data_1ZMD
# 
_entry.id   1ZMD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZMD         
RCSB  RCSB032889   
WWPDB D_1000032889 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1ZMC 
_pdbx_database_related.details        'Crystal structure of the same protein in complex with NAD+' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZMD 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brautigam, C.A.' 1 
'Chuang, J.L.'    2 
'Tomchick, D.R.'  3 
'Machius, M.'     4 
'Chuang, D.T.'    5 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of Human Dihydrolipoamide Dehydrogenase: NAD+/NADH Binding and the Structural Basis of Disease-causing Mutations' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            350 
_citation.page_first                543 
_citation.page_last                 552 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15946682 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.05.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brautigam, C.A.' 1 
primary 'Chuang, J.L.'    2 
primary 'Tomchick, D.R.'  3 
primary 'Machius, M.'     4 
primary 'Chuang, D.T.'    5 
# 
_cell.entry_id           1ZMD 
_cell.length_a           175.871 
_cell.length_b           210.914 
_cell.length_c           127.096 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZMD 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Dihydrolipoyl dehydrogenase'                  50208.406 8    1.8.1.4 ? ? ? 
2 non-polymer syn 'SULFATE ION'                                  96.063    31   ?       ? ? ? 
3 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'                  785.550   8    ?       ? ? ? 
4 non-polymer syn '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' 665.441   8    ?       ? ? ? 
5 water       nat water                                          18.015    1899 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dihydrolipoamide dehydrogenase, Glycine cleavage system L protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGTDFASRGIEMSE
VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITI
DEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLN
TKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGD
VVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADT
DGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGTDFASRGIEMSE
VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITI
DEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLN
TKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGD
VVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADT
DGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   GLN n 
1 4   PRO n 
1 5   ILE n 
1 6   ASP n 
1 7   ALA n 
1 8   ASP n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ILE n 
1 13  GLY n 
1 14  SER n 
1 15  GLY n 
1 16  PRO n 
1 17  GLY n 
1 18  GLY n 
1 19  TYR n 
1 20  VAL n 
1 21  ALA n 
1 22  ALA n 
1 23  ILE n 
1 24  LYS n 
1 25  ALA n 
1 26  ALA n 
1 27  GLN n 
1 28  LEU n 
1 29  GLY n 
1 30  PHE n 
1 31  LYS n 
1 32  THR n 
1 33  VAL n 
1 34  CYS n 
1 35  ILE n 
1 36  GLU n 
1 37  LYS n 
1 38  ASN n 
1 39  GLU n 
1 40  THR n 
1 41  LEU n 
1 42  GLY n 
1 43  GLY n 
1 44  THR n 
1 45  CYS n 
1 46  LEU n 
1 47  ASN n 
1 48  VAL n 
1 49  GLY n 
1 50  CYS n 
1 51  ILE n 
1 52  PRO n 
1 53  SER n 
1 54  LYS n 
1 55  ALA n 
1 56  LEU n 
1 57  LEU n 
1 58  ASN n 
1 59  ASN n 
1 60  SER n 
1 61  HIS n 
1 62  TYR n 
1 63  TYR n 
1 64  HIS n 
1 65  MET n 
1 66  ALA n 
1 67  HIS n 
1 68  GLY n 
1 69  THR n 
1 70  ASP n 
1 71  PHE n 
1 72  ALA n 
1 73  SER n 
1 74  ARG n 
1 75  GLY n 
1 76  ILE n 
1 77  GLU n 
1 78  MET n 
1 79  SER n 
1 80  GLU n 
1 81  VAL n 
1 82  ARG n 
1 83  LEU n 
1 84  ASN n 
1 85  LEU n 
1 86  ASP n 
1 87  LYS n 
1 88  MET n 
1 89  MET n 
1 90  GLU n 
1 91  GLN n 
1 92  LYS n 
1 93  SER n 
1 94  THR n 
1 95  ALA n 
1 96  VAL n 
1 97  LYS n 
1 98  ALA n 
1 99  LEU n 
1 100 THR n 
1 101 GLY n 
1 102 GLY n 
1 103 ILE n 
1 104 ALA n 
1 105 HIS n 
1 106 LEU n 
1 107 PHE n 
1 108 LYS n 
1 109 GLN n 
1 110 ASN n 
1 111 LYS n 
1 112 VAL n 
1 113 VAL n 
1 114 HIS n 
1 115 VAL n 
1 116 ASN n 
1 117 GLY n 
1 118 TYR n 
1 119 GLY n 
1 120 LYS n 
1 121 ILE n 
1 122 THR n 
1 123 GLY n 
1 124 LYS n 
1 125 ASN n 
1 126 GLN n 
1 127 VAL n 
1 128 THR n 
1 129 ALA n 
1 130 THR n 
1 131 LYS n 
1 132 ALA n 
1 133 ASP n 
1 134 GLY n 
1 135 GLY n 
1 136 THR n 
1 137 GLN n 
1 138 VAL n 
1 139 ILE n 
1 140 ASP n 
1 141 THR n 
1 142 LYS n 
1 143 ASN n 
1 144 ILE n 
1 145 LEU n 
1 146 ILE n 
1 147 ALA n 
1 148 THR n 
1 149 GLY n 
1 150 SER n 
1 151 GLU n 
1 152 VAL n 
1 153 THR n 
1 154 PRO n 
1 155 PHE n 
1 156 PRO n 
1 157 GLY n 
1 158 ILE n 
1 159 THR n 
1 160 ILE n 
1 161 ASP n 
1 162 GLU n 
1 163 ASP n 
1 164 THR n 
1 165 ILE n 
1 166 VAL n 
1 167 SER n 
1 168 SER n 
1 169 THR n 
1 170 GLY n 
1 171 ALA n 
1 172 LEU n 
1 173 SER n 
1 174 LEU n 
1 175 LYS n 
1 176 LYS n 
1 177 VAL n 
1 178 PRO n 
1 179 GLU n 
1 180 LYS n 
1 181 MET n 
1 182 VAL n 
1 183 VAL n 
1 184 ILE n 
1 185 GLY n 
1 186 ALA n 
1 187 GLY n 
1 188 VAL n 
1 189 ILE n 
1 190 GLY n 
1 191 VAL n 
1 192 GLU n 
1 193 LEU n 
1 194 GLY n 
1 195 SER n 
1 196 VAL n 
1 197 TRP n 
1 198 GLN n 
1 199 ARG n 
1 200 LEU n 
1 201 GLY n 
1 202 ALA n 
1 203 ASP n 
1 204 VAL n 
1 205 THR n 
1 206 ALA n 
1 207 VAL n 
1 208 GLU n 
1 209 PHE n 
1 210 LEU n 
1 211 GLY n 
1 212 HIS n 
1 213 VAL n 
1 214 GLY n 
1 215 GLY n 
1 216 VAL n 
1 217 GLY n 
1 218 ILE n 
1 219 ASP n 
1 220 MET n 
1 221 GLU n 
1 222 ILE n 
1 223 SER n 
1 224 LYS n 
1 225 ASN n 
1 226 PHE n 
1 227 GLN n 
1 228 ARG n 
1 229 ILE n 
1 230 LEU n 
1 231 GLN n 
1 232 LYS n 
1 233 GLN n 
1 234 GLY n 
1 235 PHE n 
1 236 LYS n 
1 237 PHE n 
1 238 LYS n 
1 239 LEU n 
1 240 ASN n 
1 241 THR n 
1 242 LYS n 
1 243 VAL n 
1 244 THR n 
1 245 GLY n 
1 246 ALA n 
1 247 THR n 
1 248 LYS n 
1 249 LYS n 
1 250 SER n 
1 251 ASP n 
1 252 GLY n 
1 253 LYS n 
1 254 ILE n 
1 255 ASP n 
1 256 VAL n 
1 257 SER n 
1 258 ILE n 
1 259 GLU n 
1 260 ALA n 
1 261 ALA n 
1 262 SER n 
1 263 GLY n 
1 264 GLY n 
1 265 LYS n 
1 266 ALA n 
1 267 GLU n 
1 268 VAL n 
1 269 ILE n 
1 270 THR n 
1 271 CYS n 
1 272 ASP n 
1 273 VAL n 
1 274 LEU n 
1 275 LEU n 
1 276 VAL n 
1 277 CYS n 
1 278 ILE n 
1 279 GLY n 
1 280 ARG n 
1 281 ARG n 
1 282 PRO n 
1 283 PHE n 
1 284 THR n 
1 285 LYS n 
1 286 ASN n 
1 287 LEU n 
1 288 GLY n 
1 289 LEU n 
1 290 GLU n 
1 291 GLU n 
1 292 LEU n 
1 293 GLY n 
1 294 ILE n 
1 295 GLU n 
1 296 LEU n 
1 297 ASP n 
1 298 PRO n 
1 299 ARG n 
1 300 GLY n 
1 301 ARG n 
1 302 ILE n 
1 303 PRO n 
1 304 VAL n 
1 305 ASN n 
1 306 THR n 
1 307 ARG n 
1 308 PHE n 
1 309 GLN n 
1 310 THR n 
1 311 LYS n 
1 312 ILE n 
1 313 PRO n 
1 314 ASN n 
1 315 ILE n 
1 316 TYR n 
1 317 ALA n 
1 318 ILE n 
1 319 GLY n 
1 320 ASP n 
1 321 VAL n 
1 322 VAL n 
1 323 ALA n 
1 324 GLY n 
1 325 PRO n 
1 326 MET n 
1 327 LEU n 
1 328 ALA n 
1 329 HIS n 
1 330 LYS n 
1 331 ALA n 
1 332 GLU n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 ILE n 
1 337 ILE n 
1 338 CYS n 
1 339 VAL n 
1 340 GLU n 
1 341 GLY n 
1 342 MET n 
1 343 ALA n 
1 344 GLY n 
1 345 GLY n 
1 346 ALA n 
1 347 VAL n 
1 348 HIS n 
1 349 ILE n 
1 350 ASP n 
1 351 TYR n 
1 352 ASN n 
1 353 CYS n 
1 354 VAL n 
1 355 PRO n 
1 356 SER n 
1 357 VAL n 
1 358 ILE n 
1 359 TYR n 
1 360 THR n 
1 361 HIS n 
1 362 PRO n 
1 363 GLU n 
1 364 VAL n 
1 365 ALA n 
1 366 TRP n 
1 367 VAL n 
1 368 GLY n 
1 369 LYS n 
1 370 SER n 
1 371 GLU n 
1 372 GLU n 
1 373 GLN n 
1 374 LEU n 
1 375 LYS n 
1 376 GLU n 
1 377 GLU n 
1 378 GLY n 
1 379 ILE n 
1 380 GLU n 
1 381 TYR n 
1 382 LYS n 
1 383 VAL n 
1 384 GLY n 
1 385 LYS n 
1 386 PHE n 
1 387 PRO n 
1 388 PHE n 
1 389 ALA n 
1 390 ALA n 
1 391 ASN n 
1 392 SER n 
1 393 ARG n 
1 394 ALA n 
1 395 LYS n 
1 396 THR n 
1 397 ASN n 
1 398 ALA n 
1 399 ASP n 
1 400 THR n 
1 401 ASP n 
1 402 GLY n 
1 403 MET n 
1 404 VAL n 
1 405 LYS n 
1 406 ILE n 
1 407 LEU n 
1 408 GLY n 
1 409 GLN n 
1 410 LYS n 
1 411 SER n 
1 412 THR n 
1 413 ASP n 
1 414 ARG n 
1 415 VAL n 
1 416 LEU n 
1 417 GLY n 
1 418 ALA n 
1 419 HIS n 
1 420 ILE n 
1 421 LEU n 
1 422 GLY n 
1 423 PRO n 
1 424 GLY n 
1 425 ALA n 
1 426 GLY n 
1 427 GLU n 
1 428 MET n 
1 429 VAL n 
1 430 ASN n 
1 431 GLU n 
1 432 ALA n 
1 433 ALA n 
1 434 LEU n 
1 435 ALA n 
1 436 LEU n 
1 437 GLU n 
1 438 TYR n 
1 439 GLY n 
1 440 ALA n 
1 441 SER n 
1 442 CYS n 
1 443 GLU n 
1 444 ASP n 
1 445 ILE n 
1 446 ALA n 
1 447 ARG n 
1 448 VAL n 
1 449 CYS n 
1 450 HIS n 
1 451 ALA n 
1 452 HIS n 
1 453 PRO n 
1 454 THR n 
1 455 LEU n 
1 456 SER n 
1 457 GLU n 
1 458 ALA n 
1 459 PHE n 
1 460 ARG n 
1 461 GLU n 
1 462 ALA n 
1 463 ASN n 
1 464 LEU n 
1 465 ALA n 
1 466 ALA n 
1 467 SER n 
1 468 PHE n 
1 469 GLY n 
1 470 LYS n 
1 471 SER n 
1 472 ILE n 
1 473 ASN n 
1 474 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'DLD, GCSL, LAD, PHE3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               XL1-blue 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pTrcHisThE3 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PLASMID 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DLDH_HUMAN 
_struct_ref.pdbx_db_accession          P09622 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGTDFASRGIEMSE
VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITI
DEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLN
TKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGD
VVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADT
DGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
;
_struct_ref.pdbx_align_begin           36 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZMD A 1 ? 474 ? P09622 36 ? 509 ? 1 474 
2 1 1ZMD B 1 ? 474 ? P09622 36 ? 509 ? 1 474 
3 1 1ZMD C 1 ? 474 ? P09622 36 ? 509 ? 1 474 
4 1 1ZMD D 1 ? 474 ? P09622 36 ? 509 ? 1 474 
5 1 1ZMD E 1 ? 474 ? P09622 36 ? 509 ? 1 474 
6 1 1ZMD F 1 ? 474 ? P09622 36 ? 509 ? 1 474 
7 1 1ZMD G 1 ? 474 ? P09622 36 ? 509 ? 1 474 
8 1 1ZMD H 1 ? 474 ? P09622 36 ? 509 ? 1 474 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                        ?    'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ?    'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?    'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?    'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                       ?    'C3 H7 N O2 S'      121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'                  ?    'C27 H33 N9 O15 P2' 785.550 
GLN 'L-peptide linking' y GLUTAMINE                                      ?    'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?    'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ?    'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ?    'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                          ?    'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?    'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?    'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ?    'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ?    'C5 H11 N O2 S'     149.211 
NAI non-polymer         . '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' NADH 'C21 H29 N7 O14 P2' 665.441 
PHE 'L-peptide linking' y PHENYLALANINE                                  ?    'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ?    'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                         ?    'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                  ?    'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                                      ?    'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ?    'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ?    'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ?    'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1ZMD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'HEPES, PEG 4000, ammonium sulfate, pH 7.0, temperature 293K, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   APS 
_diffrn_detector.pdbx_collection_date   2004-07-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97943 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97943 
# 
_reflns.entry_id                     1ZMD 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             33.1 
_reflns.d_resolution_high            2.08 
_reflns.number_obs                   281013 
_reflns.number_all                   281138 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.054 
_reflns.pdbx_netI_over_sigmaI        20.1 
_reflns.B_iso_Wilson_estimate        19.7 
_reflns.pdbx_redundancy              8.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.08 
_reflns_shell.d_res_low              2.15 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.434 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        7.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      27865 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1ZMD 
_refine.ls_number_reflns_obs                     281013 
_refine.ls_number_reflns_all                     281125 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               5519904.25 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             33.06 
_refine.ls_d_res_high                            2.08 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.221 
_refine.ls_R_factor_all                          0.221 
_refine.ls_R_factor_R_work                       0.221 
_refine.ls_R_factor_R_free                       0.249 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.6 
_refine.ls_number_reflns_R_free                  1748 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.0 
_refine.aniso_B[1][1]                            10.15 
_refine.aniso_B[2][2]                            -3.34 
_refine.aniso_B[3][3]                            -6.82 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.337679 
_refine.solvent_model_param_bsol                 45.2125 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1JEH 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ZMD 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.24 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.30 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28128 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         931 
_refine_hist.number_atoms_solvent             1900 
_refine_hist.number_atoms_total               30959 
_refine_hist.d_res_high                       2.08 
_refine_hist.d_res_low                        33.06 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.013 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 2.09  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.27  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.92  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.13  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.07  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.08 
_refine_ls_shell.d_res_low                        2.21 
_refine_ls_shell.number_reflns_R_work             45404 
_refine_ls_shell.R_factor_R_work                  0.293 
_refine_ls_shell.percent_reflns_obs               98.1 
_refine_ls_shell.R_factor_R_free                  0.315 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.percent_reflns_R_free            0.6 
_refine_ls_shell.number_reflns_R_free             286 
_refine_ls_shell.number_reflns_obs                45404 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   ?           'X-RAY DIFFRACTION' 
3 nad_drg.param     ?           'X-RAY DIFFRACTION' 
4 so4_drg.param     ?           'X-RAY DIFFRACTION' 
5 fad.param         ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ZMD 
_struct.title                     'Crystal Structure of Human dihydrolipoamide dehydrogenase complexed to NADH' 
_struct.pdbx_descriptor           'Dihydrolipoyl dehydrogenase, mitochondrial (E.C.1.8.1.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZMD 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;E3, lipoamide dehydrogenase, pyruvate dehydrogenase, alpha-ketoglutarate dehydrogenase, branched-chain alpha-ketoacid dehydrogenase, glycine decarboxylase, glycine cleavage, OXIDOREDUCTASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 4 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 3 ? 
KA N N 4 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 2 ? 
PA N N 3 ? 
QA N N 4 ? 
RA N N 2 ? 
SA N N 2 ? 
TA N N 2 ? 
UA N N 2 ? 
VA N N 3 ? 
WA N N 4 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 2 ? 
AB N N 2 ? 
BB N N 3 ? 
CB N N 4 ? 
DB N N 5 ? 
EB N N 5 ? 
FB N N 5 ? 
GB N N 5 ? 
HB N N 5 ? 
IB N N 5 ? 
JB N N 5 ? 
KB N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
4 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 15  ? LEU A 28  ? GLY A 15  LEU A 28  1 ? 14 
HELX_P HELX_P2   2   GLY A 42  ? GLY A 49  ? GLY A 42  GLY A 49  1 ? 8  
HELX_P HELX_P3   3   GLY A 49  ? GLY A 68  ? GLY A 49  GLY A 68  1 ? 20 
HELX_P HELX_P4   4   THR A 69  ? ARG A 74  ? THR A 69  ARG A 74  1 ? 6  
HELX_P HELX_P5   5   ASN A 84  ? ASN A 110 ? ASN A 84  ASN A 110 1 ? 27 
HELX_P HELX_P6   6   SER A 167 ? LEU A 172 ? SER A 167 LEU A 172 1 ? 6  
HELX_P HELX_P7   7   GLY A 187 ? LEU A 200 ? GLY A 187 LEU A 200 1 ? 14 
HELX_P HELX_P8   8   ASP A 219 ? GLN A 233 ? ASP A 219 GLN A 233 1 ? 15 
HELX_P HELX_P9   9   GLY A 288 ? GLY A 293 ? GLY A 288 GLY A 293 1 ? 6  
HELX_P HELX_P10  10  GLY A 319 ? VAL A 322 ? GLY A 319 VAL A 322 5 ? 4  
HELX_P HELX_P11  11  LEU A 327 ? ALA A 343 ? LEU A 327 ALA A 343 1 ? 17 
HELX_P HELX_P12  12  ASP A 350 ? VAL A 354 ? ASP A 350 VAL A 354 5 ? 5  
HELX_P HELX_P13  13  SER A 370 ? GLY A 378 ? SER A 370 GLY A 378 1 ? 9  
HELX_P HELX_P14  14  ASN A 391 ? ASN A 397 ? ASN A 391 ASN A 397 1 ? 7  
HELX_P HELX_P15  15  GLY A 424 ? GLY A 439 ? GLY A 424 GLY A 439 1 ? 16 
HELX_P HELX_P16  16  SER A 441 ? VAL A 448 ? SER A 441 VAL A 448 1 ? 8  
HELX_P HELX_P17  17  LEU A 455 ? GLY A 469 ? LEU A 455 GLY A 469 1 ? 15 
HELX_P HELX_P18  18  GLY B 15  ? GLY B 29  ? GLY B 15  GLY B 29  1 ? 15 
HELX_P HELX_P19  19  GLY B 42  ? VAL B 48  ? GLY B 42  VAL B 48  1 ? 7  
HELX_P HELX_P20  20  GLY B 49  ? GLY B 68  ? GLY B 49  GLY B 68  1 ? 20 
HELX_P HELX_P21  21  THR B 69  ? ARG B 74  ? THR B 69  ARG B 74  1 ? 6  
HELX_P HELX_P22  22  ASN B 84  ? ASN B 110 ? ASN B 84  ASN B 110 1 ? 27 
HELX_P HELX_P23  23  SER B 167 ? LEU B 172 ? SER B 167 LEU B 172 1 ? 6  
HELX_P HELX_P24  24  GLY B 187 ? LEU B 200 ? GLY B 187 LEU B 200 1 ? 14 
HELX_P HELX_P25  25  ASP B 219 ? GLY B 234 ? ASP B 219 GLY B 234 1 ? 16 
HELX_P HELX_P26  26  GLY B 288 ? GLY B 293 ? GLY B 288 GLY B 293 1 ? 6  
HELX_P HELX_P27  27  GLY B 319 ? VAL B 322 ? GLY B 319 VAL B 322 5 ? 4  
HELX_P HELX_P28  28  LEU B 327 ? ALA B 343 ? LEU B 327 ALA B 343 1 ? 17 
HELX_P HELX_P29  29  ASP B 350 ? VAL B 354 ? ASP B 350 VAL B 354 5 ? 5  
HELX_P HELX_P30  30  SER B 370 ? GLY B 378 ? SER B 370 GLY B 378 1 ? 9  
HELX_P HELX_P31  31  ASN B 391 ? ASN B 397 ? ASN B 391 ASN B 397 1 ? 7  
HELX_P HELX_P32  32  GLY B 424 ? GLY B 439 ? GLY B 424 GLY B 439 1 ? 16 
HELX_P HELX_P33  33  SER B 441 ? VAL B 448 ? SER B 441 VAL B 448 1 ? 8  
HELX_P HELX_P34  34  LEU B 455 ? GLY B 469 ? LEU B 455 GLY B 469 1 ? 15 
HELX_P HELX_P35  35  GLY C 15  ? LEU C 28  ? GLY C 15  LEU C 28  1 ? 14 
HELX_P HELX_P36  36  GLY C 42  ? GLY C 49  ? GLY C 42  GLY C 49  1 ? 8  
HELX_P HELX_P37  37  GLY C 49  ? GLY C 68  ? GLY C 49  GLY C 68  1 ? 20 
HELX_P HELX_P38  38  THR C 69  ? ARG C 74  ? THR C 69  ARG C 74  1 ? 6  
HELX_P HELX_P39  39  ASN C 84  ? ASN C 110 ? ASN C 84  ASN C 110 1 ? 27 
HELX_P HELX_P40  40  SER C 167 ? LEU C 172 ? SER C 167 LEU C 172 1 ? 6  
HELX_P HELX_P41  41  GLY C 187 ? GLY C 201 ? GLY C 187 GLY C 201 1 ? 15 
HELX_P HELX_P42  42  ASP C 219 ? GLY C 234 ? ASP C 219 GLY C 234 1 ? 16 
HELX_P HELX_P43  43  GLY C 288 ? GLY C 293 ? GLY C 288 GLY C 293 1 ? 6  
HELX_P HELX_P44  44  GLY C 319 ? VAL C 322 ? GLY C 319 VAL C 322 5 ? 4  
HELX_P HELX_P45  45  LEU C 327 ? ALA C 343 ? LEU C 327 ALA C 343 1 ? 17 
HELX_P HELX_P46  46  ASP C 350 ? VAL C 354 ? ASP C 350 VAL C 354 5 ? 5  
HELX_P HELX_P47  47  SER C 370 ? GLY C 378 ? SER C 370 GLY C 378 1 ? 9  
HELX_P HELX_P48  48  ASN C 391 ? ASN C 397 ? ASN C 391 ASN C 397 1 ? 7  
HELX_P HELX_P49  49  GLY C 424 ? GLY C 439 ? GLY C 424 GLY C 439 1 ? 16 
HELX_P HELX_P50  50  SER C 441 ? VAL C 448 ? SER C 441 VAL C 448 1 ? 8  
HELX_P HELX_P51  51  LEU C 455 ? GLY C 469 ? LEU C 455 GLY C 469 1 ? 15 
HELX_P HELX_P52  52  GLY D 15  ? LEU D 28  ? GLY D 15  LEU D 28  1 ? 14 
HELX_P HELX_P53  53  GLY D 42  ? GLY D 49  ? GLY D 42  GLY D 49  1 ? 8  
HELX_P HELX_P54  54  GLY D 49  ? GLY D 68  ? GLY D 49  GLY D 68  1 ? 20 
HELX_P HELX_P55  55  THR D 69  ? ARG D 74  ? THR D 69  ARG D 74  1 ? 6  
HELX_P HELX_P56  56  ASN D 84  ? ASN D 110 ? ASN D 84  ASN D 110 1 ? 27 
HELX_P HELX_P57  57  SER D 167 ? SER D 173 ? SER D 167 SER D 173 1 ? 7  
HELX_P HELX_P58  58  GLY D 187 ? LEU D 200 ? GLY D 187 LEU D 200 1 ? 14 
HELX_P HELX_P59  59  ASP D 219 ? GLN D 233 ? ASP D 219 GLN D 233 1 ? 15 
HELX_P HELX_P60  60  GLY D 288 ? GLY D 293 ? GLY D 288 GLY D 293 1 ? 6  
HELX_P HELX_P61  61  GLY D 319 ? VAL D 322 ? GLY D 319 VAL D 322 5 ? 4  
HELX_P HELX_P62  62  LEU D 327 ? ALA D 343 ? LEU D 327 ALA D 343 1 ? 17 
HELX_P HELX_P63  63  ASP D 350 ? VAL D 354 ? ASP D 350 VAL D 354 5 ? 5  
HELX_P HELX_P64  64  SER D 370 ? GLY D 378 ? SER D 370 GLY D 378 1 ? 9  
HELX_P HELX_P65  65  ASN D 391 ? ALA D 398 ? ASN D 391 ALA D 398 1 ? 8  
HELX_P HELX_P66  66  GLY D 424 ? GLY D 439 ? GLY D 424 GLY D 439 1 ? 16 
HELX_P HELX_P67  67  SER D 441 ? ARG D 447 ? SER D 441 ARG D 447 1 ? 7  
HELX_P HELX_P68  68  LEU D 455 ? GLY D 469 ? LEU D 455 GLY D 469 1 ? 15 
HELX_P HELX_P69  69  GLY E 15  ? GLY E 29  ? GLY E 15  GLY E 29  1 ? 15 
HELX_P HELX_P70  70  GLY E 42  ? GLY E 49  ? GLY E 42  GLY E 49  1 ? 8  
HELX_P HELX_P71  71  GLY E 49  ? GLY E 68  ? GLY E 49  GLY E 68  1 ? 20 
HELX_P HELX_P72  72  THR E 69  ? ARG E 74  ? THR E 69  ARG E 74  1 ? 6  
HELX_P HELX_P73  73  ASN E 84  ? ASN E 110 ? ASN E 84  ASN E 110 1 ? 27 
HELX_P HELX_P74  74  SER E 167 ? LEU E 172 ? SER E 167 LEU E 172 1 ? 6  
HELX_P HELX_P75  75  GLY E 187 ? LEU E 200 ? GLY E 187 LEU E 200 1 ? 14 
HELX_P HELX_P76  76  ASP E 219 ? GLY E 234 ? ASP E 219 GLY E 234 1 ? 16 
HELX_P HELX_P77  77  GLY E 319 ? VAL E 322 ? GLY E 319 VAL E 322 5 ? 4  
HELX_P HELX_P78  78  LEU E 327 ? ALA E 343 ? LEU E 327 ALA E 343 1 ? 17 
HELX_P HELX_P79  79  ASP E 350 ? VAL E 354 ? ASP E 350 VAL E 354 5 ? 5  
HELX_P HELX_P80  80  SER E 370 ? GLU E 377 ? SER E 370 GLU E 377 1 ? 8  
HELX_P HELX_P81  81  ASN E 391 ? ALA E 398 ? ASN E 391 ALA E 398 1 ? 8  
HELX_P HELX_P82  82  GLY E 424 ? TYR E 438 ? GLY E 424 TYR E 438 1 ? 15 
HELX_P HELX_P83  83  SER E 441 ? VAL E 448 ? SER E 441 VAL E 448 1 ? 8  
HELX_P HELX_P84  84  LEU E 455 ? GLY E 469 ? LEU E 455 GLY E 469 1 ? 15 
HELX_P HELX_P85  85  GLY F 15  ? LEU F 28  ? GLY F 15  LEU F 28  1 ? 14 
HELX_P HELX_P86  86  GLY F 42  ? GLY F 49  ? GLY F 42  GLY F 49  1 ? 8  
HELX_P HELX_P87  87  GLY F 49  ? GLY F 68  ? GLY F 49  GLY F 68  1 ? 20 
HELX_P HELX_P88  88  THR F 69  ? ARG F 74  ? THR F 69  ARG F 74  1 ? 6  
HELX_P HELX_P89  89  ASN F 84  ? ASN F 110 ? ASN F 84  ASN F 110 1 ? 27 
HELX_P HELX_P90  90  SER F 167 ? SER F 173 ? SER F 167 SER F 173 1 ? 7  
HELX_P HELX_P91  91  GLY F 187 ? LEU F 200 ? GLY F 187 LEU F 200 1 ? 14 
HELX_P HELX_P92  92  ASP F 219 ? GLY F 234 ? ASP F 219 GLY F 234 1 ? 16 
HELX_P HELX_P93  93  GLY F 288 ? GLY F 293 ? GLY F 288 GLY F 293 1 ? 6  
HELX_P HELX_P94  94  GLY F 319 ? VAL F 322 ? GLY F 319 VAL F 322 5 ? 4  
HELX_P HELX_P95  95  LEU F 327 ? ALA F 343 ? LEU F 327 ALA F 343 1 ? 17 
HELX_P HELX_P96  96  ASP F 350 ? VAL F 354 ? ASP F 350 VAL F 354 5 ? 5  
HELX_P HELX_P97  97  SER F 370 ? GLY F 378 ? SER F 370 GLY F 378 1 ? 9  
HELX_P HELX_P98  98  ASN F 391 ? ASN F 397 ? ASN F 391 ASN F 397 1 ? 7  
HELX_P HELX_P99  99  GLY F 424 ? GLY F 439 ? GLY F 424 GLY F 439 1 ? 16 
HELX_P HELX_P100 100 SER F 441 ? VAL F 448 ? SER F 441 VAL F 448 1 ? 8  
HELX_P HELX_P101 101 LEU F 455 ? GLY F 469 ? LEU F 455 GLY F 469 1 ? 15 
HELX_P HELX_P102 102 GLY G 15  ? LEU G 28  ? GLY G 15  LEU G 28  1 ? 14 
HELX_P HELX_P103 103 GLY G 42  ? GLY G 49  ? GLY G 42  GLY G 49  1 ? 8  
HELX_P HELX_P104 104 GLY G 49  ? GLY G 68  ? GLY G 49  GLY G 68  1 ? 20 
HELX_P HELX_P105 105 GLY G 68  ? ARG G 74  ? GLY G 68  ARG G 74  1 ? 7  
HELX_P HELX_P106 106 ASN G 84  ? ASN G 110 ? ASN G 84  ASN G 110 1 ? 27 
HELX_P HELX_P107 107 SER G 167 ? LEU G 172 ? SER G 167 LEU G 172 1 ? 6  
HELX_P HELX_P108 108 GLY G 187 ? GLY G 201 ? GLY G 187 GLY G 201 1 ? 15 
HELX_P HELX_P109 109 ASP G 219 ? GLY G 234 ? ASP G 219 GLY G 234 1 ? 16 
HELX_P HELX_P110 110 GLY G 288 ? GLY G 293 ? GLY G 288 GLY G 293 1 ? 6  
HELX_P HELX_P111 111 GLY G 319 ? VAL G 322 ? GLY G 319 VAL G 322 5 ? 4  
HELX_P HELX_P112 112 LEU G 327 ? ALA G 343 ? LEU G 327 ALA G 343 1 ? 17 
HELX_P HELX_P113 113 ASP G 350 ? VAL G 354 ? ASP G 350 VAL G 354 5 ? 5  
HELX_P HELX_P114 114 SER G 370 ? GLY G 378 ? SER G 370 GLY G 378 1 ? 9  
HELX_P HELX_P115 115 ASN G 391 ? ALA G 398 ? ASN G 391 ALA G 398 1 ? 8  
HELX_P HELX_P116 116 GLY G 424 ? GLY G 439 ? GLY G 424 GLY G 439 1 ? 16 
HELX_P HELX_P117 117 SER G 441 ? VAL G 448 ? SER G 441 VAL G 448 1 ? 8  
HELX_P HELX_P118 118 LEU G 455 ? GLY G 469 ? LEU G 455 GLY G 469 1 ? 15 
HELX_P HELX_P119 119 GLY H 15  ? GLY H 29  ? GLY H 15  GLY H 29  1 ? 15 
HELX_P HELX_P120 120 GLY H 42  ? GLY H 49  ? GLY H 42  GLY H 49  1 ? 8  
HELX_P HELX_P121 121 GLY H 49  ? GLY H 68  ? GLY H 49  GLY H 68  1 ? 20 
HELX_P HELX_P122 122 THR H 69  ? ARG H 74  ? THR H 69  ARG H 74  1 ? 6  
HELX_P HELX_P123 123 ASN H 84  ? LYS H 111 ? ASN H 84  LYS H 111 1 ? 28 
HELX_P HELX_P124 124 SER H 167 ? LEU H 172 ? SER H 167 LEU H 172 1 ? 6  
HELX_P HELX_P125 125 GLY H 187 ? LEU H 200 ? GLY H 187 LEU H 200 1 ? 14 
HELX_P HELX_P126 126 ASP H 219 ? GLY H 234 ? ASP H 219 GLY H 234 1 ? 16 
HELX_P HELX_P127 127 GLY H 288 ? GLY H 293 ? GLY H 288 GLY H 293 1 ? 6  
HELX_P HELX_P128 128 GLY H 319 ? VAL H 322 ? GLY H 319 VAL H 322 5 ? 4  
HELX_P HELX_P129 129 LEU H 327 ? ALA H 343 ? LEU H 327 ALA H 343 1 ? 17 
HELX_P HELX_P130 130 ASP H 350 ? VAL H 354 ? ASP H 350 VAL H 354 5 ? 5  
HELX_P HELX_P131 131 SER H 370 ? GLU H 377 ? SER H 370 GLU H 377 1 ? 8  
HELX_P HELX_P132 132 ASN H 391 ? ALA H 398 ? ASN H 391 ALA H 398 1 ? 8  
HELX_P HELX_P133 133 GLY H 424 ? TYR H 438 ? GLY H 424 TYR H 438 1 ? 15 
HELX_P HELX_P134 134 SER H 441 ? ARG H 447 ? SER H 441 ARG H 447 1 ? 7  
HELX_P HELX_P135 135 LEU H 455 ? GLY H 469 ? LEU H 455 GLY H 469 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 45 SG A ? ? 1_555 A CYS 50 SG A ? A CYS 45 A CYS 50 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf2 disulf ? ? B CYS 45 SG A ? ? 1_555 B CYS 50 SG A ? B CYS 45 B CYS 50 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf3 disulf ? ? C CYS 45 SG A ? ? 1_555 C CYS 50 SG A ? C CYS 45 C CYS 50 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf4 disulf ? ? D CYS 45 SG A ? ? 1_555 D CYS 50 SG A ? D CYS 45 D CYS 50 1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf5 disulf ? ? E CYS 45 SG A ? ? 1_555 E CYS 50 SG A ? E CYS 45 E CYS 50 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf6 disulf ? ? F CYS 45 SG A ? ? 1_555 F CYS 50 SG A ? F CYS 45 F CYS 50 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf7 disulf ? ? G CYS 45 SG A ? ? 1_555 G CYS 50 SG A ? G CYS 45 G CYS 50 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf8 disulf ? ? H CYS 45 SG A ? ? 1_555 H CYS 50 SG A ? H CYS 45 H CYS 50 1_555 ? ? ? ? ? ? ? 2.044 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  HIS 361 A . ? HIS 361 A PRO 362 A ? PRO 362 A 1 0.52  
2  HIS 452 A . ? HIS 452 A PRO 453 A ? PRO 453 A 1 -0.01 
3  HIS 361 B . ? HIS 361 B PRO 362 B ? PRO 362 B 1 0.33  
4  HIS 452 B . ? HIS 452 B PRO 453 B ? PRO 453 B 1 -0.17 
5  HIS 361 C . ? HIS 361 C PRO 362 C ? PRO 362 C 1 0.12  
6  HIS 452 C . ? HIS 452 C PRO 453 C ? PRO 453 C 1 -0.40 
7  HIS 361 D . ? HIS 361 D PRO 362 D ? PRO 362 D 1 0.34  
8  HIS 452 D . ? HIS 452 D PRO 453 D ? PRO 453 D 1 -0.02 
9  HIS 361 E . ? HIS 361 E PRO 362 E ? PRO 362 E 1 0.06  
10 HIS 452 E . ? HIS 452 E PRO 453 E ? PRO 453 E 1 0.00  
11 HIS 361 F . ? HIS 361 F PRO 362 F ? PRO 362 F 1 0.29  
12 HIS 452 F . ? HIS 452 F PRO 453 F ? PRO 453 F 1 0.04  
13 HIS 361 G . ? HIS 361 G PRO 362 G ? PRO 362 G 1 0.19  
14 HIS 452 G . ? HIS 452 G PRO 453 G ? PRO 453 G 1 -0.02 
15 HIS 361 H . ? HIS 361 H PRO 362 H ? PRO 362 H 1 0.20  
16 HIS 452 H . ? HIS 452 H PRO 453 H ? PRO 453 H 1 0.17  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 6 ? 
B  ? 5 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 5 ? 
G  ? 3 ? 
H  ? 5 ? 
I  ? 6 ? 
J  ? 5 ? 
K  ? 2 ? 
L  ? 5 ? 
M  ? 3 ? 
N  ? 5 ? 
O  ? 6 ? 
P  ? 5 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 2 ? 
T  ? 5 ? 
U  ? 3 ? 
V  ? 5 ? 
W  ? 6 ? 
X  ? 5 ? 
Y  ? 2 ? 
Z  ? 5 ? 
AA ? 3 ? 
AB ? 5 ? 
AC ? 6 ? 
AD ? 5 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 5 ? 
AI ? 3 ? 
