C CB    1 
ATOM   8991  C CG1   . VAL C  1 273 ? 192.200 118.800 -135.877 1.00 34.17  ? 273  VAL C CG1   1 
ATOM   8992  C CG2   . VAL C  1 273 ? 191.243 119.262 -138.147 1.00 35.09  ? 273  VAL C CG2   1 
ATOM   8993  N N     . LEU C  1 274 ? 193.696 116.059 -136.166 1.00 34.58  ? 274  LEU C N     1 
ATOM   8994  C CA    . LEU C  1 274 ? 194.215 115.284 -135.061 1.00 33.35  ? 274  LEU C CA    1 
ATOM   8995  C C     . LEU C  1 274 ? 194.810 116.256 -134.050 1.00 32.89  ? 274  LEU C C     1 
ATOM   8996  O O     . LEU C  1 274 ? 195.661 117.078 -134.394 1.00 32.00  ? 274  LEU C O     1 
ATOM   8997  C CB    . LEU C  1 274 ? 195.285 114.318 -135.543 1.00 32.86  ? 274  LEU C CB    1 
ATOM   8998  C CG    . LEU C  1 274 ? 195.828 113.335 -134.509 1.00 35.72  ? 274  LEU C CG    1 
ATOM   8999  C CD1   . LEU C  1 274 ? 194.709 112.421 -133.995 1.00 34.92  ? 274  LEU C CD1   1 
ATOM   9000  C CD2   . LEU C  1 274 ? 196.930 112.508 -135.151 1.00 36.17  ? 274  LEU C CD2   1 
ATOM   9001  N N     . LEU C  1 275 ? 194.321 116.160 -132.811 1.00 33.16  ? 275  LEU C N     1 
ATOM   9002  C CA    . LEU C  1 275 ? 194.782 116.978 -131.685 1.00 31.42  ? 275  LEU C CA    1 
ATOM   9003  C C     . LEU C  1 275 ? 195.627 116.109 -130.765 1.00 33.24  ? 275  LEU C C     1 
ATOM   9004  O O     . LEU C  1 275 ? 195.134 115.154 -130.140 1.00 31.62  ? 275  LEU C O     1 
ATOM   9005  C CB    . LEU C  1 275 ? 193.602 117.531 -130.892 1.00 31.04  ? 275  LEU C CB    1 
ATOM   9006  C CG    . LEU C  1 275 ? 193.833 118.096 -129.476 1.00 31.09  ? 275  LEU C CG    1 
ATOM   9007  C CD1   . LEU C  1 275 ? 194.920 119.167 -129.466 1.00 29.06  ? 275  LEU C CD1   1 
ATOM   9008  C CD2   . LEU C  1 275 ? 192.523 118.661 -128.967 1.00 28.34  ? 275  LEU C CD2   1 
ATOM   9009  N N     . VAL C  1 276 ? 196.916 116.414 -130.700 1.00 35.05  ? 276  VAL C N     1 
ATOM   9010  C CA    . VAL C  1 276 ? 197.833 115.658 -129.843 1.00 36.58  ? 276  VAL C CA    1 
ATOM   9011  C C     . VAL C  1 276 ? 197.894 116.403 -128.478 1.00 38.64  ? 276  VAL C C     1 
ATOM   9012  O O     . VAL C  1 276 ? 198.385 117.575 -128.401 1.00 39.52  ? 276  VAL C O     1 
ATOM   9013  C CB    . VAL C  1 276 ? 199.236 115.600 -130.439 1.00 36.76  ? 276  VAL C CB    1 
ATOM   9014  C CG1   . VAL C  1 276 ? 200.115 114.724 -129.612 1.00 38.61  ? 276  VAL C CG1   1 
ATOM   9015  C CG2   . VAL C  1 276 ? 199.145 115.047 -131.853 1.00 36.61  ? 276  VAL C CG2   1 
ATOM   9016  N N     . CYS C  1 277 ? 197.368 115.737 -127.448 1.00 39.61  ? 277  CYS C N     1 
ATOM   9017  C CA    . CYS C  1 277 ? 197.244 116.323 -126.097 1.00 40.88  ? 277  CYS C CA    1 
ATOM   9018  C C     . CYS C  1 277 ? 197.690 115.305 -125.071 1.00 38.93  ? 277  CYS C C     1 
ATOM   9019  O O     . CYS C  1 277 ? 196.860 114.924 -124.275 1.00 38.05  ? 277  CYS C O     1 
ATOM   9020  C CB    . CYS C  1 277 ? 195.763 116.606 -125.860 1.00 41.49  ? 277  CYS C CB    1 
ATOM   9021  S SG    . CYS C  1 277 ? 195.333 118.226 -125.379 1.00 49.45  ? 277  CYS C SG    1 
ATOM   9022  N N     . ILE C  1 278 ? 198.925 114.838 -125.122 1.00 38.09  ? 278  ILE C N     1 
ATOM   9023  C CA    . ILE C  1 278 ? 199.330 113.838 -124.175 1.00 37.29  ? 278  ILE C CA    1 
ATOM   9024  C C     . ILE C  1 278 ? 200.113 114.406 -123.045 1.00 36.92  ? 278  ILE C C     1 
ATOM   9025  O O     . ILE C  1 278 ? 200.824 113.707 -122.355 1.00 38.18  ? 278  ILE C O     1 
ATOM   9026  C CB    . ILE C  1 278 ? 200.130 112.708 -124.860 1.00 37.09  ? 278  ILE C CB    1 
ATOM   9027  C CG1   . ILE C  1 278 ? 201.463 113.243 -125.387 1.00 39.73  ? 278  ILE C CG1   1 
ATOM   9028  C CG2   . ILE C  1 278 ? 199.326 112.124 -125.989 1.00 35.58  ? 278  ILE C CG2   1 
ATOM   9029  C CD1   . ILE C  1 278 ? 202.448 112.157 -125.857 1.00 37.28  ? 278  ILE C CD1   1 
ATOM   9030  N N     . GLY C  1 279 ? 199.976 115.700 -122.857 1.00 37.65  ? 279  GLY C N     1 
ATOM   9031  C CA    . GLY C  1 279 ? 200.693 116.325 -121.772 1.00 36.87  ? 279  GLY C CA    1 
ATOM   9032  C C     . GLY C  1 279 ? 201.659 117.465 -122.068 1.00 36.15  ? 279  GLY C C     1 
ATOM   9033  O O     . GLY C  1 279 ? 201.877 117.880 -123.216 1.00 34.70  ? 279  GLY C O     1 
ATOM   9034  N N     . ARG C  1 280 ? 202.232 117.978 -120.987 1.00 36.41  ? 280  ARG C N     1 
ATOM   9035  C CA    . ARG C  1 280 ? 203.171 119.066 -121.053 1.00 37.53  ? 280  ARG C CA    1 
ATOM   9036  C C     . ARG C  1 280 ? 204.379 118.727 -120.198 1.00 39.66  ? 280  ARG C C     1 
ATOM   9037  O O     . ARG C  1 280 ? 204.309 117.933 -119.252 1.00 40.55  ? 280  ARG C O     1 
ATOM   9038  C CB    . ARG C  1 280 ? 202.510 120.356 -120.590 1.00 35.88  ? 280  ARG C CB    1 
ATOM   9039  C CG    . ARG C  1 280 ? 201.407 120.826 -121.526 1.00 36.84  ? 280  ARG C CG    1 
ATOM   9040  C CD    . ARG C  1 280 ? 200.881 122.178 -121.107 1.00 40.53  ? 280  ARG C CD    1 
ATOM   9041  N NE    . ARG C  1 280 ? 201.845 123.244 -121.357 1.00 42.74  ? 280  ARG C NE    1 
ATOM   9042  C CZ    . ARG C  1 280 ? 202.019 123.824 -122.539 1.00 44.84  ? 280  ARG C CZ    1 
ATOM   9043  N NH1   . ARG C  1 280 ? 201.286 123.444 -123.582 1.00 45.58  ? 280  ARG C NH1   1 
ATOM   9044  N NH2   . ARG C  1 280 ? 202.933 124.773 -122.685 1.00 46.56  ? 280  ARG C NH2   1 
ATOM   9045  N N     . ARG C  1 281 ? 205.508 119.312 -120.567 1.00 40.27  ? 281  ARG C N     1 
ATOM   9046  C CA    . ARG C  1 281 ? 206.744 119.066 -119.860 1.00 39.62  ? 281  ARG C CA    1 
ATOM   9047  C C     . ARG C  1 281 ? 207.476 120.387 -119.630 1.00 39.80  ? 281  ARG C C     1 
ATOM   9048  O O     . ARG C  1 281 ? 207.234 121.380 -120.326 1.00 37.17  ? 281  ARG C O     1 
ATOM   9049  C CB    . ARG C  1 281 ? 207.591 118.107 -120.674 1.00 39.43  ? 281  ARG C CB    1 
ATOM   9050  C CG    . ARG C  1 281 ? 207.817 118.585 -122.079 1.00 42.23  ? 281  ARG C CG    1 
ATOM   9051  C CD    . ARG C  1 281 ? 208.471 117.514 -122.912 1.00 45.38  ? 281  ARG C CD    1 
ATOM   9052  N NE    . ARG C  1 281 ? 209.104 118.067 -124.107 1.00 47.30  ? 281  ARG C NE    1 
ATOM   9053  C CZ    . ARG C  1 281 ? 209.733 117.339 -125.027 1.00 46.95  ? 281  ARG C CZ    1 
ATOM   9054  N NH1   . ARG C  1 281 ? 209.814 116.014 -124.897 1.00 45.35  ? 281  ARG C NH1   1 
ATOM   9055  N NH2   . ARG C  1 281 ? 210.289 117.942 -126.069 1.00 46.10  ? 281  ARG C NH2   1 
ATOM   9056  N N     . PRO C  1 282 ? 208.382 120.410 -118.642 1.00 40.51  ? 282  PRO C N     1 
ATOM   9057  C CA    . PRO C  1 282 ? 209.155 121.601 -118.298 1.00 41.49  ? 282  PRO C CA    1 
ATOM   9058  C C     . PRO C  1 282 ? 210.004 122.112 -119.453 1.00 43.06  ? 282  PRO C C     1 
ATOM   9059  O O     . PRO C  1 282 ? 210.496 121.334 -120.264 1.00 42.51  ? 282  PRO C O     1 
ATOM   9060  C CB    . PRO C  1 282 ? 210.031 121.125 -117.141 1.00 41.21  ? 282  PRO C CB    1 
ATOM   9061  C CG    . PRO C  1 282 ? 209.331 119.910 -116.623 1.00 40.40  ? 282  PRO C CG    1 
ATOM   9062  C CD    . PRO C  1 282 ? 208.828 119.254 -117.844 1.00 40.13  ? 282  PRO C CD    1 
ATOM   9063  N N     . PHE C  1 283 ? 210.182 123.426 -119.511 1.00 44.94  ? 283  PHE C N     1 
ATOM   9064  C CA    . PHE C  1 283 ? 211.001 124.036 -120.545 1.00 47.30  ? 283  PHE C CA    1 
ATOM   9065  C C     . PHE C  1 283 ? 212.238 124.707 -119.926 1.00 48.93  ? 283  PHE C C     1 
ATOM   9066  O O     . PHE C  1 283 ? 212.118 125.639 -119.133 1.00 48.39  ? 283  PHE C O     1 
ATOM   9067  C CB    . PHE C  1 283 ? 210.194 125.074 -121.312 1.00 46.94  ? 283  PHE C CB    1 
ATOM   9068  C CG    . PHE C  1 283 ? 210.892 125.591 -122.525 1.00 47.74  ? 283  PHE C CG    1 
ATOM   9069  C CD1   . PHE C  1 283 ? 210.974 124.817 -123.681 1.00 48.85  ? 283  PHE C CD1   1 
ATOM   9070  C CD2   . PHE C  1 283 ? 211.490 126.840 -122.516 1.00 47.73  ? 283  PHE C CD2   1 
ATOM   9071  C CE1   . PHE C  1 283 ? 211.645 125.285 -124.811 1.00 47.87  ? 283  PHE C CE1   1 
ATOM   9072  C CE2   . PHE C  1 283 ? 212.162 127.316 -123.640 1.00 47.40  ? 283  PHE C CE2   1 
ATOM   9073  C CZ    . PHE C  1 283 ? 212.239 126.537 -124.789 1.00 47.30  ? 283  PHE C CZ    1 
ATOM   9074  N N     . THR C  1 284 ? 213.419 124.229 -120.305 1.00 50.33  ? 284  THR C N     1 
ATOM   9075  C CA    . THR C  1 284 ? 214.676 124.766 -119.795 1.00 52.65  ? 284  THR C CA    1 
ATOM   9076  C C     . THR C  1 284 ? 215.754 124.828 -120.884 1.00 54.43  ? 284  THR C C     1 
ATOM   9077  O O     . THR C  1 284 ? 216.939 124.997 -120.589 1.00 53.54  ? 284  THR C O     1 
ATOM   9078  C CB    . THR C  1 284 ? 215.203 123.885 -118.649 1.00 52.11  ? 284  THR C CB    1 
ATOM   9079  O OG1   . THR C  1 284 ? 215.163 122.507 -119.047 1.00 52.33  ? 284  THR C OG1   1 
ATOM   9080  C CG2   . THR C  1 284 ? 214.365 124.069 -117.406 1.00 52.41  ? 284  THR C CG2   1 
ATOM   9081  N N     . LYS C  1 285 ? 215.328 124.697 -122.138 1.00 56.80  ? 285  LYS C N     1 
ATOM   9082  C CA    . LYS C  1 285 ? 216.233 124.689 -123.288 1.00 59.23  ? 285  LYS C CA    1 