AJ ? 5 ? 
AK ? 6 ? 
AL ? 5 ? 
AM ? 2 ? 
AN ? 5 ? 
AO ? 3 ? 
AP ? 5 ? 
AQ ? 6 ? 
AR ? 5 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 5 ? 
AW ? 3 ? 
AX ? 5 ? 
AY ? 6 ? 
AZ ? 5 ? 
BA ? 2 ? 
BB ? 5 ? 
BC ? 3 ? 
BD ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
B  1 2 ? parallel      
B  2 3 ? parallel      
B  3 4 ? parallel      
B  4 5 ? parallel      
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? parallel      
F  2 3 ? parallel      
F  3 4 ? parallel      
F  4 5 ? parallel      
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
I  1 2 ? parallel      
I  2 3 ? parallel      
I  3 4 ? parallel      
I  4 5 ? anti-parallel 
I  5 6 ? anti-parallel 
J  1 2 ? parallel      
J  2 3 ? parallel      
J  3 4 ? parallel      
J  4 5 ? parallel      
K  1 2 ? anti-parallel 
L  1 2 ? parallel      
L  2 3 ? parallel      
L  3 4 ? parallel      
L  4 5 ? parallel      
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
O  1 2 ? parallel      
O  2 3 ? parallel      
O  3 4 ? parallel      
O  4 5 ? anti-parallel 
O  5 6 ? anti-parallel 
P  1 2 ? parallel      
P  2 3 ? parallel      
P  3 4 ? parallel      
P  4 5 ? parallel      
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? parallel      
T  2 3 ? parallel      
T  3 4 ? parallel      
T  4 5 ? parallel      
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
V  4 5 ? anti-parallel 
W  1 2 ? parallel      
W  2 3 ? parallel      
W  3 4 ? parallel      
W  4 5 ? anti-parallel 
W  5 6 ? anti-parallel 
X  1 2 ? parallel      
X  2 3 ? parallel      
X  3 4 ? parallel      
X  4 5 ? parallel      
Y  1 2 ? anti-parallel 
Z  1 2 ? parallel      
Z  2 3 ? parallel      
Z  3 4 ? parallel      
Z  4 5 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AC 4 5 ? anti-parallel 
AC 5 6 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AD 3 4 ? parallel      
AD 4 5 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? parallel      
AH 2 3 ? parallel      
AH 3 4 ? parallel      
AH 4 5 ? parallel      
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AK 1 2 ? parallel      
AK 2 3 ? parallel      
AK 3 4 ? parallel      
AK 4 5 ? anti-parallel 
AK 5 6 ? anti-parallel 
AL 1 2 ? parallel      
AL 2 3 ? parallel      
AL 3 4 ? parallel      
AL 4 5 ? parallel      
AM 1 2 ? anti-parallel 
AN 1 2 ? parallel      
AN 2 3 ? parallel      
AN 3 4 ? parallel      
AN 4 5 ? parallel      
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AQ 1 2 ? parallel      
AQ 2 3 ? parallel      
AQ 3 4 ? parallel      
AQ 4 5 ? anti-parallel 
AQ 5 6 ? anti-parallel 
AR 1 2 ? parallel      
AR 2 3 ? parallel      
AR 3 4 ? parallel      
AR 4 5 ? parallel      
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? parallel      
AV 2 3 ? parallel      
AV 3 4 ? parallel      
AV 4 5 ? parallel      
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AX 4 5 ? anti-parallel 
AY 1 2 ? parallel      
AY 2 3 ? parallel      
AY 3 4 ? parallel      
AY 4 5 ? anti-parallel 
AY 5 6 ? anti-parallel 
AZ 1 2 ? parallel      
AZ 2 3 ? parallel      
AZ 3 4 ? parallel      
AZ 4 5 ? parallel      
BA 1 2 ? anti-parallel 
BB 1 2 ? parallel      
BB 2 3 ? parallel      
BB 3 4 ? parallel      
BB 4 5 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 113 ? ASN A 116 ? VAL A 113 ASN A 116 
A  2 THR A 32  ? GLU A 36  ? THR A 32  GLU A 36  
A  3 ILE A 5   ? ILE A 12  ? ILE A 5   ILE A 12  
A  4 THR A 136 ? ILE A 146 ? THR A 136 ILE A 146 
A  5 GLN A 126 ? THR A 130 ? GLN A 126 THR A 130 
A  6 TYR A 118 ? GLY A 123 ? TYR A 118 GLY A 123 
B  1 VAL A 113 ? ASN A 116 ? VAL A 113 ASN A 116 
B  2 THR A 32  ? GLU A 36  ? THR A 32  GLU A 36  
B  3 ILE A 5   ? ILE A 12  ? ILE A 5   ILE A 12  
B  4 THR A 136 ? ILE A 146 ? THR A 136 ILE A 146 
B  5 ILE A 315 ? ALA A 317 ? ILE A 315 ALA A 317 
C  1 ILE A 76  ? MET A 78  ? ILE A 76  MET A 78  
C  2 VAL B 81  ? LEU B 83  ? VAL B 81  LEU B 83  
D  1 VAL A 81  ? LEU A 83  ? VAL A 81  LEU A 83  
D  2 ILE B 76  ? MET B 78  ? ILE B 76  MET B 78  
E  1 SER A 150 ? VAL A 152 ? SER A 150 VAL A 152 
E  2 ARG A 280 ? PRO A 282 ? ARG A 280 PRO A 282 
F  1 ILE A 165 ? VAL A 166 ? ILE A 165 VAL A 166 
F  2 VAL A 273 ? VAL A 276 ? VAL A 273 VAL A 276 
F  3 LYS A 180 ? ILE A 184 ? LYS A 180 ILE A 184 
F  4 ASP A 203 ? VAL A 207 ? ASP A 203 VAL A 207 
F  5 LYS A 236 ? LYS A 238 ? LYS A 236 LYS A 238 
G  1 THR A 241 ? LYS A 248 ? THR A 241 LYS A 248 
G  2 ILE A 254 ? ALA A 260 ? ILE A 254 ALA A 260 
G  3 GLU A 267 ? CYS A 271 ? GLU A 267 CYS A 271 
H  1 SER A 356 ? ILE A 358 ? SER A 356 ILE A 358 
H  2 GLU A 363 ? GLY A 368 ? GLU A 363 GLY A 368 
H  3 VAL A 415 ? GLY A 422 ? VAL A 415 GLY A 422 
H  4 MET A 403 ? GLN A 409 ? MET A 403 GLN A 409 
H  5 TYR A 381 ? PRO A 387 ? TYR A 381 PRO A 387 
I  1 VAL B 113 ? ASN B 116 ? VAL B 113 ASN B 116 
I  2 THR B 32  ? GLU B 36  ? THR B 32  GLU B 36  
I  3 ILE B 5   ? ILE B 12  ? ILE B 5   ILE B 12  
I  4 VAL B 138 ? ILE B 146 ? VAL B 138 ILE B 146 
I  5 GLN B 126 ? THR B 130 ? GLN B 126 THR B 130 
I  6 TYR B 118 ? ILE B 121 ? TYR B 118 ILE B 121 
J  1 VAL B 113 ? ASN B 116 ? VAL B 113 ASN B 116 
J  2 THR B 32  ? GLU B 36  ? THR B 32  GLU B 36  
J  3 ILE B 5   ? ILE B 12  ? ILE B 5   ILE B 12  
J  4 VAL B 138 ? ILE B 146 ? VAL B 138 ILE B 146 
J  5 ILE B 315 ? ALA B 317 ? ILE B 315 ALA B 317 
K  1 SER B 150 ? VAL B 152 ? SER B 150 VAL B 152 
K  2 ARG B 280 ? PRO B 282 ? ARG B 280 PRO B 282 
L  1 ILE B 165 ? VAL B 166 ? ILE B 165 VAL B 166 
L  2 VAL B 273 ? VAL B 276 ? VAL B 273 VAL B 276 
L  3 LYS B 180 ? ILE B 184 ? LYS B 180 ILE B 184 
L  4 ASP B 203 ? VAL B 207 ? ASP B 203 VAL B 207 
L  5 LYS B 236 ? LYS B 238 ? LYS B 236 LYS B 238 
M  1 THR B 241 ? LYS B 248 ? THR B 241 LYS B 248 
M  2 ILE B 254 ? ALA B 260 ? ILE B 254 ALA B 260 
M  3 GLU B 267 ? CYS B 271 ? GLU B 267 CYS B 271 
N  1 SER B 356 ? ILE B 358 ? SER B 356 ILE B 358 
N  2 GLU B 363 ? GLY B 368 ? GLU B 363 GLY B 368 
N  3 VAL B 415 ? GLY B 422 ? VAL B 415 GLY B 422 
N  4 MET B 403 ? GLN B 409 ? MET B 403 GLN B 409 
N  5 TYR B 381 ? PRO B 387 ? TYR B 381 PRO B 387 
O  1 VAL C 113 ? ASN C 116 ? VAL C 113 ASN C 116 
O  2 THR C 32  ? GLU C 36  ? THR C 32  GLU C 36  
O  3 ILE C 5   ? ILE C 12  ? ILE C 5   ILE C 12  
O  4 VAL C 138 ? ILE C 146 ? VAL C 138 ILE C 146 
O  5 GLN C 126 ? THR C 130 ? GLN C 126 THR C 130 
O  6 TYR C 118 ? GLY C 123 ? TYR C 118 GLY C 123 
P  1 VAL C 113 ? ASN C 116 ? VAL C 113 ASN C 116 
P  2 THR C 32  ? GLU C 36  ? THR C 32  GLU C 36  
P  3 ILE C 5   ? ILE C 12  ? ILE C 5   ILE C 12  
P  4 VAL C 138 ? ILE C 146 ? VAL C 138 ILE C 146 
P  5 ILE C 315 ? ALA C 317 ? ILE C 315 ALA C 317 
Q  1 ILE C 76  ? MET C 78  ? ILE C 76  MET C 78  
Q  2 VAL D 81  ? LEU D 83  ? VAL D 81  LEU D 83  
R  1 VAL C 81  ? LEU C 83  ? VAL C 81  LEU C 83  
R  2 ILE D 76  ? MET D 78  ? ILE D 76  MET D 78  
S  1 SER C 150 ? VAL C 152 ? SER C 150 VAL C 152 
S  2 ARG C 280 ? PRO C 282 ? ARG C 280 PRO C 282 
T  1 ILE C 165 ? VAL C 166 ? ILE C 165 VAL C 166 
T  2 VAL C 273 ? VAL C 276 ? VAL C 273 VAL C 276 
T  3 LYS C 180 ? ILE C 184 ? LYS C 180 ILE C 184 
T  4 ASP C 203 ? VAL C 207 ? ASP C 203 VAL C 207 
T  5 LYS C 236 ? LYS C 238 ? LYS C 236 LYS C 238 
U  1 THR C 241 ? LYS C 248 ? THR C 241 LYS C 248 
U  2 ILE C 254 ? ALA C 260 ? ILE C 254 ALA C 260 
U  3 GLU C 267 ? CYS C 271 ? GLU C 267 CYS C 271 
V  1 SER C 356 ? ILE C 358 ? SER C 356 ILE C 358 
V  2 GLU C 363 ? GLY C 368 ? GLU C 363 GLY C 368 
V  3 VAL C 415 ? GLY C 422 ? VAL C 415 GLY C 422 
V  4 MET C 403 ? GLN C 409 ? MET C 403 GLN C 409 
V  5 TYR C 381 ? PRO C 387 ? TYR C 381 PRO C 387 
W  1 VAL D 113 ? ASN D 116 ? VAL D 113 ASN D 116 
W  2 THR D 32  ? GLU D 36  ? THR D 32  GLU D 36  
W  3 ILE D 5   ? ILE D 12  ? ILE D 5   ILE D 12  
W  4 THR D 136 ? ILE D 146 ? THR D 136 ILE D 146 
W  5 GLN D 126 ? THR D 130 ? GLN D 126 THR D 130 
W  6 TYR D 118 ? GLY D 123 ? TYR D 118 GLY D 123 
X  1 VAL D 113 ? ASN D 116 ? VAL D 113 ASN D 116 
X  2 THR D 32  ? GLU D 36  ? THR D 32  GLU D 36  
X  3 ILE D 5   ? ILE D 12  ? ILE D 5   ILE D 12  
X  4 THR D 136 ? ILE D 146 ? THR D 136 ILE D 146 
X  5 ILE D 315 ? ALA D 317 ? ILE D 315 ALA D 317 
Y  1 SER D 150 ? VAL D 152 ? SER D 150 VAL D 152 
Y  2 ARG D 280 ? PRO D 282 ? ARG D 280 PRO D 282 
Z  1 ILE D 165 ? VAL D 166 ? ILE D 165 VAL D 166 
Z  2 VAL D 273 ? VAL D 276 ? VAL D 273 VAL D 276 
Z  3 LYS D 180 ? ILE D 184 ? LYS D 180 ILE D 184 
Z  4 ASP D 203 ? GLU D 208 ? ASP D 203 GLU D 208 
Z  5 LYS D 236 ? LEU D 239 ? LYS D 236 LEU D 239 
AA 1 THR D 241 ? LYS D 248 ? THR D 241 LYS D 248 
AA 2 ILE D 254 ? ALA D 260 ? ILE D 254 ALA D 260 
AA 3 GLU D 267 ? CYS D 271 ? GLU D 267 CYS D 271 
AB 1 SER D 356 ? ILE D 358 ? SER D 356 ILE D 358 
AB 2 GLU D 363 ? GLY D 368 ? GLU D 363 GLY D 368 
AB 3 VAL D 415 ? GLY D 422 ? VAL D 415 GLY D 422 
AB 4 MET D 403 ? GLN D 409 ? MET D 403 GLN D 409 
AB 5 TYR D 381 ? PRO D 387 ? TYR D 381 PRO D 387 
AC 1 VAL E 113 ? ASN E 116 ? VAL E 113 ASN E 116 
AC 2 THR E 32  ? GLU E 36  ? THR E 32  GLU E 36  
AC 3 ILE E 5   ? ILE E 12  ? ILE E 5   ILE E 12  
AC 4 THR E 136 ? ILE E 146 ? THR E 136 ILE E 146 
AC 5 GLN E 126 ? THR E 130 ? GLN E 126 THR E 130 
AC 6 TYR E 118 ? GLY E 123 ? TYR E 118 GLY E 123 
AD 1 VAL E 113 ? ASN E 116 ? VAL E 113 ASN E 116 
AD 2 THR E 32  ? GLU E 36  ? THR E 32  GLU E 36  
AD 3 ILE E 5   ? ILE E 12  ? ILE E 5   ILE E 12  
AD 4 THR E 136 ? ILE E 146 ? THR E 136 ILE E 146 
AD 5 ILE E 315 ? ALA E 317 ? ILE E 315 ALA E 317 
AE 1 ILE E 76  ? GLU E 77  ? ILE E 76  GLU E 77  
AE 2 ARG F 82  ? LEU F 83  ? ARG F 82  LEU F 83  
AF 1 VAL E 81  ? LEU E 83  ? VAL E 81  LEU E 83  
AF 2 ILE F 76  ? MET F 78  ? ILE F 76  MET F 78  
AG 1 SER E 150 ? VAL E 152 ? SER E 150 VAL E 152 
AG 2 ARG E 280 ? PRO E 282 ? ARG E 280 PRO E 282 
AH 1 ILE E 165 ? VAL E 166 ? ILE E 165 VAL E 166 
AH 2 VAL E 273 ? VAL E 276 ? VAL E 273 VAL E 276 
AH 3 LYS E 180 ? ILE E 184 ? LYS E 180 ILE E 184 
AH 4 ASP E 203 ? VAL E 207 ? ASP E 203 VAL E 207 
AH 5 LYS E 236 ? LYS E 238 ? LYS E 236 LYS E 238 
AI 1 THR E 241 ? LYS E 248 ? THR E 241 LYS E 248 
AI 2 ILE E 254 ? ALA E 260 ? ILE E 254 ALA E 260 
AI 3 GLU E 267 ? CYS E 271 ? GLU E 267 CYS E 271 
AJ 1 SER E 356 ? ILE E 358 ? SER E 356 ILE E 358 
AJ 2 GLU E 363 ? GLY E 368 ? GLU E 363 GLY E 368 
AJ 3 VAL E 415 ? GLY E 422 ? VAL E 415 GLY E 422 
AJ 4 MET E 403 ? GLN E 409 ? MET E 403 GLN E 409 
AJ 5 TYR E 381 ? PRO E 387 ? TYR E 381 PRO E 387 
AK 1 VAL F 113 ? ASN F 116 ? VAL F 113 ASN F 116 
AK 2 THR F 32  ? GLU F 36  ? THR F 32  GLU F 36  
AK 3 ILE F 5   ? ILE F 12  ? ILE F 5   ILE F 12  
AK 4 THR F 136 ? ILE F 146 ? THR F 136 ILE F 146 
AK 5 GLN F 126 ? THR F 130 ? GLN F 126 THR F 130 
AK 6 TYR F 118 ? GLY F 123 ? TYR F 118 GLY F 123 
AL 1 VAL F 113 ? ASN F 116 ? VAL F 113 ASN F 116 
AL 2 THR F 32  ? GLU F 36  ? THR F 32  GLU F 36  
AL 3 ILE F 5   ? ILE F 12  ? ILE F 5   ILE F 12  
AL 4 THR F 136 ? ILE F 146 ? THR F 136 ILE F 146 
AL 5 ILE F 315 ? ALA F 317 ? ILE F 315 ALA F 317 
AM 1 SER F 150 ? VAL F 152 ? SER F 150 VAL F 152 
AM 2 ARG F 280 ? PRO F 282 ? ARG F 280 PRO F 282 
AN 1 ILE F 165 ? VAL F 166 ? ILE F 165 VAL F 166 
AN 2 VAL F 273 ? VAL F 276 ? VAL F 273 VAL F 276 
AN 3 LYS F 180 ? ILE F 184 ? LYS F 180 ILE F 184 
AN 4 ASP F 203 ? GLU F 208 ? ASP F 203 GLU F 208 
AN 5 LYS F 236 ? LEU F 239 ? LYS F 236 LEU F 239 
AO 1 THR F 241 ? LYS F 248 ? THR F 241 LYS F 248 
AO 2 ILE F 254 ? ALA F 260 ? ILE F 254 ALA F 260 
AO 3 GLU F 267 ? CYS F 271 ? GLU F 267 CYS F 271 
AP 1 SER F 356 ? ILE F 358 ? SER F 356 ILE F 358 
AP 2 GLU F 363 ? GLY F 368 ? GLU F 363 GLY F 368 
AP 3 VAL F 415 ? GLY F 422 ? VAL F 415 GLY F 422 
AP 4 MET F 403 ? GLN F 409 ? MET F 403 GLN F 409 
AP 5 TYR F 381 ? PRO F 387 ? TYR F 381 PRO F 387 
AQ 1 VAL G 113 ? ASN G 116 ? VAL G 113 ASN G 116 
AQ 2 THR G 32  ? GLU G 36  ? THR G 32  GLU G 36  
AQ 3 ILE G 5   ? ILE G 12  ? ILE G 5   ILE G 12  
AQ 4 THR G 136 ? ILE G 146 ? THR G 136 ILE G 146 
AQ 5 GLN G 126 ? THR G 130 ? GLN G 126 THR G 130 
AQ 6 TYR G 118 ? GLY G 123 ? TYR G 118 GLY G 123 
AR 1 VAL G 113 ? ASN G 116 ? VAL G 113 ASN G 116 
AR 2 THR G 32  ? GLU G 36  ? THR G 32  GLU G 36  
AR 3 ILE G 5   ? ILE G 12  ? ILE G 5   ILE G 12  
AR 4 THR G 136 ? ILE G 146 ? THR G 136 ILE G 146 
AR 5 ILE G 315 ? ALA G 317 ? ILE G 315 ALA G 317 
AS 1 ILE G 76  ? MET G 78  ? ILE G 76  MET G 78  
AS 2 VAL H 81  ? LEU H 83  ? VAL H 81  LEU H 83  
AT 1 VAL G 81  ? LEU G 83  ? VAL G 81  LEU G 83  
AT 2 ILE H 76  ? MET H 78  ? ILE H 76  MET H 78  
AU 1 SER G 150 ? VAL G 152 ? SER G 150 VAL G 152 
AU 2 ARG G 280 ? PRO G 282 ? ARG G 280 PRO G 282 
AV 1 ILE G 165 ? VAL G 166 ? ILE G 165 VAL G 166 
AV 2 VAL G 273 ? VAL G 276 ? VAL G 273 VAL G 276 
AV 3 LYS G 180 ? ILE G 184 ? LYS G 180 ILE G 184 
AV 4 ASP G 203 ? GLU G 208 ? ASP G 203 GLU G 208 
AV 5 LYS G 236 ? LEU G 239 ? LYS G 236 LEU G 239 
AW 1 THR G 241 ? LYS G 248 ? THR G 241 LYS G 248 
AW 2 ILE G 254 ? ALA G 260 ? ILE G 254 ALA G 260 
AW 3 GLU G 267 ? CYS G 271 ? GLU G 267 CYS G 271 
AX 1 SER G 356 ? ILE G 358 ? SER G 356 ILE G 358 
AX 2 GLU G 363 ? GLY G 368 ? GLU G 363 GLY G 368 
AX 3 VAL G 415 ? GLY G 422 ? VAL G 415 GLY G 422 
AX 4 MET G 403 ? GLN G 409 ? MET G 403 GLN G 409 
AX 5 TYR G 381 ? PRO G 387 ? TYR G 381 PRO G 387 
AY 1 VAL H 113 ? ASN H 116 ? VAL H 113 ASN H 116 
AY 2 THR H 32  ? GLU H 36  ? THR H 32  GLU H 36  
AY 3 ILE H 5   ? ILE H 12  ? ILE H 5   ILE H 12  
AY 4 THR H 136 ? ILE H 146 ? THR H 136 ILE H 146 
AY 5 GLN H 126 ? THR H 130 ? GLN H 126 THR H 130 
AY 6 TYR H 118 ? GLY H 123 ? TYR H 118 GLY H 123 
AZ 1 VAL H 113 ? ASN H 116 ? VAL H 113 ASN H 116 
AZ 2 THR H 32  ? GLU H 36  ? THR H 32  GLU H 36  
AZ 3 ILE H 5   ? ILE H 12  ? ILE H 5   ILE H 12  
AZ 4 THR H 136 ? ILE H 146 ? THR H 136 ILE H 146 
AZ 5 ILE H 315 ? ALA H 317 ? ILE H 315 ALA H 317 
BA 1 SER H 150 ? VAL H 152 ? SER H 150 VAL H 152 
BA 2 ARG H 280 ? PRO H 282 ? ARG H 280 PRO H 282 
BB 1 ILE H 165 ? VAL H 166 ? ILE H 165 VAL H 166 
BB 2 VAL H 273 ? VAL H 276 ? VAL H 273 VAL H 276 
BB 3 LYS H 180 ? ILE H 184 ? LYS H 180 ILE H 184 
BB 4 ASP H 203 ? VAL H 207 ? ASP H 203 VAL H 207 
BB 5 LYS H 236 ? LYS H 238 ? LYS H 236 LYS H 238 
BC 1 THR H 241 ? LYS H 248 ? THR H 241 LYS H 248 
BC 2 ILE H 254 ? ALA H 260 ? ILE H 254 ALA H 260 
BC 3 GLU H 267 ? CYS H 271 ? GLU H 267 CYS H 271 
BD 1 SER H 356 ? ILE H 358 ? SER H 356 ILE H 358 
BD 2 GLU H 363 ? GLY H 368 ? GLU H 363 GLY H 368 
BD 3 VAL H 415 ? GLY H 422 ? VAL H 415 GLY H 422 
BD 4 MET H 403 ? GLN H 409 ? MET H 403 GLN H 409 
BD 5 TYR H 381 ? PRO H 387 ? TYR H 381 PRO H 387 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O VAL A 113 ? O VAL A 113 N CYS A 34  ? N CYS A 34  
A  2 3 O VAL A 33  ? O VAL A 33  N VAL A 11  ? N VAL A 11  
A  3 4 N THR A 10  ? N THR A 10  O LEU A 145 ? O LEU A 145 
A  4 5 O ILE A 139 ? O ILE A 139 N VAL A 127 ? N VAL A 127 
A  5 6 O THR A 128 ? O THR A 128 N LYS A 120 ? N LYS A 120 
B  1 2 O VAL A 113 ? O VAL A 113 N CYS A 34  ? N CYS A 34  
B  2 3 O VAL A 33  ? O VAL A 33  N VAL A 11  ? N VAL A 11  
B  3 4 N THR A 10  ? N THR A 10  O LEU A 145 ? O LEU A 145 
B  4 5 N ILE A 144 ? N ILE A 144 O TYR A 316 ? O TYR A 316 
C  1 2 N GLU A 77  ? N GLU A 77  O ARG B 82  ? O ARG B 82  
D  1 2 N ARG A 82  ? N ARG A 82  O GLU B 77  ? O GLU B 77  
E  1 2 N GLU A 151 ? N GLU A 151 O ARG A 281 ? O ARG A 281 
F  1 2 N VAL A 166 ? N VAL A 166 O VAL A 276 ? O VAL A 276 
F  2 3 O LEU A 275 ? O LEU A 275 N ILE A 184 ? N ILE A 184 
F  3 4 N MET A 181 ? N MET A 181 O ASP A 203 ? O ASP A 203 
F  4 5 N ALA A 206 ? N ALA A 206 O LYS A 238 ? O LYS A 238 
G  1 2 N LYS A 242 ? N LYS A 242 O GLU A 259 ? O GLU A 259 
G  2 3 N VAL A 256 ? N VAL A 256 O ILE A 269 ? O ILE A 269 
H  1 2 N ILE A 358 ? N ILE A 358 O VAL A 364 ? O VAL A 364 
H  2 3 N ALA A 365 ? N ALA A 365 O ILE A 420 ? O ILE A 420 
H  3 4 O LEU A 416 ? O LEU A 416 N LEU A 407 ? N LEU A 407 
H  4 5 O ILE A 406 ? O ILE A 406 N GLY A 384 ? N GLY A 384 
I  1 2 O VAL B 113 ? O VAL B 113 N CYS B 34  ? N CYS B 34  
I  2 3 O ILE B 35  ? O ILE B 35  N VAL B 11  ? N VAL B 11  
I  3 4 N THR B 10  ? N THR B 10  O LEU B 145 ? O LEU B 145 
I  4 5 O ILE B 139 ? O ILE B 139 N VAL B 127 ? N VAL B 127 
I  5 6 O THR B 128 ? O THR B 128 N LYS B 120 ? N LYS B 120 
J  1 2 O VAL B 113 ? O VAL B 113 N CYS B 34  ? N CYS B 34  
J  2 3 O ILE B 35  ? O ILE B 35  N VAL B 11  ? N VAL B 11  
J  3 4 N THR B 10  ? N THR B 10  O LEU B 145 ? O LEU B 145 
J  4 5 N ILE B 146 ? N ILE B 146 O TYR B 316 ? O TYR B 316 
K  1 2 N GLU B 151 ? N GLU B 151 O ARG B 281 ? O ARG B 281 
L  1 2 N VAL B 166 ? N VAL B 166 O LEU B 274 ? O LEU B 274 
L  2 3 O LEU B 275 ? O LEU B 275 N ILE B 184 ? N ILE B 184 
L  3 4 N VAL B 183 ? N VAL B 183 O VAL B 207 ? O VAL B 207 
L  4 5 N ALA B 206 ? N ALA B 206 O LYS B 236 ? O LYS B 236 
M  1 2 N LYS B 242 ? N LYS B 242 O GLU B 259 ? O GLU B 259 
M  2 3 N VAL B 256 ? N VAL B 256 O ILE B 269 ? O ILE B 269 
N  1 2 N ILE B 358 ? N ILE B 358 O VAL B 364 ? O VAL B 364 
N  2 3 N ALA B 365 ? N ALA B 365 O ILE B 420 ? O ILE B 420 
N  3 4 O HIS B 419 ? O HIS B 419 N LYS B 405 ? N LYS B 405 
N  4 5 O ILE B 406 ? O ILE B 406 N GLY B 384 ? N GLY B 384 
O  1 2 O VAL C 113 ? O VAL C 113 N CYS C 34  ? N CYS C 34  
O  2 3 O VAL C 33  ? O VAL C 33  N VAL C 11  ? N VAL C 11  
O  3 4 N ILE C 5   ? N ILE C 5   O ASP C 140 ? O ASP C 140 
O  4 5 O ILE C 139 ? O ILE C 139 N VAL C 127 ? N VAL C 127 
O  5 6 O GLN C 126 ? O GLN C 126 N GLY C 123 ? N GLY C 123 
P  1 2 O VAL C 113 ? O VAL C 113 N CYS C 34  ? N CYS C 34  
P  2 3 O VAL C 33  ? O VAL C 33  N VAL C 11  ? N VAL C 11  
P  3 4 N ILE C 5   ? N ILE C 5   O ASP C 140 ? O ASP C 140 
P  4 5 N ILE C 144 ? N ILE C 144 O TYR C 316 ? O TYR C 316 
Q  1 2 N GLU C 77  ? N GLU C 77  O ARG D 82  ? O ARG D 82  
R  1 2 N ARG C 82  ? N ARG C 82  O GLU D 77  ? O GLU D 77  
S  1 2 N GLU C 151 ? N GLU C 151 O ARG C 281 ? O ARG C 281 
T  1 2 N VAL C 166 ? N VAL C 166 O VAL C 276 ? O VAL C 276 
T  2 3 O LEU C 275 ? O LEU C 275 N ILE C 184 ? N ILE C 184 
T  3 4 N VAL C 183 ? N VAL C 183 O VAL C 207 ? O VAL C 207 
T  4 5 N ALA C 206 ? N ALA C 206 O LYS C 238 ? O LYS C 238 
U  1 2 N LYS C 242 ? N LYS C 242 O GLU C 259 ? O GLU C 259 
U  2 3 N VAL C 256 ? N VAL C 256 O ILE C 269 ? O ILE C 269 
V  1 2 N ILE C 358 ? N ILE C 358 O VAL C 364 ? O VAL C 364 
V  2 3 N ALA C 365 ? N ALA C 365 O ILE C 420 ? O ILE C 420 
V  3 4 O HIS C 419 ? O HIS C 419 N LYS C 405 ? N LYS C 405 
V  4 5 O GLY C 408 ? O GLY C 408 N LYS C 382 ? N LYS C 382 
W  1 2 O VAL D 113 ? O VAL D 113 N CYS D 34  ? N CYS D 34  
W  2 3 O VAL D 33  ? O VAL D 33  N VAL D 11  ? N VAL D 11  
W  3 4 N ILE D 12  ? N ILE D 12  O LEU D 145 ? O LEU D 145 
W  4 5 O ILE D 139 ? O ILE D 139 N VAL D 127 ? N VAL D 127 
W  5 6 O THR D 128 ? O THR D 128 N LYS D 120 ? N LYS D 120 
X  1 2 O VAL D 113 ? O VAL D 113 N CYS D 34  ? N CYS D 34  
X  2 3 O VAL D 33  ? O VAL D 33  N VAL D 11  ? N VAL D 11  
X  3 4 N ILE D 12  ? N ILE D 12  O LEU D 145 ? O LEU D 145 
X  4 5 N ILE D 144 ? N ILE D 144 O TYR D 316 ? O TYR D 316 
Y  1 2 N GLU D 151 ? N GLU D 151 O ARG D 281 ? O ARG D 281 
Z  1 2 N VAL D 166 ? N VAL D 166 O VAL D 276 ? O VAL D 276 
Z  2 3 O LEU D 275 ? O LEU D 275 N ILE D 184 ? N ILE D 184 
Z  3 4 N VAL D 183 ? N VAL D 183 O THR D 205 ? O THR D 205 
Z  4 5 N GLU D 208 ? N GLU D 208 O LYS D 238 ? O LYS D 238 
AA 1 2 N LYS D 242 ? N LYS D 242 O GLU D 259 ? O GLU D 259 
AA 2 3 N VAL D 256 ? N VAL D 256 O ILE D 269 ? O ILE D 269 
AB 1 2 N ILE D 358 ? N ILE D 358 O VAL D 364 ? O VAL D 364 
AB 2 3 N ALA D 365 ? N ALA D 365 O ILE D 420 ? O ILE D 420 
AB 3 4 O LEU D 416 ? O LEU D 416 N LEU D 407 ? N LEU D 407 
AB 4 5 O ILE D 406 ? O ILE D 406 N GLY D 384 ? N GLY D 384 
AC 1 2 O VAL E 113 ? O VAL E 113 N THR E 32  ? N THR E 32  
AC 2 3 O VAL E 33  ? O VAL E 33  N VAL E 11  ? N VAL E 11  
AC 3 4 N ILE E 5   ? N ILE E 5   O VAL E 138 ? O VAL E 138 
AC 4 5 O GLN E 137 ? O GLN E 137 N ALA E 129 ? N ALA E 129 
AC 5 6 O THR E 128 ? O THR E 128 N LYS E 120 ? N LYS E 120 
AD 1 2 O VAL E 113 ? O VAL E 113 N THR E 32  ? N THR E 32  
AD 2 3 O VAL E 33  ? O VAL E 33  N VAL E 11  ? N VAL E 11  
AD 3 4 N ILE E 5   ? N ILE E 5   O VAL E 138 ? O VAL E 138 
AD 4 5 N ILE E 144 ? N ILE E 144 O TYR E 316 ? O TYR E 316 
AE 1 2 N GLU E 77  ? N GLU E 77  O ARG F 82  ? O ARG F 82  
AF 1 2 N ARG E 82  ? N ARG E 82  O GLU F 77  ? O GLU F 77  
AG 1 2 N GLU E 151 ? N GLU E 151 O ARG E 281 ? O ARG E 281 
AH 1 2 N VAL E 166 ? N VAL E 166 O VAL E 276 ? O VAL E 276 
AH 2 3 O LEU E 275 ? O LEU E 275 N VAL E 182 ? N VAL E 182 
AH 3 4 N VAL E 183 ? N VAL E 183 O VAL E 207 ? O VAL E 207 
AH 4 5 N ALA E 206 ? N ALA E 206 O LYS E 236 ? O LYS E 236 
AI 1 2 N THR E 244 ? N THR E 244 O SER E 257 ? O SER E 257 
AI 2 3 N VAL E 256 ? N VAL E 256 O ILE E 269 ? O ILE E 269 
AJ 1 2 N ILE E 358 ? N ILE E 358 O VAL E 364 ? O VAL E 364 
AJ 2 3 N ALA E 365 ? N ALA E 365 O ILE E 420 ? O ILE E 420 
AJ 3 4 O LEU E 416 ? O LEU E 416 N LEU E 407 ? N LEU E 407 
AJ 4 5 O GLY E 408 ? O GLY E 408 N LYS E 382 ? N LYS E 382 
AK 1 2 O VAL F 113 ? O VAL F 113 N CYS F 34  ? N CYS F 34  
AK 2 3 O ILE F 35  ? O ILE F 35  N VAL F 11  ? N VAL F 11  
AK 3 4 N ILE F 12  ? N ILE F 12  O LEU F 145 ? O LEU F 145 
AK 4 5 O GLN F 137 ? O GLN F 137 N ALA F 129 ? N ALA F 129 
AK 5 6 O THR F 128 ? O THR F 128 N LYS F 120 ? N LYS F 120 
AL 1 2 O VAL F 113 ? O VAL F 113 N CYS F 34  ? N CYS F 34  
AL 2 3 O ILE F 35  ? O ILE F 35  N VAL F 11  ? N VAL F 11  
AL 3 4 N ILE F 12  ? N ILE F 12  O LEU F 145 ? O LEU F 145 
AL 4 5 N ILE F 144 ? N ILE F 144 O TYR F 316 ? O TYR F 316 
AM 1 2 N GLU F 151 ? N GLU F 151 O ARG F 281 ? O ARG F 281 
AN 1 2 N VAL F 166 ? N VAL F 166 O VAL F 276 ? O VAL F 276 
AN 2 3 O LEU F 275 ? O LEU F 275 N ILE F 184 ? N ILE F 184 
AN 3 4 N VAL F 183 ? N VAL F 183 O VAL F 207 ? O VAL F 207 
AN 4 5 N ALA F 206 ? N ALA F 206 O LYS F 238 ? O LYS F 238 
AO 1 2 N THR F 244 ? N THR F 244 O SER F 257 ? O SER F 257 
AO 2 3 N VAL F 256 ? N VAL F 256 O ILE F 269 ? O ILE F 269 
AP 1 2 N ILE F 358 ? N ILE F 358 O VAL F 364 ? O VAL F 364 
AP 2 3 N ALA F 365 ? N ALA F 365 O ILE F 420 ? O ILE F 420 
AP 3 4 O LEU F 416 ? O LEU F 416 N LEU F 407 ? N LEU F 407 
AP 4 5 O ILE F 406 ? O ILE F 406 N GLY F 384 ? N GLY F 384 
AQ 1 2 O VAL G 113 ? O VAL G 113 N CYS G 34  ? N CYS G 34  
AQ 2 3 O VAL G 33  ? O VAL G 33  N VAL G 11  ? N VAL G 11  
AQ 3 4 N ILE G 5   ? N ILE G 5   O ASP G 140 ? O ASP G 140 
AQ 4 5 O GLN G 137 ? O GLN G 137 N ALA G 129 ? N ALA G 129 
AQ 5 6 O THR G 128 ? O THR G 128 N LYS G 120 ? N LYS G 120 
AR 1 2 O VAL G 113 ? O VAL G 113 N CYS G 34  ? N CYS G 34  
AR 2 3 O VAL G 33  ? O VAL G 33  N VAL G 11  ? N VAL G 11  
AR 3 4 N ILE G 5   ? N ILE G 5   O ASP G 140 ? O ASP G 140 
AR 4 5 N ILE G 146 ? N ILE G 146 O TYR G 316 ? O TYR G 316 
AS 1 2 N GLU G 77  ? N GLU G 77  O ARG H 82  ? O ARG H 82  
AT 1 2 N ARG G 82  ? N ARG G 82  O GLU H 77  ? O GLU H 77  
AU 1 2 N GLU G 151 ? N GLU G 151 O ARG G 281 ? O ARG G 281 
AV 1 2 N VAL G 166 ? N VAL G 166 O VAL G 276 ? O VAL G 276 
AV 2 3 O LEU G 275 ? O LEU G 275 N ILE G 184 ? N ILE G 184 
AV 3 4 N VAL G 183 ? N VAL G 183 O VAL G 207 ? O VAL G 207 
AV 4 5 N ALA G 206 ? N ALA G 206 O LYS G 238 ? O LYS G 238 
AW 1 2 N THR G 244 ? N THR G 244 O SER G 257 ? O SER G 257 
AW 2 3 N VAL G 256 ? N VAL G 256 O ILE G 269 ? O ILE G 269 
AX 1 2 N ILE G 358 ? N ILE G 358 O VAL G 364 ? O VAL G 364 
AX 2 3 N ALA G 365 ? N ALA G 365 O ILE G 420 ? O ILE G 420 
AX 3 4 O LEU G 416 ? O LEU G 416 N LEU G 407 ? N LEU G 407 
AX 4 5 O ILE G 406 ? O ILE G 406 N GLY G 384 ? N GLY G 384 
AY 1 2 O VAL H 113 ? O VAL H 113 N THR H 32  ? N THR H 32  
AY 2 3 O VAL H 33  ? O VAL H 33  N VAL H 11  ? N VAL H 11  
AY 3 4 N THR H 10  ? N THR H 10  O LEU H 145 ? O LEU H 145 
AY 4 5 O ILE H 139 ? O ILE H 139 N VAL H 127 ? N VAL H 127 
AY 5 6 O THR H 128 ? O THR H 128 N LYS H 120 ? N LYS H 120 
AZ 1 2 O VAL H 113 ? O VAL H 113 N THR H 32  ? N THR H 32  
AZ 2 3 O VAL H 33  ? O VAL H 33  N VAL H 11  ? N VAL H 11  
AZ 3 4 N THR H 10  ? N THR H 10  O LEU H 145 ? O LEU H 145 
AZ 4 5 N ILE H 146 ? N ILE H 146 O TYR H 316 ? O TYR H 316 
BA 1 2 N GLU H 151 ? N GLU H 151 O ARG H 281 ? O ARG H 281 
BB 1 2 N VAL H 166 ? N VAL H 166 O VAL H 276 ? O VAL H 276 
BB 2 3 O LEU H 275 ? O LEU H 275 N VAL H 182 ? N VAL H 182 
BB 3 4 N VAL H 183 ? N VAL H 183 O VAL H 207 ? O VAL H 207 
BB 4 5 N ALA H 206 ? N ALA H 206 O LYS H 238 ? O LYS H 238 
BC 1 2 N GLY H 245 ? N GLY H 245 O SER H 257 ? O SER H 257 
BC 2 3 N VAL H 256 ? N VAL H 256 O ILE H 269 ? O ILE H 269 
BD 1 2 N ILE H 358 ? N ILE H 358 O VAL H 364 ? O VAL H 364 
BD 2 3 N ALA H 365 ? N ALA H 365 O ILE H 420 ? O ILE H 420 
BD 3 4 O LEU H 416 ? O LEU H 416 N LEU H 407 ? N LEU H 407 
BD 4 5 O ILE H 406 ? O ILE H 406 N GLY H 384 ? N GLY H 384 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 2000' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 A 2001' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 2002' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 2003' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 B 2004' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 2005' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 2006' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 C 2007' 
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 2008' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 2009' 
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 C 2010' 
BC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 2011' 
BC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 D 2012' 
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 2013' 
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 2014' 
BC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 E 2015' 
BC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 E 2016' 
BC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 E 2017' 
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 E 2018' 
CC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 F 2019' 
CC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 F 2020' 
CC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 F 2021' 
CC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 F 2022' 
CC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 G 2023' 
CC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 G 2024' 
CC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 G 2025' 
CC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 G 2026' 
DC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 H 2027' 
DC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 H 2028' 
DC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 H 2029' 
DC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 H 2030' 
DC5 Software ? ? ? ? 38 'BINDING SITE FOR RESIDUE FAD A 480'  
DC6 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE NAI A 481'  
DC7 Software ? ? ? ? 38 'BINDING SITE FOR RESIDUE FAD B 480'  
DC8 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE NAI B 481'  
DC9 Software ? ? ? ? 41 'BINDING SITE FOR RESIDUE FAD C 480'  
EC1 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE NAI C 481'  
EC2 Software ? ? ? ? 40 'BINDING SITE FOR RESIDUE FAD D 480'  
EC3 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE NAI D 481'  
EC4 Software ? ? ? ? 40 'BINDING SITE FOR RESIDUE FAD E 480'  
EC5 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE NAI E 481'  
EC6 Software ? ? ? ? 42 'BINDING SITE FOR RESIDUE FAD F 480'  
EC7 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAI F 481'  
EC8 Software ? ? ? ? 40 'BINDING SITE FOR RESIDUE FAD G 480'  
EC9 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE NAI G 481'  
FC1 Software ? ? ? ? 40 'BINDING SITE FOR RESIDUE FAD H 480'  
FC2 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE NAI H 481'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 3  HIS A  64  ? HIS A 64   . ? 1_555 ? 
2   AC1 3  GLY A  68  ? GLY A 68   . ? 1_555 ? 
3   AC1 3  THR A  69  ? THR A 69   . ? 1_555 ? 
4   AC2 8  THR A  284 ? THR A 284  . ? 1_555 ? 
5   AC2 8  ASN A  286 ? ASN A 286  . ? 1_555 ? 
6   AC2 8  LEU A  287 ? LEU A 287  . ? 1_555 ? 
7   AC2 8  GLY A  288 ? GLY A 288  . ? 1_555 ? 
8   AC2 8  LEU A  289 ? LEU A 289  . ? 1_555 ? 
9   AC2 8  GLU A  290 ? GLU A 290  . ? 1_555 ? 
10  AC2 8  GLU A  291 ? GLU A 291  . ? 1_555 ? 
11  AC2 8  HOH DB .   ? HOH A 2055 . ? 1_555 ? 
12  AC3 4  ARG A  299 ? ARG A 299  . ? 1_555 ? 
13  AC3 4  ARG A  301 ? ARG A 301  . ? 1_555 ? 
14  AC3 4  GLY A  324 ? GLY A 324  . ? 1_555 ? 
15  AC3 4  HOH DB .   ? HOH A 2114 . ? 1_555 ? 
16  AC4 3  HIS B  64  ? HIS B 64   . ? 1_555 ? 
17  AC4 3  GLY B  68  ? GLY B 68   . ? 1_555 ? 
18  AC4 3  THR B  69  ? THR B 69   . ? 1_555 ? 
19  AC5 6  ASN B  286 ? ASN B 286  . ? 1_555 ? 
20  AC5 6  LEU B  287 ? LEU B 287  . ? 1_555 ? 
21  AC5 6  GLY B  288 ? GLY B 288  . ? 1_555 ? 
22  AC5 6  LEU B  289 ? LEU B 289  . ? 1_555 ? 
23  AC5 6  GLU B  290 ? GLU B 290  . ? 1_555 ? 
24  AC5 6  HOH EB .   ? HOH B 2100 . ? 1_555 ? 
25  AC6 5  LYS A  111 ? LYS A 111  . ? 2_665 ? 
26  AC6 5  ILE B  379 ? ILE B 379  . ? 1_555 ? 
27  AC6 5  GLU B  380 ? GLU B 380  . ? 1_555 ? 
28  AC6 5  GLN B  409 ? GLN B 409  . ? 1_555 ? 
29  AC6 5  HOH EB .   ? HOH B 2036 . ? 1_555 ? 
30  AC7 4  ARG B  299 ? ARG B 299  . ? 1_555 ? 
31  AC7 4  ARG B  301 ? ARG B 301  . ? 1_555 ? 
32  AC7 4  ALA B  323 ? ALA B 323  . ? 1_555 ? 
33  AC7 4  GLY B  324 ? GLY B 324  . ? 1_555 ? 
34  AC8 3  HIS C  64  ? HIS C 64   . ? 1_555 ? 
35  AC8 3  GLY C  68  ? GLY C 68   . ? 1_555 ? 
36  AC8 3  THR C  69  ? THR C 69   . ? 1_555 ? 
37  AC9 5  ASN C  286 ? ASN C 286  . ? 1_555 ? 
38  AC9 5  LEU C  287 ? LEU C 287  . ? 1_555 ? 
39  AC9 5  GLY C  288 ? GLY C 288  . ? 1_555 ? 
40  AC9 5  LEU C  289 ? LEU C 289  . ? 1_555 ? 
41  AC9 5  GLU C  290 ? GLU C 290  . ? 1_555 ? 
42  BC1 5  ILE C  379 ? ILE C 379  . ? 1_555 ? 
43  BC1 5  GLU C  380 ? GLU C 380  . ? 1_555 ? 
44  BC1 5  GLN C  409 ? GLN C 409  . ? 1_555 ? 
45  BC1 5  HOH FB .   ? HOH C 2044 . ? 1_555 ? 
46  BC1 5  LYS D  111 ? LYS D 111  . ? 2_765 ? 
47  BC2 4  ARG C  299 ? ARG C 299  . ? 1_555 ? 
48  BC2 4  ARG C  301 ? ARG C 301  . ? 1_555 ? 
49  BC2 4  ALA C  323 ? ALA C 323  . ? 1_555 ? 
50  BC2 4  GLY C  324 ? GLY C 324  . ? 1_555 ? 
51  BC3 4  HIS D  64  ? HIS D 64   . ? 1_555 ? 
52  BC3 4  GLY D  68  ? GLY D 68   . ? 1_555 ? 
53  BC3 4  THR D  69  ? THR D 69   . ? 1_555 ? 
54  BC3 4  HOH GB .   ? HOH D 2037 . ? 1_555 ? 
55  BC4 9  THR D  284 ? THR D 284  . ? 1_555 ? 
56  BC4 9  ASN D  286 ? ASN D 286  . ? 1_555 ? 
57  BC4 9  LEU D  287 ? LEU D 287  . ? 1_555 ? 
58  BC4 9  GLY D  288 ? GLY D 288  . ? 1_555 ? 
59  BC4 9  LEU D  289 ? LEU D 289  . ? 1_555 ? 
60  BC4 9  GLU D  290 ? GLU D 290  . ? 1_555 ? 
61  BC4 9  GLU D  291 ? GLU D 291  . ? 1_555 ? 
62  BC4 9  HOH GB .   ? HOH D 2174 . ? 1_555 ? 
63  BC4 9  HOH GB .   ? HOH D 2205 . ? 1_555 ? 
64  BC5 4  GLY D  378 ? GLY D 378  . ? 1_555 ? 
65  BC5 4  ILE D  379 ? ILE D 379  . ? 1_555 ? 
66  BC5 4  GLU D  380 ? GLU D 380  . ? 1_555 ? 
67  BC5 4  GLN D  409 ? GLN D 409  . ? 1_555 ? 
68  BC6 4  ARG D  299 ? ARG D 299  . ? 1_555 ? 
69  BC6 4  ARG D  301 ? ARG D 301  . ? 1_555 ? 
70  BC6 4  ALA D  323 ? ALA D 323  . ? 1_555 ? 
71  BC6 4  GLY D  324 ? GLY D 324  . ? 1_555 ? 
72  BC7 4  HIS E  64  ? HIS E 64   . ? 1_555 ? 
73  BC7 4  GLY E  68  ? GLY E 68   . ? 1_555 ? 
74  BC7 4  THR E  69  ? THR E 69   . ? 1_555 ? 
75  BC7 4  HOH HB .   ? HOH E 2052 . ? 1_555 ? 
76  BC8 6  THR E  284 ? THR E 284  . ? 1_555 ? 
77  BC8 6  ASN E  286 ? ASN E 286  . ? 1_555 ? 
78  BC8 6  LEU E  287 ? LEU E 287  . ? 1_555 ? 
79  BC8 6  GLY E  288 ? GLY E 288  . ? 1_555 ? 
80  BC8 6  LEU E  289 ? LEU E 289  . ? 1_555 ? 
81  BC8 6  GLU E  290 ? GLU E 290  . ? 1_555 ? 
82  BC9 8  GLY E  378 ? GLY E 378  . ? 1_555 ? 
83  BC9 8  ILE E  379 ? ILE E 379  . ? 1_555 ? 
84  BC9 8  GLU E  380 ? GLU E 380  . ? 1_555 ? 
85  BC9 8  GLN E  409 ? GLN E 409  . ? 1_555 ? 
86  BC9 8  HOH HB .   ? HOH E 2057 . ? 1_555 ? 
87  BC9 8  HOH HB .   ? HOH E 2121 . ? 1_555 ? 
88  BC9 8  HOH HB .   ? HOH E 2122 . ? 1_555 ? 
89  BC9 8  LYS F  111 ? LYS F 111  . ? 2_665 ? 
90  CC1 5  ARG E  299 ? ARG E 299  . ? 1_555 ? 
91  CC1 5  ARG E  301 ? ARG E 301  . ? 1_555 ? 
92  CC1 5  ALA E  323 ? ALA E 323  . ? 1_555 ? 
93  CC1 5  GLY E  324 ? GLY E 324  . ? 1_555 ? 
94  CC1 5  HOH HB .   ? HOH E 2063 . ? 1_555 ? 
95  CC2 4  HIS F  64  ? HIS F 64   . ? 1_555 ? 
96  CC2 4  GLY F  68  ? GLY F 68   . ? 1_555 ? 
97  CC2 4  THR F  69  ? THR F 69   . ? 1_555 ? 
98  CC2 4  HOH IB .   ? HOH F 2079 . ? 1_555 ? 
99  CC3 8  THR F  284 ? THR F 284  . ? 1_555 ? 
100 CC3 8  LEU F  287 ? LEU F 287  . ? 1_555 ? 
101 CC3 8  GLY F  288 ? GLY F 288  . ? 1_555 ? 
102 CC3 8  LEU F  289 ? LEU F 289  . ? 1_555 ? 
103 CC3 8  GLU F  290 ? GLU F 290  . ? 1_555 ? 
104 CC3 8  GLU F  291 ? GLU F 291  . ? 1_555 ? 
105 CC3 8  HOH IB .   ? HOH F 2291 . ? 1_555 ? 
106 CC3 8  HOH IB .   ? HOH F 2304 . ? 1_555 ? 
107 CC4 4  GLY F  378 ? GLY F 378  . ? 1_555 ? 
108 CC4 4  ILE F  379 ? ILE F 379  . ? 1_555 ? 
109 CC4 4  GLU F  380 ? GLU F 380  . ? 1_555 ? 
110 CC4 4  GLN F  409 ? GLN F 409  . ? 1_555 ? 
111 CC5 3  ARG F  299 ? ARG F 299  . ? 1_555 ? 
112 CC5 3  ARG F  301 ? ARG F 301  . ? 1_555 ? 
113 CC5 3  LYS G  265 ? LYS G 265  . ? 1_555 ? 
114 CC6 4  HIS G  64  ? HIS G 64   . ? 1_555 ? 
115 CC6 4  GLY G  68  ? GLY G 68   . ? 1_555 ? 
116 CC6 4  THR G  69  ? THR G 69   . ? 1_555 ? 
117 CC6 4  HOH JB .   ? HOH G 2080 . ? 1_555 ? 
118 CC7 8  THR G  284 ? THR G 284  . ? 1_555 ? 
119 CC7 8  ASN G  286 ? ASN G 286  . ? 1_555 ? 
120 CC7 8  LEU G  287 ? LEU G 287  . ? 1_555 ? 
121 CC7 8  GLY G  288 ? GLY G 288  . ? 1_555 ? 
122 CC7 8  LEU G  289 ? LEU G 289  . ? 1_555 ? 
123 CC7 8  GLU G  290 ? GLU G 290  . ? 1_555 ? 
124 CC7 8  GLU G  291 ? GLU G 291  . ? 1_555 ? 
125 CC7 8  HOH JB .   ? HOH G 2220 . ? 1_555 ? 
126 CC8 3  ILE G  379 ? ILE G 379  . ? 1_555 ? 
127 CC8 3  GLU G  380 ? GLU G 380  . ? 1_555 ? 
128 CC8 3  GLN G  409 ? GLN G 409  . ? 1_555 ? 
129 CC9 2  LYS F  265 ? LYS F 265  . ? 1_555 ? 
130 CC9 2  ARG G  299 ? ARG G 299  . ? 1_555 ? 
131 DC1 5  HIS H  64  ? HIS H 64   . ? 1_555 ? 
132 DC1 5  GLY H  68  ? GLY H 68   . ? 1_555 ? 
133 DC1 5  THR H  69  ? THR H 69   . ? 1_555 ? 
134 DC1 5  HOH KB .   ? HOH H 2069 . ? 1_555 ? 
135 DC1 5  HOH KB .   ? HOH H 2190 . ? 1_555 ? 
136 DC2 7  ASN H  286 ? ASN H 286  . ? 1_555 ? 
137 DC2 7  LEU H  287 ? LEU H 287  . ? 1_555 ? 
138 DC2 7  GLY H  288 ? GLY H 288  . ? 1_555 ? 
139 DC2 7  LEU H  289 ? LEU H 289  . ? 1_555 ? 
140 DC2 7  GLU H  290 ? GLU H 290  . ? 1_555 ? 
141 DC2 7  GLU H  291 ? GLU H 291  . ? 1_555 ? 
142 DC2 7  HOH KB .   ? HOH H 2281 . ? 1_555 ? 
143 DC3 5  LYS G  111 ? LYS G 111  . ? 2_675 ? 
144 DC3 5  ILE H  379 ? ILE H 379  . ? 1_555 ? 
145 DC3 5  GLU H  380 ? GLU H 380  . ? 1_555 ? 
146 DC3 5  GLN H  409 ? GLN H 409  . ? 1_555 ? 
147 DC3 5  HOH KB .   ? HOH H 2071 . ? 1_555 ? 
148 DC4 4  ARG H  299 ? ARG H 299  . ? 1_555 ? 
149 DC4 4  ARG H  301 ? ARG H 301  . ? 1_555 ? 
150 DC4 4  ALA H  323 ? ALA H 323  . ? 1_555 ? 
151 DC4 4  GLY H  324 ? GLY H 324  . ? 1_555 ? 
152 DC5 38 ILE A  12  ? ILE A 12   . ? 1_555 ? 
153 DC5 38 GLY A  13  ? GLY A 13   . ? 1_555 ? 
154 DC5 38 SER A  14  ? SER A 14   . ? 1_555 ? 
155 DC5 38 GLY A  15  ? GLY A 15   . ? 1_555 ? 
156 DC5 38 PRO A  16  ? PRO A 16   . ? 1_555 ? 
157 DC5 38 GLY A  17  ? GLY A 17   . ? 1_555 ? 
158 DC5 38 GLU A  36  ? GLU A 36   . ? 1_555 ? 
159 DC5 38 LYS A  37  ? LYS A 37   . ? 1_555 ? 
160 DC5 38 ASN A  38  ? ASN A 38   . ? 1_555 ? 
161 DC5 38 GLY A  43  ? GLY A 43   . ? 1_555 ? 
162 DC5 38 THR A  44  ? THR A 44   . ? 1_555 ? 
163 DC5 38 CYS A  45  ? CYS A 45   . ? 1_555 ? 
164 DC5 38 GLY A  49  ? GLY A 49   . ? 1_555 ? 
165 DC5 38 CYS A  50  ? CYS A 50   . ? 1_555 ? 
166 DC5 38 LYS A  54  ? LYS A 54   . ? 1_555 ? 
167 DC5 38 GLY A  117 ? GLY A 117  . ? 1_555 ? 
168 DC5 38 TYR A  118 ? TYR A 118  . ? 1_555 ? 
169 DC5 38 GLY A  119 ? GLY A 119  . ? 1_555 ? 
170 DC5 38 ALA A  147 ? ALA A 147  . ? 1_555 ? 
171 DC5 38 THR A  148 ? THR A 148  . ? 1_555 ? 
172 DC5 38 GLY A  149 ? GLY A 149  . ? 1_555 ? 
173 DC5 38 SER A  150 ? SER A 150  . ? 1_555 ? 
174 DC5 38 SER A  168 ? SER A 168  . ? 1_555 ? 
175 DC5 38 ARG A  280 ? ARG A 280  . ? 1_555 ? 
176 DC5 38 PHE A  283 ? PHE A 283  . ? 1_555 ? 
177 DC5 38 GLY A  319 ? GLY A 319  . ? 1_555 ? 
178 DC5 38 ASP A  320 ? ASP A 320  . ? 1_555 ? 
179 DC5 38 MET A  326 ? MET A 326  . ? 1_555 ? 
180 DC5 38 LEU A  327 ? LEU A 327  . ? 1_555 ? 
181 DC5 38 ALA A  328 ? ALA A 328  . ? 1_555 ? 
182 DC5 38 HIS A  329 ? HIS A 329  . ? 1_555 ? 
183 DC5 38 TYR A  359 ? TYR A 359  . ? 1_555 ? 
184 DC5 38 NAI M  .   ? NAI A 481  . ? 1_555 ? 
185 DC5 38 HOH DB .   ? HOH A 2003 . ? 1_555 ? 
186 DC5 38 HOH DB .   ? HOH A 2005 . ? 1_555 ? 
187 DC5 38 HOH DB .   ? HOH A 2012 . ? 1_555 ? 
188 DC5 38 HOH DB .   ? HOH A 2016 . ? 1_555 ? 
189 DC5 38 HIS B  452 ? HIS B 452  . ? 1_555 ? 
190 DC6 23 PHE A  155 ? PHE A 155  . ? 1_555 ? 
191 DC6 23 ILE A  184 ? ILE A 184  . ? 1_555 ? 
192 DC6 23 GLY A  185 ? GLY A 185  . ? 1_555 ? 
193 DC6 23 GLY A  187 ? GLY A 187  . ? 1_555 ? 
194 DC6 23 VAL A  188 ? VAL A 188  . ? 1_555 ? 
195 DC6 23 ILE A  189 ? ILE A 189  . ? 1_555 ? 
196 DC6 23 GLU A  192 ? GLU A 192  . ? 1_555 ? 
197 DC6 23 VAL A  207 ? VAL A 207  . ? 1_555 ? 
198 DC6 23 GLU A  208 ? GLU A 208  . ? 1_555 ? 
199 DC6 23 PHE A  209 ? PHE A 209  . ? 1_555 ? 
200 DC6 23 LEU A  210 ? LEU A 210  . ? 1_555 ? 
201 DC6 23 CYS A  277 ? CYS A 277  . ? 1_555 ? 
202 DC6 23 ILE A  278 ? ILE A 278  . ? 1_555 ? 
203 DC6 23 GLY A  279 ? GLY A 279  . ? 1_555 ? 
204 DC6 23 ARG A  280 ? ARG A 280  . ? 1_555 ? 
205 DC6 23 MET A  326 ? MET A 326  . ? 1_555 ? 
206 DC6 23 LEU A  327 ? LEU A 327  . ? 1_555 ? 
207 DC6 23 VAL A  357 ? VAL A 357  . ? 1_555 ? 
208 DC6 23 TYR A  359 ? TYR A 359  . ? 1_555 ? 
209 DC6 23 FAD L  .   ? FAD A 480  . ? 1_555 ? 
210 DC6 23 HOH DB .   ? HOH A 2042 . ? 1_555 ? 
211 DC6 23 HOH DB .   ? HOH A 2045 . ? 1_555 ? 
212 DC6 23 HOH DB .   ? HOH A 2097 . ? 1_555 ? 
213 DC7 38 HIS A  452 ? HIS A 452  . ? 1_555 ? 
214 DC7 38 PRO A  453 ? PRO A 453  . ? 1_555 ? 
215 DC7 38 ILE B  12  ? ILE B 12   . ? 1_555 ? 
216 DC7 38 GLY B  13  ? GLY B 13   . ? 1_555 ? 
217 DC7 38 GLY B  15  ? GLY B 15   . ? 1_555 ? 
218 DC7 38 PRO B  16  ? PRO B 16   . ? 1_555 ? 
219 DC7 38 GLY B  17  ? GLY B 17   . ? 1_555 ? 
220 DC7 38 ILE B  35  ? ILE B 35   . ? 1_555 ? 
221 DC7 38 GLU B  36  ? GLU B 36   . ? 1_555 ? 
222 DC7 38 LYS B  37  ? LYS B 37   . ? 1_555 ? 
223 DC7 38 ASN B  38  ? ASN B 38   . ? 1_555 ? 
224 DC7 38 GLY B  43  ? GLY B 43   . ? 1_555 ? 
225 DC7 38 THR B  44  ? THR B 44   . ? 1_555 ? 
226 DC7 38 CYS B  45  ? CYS B 45   . ? 1_555 ? 
227 DC7 38 VAL B  48  ? VAL B 48   . ? 1_555 ? 
228 DC7 38 GLY B  49  ? GLY B 49   . ? 1_555 ? 
229 DC7 38 CYS B  50  ? CYS B 50   . ? 1_555 ? 
230 DC7 38 SER B  53  ? SER B 53   . ? 1_555 ? 
231 DC7 38 LYS B  54  ? LYS B 54   . ? 1_555 ? 
232 DC7 38 GLY B  117 ? GLY B 117  . ? 1_555 ? 
233 DC7 38 TYR B  118 ? TYR B 118  . ? 1_555 ? 
234 DC7 38 GLY B  119 ? GLY B 119  . ? 1_555 ? 
235 DC7 38 ALA B  147 ? ALA B 147  . ? 1_555 ? 
236 DC7 38 THR B  148 ? THR B 148  . ? 1_555 ? 
237 DC7 38 GLY B  149 ? GLY B 149  . ? 1_555 ? 
238 DC7 38 SER B  150 ? SER B 150  . ? 1_555 ? 
239 DC7 38 SER B  168 ? SER B 168  . ? 1_555 ? 
240 DC7 38 GLY B  319 ? GLY B 319  . ? 1_555 ? 
241 DC7 38 ASP B  320 ? ASP B 320  . ? 1_555 ? 
242 DC7 38 MET B  326 ? MET B 326  . ? 1_555 ? 
243 DC7 38 LEU B  327 ? LEU B 327  . ? 1_555 ? 
244 DC7 38 ALA B  328 ? ALA B 328  . ? 1_555 ? 
245 DC7 38 HIS B  329 ? HIS B 329  . ? 1_555 ? 
246 DC7 38 TYR B  359 ? TYR B 359  . ? 1_555 ? 
247 DC7 38 NAI S  .   ? NAI B 481  . ? 1_555 ? 
248 DC7 38 HOH EB .   ? HOH B 2021 . ? 1_555 ? 
249 DC7 38 HOH EB .   ? HOH B 2045 . ? 1_555 ? 
250 DC7 38 HOH EB .   ? HOH B 2123 . ? 1_555 ? 
251 DC8 23 GLY B  185 ? GLY B 185  . ? 1_555 ? 
252 DC8 23 GLY B  187 ? GLY B 187  . ? 1_555 ? 
253 DC8 23 VAL B  188 ? VAL B 188  . ? 1_555 ? 
254 DC8 23 ILE B  189 ? ILE B 189  . ? 1_555 ? 
255 DC8 23 GLU B  192 ? GLU B 192  . ? 1_555 ? 
256 DC8 23 GLU B  208 ? GLU B 208  . ? 1_555 ? 
257 DC8 23 PHE B  209 ? PHE B 209  . ? 1_555 ? 
258 DC8 23 LEU B  210 ? LEU B 210  . ? 1_555 ? 
259 DC8 23 CYS B  277 ? CYS B 277  . ? 1_555 ? 
260 DC8 23 ILE B  278 ? ILE B 278  . ? 1_555 ? 
261 DC8 23 GLY B  279 ? GLY B 279  . ? 1_555 ? 
262 DC8 23 MET B  326 ? MET B 326  . ? 1_555 ? 
263 DC8 23 LEU B  327 ? LEU B 327  . ? 1_555 ? 
264 DC8 23 VAL B  357 ? VAL B 357  . ? 1_555 ? 
265 DC8 23 TYR B  359 ? TYR B 359  . ? 1_555 ? 
266 DC8 23 FAD R  .   ? FAD B 480  . ? 1_555 ? 
267 DC8 23 HOH EB .   ? HOH B 2022 . ? 1_555 ? 
268 DC8 23 HOH EB .   ? HOH B 2056 . ? 1_555 ? 
269 DC8 23 HOH EB .   ? HOH B 2057 . ? 1_555 ? 
270 DC8 23 HOH EB .   ? HOH B 2063 . ? 1_555 ? 
271 DC8 23 HOH EB .   ? HOH B 2064 . ? 1_555 ? 
272 DC8 23 HOH EB .   ? HOH B 2094 . ? 1_555 ? 
273 DC8 23 HOH EB .   ? HOH B 2108 . ? 1_555 ? 
274 DC9 41 ILE C  12  ? ILE C 12   . ? 1_555 ? 
275 DC9 41 GLY C  13  ? GLY C 13   . ? 1_555 ? 
276 DC9 41 GLY C  15  ? GLY C 15   . ? 1_555 ? 
277 DC9 41 PRO C  16  ? PRO C 16   . ? 1_555 ? 
278 DC9 41 GLY C  17  ? GLY C 17   . ? 1_555 ? 
279 DC9 41 ILE C  35  ? ILE C 35   . ? 1_555 ? 
280 DC9 41 GLU C  36  ? GLU C 36   . ? 1_555 ? 
281 DC9 41 LYS C  37  ? LYS C 37   . ? 1_555 ? 
282 DC9 41 ASN C  38  ? ASN C 38   . ? 1_555 ? 
283 DC9 41 GLY C  43  ? GLY C 43   . ? 1_555 ? 
284 DC9 41 THR C  44  ? THR C 44   . ? 1_555 ? 
285 DC9 41 CYS C  45  ? CYS C 45   . ? 1_555 ? 
286 DC9 41 VAL C  48  ? VAL C 48   . ? 1_555 ? 
287 DC9 41 GLY C  49  ? GLY C 49   . ? 1_555 ? 
288 DC9 41 CYS C  50  ? CYS C 50   . ? 1_555 ? 
289 DC9 41 SER C  53  ? SER C 53   . ? 1_555 ? 
290 DC9 41 LYS C  54  ? LYS C 54   . ? 1_555 ? 
291 DC9 41 GLY C  117 ? GLY C 117  . ? 1_555 ? 
292 DC9 41 TYR C  118 ? TYR C 118  . ? 1_555 ? 
293 DC9 41 GLY C  119 ? GLY C 119  . ? 1_555 ? 
294 DC9 41 ALA C  147 ? ALA C 147  . ? 1_555 ? 
295 DC9 41 THR C  148 ? THR C 148  . ? 1_555 ? 
296 DC9 41 GLY C  149 ? GLY C 149  . ? 1_555 ? 
297 DC9 41 SER C  150 ? SER C 150  . ? 1_555 ? 
298 DC9 41 SER C  168 ? SER C 168  . ? 1_555 ? 
299 DC9 41 ILE C  189 ? ILE C 189  . ? 1_555 ? 
300 DC9 41 ARG C  280 ? ARG C 280  . ? 1_555 ? 
301 DC9 41 PHE C  283 ? PHE C 283  . ? 1_555 ? 
302 DC9 41 GLY C  319 ? GLY C 319  . ? 1_555 ? 
303 DC9 41 ASP C  320 ? ASP C 320  . ? 1_555 ? 
304 DC9 41 MET C  326 ? MET C 326  . ? 1_555 ? 
305 DC9 41 LEU C  327 ? LEU C 327  . ? 1_555 ? 
306 DC9 41 ALA C  328 ? ALA C 328  . ? 1_555 ? 
307 DC9 41 HIS C  329 ? HIS C 329  . ? 1_555 ? 
308 DC9 41 TYR C  359 ? TYR C 359  . ? 1_555 ? 
309 DC9 41 NAI Y  .   ? NAI C 481  . ? 1_555 ? 
310 DC9 41 HOH FB .   ? HOH C 2020 . ? 1_555 ? 
311 DC9 41 HOH FB .   ? HOH C 2026 . ? 1_555 ? 
312 DC9 41 HOH FB .   ? HOH C 2054 . ? 1_555 ? 
313 DC9 41 HIS D  452 ? HIS D 452  . ? 1_555 ? 
314 DC9 41 PRO D  453 ? PRO D 453  . ? 1_555 ? 
315 EC1 24 GLY C  185 ? GLY C 185  . ? 1_555 ? 
316 EC1 24 GLY C  187 ? GLY C 187  . ? 1_555 ? 
317 EC1 24 VAL C  188 ? VAL C 188  . ? 1_555 ? 
318 EC1 24 ILE C  189 ? ILE C 189  . ? 1_555 ? 
319 EC1 24 GLU C  192 ? GLU C 192  . ? 1_555 ? 
320 EC1 24 GLU C  208 ? GLU C 208  . ? 1_555 ? 
321 EC1 24 PHE C  209 ? PHE C 209  . ? 1_555 ? 
322 EC1 24 LEU C  210 ? LEU C 210  . ? 1_555 ? 
323 EC1 24 CYS C  277 ? CYS C 277  . ? 1_555 ? 
324 EC1 24 ILE C  278 ? ILE C 278  . ? 1_555 ? 
325 EC1 24 GLY C  279 ? GLY C 279  . ? 1_555 ? 
326 EC1 24 ARG C  280 ? ARG C 280  . ? 1_555 ? 
327 EC1 24 MET C  326 ? MET C 326  . ? 1_555 ? 
328 EC1 24 VAL C  357 ? VAL C 357  . ? 1_555 ? 
329 EC1 24 TYR C  359 ? TYR C 359  . ? 1_555 ? 
330 EC1 24 FAD X  .   ? FAD C 480  . ? 1_555 ? 
331 EC1 24 HOH FB .   ? HOH C 2050 . ? 1_555 ? 
332 EC1 24 HOH FB .   ? HOH C 2052 . ? 1_555 ? 
333 EC1 24 HOH FB .   ? HOH C 2058 . ? 1_555 ? 
334 EC1 24 HOH FB .   ? HOH C 2060 . ? 1_555 ? 
335 EC1 24 HOH FB .   ? HOH C 2077 . ? 1_555 ? 
336 EC1 24 HOH FB .   ? HOH C 2107 . ? 1_555 ? 
337 EC1 24 HOH FB .   ? HOH C 2109 . ? 1_555 ? 
338 EC1 24 HOH FB .   ? HOH C 2196 . ? 1_555 ? 
339 EC2 40 HIS C  452 ? HIS C 452  . ? 1_555 ? 
340 EC2 40 ILE D  12  ? ILE D 12   . ? 1_555 ? 
341 EC2 40 GLY D  13  ? GLY D 13   . ? 1_555 ? 
342 EC2 40 SER D  14  ? SER D 14   . ? 1_555 ? 
343 EC2 40 GLY D  15  ? GLY D 15   . ? 1_555 ? 
344 EC2 40 PRO D  16  ? PRO D 16   . ? 1_555 ? 
345 EC2 40 GLY D  17  ? GLY D 17   . ? 1_555 ? 
346 EC2 40 GLU D  36  ? GLU D 36   . ? 1_555 ? 
347 EC2 40 LYS D  37  ? LYS D 37   . ? 1_555 ? 
348 EC2 40 ASN D  38  ? ASN D 38   . ? 1_555 ? 
349 EC2 40 GLY D  43  ? GLY D 43   . ? 1_555 ? 
350 EC2 40 THR D  44  ? THR D 44   . ? 1_555 ? 
351 EC2 40 CYS D  45  ? CYS D 45   . ? 1_555 ? 
352 EC2 40 VAL D  48  ? VAL D 48   . ? 1_555 ? 
353 EC2 40 GLY D  49  ? GLY D 49   . ? 1_555 ? 
354 EC2 40 CYS D  50  ? CYS D 50   . ? 1_555 ? 
355 EC2 40 SER D  53  ? SER D 53   . ? 1_555 ? 
356 EC2 40 LYS D  54  ? LYS D 54   . ? 1_555 ? 
357 EC2 40 GLY D  117 ? GLY D 117  . ? 1_555 ? 
358 EC2 40 TYR D  118 ? TYR D 118  . ? 1_555 ? 
359 EC2 40 GLY D  119 ? GLY D 119  . ? 1_555 ? 
360 EC2 40 ALA D  147 ? ALA D 147  . ? 1_555 ? 
361 EC2 40 THR D  148 ? THR D 148  . ? 1_555 ? 
362 EC2 40 GLY D  149 ? GLY D 149  . ? 1_555 ? 
363 EC2 40 SER D  150 ? SER D 150  . ? 1_555 ? 
364 EC2 40 SER D  168 ? SER D 168  . ? 1_555 ? 
365 EC2 40 ARG D  280 ? ARG D 280  . ? 1_555 ? 
366 EC2 40 PHE D  283 ? PHE D 283  . ? 1_555 ? 
367 EC2 40 GLY D  319 ? GLY D 319  . ? 1_555 ? 
368 EC2 40 ASP D  320 ? ASP D 320  . ? 1_555 ? 
369 EC2 40 MET D  326 ? MET D 326  . ? 1_555 ? 
370 EC2 40 LEU D  327 ? LEU D 327  . ? 1_555 ? 
371 EC2 40 ALA D  328 ? ALA D 328  . ? 1_555 ? 
372 EC2 40 HIS D  329 ? HIS D 329  . ? 1_555 ? 
373 EC2 40 TYR D  359 ? TYR D 359  . ? 1_555 ? 
374 EC2 40 NAI EA .   ? NAI D 481  . ? 1_555 ? 
375 EC2 40 HOH GB .   ? HOH D 2015 . ? 1_555 ? 
376 EC2 40 HOH GB .   ? HOH D 2018 . ? 1_555 ? 
377 EC2 40 HOH GB .   ? HOH D 2026 . ? 1_555 ? 
378 EC2 40 HOH GB .   ? HOH D 2080 . ? 1_555 ? 
379 EC3 22 PHE D  155 ? PHE D 155  . ? 1_555 ? 
380 EC3 22 GLY D  185 ? GLY D 185  . ? 1_555 ? 
381 EC3 22 GLY D  187 ? GLY D 187  . ? 1_555 ? 
382 EC3 22 VAL D  188 ? VAL D 188  . ? 1_555 ? 
383 EC3 22 ILE D  189 ? ILE D 189  . ? 1_555 ? 
384 EC3 22 GLU D  192 ? GLU D 192  . ? 1_555 ? 
385 EC3 22 VAL D  207 ? VAL D 207  . ? 1_555 ? 
386 EC3 22 GLU D  208 ? GLU D 208  . ? 1_555 ? 
387 EC3 22 PHE D  209 ? PHE D 209  . ? 1_555 ? 
388 EC3 22 LEU D  210 ? LEU D 210  . ? 1_555 ? 
389 EC3 22 CYS D  277 ? CYS D 277  . ? 1_555 ? 
390 EC3 22 ILE D  278 ? ILE D 278  . ? 1_555 ? 
391 EC3 22 GLY D  279 ? GLY D 279  . ? 1_555 ? 
392 EC3 22 MET D  326 ? MET D 326  . ? 1_555 ? 
393 EC3 22 VAL D  357 ? VAL D 357  . ? 1_555 ? 
394 EC3 22 TYR D  359 ? TYR D 359  . ? 1_555 ? 
395 EC3 22 FAD DA .   ? FAD D 480  . ? 1_555 ? 
396 EC3 22 HOH GB .   ? HOH D 2085 . ? 1_555 ? 
397 EC3 22 HOH GB .   ? HOH D 2086 . ? 1_555 ? 
398 EC3 22 HOH GB .   ? HOH D 2096 . ? 1_555 ? 
399 EC3 22 HOH GB .   ? HOH D 2199 . ? 1_555 ? 
400 EC3 22 HOH GB .   ? HOH D 2200 . ? 1_555 ? 
401 EC4 40 ILE E  12  ? ILE E 12   . ? 1_555 ? 
402 EC4 40 GLY E  13  ? GLY E 13   . ? 1_555 ? 
403 EC4 40 SER E  14  ? SER E 14   . ? 1_555 ? 
404 EC4 40 GLY E  15  ? GLY E 15   . ? 1_555 ? 
405 EC4 40 PRO E  16  ? PRO E 16   . ? 1_555 ? 
406 EC4 40 GLY E  17  ? GLY E 17   . ? 1_555 ? 
407 EC4 40 GLU E  36  ? GLU E 36   . ? 1_555 ? 
408 EC4 40 LYS E  37  ? LYS E 37   . ? 1_555 ? 
409 EC4 40 ASN E  38  ? ASN E 38   . ? 1_555 ? 
410 EC4 40 GLY E  43  ? GLY E 43   . ? 1_555 ? 
411 EC4 40 THR E  44  ? THR E 44   . ? 1_555 ? 
412 EC4 40 CYS E  45  ? CYS E 45   . ? 1_555 ? 
413 EC4 40 VAL E  48  ? VAL E 48   . ? 1_555 ? 
414 EC4 40 GLY E  49  ? GLY E 49   . ? 1_555 ? 
415 EC4 40 CYS E  50  ? CYS E 50   . ? 1_555 ? 
416 EC4 40 SER E  53  ? SER E 53   . ? 1_555 ? 
417 EC4 40 LYS E  54  ? LYS E 54   . ? 1_555 ? 
418 EC4 40 TYR E  118 ? TYR E 118  . ? 1_555 ? 
419 EC4 40 GLY E  119 ? GLY E 119  . ? 1_555 ? 
420 EC4 40 ALA E  147 ? ALA E 147  . ? 1_555 ? 
421 EC4 40 THR E  148 ? THR E 148  . ? 1_555 ? 
422 EC4 40 GLY E  149 ? GLY E 149  . ? 1_555 ? 
423 EC4 40 SER E  150 ? SER E 150  . ? 1_555 ? 
424 EC4 40 SER E  168 ? SER E 168  . ? 1_555 ? 
425 EC4 40 ILE E  189 ? ILE E 189  . ? 1_555 ? 
426 EC4 40 PHE E  283 ? PHE E 283  . ? 1_555 ? 
427 EC4 40 GLY E  319 ? GLY E 319  . ? 1_555 ? 
428 EC4 40 ASP E  320 ? ASP E 320  . ? 1_555 ? 
429 EC4 40 MET E  326 ? MET E 326  . ? 1_555 ? 
430 EC4 40 LEU E  327 ? LEU E 327  . ? 1_555 ? 
431 EC4 40 ALA E  328 ? ALA E 328  . ? 1_555 ? 
432 EC4 40 HIS E  329 ? HIS E 329  . ? 1_555 ? 
433 EC4 40 TYR E  359 ? TYR E 359  . ? 1_555 ? 
434 EC4 40 NAI KA .   ? NAI E 481  . ? 1_555 ? 
435 EC4 40 HOH HB .   ? HOH E 2021 . ? 1_555 ? 
436 EC4 40 HOH HB .   ? HOH E 2024 . ? 1_555 ? 
437 EC4 40 HOH HB .   ? HOH E 2243 . ? 1_555 ? 
438 EC4 40 HOH HB .   ? HOH E 2248 . ? 1_555 ? 
439 EC4 40 HIS F  452 ? HIS F 452  . ? 1_555 ? 
440 EC4 40 PRO F  453 ? PRO F 453  . ? 1_555 ? 
441 EC5 26 GLY E  185 ? GLY E 185  . ? 1_555 ? 
442 EC5 26 GLY E  187 ? GLY E 187  . ? 1_555 ? 
443 EC5 26 VAL E  188 ? VAL E 188  . ? 1_555 ? 
444 EC5 26 ILE E  189 ? ILE E 189  . ? 1_555 ? 
445 EC5 26 GLU E  192 ? GLU E 192  . ? 1_555 ? 
446 EC5 26 GLU E  208 ? GLU E 208  . ? 1_555 ? 
447 EC5 26 PHE E  209 ? PHE E 209  . ? 1_555 ? 
448 EC5 26 LEU E  210 ? LEU E 210  . ? 1_555 ? 
449 EC5 26 CYS E  277 ? CYS E 277  . ? 1_555 ? 
450 EC5 26 ILE E  278 ? ILE E 278  . ? 1_555 ? 
451 EC5 26 GLY E  279 ? GLY E 279  . ? 1_555 ? 
452 EC5 26 ARG E  280 ? ARG E 280  . ? 1_555 ? 
453 EC5 26 MET E  326 ? MET E 326  . ? 1_555 ? 
454 EC5 26 LEU E  327 ? LEU E 327  . ? 1_555 ? 
455 EC5 26 VAL E  357 ? VAL E 357  . ? 1_555 ? 
456 EC5 26 TYR E  359 ? TYR E 359  . ? 1_555 ? 
457 EC5 26 FAD JA .   ? FAD E 480  . ? 1_555 ? 
458 EC5 26 HOH HB .   ? HOH E 2043 . ? 1_555 ? 
459 EC5 26 HOH HB .   ? HOH E 2048 . ? 1_555 ? 
460 EC5 26 HOH HB .   ? HOH E 2071 . ? 1_555 ? 
461 EC5 26 HOH HB .   ? HOH E 2075 . ? 1_555 ? 
462 EC5 26 HOH HB .   ? HOH E 2091 . ? 1_555 ? 
463 EC5 26 HOH HB .   ? HOH E 2129 . ? 1_555 ? 
464 EC5 26 HOH HB .   ? HOH E 2140 . ? 1_555 ? 
465 EC5 26 HOH HB .   ? HOH E 2241 . ? 1_555 ? 
466 EC5 26 HOH HB .   ? HOH E 2242 . ? 1_555 ? 
467 EC6 42 HIS E  452 ? HIS E 452  . ? 1_555 ? 
468 EC6 42 PRO E  453 ? PRO E 453  . ? 1_555 ? 
469 EC6 42 ILE F  12  ? ILE F 12   . ? 1_555 ? 
470 EC6 42 GLY F  13  ? GLY F 13   . ? 1_555 ? 
471 EC6 42 SER F  14  ? SER F 14   . ? 1_555 ? 
472 EC6 42 GLY F  15  ? GLY F 15   . ? 1_555 ? 
473 EC6 42 PRO F  16  ? PRO F 16   . ? 1_555 ? 
474 EC6 42 GLY F  17  ? GLY F 17   . ? 1_555 ? 
475 EC6 42 GLU F  36  ? GLU F 36   . ? 1_555 ? 
476 EC6 42 LYS F  37  ? LYS F 37   . ? 1_555 ? 
477 EC6 42 ASN F  38  ? ASN F 38   . ? 1_555 ? 
478 EC6 42 GLY F  43  ? GLY F 43   . ? 1_555 ? 
479 EC6 42 THR F  44  ? THR F 44   . ? 1_555 ? 
480 EC6 42 CYS F  45  ? CYS F 45   . ? 1_555 ? 
481 EC6 42 VAL F  48  ? VAL F 48   . ? 1_555 ? 
482 EC6 42 GLY F  49  ? GLY F 49   . ? 1_555 ? 
483 EC6 42 CYS F  50  ? CYS F 50   . ? 1_555 ? 
484 EC6 42 SER F  53  ? SER F 53   . ? 1_555 ? 
485 EC6 42 LYS F  54  ? LYS F 54   . ? 1_555 ? 
486 EC6 42 GLY F  117 ? GLY F 117  . ? 1_555 ? 
487 EC6 42 TYR F  118 ? TYR F 118  . ? 1_555 ? 
488 EC6 42 GLY F  119 ? GLY F 119  . ? 1_555 ? 
489 EC6 42 ALA F  147 ? ALA F 147  . ? 1_555 ? 
490 EC6 42 THR F  148 ? THR F 148  . ? 1_555 ? 
491 EC6 42 GLY F  149 ? GLY F 149  . ? 1_555 ? 
492 EC6 42 SER F  150 ? SER F 150  . ? 1_555 ? 
493 EC6 42 SER F  168 ? SER F 168  . ? 1_555 ? 
494 EC6 42 ARG F  280 ? ARG F 280  . ? 1_555 ? 
495 EC6 42 PHE F  283 ? PHE F 283  . ? 1_555 ? 
496 EC6 42 GLY F  319 ? GLY F 319  . ? 1_555 ? 
497 EC6 42 ASP F  320 ? ASP F 320  . ? 1_555 ? 
498 EC6 42 MET F  326 ? MET F 326  . ? 1_555 ? 
499 EC6 42 LEU F  327 ? LEU F 327  . ? 1_555 ? 
500 EC6 42 ALA F  328 ? ALA F 328  . ? 1_555 ? 
501 EC6 42 HIS F  329 ? HIS F 329  . ? 1_555 ? 
502 EC6 42 ALA F  331 ? ALA F 331  . ? 1_555 ? 
503 EC6 42 TYR F  359 ? TYR F 359  . ? 1_555 ? 
504 EC6 42 NAI QA .   ? NAI F 481  . ? 1_555 ? 
505 EC6 42 HOH IB .   ? HOH F 2023 . ? 1_555 ? 
506 EC6 42 HOH IB .   ? HOH F 2024 . ? 1_555 ? 
507 EC6 42 HOH IB .   ? HOH F 2035 . ? 1_555 ? 
508 EC6 42 HOH IB .   ? HOH F 2218 . ? 1_555 ? 
509 EC7 27 PHE F  155 ? PHE F 155  . ? 1_555 ? 
510 EC7 27 ILE F  184 ? ILE F 184  . ? 1_555 ? 