ATOM   9083  C C     . LYS C  1 285 ? 217.196 125.877 -123.354 1.00 60.45  ? 285  LYS C C     1 
ATOM   9084  O O     . LYS C  1 285 ? 216.774 127.030 -123.447 1.00 59.22  ? 285  LYS C O     1 
ATOM   9085  C CB    . LYS C  1 285 ? 215.418 124.617 -124.589 1.00 59.46  ? 285  LYS C CB    1 
ATOM   9086  C CG    . LYS C  1 285 ? 216.176 124.116 -125.813 1.00 59.85  ? 285  LYS C CG    1 
ATOM   9087  C CD    . LYS C  1 285 ? 215.324 124.265 -127.069 1.00 61.61  ? 285  LYS C CD    1 
ATOM   9088  C CE    . LYS C  1 285 ? 216.002 123.680 -128.294 1.00 62.30  ? 285  LYS C CE    1 
ATOM   9089  N NZ    . LYS C  1 285 ? 216.183 122.211 -128.152 1.00 63.77  ? 285  LYS C NZ    1 
ATOM   9090  N N     . ASN C  1 286 ? 218.493 125.567 -123.304 1.00 62.49  ? 286  ASN C N     1 
ATOM   9091  C CA    . ASN C  1 286 ? 219.563 126.562 -123.387 1.00 64.50  ? 286  ASN C CA    1 
ATOM   9092  C C     . ASN C  1 286 ? 219.427 127.684 -122.377 1.00 65.19  ? 286  ASN C C     1 
ATOM   9093  O O     . ASN C  1 286 ? 219.557 128.867 -122.720 1.00 64.53  ? 286  ASN C O     1 
ATOM   9094  C CB    . ASN C  1 286 ? 219.631 127.166 -124.797 1.00 64.96  ? 286  ASN C CB    1 
ATOM   9095  C CG    . ASN C  1 286 ? 219.705 126.106 -125.890 1.00 65.31  ? 286  ASN C CG    1 
ATOM   9096  O OD1   . ASN C  1 286 ? 220.407 125.096 -125.756 1.00 65.14  ? 286  ASN C OD1   1 
ATOM   9097  N ND2   . ASN C  1 286 ? 218.983 126.340 -126.984 1.00 65.29  ? 286  ASN C ND2   1 
ATOM   9098  N N     . LEU C  1 287 ? 219.162 127.306 -121.131 1.00 65.93  ? 287  LEU C N     1 
ATOM   9099  C CA    . LEU C  1 287 ? 219.018 128.276 -120.059 1.00 65.59  ? 287  LEU C CA    1 
ATOM   9100  C C     . LEU C  1 287 ? 220.391 128.373 -119.412 1.00 65.35  ? 287  LEU C C     1 
ATOM   9101  O O     . LEU C  1 287 ? 220.709 129.355 -118.749 1.00 65.15  ? 287  LEU C O     1 
ATOM   9102  C CB    . LEU C  1 287 ? 217.973 127.797 -119.044 1.00 65.31  ? 287  LEU C CB    1 
ATOM   9103  C CG    . LEU C  1 287 ? 217.444 128.806 -118.020 1.00 64.13  ? 287  LEU C CG    1 
ATOM   9104  C CD1   . LEU C  1 287 ? 216.687 129.925 -118.714 1.00 62.97  ? 287  LEU C CD1   1 
ATOM   9105  C CD2   . LEU C  1 287 ? 216.542 128.088 -117.049 1.00 63.91  ? 287  LEU C CD2   1 
ATOM   9106  N N     . GLY C  1 288 ? 221.206 127.347 -119.635 1.00 64.87  ? 288  GLY C N     1 
ATOM   9107  C CA    . GLY C  1 288 ? 222.542 127.333 -119.079 1.00 65.12  ? 288  GLY C CA    1 
ATOM   9108  C C     . GLY C  1 288 ? 222.643 126.444 -117.861 1.00 65.29  ? 288  GLY C C     1 
ATOM   9109  O O     . GLY C  1 288 ? 223.674 126.390 -117.202 1.00 66.09  ? 288  GLY C O     1 
ATOM   9110  N N     . LEU C  1 289 ? 221.567 125.746 -117.543 1.00 65.34  ? 289  LEU C N     1 
ATOM   9111  C CA    . LEU C  1 289 ? 221.603 124.865 -116.396 1.00 65.63  ? 289  LEU C CA    1 
ATOM   9112  C C     . LEU C  1 289 ? 222.666 123.841 -116.728 1.00 66.50  ? 289  LEU C C     1 
ATOM   9113  O O     . LEU C  1 289 ? 223.366 123.323 -115.859 1.00 65.63  ? 289  LEU C O     1 
ATOM   9114  C CB    . LEU C  1 289 ? 220.247 124.198 -116.223 1.00 64.28  ? 289  LEU C CB    1 
ATOM   9115  C CG    . LEU C  1 289 ? 219.130 125.226 -116.306 1.00 63.46  ? 289  LEU C CG    1 
ATOM   9116  C CD1   . LEU C  1 289 ? 217.792 124.517 -116.184 1.00 63.27  ? 289  LEU C CD1   1 
ATOM   9117  C CD2   . LEU C  1 289 ? 219.320 126.279 -115.210 1.00 61.95  ? 289  LEU C CD2   1 
ATOM   9118  N N     . GLU C  1 290 ? 222.779 123.566 -118.019 1.00 68.84  ? 290  GLU C N     1 
ATOM   9119  C CA    . GLU C  1 290 ? 223.749 122.614 -118.500 1.00 70.55  ? 290  GLU C CA    1 
ATOM   9120  C C     . GLU C  1 290 ? 225.097 123.083 -117.963 1.00 72.88  ? 290  GLU C C     1 
ATOM   9121  O O     . GLU C  1 290 ? 225.840 122.302 -117.373 1.00 73.29  ? 290  GLU C O     1 
ATOM   9122  C CB    . GLU C  1 290 ? 223.741 122.588 -120.034 1.00 69.79  ? 290  GLU C CB    1 
ATOM   9123  C CG    . GLU C  1 290 ? 222.340 122.509 -120.692 1.00 67.69  ? 290  GLU C CG    1 
ATOM   9124  C CD    . GLU C  1 290 ? 221.645 123.870 -120.820 1.00 66.76  ? 290  GLU C CD    1 
ATOM   9125  O OE1   . GLU C  1 290 ? 222.243 124.810 -121.391 1.00 66.40  ? 290  GLU C OE1   1 
ATOM   9126  O OE2   . GLU C  1 290 ? 220.493 124.003 -120.364 1.00 65.11  ? 290  GLU C OE2   1 
ATOM   9127  N N     . GLU C  1 291 ? 225.377 124.377 -118.128 1.00 75.37  ? 291  GLU C N     1 
ATOM   9128  C CA    . GLU C  1 291 ? 226.639 124.983 -117.681 1.00 77.41  ? 291  GLU C CA    1 
ATOM   9129  C C     . GLU C  1 291 ? 226.770 125.062 -116.164 1.00 77.05  ? 291  GLU C C     1 
ATOM   9130  O O     . GLU C  1 291 ? 227.703 124.505 -115.590 1.00 77.61  ? 291  GLU C O     1 
ATOM   9131  C CB    . GLU C  1 291 ? 226.794 126.405 -118.246 1.00 79.98  ? 291  GLU C CB    1 
ATOM   9132  C CG    . GLU C  1 291 ? 226.310 126.603 -119.690 1.00 85.06  ? 291  GLU C CG    1 
ATOM   9133  C CD    . GLU C  1 291 ? 226.930 125.619 -120.682 1.00 87.73  ? 291  GLU C CD    1 
ATOM   9134  O OE1   . GLU C  1 291 ? 228.178 125.481 -120.681 1.00 89.11  ? 291  GLU C OE1   1 
ATOM   9135  O OE2   . GLU C  1 291 ? 226.167 124.995 -121.465 1.00 88.07  ? 291  GLU C OE2   1 
ATOM   9136  N N     . LEU C  1 292 ? 225.835 125.771 -115.533 1.00 76.46  ? 292  LEU C N     1 
ATOM   9137  C CA    . LEU C  1 292 ? 225.800 125.974 -114.080 1.00 75.78  ? 292  LEU C CA    1 
ATOM   9138  C C     . LEU C  1 292 ? 226.056 124.746 -113.214 1.00 75.03  ? 292  LEU C C     1 
ATOM   9139  O O     . LEU C  1 292 ? 226.693 124.843 -112.160 1.00 74.75  ? 292  LEU C O     1 
ATOM   9140  C CB    . LEU C  1 292 ? 224.452 126.564 -113.669 1.00 76.34  ? 292  LEU C CB    1 
ATOM   9141  C CG    . LEU C  1 292 ? 224.167 128.025 -113.991 1.00 76.82  ? 292  LEU C CG    1 
ATOM   9142  C CD1   . LEU C  1 292 ? 222.691 128.306 -113.754 1.00 77.09  ? 292  LEU C CD1   1 
ATOM   9143  C CD2   . LEU C  1 292 ? 225.054 128.925 -113.133 1.00 76.55  ? 292  LEU C CD2   1 
ATOM   9144  N N     . GLY C  1 293 ? 225.542 123.600 -113.647 1.00 74.26  ? 293  GLY C N     1 
ATOM   9145  C CA    . GLY C  1 293 ? 225.714 122.381 -112.878 1.00 73.35  ? 293  GLY C CA    1 
ATOM   9146  C C     . GLY C  1 293 ? 224.414 122.016 -112.184 1.00 72.32  ? 293  GLY C C     1 
ATOM   9147  O O     . GLY C  1 293 ? 224.398 121.418 -111.108 1.00 72.30  ? 293  GLY C O     1 
ATOM   9148  N N     . ILE C  1 294 ? 223.310 122.397 -112.813 1.00 71.34  ? 294  ILE C N     1 
ATOM   9149  C CA    . ILE C  1 294 ? 221.986 122.115 -112.292 1.00 69.53  ? 294  ILE C CA    1 
ATOM   9150  C C     . ILE C  1 294 ? 221.397 120.955 -113.080 1.00 68.67  ? 294  ILE C C     1 
ATOM   9151  O O     . ILE C  1 294 ? 220.857 121.138 -114.168 1.00 67.30  ? 294  ILE C O     1 
ATOM   9152  C CB    . ILE C  1 294 ? 221.089 123.342 -112.435 1.00 69.07  ? 294  ILE C CB    1 
ATOM   9153  C CG1   . ILE C  1 294 ? 221.616 124.458 -111.528 1.00 68.91  ? 294  ILE C CG1   1 
ATOM   9154  C CG2   . ILE C  1 294 ? 219.667 122.983 -112.099 1.00 68.68  ? 294  ILE C CG2   1 
ATOM   9155  C CD1   . ILE C  1 294 ? 220.909 125.787 -111.679 1.00 68.13  ? 294  ILE C CD1   1 
ATOM   9156  N N     . GLU C  1 295 ? 221.526 119.755 -112.525 1.00 68.88  ? 295  GLU C N     1 
ATOM   9157  C CA    . GLU C  1 295 ? 221.013 118.555 -113.170 1.00 69.37  ? 295  GLU C CA    1 
ATOM   9158  C C     . GLU C  1 295 ? 219.529 118.390 -112.854 1.00 67.98  ? 295  GLU C C     1 
ATOM   9159  O O     . GLU C  1 295 ? 219.114 118.520 -111.702 1.00 68.21  ? 295  GLU C O     1 
ATOM   9160  C CB    . GLU C  1 295 ? 221.812 117.323 -112.714 1.00 71.29  ? 295  GLU C CB    1 
ATOM   9161  C CG    . GLU C  1 295 ? 221.799 117.051 -111.209 1.00 75.37  ? 295  GLU C CG    1 
ATOM   9162  C CD    . GLU C  1 295 ? 222.809 115.978 -110.797 1.00 77.06  ? 295  GLU C CD    1 
ATOM   9163  O OE1   . GLU C  1 295 ? 222.754 114.856 -111.360 1.00 77.55  ? 295  GLU C OE1   1 
ATOM   9164  O OE2   . GLU C  1 295 ? 223.656 116.260 -109.914 1.00 77.37  ? 295  GLU C OE2   1 
ATOM   9165  N N     . LEU C  1 296 ? 218.737 118.112 -113.885 1.00 65.35  ? 296  LEU C N     1 
ATOM   9166  C CA    . LEU C  1 296 ? 217.294 117.951 -113.736 1.00 63.29  ? 296  LEU C CA    1 
ATOM   9167  C C     . LEU C  1 296 ? 216.890 116.560 -113.240 1.00 62.42  ? 296  LEU C C     1 
ATOM   9168  O O     . LEU C  1 296 ? 217.727 115.662 -113.151 1.00 62.58  ? 296  LEU C O     1 
ATOM   9169  C CB    . LEU C  1 296 ? 216.628 118.219 -115.078 1.00 62.02  ? 296  LEU C CB    1 
ATOM   9170  C CG    . LEU C  1 296 ? 217.138 119.476 -115.769 1.00 62.01  ? 296  LEU C CG    1 
ATOM   9171  C CD1   . LEU C  1 296 ? 216.776 119.429 -117.244 1.00 61.70  ? 296  LEU C CD1   1 
ATOM   9172  C CD2   . LEU C  1 296 ? 216.563 120.706 -115.085 1.00 61.61  ? 296  LEU C CD2   1 
ATOM   9173  N N     . ASP C  1 297 ? 215.612 116.387 -112.897 1.00 61.03  ? 297  ASP C N     1 
ATOM   9174  C CA    . ASP C  1 297 ? 215.140 115.079 -112.457 1.00 59.58  ? 297  ASP C CA    1 