511 EC7 27 GLY F  185 ? GLY F 185  . ? 1_555 ? 
512 EC7 27 GLY F  187 ? GLY F 187  . ? 1_555 ? 
513 EC7 27 VAL F  188 ? VAL F 188  . ? 1_555 ? 
514 EC7 27 ILE F  189 ? ILE F 189  . ? 1_555 ? 
515 EC7 27 GLU F  192 ? GLU F 192  . ? 1_555 ? 
516 EC7 27 GLU F  208 ? GLU F 208  . ? 1_555 ? 
517 EC7 27 PHE F  209 ? PHE F 209  . ? 1_555 ? 
518 EC7 27 CYS F  277 ? CYS F 277  . ? 1_555 ? 
519 EC7 27 ILE F  278 ? ILE F 278  . ? 1_555 ? 
520 EC7 27 GLY F  279 ? GLY F 279  . ? 1_555 ? 
521 EC7 27 ARG F  280 ? ARG F 280  . ? 1_555 ? 
522 EC7 27 MET F  326 ? MET F 326  . ? 1_555 ? 
523 EC7 27 LEU F  327 ? LEU F 327  . ? 1_555 ? 
524 EC7 27 VAL F  357 ? VAL F 357  . ? 1_555 ? 
525 EC7 27 TYR F  359 ? TYR F 359  . ? 1_555 ? 
526 EC7 27 FAD PA .   ? FAD F 480  . ? 1_555 ? 
527 EC7 27 HOH IB .   ? HOH F 2095 . ? 1_555 ? 
528 EC7 27 HOH IB .   ? HOH F 2098 . ? 1_555 ? 
529 EC7 27 HOH IB .   ? HOH F 2147 . ? 1_555 ? 
530 EC7 27 HOH IB .   ? HOH F 2170 . ? 1_555 ? 
531 EC7 27 HOH IB .   ? HOH F 2172 . ? 1_555 ? 
532 EC7 27 HOH IB .   ? HOH F 2194 . ? 1_555 ? 
533 EC7 27 HOH IB .   ? HOH F 2196 . ? 1_555 ? 
534 EC7 27 HOH IB .   ? HOH F 2307 . ? 1_555 ? 
535 EC7 27 SER G  262 ? SER G 262  . ? 1_555 ? 
536 EC8 40 ILE G  12  ? ILE G 12   . ? 1_555 ? 
537 EC8 40 GLY G  13  ? GLY G 13   . ? 1_555 ? 
538 EC8 40 SER G  14  ? SER G 14   . ? 1_555 ? 
539 EC8 40 GLY G  15  ? GLY G 15   . ? 1_555 ? 
540 EC8 40 PRO G  16  ? PRO G 16   . ? 1_555 ? 
541 EC8 40 GLY G  17  ? GLY G 17   . ? 1_555 ? 
542 EC8 40 GLU G  36  ? GLU G 36   . ? 1_555 ? 
543 EC8 40 LYS G  37  ? LYS G 37   . ? 1_555 ? 
544 EC8 40 ASN G  38  ? ASN G 38   . ? 1_555 ? 
545 EC8 40 GLY G  43  ? GLY G 43   . ? 1_555 ? 
546 EC8 40 THR G  44  ? THR G 44   . ? 1_555 ? 
547 EC8 40 CYS G  45  ? CYS G 45   . ? 1_555 ? 
548 EC8 40 VAL G  48  ? VAL G 48   . ? 1_555 ? 
549 EC8 40 GLY G  49  ? GLY G 49   . ? 1_555 ? 
550 EC8 40 CYS G  50  ? CYS G 50   . ? 1_555 ? 
551 EC8 40 SER G  53  ? SER G 53   . ? 1_555 ? 
552 EC8 40 LYS G  54  ? LYS G 54   . ? 1_555 ? 
553 EC8 40 GLY G  117 ? GLY G 117  . ? 1_555 ? 
554 EC8 40 TYR G  118 ? TYR G 118  . ? 1_555 ? 
555 EC8 40 GLY G  119 ? GLY G 119  . ? 1_555 ? 
556 EC8 40 ALA G  147 ? ALA G 147  . ? 1_555 ? 
557 EC8 40 THR G  148 ? THR G 148  . ? 1_555 ? 
558 EC8 40 GLY G  149 ? GLY G 149  . ? 1_555 ? 
559 EC8 40 SER G  150 ? SER G 150  . ? 1_555 ? 
560 EC8 40 SER G  168 ? SER G 168  . ? 1_555 ? 
561 EC8 40 ARG G  280 ? ARG G 280  . ? 1_555 ? 
562 EC8 40 PHE G  283 ? PHE G 283  . ? 1_555 ? 
563 EC8 40 GLY G  319 ? GLY G 319  . ? 1_555 ? 
564 EC8 40 ASP G  320 ? ASP G 320  . ? 1_555 ? 
565 EC8 40 MET G  326 ? MET G 326  . ? 1_555 ? 
566 EC8 40 LEU G  327 ? LEU G 327  . ? 1_555 ? 
567 EC8 40 ALA G  328 ? ALA G 328  . ? 1_555 ? 
568 EC8 40 HIS G  329 ? HIS G 329  . ? 1_555 ? 
569 EC8 40 TYR G  359 ? TYR G 359  . ? 1_555 ? 
570 EC8 40 NAI WA .   ? NAI G 481  . ? 1_555 ? 
571 EC8 40 HOH JB .   ? HOH G 2027 . ? 1_555 ? 
572 EC8 40 HOH JB .   ? HOH G 2028 . ? 1_555 ? 
573 EC8 40 HOH JB .   ? HOH G 2055 . ? 1_555 ? 
574 EC8 40 HOH JB .   ? HOH G 2166 . ? 1_555 ? 
575 EC8 40 HIS H  452 ? HIS H 452  . ? 1_555 ? 
576 EC9 28 PHE G  155 ? PHE G 155  . ? 1_555 ? 
577 EC9 28 GLY G  185 ? GLY G 185  . ? 1_555 ? 
578 EC9 28 GLY G  187 ? GLY G 187  . ? 1_555 ? 
579 EC9 28 VAL G  188 ? VAL G 188  . ? 1_555 ? 
580 EC9 28 ILE G  189 ? ILE G 189  . ? 1_555 ? 
581 EC9 28 GLU G  192 ? GLU G 192  . ? 1_555 ? 
582 EC9 28 VAL G  207 ? VAL G 207  . ? 1_555 ? 
583 EC9 28 GLU G  208 ? GLU G 208  . ? 1_555 ? 
584 EC9 28 PHE G  209 ? PHE G 209  . ? 1_555 ? 
585 EC9 28 LEU G  210 ? LEU G 210  . ? 1_555 ? 
586 EC9 28 THR G  241 ? THR G 241  . ? 1_555 ? 
587 EC9 28 VAL G  243 ? VAL G 243  . ? 1_555 ? 
588 EC9 28 CYS G  277 ? CYS G 277  . ? 1_555 ? 
589 EC9 28 ILE G  278 ? ILE G 278  . ? 1_555 ? 
590 EC9 28 GLY G  279 ? GLY G 279  . ? 1_555 ? 
591 EC9 28 ARG G  280 ? ARG G 280  . ? 1_555 ? 
592 EC9 28 MET G  326 ? MET G 326  . ? 1_555 ? 
593 EC9 28 LEU G  327 ? LEU G 327  . ? 1_555 ? 
594 EC9 28 VAL G  357 ? VAL G 357  . ? 1_555 ? 
595 EC9 28 TYR G  359 ? TYR G 359  . ? 1_555 ? 
596 EC9 28 FAD VA .   ? FAD G 480  . ? 1_555 ? 
597 EC9 28 HOH JB .   ? HOH G 2089 . ? 1_555 ? 
598 EC9 28 HOH JB .   ? HOH G 2093 . ? 1_555 ? 
599 EC9 28 HOH JB .   ? HOH G 2162 . ? 1_555 ? 
600 EC9 28 HOH JB .   ? HOH G 2203 . ? 1_555 ? 
601 EC9 28 HOH JB .   ? HOH G 2336 . ? 1_555 ? 
602 EC9 28 HOH JB .   ? HOH G 2338 . ? 1_555 ? 
603 EC9 28 HOH JB .   ? HOH G 2341 . ? 1_555 ? 
604 FC1 40 HIS G  452 ? HIS G 452  . ? 1_555 ? 
605 FC1 40 PRO G  453 ? PRO G 453  . ? 1_555 ? 
606 FC1 40 ILE H  12  ? ILE H 12   . ? 1_555 ? 
607 FC1 40 GLY H  13  ? GLY H 13   . ? 1_555 ? 
608 FC1 40 SER H  14  ? SER H 14   . ? 1_555 ? 
609 FC1 40 GLY H  15  ? GLY H 15   . ? 1_555 ? 
610 FC1 40 PRO H  16  ? PRO H 16   . ? 1_555 ? 
611 FC1 40 GLY H  17  ? GLY H 17   . ? 1_555 ? 
612 FC1 40 GLU H  36  ? GLU H 36   . ? 1_555 ? 
613 FC1 40 LYS H  37  ? LYS H 37   . ? 1_555 ? 
614 FC1 40 ASN H  38  ? ASN H 38   . ? 1_555 ? 
615 FC1 40 GLY H  43  ? GLY H 43   . ? 1_555 ? 
616 FC1 40 THR H  44  ? THR H 44   . ? 1_555 ? 
617 FC1 40 CYS H  45  ? CYS H 45   . ? 1_555 ? 
618 FC1 40 VAL H  48  ? VAL H 48   . ? 1_555 ? 
619 FC1 40 GLY H  49  ? GLY H 49   . ? 1_555 ? 
620 FC1 40 CYS H  50  ? CYS H 50   . ? 1_555 ? 
621 FC1 40 SER H  53  ? SER H 53   . ? 1_555 ? 
622 FC1 40 LYS H  54  ? LYS H 54   . ? 1_555 ? 
623 FC1 40 GLY H  117 ? GLY H 117  . ? 1_555 ? 
624 FC1 40 TYR H  118 ? TYR H 118  . ? 1_555 ? 
625 FC1 40 GLY H  119 ? GLY H 119  . ? 1_555 ? 
626 FC1 40 ALA H  147 ? ALA H 147  . ? 1_555 ? 
627 FC1 40 THR H  148 ? THR H 148  . ? 1_555 ? 
628 FC1 40 GLY H  149 ? GLY H 149  . ? 1_555 ? 
629 FC1 40 SER H  150 ? SER H 150  . ? 1_555 ? 
630 FC1 40 SER H  168 ? SER H 168  . ? 1_555 ? 
631 FC1 40 PHE H  283 ? PHE H 283  . ? 1_555 ? 
632 FC1 40 GLY H  319 ? GLY H 319  . ? 1_555 ? 
633 FC1 40 ASP H  320 ? ASP H 320  . ? 1_555 ? 
634 FC1 40 MET H  326 ? MET H 326  . ? 1_555 ? 
635 FC1 40 LEU H  327 ? LEU H 327  . ? 1_555 ? 
636 FC1 40 ALA H  328 ? ALA H 328  . ? 1_555 ? 
637 FC1 40 HIS H  329 ? HIS H 329  . ? 1_555 ? 
638 FC1 40 TYR H  359 ? TYR H 359  . ? 1_555 ? 
639 FC1 40 NAI CB .   ? NAI H 481  . ? 1_555 ? 
640 FC1 40 HOH KB .   ? HOH H 2031 . ? 1_555 ? 
641 FC1 40 HOH KB .   ? HOH H 2036 . ? 1_555 ? 
642 FC1 40 HOH KB .   ? HOH H 2095 . ? 1_555 ? 
643 FC1 40 HOH KB .   ? HOH H 2207 . ? 1_555 ? 
644 FC2 23 GLY H  185 ? GLY H 185  . ? 1_555 ? 
645 FC2 23 GLY H  187 ? GLY H 187  . ? 1_555 ? 
646 FC2 23 VAL H  188 ? VAL H 188  . ? 1_555 ? 
647 FC2 23 ILE H  189 ? ILE H 189  . ? 1_555 ? 
648 FC2 23 GLU H  192 ? GLU H 192  . ? 1_555 ? 
649 FC2 23 GLU H  208 ? GLU H 208  . ? 1_555 ? 
650 FC2 23 PHE H  209 ? PHE H 209  . ? 1_555 ? 
651 FC2 23 LEU H  210 ? LEU H 210  . ? 1_555 ? 
652 FC2 23 CYS H  277 ? CYS H 277  . ? 1_555 ? 
653 FC2 23 ILE H  278 ? ILE H 278  . ? 1_555 ? 
654 FC2 23 GLY H  279 ? GLY H 279  . ? 1_555 ? 
655 FC2 23 MET H  326 ? MET H 326  . ? 1_555 ? 
656 FC2 23 LEU H  327 ? LEU H 327  . ? 1_555 ? 
657 FC2 23 VAL H  357 ? VAL H 357  . ? 1_555 ? 
658 FC2 23 TYR H  359 ? TYR H 359  . ? 1_555 ? 
659 FC2 23 FAD BB .   ? FAD H 480  . ? 1_555 ? 
660 FC2 23 HOH KB .   ? HOH H 2051 . ? 1_555 ? 
661 FC2 23 HOH KB .   ? HOH H 2067 . ? 1_555 ? 
662 FC2 23 HOH KB .   ? HOH H 2086 . ? 1_555 ? 
663 FC2 23 HOH KB .   ? HOH H 2096 . ? 1_555 ? 
664 FC2 23 HOH KB .   ? HOH H 2110 . ? 1_555 ? 
665 FC2 23 HOH KB .   ? HOH H 2127 . ? 1_555 ? 
666 FC2 23 HOH KB .   ? HOH H 2166 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZMD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZMD 
_atom_sites.fract_transf_matrix[1][1]   0.005686 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004741 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007868 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . GLN A  1 3   ? 50.558  111.818 -80.794  1.00 60.75  ? 3    GLN A N     1 
ATOM   2     C CA    . GLN A  1 3   ? 51.784  111.726 -81.648  1.00 59.36  ? 3    GLN A CA    1 
ATOM   3     C C     . GLN A  1 3   ? 52.925  112.721 -81.320  1.00 56.99  ? 3    GLN A C     1 
ATOM   4     O O     . GLN A  1 3   ? 53.516  113.309 -82.223  1.00 56.82  ? 3    GLN A O     1 
ATOM   5     C CB    . GLN A  1 3   ? 51.388  111.879 -83.124  1.00 60.94  ? 3    GLN A CB    1 
ATOM   6     C CG    . GLN A  1 3   ? 50.575  113.139 -83.423  1.00 62.77  ? 3    GLN A CG    1 
ATOM   7     C CD    . GLN A  1 3   ? 50.409  113.381 -84.908  1.00 64.30  ? 3    GLN A CD    1 
ATOM   8     O OE1   . GLN A  1 3   ? 51.360  113.767 -85.597  1.00 64.78  ? 3    GLN A OE1   1 
ATOM   9     N NE2   . GLN A  1 3   ? 49.201  113.142 -85.418  1.00 64.63  ? 3    GLN A NE2   1 
ATOM   10    N N     . PRO A  1 4   ? 53.239  112.932 -80.028  1.00 55.03  ? 4    PRO A N     1 
ATOM   11    C CA    . PRO A  1 4   ? 54.329  113.866 -79.712  1.00 53.21  ? 4    PRO A CA    1 
ATOM   12    C C     . PRO A  1 4   ? 55.682  113.200 -79.963  1.00 51.16  ? 4    PRO A C     1 
ATOM   13    O O     . PRO A  1 4   ? 55.819  111.987 -79.789  1.00 50.88  ? 4    PRO A O     1 
ATOM   14    C CB    . PRO A  1 4   ? 54.128  114.150 -78.223  1.00 53.22  ? 4    PRO A CB    1 
ATOM   15    C CG    . PRO A  1 4   ? 52.674  113.915 -78.023  1.00 54.35  ? 4    PRO A CG    1 
ATOM   16    C CD    . PRO A  1 4   ? 52.437  112.663 -78.825  1.00 54.85  ? 4    PRO A CD    1 
ATOM   17    N N     . ILE A  1 5   ? 56.674  113.979 -80.372  1.00 48.34  ? 5    ILE A N     1 
ATOM   18    C CA    . ILE A  1 5   ? 58.001  113.423 -80.609  1.00 46.48  ? 5    ILE A CA    1 
ATOM   19    C C     . ILE A  1 5   ? 58.986  113.996 -79.594  1.00 44.30  ? 5    ILE A C     1 
ATOM   20    O O     . ILE A  1 5   ? 58.794  115.101 -79.093  1.00 42.62  ? 5    ILE A O     1 
ATOM   21    C CB    . ILE A  1 5   ? 58.475  113.706 -82.051  1.00 47.68  ? 5    ILE A CB    1 
ATOM   22    C CG1   . ILE A  1 5   ? 57.565  112.948 -83.027  1.00 49.30  ? 5    ILE A CG1   1 
ATOM   23    C CG2   . ILE A  1 5   ? 59.909  113.246 -82.237  1.00 48.69  ? 5    ILE A CG2   1 
ATOM   24    C CD1   . ILE A  1 5   ? 57.792  113.289 -84.498  1.00 52.78  ? 5    ILE A CD1   1 
ATOM   25    N N     . ASP A  1 6   ? 60.015  113.240 -79.235  1.00 42.80  ? 6    ASP A N     1 
ATOM   26    C CA    . ASP A  1 6   ? 60.957  113.772 -78.265  1.00 42.08  ? 6    ASP A CA    1 
ATOM   27    C C     . ASP A  1 6   ? 62.375  113.869 -78.805  1.00 39.24  ? 6    ASP A C     1 
ATOM   28    O O     . ASP A  1 6   ? 62.791  113.109 -79.686  1.00 38.30  ? 6    ASP A O     1 
ATOM   29    C CB    . ASP A  1 6   ? 60.931  112.953 -76.981  1.00 45.37  ? 6    ASP A CB    1 
ATOM   30    C CG    . ASP A  1 6   ? 61.653  111.657 -77.118  1.00 50.18  ? 6    ASP A CG    1 
ATOM   31    O OD1   . ASP A  1 6   ? 62.908  111.675 -77.135  1.00 53.01  ? 6    ASP A OD1   1 
ATOM   32    O OD2   . ASP A  1 6   ? 60.967  110.620 -77.225  1.00 53.29  ? 6    ASP A OD2   1 
ATOM   33    N N     . ALA A  1 7   ? 63.116  114.833 -78.278  1.00 36.41  ? 7    ALA A N     1 
ATOM   34    C CA    . ALA A  1 7   ? 64.477  115.042 -78.727  1.00 33.58  ? 7    ALA A CA    1 
ATOM   35    C C     . ALA A  1 7   ? 65.367  115.671 -77.679  1.00 30.57  ? 7    ALA A C     1 
ATOM   36    O O     . ALA A  1 7   ? 64.895  116.174 -76.662  1.00 29.11  ? 7    ALA A O     1 
ATOM   37    C CB    . ALA A  1 7   ? 64.451  115.925 -79.964  1.00 33.24  ? 7    ALA A CB    1 
ATOM   38    N N     . ASP A  1 8   ? 66.663  115.643 -77.957  1.00 28.68  ? 8    ASP A N     1 
ATOM   39    C CA    . ASP A  1 8   ? 67.668  116.280 -77.106  1.00 25.56  ? 8    ASP A CA    1 
ATOM   40    C C     . ASP A  1 8   ? 67.819  117.734 -77.562  1.00 24.65  ? 8    ASP A C     1 
ATOM   41    O O     . ASP A  1 8   ? 67.953  118.645 -76.744  1.00 24.96  ? 8    ASP A O     1 
ATOM   42    C CB    . ASP A  1 8   ? 69.025  115.580 -77.258  1.00 23.53  ? 8    ASP A CB    1 
ATOM   43    C CG    . ASP A  1 8   ? 68.985  114.168 -76.761  1.00 26.33  ? 8    ASP A CG    1 
ATOM   44    O OD1   . ASP A  1 8   ? 68.331  113.959 -75.716  1.00 28.26  ? 8    ASP A OD1   1 
ATOM   45    O OD2   . ASP A  1 8   ? 69.586  113.284 -77.396  1.00 24.93  ? 8    ASP A OD2   1 
ATOM   46    N N     . VAL A  1 9   ? 67.793  117.928 -78.881  1.00 23.98  ? 9    VAL A N     1 
ATOM   47    C CA    . VAL A  1 9   ? 67.980  119.241 -79.498  1.00 23.20  ? 9    VAL A CA    1 
ATOM   48    C C     . VAL A  1 9   ? 66.989  119.481 -80.630  1.00 22.63  ? 9    VAL A C     1 
ATOM   49    O O     . VAL A  1 9   ? 66.919  118.690 -81.566  1.00 21.00  ? 9    VAL A O     1 
ATOM   50    C CB    . VAL A  1 9   ? 69.403  119.367 -80.128  1.00 25.11  ? 9    VAL A CB    1 
ATOM   51    C CG1   . VAL A  1 9   ? 69.572  120.782 -80.789  1.00 21.99  ? 9    VAL A CG1   1 
ATOM   52    C CG2   . VAL A  1 9   ? 70.482  119.117 -79.067  1.00 21.00  ? 9    VAL A CG2   1 
ATOM   53    N N     . THR A  1 10  ? 66.257  120.586 -80.543  1.00 20.55  ? 10   THR A N     1 
ATOM   54    C CA    . THR A  1 10  ? 65.307  120.929 -81.582  1.00 21.98  ? 10   THR A CA    1 
ATOM   55    C C     . THR A  1 10  ? 65.741  122.274 -82.121  1.00 22.36  ? 10   THR A C     1 
ATOM   56    O O     . THR A  1 10  ? 65.789  123.285 -81.395  1.00 21.34  ? 10   THR A O     1 
ATOM   57    C CB    . THR A  1 10  ? 63.833  121.011 -81.062  1.00 22.39  ? 10   THR A CB    1 
ATOM   58    O OG1   . THR A  1 10  ? 63.404  119.703 -80.630  1.00 23.23  ? 10   THR A OG1   1 
ATOM   59    C CG2   . THR A  1 10  ? 62.910  121.504 -82.194  1.00 20.33  ? 10   THR A CG2   1 
ATOM   60    N N     . VAL A  1 11  ? 66.083  122.244 -83.393  1.00 21.28  ? 11   VAL A N     1 
ATOM   61    C CA    . VAL A  1 11  ? 66.551  123.398 -84.122  1.00 22.88  ? 11   VAL A CA    1 
ATOM   62    C C     . VAL A  1 11  ? 65.388  124.040 -84.904  1.00 23.68  ? 11   VAL A C     1 
ATOM   63    O O     . VAL A  1 11  ? 64.719  123.389 -85.705  1.00 23.56  ? 11   VAL A O     1 
ATOM   64    C CB    . VAL A  1 11  ? 67.678  122.951 -85.061  1.00 22.69  ? 11   VAL A CB    1 
ATOM   65    C CG1   . VAL A  1 11  ? 68.253  124.137 -85.801  1.00 22.35  ? 11   VAL A CG1   1 
ATOM   66    C CG2   . VAL A  1 11  ? 68.766  122.249 -84.230  1.00 21.72  ? 11   VAL A CG2   1 
ATOM   67    N N     . ILE A  1 12  ? 65.126  125.309 -84.637  1.00 24.84  ? 12   ILE A N     1 
ATOM   68    C CA    . ILE A  1 12  ? 64.045  125.999 -85.319  1.00 23.29  ? 12   ILE A CA    1 
ATOM   69    C C     . ILE A  1 12  ? 64.689  126.806 -86.412  1.00 22.56  ? 12   ILE A C     1 
ATOM   70    O O     . ILE A  1 12  ? 65.363  127.795 -86.138  1.00 21.69  ? 12   ILE A O     1 
ATOM   71    C CB    . ILE A  1 12  ? 63.260  126.933 -84.348  1.00 25.57  ? 12   ILE A CB    1 
ATOM   72    C CG1   . ILE A  1 12  ? 62.713  126.109 -83.167  1.00 23.60  ? 12   ILE A CG1   1 
ATOM   73    C CG2   . ILE A  1 12  ? 62.086  127.608 -85.110  1.00 24.56  ? 12   ILE A CG2   1 
ATOM   74    C CD1   . ILE A  1 12  ? 62.064  126.964 -82.012  1.00 23.30  ? 12   ILE A CD1   1 
ATOM   75    N N     . GLY A  1 13  ? 64.487  126.363 -87.654  1.00 21.85  ? 13   GLY A N     1 
ATOM   76    C CA    . GLY A  1 13  ? 65.078  127.020 -88.807  1.00 22.05  ? 13   GLY A CA    1 
ATOM   77    C C     . GLY A  1 13  ? 66.140  126.149 -89.490  1.00 22.32  ? 13   GLY A C     1 
ATOM   78    O O     . GLY A  1 13  ? 67.007  125.576 -88.823  1.00 22.55  ? 13   GLY A O     1 
ATOM   79    N N     . SER A  1 14  ? 66.102  126.095 -90.818  1.00 21.85  ? 14   SER A N     1 
ATOM   80    C CA    . SER A  1 14  ? 67.026  125.272 -91.576  1.00 24.02  ? 14   SER A CA    1 
ATOM   81    C C     . SER A  1 14  ? 67.951  126.036 -92.494  1.00 22.39  ? 14   SER A C     1 
ATOM   82    O O     . SER A  1 14  ? 68.385  125.504 -93.514  1.00 24.80  ? 14   SER A O     1 
ATOM   83    C CB    . SER A  1 14  ? 66.258  124.227 -92.416  1.00 24.20  ? 14   SER A CB    1 
ATOM   84    O OG    . SER A  1 14  ? 65.591  124.851 -93.493  1.00 24.29  ? 14   SER A OG    1 
ATOM   85    N N     . GLY A  1 15  ? 68.228  127.294 -92.172  1.00 23.93  ? 15   GLY A N     1 
ATOM   86    C CA    . GLY A  1 15  ? 69.177  128.034 -92.973  1.00 24.25  ? 15   GLY A CA    1 
ATOM   87    C C     . GLY A  1 15  ? 70.584  127.570 -92.586  1.00 25.74  ? 15   GLY A C     1 
ATOM   88    O O     . GLY A  1 15  ? 70.742  126.601 -91.809  1.00 26.41  ? 15   GLY A O     1 
ATOM   89    N N     . PRO A  1 16  ? 71.635  128.239 -93.097  1.00 26.73  ? 16   PRO A N     1 
ATOM   90    C CA    . PRO A  1 16  ? 73.034  127.902 -92.798  1.00 24.90  ? 16   PRO A CA    1 
ATOM   91    C C     . PRO A  1 16  ? 73.291  127.582 -91.311  1.00 25.43  ? 16   PRO A C     1 
ATOM   92    O O     . PRO A  1 16  ? 73.912  126.569 -90.974  1.00 23.84  ? 16   PRO A O     1 
ATOM   93    C CB    . PRO A  1 16  ? 73.787  129.148 -93.248  1.00 25.38  ? 16   PRO A CB    1 
ATOM   94    C CG    . PRO A  1 16  ? 72.994  129.615 -94.407  1.00 23.61  ? 16   PRO A CG    1 
ATOM   95    C CD    . PRO A  1 16  ? 71.557  129.445 -93.955  1.00 26.53  ? 16   PRO A CD    1 
ATOM   96    N N     . GLY A  1 17  ? 72.813  128.454 -90.430  1.00 24.67  ? 17   GLY A N     1 
ATOM   97    C CA    . GLY A  1 17  ? 73.006  128.239 -89.013  1.00 23.05  ? 17   GLY A CA    1 
ATOM   98    C C     . GLY A  1 17  ? 72.319  126.964 -88.536  1.00 24.68  ? 17   GLY A C     1 
ATOM   99    O O     . GLY A  1 17  ? 72.958  126.035 -87.992  1.00 23.10  ? 17   GLY A O     1 
ATOM   100   N N     . GLY A  1 18  ? 71.007  126.914 -88.765  1.00 23.31  ? 18   GLY A N     1 
ATOM   101   C CA    . GLY A  1 18  ? 70.212  125.781 -88.340  1.00 21.25  ? 18   GLY A CA    1 
ATOM   102   C C     . GLY A  1 18  ? 70.510  124.410 -88.917  1.00 23.08  ? 18   GLY A C     1 
ATOM   103   O O     . GLY A  1 18  ? 70.645  123.426 -88.166  1.00 23.59  ? 18   GLY A O     1 
ATOM   104   N N     . TYR A  1 19  ? 70.632  124.307 -90.234  1.00 21.21  ? 19   TYR A N     1 
ATOM   105   C CA    . TYR A  1 19  ? 70.856  122.976 -90.797  1.00 21.62  ? 19   TYR A CA    1 
ATOM   106   C C     . TYR A  1 19  ? 72.234  122.391 -90.437  1.00 20.70  ? 19   TYR A C     1 
ATOM   107   O O     . TYR A  1 19  ? 72.360  121.187 -90.241  1.00 19.64  ? 19   TYR A O     1 
ATOM   108   C CB    . TYR A  1 19  ? 70.615  122.988 -92.315  1.00 20.39  ? 19   TYR A CB    1 
ATOM   109   C CG    . TYR A  1 19  ? 71.849  123.070 -93.178  1.00 21.62  ? 19   TYR A CG    1 
ATOM   110   C CD1   . TYR A  1 19  ? 72.598  121.921 -93.439  1.00 21.10  ? 19   TYR A CD1   1 
ATOM   111   C CD2   . TYR A  1 19  ? 72.221  124.265 -93.799  1.00 20.79  ? 19   TYR A CD2   1 
ATOM   112   C CE1   . TYR A  1 19  ? 73.649  121.951 -94.268  1.00 21.29  ? 19   TYR A CE1   1 
ATOM   113   C CE2   . TYR A  1 19  ? 73.316  124.304 -94.673  1.00 23.23  ? 19   TYR A CE2   1 
ATOM   114   C CZ    . TYR A  1 19  ? 74.013  123.140 -94.898  1.00 22.37  ? 19   TYR A CZ    1 
ATOM   115   O OH    . TYR A  1 19  ? 75.044  123.110 -95.805  1.00 26.48  ? 19   TYR A OH    1 
ATOM   116   N N     . VAL A  1 20  ? 73.250  123.240 -90.334  1.00 21.42  ? 20   VAL A N     1 
ATOM   117   C CA    . VAL A  1 20  ? 74.585  122.789 -89.955  1.00 19.24  ? 20   VAL A CA    1 
ATOM   118   C C     . VAL A  1 20  ? 74.576  122.381 -88.477  1.00 20.30  ? 20   VAL A C     1 
ATOM   119   O O     . VAL A  1 20  ? 75.148  121.368 -88.113  1.00 20.01  ? 20   VAL A O     1 
ATOM   120   C CB    . VAL A  1 20  ? 75.654  123.913 -90.187  1.00 18.90  ? 20   VAL A CB    1 
ATOM   121   C CG1   . VAL A  1 20  ? 76.992  123.517 -89.551  1.00 18.09  ? 20   VAL A CG1   1 
ATOM   122   C CG2   . VAL A  1 20  ? 75.876  124.108 -91.683  1.00 17.26  ? 20   VAL A CG2   1 
ATOM   123   N N     . ALA A  1 21  ? 73.926  123.182 -87.630  1.00 19.67  ? 21   ALA A N     1 
ATOM   124   C CA    . ALA A  1 21  ? 73.828  122.874 -86.205  1.00 20.62  ? 21   ALA A CA    1 
ATOM   125   C C     . ALA A  1 21  ? 73.118  121.535 -85.990  1.00 20.39  ? 21   ALA A C     1 
ATOM   126   O O     . ALA A  1 21  ? 73.562  120.722 -85.166  1.00 21.36  ? 21   ALA A O     1 
ATOM   127   C CB    . ALA A  1 21  ? 73.068  123.972 -85.468  1.00 18.99  ? 21   ALA A CB    1 
ATOM   128   N N     . ALA A  1 22  ? 72.016  121.321 -86.728  1.00 19.97  ? 22   ALA A N     1 
ATOM   129   C CA    . ALA A  1 22  ? 71.235  120.069 -86.650  1.00 18.95  ? 22   ALA A CA    1 
ATOM   130   C C     . ALA A  1 22  ? 72.112  118.874 -87.020  1.00 17.31  ? 22   ALA A C     1 
ATOM   131   O O     . ALA A  1 22  ? 72.102  117.870 -86.340  1.00 17.86  ? 22   ALA A O     1 
ATOM   132   C CB    . ALA A  1 22  ? 70.031  120.128 -87.605  1.00 19.62  ? 22   ALA A CB    1 
ATOM   133   N N     . ILE A  1 23  ? 72.840  118.978 -88.129  1.00 18.01  ? 23   ILE A N     1 
ATOM   134   C CA    . ILE A  1 23  ? 73.731  117.904 -88.565  1.00 19.21  ? 23   ILE A CA    1 
ATOM   135   C C     . ILE A  1 23  ? 74.824  117.654 -87.503  1.00 19.55  ? 23   ILE A C     1 
ATOM   136   O O     . ILE A  1 23  ? 75.071  116.510 -87.095  1.00 19.12  ? 23   ILE A O     1 
ATOM   137   C CB    . ILE A  1 23  ? 74.425  118.250 -89.933  1.00 19.66  ? 23   ILE A CB    1 
ATOM   138   C CG1   . ILE A  1 23  ? 73.412  118.110 -91.081  1.00 20.76  ? 23   ILE A CG1   1 
ATOM   139   C CG2   . ILE A  1 23  ? 75.621  117.303 -90.176  1.00 15.43  ? 23   ILE A CG2   1 
ATOM   140   C CD1   . ILE A  1 23  ? 73.940  118.624 -92.392  1.00 15.90  ? 23   ILE A CD1   1 
ATOM   141   N N     . LYS A  1 24  ? 75.493  118.737 -87.091  1.00 19.31  ? 24   LYS A N     1 
ATOM   142   C CA    . LYS A  1 24  ? 76.537  118.621 -86.083  1.00 20.00  ? 24   LYS A CA    1 
ATOM   143   C C     . LYS A  1 24  ? 75.983  117.974 -84.811  1.00 19.92  ? 24   LYS A C     1 
ATOM   144   O O     . LYS A  1 24  ? 76.616  117.098 -84.224  1.00 21.36  ? 24   LYS A O     1 
ATOM   145   C CB    . LYS A  1 24  ? 77.148  119.987 -85.714  1.00 17.55  ? 24   LYS A CB    1 
ATOM   146   C CG    . LYS A  1 24  ? 78.380  119.812 -84.807  1.00 19.13  ? 24   LYS A CG    1 
ATOM   147   C CD    . LYS A  1 24  ? 79.540  119.181 -85.605  1.00 21.86  ? 24   LYS A CD    1 
ATOM   148   C CE    . LYS A  1 24  ? 80.731  118.692 -84.720  1.00 20.04  ? 24   LYS A CE    1 
ATOM   149   N NZ    . LYS A  1 24  ? 81.897  118.281 -85.580  1.00 20.41  ? 24   LYS A NZ    1 
ATOM   150   N N     . ALA A  1 25  ? 74.819  118.425 -84.360  1.00 19.03  ? 25   ALA A N     1 
ATOM   151   C CA    . ALA A  1 25  ? 74.250  117.874 -83.146  1.00 18.46  ? 25   ALA A CA    1 
ATOM   152   C C     . ALA A  1 25  ? 73.988  116.371 -83.308  1.00 19.63  ? 25   ALA A C     1 
ATOM   153   O O     . ALA A  1 25  ? 74.236  115.576 -82.388  1.00 19.61  ? 25   ALA A O     1 
ATOM   154   C CB    . ALA A  1 25  ? 72.930  118.629 -82.768  1.00 19.97  ? 25   ALA A CB    1 
ATOM   155   N N     . ALA A  1 26  ? 73.473  115.984 -84.464  1.00 19.66  ? 26   ALA A N     1 
ATOM   156   C CA    . ALA A  1 26  ? 73.207  114.570 -84.705  1.00 22.92  ? 26   ALA A CA    1 
ATOM   157   C C     . ALA A  1 26  ? 74.538  113.781 -84.684  1.00 24.37  ? 26   ALA A C     1 
ATOM   158   O O     . ALA A  1 26  ? 74.644  112.697 -84.081  1.00 23.52  ? 26   ALA A O     1 
ATOM   159   C CB    . ALA A  1 26  ? 72.510  114.409 -86.039  1.00 21.65  ? 26   ALA A CB    1 
ATOM   160   N N     . GLN A  1 27  ? 75.562  114.325 -85.339  1.00 24.33  ? 27   GLN A N     1 
ATOM   161   C CA    . GLN A  1 27  ? 76.847  113.635 -85.366  1.00 22.93  ? 27   GLN A CA    1 
ATOM   162   C C     . GLN A  1 27  ? 77.471  113.512 -83.959  1.00 23.90  ? 27   GLN A C     1 
ATOM   163   O O     . GLN A  1 27  ? 78.239  112.600 -83.705  1.00 22.93  ? 27   GLN A O     1 
ATOM   164   C CB    . GLN A  1 27  ? 77.800  114.344 -86.330  1.00 23.85  ? 27   GLN A CB    1 
ATOM   165   C CG    . GLN A  1 27  ? 77.335  114.319 -87.821  1.00 19.70  ? 27   GLN A CG    1 
ATOM   166   C CD    . GLN A  1 27  ? 78.268  115.106 -88.735  1.00 21.34  ? 27   GLN A CD    1 
ATOM   167   O OE1   . GLN A  1 27  ? 79.124  115.867 -88.266  1.00 22.24  ? 27   GLN A OE1   1 
ATOM   168   N NE2   . GLN A  1 27  ? 78.096  114.946 -90.050  1.00 20.89  ? 27   GLN A NE2   1 
ATOM   169   N N     . LEU A  1 28  ? 77.137  114.431 -83.057  1.00 23.26  ? 28   LEU A N     1 
ATOM   170   C CA    . LEU A  1 28  ? 77.664  114.398 -81.690  1.00 22.61  ? 28   LEU A CA    1 
ATOM   171   C C     . LEU A  1 28  ? 76.897  113.427 -80.812  1.00 23.74  ? 28   LEU A C     1 
ATOM   172   O O     . LEU A  1 28  ? 77.264  113.233 -79.648  1.00 22.60  ? 28   LEU A O     1 
ATOM   173   C CB    . LEU A  1 28  ? 77.609  115.791 -81.041  1.00 22.95  ? 28   LEU A CB    1 
ATOM   174   C CG    . LEU A  1 28  ? 78.603  116.835 -81.583  1.00 25.63  ? 28   LEU A CG    1 
ATOM   175   C CD1   . LEU A  1 28  ? 78.339  118.207 -80.961  1.00 24.24  ? 28   LEU A CD1   1 
ATOM   176   C CD2   . LEU A  1 28  ? 80.046  116.383 -81.297  1.00 24.20  ? 28   LEU A CD2   1 
ATOM   177   N N     . GLY A  1 29  ? 75.818  112.853 -81.358  1.00 23.28  ? 29   GLY A N     1 
ATOM   178   C CA    . GLY A  1 29  ? 75.015  111.894 -80.619  1.00 23.61  ? 29   GLY A CA    1 
ATOM   179   C C     . GLY A  1 29  ? 73.656  112.370 -80.091  1.00 24.24  ? 29   GLY A C     1 
ATOM   180   O O     . GLY A  1 29  ? 72.921  111.595 -79.479  1.00 21.69  ? 29   GLY A O     1 
ATOM   181   N N     . PHE A  1 30  ? 73.308  113.632 -80.310  1.00 21.59  ? 30   PHE A N     1 
ATOM   182   C CA    . PHE A  1 30  ? 72.020  114.124 -79.831  1.00 21.03  ? 30   PHE A CA    1 
ATOM   183   C C     . PHE A  1 30  ? 70.871  113.693 -80.743  1.00 21.17  ? 30   PHE A C     1 
ATOM   184   O O     . PHE A  1 30  ? 71.014  113.721 -81.968  1.00 19.41  ? 30   PHE A O     1 
ATOM   185   C CB    . PHE A  1 30  ? 72.012  115.652 -79.792  1.00 20.08  ? 30   PHE A CB    1 
ATOM   186   C CG    . PHE A  1 30  ? 72.904  116.244 -78.741  1.00 20.47  ? 30   PHE A CG    1 
ATOM   187   C CD1   . PHE A  1 30  ? 72.656  116.006 -77.394  1.00 21.19  ? 30   PHE A CD1   1 
ATOM   188   C CD2   . PHE A  1 30  ? 73.944  117.091 -79.092  1.00 22.50  ? 30   PHE A CD2   1 
ATOM   189   C CE1   . PHE A  1 30  ? 73.418  116.607 -76.420  1.00 22.89  ? 30   PHE A CE1   1 
ATOM   190   C CE2   . PHE A  1 30  ? 74.735  117.710 -78.114  1.00 24.09  ? 30   PHE A CE2   1 
ATOM   191   C CZ    . PHE A  1 30  ? 74.462  117.466 -76.770  1.00 22.56  ? 30   PHE A CZ    1 
ATOM   192   N N     . LYS A  1 31  ? 69.746  113.294 -80.150  1.00 21.35  ? 31   LYS A N     1 
ATOM   193   C CA    . LYS A  1 31  ? 68.555  112.975 -80.948  1.00 23.27  ? 31   LYS A CA    1 
ATOM   194   C C     . LYS A  1 31  ? 68.123  114.386 -81.378  1.00 21.84  ? 31   LYS A C     1 
ATOM   195   O O     . LYS A  1 31  ? 67.797  115.241 -80.552  1.00 20.27  ? 31   LYS A O     1 
ATOM   196   C CB    . LYS A  1 31  ? 67.463  112.312 -80.110  1.00 26.21  ? 31   LYS A CB    1 
ATOM   197   C CG    . LYS A  1 31  ? 66.253  111.948 -80.935  1.00 32.00  ? 31   LYS A CG    1 
ATOM   198   C CD    . LYS A  1 31  ? 65.227  111.268 -80.061  1.00 37.27  ? 31   LYS A CD    1 
ATOM   199   C CE    . LYS A  1 31  ? 64.124  110.609 -80.881  1.00 40.69  ? 31   LYS A CE    1 
ATOM   200   N NZ    . LYS A  1 31  ? 63.121  109.955 -79.957  1.00 41.75  ? 31   LYS A NZ    1 
ATOM   201   N N     . THR A  1 32  ? 68.141  114.619 -82.687  1.00 22.75  ? 32   THR A N     1 
ATOM   202   C CA    . THR A  1 32  ? 67.894  115.956 -83.221  1.00 23.49  ? 32   THR A CA    1 
ATOM   203   C C     . THR A  1 32  ? 66.726  116.152 -84.161  1.00 22.11  ? 32   THR A C     1 
ATOM   204   O O     . THR A  1 32  ? 66.471  115.351 -85.063  1.00 22.11  ? 32   THR A O     1 
ATOM   205   C CB    . THR A  1 32  ? 69.172  116.448 -83.952  1.00 23.99  ? 32   THR A CB    1 
ATOM   206   O OG1   . THR A  1 32  ? 70.304  116.284 -83.088  1.00 21.85  ? 32   THR A OG1   1 
ATOM   207   C CG2   . THR A  1 32  ? 69.037  117.917 -84.358  1.00 25.74  ? 32   THR A CG2   1 
ATOM   208   N N     . VAL A  1 33  ? 66.043  117.265 -83.951  1.00 23.30  ? 33   VAL A N     1 
ATOM   209   C CA    . VAL A  1 33  ? 64.910  117.636 -84.769  1.00 22.32  ? 33   VAL A CA    1 
ATOM   210   C C     . VAL A  1 33  ? 65.136  119.020 -85.354  1.00 21.65  ? 33   VAL A C     1 
ATOM   211   O O     . VAL A  1 33  ? 65.598  119.913 -84.662  1.00 20.89  ? 33   VAL A O     1 
ATOM   212   C CB    . VAL A  1 33  ? 63.623  117.636 -83.920  1.00 23.94  ? 33   VAL A CB    1 
ATOM   213   C CG1   . VAL A  1 33  ? 62.480  118.300 -84.673  1.00 23.65  ? 33   VAL A CG1   1 
ATOM   214   C CG2   . VAL A  1 33  ? 63.258  116.180 -83.579  1.00 24.84  ? 33   VAL A CG2   1 
ATOM   215   N N     . CYS A  1 34  ? 64.839  119.183 -86.642  1.00 22.78  ? 34   CYS A N     1 
ATOM   216   C CA    . CYS A  1 34  ? 64.966  120.488 -87.293  1.00 23.85  ? 34   CYS A CA    1 
ATOM   217   C C     . CYS A  1 34  ? 63.610  120.830 -87.897  1.00 23.62  ? 34   CYS A C     1 
ATOM   218   O O     . CYS A  1 34  ? 63.063  120.063 -88.688  1.00 23.69  ? 34   CYS A O     1 
ATOM   219   C CB    . CYS A  1 34  ? 66.047  120.513 -88.397  1.00 18.52  ? 34   CYS A CB    1 
ATOM   220   S SG    . CYS A  1 34  ? 66.197  122.178 -89.216  1.00 22.31  ? 34   CYS A SG    1 
ATOM   221   N N     . ILE A  1 35  ? 63.095  121.987 -87.503  1.00 24.79  ? 35   ILE A N     1 
ATOM   222   C CA    . ILE A  1 35  ? 61.796  122.499 -87.950  1.00 26.07  ? 35   ILE A CA    1 
ATOM   223   C C     . ILE A  1 35  ? 61.973  123.620 -88.949  1.00 24.41  ? 35   ILE A C     1 
ATOM   224   O O     . ILE A  1 35  ? 62.707  124.556 -88.695  1.00 26.09  ? 35   ILE A O     1 
ATOM   225   C CB    . ILE A  1 35  ? 61.000  123.077 -86.780  1.00 26.19  ? 35   ILE A CB    1 
ATOM   226   C CG1   . ILE A  1 35  ? 60.785  121.991 -85.727  1.00 28.10  ? 35   ILE A CG1   1 
ATOM   227   C CG2   . ILE A  1 35  ? 59.669  123.637 -87.286  1.00 27.26  ? 35   ILE A CG2   1 
ATOM   228   C CD1   . ILE A  1 35  ? 60.431  122.534 -84.344  1.00 26.77  ? 35   ILE A CD1   1 
ATOM   229   N N     . GLU A  1 36  ? 61.284  123.522 -90.071  1.00 25.47  ? 36   GLU A N     1 
ATOM   230   C CA    . GLU A  1 36  ? 61.350  124.526 -91.123  1.00 25.28  ? 36   GLU A CA    1 
ATOM   231   C C     . GLU A  1 36  ? 59.932  124.826 -91.643  1.00 26.93  ? 36   GLU A C     1 
ATOM   232   O O     . GLU A  1 36  ? 59.149  123.904 -91.938  1.00 25.63  ? 36   GLU A O     1 
ATOM   233   C CB    . GLU A  1 36  ? 62.235  124.020 -92.267  1.00 24.61  ? 36   GLU A CB    1 
ATOM   234   C CG    . GLU A  1 36  ? 62.334  124.968 -93.466  1.00 23.13  ? 36   GLU A CG    1 
ATOM   235   C CD    . GLU A  1 36  ? 62.733  126.389 -93.064  1.00 26.25  ? 36   GLU A CD    1 
ATOM   236   O OE1   . GLU A  1 36  ? 63.844  126.576 -92.498  1.00 24.06  ? 36   GLU A OE1   1 
ATOM   237   O OE2   . GLU A  1 36  ? 61.926  127.323 -93.316  1.00 24.28  ? 36   GLU A OE2   1 
ATOM   238   N N     . LYS A  1 37  ? 59.600  126.112 -91.755  1.00 27.85  ? 37   LYS A N     1 
ATOM   239   C CA    . LYS A  1 37  ? 58.283  126.507 -92.247  1.00 28.75  ? 37   LYS A CA    1 
ATOM   240   C C     . LYS A  1 37  ? 58.218  126.607 -93.767  1.00 29.24  ? 37   LYS A C     1 
ATOM   241   O O     . LYS A  1 37  ? 57.145  126.447 -94.338  1.00 31.52  ? 37   LYS A O     1 
ATOM   242   C CB    . LYS A  1 37  ? 57.856  127.853 -91.630  1.00 28.39  ? 37   LYS A CB    1 
ATOM   243   C CG    . LYS A  1 37  ? 58.721  129.045 -92.061  1.00 27.37  ? 37   LYS A CG    1 
ATOM   244   C CD    . LYS A  1 37  ? 58.226  130.326 -91.400  1.00 29.55  ? 37   LYS A CD    1 
ATOM   245   C CE    . LYS A  1 37  ? 59.181  131.487 -91.597  1.00 28.55  ? 37   LYS A CE    1 
ATOM   246   N NZ    . LYS A  1 37  ? 59.544  131.700 -93.030  1.00 27.67  ? 37   LYS A NZ    1 
ATOM   247   N N     . ASN A  1 38  ? 59.337  126.892 -94.436  1.00 30.04  ? 38   ASN A N     1 
ATOM   248   C CA    . ASN A  1 38  ? 59.304  127.002 -95.896  1.00 30.85  ? 38   ASN A CA    1 
ATOM   249   C C     . ASN A  1 38  ? 59.240  125.629 -96.586  1.00 33.16  ? 38   ASN A C     1 
ATOM   250   O O     . ASN A  1 38  ? 59.433  124.574 -95.941  1.00 32.94  ? 38   ASN A O     1 
ATOM   251   C CB    . ASN A  1 38  ? 60.489  127.829 -96.413  1.00 28.07  ? 38   ASN A CB    1 
ATOM   252   C CG    . ASN A  1 38  ? 60.402  129.286 -95.998  1.00 28.45  ? 38   ASN A CG    1 
ATOM   253   O OD1   . ASN A  1 38  ? 59.509  129.685 -95.255  1.00 26.70  ? 38   ASN A OD1   1 
ATOM   254   N ND2   . ASN A  1 38  ? 61.351  130.090 -96.463  1.00 31.22  ? 38   ASN A ND2   1 
ATOM   255   N N     . GLU A  1 39  ? 58.923  125.647 -97.884  1.00 33.88  ? 39   GLU A N     1 
ATOM   256   C CA    . GLU A  1 39  ? 58.782  124.424 -98.680  1.00 35.93  ? 39   GLU A CA    1 
ATOM   257   C C     . GLU A  1 39  ? 60.074  123.689 -98.907  1.00 34.53  ? 39   GLU A C     1 
ATOM   258   O O     . GLU A  1 39  ? 60.059  122.523 -99.266  1.00 33.32  ? 39   GLU A O     1 
ATOM   259   C CB    . GLU A  1 39  ? 58.204  124.727 -100.058 1.00 40.32  ? 39   GLU A CB    1 
ATOM   260   C CG    . GLU A  1 39  ? 56.737  125.088 -100.079 1.00 47.95  ? 39   GLU A CG    1 
ATOM   261   C CD    . GLU A  1 39  ? 56.258  125.414 -101.491 1.00 50.91  ? 39   GLU A CD    1 
ATOM   262   O OE1   . GLU A  1 39  ? 57.114  125.557 -102.396 1.00 52.05  ? 39   GLU A OE1   1 
ATOM   263   O OE2   . GLU A  1 39  ? 55.029  125.532 -101.694 1.00 53.97  ? 39   GLU A OE2   1 
ATOM   264   N N     . THR A  1 40  ? 61.187  124.396 -98.763  1.00 32.69  ? 40   THR A N     1 
ATOM   265   C CA    . THR A  1 40  ? 62.500  123.803 -98.956  1.00 31.11  ? 40   THR A CA    1 
ATOM   266   C C     . THR A  1 40  ? 63.353  124.132 -97.732  1.00 30.32  ? 40   THR A C     1 
ATOM   267   O O     . THR A  1 40  ? 62.974  124.954 -96.896  1.00 29.04  ? 40   THR A O     1 
ATOM   268   C CB    . THR A  1 40  ? 63.210  124.359 -100.233 1.00 30.94  ? 40   THR A CB    1 
ATOM   269   O OG1   . THR A  1 40  ? 63.423  125.770 -100.103 1.00 32.53  ? 40   THR A OG1   1 
ATOM   270   C CG2   . THR A  1 40  ? 62.366  124.109 -101.470 1.00 31.04  ? 40   THR A CG2   1 
ATOM   271   N N     . LEU A  1 41  ? 64.494  123.464 -97.641  1.00 28.50  ? 41   LEU A N     1 
ATOM   272   C CA    . LEU A  1 41  ? 65.433  123.655 -96.549  1.00 27.13  ? 41   LEU A CA    1 
ATOM   273   C C     . LEU A  1 41  ? 66.471  124.673 -97.056  1.00 26.78  ? 41   LEU A C     1 
ATOM   274   O O     . LEU A  1 41  ? 66.499  125.002 -98.261  1.00 26.16  ? 41   LEU A O     1 
ATOM   275   C CB    . LEU A  1 41  ? 66.113  122.310 -96.236  1.00 23.05  ? 41   LEU A CB    1 
ATOM   276   C CG    . LEU A  1 41  ? 65.174  121.137 -95.846  1.00 25.82  ? 41   LEU A CG    1 
ATOM   277   C CD1   . LEU A  1 41  ? 65.951  119.851 -95.625  1.00 20.68  ? 41   LEU A CD1   1 
ATOM   278   C CD2   . LEU A  1 41  ? 64.412  121.494 -94.553  1.00 26.32  ? 41   LEU A CD2   1 
ATOM   279   N N     . GLY A  1 42  ? 67.295  125.207 -96.158  1.00 24.46  ? 42   GLY A N     1 
ATOM   280   C CA    . GLY A  1 42  ? 68.353  126.078 -96.637  1.00 23.83  ? 42   GLY A CA    1 
ATOM   281   C C     . GLY A  1 42  ? 68.260  127.558 -96.355  1.00 23.59  ? 42   GLY A C     1 
ATOM   282   O O     . GLY A  1 42  ? 69.213  128.299 -96.642  1.00 21.60  ? 42   GLY A O     1 
ATOM   283   N N     . GLY A  1 43  ? 67.133  127.968 -95.790  1.00 23.73  ? 43   GLY A N     1 
ATOM   284   C CA    . GLY A  1 43  ? 66.933  129.369 -95.450  1.00 22.70  ? 43   GLY A CA    1 
ATOM   285   C C     . GLY A  1 43  ? 67.216  130.356 -96.559  1.00 22.86  ? 43   GLY A C     1 
ATOM   286   O O     . GLY A  1 43  ? 67.171  130.040 -97.755  1.00 24.57  ? 43   GLY A O     1 
ATOM   287   N N     . THR A  1 44  ? 67.558  131.566 -96.140  1.00 23.06  ? 44   THR A N     1 
ATOM   288   C CA    . THR A  1 44  ? 67.837  132.667 -97.054  1.00 22.48  ? 44   THR A CA    1 
ATOM   289   C C     . THR A  1 44  ? 68.977  132.369 -98.029  1.00 23.14  ? 44   THR A C     1 
ATOM   290   O O     . THR A  1 44  ? 68.814  132.463 -99.253  1.00 21.84  ? 44   THR A O     1 
ATOM   291   C CB    . THR A  1 44  ? 68.161  133.933 -96.228  1.00 22.84  ? 44   THR A CB    1 
ATOM   292   O OG1   . THR A  1 44  ? 67.087  134.160 -95.313  1.00 24.01  ? 44   THR A OG1   1 
ATOM   293   C CG2   . THR A  1 44  ? 68.319  135.149 -97.115  1.00 23.94  ? 44   THR A CG2   1 
ATOM   294   N N     A CYS A  1 45  ? 70.126  132.001 -97.477  0.54 23.11  ? 45   CYS A N     1 
ATOM   295   N N     B CYS A  1 45  ? 70.116  131.975 -97.456  0.46 22.33  ? 45   CYS A N     1 
ATOM   296   C CA    A CYS A  1 45  ? 71.320  131.717 -98.254  0.54 23.89  ? 45   CYS A CA    1 
ATOM   297   C CA    B CYS A  1 45  ? 71.331  131.652 -98.196  0.46 22.50  ? 45   CYS A CA    1 
ATOM   298   C C     A CYS A  1 45  ? 71.098  130.824 -99.453  0.54 23.42  ? 45   CYS A C     1 
ATOM   299   C C     B CYS A  1 45  ? 71.103  130.823 -99.430  0.46 22.68  ? 45   CYS A C     1 
ATOM   300   O O     A CYS A  1 45  ? 71.462  131.176 -100.560 0.54 24.01  ? 45   CYS A O     1 
ATOM   301   O O     B CYS A  1 45  ? 71.457  131.216 -100.527 0.46 23.35  ? 45   CYS A O     1 
ATOM   302   C CB    A CYS A  1 45  ? 72.355  131.088 -97.336  0.54 25.93  ? 45   CYS A CB    1 
ATOM   303   C CB    B CYS A  1 45  ? 72.330  130.900 -97.294  0.46 22.85  ? 45   CYS A CB    1 
ATOM   304   S SG    A CYS A  1 45  ? 74.109  131.076 -97.840  0.54 27.69  ? 45   CYS A SG    1 
ATOM   305   S SG    B CYS A  1 45  ? 73.724  130.097 -98.172  0.46 20.55  ? 45   CYS A SG    1 
ATOM   306   N N     . LEU A  1 46  ? 70.540  129.645 -99.241  1.00 24.36  ? 46   LEU A N     1 
ATOM   307   C CA    . LEU A  1 46  ? 70.308  128.759 -100.367 1.00 25.87  ? 46   LEU A CA    1 
ATOM   308   C C     . LEU A  1 46  ? 69.186  129.138 -101.320 1.00 25.56  ? 46   LEU A C     1 
ATOM   309   O O     . LEU A  1 46  ? 69.334  129.019 -102.535 1.00 25.77  ? 46   LEU A O     1 
ATOM   310   C CB    . LEU A  1 46  ? 70.020  127.351 -99.888  1.00 28.49  ? 46   LEU A CB    1 
ATOM   311   C CG    . LEU A  1 46  ? 71.238  126.510 -99.584  1.00 31.14  ? 46   LEU A CG    1 
ATOM   312   C CD1   . LEU A  1 46  ? 71.872  126.915 -98.224  1.00 33.16  ? 46   LEU A CD1   1 
ATOM   313   C CD2   . LEU A  1 46  ? 70.777  125.089 -99.594  1.00 32.06  ? 46   LEU A CD2   1 
ATOM   314   N N     . ASN A  1 47  ? 68.074  129.603 -100.781 1.00 24.93  ? 47   ASN A N     1 
ATOM   315   C CA    . ASN A  1 47  ? 66.932  129.864 -101.633 1.00 26.53  ? 47   ASN A CA    1 
ATOM   316   C C     . ASN A  1 47  ? 66.831  131.203 -102.305 1.00 26.89  ? 47   ASN A C     1 
ATOM   317   O O     . ASN A  1 47  ? 66.588  131.244 -103.504 1.00 25.75  ? 47   ASN A O     1 
ATOM   318   C CB    . ASN A  1 47  ? 65.662  129.529 -100.846 1.00 25.80  ? 47   ASN A CB    1 
ATOM   319   C CG    . ASN A  1 47  ? 65.651  128.072 -100.411 1.00 28.67  ? 47   ASN A CG    1 
ATOM   320   O OD1   . ASN A  1 47  ? 65.251  127.180 -101.173 1.00 29.57  ? 47   ASN A OD1   1 
ATOM   321   N ND2   . ASN A  1 47  ? 66.138  127.812 -99.206  1.00 26.68  ? 47   ASN A ND2   1 
ATOM   322   N N     . VAL A  1 48  ? 67.077  132.284 -101.567 1.00 28.49  ? 48   VAL A N     1 
ATOM   323   C CA    . VAL A  1 48  ? 66.957  133.635 -102.138 1.00 28.66  ? 48   VAL A CA    1 
ATOM   324   C C     . VAL A  1 48  ? 68.143  134.480 -101.734 1.00 29.51  ? 48   VAL A C     1 
ATOM   325   O O     . VAL A  1 48  ? 68.022  135.684 -101.500 1.00 28.86  ? 48   VAL A O     1 
ATOM   326   C CB    . VAL A  1 48  ? 65.672  134.311 -101.625 1.00 27.78  ? 48   VAL A CB    1 
ATOM   327   C CG1   . VAL A  1 48  ? 64.455  133.449 -101.954 1.00 24.82  ? 48   VAL A CG1   1 
ATOM   328   C CG2   . VAL A  1 48  ? 65.772  134.510 -100.114 1.00 27.94  ? 48   VAL A CG2   1 
ATOM   329   N N     . GLY A  1 49  ? 69.305  133.847 -101.637 1.00 30.15  ? 49   GLY A N     1 
ATOM   330   C CA    . GLY A  1 49  ? 70.463  134.598 -101.229 1.00 29.57  ? 49   GLY A CA    1 
ATOM   331   C C     . GLY A  1 49  ? 71.790  134.298 -101.877 1.00 30.23  ? 49   GLY A C     1 
ATOM   332   O O     . GLY A  1 49  ? 72.005  134.513 -103.087 1.00 28.71  ? 49   GLY A O     1 
ATOM   333   N N     A CYS A  1 50  ? 72.687  133.770 -101.045 0.54 28.97  ? 50   CYS A N     1 
ATOM   334   N N     B CYS A  1 50  ? 72.707  133.811 -101.053 0.46 29.94  ? 50   CYS A N     1 
ATOM   335   C CA    A CYS A  1 50  ? 74.041  133.431 -101.456 0.54 27.34  ? 50   CYS A CA    1 
ATOM   336   C CA    B CYS A  1 50  ? 74.055  133.487 -101.485 0.46 29.27  ? 50   CYS A CA    1 
ATOM   337   C C     A CYS A  1 50  ? 74.091  132.645 -102.757 0.54 26.82  ? 50   CYS A C     1 
ATOM   338   C C     B CYS A  1 50  ? 74.144  132.611 -102.739 0.46 27.97  ? 50   CYS A C     1 
ATOM   339   O O     A CYS A  1 50  ? 74.749  133.045 -103.718 0.54 26.77  ? 50   CYS A O     1 
ATOM   340   O O     B CYS A  1 50  ? 74.885  132.929 -103.670 0.46 27.71  ? 50   CYS A O     1 
ATOM   341   C CB    A CYS A  1 50  ? 74.752  132.569 -100.397 0.54 27.28  ? 50   CYS A CB    1 
ATOM   342   C CB    B CYS A  1 50  ? 74.793  132.849 -100.304 0.46 30.65  ? 50   CYS A CB    1 
ATOM   343   S SG    A CYS A  1 50  ? 74.592  132.910 -98.607  0.54 25.16  ? 50   CYS A SG    1 
ATOM   344   S SG    B CYS A  1 50  ? 76.084  131.672 -100.753 0.46 34.05  ? 50   CYS A SG    1 
ATOM   345   N N     . ILE A  1 51  ? 73.393  131.514 -102.771 1.00 26.51  ? 51   ILE A N     1 
ATOM   346   C CA    . ILE A  1 51  ? 73.426  130.624 -103.921 1.00 24.93  ? 51   ILE A CA    1 
ATOM   347   C C     . ILE A  1 51  ? 72.926  131.219 -105.240 1.00 24.24  ? 51   ILE A C     1 
ATOM   348   O O     . ILE A  1 51  ? 73.706  131.262 -106.191 1.00 23.89  ? 51   ILE A O     1 
ATOM   349   C CB    . ILE A  1 51  ? 72.719  129.279 -103.595 1.00 23.93  ? 51   ILE A CB    1 
ATOM   350   C CG1   . ILE A  1 51  ? 73.362  128.665 -102.334 1.00 26.96  ? 51   ILE A CG1   1 
ATOM   351   C CG2   . ILE A  1 51  ? 72.837  128.306 -104.776 1.00 23.26  ? 51   ILE A CG2   1 
ATOM   352   C CD1   . ILE A  1 51  ? 74.907  128.618 -102.348 1.00 24.69  ? 51   ILE A CD1   1 
ATOM   353   N N     . PRO A  1 52  ? 71.656  131.711 -105.309 1.00 23.13  ? 52   PRO A N     1 
ATOM   354   C CA    . PRO A  1 52  ? 71.231  132.273 -106.601 1.00 22.95  ? 52   PRO A CA    1 
ATOM   355   C C     . PRO A  1 52  ? 72.003  133.553 -106.983 1.00 23.72  ? 52   PRO A C     1 
ATOM   356   O O     . PRO A  1 52  ? 72.319  133.753 -108.161 1.00 24.67  ? 52   PRO A O     1 
ATOM   357   C CB    . PRO A  1 52  ? 69.699  132.484 -106.428 1.00 19.33  ? 52   PRO A CB    1 
ATOM   358   C CG    . PRO A  1 52  ? 69.538  132.686 -104.960 1.00 21.02  ? 52   PRO A CG    1 
ATOM   359   C CD    . PRO A  1 52  ? 70.531  131.677 -104.356 1.00 20.84  ? 52   PRO A CD    1 
ATOM   360   N N     . SER A  1 53  ? 72.358  134.401 -106.019 1.00 24.77  ? 53   SER A N     1 
ATOM   361   C CA    . SER A  1 53  ? 73.100  135.606 -106.402 1.00 26.39  ? 53   SER A CA    1 
ATOM   362   C C     . SER A  1 53  ? 74.477  135.256 -106.997 1.00 26.75  ? 53   SER A C     1 
ATOM   363   O O     . SER A  1 53  ? 74.880  135.842 -108.003 1.00 26.41  ? 53   SER A O     1 
ATOM   364   C CB    . SER A  1 53  ? 73.227  136.591 -105.222 1.00 26.59  ? 53   SER A CB    1 
ATOM   365   O OG    . SER A  1 53  ? 74.017  136.087 -104.164 1.00 32.76  ? 53   SER A OG    1 
ATOM   366   N N     . LYS A  1 54  ? 75.180  134.267 -106.424 1.00 27.32  ? 54   LYS A N     1 
ATOM   367   C CA    . LYS A  1 54  ? 76.489  133.896 -106.962 1.00 25.20  ? 54   LYS A CA    1 
ATOM   368   C C     . LYS A  1 54  ? 76.346  133.250 -108.348 1.00 24.67  ? 54   LYS A C     1 
ATOM   369   O O     . LYS A  1 54  ? 77.196  133.437 -109.227 1.00 23.61  ? 54   LYS A O     1 
ATOM   370   C CB    . LYS A  1 54  ? 77.230  132.951 -106.000 1.00 26.77  ? 54   LYS A CB    1 
ATOM   371   C CG    . LYS A  1 54  ? 78.330  133.614 -105.105 1.00 27.33  ? 54   LYS A CG    1 
ATOM   372   C CD    . LYS A  1 54  ? 77.796  134.385 -103.889 1.00 24.58  ? 54   LYS A CD    1 
ATOM   373   C CE    . LYS A  1 54  ? 77.258  135.751 -104.261 1.00 26.02  ? 54   LYS A CE    1 
ATOM   374   N NZ    . LYS A  1 54  ? 76.676  136.452 -103.057 1.00 24.12  ? 54   LYS A NZ    1 
ATOM   375   N N     . ALA A  1 55  ? 75.281  132.480 -108.552 1.00 24.54  ? 55   ALA A N     1 
ATOM   376   C CA    . ALA A  1 55  ? 75.046  131.869 -109.862 1.00 24.28  ? 55   ALA A CA    1 
ATOM   377   C C     . ALA A  1 55  ? 74.918  132.981 -110.915 1.00 23.55  ? 55   ALA A C     1 
ATOM   378   O O     . ALA A  1 55  ? 75.523  132.907 -111.972 1.00 24.43  ? 55   ALA A O     1 
ATOM   379   C CB    . ALA A  1 55  ? 73.754  131.017 -109.842 1.00 22.98  ? 55   ALA A CB    1 
ATOM   380   N N     . LEU A  1 56  ? 74.126  134.006 -110.612 1.00 25.93  ? 56   LEU A N     1 
ATOM   381   C CA    . LEU A  1 56  ? 73.927  135.116 -111.541 1.00 26.24  ? 56   LEU A CA    1 
ATOM   382   C C     . LEU A  1 56  ? 75.169  135.942 -111.730 1.00 26.99  ? 56   LEU A C     1 
ATOM   383   O O     . LEU A  1 56  ? 75.461  136.373 -112.836 1.00 28.22  ? 56   LEU A O     1 
ATOM   384   C CB    . LEU A  1 56  ? 72.766  135.991 -111.073 1.00 25.97  ? 56   LEU A CB    1 
ATOM   385   C CG    . LEU A  1 56  ? 71.446  135.217 -111.148 1.00 25.77  ? 56   LEU A CG    1 
ATOM   386   C CD1   . LEU A  1 56  ? 70.295  136.152 -110.878 1.00 25.48  ? 56   LEU A CD1   1 
ATOM   387   C CD2   . LEU A  1 56  ? 71.273  134.574 -112.533 1.00 24.61  ? 56   LEU A CD2   1 
ATOM   388   N N     . LEU A  1 57  ? 75.910  136.161 -110.642 1.00 27.24  ? 57   LEU A N     1 
ATOM   389   C CA    . LEU A  1 57  ? 77.161  136.903 -110.717 1.00 25.92  ? 57   LEU A CA    1 
ATOM   390   C C     . LEU A  1 57  ? 78.135  136.180 -111.651 1.00 26.74  ? 57   LEU A C     1 
ATOM   391   O O     . LEU A  1 57  ? 78.816  136.794 -112.488 1.00 25.09  ? 57   LEU A O     1 
ATOM   392   C CB    . LEU A  1 57  ? 77.770  137.025 -109.314 1.00 27.30  ? 57   LEU A CB    1 
ATOM   393   C CG    . LEU A  1 57  ? 77.213  138.243 -108.571 1.00 26.34  ? 57   LEU A CG    1 
ATOM   394   C CD1   . LEU A  1 57  ? 77.513  138.129 -107.064 1.00 25.02  ? 57   LEU A CD1   1 
ATOM   395   C CD2   . LEU A  1 57  ? 77.829  139.520 -109.168 1.00 25.38  ? 57   LEU A CD2   1 
ATOM   396   N N     . ASN A  1 58  ? 78.191  134.858 -111.524 1.00 26.96  ? 58   ASN A N     1 
ATOM   397   C CA    . ASN A  1 58  ? 79.092  134.077 -112.354 1.00 27.14  ? 58   ASN A CA    1 
ATOM   398   C C     . ASN A  1 58  ? 78.676  134.079 -113.825 1.00 27.65  ? 58   ASN A C     1 
ATOM   399   O O     . ASN A  1 58  ? 79.496  134.315 -114.714 1.00 26.92  ? 58   ASN A O     1 
ATOM   400   C CB    . ASN A  1 58  ? 79.175  132.640 -111.804 1.00 30.10  ? 58   ASN A CB    1 
ATOM   401   C CG    . ASN A  1 58  ? 80.220  131.798 -112.524 1.00 34.08  ? 58   ASN A CG    1 
ATOM   402   O OD1   . ASN A  1 58  ? 81.384  132.207 -112.664 1.00 36.17  ? 58   ASN A OD1   1 
ATOM   403   N ND2   . ASN A  1 58  ? 79.813  130.600 -112.972 1.00 35.03  ? 58   ASN A ND2   1 
ATOM   404   N N     . ASN A  1 59  ? 77.402  133.820 -114.084 1.00 27.54  ? 59   ASN A N     1 
ATOM   405   C CA    . ASN A  1 59  ? 76.913  133.787 -115.455 1.00 28.26  ? 59   ASN A CA    1 
ATOM   406   C C     . ASN A  1 59  ? 76.954  135.183 -116.108 1.00 29.82  ? 59   ASN A C     1 
ATOM   407   O O     . ASN A  1 59  ? 77.340  135.314 -117.271 1.00 32.01  ? 59   ASN A O     1 
ATOM   408   C CB    . ASN A  1 59  ? 75.482  133.249 -115.495 1.00 25.76  ? 59   ASN A CB    1 
ATOM   409   C CG    . ASN A  1 59  ? 75.360  131.818 -114.987 1.00 25.57  ? 59   ASN A CG    1 
ATOM   410   O OD1   . ASN A  1 59  ? 76.317  131.035 -115.026 1.00 25.40  ? 59   ASN A OD1   1 
ATOM   411   N ND2   . ASN A  1 59  ? 74.157  131.461 -114.534 1.00 21.95  ? 59   ASN A ND2   1 
ATOM   412   N N     . SER A  1 60  ? 76.574  136.219 -115.365 1.00 29.69  ? 60   SER A N     1 
ATOM   413   C CA    . SER A  1 60  ? 76.582  137.566 -115.932 1.00 30.20  ? 60   SER A CA    1 
ATOM   414   C C     . SER A  1 60  ? 77.998  138.029 -116.234 1.00 30.57  ? 60   SER A C     1 
ATOM   415   O O     . SER A  1 60  ? 78.208  138.782 -117.177 1.00 30.46  ? 60   SER A O     1 
ATOM   416   C CB    . SER A  1 60  ? 75.867  138.563 -115.012 1.00 28.50  ? 60   SER A CB    1 
ATOM   417   O OG    . SER A  1 60  ? 76.574  138.800 -113.802 1.00 25.77  ? 60   SER A OG    1 
ATOM   418   N N     . HIS A  1 61  ? 78.978  137.570 -115.459 1.00 30.71  ? 61   HIS A N     1 
ATOM   419   C CA    . HIS A  1 61  ? 80.370  137.954 -115.720 1.00 30.62  ? 61   HIS A CA    1 
ATOM   420   C C     . HIS A  1 61  ? 80.838  137.299 -117.028 1.00 32.71  ? 61   HIS A C     1 
ATOM   421   O O     . HIS A  1 61  ? 81.507  137.935 -117.855 1.00 32.52  ? 61   HIS A O     1 
ATOM   422   C CB    . HIS A  1 61  ? 81.293  137.502 -114.579 1.00 30.96  ? 61   HIS A CB    1 
ATOM   423   C CG    . HIS A  1 61  ? 82.751  137.570 -114.922 1.00 29.86  ? 61   HIS A CG    1 