ATOM   9175  C C     . ASP C  1 297 ? 214.729 114.364 -113.732 1.00 58.23  ? 297  ASP C C     1 
ATOM   9176  O O     . ASP C  1 297 ? 214.699 114.971 -114.803 1.00 57.08  ? 297  ASP C O     1 
ATOM   9177  C CB    . ASP C  1 297 ? 213.961 115.180 -111.452 1.00 59.96  ? 297  ASP C CB    1 
ATOM   9178  C CG    . ASP C  1 297 ? 212.660 115.707 -112.070 1.00 60.00  ? 297  ASP C CG    1 
ATOM   9179  O OD1   . ASP C  1 297 ? 212.560 115.851 -113.304 1.00 60.45  ? 297  ASP C OD1   1 
ATOM   9180  O OD2   . ASP C  1 297 ? 211.716 115.971 -111.297 1.00 59.32  ? 297  ASP C OD2   1 
ATOM   9181  N N     . PRO C  1 298 ? 214.414 113.069 -113.644 1.00 57.54  ? 298  PRO C N     1 
ATOM   9182  C CA    . PRO C  1 298 ? 214.017 112.324 -114.839 1.00 57.01  ? 298  PRO C CA    1 
ATOM   9183  C C     . PRO C  1 298 ? 212.949 112.992 -115.699 1.00 56.56  ? 298  PRO C C     1 
ATOM   9184  O O     . PRO C  1 298 ? 213.003 112.911 -116.923 1.00 57.27  ? 298  PRO C O     1 
ATOM   9185  C CB    . PRO C  1 298 ? 213.549 110.998 -114.267 1.00 56.93  ? 298  PRO C CB    1 
ATOM   9186  C CG    . PRO C  1 298 ? 214.435 110.831 -113.097 1.00 57.65  ? 298  PRO C CG    1 
ATOM   9187  C CD    . PRO C  1 298 ? 214.389 112.195 -112.463 1.00 57.49  ? 298  PRO C CD    1 
ATOM   9188  N N     . ARG C  1 299 ? 211.985 113.655 -115.071 1.00 55.70  ? 299  ARG C N     1 
ATOM   9189  C CA    . ARG C  1 299 ? 210.918 114.312 -115.820 1.00 54.01  ? 299  ARG C CA    1 
ATOM   9190  C C     . ARG C  1 299 ? 211.286 115.685 -116.391 1.00 52.12  ? 299  ARG C C     1 
ATOM   9191  O O     . ARG C  1 299 ? 210.435 116.412 -116.892 1.00 52.32  ? 299  ARG C O     1 
ATOM   9192  C CB    . ARG C  1 299 ? 209.666 114.384 -114.942 1.00 55.65  ? 299  ARG C CB    1 
ATOM   9193  C CG    . ARG C  1 299 ? 209.044 112.994 -114.724 1.00 57.98  ? 299  ARG C CG    1 
ATOM   9194  C CD    . ARG C  1 299 ? 207.984 112.972 -113.643 1.00 59.57  ? 299  ARG C CD    1 
ATOM   9195  N NE    . ARG C  1 299 ? 206.907 113.909 -113.937 1.00 62.33  ? 299  ARG C NE    1 
ATOM   9196  C CZ    . ARG C  1 299 ? 205.891 114.156 -113.117 1.00 64.02  ? 299  ARG C CZ    1 
ATOM   9197  N NH1   . ARG C  1 299 ? 205.820 113.520 -111.948 1.00 63.67  ? 299  ARG C NH1   1 
ATOM   9198  N NH2   . ARG C  1 299 ? 204.963 115.050 -113.460 1.00 63.49  ? 299  ARG C NH2   1 
ATOM   9199  N N     . GLY C  1 300 ? 212.569 116.022 -116.336 1.00 50.33  ? 300  GLY C N     1 
ATOM   9200  C CA    . GLY C  1 300 ? 213.028 117.288 -116.874 1.00 47.37  ? 300  GLY C CA    1 
ATOM   9201  C C     . GLY C  1 300 ? 212.727 118.487 -116.004 1.00 46.41  ? 300  GLY C C     1 
ATOM   9202  O O     . GLY C  1 300 ? 212.795 119.629 -116.465 1.00 45.38  ? 300  GLY C O     1 
ATOM   9203  N N     . ARG C  1 301 ? 212.401 118.241 -114.743 1.00 44.92  ? 301  ARG C N     1 
ATOM   9204  C CA    . ARG C  1 301 ? 212.093 119.340 -113.849 1.00 44.86  ? 301  ARG C CA    1 
ATOM   9205  C C     . ARG C  1 301 ? 213.300 119.778 -113.020 1.00 44.21  ? 301  ARG C C     1 
ATOM   9206  O O     . ARG C  1 301 ? 214.217 118.995 -112.754 1.00 43.72  ? 301  ARG C O     1 
ATOM   9207  C CB    . ARG C  1 301 ? 210.917 118.953 -112.945 1.00 45.49  ? 301  ARG C CB    1 
ATOM   9208  C CG    . ARG C  1 301 ? 209.673 118.567 -113.740 1.00 46.30  ? 301  ARG C CG    1 
ATOM   9209  C CD    . ARG C  1 301 ? 208.595 117.964 -112.882 1.00 47.16  ? 301  ARG C CD    1 
ATOM   9210  N NE    . ARG C  1 301 ? 209.103 116.803 -112.169 1.00 50.28  ? 301  ARG C NE    1 
ATOM   9211  C CZ    . ARG C  1 301 ? 208.376 116.052 -111.353 1.00 51.74  ? 301  ARG C CZ    1 
ATOM   9212  N NH1   . ARG C  1 301 ? 207.094 116.341 -111.151 1.00 52.51  ? 301  ARG C NH1   1 
ATOM   9213  N NH2   . ARG C  1 301 ? 208.941 115.025 -110.726 1.00 53.19  ? 301  ARG C NH2   1 
ATOM   9214  N N     . ILE C  1 302 ? 213.295 121.049 -112.636 1.00 42.82  ? 302  ILE C N     1 
ATOM   9215  C CA    . ILE C  1 302 ? 214.362 121.614 -111.834 1.00 42.12  ? 302  ILE C CA    1 
ATOM   9216  C C     . ILE C  1 302 ? 214.168 121.327 -110.344 1.00 43.68  ? 302  ILE C C     1 
ATOM   9217  O O     . ILE C  1 302 ? 213.181 121.770 -109.745 1.00 42.44  ? 302  ILE C O     1 
ATOM   9218  C CB    . ILE C  1 302 ? 214.418 123.118 -112.013 1.00 41.16  ? 302  ILE C CB    1 
ATOM   9219  C CG1   . ILE C  1 302 ? 214.658 123.452 -113.480 1.00 40.08  ? 302  ILE C CG1   1 
ATOM   9220  C CG2   . ILE C  1 302 ? 215.496 123.694 -111.118 1.00 39.85  ? 302  ILE C CG2   1 
ATOM   9221  C CD1   . ILE C  1 302 ? 214.857 124.917 -113.753 1.00 40.53  ? 302  ILE C CD1   1 
ATOM   9222  N N     . PRO C  1 303 ? 215.108 120.580 -109.726 1.00 44.72  ? 303  PRO C N     1 
ATOM   9223  C CA    . PRO C  1 303 ? 215.002 120.257 -108.296 1.00 45.59  ? 303  PRO C CA    1 
ATOM   9224  C C     . PRO C  1 303 ? 215.108 121.504 -107.423 1.00 46.67  ? 303  PRO C C     1 
ATOM   9225  O O     . PRO C  1 303 ? 216.009 122.319 -107.614 1.00 47.30  ? 303  PRO C O     1 
ATOM   9226  C CB    . PRO C  1 303 ? 216.174 119.296 -108.064 1.00 45.61  ? 303  PRO C CB    1 
ATOM   9227  C CG    . PRO C  1 303 ? 216.360 118.638 -109.406 1.00 44.12  ? 303  PRO C CG    1 
ATOM   9228  C CD    . PRO C  1 303 ? 216.193 119.805 -110.360 1.00 44.25  ? 303  PRO C CD    1 
ATOM   9229  N N     . VAL C  1 304 ? 214.199 121.654 -106.464 1.00 46.90  ? 304  VAL C N     1 
ATOM   9230  C CA    . VAL C  1 304 ? 214.230 122.812 -105.580 1.00 46.34  ? 304  VAL C CA    1 
ATOM   9231  C C     . VAL C  1 304 ? 213.954 122.430 -104.142 1.00 47.27  ? 304  VAL C C     1 
ATOM   9232  O O     . VAL C  1 304 ? 213.372 121.383 -103.864 1.00 46.87  ? 304  VAL C O     1 
ATOM   9233  C CB    . VAL C  1 304 ? 213.183 123.861 -105.976 1.00 46.23  ? 304  VAL C CB    1 
ATOM   9234  C CG1   . VAL C  1 304 ? 213.590 124.546 -107.253 1.00 45.56  ? 304  VAL C CG1   1 
ATOM   9235  C CG2   . VAL C  1 304 ? 211.820 123.195 -106.121 1.00 46.76  ? 304  VAL C CG2   1 
ATOM   9236  N N     . ASN C  1 305 ? 214.375 123.290 -103.223 1.00 48.53  ? 305  ASN C N     1 
ATOM   9237  C CA    . ASN C  1 305 ? 214.138 123.032 -101.818 1.00 50.07  ? 305  ASN C CA    1 
ATOM   9238  C C     . ASN C  1 305 ? 212.826 123.701 -101.405 1.00 51.01  ? 305  ASN C C     1 
ATOM   9239  O O     . ASN C  1 305 ? 212.087 124.207 -102.255 1.00 51.34  ? 305  ASN C O     1 
ATOM   9240  C CB    . ASN C  1 305 ? 215.332 123.505 -100.967 1.00 50.15  ? 305  ASN C CB    1 
ATOM   9241  C CG    . ASN C  1 305 ? 215.447 125.023 -100.863 1.00 50.24  ? 305  ASN C CG    1 
ATOM   9242  O OD1   . ASN C  1 305 ? 214.703 125.780 -101.495 1.00 49.46  ? 305  ASN C OD1   1 
ATOM   9243  N ND2   . ASN C  1 305 ? 216.394 125.472 -100.044 1.00 49.07  ? 305  ASN C ND2   1 
ATOM   9244  N N     . THR C  1 306 ? 212.532 123.698 -100.109 1.00 51.85  ? 306  THR C N     1 
ATOM   9245  C CA    . THR C  1 306 ? 211.285 124.265 -99.594  1.00 52.34  ? 306  THR C CA    1 
ATOM   9246  C C     . THR C  1 306 ? 211.072 125.770 -99.820  1.00 52.67  ? 306  THR C C     1 
ATOM   9247  O O     . THR C  1 306 ? 209.941 126.253 -99.728  1.00 51.84  ? 306  THR C O     1 
ATOM   9248  C CB    . THR C  1 306 ? 211.158 123.965 -98.099  1.00 52.92  ? 306  THR C CB    1 
ATOM   9249  O OG1   . THR C  1 306 ? 211.775 125.016 -97.346  1.00 54.95  ? 306  THR C OG1   1 
ATOM   9250  C CG2   . THR C  1 306 ? 211.880 122.655 -97.775  1.00 55.13  ? 306  THR C CG2   1 
ATOM   9251  N N     . ARG C  1 307 ? 212.149 126.507 -100.103 1.00 53.32  ? 307  ARG C N     1 
ATOM   9252  C CA    . ARG C  1 307 ? 212.058 127.951 -100.354 1.00 53.04  ? 307  ARG C CA    1 
ATOM   9253  C C     . ARG C  1 307 ? 212.099 128.238 -101.854 1.00 53.08  ? 307  ARG C C     1 
ATOM   9254  O O     . ARG C  1 307 ? 212.111 129.388 -102.277 1.00 52.78  ? 307  ARG C O     1 
ATOM   9255  C CB    . ARG C  1 307 ? 213.219 128.699 -99.694  1.00 53.93  ? 307  ARG C CB    1 
ATOM   9256  C CG    . ARG C  1 307 ? 213.422 128.395 -98.235  1.00 54.89  ? 307  ARG C CG    1 
ATOM   9257  C CD    . ARG C  1 307 ? 214.524 129.272 -97.675  1.00 57.15  ? 307  ARG C CD    1 
ATOM   9258  N NE    . ARG C  1 307 ? 214.159 130.686 -97.722  1.00 57.98  ? 307  ARG C NE    1 
ATOM   9259  C CZ    . ARG C  1 307 ? 213.294 131.269 -96.890  1.00 59.57  ? 307  ARG C CZ    1 
ATOM   9260  N NH1   . ARG C  1 307 ? 212.697 130.564 -95.925  1.00 58.18  ? 307  ARG C NH1   1 
ATOM   9261  N NH2   . ARG C  1 307 ? 213.008 132.563 -97.037  1.00 58.98  ? 307  ARG C NH2   1 
ATOM   9262  N N     . PHE C  1 308 ? 212.134 127.179 -102.654 1.00 53.37  ? 308  PHE C N     1 
ATOM   9263  C CA    . PHE C  1 308 ? 212.178 127.292 -104.110 1.00 53.19  ? 308  PHE C CA    1 
ATOM   9264  C C     . PHE C  1 308 ? 213.570 127.593 -104.658 1.00 54.30  ? 308  PHE C C     1 
ATOM   9265  O O     . PHE C  1 308 ? 213.734 128.094 -105.774 1.00 54.35  ? 308  PHE C O     1 
ATOM   9266  C CB    . PHE C  1 308 ? 211.132 128.308 -104.584 1.00 50.87  ? 308  PHE C CB    1 