ATOM   424   N ND1   . HIS A  1 61  ? 83.409  138.760 -115.147 1.00 30.08  ? 61   HIS A ND1   1 
ATOM   425   C CD2   . HIS A  1 61  ? 83.665  136.592 -115.121 1.00 29.91  ? 61   HIS A CD2   1 
ATOM   426   C CE1   . HIS A  1 61  ? 84.665  138.511 -115.472 1.00 27.72  ? 61   HIS A CE1   1 
ATOM   427   N NE2   . HIS A  1 61  ? 84.846  137.206 -115.463 1.00 29.18  ? 61   HIS A NE2   1 
ATOM   428   N N     . TYR A  1 62  ? 80.507  136.019 -117.193 1.00 33.13  ? 62   TYR A N     1 
ATOM   429   C CA    . TYR A  1 62  ? 80.880  135.301 -118.395 1.00 34.69  ? 62   TYR A CA    1 
ATOM   430   C C     . TYR A  1 62  ? 80.199  135.899 -119.616 1.00 34.08  ? 62   TYR A C     1 
ATOM   431   O O     . TYR A  1 62  ? 80.803  135.967 -120.674 1.00 32.63  ? 62   TYR A O     1 
ATOM   432   C CB    . TYR A  1 62  ? 80.537  133.823 -118.264 1.00 38.66  ? 62   TYR A CB    1 
ATOM   433   C CG    . TYR A  1 62  ? 81.518  133.096 -117.391 1.00 43.09  ? 62   TYR A CG    1 
ATOM   434   C CD1   . TYR A  1 62  ? 82.886  133.357 -117.497 1.00 44.83  ? 62   TYR A CD1   1 
ATOM   435   C CD2   . TYR A  1 62  ? 81.093  132.153 -116.461 1.00 44.64  ? 62   TYR A CD2   1 
ATOM   436   C CE1   . TYR A  1 62  ? 83.807  132.694 -116.698 1.00 47.35  ? 62   TYR A CE1   1 
ATOM   437   C CE2   . TYR A  1 62  ? 82.011  131.479 -115.655 1.00 47.38  ? 62   TYR A CE2   1 
ATOM   438   C CZ    . TYR A  1 62  ? 83.363  131.751 -115.781 1.00 48.49  ? 62   TYR A CZ    1 
ATOM   439   O OH    . TYR A  1 62  ? 84.272  131.053 -115.011 1.00 51.01  ? 62   TYR A OH    1 
ATOM   440   N N     . TYR A  1 63  ? 78.943  136.311 -119.462 1.00 32.22  ? 63   TYR A N     1 
ATOM   441   C CA    . TYR A  1 63  ? 78.236  136.945 -120.555 1.00 33.11  ? 63   TYR A CA    1 
ATOM   442   C C     . TYR A  1 63  ? 79.076  138.163 -120.990 1.00 33.80  ? 63   TYR A C     1 
ATOM   443   O O     . TYR A  1 63  ? 79.416  138.332 -122.160 1.00 32.11  ? 63   TYR A O     1 
ATOM   444   C CB    . TYR A  1 63  ? 76.843  137.395 -120.084 1.00 34.42  ? 63   TYR A CB    1 
ATOM   445   C CG    . TYR A  1 63  ? 76.130  138.264 -121.097 1.00 36.80  ? 63   TYR A CG    1 
ATOM   446   C CD1   . TYR A  1 63  ? 75.713  137.739 -122.334 1.00 36.58  ? 63   TYR A CD1   1 
ATOM   447   C CD2   . TYR A  1 63  ? 75.900  139.621 -120.841 1.00 36.62  ? 63   TYR A CD2   1 
ATOM   448   C CE1   . TYR A  1 63  ? 75.091  138.544 -123.281 1.00 37.01  ? 63   TYR A CE1   1 
ATOM   449   C CE2   . TYR A  1 63  ? 75.277  140.436 -121.786 1.00 38.75  ? 63   TYR A CE2   1 
ATOM   450   C CZ    . TYR A  1 63  ? 74.880  139.887 -123.006 1.00 38.34  ? 63   TYR A CZ    1 
ATOM   451   O OH    . TYR A  1 63  ? 74.303  140.689 -123.963 1.00 38.76  ? 63   TYR A OH    1 
ATOM   452   N N     . HIS A  1 64  ? 79.429  138.992 -120.019 1.00 33.40  ? 64   HIS A N     1 
ATOM   453   C CA    . HIS A  1 64  ? 80.217  140.179 -120.253 1.00 34.41  ? 64   HIS A CA    1 
ATOM   454   C C     . HIS A  1 64  ? 81.523  139.876 -121.001 1.00 35.51  ? 64   HIS A C     1 
ATOM   455   O O     . HIS A  1 64  ? 81.891  140.597 -121.945 1.00 34.01  ? 64   HIS A O     1 
ATOM   456   C CB    . HIS A  1 64  ? 80.510  140.869 -118.912 1.00 35.92  ? 64   HIS A CB    1 
ATOM   457   C CG    . HIS A  1 64  ? 81.389  142.067 -119.021 1.00 39.47  ? 64   HIS A CG    1 
ATOM   458   N ND1   . HIS A  1 64  ? 82.122  142.598 -117.997 1.00 40.46  ? 64   HIS A ND1   1 
ATOM   459   C CD2   . HIS A  1 64  ? 81.613  142.895 -120.109 1.00 40.13  ? 64   HIS A CD2   1 
ATOM   460   C CE1   . HIS A  1 64  ? 82.760  143.696 -118.415 1.00 40.40  ? 64   HIS A CE1   1 
ATOM   461   N NE2   . HIS A  1 64  ? 82.449  143.871 -119.697 1.00 40.69  ? 64   HIS A NE2   1 
ATOM   462   N N     . MET A  1 65  ? 82.232  138.823 -120.578 1.00 35.67  ? 65   MET A N     1 
ATOM   463   C CA    . MET A  1 65  ? 83.509  138.432 -121.203 1.00 36.72  ? 65   MET A CA    1 
ATOM   464   C C     . MET A  1 65  ? 83.319  138.019 -122.660 1.00 35.95  ? 65   MET A C     1 
ATOM   465   O O     . MET A  1 65  ? 84.189  138.255 -123.498 1.00 34.08  ? 65   MET A O     1 
ATOM   466   C CB    . MET A  1 65  ? 84.161  137.255 -120.442 1.00 39.60  ? 65   MET A CB    1 
ATOM   467   C CG    . MET A  1 65  ? 84.551  137.551 -118.994 1.00 43.40  ? 65   MET A CG    1 
ATOM   468   S SD    . MET A  1 65  ? 85.550  139.056 -118.864 1.00 46.99  ? 65   MET A SD    1 
ATOM   469   C CE    . MET A  1 65  ? 87.179  138.383 -118.495 1.00 48.60  ? 65   MET A CE    1 
ATOM   470   N N     . ALA A  1 66  ? 82.192  137.375 -122.935 1.00 36.06  ? 66   ALA A N     1 
ATOM   471   C CA    . ALA A  1 66  ? 81.864  136.929 -124.288 1.00 38.66  ? 66   ALA A CA    1 
ATOM   472   C C     . ALA A  1 66  ? 81.318  138.049 -125.182 1.00 38.88  ? 66   ALA A C     1 
ATOM   473   O O     . ALA A  1 66  ? 81.804  138.266 -126.283 1.00 40.30  ? 66   ALA A O     1 
ATOM   474   C CB    . ALA A  1 66  ? 80.850  135.785 -124.228 1.00 36.83  ? 66   ALA A CB    1 
ATOM   475   N N     . HIS A  1 67  ? 80.288  138.730 -124.704 1.00 41.35  ? 67   HIS A N     1 
ATOM   476   C CA    . HIS A  1 67  ? 79.625  139.813 -125.433 1.00 43.62  ? 67   HIS A CA    1 
ATOM   477   C C     . HIS A  1 67  ? 80.575  140.990 -125.629 1.00 44.06  ? 67   HIS A C     1 
ATOM   478   O O     . HIS A  1 67  ? 80.598  141.600 -126.694 1.00 44.15  ? 67   HIS A O     1 
ATOM   479   C CB    . HIS A  1 67  ? 78.386  140.237 -124.635 1.00 45.37  ? 67   HIS A CB    1 
ATOM   480   C CG    . HIS A  1 67  ? 77.667  141.434 -125.175 1.00 48.74  ? 67   HIS A CG    1 
ATOM   481   N ND1   . HIS A  1 67  ? 76.937  141.403 -126.345 1.00 49.84  ? 67   HIS A ND1   1 
ATOM   482   C CD2   . HIS A  1 67  ? 77.509  142.680 -124.666 1.00 49.91  ? 67   HIS A CD2   1 
ATOM   483   C CE1   . HIS A  1 67  ? 76.356  142.578 -126.530 1.00 49.71  ? 67   HIS A CE1   1 
ATOM   484   N NE2   . HIS A  1 67  ? 76.686  143.369 -125.526 1.00 50.46  ? 67   HIS A NE2   1 
ATOM   485   N N     . GLY A  1 68  ? 81.369  141.276 -124.596 1.00 44.11  ? 68   GLY A N     1 
ATOM   486   C CA    . GLY A  1 68  ? 82.314  142.379 -124.628 1.00 43.22  ? 68   GLY A CA    1 
ATOM   487   C C     . GLY A  1 68  ? 83.547  142.108 -125.459 1.00 43.74  ? 68   GLY A C     1 
ATOM   488   O O     . GLY A  1 68  ? 83.498  141.334 -126.416 1.00 43.92  ? 68   GLY A O     1 
ATOM   489   N N     . THR A  1 69  ? 84.662  142.728 -125.078 1.00 43.04  ? 69   THR A N     1 
ATOM   490   C CA    . THR A  1 69  ? 85.921  142.591 -125.812 1.00 43.73  ? 69   THR A CA    1 
ATOM   491   C C     . THR A  1 69  ? 86.905  141.524 -125.317 1.00 42.56  ? 69   THR A C     1 
ATOM   492   O O     . THR A  1 69  ? 87.880  141.204 -125.999 1.00 42.81  ? 69   THR A O     1 
ATOM   493   C CB    . THR A  1 69  ? 86.688  143.940 -125.825 1.00 45.66  ? 69   THR A CB    1 
ATOM   494   O OG1   . THR A  1 69  ? 86.836  144.403 -124.477 1.00 48.68  ? 69   THR A OG1   1 
ATOM   495   C CG2   . THR A  1 69  ? 85.938  145.009 -126.643 1.00 45.33  ? 69   THR A CG2   1 
ATOM   496   N N     . ASP A  1 70  ? 86.657  140.967 -124.142 1.00 41.25  ? 70   ASP A N     1 
ATOM   497   C CA    . ASP A  1 70  ? 87.592  140.001 -123.589 1.00 39.56  ? 70   ASP A CA    1 
ATOM   498   C C     . ASP A  1 70  ? 87.888  138.750 -124.431 1.00 37.58  ? 70   ASP A C     1 
ATOM   499   O O     . ASP A  1 70  ? 89.038  138.484 -124.767 1.00 36.80  ? 70   ASP A O     1 
ATOM   500   C CB    . ASP A  1 70  ? 87.144  139.584 -122.188 1.00 39.60  ? 70   ASP A CB    1 
ATOM   501   C CG    . ASP A  1 70  ? 88.113  138.612 -121.551 1.00 39.00  ? 70   ASP A CG    1 
ATOM   502   O OD1   . ASP A  1 70  ? 89.073  139.053 -120.893 1.00 39.46  ? 70   ASP A OD1   1 
ATOM   503   O OD2   . ASP A  1 70  ? 87.937  137.397 -121.738 1.00 39.49  ? 70   ASP A OD2   1 
ATOM   504   N N     . PHE A  1 71  ? 86.874  137.969 -124.757 1.00 36.44  ? 71   PHE A N     1 
ATOM   505   C CA    . PHE A  1 71  ? 87.132  136.765 -125.549 1.00 37.51  ? 71   PHE A CA    1 
ATOM   506   C C     . PHE A  1 71  ? 87.714  137.138 -126.901 1.00 36.80  ? 71   PHE A C     1 
ATOM   507   O O     . PHE A  1 71  ? 88.624  136.472 -127.394 1.00 35.49  ? 71   PHE A O     1 
ATOM   508   C CB    . PHE A  1 71  ? 85.847  135.943 -125.721 1.00 36.95  ? 71   PHE A CB    1 
ATOM   509   C CG    . PHE A  1 71  ? 85.599  134.962 -124.599 1.00 39.29  ? 71   PHE A CG    1 
ATOM   510   C CD1   . PHE A  1 71  ? 86.110  135.198 -123.324 1.00 38.78  ? 71   PHE A CD1   1 
ATOM   511   C CD2   . PHE A  1 71  ? 84.850  133.808 -124.817 1.00 39.52  ? 71   PHE A CD2   1 
ATOM   512   C CE1   . PHE A  1 71  ? 85.876  134.292 -122.270 1.00 40.33  ? 71   PHE A CE1   1 
ATOM   513   C CE2   . PHE A  1 71  ? 84.607  132.897 -123.777 1.00 41.44  ? 71   PHE A CE2   1 
ATOM   514   C CZ    . PHE A  1 71  ? 85.123  133.143 -122.500 1.00 40.25  ? 71   PHE A CZ    1 
ATOM   515   N N     . ALA A  1 72  ? 87.210  138.225 -127.480 1.00 36.62  ? 72   ALA A N     1 
ATOM   516   C CA    . ALA A  1 72  ? 87.698  138.661 -128.777 1.00 37.36  ? 72   ALA A CA    1 
ATOM   517   C C     . ALA A  1 72  ? 89.194  138.878 -128.704 1.00 37.42  ? 72   ALA A C     1 
ATOM   518   O O     . ALA A  1 72  ? 89.922  138.529 -129.625 1.00 38.36  ? 72   ALA A O     1 
ATOM   519   C CB    . ALA A  1 72  ? 86.977  139.962 -129.213 1.00 38.04  ? 72   ALA A CB    1 
ATOM   520   N N     . SER A  1 73  ? 89.662  139.440 -127.592 1.00 38.00  ? 73   SER A N     1 
ATOM   521   C CA    . SER A  1 73  ? 91.095  139.706 -127.416 1.00 37.63  ? 73   SER A CA    1 
ATOM   522   C C     . SER A  1 73  ? 91.907  138.418 -127.267 1.00 37.12  ? 73   SER A C     1 
ATOM   523   O O     . SER A  1 73  ? 93.134  138.442 -127.330 1.00 35.52  ? 73   SER A O     1 
ATOM   524   C CB    . SER A  1 73  ? 91.334  140.583 -126.169 1.00 39.49  ? 73   SER A CB    1 
ATOM   525   O OG    . SER A  1 73  ? 91.124  139.853 -124.960 1.00 37.11  ? 73   SER A OG    1 
ATOM   526   N N     . ARG A  1 74  ? 91.229  137.295 -127.064 1.00 36.59  ? 74   ARG A N     1 
ATOM   527   C CA    . ARG A  1 74  ? 91.946  136.036 -126.883 1.00 37.77  ? 74   ARG A CA    1 
ATOM   528   C C     . ARG A  1 74  ? 91.871  135.123 -128.096 1.00 37.59  ? 74   ARG A C     1 
ATOM   529   O O     . ARG A  1 74  ? 92.265  133.955 -128.017 1.00 37.42  ? 74   ARG A O     1 
ATOM   530   C CB    . ARG A  1 74  ? 91.389  135.285 -125.674 1.00 38.71  ? 74   ARG A CB    1 
ATOM   531   C CG    . ARG A  1 74  ? 91.581  135.991 -124.357 1.00 40.53  ? 74   ARG A CG    1 
ATOM   532   C CD    . ARG A  1 74  ? 90.770  135.286 -123.297 1.00 41.60  ? 74   ARG A CD    1 
ATOM   533   N NE    . ARG A  1 74  ? 90.595  136.126 -122.120 1.00 43.47  ? 74   ARG A NE    1 
ATOM   534   C CZ    . ARG A  1 74  ? 91.502  136.278 -121.160 1.00 43.63  ? 74   ARG A CZ    1 
ATOM   535   N NH1   . ARG A  1 74  ? 92.661  135.643 -121.225 1.00 43.49  ? 74   ARG A NH1   1 
ATOM   536   N NH2   . ARG A  1 74  ? 91.239  137.065 -120.129 1.00 45.15  ? 74   ARG A NH2   1 
ATOM   537   N N     . GLY A  1 75  ? 91.351  135.648 -129.205 1.00 37.44  ? 75   GLY A N     1 
ATOM   538   C CA    . GLY A  1 75  ? 91.221  134.853 -130.410 1.00 36.23  ? 75   GLY A CA    1 
ATOM   539   C C     . GLY A  1 75  ? 89.980  133.975 -130.401 1.00 36.65  ? 75   GLY A C     1 
ATOM   540   O O     . GLY A  1 75  ? 89.890  133.018 -131.159 1.00 35.34  ? 75   GLY A O     1 
ATOM   541   N N     . ILE A  1 76  ? 89.022  134.295 -129.538 1.00 36.50  ? 76   ILE A N     1 
ATOM   542   C CA    . ILE A  1 76  ? 87.793  133.523 -129.455 1.00 38.77  ? 76   ILE A CA    1 
ATOM   543   C C     . ILE A  1 76  ? 86.741  134.379 -130.131 1.00 40.54  ? 76   ILE A C     1 
ATOM   544   O O     . ILE A  1 76  ? 86.060  135.180 -129.509 1.00 39.90  ? 76   ILE A O     1 
ATOM   545   C CB    . ILE A  1 76  ? 87.419  133.236 -127.988 1.00 36.89  ? 76   ILE A CB    1 
ATOM   546   C CG1   . ILE A  1 76  ? 88.557  132.463 -127.313 1.00 36.07  ? 76   ILE A CG1   1 
ATOM   547   C CG2   . ILE A  1 76  ? 86.153  132.429 -127.926 1.00 36.96  ? 76   ILE A CG2   1 
ATOM   548   C CD1   . ILE A  1 76  ? 88.383  132.293 -125.815 1.00 36.03  ? 76   ILE A CD1   1 
ATOM   549   N N     . GLU A  1 77  ? 86.626  134.198 -131.435 1.00 44.69  ? 77   GLU A N     1 
ATOM   550   C CA    . GLU A  1 77  ? 85.710  134.989 -132.230 1.00 47.28  ? 77   GLU A CA    1 
ATOM   551   C C     . GLU A  1 77  ? 84.305  134.449 -132.374 1.00 48.58  ? 77   GLU A C     1 
ATOM   552   O O     . GLU A  1 77  ? 84.093  133.324 -132.808 1.00 47.55  ? 77   GLU A O     1 
ATOM   553   C CB    . GLU A  1 77  ? 86.351  135.237 -133.592 1.00 48.72  ? 77   GLU A CB    1 
ATOM   554   C CG    . GLU A  1 77  ? 87.482  136.259 -133.505 1.00 50.73  ? 77   GLU A CG    1 
ATOM   555   C CD    . GLU A  1 77  ? 88.451  136.196 -134.674 1.00 52.12  ? 77   GLU A CD    1 
ATOM   556   O OE1   . GLU A  1 77  ? 88.151  135.511 -135.679 1.00 52.46  ? 77   GLU A OE1   1 
ATOM   557   O OE2   . GLU A  1 77  ? 89.522  136.841 -134.587 1.00 51.75  ? 77   GLU A OE2   1 
ATOM   558   N N     . MET A  1 78  ? 83.349  135.288 -131.987 1.00 51.87  ? 78   MET A N     1 
ATOM   559   C CA    . MET A  1 78  ? 81.935  134.958 -132.042 1.00 54.38  ? 78   MET A CA    1 
ATOM   560   C C     . MET A  1 78  ? 81.116  135.840 -132.968 1.00 56.12  ? 78   MET A C     1 
ATOM   561   O O     . MET A  1 78  ? 81.335  137.054 -133.082 1.00 56.55  ? 78   MET A O     1 
ATOM   562   C CB    . MET A  1 78  ? 81.309  135.035 -130.656 1.00 55.28  ? 78   MET A CB    1 
ATOM   563   C CG    . MET A  1 78  ? 81.370  133.739 -129.879 1.00 57.76  ? 78   MET A CG    1 
ATOM   564   S SD    . MET A  1 78  ? 82.559  133.808 -128.543 1.00 58.30  ? 78   MET A SD    1 
ATOM   565   C CE    . MET A  1 78  ? 81.904  135.132 -127.565 1.00 57.59  ? 78   MET A CE    1 
ATOM   566   N N     . SER A  1 79  ? 80.147  135.194 -133.606 1.00 57.51  ? 79   SER A N     1 
ATOM   567   C CA    . SER A  1 79  ? 79.225  135.835 -134.520 1.00 58.35  ? 79   SER A CA    1 
ATOM   568   C C     . SER A  1 79  ? 78.367  136.912 -133.817 1.00 57.85  ? 79   SER A C     1 
ATOM   569   O O     . SER A  1 79  ? 78.610  138.114 -133.970 1.00 59.31  ? 79   SER A O     1 
ATOM   570   C CB    . SER A  1 79  ? 78.338  134.752 -135.151 1.00 59.40  ? 79   SER A CB    1 
ATOM   571   O OG    . SER A  1 79  ? 77.982  133.762 -134.193 1.00 60.91  ? 79   SER A OG    1 
ATOM   572   N N     . GLU A  1 80  ? 77.375  136.480 -133.045 1.00 56.17  ? 80   GLU A N     1 
ATOM   573   C CA    . GLU A  1 80  ? 76.484  137.397 -132.336 1.00 55.25  ? 80   GLU A CA    1 
ATOM   574   C C     . GLU A  1 80  ? 76.213  136.826 -130.950 1.00 53.30  ? 80   GLU A C     1 
ATOM   575   O O     . GLU A  1 80  ? 75.456  135.870 -130.817 1.00 54.72  ? 80   GLU A O     1 
ATOM   576   C CB    . GLU A  1 80  ? 75.166  137.539 -133.122 1.00 56.71  ? 80   GLU A CB    1 
ATOM   577   C CG    . GLU A  1 80  ? 73.928  137.968 -132.309 1.00 60.16  ? 80   GLU A CG    1 
ATOM   578   C CD    . GLU A  1 80  ? 72.605  137.667 -133.038 1.00 61.51  ? 80   GLU A CD    1 
ATOM   579   O OE1   . GLU A  1 80  ? 72.248  138.418 -133.977 1.00 63.61  ? 80   GLU A OE1   1 
ATOM   580   O OE2   . GLU A  1 80  ? 71.931  136.671 -132.680 1.00 61.16  ? 80   GLU A OE2   1 
ATOM   581   N N     . VAL A  1 81  ? 76.832  137.383 -129.915 1.00 50.65  ? 81   VAL A N     1 
ATOM   582   C CA    . VAL A  1 81  ? 76.590  136.873 -128.561 1.00 47.32  ? 81   VAL A CA    1 
ATOM   583   C C     . VAL A  1 81  ? 75.227  137.372 -128.124 1.00 45.23  ? 81   VAL A C     1 
ATOM   584   O O     . VAL A  1 81  ? 74.970  138.570 -128.169 1.00 45.57  ? 81   VAL A O     1 
ATOM   585   C CB    . VAL A  1 81  ? 77.655  137.367 -127.549 1.00 46.28  ? 81   VAL A CB    1 
ATOM   586   C CG1   . VAL A  1 81  ? 77.409  136.746 -126.190 1.00 46.14  ? 81   VAL A CG1   1 
ATOM   587   C CG2   . VAL A  1 81  ? 79.036  137.014 -128.029 1.00 47.01  ? 81   VAL A CG2   1 
ATOM   588   N N     . ARG A  1 82  ? 74.366  136.451 -127.699 1.00 44.43  ? 82   ARG A N     1 
ATOM   589   C CA    . ARG A  1 82  ? 73.007  136.779 -127.261 1.00 44.14  ? 82   ARG A CA    1 
ATOM   590   C C     . ARG A  1 82  ? 72.674  136.264 -125.843 1.00 42.05  ? 82   ARG A C     1 
ATOM   591   O O     . ARG A  1 82  ? 73.148  135.216 -125.416 1.00 40.51  ? 82   ARG A O     1 
ATOM   592   C CB    . ARG A  1 82  ? 71.976  136.200 -128.261 1.00 46.95  ? 82   ARG A CB    1 
ATOM   593   C CG    . ARG A  1 82  ? 70.543  136.742 -128.091 1.00 53.20  ? 82   ARG A CG    1 
ATOM   594   C CD    . ARG A  1 82  ? 69.483  136.025 -129.000 1.00 59.09  ? 82   ARG A CD    1 
ATOM   595   N NE    . ARG A  1 82  ? 68.687  134.991 -128.307 1.00 61.67  ? 82   ARG A NE    1 
ATOM   596   C CZ    . ARG A  1 82  ? 67.725  135.232 -127.406 1.00 63.40  ? 82   ARG A CZ    1 
ATOM   597   N NH1   . ARG A  1 82  ? 67.414  136.481 -127.069 1.00 63.58  ? 82   ARG A NH1   1 
ATOM   598   N NH2   . ARG A  1 82  ? 67.073  134.219 -126.829 1.00 63.22  ? 82   ARG A NH2   1 
ATOM   599   N N     . LEU A  1 83  ? 71.820  137.005 -125.142 1.00 40.68  ? 83   LEU A N     1 
ATOM   600   C CA    . LEU A  1 83  ? 71.383  136.653 -123.801 1.00 38.55  ? 83   LEU A CA    1 
ATOM   601   C C     . LEU A  1 83  ? 70.042  135.929 -123.776 1.00 38.83  ? 83   LEU A C     1 
ATOM   602   O O     . LEU A  1 83  ? 69.012  136.474 -124.196 1.00 37.62  ? 83   LEU A O     1 
ATOM   603   C CB    . LEU A  1 83  ? 71.249  137.900 -122.931 1.00 38.02  ? 83   LEU A CB    1 
ATOM   604   C CG    . LEU A  1 83  ? 70.656  137.643 -121.537 1.00 37.50  ? 83   LEU A CG    1 
ATOM   605   C CD1   . LEU A  1 83  ? 71.564  136.675 -120.742 1.00 36.44  ? 83   LEU A CD1   1 
ATOM   606   C CD2   . LEU A  1 83  ? 70.531  138.956 -120.812 1.00 36.30  ? 83   LEU A CD2   1 
ATOM   607   N N     . ASN A  1 84  ? 70.060  134.696 -123.288 1.00 37.29  ? 84   ASN A N     1 
ATOM   608   C CA    . ASN A  1 84  ? 68.837  133.933 -123.144 1.00 36.90  ? 84   ASN A CA    1 
ATOM   609   C C     . ASN A  1 84  ? 68.592  133.989 -121.630 1.00 38.04  ? 84   ASN A C     1 
ATOM   610   O O     . ASN A  1 84  ? 69.025  133.095 -120.880 1.00 37.48  ? 84   ASN A O     1 
ATOM   611   C CB    . ASN A  1 84  ? 69.048  132.489 -123.592 1.00 35.13  ? 84   ASN A CB    1 
ATOM   612   C CG    . ASN A  1 84  ? 67.822  131.659 -123.413 1.00 34.75  ? 84   ASN A CG    1 
ATOM   613   O OD1   . ASN A  1 84  ? 66.942  132.011 -122.644 1.00 35.10  ? 84   ASN A OD1   1 
ATOM   614   N ND2   . ASN A  1 84  ? 67.756  130.529 -124.109 1.00 36.82  ? 84   ASN A ND2   1 
ATOM   615   N N     . LEU A  1 85  ? 67.912  135.038 -121.185 1.00 37.01  ? 85   LEU A N     1 
ATOM   616   C CA    . LEU A  1 85  ? 67.658  135.211 -119.769 1.00 38.41  ? 85   LEU A CA    1 
ATOM   617   C C     . LEU A  1 85  ? 66.959  134.020 -119.137 1.00 39.70  ? 85   LEU A C     1 
ATOM   618   O O     . LEU A  1 85  ? 67.219  133.678 -117.979 1.00 39.99  ? 85   LEU A O     1 
ATOM   619   C CB    . LEU A  1 85  ? 66.852  136.478 -119.509 1.00 37.13  ? 85   LEU A CB    1 
ATOM   620   C CG    . LEU A  1 85  ? 66.784  136.781 -118.008 1.00 37.11  ? 85   LEU A CG    1 
ATOM   621   C CD1   . LEU A  1 85  ? 68.196  137.100 -117.519 1.00 37.28  ? 85   LEU A CD1   1 
ATOM   622   C CD2   . LEU A  1 85  ? 65.852  137.950 -117.736 1.00 35.74  ? 85   LEU A CD2   1 
ATOM   623   N N     . ASP A  1 86  ? 66.071  133.379 -119.889 1.00 40.07  ? 86   ASP A N     1 
ATOM   624   C CA    . ASP A  1 86  ? 65.368  132.222 -119.363 1.00 40.61  ? 86   ASP A CA    1 
ATOM   625   C C     . ASP A  1 86  ? 66.342  131.081 -119.034 1.00 38.94  ? 86   ASP A C     1 
ATOM   626   O O     . ASP A  1 86  ? 66.263  130.481 -117.965 1.00 35.92  ? 86   ASP A O     1 
ATOM   627   C CB    . ASP A  1 86  ? 64.324  131.718 -120.365 1.00 45.60  ? 86   ASP A CB    1 
ATOM   628   C CG    . ASP A  1 86  ? 63.153  132.681 -120.541 1.00 48.59  ? 86   ASP A CG    1 
ATOM   629   O OD1   . ASP A  1 86  ? 63.070  133.704 -119.818 1.00 51.09  ? 86   ASP A OD1   1 
ATOM   630   O OD2   . ASP A  1 86  ? 62.310  132.398 -121.415 1.00 50.04  ? 86   ASP A OD2   1 
ATOM   631   N N     . LYS A  1 87  ? 67.246  130.789 -119.963 1.00 37.46  ? 87   LYS A N     1 
ATOM   632   C CA    . LYS A  1 87  ? 68.221  129.728 -119.776 1.00 37.86  ? 87   LYS A CA    1 
ATOM   633   C C     . LYS A  1 87  ? 69.168  130.046 -118.602 1.00 36.87  ? 87   LYS A C     1 
ATOM   634   O O     . LYS A  1 87  ? 69.486  129.173 -117.782 1.00 35.84  ? 87   LYS A O     1 
ATOM   635   C CB    . LYS A  1 87  ? 69.009  129.527 -121.077 1.00 39.41  ? 87   LYS A CB    1 
ATOM   636   C CG    . LYS A  1 87  ? 70.266  128.683 -120.943 1.00 42.57  ? 87   LYS A CG    1 
ATOM   637   C CD    . LYS A  1 87  ? 69.973  127.272 -120.439 1.00 46.27  ? 87   LYS A CD    1 
ATOM   638   C CE    . LYS A  1 87  ? 69.086  126.503 -121.397 1.00 45.84  ? 87   LYS A CE    1 
ATOM   639   N NZ    . LYS A  1 87  ? 68.996  125.069 -120.981 1.00 49.40  ? 87   LYS A NZ    1 
ATOM   640   N N     . MET A  1 88  ? 69.610  131.296 -118.525 1.00 34.24  ? 88   MET A N     1 
ATOM   641   C CA    . MET A  1 88  ? 70.494  131.702 -117.453 1.00 35.16  ? 88   MET A CA    1 
ATOM   642   C C     . MET A  1 88  ? 69.817  131.575 -116.083 1.00 33.96  ? 88   MET A C     1 
ATOM   643   O O     . MET A  1 88  ? 70.469  131.213 -115.105 1.00 33.14  ? 88   MET A O     1 
ATOM   644   C CB    . MET A  1 88  ? 70.994  133.138 -117.668 1.00 35.52  ? 88   MET A CB    1 
ATOM   645   C CG    . MET A  1 88  ? 72.037  133.587 -116.633 1.00 34.94  ? 88   MET A CG    1 
ATOM   646   S SD    . MET A  1 88  ? 72.919  135.073 -117.197 1.00 37.10  ? 88   MET A SD    1 
ATOM   647   C CE    . MET A  1 88  ? 71.926  136.131 -116.688 1.00 34.61  ? 88   MET A CE    1 
ATOM   648   N N     . MET A  1 89  ? 68.524  131.874 -116.017 1.00 32.05  ? 89   MET A N     1 
ATOM   649   C CA    . MET A  1 89  ? 67.788  131.774 -114.765 1.00 31.60  ? 89   MET A CA    1 
ATOM   650   C C     . MET A  1 89  ? 67.617  130.327 -114.368 1.00 32.31  ? 89   MET A C     1 
ATOM   651   O O     . MET A  1 89  ? 67.523  130.007 -113.175 1.00 30.48  ? 89   MET A O     1 
ATOM   652   C CB    . MET A  1 89  ? 66.404  132.427 -114.876 1.00 30.43  ? 89   MET A CB    1 
ATOM   653   C CG    . MET A  1 89  ? 66.459  133.933 -114.820 1.00 28.46  ? 89   MET A CG    1 
ATOM   654   S SD    . MET A  1 89  ? 67.014  134.508 -113.164 1.00 29.45  ? 89   MET A SD    1 
ATOM   655   C CE    . MET A  1 89  ? 67.343  136.242 -113.486 1.00 27.86  ? 89   MET A CE    1 
ATOM   656   N N     . GLU A  1 90  ? 67.578  129.468 -115.386 1.00 32.60  ? 90   GLU A N     1 
ATOM   657   C CA    . GLU A  1 90  ? 67.428  128.026 -115.232 1.00 33.79  ? 90   GLU A CA    1 
ATOM   658   C C     . GLU A  1 90  ? 68.678  127.421 -114.589 1.00 32.15  ? 90   GLU A C     1 
ATOM   659   O O     . GLU A  1 90  ? 68.590  126.542 -113.730 1.00 31.18  ? 90   GLU A O     1 
ATOM   660   C CB    . GLU A  1 90  ? 67.215  127.389 -116.612 1.00 35.23  ? 90   GLU A CB    1 
ATOM   661   C CG    . GLU A  1 90  ? 67.130  125.879 -116.603 1.00 39.74  ? 90   GLU A CG    1 
ATOM   662   C CD    . GLU A  1 90  ? 67.165  125.307 -118.013 1.00 44.55  ? 90   GLU A CD    1 
ATOM   663   O OE1   . GLU A  1 90  ? 66.276  125.648 -118.831 1.00 46.13  ? 90   GLU A OE1   1 
ATOM   664   O OE2   . GLU A  1 90  ? 68.090  124.522 -118.312 1.00 47.86  ? 90   GLU A OE2   1 
ATOM   665   N N     . GLN A  1 91  ? 69.842  127.876 -115.040 1.00 30.57  ? 91   GLN A N     1 
ATOM   666   C CA    . GLN A  1 91  ? 71.099  127.391 -114.492 1.00 30.12  ? 91   GLN A CA    1 
ATOM   667   C C     . GLN A  1 91  ? 71.123  127.734 -112.981 1.00 29.42  ? 91   GLN A C     1 
ATOM   668   O O     . GLN A  1 91  ? 71.480  126.910 -112.140 1.00 27.36  ? 91   GLN A O     1 
ATOM   669   C CB    . GLN A  1 91  ? 72.259  128.071 -115.219 1.00 30.22  ? 91   GLN A CB    1 
ATOM   670   C CG    . GLN A  1 91  ? 73.671  127.603 -114.844 1.00 30.68  ? 91   GLN A CG    1 
ATOM   671   C CD    . GLN A  1 91  ? 74.096  128.019 -113.437 1.00 32.53  ? 91   GLN A CD    1 
ATOM   672   O OE1   . GLN A  1 91  ? 73.851  129.153 -113.004 1.00 28.04  ? 91   GLN A OE1   1 
ATOM   673   N NE2   . GLN A  1 91  ? 74.752  127.094 -112.714 1.00 33.59  ? 91   GLN A NE2   1 
ATOM   674   N N     . LYS A  1 92  ? 70.706  128.954 -112.667 1.00 29.29  ? 92   LYS A N     1 
ATOM   675   C CA    . LYS A  1 92  ? 70.655  129.449 -111.301 1.00 30.35  ? 92   LYS A CA    1 
ATOM   676   C C     . LYS A  1 92  ? 69.736  128.563 -110.454 1.00 31.85  ? 92   LYS A C     1 
ATOM   677   O O     . LYS A  1 92  ? 70.065  128.167 -109.339 1.00 32.31  ? 92   LYS A O     1 
ATOM   678   C CB    . LYS A  1 92  ? 70.137  130.897 -111.303 1.00 29.47  ? 92   LYS A CB    1 
ATOM   679   C CG    . LYS A  1 92  ? 69.762  131.450 -109.924 1.00 28.92  ? 92   LYS A CG    1 
ATOM   680   C CD    . LYS A  1 92  ? 68.735  132.584 -110.005 1.00 30.47  ? 92   LYS A CD    1 
ATOM   681   C CE    . LYS A  1 92  ? 67.332  132.063 -110.346 1.00 32.01  ? 92   LYS A CE    1 
ATOM   682   N NZ    . LYS A  1 92  ? 66.281  133.056 -109.997 1.00 32.44  ? 92   LYS A NZ    1 
ATOM   683   N N     . SER A  1 93  ? 68.576  128.254 -111.013 1.00 32.96  ? 93   SER A N     1 
ATOM   684   C CA    . SER A  1 93  ? 67.577  127.435 -110.354 1.00 33.20  ? 93   SER A CA    1 
ATOM   685   C C     . SER A  1 93  ? 67.987  125.984 -110.176 1.00 31.67  ? 93   SER A C     1 
ATOM   686   O O     . SER A  1 93  ? 67.651  125.358 -109.172 1.00 30.35  ? 93   SER A O     1 
ATOM   687   C CB    . SER A  1 93  ? 66.268  127.489 -111.149 1.00 37.09  ? 93   SER A CB    1 
ATOM   688   O OG    . SER A  1 93  ? 65.595  128.712 -110.929 1.00 39.82  ? 93   SER A OG    1 
ATOM   689   N N     . THR A  1 94  ? 68.677  125.445 -111.166 1.00 31.30  ? 94   THR A N     1 
ATOM   690   C CA    . THR A  1 94  ? 69.119  124.063 -111.089 1.00 33.46  ? 94   THR A CA    1 
ATOM   691   C C     . THR A  1 94  ? 70.069  123.885 -109.909 1.00 32.34  ? 94   THR A C     1 
ATOM   692   O O     . THR A  1 94  ? 70.085  122.834 -109.260 1.00 32.92  ? 94   THR A O     1 
ATOM   693   C CB    . THR A  1 94  ? 69.851  123.652 -112.376 1.00 34.04  ? 94   THR A CB    1 
ATOM   694   O OG1   . THR A  1 94  ? 68.900  123.584 -113.441 1.00 37.53  ? 94   THR A OG1   1 
ATOM   695   C CG2   . THR A  1 94  ? 70.538  122.299 -112.210 1.00 35.20  ? 94   THR A CG2   1 
ATOM   696   N N     . ALA A  1 95  ? 70.866  124.917 -109.657 1.00 31.80  ? 95   ALA A N     1 
ATOM   697   C CA    . ALA A  1 95  ? 71.835  124.870 -108.574 1.00 31.39  ? 95   ALA A CA    1 
ATOM   698   C C     . ALA A  1 95  ? 71.116  124.923 -107.237 1.00 30.68  ? 95   ALA A C     1 
ATOM   699   O O     . ALA A  1 95  ? 71.405  124.120 -106.347 1.00 29.37  ? 95   ALA A O     1 
ATOM   700   C CB    . ALA A  1 95  ? 72.845  126.020 -108.695 1.00 30.92  ? 95   ALA A CB    1 
ATOM   701   N N     . VAL A  1 96  ? 70.169  125.853 -107.112 1.00 29.69  ? 96   VAL A N     1 
ATOM   702   C CA    . VAL A  1 96  ? 69.400  125.993 -105.888 1.00 30.77  ? 96   VAL A CA    1 
ATOM   703   C C     . VAL A  1 96  ? 68.631  124.707 -105.559 1.00 33.02  ? 96   VAL A C     1 
ATOM   704   O O     . VAL A  1 96  ? 68.528  124.308 -104.393 1.00 33.05  ? 96   VAL A O     1 
ATOM   705   C CB    . VAL A  1 96  ? 68.400  127.185 -105.989 1.00 31.35  ? 96   VAL A CB    1 
ATOM   706   C CG1   . VAL A  1 96  ? 67.507  127.258 -104.740 1.00 27.87  ? 96   VAL A CG1   1 
ATOM   707   C CG2   . VAL A  1 96  ? 69.186  128.487 -106.200 1.00 29.77  ? 96   VAL A CG2   1 
ATOM   708   N N     . LYS A  1 97  ? 68.089  124.054 -106.581 1.00 32.84  ? 97   LYS A N     1 
ATOM   709   C CA    . LYS A  1 97  ? 67.328  122.824 -106.360 1.00 33.59  ? 97   LYS A CA    1 
ATOM   710   C C     . LYS A  1 97  ? 68.254  121.691 -105.927 1.00 32.83  ? 97   LYS A C     1 
ATOM   711   O O     . LYS A  1 97  ? 67.959  120.930 -105.005 1.00 33.26  ? 97   LYS A O     1 
ATOM   712   C CB    . LYS A  1 97  ? 66.576  122.404 -107.630 1.00 35.29  ? 97   LYS A CB    1 
ATOM   713   C CG    . LYS A  1 97  ? 65.597  121.255 -107.381 1.00 38.14  ? 97   LYS A CG    1 
ATOM   714   C CD    . LYS A  1 97  ? 64.949  120.781 -108.682 1.00 41.01  ? 97   LYS A CD    1 
ATOM   715   C CE    . LYS A  1 97  ? 64.199  119.468 -108.458 1.00 42.40  ? 97   LYS A CE    1 
ATOM   716   N NZ    . LYS A  1 97  ? 63.696  118.918 -109.751 1.00 44.30  ? 97   LYS A NZ    1 
ATOM   717   N N     . ALA A  1 98  ? 69.380  121.576 -106.598 1.00 32.21  ? 98   ALA A N     1 
ATOM   718   C CA    . ALA A  1 98  ? 70.324  120.540 -106.250 1.00 32.39  ? 98   ALA A CA    1 
ATOM   719   C C     . ALA A  1 98  ? 70.807  120.707 -104.795 1.00 32.79  ? 98   ALA A C     1 
ATOM   720   O O     . ALA A  1 98  ? 70.764  119.753 -104.009 1.00 31.63  ? 98   ALA A O     1 
ATOM   721   C CB    . ALA A  1 98  ? 71.490  120.573 -107.219 1.00 31.15  ? 98   ALA A CB    1 
ATOM   722   N N     . LEU A  1 99  ? 71.256  121.910 -104.430 1.00 31.36  ? 99   LEU A N     1 
ATOM   723   C CA    . LEU A  1 99  ? 71.762  122.127 -103.077 1.00 31.76  ? 99   LEU A CA    1 
ATOM   724   C C     . LEU A  1 99  ? 70.726  121.962 -101.975 1.00 31.62  ? 99   LEU A C     1 
ATOM   725   O O     . LEU A  1 99  ? 71.053  121.418 -100.915 1.00 30.86  ? 99   LEU A O     1 
ATOM   726   C CB    . LEU A  1 99  ? 72.462  123.495 -102.962 1.00 30.38  ? 99   LEU A CB    1 
ATOM   727   C CG    . LEU A  1 99  ? 73.826  123.513 -103.676 1.00 29.66  ? 99   LEU A CG    1 
ATOM   728   C CD1   . LEU A  1 99  ? 74.371  124.906 -103.693 1.00 28.50  ? 99   LEU A CD1   1 
ATOM   729   C CD2   . LEU A  1 99  ? 74.803  122.571 -102.970 1.00 28.41  ? 99   LEU A CD2   1 
ATOM   730   N N     . THR A  1 100 ? 69.489  122.416 -102.211 1.00 31.83  ? 100  THR A N     1 
ATOM   731   C CA    . THR A  1 100 ? 68.425  122.283 -101.211 1.00 31.30  ? 100  THR A CA    1 
ATOM   732   C C     . THR A  1 100 ? 68.060  120.808 -101.021 1.00 31.79  ? 100  THR A C     1 
ATOM   733   O O     . THR A  1 100 ? 67.750  120.375 -99.907  1.00 30.61  ? 100  THR A O     1 
ATOM   734   C CB    . THR A  1 100 ? 67.144  123.062 -101.602 1.00 32.58  ? 100  THR A CB    1 
ATOM   735   O OG1   . THR A  1 100 ? 66.761  122.709 -102.936 1.00 33.37  ? 100  THR A OG1   1 
ATOM   736   C CG2   . THR A  1 100 ? 67.377  124.577 -101.500 1.00 32.91  ? 100  THR A CG2   1 
ATOM   737   N N     . GLY A  1 101 ? 68.125  120.045 -102.111 1.00 30.84  ? 101  GLY A N     1 
ATOM   738   C CA    . GLY A  1 101 ? 67.813  118.636 -102.052 1.00 31.14  ? 101  GLY A CA    1 
ATOM   739   C C     . GLY A  1 101 ? 68.920  117.913 -101.336 1.00 29.66  ? 101  GLY A C     1 
ATOM   740   O O     . GLY A  1 101 ? 68.714  116.872 -100.730 1.00 31.14  ? 101  GLY A O     1 
ATOM   741   N N     . GLY A  1 102 ? 70.107  118.495 -101.423 1.00 30.51  ? 102  GLY A N     1 
ATOM   742   C CA    . GLY A  1 102 ? 71.270  117.929 -100.787 1.00 26.67  ? 102  GLY A CA    1 
ATOM   743   C C     . GLY A  1 102 ? 71.121  117.987 -99.280  1.00 25.75  ? 102  GLY A C     1 
ATOM   744   O O     . GLY A  1 102 ? 71.492  117.045 -98.599  1.00 25.98  ? 102  GLY A O     1 
ATOM   745   N N     . ILE A  1 103 ? 70.576  119.081 -98.759  1.00 23.69  ? 103  ILE A N     1 
ATOM   746   C CA    . ILE A  1 103 ? 70.418  119.192 -97.317  1.00 23.16  ? 103  ILE A CA    1 
ATOM   747   C C     . ILE A  1 103 ? 69.470  118.107 -96.810  1.00 23.23  ? 103  ILE A C     1 
ATOM   748   O O     . ILE A  1 103 ? 69.717  117.516 -95.750  1.00 21.90  ? 103  ILE A O     1 
ATOM   749   C CB    . ILE A  1 103 ? 69.883  120.595 -96.896  1.00 23.29  ? 103  ILE A CB    1 
ATOM   750   C CG1   . ILE A  1 103 ? 70.880  121.682 -97.332  1.00 24.64  ? 103  ILE A CG1   1 
ATOM   751   C CG2   . ILE A  1 103 ? 69.632  120.637 -95.396  1.00 21.84  ? 103  ILE A CG2   1 
ATOM   752   C CD1   . ILE A  1 103 ? 70.455  123.095 -96.896  1.00 27.31  ? 103  ILE A CD1   1 
ATOM   753   N N     . ALA A  1 104 ? 68.387  117.858 -97.562  1.00 23.17  ? 104  ALA A N     1 
ATOM   754   C CA    . ALA A  1 104 ? 67.405  116.838 -97.200  1.00 21.74  ? 104  ALA A CA    1 
ATOM   755   C C     . ALA A  1 104 ? 68.082  115.473 -97.092  1.00 22.92  ? 104  ALA A C     1 
ATOM   756   O O     . ALA A  1 104 ? 67.794  114.711 -96.178  1.00 22.03  ? 104  ALA A O     1 
ATOM   757   C CB    . ALA A  1 104 ? 66.260  116.779 -98.254  1.00 22.00  ? 104  ALA A CB    1 
ATOM   758   N N     A HIS A  1 105 ? 68.964  115.162 -98.036  0.50 24.84  ? 105  HIS A N     1 
ATOM   759   N N     B HIS A  1 105 ? 68.968  115.172 -98.037  0.50 24.85  ? 105  HIS A N     1 
ATOM   760   C CA    A HIS A  1 105 ? 69.685  113.897 -98.019  0.50 28.36  ? 105  HIS A CA    1 
ATOM   761   C CA    B HIS A  1 105 ? 69.688  113.905 -98.009  0.50 28.40  ? 105  HIS A CA    1 
ATOM   762   C C     A HIS A  1 105 ? 70.651  113.835 -96.813  0.50 27.55  ? 105  HIS A C     1 
ATOM   763   C C     B HIS A  1 105 ? 70.657  113.835 -96.818  0.50 27.55  ? 105  HIS A C     1 
ATOM   764   O O     A HIS A  1 105 ? 70.788  112.789 -96.182  0.50 27.10  ? 105  HIS A O     1 
ATOM   765   O O     B HIS A  1 105 ? 70.791  112.789 -96.187  0.50 27.11  ? 105  HIS A O     1 
ATOM   766   C CB    A HIS A  1 105 ? 70.463  113.717 -99.322  0.50 33.18  ? 105  HIS A CB    1 
ATOM   767   C CB    B HIS A  1 105 ? 70.434  113.682 -99.317  0.50 33.25  ? 105  HIS A CB    1 
ATOM   768   C CG    A HIS A  1 105 ? 71.472  112.606 -99.267  0.50 37.99  ? 105  HIS A CG    1 
ATOM   769   C CG    B HIS A  1 105 ? 69.576  113.096 -100.396 0.50 38.42  ? 105  HIS A CG    1 
ATOM   770   N ND1   A HIS A  1 105 ? 71.137  111.278 -99.428  0.50 40.81  ? 105  HIS A ND1   1 
ATOM   771   N ND1   B HIS A  1 105 ? 68.744  113.860 -101.186 0.50 40.43  ? 105  HIS A ND1   1 
ATOM   772   C CD2   A HIS A  1 105 ? 72.799  112.623 -99.002  0.50 40.03  ? 105  HIS A CD2   1 
ATOM   773   C CD2   B HIS A  1 105 ? 69.412  111.816 -100.802 0.50 40.82  ? 105  HIS A CD2   1 
ATOM   774   C CE1   A HIS A  1 105 ? 72.211  110.531 -99.266  0.50 41.22  ? 105  HIS A CE1   1 
ATOM   775   C CE1   B HIS A  1 105 ? 68.110  113.075 -102.039 0.50 41.90  ? 105  HIS A CE1   1 
ATOM   776   N NE2   A HIS A  1 105 ? 73.233  111.323 -99.006  0.50 40.89  ? 105  HIS A NE2   1 
ATOM   777   N NE2   B HIS A  1 105 ? 68.498  111.831 -101.829 0.50 41.80  ? 105  HIS A NE2   1 
ATOM   778   N N     . LEU A  1 106 ? 71.317  114.947 -96.505  1.00 26.09  ? 106  LEU A N     1 
ATOM   779   C CA    . LEU A  1 106 ? 72.243  114.991 -95.361  1.00 24.83  ? 106  LEU A CA    1 
ATOM   780   C C     . LEU A  1 106 ? 71.465  114.810 -94.051  1.00 24.12  ? 106  LEU A C     1 
ATOM   781   O O     . LEU A  1 106 ? 71.955  114.192 -93.107  1.00 22.58  ? 106  LEU A O     1 
ATOM   782   C CB    . LEU A  1 106 ? 73.027  116.320 -95.325  1.00 23.83  ? 106  LEU A CB    1 
ATOM   783   C CG    . LEU A  1 106 ? 74.062  116.532 -96.433  1.00 22.39  ? 106  LEU A CG    1 
ATOM   784   C CD1   . LEU A  1 106 ? 74.551  117.970 -96.386  1.00 21.36  ? 106  LEU A CD1   1 
ATOM   785   C CD2   . LEU A  1 106 ? 75.254  115.505 -96.261  1.00 20.92  ? 106  LEU A CD2   1 
ATOM   786   N N     . PHE A  1 107 ? 70.243  115.332 -93.993  1.00 22.88  ? 107  PHE A N     1 
ATOM   787   C CA    . PHE A  1 107 ? 69.446  115.172 -92.771  1.00 22.63  ? 107  PHE A CA    1 
ATOM   788   C C     . PHE A  1 107 ? 69.136  113.691 -92.585  1.00 22.18  ? 107  PHE A C     1 
ATOM   789   O O     . PHE A  1 107 ? 69.181  113.152 -91.490  1.00 20.43  ? 107  PHE A O     1 
ATOM   790   C CB    . PHE A  1 107 ? 68.148  115.969 -92.867  1.00 19.03  ? 107  PHE A CB    1 
ATOM   791   C CG    . PHE A  1 107 ? 68.279  117.402 -92.440  1.00 18.38  ? 107  PHE A CG    1 
ATOM   792   C CD1   . PHE A  1 107 ? 69.519  117.932 -92.100  1.00 19.96  ? 107  PHE A CD1   1 
ATOM   793   C CD2   . PHE A  1 107 ? 67.141  118.207 -92.298  1.00 20.00  ? 107  PHE A CD2   1 
ATOM   794   C CE1   . PHE A  1 107 ? 69.626  119.249 -91.616  1.00 16.47  ? 107  PHE A CE1   1 
ATOM   795   C CE2   . PHE A  1 107 ? 67.227  119.503 -91.823  1.00 18.32  ? 107  PHE A CE2   1 
ATOM   796   C CZ    . PHE A  1 107 ? 68.479  120.026 -91.475  1.00 20.55  ? 107  PHE A CZ    1 
ATOM   797   N N     . LYS A  1 108 ? 68.827  113.033 -93.689  1.00 24.26  ? 108  LYS A N     1 
ATOM   798   C CA    . LYS A  1 108 ? 68.513  111.628 -93.644  1.00 25.12  ? 108  LYS A CA    1 
ATOM   799   C C     . LYS A  1 108 ? 69.721  110.793 -93.242  1.00 23.34  ? 108  LYS A C     1 
ATOM   800   O O     . LYS A  1 108 ? 69.611  109.934 -92.382  1.00 23.38  ? 108  LYS A O     1 
ATOM   801   C CB    . LYS A  1 108 ? 67.965  111.176 -94.999  1.00 28.12  ? 108  LYS A CB    1 
ATOM   802   C CG    . LYS A  1 108 ? 66.505  111.532 -95.135  1.00 32.22  ? 108  LYS A CG    1 
ATOM   803   C CD    . LYS A  1 108 ? 65.907  111.025 -96.422  1.00 35.90  ? 108  LYS A CD    1 
ATOM   804   C CE    . LYS A  1 108 ? 64.394  110.948 -96.284  1.00 39.50  ? 108  LYS A CE    1 
ATOM   805   N NZ    . LYS A  1 108 ? 63.740  110.340 -97.491  1.00 42.13  ? 108  LYS A NZ    1 
ATOM   806   N N     . GLN A  1 109 ? 70.861  111.070 -93.861  1.00 22.60  ? 109  GLN A N     1 
ATOM   807   C CA    . GLN A  1 109 ? 72.120  110.374 -93.596  1.00 22.37  ? 109  GLN A CA    1 
ATOM   808   C C     . GLN A  1 109 ? 72.546  110.465 -92.126  1.00 22.01  ? 109  GLN A C     1 
ATOM   809   O O     . GLN A  1 109 ? 73.098  109.506 -91.561  1.00 19.99  ? 109  GLN A O     1 
ATOM   810   C CB    . GLN A  1 109 ? 73.208  110.980 -94.486  1.00 22.34  ? 109  GLN A CB    1 
ATOM   811   C CG    . GLN A  1 109 ? 74.602  110.486 -94.205  1.00 22.62  ? 109  GLN A CG    1 
ATOM   812   C CD    . GLN A  1 109 ? 75.638  111.138 -95.115  1.00 23.49  ? 109  GLN A CD    1 
ATOM   813   O OE1   . GLN A  1 109 ? 75.467  111.201 -96.323  1.00 22.46  ? 109  GLN A OE1   1 
ATOM   814   N NE2   . GLN A  1 109 ? 76.725  111.606 -94.527  1.00 25.33  ? 109  GLN A NE2   1 
ATOM   815   N N     . ASN A  1 110 ? 72.265  111.622 -91.520  1.00 21.31  ? 110  ASN A N     1 
ATOM   816   C CA    . ASN A  1 110 ? 72.614  111.910 -90.134  1.00 21.34  ? 110  ASN A CA    1 
ATOM   817   C C     . ASN A  1 110 ? 71.535  111.698 -89.060  1.00 22.56  ? 110  ASN A C     1 
ATOM   818   O O     . ASN A  1 110 ? 71.760  111.993 -87.884  1.00 23.97  ? 110  ASN A O     1 
ATOM   819   C CB    . ASN A  1 110 ? 73.148  113.348 -90.057  1.00 20.53  ? 110  ASN A CB    1 
ATOM   820   C CG    . ASN A  1 110 ? 74.499  113.487 -90.722  1.00 20.88  ? 110  ASN A CG    1 
ATOM   821   O OD1   . ASN A  1 110 ? 75.530  113.147 -90.132  1.00 22.81  ? 110  ASN A OD1   1 
ATOM   822   N ND2   . ASN A  1 110 ? 74.507  113.953 -91.968  1.00 20.51  ? 110  ASN A ND2   1 
ATOM   823   N N     . LYS A  1 111 ? 70.383  111.177 -89.460  1.00 23.41  ? 111  LYS A N     1 
ATOM   824   C CA    . LYS A  1 111 ? 69.274  110.938 -88.540  1.00 24.43  ? 111  LYS A CA    1 
ATOM   825   C C     . LYS A  1 111 ? 68.555  112.199 -88.081  1.00 22.01  ? 111  LYS A C     1 
ATOM   826   O O     . LYS A  1 111 ? 67.894  112.184 -87.053  1.00 21.25  ? 111  LYS A O     1 
ATOM   827   C CB    . LYS A  1 111 ? 69.738  110.183 -87.291  1.00 27.09  ? 111  LYS A CB    1 
ATOM   828   C CG    . LYS A  1 111 ? 70.224  108.773 -87.538  1.00 32.73  ? 111  LYS A CG    1 
ATOM   829   C CD    . LYS A  1 111 ? 70.364  108.027 -86.184  1.00 35.12  ? 111  LYS A CD    1 
ATOM   830   C CE    . LYS A  1 111 ? 70.851  106.581 -86.335  1.00 36.85  ? 111  LYS A CE    1 
ATOM   831   N NZ    . LYS A  1 111 ? 72.327  106.542 -86.533  1.00 38.40  ? 111  LYS A NZ    1 
ATOM   832   N N     . VAL A  1 112 ? 68.687  113.306 -88.792  1.00 22.29  ? 112  VAL A N     1 
ATOM   833   C CA    . VAL A  1 112 ? 67.977  114.499 -88.337  1.00 23.29  ? 112  VAL A CA    1 
ATOM   834   C C     . VAL A  1 112 ? 66.513  114.369 -88.725  1.00 25.11  ? 112  VAL A C     1 
ATOM   835   O O     . VAL A  1 112 ? 66.208  114.033 -89.861  1.00 26.40  ? 112  VAL A O     1 
ATOM   836   C CB    . VAL A  1 112 ? 68.574  115.785 -88.941  1.00 22.74  ? 112  VAL A CB    1 
ATOM   837   C CG1   . VAL A  1 112 ? 67.726  117.004 -88.545  1.00 21.37  ? 112  VAL A CG1   1 
ATOM   838   C CG2   . VAL A  1 112 ? 70.034  115.951 -88.445  1.00 23.05  ? 112  VAL A CG2   1 
ATOM   839   N N     . VAL A  1 113 ? 65.613  114.584 -87.770  1.00 25.60  ? 113  VAL A N     1 
ATOM   840   C CA    . VAL A  1 113 ? 64.181  114.498 -88.040  1.00 27.19  ? 113  VAL A CA    1 
ATOM   841   C C     . VAL A  1 113 ? 63.697  115.876 -88.481  1.00 27.38  ? 113  VAL A C     1 
ATOM   842   O O     . VAL A  1 113 ? 63.748  116.853 -87.723  1.00 28.80  ? 113  VAL A O     1 
ATOM   843   C CB    . VAL A  1 113 ? 63.384  114.053 -86.789  1.00 26.13  ? 113  VAL A CB    1 
ATOM   844   C CG1   . VAL A  1 113 ? 61.890  114.141 -87.058  1.00 26.80  ? 113  VAL A CG1   1 
ATOM   845   C CG2   . VAL A  1 113 ? 63.726  112.635 -86.464  1.00 26.91  ? 113  VAL A CG2   1 
ATOM   846   N N     . HIS A  1 114 ? 63.268  115.940 -89.729  1.00 27.50  ? 114  HIS A N     1 
ATOM   847   C CA    . HIS A  1 114 ? 62.784  117.167 -90.334  1.00 29.29  ? 114  HIS A CA    1 
ATOM   848   C C     . HIS A  1 114 ? 61.272  117.338 -90.083  1.00 30.13  ? 114  HIS A C     1 
ATOM   849   O O     . HIS A  1 114 ? 60.488  116.484 -90.466  1.00 31.52  ? 114  HIS A O     1 
ATOM   850   C CB    . HIS A  1 114 ? 63.085  117.111 -91.846  1.00 30.11  ? 114  HIS A CB    1 
ATOM   851   C CG    . HIS A  1 114 ? 62.445  118.203 -92.655  1.00 29.62  ? 114  HIS A CG    1 
ATOM   852   N ND1   . HIS A  1 114 ? 62.261  118.102 -94.018  1.00 32.30  ? 114  HIS A ND1   1 
ATOM   853   C CD2   . HIS A  1 114 ? 61.966  119.419 -92.304  1.00 30.29  ? 114  HIS A CD2   1 
ATOM   854   C CE1   . HIS A  1 114 ? 61.689  119.204 -94.470  1.00 31.74  ? 114  HIS A CE1   1 
ATOM   855   N NE2   . HIS A  1 114 ? 61.499  120.021 -93.449  1.00 28.61  ? 114  HIS A NE2   1 
ATOM   856   N N     . VAL A  1 115 ? 60.873  118.415 -89.410  1.00 30.04  ? 115  VAL A N     1 
ATOM   857   C CA    . VAL A  1 115 ? 59.452  118.690 -89.188  1.00 29.11  ? 115  VAL A CA    1 
ATOM   858   C C     . VAL A  1 115 ? 59.098  119.952 -89.995  1.00 30.87  ? 115  VAL A C     1 
ATOM   859   O O     . VAL A  1 115 ? 59.773  120.988 -89.881  1.00 28.46  ? 115  VAL A O     1 
ATOM   860   C CB    . VAL A  1 115 ? 59.116  118.938 -87.681  1.00 28.77  ? 115  VAL A CB    1 
ATOM   861   C CG1   . VAL A  1 115 ? 57.625  119.221 -87.514  1.00 28.46  ? 115  VAL A CG1   1 
ATOM   862   C CG2   . VAL A  1 115 ? 59.459  117.710 -86.844  1.00 27.79  ? 115  VAL A CG2   1 
ATOM   863   N N     . ASN A  1 116 ? 58.075  119.848 -90.844  1.00 32.17  ? 116  ASN A N     1 
ATOM   864   C CA    . ASN A  1 116 ? 57.585  120.979 -91.649  1.00 34.69  ? 116  ASN A CA    1 
ATOM   865   C C     . ASN A  1 116 ? 56.483  121.682 -90.847  1.00 35.64  ? 116  ASN A C     1 
ATOM   866   O O     . ASN A  1 116 ? 55.560  121.028 -90.335  1.00 36.76  ? 116  ASN A O     1 
ATOM   867   C CB    . ASN A  1 116 ? 56.997  120.465 -92.968  1.00 38.75  ? 116  ASN A CB    1 
ATOM   868   C CG    . ASN A  1 116 ? 56.685  121.583 -93.974  1.00 40.98  ? 116  ASN A CG    1 
ATOM   869   O OD1   . ASN A  1 116 ? 56.223  121.306 -95.074  1.00 46.34  ? 116  ASN A OD1   1 
ATOM   870   N ND2   . ASN A  1 116 ? 56.948  122.826 -93.614  1.00 41.75  ? 116  ASN A ND2   1 
ATOM   871   N N     . GLY A  1 117 ? 56.587  123.006 -90.732  1.00 36.37  ? 117  GLY A N     1 
ATOM   872   C CA    . GLY A  1 117 ? 55.603  123.785 -89.996  1.00 35.04  ? 117  GLY A CA    1 
ATOM   873   C C     . GLY A  1 117 ? 56.239  124.992 -89.328  1.00 35.15  ? 117  GLY A C     1 
ATOM   874   O O     . GLY A  1 117 ? 57.461  125.069 -89.225  1.00 35.22  ? 117  GLY A O     1 
ATOM   875   N N     . TYR A  1 118 ? 55.414  125.939 -88.889  1.00 34.50  ? 118  TYR A N     1 
ATOM   876   C CA    . TYR A  1 118 ? 55.889  127.146 -88.218  1.00 34.00  ? 118  TYR A CA    1 
ATOM   877   C C     . TYR A  1 118 ? 56.037  126.755 -86.757  1.00 33.16  ? 118  TYR A C     1 
ATOM   878   O O     . TYR A  1 118 ? 55.063  126.375 -86.090  1.00 32.64  ? 118  TYR A O     1 
ATOM   879   C CB    . TYR A  1 118 ? 54.862  128.277 -88.377  1.00 33.69  ? 118  TYR A CB    1 
ATOM   880   C CG    . TYR A  1 118 ? 55.410  129.675 -88.185  1.00 35.46  ? 118  TYR A CG    1 
ATOM   881   C CD1   . TYR A  1 118 ? 55.765  130.138 -86.916  1.00 35.84  ? 118  TYR A CD1   1 
ATOM   882   C CD2   . TYR A  1 118 ? 55.562  130.544 -89.273  1.00 35.22  ? 118  TYR A CD2   1 
ATOM   883   C CE1   . TYR A  1 118 ? 56.257  131.440 -86.729  1.00 37.85  ? 118  TYR A CE1   1 
ATOM   884   C CE2   . TYR A  1 118 ? 56.057  131.850 -89.095  1.00 37.65  ? 118  TYR A CE2   1 
ATOM   885   C CZ    . TYR A  1 118 ? 56.401  132.281 -87.816  1.00 36.72  ? 118  TYR A CZ    1 
ATOM   886   O OH    . TYR A  1 118 ? 56.894  133.543 -87.606  1.00 38.70  ? 118  TYR A OH    1 
ATOM   887   N N     . GLY A  1 119 ? 57.262  126.838 -86.261  1.00 31.72  ? 119  GLY A N     1 
ATOM   888   C CA    . GLY A  1 119 ? 57.495  126.437 -84.895  1.00 30.54  ? 119  GLY A CA    1 
ATOM   889   C C     . GLY A  1 119 ? 57.295  127.532 -83.889  1.00 30.86  ? 119  GLY A C     1 
ATOM   890   O O     . GLY A  1 119 ? 57.557  128.688 -84.154  1.00 30.13  ? 119  GLY A O     1 
ATOM   891   N N     . LYS A  1 120 ? 56.837  127.160 -82.705  1.00 31.25  ? 120  LYS A N     1 
ATOM   892   C CA    . LYS A  1 120 ? 56.642  128.139 -81.654  1.00 31.40  ? 120  LYS A CA    1 
ATOM   893   C C     . LYS A  1 120 ? 57.050  127.467 -80.348  1.00 30.03  ? 120  LYS A C     1 
ATOM   894   O O     . LYS A  1 120 ? 56.717  126.312 -80.102  1.00 29.43  ? 120  LYS A O     1 
ATOM   895   C CB    . LYS A  1 120 ? 55.169  128.573 -81.618  1.00 34.84  ? 120  LYS A CB    1 
ATOM   896   C CG    . LYS A  1 120 ? 54.850  129.628 -80.575  1.00 38.38  ? 120  LYS A CG    1 
ATOM   897   C CD    . LYS A  1 120 ? 53.371  129.949 -80.600  1.00 41.95  ? 120  LYS A CD    1 
ATOM   898   C CE    . LYS A  1 120 ? 52.991  130.853 -79.442  1.00 45.75  ? 120  LYS A CE    1 
ATOM   899   N NZ    . LYS A  1 120 ? 51.494  130.984 -79.286  1.00 48.83  ? 120  LYS A NZ    1 
ATOM   900   N N     . ILE A  1 121 ? 57.800  128.175 -79.521  1.00 30.52  ? 121  ILE A N     1 
ATOM   901   C CA    . ILE A  1 121 ? 58.226  127.595 -78.252  1.00 30.89  ? 121  ILE A CA    1 
ATOM   902   C C     . ILE A  1 121 ? 57.019  127.733 -77.359  1.00 31.93  ? 121  ILE A C     1 
ATOM   903   O O     . ILE A  1 121 ? 56.600  128.845 -77.028  1.00 31.02  ? 121  ILE A O     1 
ATOM   904   C CB    . ILE A  1 121 ? 59.439  128.346 -77.649  1.00 30.62  ? 121  ILE A CB    1 
ATOM   905   C CG1   . ILE A  1 121 ? 60.613  128.274 -78.635  1.00 30.02  ? 121  ILE A CG1   1 
ATOM   906   C CG2   . ILE A  1 121 ? 59.849  127.729 -76.295  1.00 28.23  ? 121  ILE A CG2   1 
ATOM   907   C CD1   . ILE A  1 121 ? 61.699  129.308 -78.361  1.00 27.84  ? 121  ILE A CD1   1 
ATOM   908   N N     . THR A  1 122 ? 56.463  126.590 -76.984  1.00 32.01  ? 122  THR A N     1 
ATOM   909   C CA    . THR A  1 122 ? 55.258  126.540 -76.164  1.00 34.43  ? 122  THR A CA    1 
ATOM   910   C C     . THR A  1 122 ? 55.533  126.074 -74.737  1.00 34.85  ? 122  THR A C     1 
ATOM   911   O O     . THR A  1 122 ? 54.604  125.790 -73.962  1.00 35.20  ? 122  THR A O     1 
ATOM   912   C CB    . THR A  1 122 ? 54.207  125.624 -76.845  1.00 34.20  ? 122  THR A CB    1 
ATOM   913   O OG1   . THR A  1 122 ? 54.827  124.391 -77.241  1.00 35.40  ? 122  THR A OG1   1 
ATOM   914   C CG2   . THR A  1 122 ? 53.658  126.302 -78.090  1.00 34.56  ? 122  THR A CG2   1 
ATOM   915   N N     . GLY A  1 123 ? 56.818  126.015 -74.402  1.00 34.78  ? 123  GLY A N     1 
ATOM   916   C CA    . GLY A  1 123 ? 57.249  125.617 -73.073  1.00 34.66  ? 123  GLY A CA    1 
ATOM   917   C C     . GLY A  1 123 ? 58.762  125.590 -72.999  1.00 35.28  ? 123  GLY A C     1 
ATOM   918   O O     . GLY A  1 123 ? 59.433  125.458 -74.027  1.00 35.90  ? 123  GLY A O     1 
ATOM   919   N N     . LYS A  1 124 ? 59.299  125.713 -71.789  1.00 34.70  ? 124  LYS A N     1 
ATOM   920   C CA    . LYS A  1 124 ? 60.737  125.673 -71.569  1.00 34.03  ? 124  LYS A CA    1 
ATOM   921   C C     . LYS A  1 124 ? 61.321  124.483 -72.324  1.00 31.30  ? 124  LYS A C     1 
ATOM   922   O O     . LYS A  1 124 ? 62.385  124.572 -72.887  1.00 27.98  ? 124  LYS A O     1 
ATOM   923   C CB    . LYS A  1 124 ? 61.055  125.507 -70.070  1.00 37.12  ? 124  LYS A CB    1 
ATOM   924   C CG    . LYS A  1 124 ? 62.076  126.504 -69.533  1.00 40.37  ? 124  LYS A CG    1 
ATOM   925   C CD    . LYS A  1 124 ? 61.526  127.950 -69.561  1.00 42.35  ? 124  LYS A CD    1 
ATOM   926   C CE    . LYS A  1 124 ? 61.129  128.473 -68.165  1.00 43.70  ? 124  LYS A CE    1 