ATOM   9267  C CG    . PHE C  1 308 ? 209.734 127.765 -104.521 1.00 49.81  ? 308  PHE C CG    1 
ATOM   9268  C CD1   . PHE C  1 308 ? 209.271 126.893 -105.506 1.00 48.85  ? 308  PHE C CD1   1 
ATOM   9269  C CD2   . PHE C  1 308 ? 208.929 128.001 -103.413 1.00 49.41  ? 308  PHE C CD2   1 
ATOM   9270  C CE1   . PHE C  1 308 ? 208.037 126.260 -105.382 1.00 47.98  ? 308  PHE C CE1   1 
ATOM   9271  C CE2   . PHE C  1 308 ? 207.686 127.365 -103.282 1.00 48.25  ? 308  PHE C CE2   1 
ATOM   9272  C CZ    . PHE C  1 308 ? 207.246 126.494 -104.268 1.00 47.45  ? 308  PHE C CZ    1 
ATOM   9273  N N     . GLN C  1 309 ? 214.571 127.227 -103.860 1.00 55.72  ? 309  GLN C N     1 
ATOM   9274  C CA    . GLN C  1 309 ? 215.978 127.400 -104.209 1.00 56.52  ? 309  GLN C CA    1 
ATOM   9275  C C     . GLN C  1 309 ? 216.528 126.165 -104.907 1.00 56.38  ? 309  GLN C C     1 
ATOM   9276  O O     . GLN C  1 309 ? 216.178 125.035 -104.560 1.00 56.08  ? 309  GLN C O     1 
ATOM   9277  C CB    . GLN C  1 309 ? 216.827 127.628 -102.956 1.00 56.93  ? 309  GLN C CB    1 
ATOM   9278  C CG    . GLN C  1 309 ? 216.671 128.966 -102.275 1.00 58.20  ? 309  GLN C CG    1 
ATOM   9279  C CD    . GLN C  1 309 ? 217.493 129.037 -101.000 1.00 58.43  ? 309  GLN C CD    1 
ATOM   9280  O OE1   . GLN C  1 309 ? 217.240 128.300 -100.040 1.00 57.88  ? 309  GLN C OE1   1 
ATOM   9281  N NE2   . GLN C  1 309 ? 218.494 129.915 -100.989 1.00 58.22  ? 309  GLN C NE2   1 
ATOM   9282  N N     . THR C  1 310 ? 217.414 126.390 -105.871 1.00 57.08  ? 310  THR C N     1 
ATOM   9283  C CA    . THR C  1 310 ? 218.043 125.295 -106.594 1.00 58.81  ? 310  THR C CA    1 
ATOM   9284  C C     . THR C  1 310 ? 219.332 124.861 -105.884 1.00 59.22  ? 310  THR C C     1 
ATOM   9285  O O     . THR C  1 310 ? 219.506 125.117 -104.691 1.00 58.82  ? 310  THR C O     1 
ATOM   9286  C CB    . THR C  1 310 ? 218.358 125.708 -108.042 1.00 58.40  ? 310  THR C CB    1 
ATOM   9287  O OG1   . THR C  1 310 ? 219.470 126.609 -108.065 1.00 57.74  ? 310  THR C OG1   1 
ATOM   9288  C CG2   . THR C  1 310 ? 217.147 126.385 -108.650 1.00 57.55  ? 310  THR C CG2   1 
ATOM   9289  N N     . LYS C  1 311 ? 220.226 124.195 -106.605 1.00 60.46  ? 311  LYS C N     1 
ATOM   9290  C CA    . LYS C  1 311 ? 221.473 123.763 -105.998 1.00 62.28  ? 311  LYS C CA    1 
ATOM   9291  C C     . LYS C  1 311 ? 222.256 125.026 -105.623 1.00 62.57  ? 311  LYS C C     1 
ATOM   9292  O O     . LYS C  1 311 ? 222.948 125.056 -104.613 1.00 62.83  ? 311  LYS C O     1 
ATOM   9293  C CB    . LYS C  1 311 ? 222.269 122.881 -106.972 1.00 63.89  ? 311  LYS C CB    1 
ATOM   9294  C CG    . LYS C  1 311 ? 223.129 121.823 -106.283 1.00 65.10  ? 311  LYS C CG    1 
ATOM   9295  C CD    . LYS C  1 311 ? 223.602 120.742 -107.257 1.00 66.72  ? 311  LYS C CD    1 
ATOM   9296  C CE    . LYS C  1 311 ? 224.342 119.610 -106.527 1.00 67.25  ? 311  LYS C CE    1 
ATOM   9297  N NZ    . LYS C  1 311 ? 224.684 118.450 -107.410 1.00 66.53  ? 311  LYS C NZ    1 
ATOM   9298  N N     . ILE C  1 312 ? 222.117 126.073 -106.434 1.00 63.11  ? 312  ILE C N     1 
ATOM   9299  C CA    . ILE C  1 312 ? 222.776 127.361 -106.201 1.00 63.54  ? 312  ILE C CA    1 
ATOM   9300  C C     . ILE C  1 312 ? 221.800 128.281 -105.450 1.00 64.37  ? 312  ILE C C     1 
ATOM   9301  O O     . ILE C  1 312 ? 220.811 128.740 -106.023 1.00 64.55  ? 312  ILE C O     1 
ATOM   9302  C CB    . ILE C  1 312 ? 223.143 128.020 -107.523 1.00 63.01  ? 312  ILE C CB    1 
ATOM   9303  C CG1   . ILE C  1 312 ? 223.932 127.037 -108.382 1.00 62.84  ? 312  ILE C CG1   1 
ATOM   9304  C CG2   . ILE C  1 312 ? 223.941 129.275 -107.267 1.00 62.74  ? 312  ILE C CG2   1 
ATOM   9305  C CD1   . ILE C  1 312 ? 224.200 127.548 -109.777 1.00 64.84  ? 312  ILE C CD1   1 
ATOM   9306  N N     . PRO C  1 313 ? 222.092 128.589 -104.169 1.00 64.89  ? 313  PRO C N     1 
ATOM   9307  C CA    . PRO C  1 313 ? 221.283 129.431 -103.276 1.00 64.11  ? 313  PRO C CA    1 
ATOM   9308  C C     . PRO C  1 313 ? 220.644 130.709 -103.786 1.00 62.62  ? 313  PRO C C     1 
ATOM   9309  O O     . PRO C  1 313 ? 219.618 131.132 -103.258 1.00 61.99  ? 313  PRO C O     1 
ATOM   9310  C CB    . PRO C  1 313 ? 222.222 129.688 -102.100 1.00 65.04  ? 313  PRO C CB    1 
ATOM   9311  C CG    . PRO C  1 313 ? 223.003 128.423 -102.040 1.00 65.87  ? 313  PRO C CG    1 
ATOM   9312  C CD    . PRO C  1 313 ? 223.360 128.239 -103.502 1.00 65.21  ? 313  PRO C CD    1 
ATOM   9313  N N     . ASN C  1 314 ? 221.221 131.336 -104.797 1.00 61.27  ? 314  ASN C N     1 
ATOM   9314  C CA    . ASN C  1 314 ? 220.619 132.567 -105.287 1.00 60.50  ? 314  ASN C CA    1 
ATOM   9315  C C     . ASN C  1 314 ? 219.827 132.357 -106.561 1.00 59.91  ? 314  ASN C C     1 
ATOM   9316  O O     . ASN C  1 314 ? 219.374 133.321 -107.183 1.00 58.89  ? 314  ASN C O     1 
ATOM   9317  C CB    . ASN C  1 314 ? 221.686 133.621 -105.523 1.00 60.90  ? 314  ASN C CB    1 
ATOM   9318  C CG    . ASN C  1 314 ? 222.707 133.175 -106.521 1.00 61.85  ? 314  ASN C CG    1 
ATOM   9319  O OD1   . ASN C  1 314 ? 223.296 132.107 -106.373 1.00 62.53  ? 314  ASN C OD1   1 
ATOM   9320  N ND2   . ASN C  1 314 ? 222.927 133.986 -107.553 1.00 62.85  ? 314  ASN C ND2   1 
ATOM   9321  N N     . ILE C  1 315 ? 219.665 131.097 -106.951 1.00 59.18  ? 315  ILE C N     1 
ATOM   9322  C CA    . ILE C  1 315 ? 218.905 130.769 -108.150 1.00 58.67  ? 315  ILE C CA    1 
ATOM   9323  C C     . ILE C  1 315 ? 217.667 129.945 -107.767 1.00 57.82  ? 315  ILE C C     1 
ATOM   9324  O O     . ILE C  1 315 ? 217.779 128.863 -107.191 1.00 57.37  ? 315  ILE C O     1 
ATOM   9325  C CB    . ILE C  1 315 ? 219.789 130.005 -109.169 1.00 58.81  ? 315  ILE C CB    1 
ATOM   9326  C CG1   . ILE C  1 315 ? 220.977 130.888 -109.581 1.00 59.03  ? 315  ILE C CG1   1 
ATOM   9327  C CG2   . ILE C  1 315 ? 218.986 129.645 -110.402 1.00 57.92  ? 315  ILE C CG2   1 
ATOM   9328  C CD1   . ILE C  1 315 ? 221.879 130.278 -110.639 1.00 58.93  ? 315  ILE C CD1   1 
ATOM   9329  N N     . TYR C  1 316 ? 216.487 130.482 -108.085 1.00 56.63  ? 316  TYR C N     1 
ATOM   9330  C CA    . TYR C  1 316 ? 215.211 129.839 -107.767 1.00 54.85  ? 316  TYR C CA    1 
ATOM   9331  C C     . TYR C  1 316 ? 214.435 129.429 -109.016 1.00 53.61  ? 316  TYR C C     1 
ATOM   9332  O O     . TYR C  1 316 ? 214.659 129.960 -110.113 1.00 52.67  ? 316  TYR C O     1 
ATOM   9333  C CB    . TYR C  1 316 ? 214.313 130.786 -106.956 1.00 55.52  ? 316  TYR C CB    1 
ATOM   9334  C CG    . TYR C  1 316 ? 214.964 131.426 -105.755 1.00 55.85  ? 316  TYR C CG    1 
ATOM   9335  C CD1   . TYR C  1 316 ? 215.995 132.359 -105.906 1.00 56.87  ? 316  TYR C CD1   1 
ATOM   9336  C CD2   . TYR C  1 316 ? 214.566 131.087 -104.465 1.00 55.18  ? 316  TYR C CD2   1 
ATOM   9337  C CE1   . TYR C  1 316 ? 216.612 132.929 -104.802 1.00 57.25  ? 316  TYR C CE1   1 
ATOM   9338  C CE2   . TYR C  1 316 ? 215.172 131.652 -103.356 1.00 56.12  ? 316  TYR C CE2   1 
ATOM   9339  C CZ    . TYR C  1 316 ? 216.195 132.570 -103.528 1.00 57.17  ? 316  TYR C CZ    1 
ATOM   9340  O OH    . TYR C  1 316 ? 216.807 133.128 -102.436 1.00 56.67  ? 316  TYR C OH    1 
ATOM   9341  N N     . ALA C  1 317 ? 213.501 128.500 -108.829 1.00 51.20  ? 317  ALA C N     1 
ATOM   9342  C CA    . ALA C  1 317 ? 212.657 128.010 -109.920 1.00 49.13  ? 317  ALA C CA    1 
ATOM   9343  C C     . ALA C  1 317 ? 211.239 127.750 -109.411 1.00 47.13  ? 317  ALA C C     1 
ATOM   9344  O O     . ALA C  1 317 ? 211.040 127.073 -108.402 1.00 47.52  ? 317  ALA C O     1 
ATOM   9345  C CB    . ALA C  1 317 ? 213.249 126.725 -110.511 1.00 50.13  ? 317  ALA C CB    1 
ATOM   9346  N N     . ILE C  1 318 ? 210.252 128.290 -110.109 1.00 44.11  ? 318  ILE C N     1 
ATOM   9347  C CA    . ILE C  1 318 ? 208.867 128.113 -109.699 1.00 40.19  ? 318  ILE C CA    1 
ATOM   9348  C C     . ILE C  1 318 ? 208.004 127.764 -110.903 1.00 39.37  ? 318  ILE C C     1 
ATOM   9349  O O     . ILE C  1 318 ? 208.450 127.890 -112.038 1.00 37.45  ? 318  ILE C O     1 
ATOM   9350  C CB    . ILE C  1 318 ? 208.316 129.397 -109.099 1.00 38.83  ? 318  ILE C CB    1 
ATOM   9351  C CG1   . ILE C  1 318 ? 208.370 130.501 -110.154 1.00 37.86  ? 318  ILE C CG1   1 
ATOM   9352  C CG2   . ILE C  1 318 ? 209.138 129.803 -107.906 1.00 38.78  ? 318  ILE C CG2   1 
ATOM   9353  C CD1   . ILE C  1 318 ? 207.273 131.495 -110.052 1.00 39.42  ? 318  ILE C CD1   1 
ATOM   9354  N N     . GLY C  1 319 ? 206.778 127.311 -110.638 1.00 37.98  ? 319  GLY C N     1 
ATOM   9355  C CA    . GLY C  1 319 ? 205.834 126.995 -111.693 1.00 37.21  ? 319  GLY C CA    1 
ATOM   9356  C C     . GLY C  1 319 ? 205.995 125.693 -112.442 1.00 36.16  ? 319  GLY C C     1 
ATOM   9357  O O     . GLY C  1 319 ? 206.561 124.728 -111.933 1.00 36.16  ? 319  GLY C O     1 
ATOM   9358  N N     . ASP C  1 320 ? 205.516 125.684 -113.680 1.00 34.75  ? 320  ASP C N     1 
ATOM   9359  C CA    . ASP C  1 320 ? 205.577 124.482 -114.496 1.00 34.62  ? 320  ASP C CA    1 
ATOM   9360  C C     . ASP C  1 320 ? 206.927 123.830 -114.614 1.00 33.95  ? 320  ASP C C     1 
ATOM   9361  O O     . ASP C  1 320 ? 207.007 122.653 -114.943 1.00 34.20  ? 320  ASP C O     1 
ATOM   9362  C CB    . ASP C  1 320 ? 205.016 124.759 -115.887 1.00 33.75  ? 320  ASP C CB    1 
ATOM   9363  C CG    . ASP C  1 320 ? 203.492 124.692 -115.922 1.00 33.88  ? 320  ASP C CG    1 
ATOM   9364  O OD1   . ASP C  1 320 ? 202.860 124.519 -114.864 1.00 31.93  ? 320  ASP C OD1   1 
ATOM   9365  O OD2   . ASP C  1 320 ? 202.918 124.822 -117.011 1.00 36.27  ? 320  ASP C OD2   1 
ATOM   9366  N N     . VAL C  1 321 ? 207.985 124.571 -114.310 1.00 34.66  ? 321  VAL C N     1 
ATOM   9367  C CA    . VAL C  1 321 ? 209.336 124.032 -114.422 1.00 34.18  ? 321  VAL C CA    1 
ATOM   9368  C C     . VAL C  1 321 ? 209.773 123.182 -113.240 1.00 33.45  ? 321  VAL C C     1 
ATOM   9369  O O     . VAL C  1 321 ? 210.791 122.493 -113.313 1.00 32.96  ? 321  VAL C O     1 
ATOM   9370  C CB    . VAL C  1 321 ? 210.367 125.153 -114.667 1.00 35.01  ? 321  VAL C CB    1 
ATOM   9371  C CG1   . VAL C  1 321 ? 211.064 125.553 -113.375 1.00 35.28  ? 321  VAL C CG1   1 
ATOM   9372  C CG2   . VAL C  1 321 ? 211.363 124.687 -115.694 1.00 38.85  ? 321  VAL C CG2   1 
ATOM   9373  N N     . VAL C  1 322 ? 209.003 123.222 -112.157 1.00 34.16  ? 322  VAL C N     1 
ATOM   9374  C CA    . VAL C  1 322 ? 209.314 122.408 -110.977 1.00 36.00  ? 322  VAL C CA    1 
ATOM   9375  C C     . VAL C  1 322 ? 208.186 121.405 -110.672 1.00 36.39  ? 322  VAL C C     1 
ATOM   9376  O O     . VAL C  1 322 ? 207.172 121.365 -111.371 1.00 37.25  ? 322  VAL C O     1 
ATOM   9377  C CB    . VAL C  1 322 ? 209.562 123.281 -109.708 1.00 37.60  ? 322  VAL C CB    1 
ATOM   9378  C CG1   . VAL C  1 322 ? 210.769 124.222 -109.937 1.00 37.41  ? 322  VAL C CG1   1 
ATOM   9379  C CG2   . VAL C  1 322 ? 208.300 124.065 -109.351 1.00 35.66  ? 322  VAL C CG2   1 
ATOM   9380  N N     . ALA C  1 323 ? 208.374 120.595 -109.636 1.00 34.97  ? 323  ALA C N     1 
ATOM   9381  C CA    . ALA C  1 323 ? 207.387 119.600 -109.245 1.00 35.35  ? 323  ALA C CA    1 
ATOM   9382  C C     . ALA C  1 323 ? 206.083 120.232 -108.738 1.00 35.37  ? 323  ALA C C     1 
ATOM   9383  O O     . ALA C  1 323 ? 206.057 121.412 -108.400 1.00 36.54  ? 323  ALA C O     1 
ATOM   9384  C CB    . ALA C  1 323 ? 207.969 118.707 -108.183 1.00 34.26  ? 323  ALA C CB    1 
ATOM   9385  N N     . GLY C  1 324 ? 205.014 119.428 -108.682 1.00 35.32  ? 324  GLY C N     1 
ATOM   9386  C CA    . GLY C  1 324 ? 203.709 119.897 -108.239 1.00 34.02  ? 324  GLY C CA    1 
ATOM   9387  C C     . GLY C  1 324 ? 202.766 120.015 -109.420 1.00 34.46  ? 324  GLY C C     1 
ATOM   9388  O O     . GLY C  1 324 ? 203.206 119.931 -110.558 1.00 34.02  ? 324  GLY C O     1 
ATOM   9389  N N     . PRO C  1 325 ? 201.465 120.214 -109.195 1.00 34.55  ? 325  PRO C N     1 
ATOM   9390  C CA    . PRO C  1 325 ? 200.517 120.333 -110.305 1.00 33.93  ? 325  PRO C CA    1 
ATOM   9391  C C     . PRO C  1 325 ? 200.831 121.502 -111.225 1.00 34.13  ? 325  PRO C C     1 
ATOM   9392  O O     . PRO C  1 325 ? 201.100 122.611 -110.771 1.00 33.99  ? 325  PRO C O     1 
ATOM   9393  C CB    . PRO C  1 325 ? 199.179 120.511 -109.600 1.00 34.43  ? 325  PRO C CB    1 
ATOM   9394  C CG    . PRO C  1 325 ? 199.560 121.215 -108.346 1.00 35.27  ? 325  PRO C CG    1 
ATOM   9395  C CD    . PRO C  1 325 ? 200.802 120.474 -107.908 1.00 34.57  ? 325  PRO C CD    1 
ATOM   9396  N N     . MET C  1 326 ? 200.780 121.248 -112.527 1.00 34.39  ? 326  MET C N     1 
ATOM   9397  C CA    . MET C  1 326 ? 201.063 122.275 -113.519 1.00 33.14  ? 326  MET C CA    1 
ATOM   9398  C C     . MET C  1 326 ? 199.867 123.144 -113.834 1.00 32.79  ? 326  MET C C     1 
ATOM   9399  O O     . MET C  1 326 ? 199.289 123.041 -114.907 1.00 33.61  ? 326  MET C O     1 
ATOM   9400  C CB    . MET C  1 326 ? 201.590 121.622 -114.781 1.00 31.57  ? 326  MET C CB    1 
ATOM   9401  C CG    . MET C  1 326 ? 202.842 120.843 -114.478 1.00 33.56  ? 326  MET C CG    1 
ATOM   9402  S SD    . MET C  1 326 ? 203.471 119.869 -115.867 1.00 39.04  ? 326  MET C SD    1 
ATOM   9403  C CE    . MET C  1 326 ? 204.050 121.227 -117.016 1.00 33.11  ? 326  MET C CE    1 
ATOM   9404  N N     . LEU C  1 327 ? 199.528 124.024 -112.893 1.00 32.67  ? 327  LEU C N     1 
ATOM   9405  C CA    . LEU C  1 327 ? 198.403 124.940 -113.017 1.00 30.96  ? 327  LEU C CA    1 
ATOM   9406  C C     . LEU C  1 327 ? 198.836 126.396 -112.828 1.00 32.04  ? 327  LEU C C     1 
ATOM   9407  O O     . LEU C  1 327 ? 199.795 126.680 -112.117 1.00 33.01  ? 327  LEU C O     1 
ATOM   9408  C CB    . LEU C  1 327 ? 197.345 124.566 -111.990 1.00 27.71  ? 327  LEU C CB    1 
ATOM   9409  C CG    . LEU C  1 327 ? 196.896 123.118 -112.167 1.00 27.90  ? 327  LEU C CG    1 
ATOM   9410  C CD1   . LEU C  1 327 ? 196.037 122.697 -110.989 1.00 28.32  ? 327  LEU C CD1   1 
ATOM   9411  C CD2   . LEU C  1 327 ? 196.120 122.986 -113.476 1.00 27.44  ? 327  LEU C CD2   1 
ATOM   9412  N N     . ALA C  1 328 ? 198.119 127.315 -113.468 1.00 32.27  ? 328  ALA C N     1 
ATOM   9413  C CA    . ALA C  1 328 ? 198.425 128.734 -113.385 1.00 32.55  ? 328  ALA C CA    1 
ATOM   9414  C C     . ALA C  1 328 ? 198.465 129.230 -111.950 1.00 33.76  ? 328  ALA C C     1 
ATOM   9415  O O     . ALA C  1 328 ? 199.472 129.811 -111.527 1.00 35.15  ? 328  ALA C O     1 
ATOM   9416  C CB    . ALA C  1 328 ? 197.400 129.546 -114.186 1.00 32.92  ? 328  ALA C CB    1 
ATOM   9417  N N     . HIS C  1 329 ? 197.377 129.002 -111.203 1.00 33.50  ? 329  HIS C N     1 
ATOM   9418  C CA    . HIS C  1 329 ? 197.298 129.459 -109.820 1.00 31.88  ? 329  HIS C CA    1 
ATOM   9419  C C     . HIS C  1 329 ? 198.369 128.836 -108.936 1.00 31.65  ? 329  HIS C C     1 
ATOM   9420  O O     . HIS C  1 329 ? 198.756 129.390 -107.913 1.00 31.09  ? 329  HIS C O     1 
ATOM   9421  C CB    . HIS C  1 329 ? 195.882 129.244 -109.232 1.00 32.30  ? 329  HIS C CB    1 
ATOM   9422  C CG    . HIS C  1 329 ? 195.309 127.876 -109.454 1.00 33.10  ? 329  HIS C CG    1 
ATOM   9423  N ND1   . HIS C  1 329 ? 194.809 127.465 -110.672 1.00 33.72  ? 329  HIS C ND1   1 
ATOM   9424  C CD2   . HIS C  1 329 ? 195.146 126.830 -108.609 1.00 30.43  ? 329  HIS C CD2   1 
ATOM   9425  C CE1   . HIS C  1 329 ? 194.366 126.224 -110.566 1.00 33.13  ? 329  HIS C CE1   1 
ATOM   9426  N NE2   . HIS C  1 329 ? 194.560 125.817 -109.325 1.00 31.06  ? 329  HIS C NE2   1 
ATOM   9427  N N     . LYS C  1 330 ? 198.875 127.687 -109.347 1.00 32.32  ? 330  LYS C N     1 
ATOM   9428  C CA    . LYS C  1 330 ? 199.932 127.036 -108.586 1.00 31.76  ? 330  LYS C CA    1 
ATOM   9429  C C     . LYS C  1 330 ? 201.267 127.737 -108.862 1.00 31.86  ? 330  LYS C C     1 
ATOM   9430  O O     . LYS C  1 330 ? 202.105 127.855 -107.977 1.00 30.19  ? 330  LYS C O     1 
ATOM   9431  C CB    . LYS C  1 330 ? 200.030 125.558 -108.980 1.00 30.38  ? 330  LYS C CB    1 
ATOM   9432  C CG    . LYS C  1 330 ? 201.127 124.772 -108.254 1.00 27.67  ? 330  LYS C CG    1 
ATOM   9433  C CD    . LYS C  1 330 ? 202.480 124.940 -108.893 1.00 26.88  ? 330  LYS C CD    1 
ATOM   9434  C CE    . LYS C  1 330 ? 203.320 123.736 -108.595 1.00 27.99  ? 330  LYS C CE    1 
ATOM   9435  N NZ    . LYS C  1 330 ? 204.607 123.844 -109.284 1.00 30.22  ? 330  LYS C NZ    1 
ATOM   9436  N N     . ALA C  1 331 ? 201.452 128.185 -110.101 1.00 31.98  ? 331  ALA C N     1 
ATOM   9437  C CA    . ALA C  1 331 ? 202.674 128.860 -110.492 1.00 33.20  ? 331  ALA C CA    1 
ATOM   9438  C C     . ALA C  1 331 ? 202.730 130.197 -109.787 1.00 33.99  ? 331  ALA C C     1 
ATOM   9439  O O     . ALA C  1 331 ? 203.783 130.628 -109.315 1.00 33.48  ? 331  ALA C O     1 
ATOM   9440  C CB    . ALA C  1 331 ? 202.699 129.077 -112.005 1.00 33.33  ? 331  ALA C CB    1 
ATOM   9441  N N     . GLU C  1 332 ? 201.580 130.851 -109.728 1.00 35.29  ? 332  GLU C N     1 
ATOM   9442  C CA    . GLU C  1 332 ? 201.486 132.154 -109.101 1.00 37.98  ? 332  GLU C CA    1 
ATOM   9443  C C     . GLU C  1 332 ? 201.762 132.145 -107.603 1.00 38.92  ? 332  GLU C C     1 
ATOM   9444  O O     . GLU C  1 332 ? 202.544 132.963 -107.112 1.00 39.36  ? 332  GLU C O     1 
ATOM   9445  C CB    . GLU C  1 332 ? 200.111 132.756 -109.370 1.00 37.66  ? 332  GLU C CB    1 
ATOM   9446  C CG    . GLU C  1 332 ? 199.902 133.099 -110.813 1.00 40.30  ? 332  GLU C CG    1 
ATOM   9447  C CD    . GLU C  1 332 ? 198.549 133.701 -111.088 1.00 42.53  ? 332  GLU C CD    1 
ATOM   9448  O OE1   . GLU C  1 332 ? 197.876 134.130 -110.126 1.00 42.90  ? 332  GLU C OE1   1 
ATOM   9449  O OE2   . GLU C  1 332 ? 198.165 133.750 -112.277 1.00 45.89  ? 332  GLU C OE2   1 
ATOM   9450  N N     . ASP C  1 333 ? 201.126 131.231 -106.878 1.00 39.21  ? 333  ASP C N     1 
ATOM   9451  C CA    . ASP C  1 333 ? 201.342 131.171 -105.442 1.00 42.06  ? 333  ASP C CA    1 
ATOM   9452  C C     . ASP C  1 333 ? 202.819 131.022 -105.159 1.00 41.53  ? 333  ASP C C     1 
ATOM   9453  O O     . ASP C  1 333 ? 203.372 131.734 -104.324 1.00 42.27  ? 333  ASP C O     1 
ATOM   9454  C CB    . ASP C  1 333 ? 200.604 129.989 -104.805 1.00 43.93  ? 333  ASP C CB    1 
ATOM   9455  C CG    . ASP C  1 333 ? 199.218 130.349 -104.329 1.00 45.82  ? 333  ASP C CG    1 
ATOM   9456  O OD1   . ASP C  1 333 ? 198.522 131.116 -105.021 1.00 45.74  ? 333  ASP C OD1   1 
ATOM   9457  O OD2   . ASP C  1 333 ? 198.818 129.842 -103.262 1.00 50.02  ? 333  ASP C OD2   1 
ATOM   9458  N N     . GLU C  1 334 ? 203.450 130.093 -105.866 1.00 40.04  ? 334  GLU C N     1 
ATOM   9459  C CA    . GLU C  1 334 ? 204.864 129.816 -105.674 1.00 39.35  ? 334  GLU C CA    1 
ATOM   9460  C C     . GLU C  1 334 ? 205.699 131.053 -105.928 1.00 39.54  ? 334  GLU C C     1 
ATOM   9461  O O     . GLU C  1 334 ? 206.656 131.324 -105.210 1.00 40.03  ? 334  GLU C O     1 
ATOM   9462  C CB    . GLU C  1 334 ? 205.309 128.658 -106.589 1.00 37.83  ? 334  GLU C CB    1 
ATOM   9463  C CG    . GLU C  1 334 ? 204.579 127.356 -106.299 1.00 34.08  ? 334  GLU C CG    1 
ATOM   9464  C CD    . GLU C  1 334 ? 205.080 126.181 -107.104 1.00 33.93  ? 334  GLU C CD    1 
ATOM   9465  O OE1   . GLU C  1 334 ? 205.202 126.314 -108.336 1.00 35.14  ? 334  GLU C OE1   1 
ATOM   9466  O OE2   . GLU C  1 334 ? 205.337 125.113 -106.511 1.00 32.64  ? 334  GLU C OE2   1 
ATOM   9467  N N     . GLY C  1 335 ? 205.314 131.809 -106.943 1.00 40.88  ? 335  GLY C N     1 
ATOM   9468  C CA    . GLY C  1 335 ? 206.051 132.999 -107.297 1.00 42.03  ? 335  GLY C CA    1 
ATOM   9469  C C     . GLY C  1 335 ? 206.007 134.005 -106.182 1.00 42.83  ? 335  GLY C C     1 
ATOM   9470  O O     . GLY C  1 335 ? 207.035 134.483 -105.729 1.00 42.06  ? 335  GLY C O     1 
ATOM   9471  N N     . ILE C  1 336 ? 204.803 134.320 -105.736 1.00 43.81  ? 336  ILE C N     1 
ATOM   9472  C CA    . ILE C  1 336 ? 204.639 135.280 -104.673 1.00 45.68  ? 336  ILE C CA    1 
ATOM   9473  C C     . ILE C  1 336 ? 205.370 134.859 -103.404 1.00 47.10  ? 336  ILE C C     1 
ATOM   9474  O O     . ILE C  1 336 ? 206.130 135.641 -102.826 1.00 47.53  ? 336  ILE C O     1 
ATOM   9475  C CB    . ILE C  1 336 ? 203.138 135.506 -104.394 1.00 46.18  ? 336  ILE C CB    1 
ATOM   9476  C CG1   . ILE C  1 336 ? 202.643 136.632 -105.301 1.00 45.78  ? 336  ILE C CG1   1 
ATOM   9477  C CG2   . ILE C  1 336 ? 202.890 135.790 -102.906 1.00 43.34  ? 336  ILE C CG2   1 
ATOM   9478  C CD1   . ILE C  1 336 ? 201.169 136.873 -105.234 1.00 47.29  ? 336  ILE C CD1   1 
ATOM   9479  N N     . ILE C  1 337 ? 205.165 133.620 -102.980 1.00 48.30  ? 337  ILE C N     1 
ATOM   9480  C CA    . ILE C  1 337 ? 205.809 133.154 -101.769 1.00 48.48  ? 337  ILE C CA    1 
ATOM   9481  C C     . ILE C  1 337 ? 207.306 132.945 -101.946 1.00 48.33  ? 337  ILE C C     1 
ATOM   9482  O O     . ILE C  1 337 ? 208.031 132.920 -100.960 1.00 49.89  ? 337  ILE C O     1 
ATOM   9483  C CB    . ILE C  1 337 ? 205.136 131.861 -101.211 1.00 49.10  ? 337  ILE C CB    1 
ATOM   9484  C CG1   . ILE C  1 337 ? 205.277 130.706 -102.200 1.00 49.34  ? 337  ILE C CG1   1 
ATOM   9485  C CG2   . ILE C  1 337 ? 203.653 132.125 -100.932 1.00 48.78  ? 337  ILE C CG2   1 
ATOM   9486  C CD1   . ILE C  1 337 ? 204.746 129.389 -101.663 1.00 48.50  ? 337  ILE C CD1   1 
ATOM   9487  N N     . CYS C  1 338 ? 207.785 132.808 -103.178 1.00 47.36  ? 338  CYS C N     1 
ATOM   9488  C CA    . CYS C  1 338 ? 209.225 132.648 -103.383 1.00 46.99  ? 338  CYS C CA    1 
ATOM   9489  C C     . CYS C  1 338 ? 209.885 134.018 -103.232 1.00 47.32  ? 338  CYS C C     1 
ATOM   9490  O O     . CYS C  1 338 ? 210.928 134.154 -102.588 1.00 47.10  ? 338  CYS C O     1 
ATOM   9491  C CB    . CYS C  1 338 ? 209.534 132.080 -104.764 1.00 46.50  ? 338  CYS C CB    1 
ATOM   9492  S SG    . CYS C  1 338 ? 211.301 131.954 -105.107 1.00 45.58  ? 338  CYS C SG    1 
ATOM   9493  N N     . VAL C  1 339 ? 209.271 135.027 -103.839 1.00 46.83  ? 339  VAL C N     1 
ATOM   9494  C CA    . VAL C  1 339 ? 209.757 136.397 -103.744 1.00 47.55  ? 339  VAL C CA    1 
ATOM   9495  C C     . VAL C  1 339 ? 209.683 136.840 -102.261 1.00 48.35  ? 339  VAL C C     1 
ATOM   9496  O O     . VAL C  1 339 ? 210.596 137.495 -101.761 1.00 47.83  ? 339  VAL C O     1 
ATOM   9497  C CB    . VAL C  1 339 ? 208.911 137.324 -104.667 1.00 45.96  ? 339  VAL C CB    1 
ATOM   9498  C CG1   . VAL C  1 339 ? 208.953 138.732 -104.200 1.00 45.74  ? 339  VAL C CG1   1 
ATOM   9499  C CG2   . VAL C  1 339 ? 209.453 137.258 -106.056 1.00 45.14  ? 339  VAL C CG2   1 
ATOM   9500  N N     . GLU C  1 340 ? 208.610 136.460 -101.557 1.00 48.69  ? 340  GLU C N     1 
ATOM   9501  C CA    . GLU C  1 340 ? 208.460 136.801 -100.141 1.00 48.84  ? 340  GLU C CA    1 
ATOM   9502  C C     . GLU C  1 340 ? 209.566 136.139 -99.314  1.00 50.27  ? 340  GLU C C     1 
ATOM   9503  O O     . GLU C  1 340 ? 209.933 136.618 -98.238  1.00 49.57  ? 340  GLU C O     1 
ATOM   9504  C CB    . GLU C  1 340 ? 207.094 136.354 -99.612  1.00 47.49  ? 340  GLU C CB    1 
ATOM   9505  C CG    . GLU C  1 340 ? 205.912 137.153 -100.171 1.00 45.93  ? 340  GLU C CG    1 
ATOM   9506  C CD    . GLU C  1 340 ? 204.593 136.803 -99.499  1.00 44.68  ? 340  GLU C CD    1 
ATOM   9507  O OE1   . GLU C  1 340 ? 204.509 135.766 -98.793  1.00 44.56  ? 340  GLU C OE1   1 
ATOM   9508  O OE2   . GLU C  1 340 ? 203.633 137.568 -99.688  1.00 45.01  ? 340  GLU C OE2   1 
ATOM   9509  N N     . GLY C  1 341 ? 210.087 135.028 -99.825  1.00 51.54  ? 341  GLY C N     1 
ATOM   9510  C CA    . GLY C  1 341 ? 211.157 134.331 -99.141  1.00 52.68  ? 341  GLY C CA    1 
ATOM   9511  C C     . GLY C  1 341 ? 212.432 135.123 -99.334  1.00 53.43  ? 341  GLY C C     1 
ATOM   9512  O O     . GLY C  1 341 ? 213.203 135.329 -98.393  1.00 53.90  ? 341  GLY C O     1 
ATOM   9513  N N     . MET C  1 342 ? 212.650 135.579 -100.561 1.00 52.98  ? 342  MET C N     1 
ATOM   9514  C CA    . MET C  1 342 ? 213.834 136.363 -100.860 1.00 53.58  ? 342  MET C CA    1 
ATOM   9515  C C     . MET C  1 342 ? 213.870 137.576 -99.937  1.00 54.29  ? 342  MET C C     1 
ATOM   9516  O O     . MET C  1 342 ? 214.934 138.019 -99.522  1.00 55.01  ? 342  MET C O     1 
ATOM   9517  C CB    . MET C  1 342 ? 213.818 136.823 -102.315 1.00 52.69  ? 342  MET C CB    1 
ATOM   9518  C CG    . MET C  1 342 ? 214.090 135.743 -103.337 1.00 51.44  ? 342  MET C CG    1 
ATOM   9519  S SD    . MET C  1 342 ? 213.866 136.451 -104.995 1.00 53.52  ? 342  MET C SD    1 
ATOM   9520  C CE    . MET C  1 342 ? 213.600 134.955 -106.010 1.00 52.87  ? 342  MET C CE    1 
ATOM   9521  N N     . ALA C  1 343 ? 212.702 138.106 -99.611  1.00 54.16  ? 343  ALA C N     1 
ATOM   9522  C CA    . ALA C  1 343 ? 212.636 139.258 -98.736  1.00 54.76  ? 343  ALA C CA    1 
ATOM   9523  C C     . ALA C  1 343 ? 212.649 138.879 -97.252  1.00 55.71  ? 343  ALA C C     1 
ATOM   9524  O O     . ALA C  1 343 ? 212.402 139.724 -96.395  1.00 55.65  ? 343  ALA C O     1 
ATOM   9525  C CB    . ALA C  1 343 ? 211.405 140.075 -99.059  1.00 54.97  ? 343  ALA C CB    1 
ATOM   9526  N N     . GLY C  1 344 ? 212.918 137.609 -96.950  1.00 56.95  ? 344  GLY C N     1 
ATOM   9527  C CA    . GLY C  1 344 ? 212.987 137.172 -95.560  1.00 58.60  ? 344  GLY C CA    1 
ATOM   9528  C C     . GLY C  1 344 ? 211.798 136.458 -94.935  1.00 59.43  ? 344  GLY C C     1 
ATOM   9529  O O     . GLY C  1 344 ? 211.957 135.716 -93.961  1.00 58.04  ? 344  GLY C O     1 
ATOM   9530  N N     . GLY C  1 345 ? 210.607 136.684 -95.482  1.00 61.35  ? 345  GLY C N     1 
ATOM   9531  C CA    . GLY C  1 345 ? 209.420 136.050 -94.942  1.00 62.82  ? 345  GLY C CA    1 
ATOM   9532  C C     . GLY C  1 345 ? 209.502 134.537 -95.007  1.00 64.15  ? 345  GLY C C     1 
ATOM   9533  O O     . GLY C  1 345 ? 210.459 133.974 -95.553  1.00 63.75  ? 345  GLY C O     1 
ATOM   9534  N N     . ALA C  1 346 ? 208.498 133.877 -94.435  1.00 64.84  ? 346  ALA C N     1 
ATOM   9535  C CA    . ALA C  1 346 ? 208.437 132.422 -94.449  1.00 65.88  ? 346  ALA C CA    1 
ATOM   9536  C C     . ALA C  1 346 ? 207.903 131.964 -95.804  1.00 66.18  ? 346  ALA C C     1 
ATOM   9537  O O     . ALA C  1 346 ? 207.197 132.710 -96.493  1.00 66.39  ? 346  ALA C O     1 
ATOM   9538  C CB    . ALA C  1 346 ? 207.533 131.924 -93.336  1.00 66.80  ? 346  ALA C CB    1 
ATOM   9539  N N     . VAL C  1 347 ? 208.239 130.739 -96.184  1.00 65.88  ? 347  VAL C N     1 
ATOM   9540  C CA    . VAL C  1 347 ? 207.798 130.195 -97.459  1.00 66.22  ? 347  VAL C CA    1 
ATOM   9541  C C     . VAL C  1 347 ? 207.058 128.890 -97.196  1.00 66.91  ? 347  VAL C C     1 
ATOM   9542  O O     . VAL C  1 347 ? 207.638 127.926 -96.689  1.00 66.80  ? 347  VAL C O     1 
ATOM   9543  C CB    . VAL C  1 347 ? 209.001 129.936 -98.379  1.00 65.71  ? 347  VAL C CB    1 
ATOM   9544  C CG1   . VAL C  1 347 ? 208.526 129.482 -99.744  1.00 65.06  ? 347  VAL C CG1   1 
ATOM   9545  C CG2   . VAL C  1 347 ? 209.839 131.200 -98.495  1.00 65.07  ? 347  VAL C CG2   1 
ATOM   9546  N N     . HIS C  1 348 ? 205.778 128.853 -97.553  1.00 67.25  ? 348  HIS C N     1 
ATOM   9547  C CA    . HIS C  1 348 ? 204.985 127.665 -97.295  1.00 67.49  ? 348  HIS C CA    1 
ATOM   9548  C C     . HIS C  1 348 ? 203.876 127.413 -98.310  1.00 65.69  ? 348  HIS C C     1 
ATOM   9549  O O     . HIS C  1 348 ? 203.064 128.299 -98.590  1.00 65.60  ? 348  HIS C O     1 
ATOM   9550  C CB    . HIS C  1 348 ? 204.392 127.781 -95.886  1.00 70.72  ? 348  HIS C CB    1 
ATOM   9551  C CG    . HIS C  1 348 ? 203.836 126.499 -95.349  1.00 74.71  ? 348  HIS C CG    1 
ATOM   9552  N ND1   . HIS C  1 348 ? 202.498 126.166 -95.437  1.00 76.02  ? 348  HIS C ND1   1 
ATOM   9553  C CD2   . HIS C  1 348 ? 204.437 125.469 -94.706  1.00 75.96  ? 348  HIS C CD2   1 
ATOM   9554  C CE1   . HIS C  1 348 ? 202.300 124.990 -94.870  1.00 76.94  ? 348  HIS C CE1   1 
ATOM   9555  N NE2   . HIS C  1 348 ? 203.460 124.545 -94.417  1.00 77.62  ? 348  HIS C NE2   1 
ATOM   9556  N N     . ILE C  1 349 ? 203.852 126.199 -98.858  1.00 63.79  ? 349  ILE C N     1 
ATOM   9557  C CA    . ILE C  1 349 ? 202.824 125.802 -99.818  1.00 61.14  ? 349  ILE C CA    1 
ATOM   9558  C C     . ILE C  1 349 ? 202.451 124.327 -99.593  1.00 59.85  ? 349  ILE C C     1 
ATOM   9559  O O     . ILE C  1 349 ? 203.318 123.478 -99.364  1.00 57.80  ? 349  ILE C O     1 
ATOM   9560  C CB    . ILE C  1 349 ? 203.301 126.045 -101.281 1.00 61.08  ? 349  ILE C CB    1 
ATOM   9561  C CG1   . ILE C  1 349 ? 202.223 125.613 -102.271 1.00 61.16  ? 349  ILE C CG1   1 
ATOM   9562  C CG2   . ILE C  1 349 ? 204.605 125.330 -101.537 1.00 60.36  ? 349  ILE C CG2   1 
ATOM   9563  C CD1   . ILE C  1 349 ? 201.020 126.510 -102.287 1.00 61.95  ? 349  ILE C CD1   1 
ATOM   9564  N N     . ASP C  1 350 ? 201.148 124.049 -99.612  1.00 59.10  ? 350  ASP C N     1 
ATOM   9565  C CA    . ASP C  1 350 ? 200.615 122.698 -99.420  1.00 58.63  ? 350  ASP C CA    1 
ATOM   9566  C C     . ASP C  1 350 ? 199.846 122.344 -100.698 1.00 57.54  ? 350  ASP C C     1 
ATOM   9567  O O     . ASP C  1 350 ? 198.710 122.782 -100.891 1.00 57.17  ? 350  ASP C O     1 
ATOM   9568  C CB    . ASP C  1 350 ? 199.660 122.671 -98.223  1.00 60.34  ? 350  ASP C CB    1 
ATOM   9569  C CG    . ASP C  1 350 ? 199.423 121.270 -97.701  1.00 61.69  ? 350  ASP C CG    1 
ATOM   9570  O OD1   . ASP C  1 350 ? 199.457 120.326 -98.516  1.00 62.40  ? 350  ASP C OD1   1 
ATOM   9571  O OD2   . ASP C  1 350 ? 199.196 121.111 -96.480  1.00 62.47  ? 350  ASP C OD2   1 
ATOM   9572  N N     . TYR C  1 351 ? 200.455 121.540 -101.562 1.00 55.21  ? 351  TYR C N     1 
ATOM   9573  C CA    . TYR C  1 351 ? 199.819 121.195 -102.826 1.00 53.76  ? 351  TYR C CA    1 
ATOM   9574  C C     . TYR C  1 351 ? 198.499 120.451 -102.703 1.00 51.92  ? 351  TYR C C     1 
ATOM   9575  O O     . TYR C  1 351 ? 197.852 120.123 -103.703 1.00 51.20  ? 351  TYR C O     1 
ATOM   9576  C CB    . TYR C  1 351 ? 200.808 120.421 -103.704 1.00 54.69  ? 351  TYR C CB    1 
ATOM   9577  C CG    . TYR C  1 351 ? 202.036 121.242 -103.982 1.00 57.41  ? 351  TYR C CG    1 
ATOM   9578  C CD1   . TYR C  1 351 ? 201.928 122.499 -104.577 1.00 57.34  ? 351  TYR C CD1   1 
ATOM   9579  C CD2   . TYR C  1 351 ? 203.293 120.823 -103.555 1.00 59.31  ? 351  TYR C CD2   1 
ATOM   9580  C CE1   . TYR C  1 351 ? 203.037 123.332 -104.730 1.00 59.20  ? 351  TYR C CE1   1 
ATOM   9581  C CE2   . TYR C  1 351 ? 204.420 121.652 -103.707 1.00 60.73  ? 351  TYR C CE2   1 
ATOM   9582  C CZ    . TYR C  1 351 ? 204.280 122.908 -104.293 1.00 60.08  ? 351  TYR C CZ    1 
ATOM   9583  O OH    . TYR C  1 351 ? 205.364 123.747 -104.432 1.00 59.72  ? 351  TYR C OH    1 
ATOM   9584  N N     . ASN C  1 352 ? 198.090 120.208 -101.468 1.00 49.91  ? 352  ASN C N     1 
ATOM   9585  C CA    . ASN C  1 352 ? 196.852 119.496 -101.202 1.00 47.46  ? 352  ASN C CA    1 
ATOM   9586  C C     . ASN C  1 352 ? 195.682 120.473 -101.241 1.00 45.26  ? 352  ASN C C     1 
ATOM   9587  O O     . ASN C  1 352 ? 194.538 120.088 -101.475 1.00 43.11  ? 352  ASN C O     1 
ATOM   9588  C CB    . ASN C  1 352 ? 196.927 118.844 -99.824  1.00 48.19  ? 352  ASN C CB    1 
ATOM   9589  C CG    . ASN C  1 352 ? 195.782 117.901 -99.567  1.00 50.29  ? 352  ASN C CG    1 
ATOM   9590  O OD1   . ASN C  1 352 ? 195.637 116.890 -100.259 1.00 52.04  ? 352  ASN C OD1   1 
ATOM   9591  N ND2   . ASN C  1 352 ? 194.954 118.222 -98.573  1.00 49.14  ? 352  ASN C ND2   1 
ATOM   9592  N N     . CYS C  1 353 ? 195.987 121.745 -101.025 1.00 42.65  ? 353  CYS C N     1 
ATOM   9593  C CA    . CYS C  1 353 ? 194.963 122.767 -101.004 1.00 40.61  ? 353  CYS C CA    1 
ATOM   9594  C C     . CYS C  1 353 ? 194.833 123.514 -102.346 1.00 38.21  ? 353  CYS C C     1 
ATOM   9595  O O     . CYS C  1 353 ? 194.009 124.430 -102.492 1.00 36.57  ? 353  CYS C O     1 
ATOM   9596  C CB    . CYS C  1 353 ? 195.243 123.719 -99.824  1.00 41.80  ? 353  CYS C CB    1 
ATOM   9597  S SG    . CYS C  1 353 ? 195.336 122.891 -98.168  1.00 45.11  ? 353  CYS C SG    1 
ATOM   9598  N N     . VAL C  1 354 ? 195.644 123.120 -103.330 1.00 35.97  ? 354  VAL C N     1 
ATOM   9599  C CA    . VAL C  1 354 ? 195.563 123.743 -104.654 1.00 35.95  ? 354  VAL C CA    1 
ATOM   9600  C C     . VAL C  1 354 ? 194.513 122.985 -105.477 1.00 34.26  ? 354  VAL C C     1 
ATOM   9601  O O     . VAL C  1 354 ? 194.648 121.785 -105.741 1.00 33.76  ? 354  VAL C O     1 
ATOM   9602  C CB    . VAL C  1 354 ? 196.931 123.754 -105.386 1.00 35.53  ? 354  VAL C CB    1 
ATOM   9603  C CG1   . VAL C  1 354 ? 197.650 122.489 -105.149 1.00 38.55  ? 354  VAL C CG1   1 
ATOM   9604  C CG2   . VAL C  1 354 ? 196.720 123.927 -106.866 1.00 35.67  ? 354  VAL C CG2   1 
ATOM   9605  N N     . PRO C  1 355 ? 193.437 123.686 -105.865 1.00 32.22  ? 355  PRO C N     1 
ATOM   9606  C CA    . PRO C  1 355 ? 192.330 123.129 -106.639 1.00 31.75  ? 355  PRO C CA    1 
ATOM   9607  C C     . PRO C  1 355 ? 192.593 122.834 -108.113 1.00 31.22  ? 355  PRO C C     1 
ATOM   9608  O O     . PRO C  1 355 ? 193.636 123.188 -108.647 1.00 31.87  ? 355  PRO C O     1 
ATOM   9609  C CB    . PRO C  1 355 ? 191.221 124.165 -106.428 1.00 30.14  ? 355  PRO C CB    1 
ATOM   9610  C CG    . PRO C  1 355 ? 191.953 125.417 -106.342 1.00 29.98  ? 355  PRO C CG    1 
ATOM   9611  C CD    . PRO C  1 355 ? 193.172 125.092 -105.515 1.00 30.80  ? 355  PRO C CD    1 
ATOM   9612  N N     . SER C  1 356 ? 191.641 122.135 -108.736 1.00 31.35  ? 356  SER C N     1 
ATOM   9613  C CA    . SER C  1 356 ? 191.672 121.782 -110.161 1.00 31.26  ? 356  SER C CA    1 
ATOM   9614  C C     . SER C  1 356 ? 190.298 122.081 -110.740 1.00 30.88  ? 356  SER C C     1 
ATOM   9615  O O     . SER C  1 356 ? 189.286 121.748 -110.132 1.00 32.38  ? 356  SER C O     1 
ATOM   9616  C CB    . SER C  1 356 ? 191.954 120.295 -110.382 1.00 31.06  ? 356  SER C CB    1 
ATOM   9617  O OG    . SER C  1 356 ? 193.276 119.964 -110.046 1.00 34.15  ? 356  SER C OG    1 
ATOM   9618  N N     . VAL C  1 357 ? 190.256 122.697 -111.916 1.00 29.92  ? 357  VAL C N     1 
ATOM   9619  C CA    . VAL C  1 357 ? 188.992 123.015 -112.551 1.00 26.25  ? 357  VAL C CA    1 
ATOM   9620  C C     . VAL C  1 357 ? 188.997 122.618 -114.015 1.00 26.81  ? 357  VAL C C     1 
ATOM   9621  O O     . VAL C  1 357 ? 189.995 122.797 -114.703 1.00 27.35  ? 357  VAL C O     1 
ATOM   9622  C CB    . VAL C  1 357 ? 188.686 124.529 -112.432 1.00 24.59  ? 357  VAL C CB    1 
ATOM   9623  C CG1   . VAL C  1 357 ? 187.328 124.871 -113.079 1.00 23.24  ? 357  VAL C CG1   1 
ATOM   9624  C CG2   . VAL C  1 357 ? 188.671 124.919 -110.985 1.00 22.77  ? 357  VAL C CG2   1 
ATOM   9625  N N     . ILE C  1 358 ? 187.873 122.058 -114.465 1.00 27.68  ? 358  ILE C N     1 
ATOM   9626  C CA    . ILE C  1 358 ? 187.644 121.659 -115.861 1.00 28.18  ? 358  ILE C CA    1 
ATOM   9627  C C     . ILE C  1 358 ? 186.461 122.556 -116.268 1.00 29.13  ? 358  ILE C C     1 
ATOM   9628  O O     . ILE C  1 358 ? 185.341 122.412 -115.749 1.00 27.78  ? 358  ILE C O     1 
ATOM   9629  C CB    . ILE C  1 358 ? 187.255 120.154 -115.993 1.00 27.85  ? 358  ILE C CB    1 
ATOM   9630  C CG1   . ILE C  1 358 ? 188.360 119.275 -115.412 1.00 28.20  ? 358  ILE C CG1   1 
ATOM   9631  C CG2   . ILE C  1 358 ? 187.040 119.801 -117.455 1.00 28.65  ? 358  ILE C CG2   1 
ATOM   9632  C CD1   . ILE C  1 358 ? 188.224 117.790 -115.691 1.00 25.33  ? 358  ILE C CD1   1 
ATOM   9633  N N     . TYR C  1 359 ? 186.701 123.480 -117.195 1.00 30.10  ? 359  TYR C N     1 
ATOM   9634  C CA    . TYR C  1 359 ? 185.667 124.441 -117.561 1.00 30.50  ? 359  TYR C CA    1 
ATOM   9635  C C     . TYR C  1 359 ? 184.656 124.042 -118.625 1.00 30.93  ? 359  TYR C C     1 
ATOM   9636  O O     . TYR C  1 359 ? 184.120 124.877 -119.339 1.00 30.23  ? 359  TYR C O     1 
ATOM   9637  C CB    . TYR C  1 359 ? 186.331 125.778 -117.898 1.00 29.94  ? 359  TYR C CB    1 
ATOM   9638  C CG    . TYR C  1 359 ? 187.147 126.366 -116.743 1.00 30.69  ? 359  TYR C CG    1 
ATOM   9639  C CD1   . TYR C  1 359 ? 188.398 125.835 -116.397 1.00 30.10  ? 359  TYR C CD1   1 
ATOM   9640  C CD2   . TYR C  1 359 ? 186.693 127.486 -116.029 1.00 30.55  ? 359  TYR C CD2   1 
ATOM   9641  C CE1   . TYR C  1 359 ? 189.177 126.410 -115.389 1.00 29.32  ? 359  TYR C CE1   1 
ATOM   9642  C CE2   . TYR C  1 359 ? 187.471 128.062 -115.012 1.00 29.68  ? 359  TYR C CE2   1 
ATOM   9643  C CZ    . TYR C  1 359 ? 188.711 127.519 -114.706 1.00 29.40  ? 359  TYR C CZ    1 
ATOM   9644  O OH    . TYR C  1 359 ? 189.498 128.080 -113.729 1.00 32.77  ? 359  TYR C OH    1 
ATOM   9645  N N     . THR C  1 360 ? 184.383 122.746 -118.704 1.00 32.14  ? 360  THR C N     1 
ATOM   9646  C CA    . THR C  1 360 ? 183.381 122.233 -119.620 1.00 31.68  ? 360  THR C CA    1 
ATOM   9647  C C     . THR C  1 360 ? 182.031 122.708 -119.059 1.00 32.36  ? 360  THR C C     1 
ATOM   9648  O O     . THR C  1 360 ? 181.954 123.675 -118.296 1.00 33.97  ? 360  THR C O     1 
ATOM   9649  C CB    . THR C  1 360 ? 183.352 120.670 -119.672 1.00 32.61  ? 360  THR C CB    1 
ATOM   9650  O OG1   . THR C  1 360 ? 183.542 120.131 -118.352 1.00 31.91  ? 360  THR C OG1   1 
ATOM   9651  C CG2   . THR C  1 360 ? 184.406 120.120 -120.614 1.00 30.79  ? 360  THR C CG2   1 
ATOM   9652  N N     . HIS C  1 361 ? 180.969 122.014 -119.435 1.00 32.54  ? 361  HIS C N     1 
ATOM   9653  C CA    . HIS C  1 361 ? 179.630 122.324 -119.000 1.00 32.56  ? 361  HIS C CA    1 
ATOM   9654  C C     . HIS C  1 361 ? 178.930 121.010 -119.083 1.00 32.45  ? 361  HIS C C     1 
ATOM   9655  O O     . HIS C  1 361 ? 178.607 120.574 -120.168 1.00 34.05  ? 361  HIS C O     1 
ATOM   9656  C CB    . HIS C  1 361 ? 178.925 123.307 -119.921 1.00 34.79  ? 361  HIS C CB    1 
ATOM   9657  C CG    . HIS C  1 361 ? 177.861 124.098 -119.212 1.00 37.84  ? 361  HIS C CG    1 
ATOM   9658  N ND1   . HIS C  1 361 ? 177.996 125.394 -118.756 1.00 40.18  ? 361  HIS C ND1   1 
ATOM   9659  C CD2   . HIS C  1 361 ? 176.617 123.688 -118.845 1.00 38.38  ? 361  HIS C CD2   1 
ATOM   9660  C CE1   . HIS C  1 361 ? 176.859 125.753 -118.146 1.00 39.51  ? 361  HIS C CE1   1 
ATOM   9661  N NE2   . HIS C  1 361 ? 176.023 124.735 -118.194 1.00 40.10  ? 361  HIS C NE2   1 
ATOM   9662  N N     . PRO C  1 362 ? 178.662 120.365 -117.946 1.00 31.67  ? 362  PRO C N     1 
ATOM   9663  C CA    . PRO C  1 362 ? 178.966 120.788 -116.578 1.00 29.40  ? 362  PRO C CA    1 
ATOM   9664  C C     . PRO C  1 362 ? 180.450 120.971 -116.308 1.00 28.50  ? 362  PRO C C     1 
ATOM   9665  O O     . PRO C  1 362 ? 181.290 120.340 -116.934 1.00 26.91  ? 362  PRO C O     1 
ATOM   9666  C CB    . PRO C  1 362 ? 178.394 119.652 -115.751 1.00 30.17  ? 362  PRO C CB    1 
ATOM   9667  C CG    . PRO C  1 362 ? 178.717 118.469 -116.609 1.00 28.44  ? 362  PRO C CG    1 
ATOM   9668  C CD    . PRO C  1 362 ? 178.247 118.950 -117.969 1.00 31.35  ? 362  PRO C CD    1 
ATOM   9669  N N     . GLU C  1 363 ? 180.762 121.846 -115.365 1.00 29.23  ? 363  GLU C N     1 
ATOM   9670  C CA    . GLU C  1 363 ? 182.142 122.075 -114.975 1.00 29.83  ? 363  GLU C CA    1 
ATOM   9671  C C     . GLU C  1 363 ? 182.498 121.020 -113.924 1.00 27.97  ? 363  GLU C C     1 
ATOM   9672  O O     . GLU C  1 363 ? 181.617 120.379 -113.360 1.00 28.64  ? 363  GLU C O     1 
ATOM   9673  C CB    . GLU C  1 363 ? 182.313 123.457 -114.344 1.00 30.93  ? 363  GLU C CB    1 
ATOM   9674  C CG    . GLU C  1 363 ? 181.739 124.572 -115.131 1.00 31.92  ? 363  GLU C CG    1 
ATOM   9675  C CD    . GLU C  1 363 ? 182.005 125.881 -114.477 1.00 31.72  ? 363  GLU C CD    1 
ATOM   9676  O OE1   . GLU C  1 363 ? 181.947 125.935 -113.232 1.00 34.11  ? 363  GLU C OE1   1 
ATOM   9677  O OE2   . GLU C  1 363 ? 182.258 126.853 -115.206 1.00 34.12  ? 363  GLU C OE2   1 
ATOM   9678  N N     . VAL C  1 364 ? 183.788 120.843 -113.681 1.00 24.62  ? 364  VAL C N     1 
ATOM   9679  C CA    . VAL C  1 364 ? 184.240 119.889 -112.689 1.00 24.67  ? 364  VAL C CA    1 
ATOM   9680  C C     . VAL C  1 364 ? 185.290 120.611 -111.867 1.00 25.50  ? 364  VAL C C     1 
ATOM   9681  O O     . VAL C  1 364 ? 186.184 121.252 -112.432 1.00 26.66  ? 364  VAL C O     1 
ATOM   9682  C CB    . VAL C  1 364 ? 184.934 118.642 -113.321 1.00 23.17  ? 364  VAL C CB    1 
ATOM   9683  C CG1   . VAL C  1 364 ? 185.027 117.529 -112.283 1.00 22.28  ? 364  VAL C CG1   1 
ATOM   9684  C CG2   . VAL C  1 364 ? 184.201 118.171 -114.556 1.00 21.95  ? 364  VAL C CG2   1 
ATOM   9685  N N     . ALA C  1 365 ? 185.198 120.529 -110.546 1.00 24.23  ? 365  ALA C N     1 
ATOM   9686  C CA    . ALA C  1 365 ? 186.209 121.181 -109.725 1.00 23.28  ? 365  ALA C CA    1 
ATOM   9687  C C     . ALA C  1 365 ? 186.449 120.379 -108.467 1.00 23.56  ? 365  ALA C C     1 
ATOM   9688  O O     . ALA C  1 365 ? 185.532 119.777 -107.894 1.00 22.94  ? 365  ALA C O     1 
ATOM   9689  C CB    . ALA C  1 365 ? 185.784 122.618 -109.368 1.00 19.02  ? 365  ALA C CB    1 
ATOM   9690  N N     . TRP C  1 366 ? 187.697 120.349 -108.045 1.00 22.82  ? 366  TRP C N     1 
ATOM   9691  C CA    . TRP C  1 366 ? 187.993 119.656 -106.834 1.00 23.16  ? 366  TRP C CA    1 
ATOM   9692  C C     . TRP C  1 366 ? 189.255 120.132 -106.159 1.00 23.98  ? 366  TRP C C     1 
ATOM   9693  O O     . TRP C  1 366 ? 190.117 120.777 -106.750 1.00 23.26  ? 366  TRP C O     1 
ATOM   9694  C CB    . TRP C  1 366 ? 188.044 118.143 -107.075 1.00 23.92  ? 366  TRP C CB    1 
ATOM   9695  C CG    . TRP C  1 366 ? 189.263 117.666 -107.791 1.00 25.18  ? 366  TRP C CG    1 
ATOM   9696  C CD1   . TRP C  1 366 ? 190.446 117.289 -107.224 1.00 25.96  ? 366  TRP C CD1   1 
ATOM   9697  C CD2   . TRP C  1 366 ? 189.439 117.550 -109.207 1.00 22.31  ? 366  TRP C CD2   1 
ATOM   9698  N NE1   . TRP C  1 366 ? 191.347 116.950 -108.197 1.00 25.85  ? 366  TRP C NE1   1 
ATOM   9699  C CE2   . TRP C  1 366 ? 190.758 117.103 -109.424 1.00 24.74  ? 366  TRP C CE2   1 
ATOM   9700  C CE3   . TRP C  1 366 ? 188.614 117.782 -110.309 1.00 23.02  ? 366  TRP C CE3   1 
ATOM   9701  C CZ2   . TRP C  1 366 ? 191.278 116.881 -110.709 1.00 24.99  ? 366  TRP C CZ2   1 
ATOM   9702  C CZ3   . TRP C  1 366 ? 189.128 117.560 -111.590 1.00 23.93  ? 366  TRP C CZ3   1 
ATOM   9703  C CH2   . TRP C  1 366 ? 190.453 117.112 -111.773 1.00 24.08  ? 366  TRP C CH2   1 
ATOM   9704  N N     . VAL C  1 367 ? 189.314 119.820 -104.876 1.00 24.06  ? 367  VAL C N     1 
ATOM   9705  C CA    . VAL C  1 367 ? 190.438 120.145 -104.038 1.00 24.45  ? 367  VAL C CA    1 
ATOM   9706  C C     . VAL C  1 367 ? 190.402 119.126 -102.899 1.00 25.12  ? 367  VAL C C     1 
ATOM   9707  O O     . VAL C  1 367 ? 189.332 118.683 -102.450 1.00 23.11  ? 367  VAL C O     1 
ATOM   9708  C CB    . VAL C  1 367 ? 190.338 121.593 -103.500 1.00 22.60  ? 367  VAL C CB    1 
ATOM   9709  C CG1   . VAL C  1 367 ? 189.125 121.727 -102.621 1.00 22.39  ? 367  VAL C CG1   1 
ATOM   9710  C CG2   . VAL C  1 367 ? 191.609 121.963 -102.749 1.00 21.22  ? 367  VAL C CG2   1 
ATOM   9711  N N     . GLY C  1 368 ? 191.581 118.738 -102.452 1.00 25.13  ? 368  GLY C N     1 
ATOM   9712  C CA    . GLY C  1 368 ? 191.641 117.770 -101.387 1.00 25.80  ? 368  GLY C CA    1 
ATOM   9713  C C     . GLY C  1 368 ? 191.893 116.410 -101.970 1.00 26.04  ? 368  GLY C C     1 
ATOM   9714  O O     . GLY C  1 368 ? 192.427 116.294 -103.061 1.00 28.32  ? 368  GLY C O     1 
ATOM   9715  N N     . LYS C  1 369 ? 191.489 115.371 -101.257 1.00 26.26  ? 369  LYS C N     1 
ATOM   9716  C CA    . LYS C  1 369 ? 191.725 114.022 -101.735 1.00 25.33  ? 369  LYS C CA    1 
ATOM   9717  C C     . LYS C  1 369 ? 190.531 113.338 -102.364 1.00 25.11  ? 369  LYS C C     1 
ATOM   9718  O O     . LYS C  1 369 ? 189.375 113.615 -102.035 1.00 24.75  ? 369  LYS C O     1 
ATOM   9719  C CB    . LYS C  1 369 ? 192.271 113.168 -100.595 1.00 26.00  ? 369  LYS C CB    1 
ATOM   9720  C CG    . LYS C  1 369 ? 193.539 113.737 -99.993  1.00 26.92  ? 369  LYS C CG    1 
ATOM   9721  C CD    . LYS C  1 369 ? 194.093 112.841 -98.914  1.00 32.69  ? 369  LYS C CD    1 
ATOM   9722  C CE    . LYS C  1 369 ? 195.410 113.387 -98.393  1.00 33.16  ? 369  LYS C CE    1 
ATOM   9723  N NZ    . LYS C  1 369 ? 196.231 113.748 -99.570  1.00 35.44  ? 369  LYS C NZ    1 
ATOM   9724  N N     . SER C  1 370 ? 190.840 112.449 -103.291 1.00 24.06  ? 370  SER C N     1 
ATOM   9725  C CA    . SER C  1 370 ? 189.837 111.680 -103.977 1.00 24.33  ? 370  SER C CA    1 
ATOM   9726  C C     . SER C  1 370 ? 189.533 110.518 -103.055 1.00 24.48  ? 370  SER C C     1 
ATOM   9727  O O     . SER C  1 370 ? 190.298 110.231 -102.136