ATOM   927   N NZ    . LYS A  1 124 ? 62.261  128.523 -67.169  1.00 43.75  ? 124  LYS A NZ    1 
ATOM   928   N N     . ASN A  1 125 ? 60.613  123.365 -72.325  1.00 29.94  ? 125  ASN A N     1 
ATOM   929   C CA    . ASN A  1 125 ? 61.106  122.175 -73.012  1.00 29.08  ? 125  ASN A CA    1 
ATOM   930   C C     . ASN A  1 125 ? 60.140  121.669 -74.076  1.00 27.38  ? 125  ASN A C     1 
ATOM   931   O O     . ASN A  1 125 ? 59.972  120.459 -74.263  1.00 27.13  ? 125  ASN A O     1 
ATOM   932   C CB    . ASN A  1 125 ? 61.390  121.069 -72.007  1.00 27.57  ? 125  ASN A CB    1 
ATOM   933   C CG    . ASN A  1 125 ? 62.436  121.474 -70.992  1.00 29.32  ? 125  ASN A CG    1 
ATOM   934   O OD1   . ASN A  1 125 ? 62.114  121.965 -69.915  1.00 30.38  ? 125  ASN A OD1   1 
ATOM   935   N ND2   . ASN A  1 125 ? 63.698  121.285 -71.338  1.00 25.36  ? 125  ASN A ND2   1 
ATOM   936   N N     . GLN A  1 126 ? 59.529  122.589 -74.799  1.00 27.47  ? 126  GLN A N     1 
ATOM   937   C CA    . GLN A  1 126 ? 58.583  122.182 -75.818  1.00 28.34  ? 126  GLN A CA    1 
ATOM   938   C C     . GLN A  1 126 ? 58.443  123.138 -76.985  1.00 27.68  ? 126  GLN A C     1 
ATOM   939   O O     . GLN A  1 126 ? 58.383  124.354 -76.812  1.00 27.08  ? 126  GLN A O     1 
ATOM   940   C CB    . GLN A  1 126 ? 57.214  121.962 -75.170  1.00 30.67  ? 126  GLN A CB    1 
ATOM   941   C CG    . GLN A  1 126 ? 56.109  121.668 -76.159  1.00 34.39  ? 126  GLN A CG    1 
ATOM   942   C CD    . GLN A  1 126 ? 54.813  121.312 -75.468  1.00 35.86  ? 126  GLN A CD    1 
ATOM   943   O OE1   . GLN A  1 126 ? 54.600  120.160 -75.077  1.00 38.57  ? 126  GLN A OE1   1 
ATOM   944   N NE2   . GLN A  1 126 ? 53.947  122.299 -75.291  1.00 36.04  ? 126  GLN A NE2   1 
ATOM   945   N N     . VAL A  1 127 ? 58.394  122.566 -78.183  1.00 26.74  ? 127  VAL A N     1 
ATOM   946   C CA    . VAL A  1 127 ? 58.214  123.353 -79.380  1.00 27.07  ? 127  VAL A CA    1 
ATOM   947   C C     . VAL A  1 127 ? 57.040  122.739 -80.121  1.00 29.13  ? 127  VAL A C     1 
ATOM   948   O O     . VAL A  1 127 ? 56.916  121.504 -80.207  1.00 29.94  ? 127  VAL A O     1 
ATOM   949   C CB    . VAL A  1 127 ? 59.455  123.322 -80.316  1.00 26.53  ? 127  VAL A CB    1 
ATOM   950   C CG1   . VAL A  1 127 ? 59.187  124.179 -81.556  1.00 25.95  ? 127  VAL A CG1   1 
ATOM   951   C CG2   . VAL A  1 127 ? 60.691  123.857 -79.585  1.00 23.84  ? 127  VAL A CG2   1 
ATOM   952   N N     . THR A  1 128 ? 56.160  123.596 -80.626  1.00 29.39  ? 128  THR A N     1 
ATOM   953   C CA    . THR A  1 128 ? 55.025  123.125 -81.422  1.00 30.03  ? 128  THR A CA    1 
ATOM   954   C C     . THR A  1 128 ? 55.142  123.715 -82.824  1.00 30.19  ? 128  THR A C     1 
ATOM   955   O O     . THR A  1 128 ? 55.369  124.911 -82.991  1.00 30.66  ? 128  THR A O     1 
ATOM   956   C CB    . THR A  1 128 ? 53.669  123.532 -80.804  1.00 29.91  ? 128  THR A CB    1 
ATOM   957   O OG1   . THR A  1 128 ? 53.595  123.037 -79.462  1.00 28.98  ? 128  THR A OG1   1 
ATOM   958   C CG2   . THR A  1 128 ? 52.509  122.930 -81.623  1.00 29.41  ? 128  THR A CG2   1 
ATOM   959   N N     . ALA A  1 129 ? 55.032  122.856 -83.827  1.00 32.41  ? 129  ALA A N     1 
ATOM   960   C CA    . ALA A  1 129 ? 55.135  123.281 -85.216  1.00 34.00  ? 129  ALA A CA    1 
ATOM   961   C C     . ALA A  1 129 ? 53.762  123.102 -85.844  1.00 36.18  ? 129  ALA A C     1 
ATOM   962   O O     . ALA A  1 129 ? 53.208  122.005 -85.839  1.00 35.30  ? 129  ALA A O     1 
ATOM   963   C CB    . ALA A  1 129 ? 56.156  122.415 -85.950  1.00 33.38  ? 129  ALA A CB    1 
ATOM   964   N N     . THR A  1 130 ? 53.212  124.184 -86.375  1.00 38.77  ? 130  THR A N     1 
ATOM   965   C CA    . THR A  1 130 ? 51.889  124.148 -86.999  1.00 40.13  ? 130  THR A CA    1 
ATOM   966   C C     . THR A  1 130 ? 52.021  124.210 -88.513  1.00 40.64  ? 130  THR A C     1 
ATOM   967   O O     . THR A  1 130 ? 52.584  125.154 -89.051  1.00 39.76  ? 130  THR A O     1 
ATOM   968   C CB    . THR A  1 130 ? 51.031  125.336 -86.509  1.00 40.55  ? 130  THR A CB    1 
ATOM   969   O OG1   . THR A  1 130 ? 50.730  125.154 -85.124  1.00 40.17  ? 130  THR A OG1   1 
ATOM   970   C CG2   . THR A  1 130 ? 49.736  125.451 -87.305  1.00 40.17  ? 130  THR A CG2   1 
ATOM   971   N N     . LYS A  1 131 ? 51.497  123.204 -89.196  1.00 43.42  ? 131  LYS A N     1 
ATOM   972   C CA    . LYS A  1 131 ? 51.567  123.167 -90.653  1.00 46.53  ? 131  LYS A CA    1 
ATOM   973   C C     . LYS A  1 131 ? 50.526  124.100 -91.300  1.00 48.51  ? 131  LYS A C     1 
ATOM   974   O O     . LYS A  1 131 ? 49.664  124.669 -90.618  1.00 48.04  ? 131  LYS A O     1 
ATOM   975   C CB    . LYS A  1 131 ? 51.373  121.725 -91.143  1.00 47.90  ? 131  LYS A CB    1 
ATOM   976   C CG    . LYS A  1 131 ? 52.256  120.726 -90.398  1.00 50.43  ? 131  LYS A CG    1 
ATOM   977   C CD    . LYS A  1 131 ? 52.307  119.357 -91.051  1.00 52.73  ? 131  LYS A CD    1 
ATOM   978   C CE    . LYS A  1 131 ? 53.273  118.438 -90.279  1.00 56.03  ? 131  LYS A CE    1 
ATOM   979   N NZ    . LYS A  1 131 ? 53.462  117.096 -90.925  1.00 57.75  ? 131  LYS A NZ    1 
ATOM   980   N N     . ALA A  1 132 ? 50.631  124.268 -92.615  1.00 49.80  ? 132  ALA A N     1 
ATOM   981   C CA    . ALA A  1 132 ? 49.709  125.113 -93.368  1.00 51.62  ? 132  ALA A CA    1 
ATOM   982   C C     . ALA A  1 132 ? 48.262  124.670 -93.158  1.00 52.62  ? 132  ALA A C     1 
ATOM   983   O O     . ALA A  1 132 ? 47.365  125.498 -92.993  1.00 52.00  ? 132  ALA A O     1 
ATOM   984   C CB    . ALA A  1 132 ? 50.050  125.063 -94.861  1.00 50.96  ? 132  ALA A CB    1 
ATOM   985   N N     . ASP A  1 133 ? 48.046  123.358 -93.175  1.00 54.25  ? 133  ASP A N     1 
ATOM   986   C CA    . ASP A  1 133 ? 46.717  122.791 -93.004  1.00 55.75  ? 133  ASP A CA    1 
ATOM   987   C C     . ASP A  1 133 ? 46.241  122.861 -91.569  1.00 55.58  ? 133  ASP A C     1 
ATOM   988   O O     . ASP A  1 133 ? 45.247  122.238 -91.221  1.00 56.73  ? 133  ASP A O     1 
ATOM   989   C CB    . ASP A  1 133 ? 46.699  121.332 -93.455  1.00 58.98  ? 133  ASP A CB    1 
ATOM   990   C CG    . ASP A  1 133 ? 47.842  120.517 -92.854  1.00 62.55  ? 133  ASP A CG    1 
ATOM   991   O OD1   . ASP A  1 133 ? 48.999  120.671 -93.330  1.00 64.01  ? 133  ASP A OD1   1 
ATOM   992   O OD2   . ASP A  1 133 ? 47.585  119.730 -91.908  1.00 63.40  ? 133  ASP A OD2   1 
ATOM   993   N N     . GLY A  1 134 ? 46.946  123.610 -90.732  1.00 54.78  ? 134  GLY A N     1 
ATOM   994   C CA    . GLY A  1 134 ? 46.550  123.713 -89.340  1.00 52.62  ? 134  GLY A CA    1 
ATOM   995   C C     . GLY A  1 134 ? 46.995  122.524 -88.510  1.00 51.44  ? 134  GLY A C     1 
ATOM   996   O O     . GLY A  1 134 ? 46.832  122.527 -87.294  1.00 51.38  ? 134  GLY A O     1 
ATOM   997   N N     . GLY A  1 135 ? 47.541  121.503 -89.167  1.00 50.69  ? 135  GLY A N     1 
ATOM   998   C CA    . GLY A  1 135 ? 48.018  120.328 -88.455  1.00 48.99  ? 135  GLY A CA    1 
ATOM   999   C C     . GLY A  1 135 ? 49.038  120.692 -87.381  1.00 48.09  ? 135  GLY A C     1 
ATOM   1000  O O     . GLY A  1 135 ? 49.716  121.720 -87.463  1.00 47.00  ? 135  GLY A O     1 
ATOM   1001  N N     . THR A  1 136 ? 49.163  119.837 -86.371  1.00 47.04  ? 136  THR A N     1 
ATOM   1002  C CA    . THR A  1 136 ? 50.086  120.109 -85.282  1.00 46.15  ? 136  THR A CA    1 
ATOM   1003  C C     . THR A  1 136 ? 51.034  118.960 -84.880  1.00 44.63  ? 136  THR A C     1 
ATOM   1004  O O     . THR A  1 136 ? 50.641  117.783 -84.831  1.00 43.54  ? 136  THR A O     1 
ATOM   1005  C CB    . THR A  1 136 ? 49.298  120.553 -84.041  1.00 46.79  ? 136  THR A CB    1 
ATOM   1006  O OG1   . THR A  1 136 ? 50.163  121.253 -83.152  1.00 48.49  ? 136  THR A OG1   1 
ATOM   1007  C CG2   . THR A  1 136 ? 48.721  119.344 -83.308  1.00 47.67  ? 136  THR A CG2   1 
ATOM   1008  N N     . GLN A  1 137 ? 52.287  119.327 -84.600  1.00 41.88  ? 137  GLN A N     1 
ATOM   1009  C CA    . GLN A  1 137 ? 53.316  118.385 -84.146  1.00 38.88  ? 137  GLN A CA    1 
ATOM   1010  C C     . GLN A  1 137 ? 54.033  119.008 -82.947  1.00 37.91  ? 137  GLN A C     1 
ATOM   1011  O O     . GLN A  1 137 ? 54.550  120.135 -82.998  1.00 34.69  ? 137  GLN A O     1 
ATOM   1012  C CB    . GLN A  1 137 ? 54.324  118.064 -85.251  1.00 39.11  ? 137  GLN A CB    1 
ATOM   1013  C CG    . GLN A  1 137 ? 55.485  117.182 -84.782  1.00 38.79  ? 137  GLN A CG    1 
ATOM   1014  C CD    . GLN A  1 137 ? 55.048  115.777 -84.384  1.00 39.73  ? 137  GLN A CD    1 
ATOM   1015  O OE1   . GLN A  1 137 ? 54.697  114.963 -85.236  1.00 39.01  ? 137  GLN A OE1   1 
ATOM   1016  N NE2   . GLN A  1 137 ? 55.065  115.491 -83.082  1.00 39.17  ? 137  GLN A NE2   1 
ATOM   1017  N N     . VAL A  1 138 ? 54.026  118.274 -81.847  1.00 37.38  ? 138  VAL A N     1 
ATOM   1018  C CA    . VAL A  1 138 ? 54.654  118.757 -80.641  1.00 36.81  ? 138  VAL A CA    1 
ATOM   1019  C C     . VAL A  1 138 ? 55.963  118.022 -80.461  1.00 36.20  ? 138  VAL A C     1 
ATOM   1020  O O     . VAL A  1 138 ? 56.077  116.833 -80.781  1.00 34.86  ? 138  VAL A O     1 
ATOM   1021  C CB    . VAL A  1 138 ? 53.759  118.526 -79.401  1.00 37.49  ? 138  VAL A CB    1 
ATOM   1022  C CG1   . VAL A  1 138 ? 54.472  119.017 -78.141  1.00 37.50  ? 138  VAL A CG1   1 
ATOM   1023  C CG2   . VAL A  1 138 ? 52.432  119.266 -79.570  1.00 38.86  ? 138  VAL A CG2   1 
ATOM   1024  N N     . ILE A  1 139 ? 56.954  118.754 -79.965  1.00 34.47  ? 139  ILE A N     1 
ATOM   1025  C CA    . ILE A  1 139 ? 58.269  118.193 -79.726  1.00 33.06  ? 139  ILE A CA    1 
ATOM   1026  C C     . ILE A  1 139 ? 58.716  118.539 -78.308  1.00 31.75  ? 139  ILE A C     1 
ATOM   1027  O O     . ILE A  1 139 ? 58.878  119.712 -77.963  1.00 30.14  ? 139  ILE A O     1 
ATOM   1028  C CB    . ILE A  1 139 ? 59.296  118.758 -80.752  1.00 35.39  ? 139  ILE A CB    1 
ATOM   1029  C CG1   . ILE A  1 139 ? 58.717  118.623 -82.172  1.00 36.48  ? 139  ILE A CG1   1 
ATOM   1030  C CG2   . ILE A  1 139 ? 60.626  118.006 -80.639  1.00 32.31  ? 139  ILE A CG2   1 
ATOM   1031  C CD1   . ILE A  1 139 ? 59.537  119.274 -83.241  1.00 40.80  ? 139  ILE A CD1   1 
ATOM   1032  N N     . ASP A  1 140 ? 58.854  117.514 -77.477  1.00 30.33  ? 140  ASP A N     1 
ATOM   1033  C CA    . ASP A  1 140 ? 59.336  117.705 -76.120  1.00 32.18  ? 140  ASP A CA    1 
ATOM   1034  C C     . ASP A  1 140 ? 60.843  117.555 -76.300  1.00 30.34  ? 140  ASP A C     1 
ATOM   1035  O O     . ASP A  1 140 ? 61.331  116.576 -76.856  1.00 29.59  ? 140  ASP A O     1 
ATOM   1036  C CB    . ASP A  1 140 ? 58.720  116.660 -75.182  1.00 32.83  ? 140  ASP A CB    1 
ATOM   1037  C CG    . ASP A  1 140 ? 57.211  116.835 -75.077  1.00 35.31  ? 140  ASP A CG    1 
ATOM   1038  O OD1   . ASP A  1 140 ? 56.774  117.970 -74.796  1.00 34.72  ? 140  ASP A OD1   1 
ATOM   1039  O OD2   . ASP A  1 140 ? 56.469  115.856 -75.296  1.00 38.30  ? 140  ASP A OD2   1 
ATOM   1040  N N     . THR A  1 141 ? 61.570  118.554 -75.834  1.00 30.06  ? 141  THR A N     1 
ATOM   1041  C CA    . THR A  1 141 ? 62.987  118.585 -76.077  1.00 27.75  ? 141  THR A CA    1 
ATOM   1042  C C     . THR A  1 141 ? 63.795  119.130 -74.901  1.00 25.94  ? 141  THR A C     1 
ATOM   1043  O O     . THR A  1 141 ? 63.330  119.992 -74.168  1.00 25.40  ? 141  THR A O     1 
ATOM   1044  C CB    . THR A  1 141 ? 63.192  119.446 -77.367  1.00 26.98  ? 141  THR A CB    1 
ATOM   1045  O OG1   . THR A  1 141 ? 64.564  119.441 -77.774  1.00 25.21  ? 141  THR A OG1   1 
ATOM   1046  C CG2   . THR A  1 141 ? 62.697  120.892 -77.111  1.00 25.15  ? 141  THR A CG2   1 
ATOM   1047  N N     . LYS A  1 142 ? 65.006  118.619 -74.744  1.00 25.61  ? 142  LYS A N     1 
ATOM   1048  C CA    . LYS A  1 142 ? 65.901  119.079 -73.687  1.00 26.80  ? 142  LYS A CA    1 
ATOM   1049  C C     . LYS A  1 142 ? 66.421  120.480 -74.011  1.00 24.76  ? 142  LYS A C     1 
ATOM   1050  O O     . LYS A  1 142 ? 66.474  121.358 -73.158  1.00 24.89  ? 142  LYS A O     1 
ATOM   1051  C CB    . LYS A  1 142 ? 67.072  118.102 -73.546  1.00 27.90  ? 142  LYS A CB    1 
ATOM   1052  C CG    . LYS A  1 142 ? 66.617  116.763 -72.980  1.00 30.87  ? 142  LYS A CG    1 
ATOM   1053  C CD    . LYS A  1 142 ? 67.768  115.782 -72.803  1.00 35.27  ? 142  LYS A CD    1 
ATOM   1054  C CE    . LYS A  1 142 ? 67.273  114.532 -72.047  1.00 37.98  ? 142  LYS A CE    1 
ATOM   1055  N NZ    . LYS A  1 142 ? 68.280  113.456 -72.079  1.00 41.17  ? 142  LYS A NZ    1 
ATOM   1056  N N     . ASN A  1 143 ? 66.766  120.695 -75.269  1.00 24.03  ? 143  ASN A N     1 
ATOM   1057  C CA    . ASN A  1 143 ? 67.299  121.975 -75.685  1.00 23.89  ? 143  ASN A CA    1 
ATOM   1058  C C     . ASN A  1 143 ? 66.605  122.470 -76.921  1.00 22.01  ? 143  ASN A C     1 
ATOM   1059  O O     . ASN A  1 143 ? 66.109  121.677 -77.728  1.00 20.74  ? 143  ASN A O     1 
ATOM   1060  C CB    . ASN A  1 143 ? 68.795  121.848 -75.989  1.00 24.51  ? 143  ASN A CB    1 
ATOM   1061  C CG    . ASN A  1 143 ? 69.554  121.303 -74.834  1.00 27.85  ? 143  ASN A CG    1 
ATOM   1062  O OD1   . ASN A  1 143 ? 69.870  122.030 -73.881  1.00 26.90  ? 143  ASN A OD1   1 
ATOM   1063  N ND2   . ASN A  1 143 ? 69.830  119.994 -74.877  1.00 31.46  ? 143  ASN A ND2   1 
ATOM   1064  N N     . ILE A  1 144 ? 66.617  123.793 -77.054  1.00 22.81  ? 144  ILE A N     1 
ATOM   1065  C CA    . ILE A  1 144 ? 66.030  124.501 -78.187  1.00 23.05  ? 144  ILE A CA    1 
ATOM   1066  C C     . ILE A  1 144 ? 67.073  125.437 -78.756  1.00 22.02  ? 144  ILE A C     1 
ATOM   1067  O O     . ILE A  1 144 ? 67.722  126.203 -78.021  1.00 18.96  ? 144  ILE A O     1 
ATOM   1068  C CB    . ILE A  1 144 ? 64.804  125.322 -77.749  1.00 24.54  ? 144  ILE A CB    1 
ATOM   1069  C CG1   . ILE A  1 144 ? 63.738  124.354 -77.215  1.00 25.75  ? 144  ILE A CG1   1 
ATOM   1070  C CG2   . ILE A  1 144 ? 64.254  126.163 -78.934  1.00 24.07  ? 144  ILE A CG2   1 
ATOM   1071  C CD1   . ILE A  1 144 ? 62.490  125.052 -76.619  1.00 27.27  ? 144  ILE A CD1   1 
ATOM   1072  N N     . LEU A  1 145 ? 67.244  125.360 -80.076  1.00 22.23  ? 145  LEU A N     1 
ATOM   1073  C CA    . LEU A  1 145 ? 68.193  126.205 -80.762  1.00 20.55  ? 145  LEU A CA    1 
ATOM   1074  C C     . LEU A  1 145 ? 67.447  127.060 -81.749  1.00 21.88  ? 145  LEU A C     1 
ATOM   1075  O O     . LEU A  1 145 ? 66.927  126.575 -82.741  1.00 21.66  ? 145  LEU A O     1 
ATOM   1076  C CB    . LEU A  1 145 ? 69.241  125.371 -81.495  1.00 21.18  ? 145  LEU A CB    1 
ATOM   1077  C CG    . LEU A  1 145 ? 70.250  126.176 -82.353  1.00 22.37  ? 145  LEU A CG    1 
ATOM   1078  C CD1   . LEU A  1 145 ? 70.820  127.412 -81.614  1.00 19.90  ? 145  LEU A CD1   1 
ATOM   1079  C CD2   . LEU A  1 145 ? 71.364  125.238 -82.735  1.00 24.18  ? 145  LEU A CD2   1 
ATOM   1080  N N     . ILE A  1 146 ? 67.385  128.345 -81.468  1.00 22.89  ? 146  ILE A N     1 
ATOM   1081  C CA    . ILE A  1 146 ? 66.697  129.265 -82.358  1.00 22.11  ? 146  ILE A CA    1 
ATOM   1082  C C     . ILE A  1 146 ? 67.666  129.694 -83.456  1.00 23.01  ? 146  ILE A C     1 
ATOM   1083  O O     . ILE A  1 146 ? 68.727  130.283 -83.189  1.00 20.66  ? 146  ILE A O     1 
ATOM   1084  C CB    . ILE A  1 146 ? 66.229  130.510 -81.591  1.00 21.93  ? 146  ILE A CB    1 
ATOM   1085  C CG1   . ILE A  1 146 ? 65.258  130.088 -80.474  1.00 18.89  ? 146  ILE A CG1   1 
ATOM   1086  C CG2   . ILE A  1 146 ? 65.564  131.493 -82.562  1.00 21.75  ? 146  ILE A CG2   1 
ATOM   1087  C CD1   . ILE A  1 146 ? 65.073  131.128 -79.402  1.00 21.81  ? 146  ILE A CD1   1 
ATOM   1088  N N     . ALA A  1 147 ? 67.307  129.363 -84.688  1.00 21.52  ? 147  ALA A N     1 
ATOM   1089  C CA    . ALA A  1 147 ? 68.108  129.720 -85.834  1.00 23.39  ? 147  ALA A CA    1 
ATOM   1090  C C     . ALA A  1 147 ? 67.112  130.244 -86.892  1.00 25.05  ? 147  ALA A C     1 
ATOM   1091  O O     . ALA A  1 147 ? 67.155  129.878 -88.061  1.00 25.24  ? 147  ALA A O     1 
ATOM   1092  C CB    . ALA A  1 147 ? 68.873  128.502 -86.338  1.00 21.84  ? 147  ALA A CB    1 
ATOM   1093  N N     . THR A  1 148 ? 66.230  131.134 -86.444  1.00 24.38  ? 148  THR A N     1 
ATOM   1094  C CA    . THR A  1 148 ? 65.175  131.698 -87.283  1.00 26.10  ? 148  THR A CA    1 
ATOM   1095  C C     . THR A  1 148 ? 65.579  132.746 -88.326  1.00 26.35  ? 148  THR A C     1 
ATOM   1096  O O     . THR A  1 148 ? 64.760  133.200 -89.136  1.00 27.10  ? 148  THR A O     1 
ATOM   1097  C CB    . THR A  1 148 ? 64.043  132.258 -86.389  1.00 24.38  ? 148  THR A CB    1 
ATOM   1098  O OG1   . THR A  1 148 ? 64.578  133.205 -85.457  1.00 24.70  ? 148  THR A OG1   1 
ATOM   1099  C CG2   . THR A  1 148 ? 63.386  131.136 -85.642  1.00 24.22  ? 148  THR A CG2   1 
ATOM   1100  N N     . GLY A  1 149 ? 66.837  133.147 -88.288  1.00 25.51  ? 149  GLY A N     1 
ATOM   1101  C CA    . GLY A  1 149 ? 67.341  134.062 -89.282  1.00 25.52  ? 149  GLY A CA    1 
ATOM   1102  C C     . GLY A  1 149 ? 66.893  135.513 -89.368  1.00 25.34  ? 149  GLY A C     1 
ATOM   1103  O O     . GLY A  1 149 ? 66.680  136.204 -88.356  1.00 22.57  ? 149  GLY A O     1 
ATOM   1104  N N     . SER A  1 150 ? 66.747  135.948 -90.622  1.00 24.22  ? 150  SER A N     1 
ATOM   1105  C CA    . SER A  1 150 ? 66.398  137.320 -90.941  1.00 26.89  ? 150  SER A CA    1 
ATOM   1106  C C     . SER A  1 150 ? 65.352  137.483 -92.053  1.00 27.49  ? 150  SER A C     1 
ATOM   1107  O O     . SER A  1 150 ? 64.854  136.511 -92.618  1.00 27.06  ? 150  SER A O     1 
ATOM   1108  C CB    . SER A  1 150 ? 67.686  138.070 -91.323  1.00 24.47  ? 150  SER A CB    1 
ATOM   1109  O OG    . SER A  1 150 ? 68.339  137.413 -92.414  1.00 26.50  ? 150  SER A OG    1 
ATOM   1110  N N     . GLU A  1 151 ? 65.059  138.748 -92.351  1.00 30.83  ? 151  GLU A N     1 
ATOM   1111  C CA    . GLU A  1 151 ? 64.112  139.171 -93.388  1.00 33.16  ? 151  GLU A CA    1 
ATOM   1112  C C     . GLU A  1 151 ? 64.641  140.493 -93.936  1.00 33.42  ? 151  GLU A C     1 
ATOM   1113  O O     . GLU A  1 151 ? 65.436  141.165 -93.284  1.00 33.55  ? 151  GLU A O     1 
ATOM   1114  C CB    . GLU A  1 151 ? 62.725  139.391 -92.774  1.00 34.24  ? 151  GLU A CB    1 
ATOM   1115  C CG    . GLU A  1 151 ? 62.673  140.529 -91.745  1.00 34.27  ? 151  GLU A CG    1 
ATOM   1116  C CD    . GLU A  1 151 ? 61.257  140.788 -91.229  1.00 35.96  ? 151  GLU A CD    1 
ATOM   1117  O OE1   . GLU A  1 151 ? 60.328  140.080 -91.655  1.00 37.52  ? 151  GLU A OE1   1 
ATOM   1118  O OE2   . GLU A  1 151 ? 61.055  141.700 -90.403  1.00 38.58  ? 151  GLU A OE2   1 
ATOM   1119  N N     . VAL A  1 152 ? 64.225  140.879 -95.136  1.00 35.51  ? 152  VAL A N     1 
ATOM   1120  C CA    . VAL A  1 152 ? 64.709  142.149 -95.678  1.00 36.49  ? 152  VAL A CA    1 
ATOM   1121  C C     . VAL A  1 152 ? 64.186  143.287 -94.801  1.00 35.86  ? 152  VAL A C     1 
ATOM   1122  O O     . VAL A  1 152 ? 63.089  143.201 -94.250  1.00 34.17  ? 152  VAL A O     1 
ATOM   1123  C CB    . VAL A  1 152 ? 64.224  142.386 -97.143  1.00 38.34  ? 152  VAL A CB    1 
ATOM   1124  C CG1   . VAL A  1 152 ? 64.453  141.126 -97.997  1.00 38.69  ? 152  VAL A CG1   1 
ATOM   1125  C CG2   . VAL A  1 152 ? 62.766  142.765 -97.150  1.00 41.18  ? 152  VAL A CG2   1 
ATOM   1126  N N     . THR A  1 153 ? 64.973  144.345 -94.658  1.00 35.25  ? 153  THR A N     1 
ATOM   1127  C CA    . THR A  1 153 ? 64.533  145.477 -93.861  1.00 36.37  ? 153  THR A CA    1 
ATOM   1128  C C     . THR A  1 153 ? 63.662  146.346 -94.778  1.00 37.86  ? 153  THR A C     1 
ATOM   1129  O O     . THR A  1 153 ? 64.111  146.808 -95.833  1.00 37.53  ? 153  THR A O     1 
ATOM   1130  C CB    . THR A  1 153 ? 65.728  146.314 -93.340  1.00 35.85  ? 153  THR A CB    1 
ATOM   1131  O OG1   . THR A  1 153 ? 66.530  145.523 -92.439  1.00 36.64  ? 153  THR A OG1   1 
ATOM   1132  C CG2   . THR A  1 153 ? 65.215  147.546 -92.619  1.00 36.80  ? 153  THR A CG2   1 
ATOM   1133  N N     . PRO A  1 154 ? 62.395  146.547 -94.407  1.00 38.28  ? 154  PRO A N     1 
ATOM   1134  C CA    . PRO A  1 154 ? 61.525  147.372 -95.255  1.00 39.60  ? 154  PRO A CA    1 
ATOM   1135  C C     . PRO A  1 154 ? 61.824  148.877 -95.194  1.00 39.84  ? 154  PRO A C     1 
ATOM   1136  O O     . PRO A  1 154 ? 62.257  149.410 -94.164  1.00 38.55  ? 154  PRO A O     1 
ATOM   1137  C CB    . PRO A  1 154 ? 60.128  147.045 -94.743  1.00 39.82  ? 154  PRO A CB    1 
ATOM   1138  C CG    . PRO A  1 154 ? 60.369  146.862 -93.245  1.00 40.42  ? 154  PRO A CG    1 
ATOM   1139  C CD    . PRO A  1 154 ? 61.684  146.055 -93.211  1.00 39.28  ? 154  PRO A CD    1 
ATOM   1140  N N     . PHE A  1 155 ? 61.605  149.541 -96.324  1.00 41.19  ? 155  PHE A N     1 
ATOM   1141  C CA    . PHE A  1 155 ? 61.806  150.982 -96.445  1.00 43.12  ? 155  PHE A CA    1 
ATOM   1142  C C     . PHE A  1 155 ? 60.414  151.575 -96.232  1.00 44.93  ? 155  PHE A C     1 
ATOM   1143  O O     . PHE A  1 155 ? 59.509  151.365 -97.043  1.00 44.12  ? 155  PHE A O     1 
ATOM   1144  C CB    . PHE A  1 155 ? 62.335  151.324 -97.838  1.00 42.48  ? 155  PHE A CB    1 
ATOM   1145  C CG    . PHE A  1 155 ? 62.732  152.770 -98.008  1.00 43.75  ? 155  PHE A CG    1 
ATOM   1146  C CD1   . PHE A  1 155 ? 61.773  153.780 -97.976  1.00 43.45  ? 155  PHE A CD1   1 
ATOM   1147  C CD2   . PHE A  1 155 ? 64.064  153.116 -98.225  1.00 44.15  ? 155  PHE A CD2   1 
ATOM   1148  C CE1   . PHE A  1 155 ? 62.129  155.114 -98.157  1.00 44.93  ? 155  PHE A CE1   1 
ATOM   1149  C CE2   . PHE A  1 155 ? 64.445  154.455 -98.408  1.00 46.42  ? 155  PHE A CE2   1 
ATOM   1150  C CZ    . PHE A  1 155 ? 63.471  155.459 -98.376  1.00 45.89  ? 155  PHE A CZ    1 
ATOM   1151  N N     . PRO A  1 156 ? 60.220  152.309 -95.127  1.00 46.99  ? 156  PRO A N     1 
ATOM   1152  C CA    . PRO A  1 156 ? 58.905  152.902 -94.849  1.00 48.84  ? 156  PRO A CA    1 
ATOM   1153  C C     . PRO A  1 156 ? 58.411  153.843 -95.954  1.00 49.34  ? 156  PRO A C     1 
ATOM   1154  O O     . PRO A  1 156 ? 59.128  154.748 -96.376  1.00 49.27  ? 156  PRO A O     1 
ATOM   1155  C CB    . PRO A  1 156 ? 59.127  153.612 -93.512  1.00 49.73  ? 156  PRO A CB    1 
ATOM   1156  C CG    . PRO A  1 156 ? 60.564  154.065 -93.618  1.00 50.51  ? 156  PRO A CG    1 
ATOM   1157  C CD    . PRO A  1 156 ? 61.245  152.836 -94.205  1.00 47.61  ? 156  PRO A CD    1 
ATOM   1158  N N     . GLY A  1 157 ? 57.193  153.609 -96.430  1.00 49.55  ? 157  GLY A N     1 
ATOM   1159  C CA    . GLY A  1 157 ? 56.645  154.455 -97.473  1.00 49.97  ? 157  GLY A CA    1 
ATOM   1160  C C     . GLY A  1 157 ? 56.705  153.812 -98.840  1.00 50.12  ? 157  GLY A C     1 
ATOM   1161  O O     . GLY A  1 157 ? 55.874  154.099 -99.697  1.00 50.90  ? 157  GLY A O     1 
ATOM   1162  N N     . ILE A  1 158 ? 57.700  152.958 -99.057  1.00 49.42  ? 158  ILE A N     1 
ATOM   1163  C CA    . ILE A  1 158 ? 57.826  152.265 -100.325 1.00 48.20  ? 158  ILE A CA    1 
ATOM   1164  C C     . ILE A  1 158 ? 57.444  150.837 -100.002 1.00 48.87  ? 158  ILE A C     1 
ATOM   1165  O O     . ILE A  1 158 ? 58.001  150.242 -99.092  1.00 50.24  ? 158  ILE A O     1 
ATOM   1166  C CB    . ILE A  1 158 ? 59.279  152.293 -100.863 1.00 47.35  ? 158  ILE A CB    1 
ATOM   1167  C CG1   . ILE A  1 158 ? 59.768  153.734 -100.971 1.00 46.13  ? 158  ILE A CG1   1 
ATOM   1168  C CG2   . ILE A  1 158 ? 59.353  151.610 -102.228 1.00 45.31  ? 158  ILE A CG2   1 
ATOM   1169  C CD1   . ILE A  1 158 ? 61.150  153.872 -101.543 1.00 43.95  ? 158  ILE A CD1   1 
ATOM   1170  N N     . THR A  1 159 ? 56.464  150.289 -100.700 1.00 49.40  ? 159  THR A N     1 
ATOM   1171  C CA    . THR A  1 159 ? 56.088  148.910 -100.428 1.00 50.52  ? 159  THR A CA    1 
ATOM   1172  C C     . THR A  1 159 ? 56.596  148.047 -101.581 1.00 50.21  ? 159  THR A C     1 
ATOM   1173  O O     . THR A  1 159 ? 56.418  148.367 -102.764 1.00 50.83  ? 159  THR A O     1 
ATOM   1174  C CB    . THR A  1 159 ? 54.555  148.754 -100.208 1.00 50.45  ? 159  THR A CB    1 
ATOM   1175  O OG1   . THR A  1 159 ? 53.843  149.313 -101.312 1.00 53.14  ? 159  THR A OG1   1 
ATOM   1176  C CG2   . THR A  1 159 ? 54.129  149.479 -98.937  1.00 50.50  ? 159  THR A CG2   1 
ATOM   1177  N N     . ILE A  1 160 ? 57.286  146.974 -101.219 1.00 48.43  ? 160  ILE A N     1 
ATOM   1178  C CA    . ILE A  1 160 ? 57.865  146.083 -102.201 1.00 46.82  ? 160  ILE A CA    1 
ATOM   1179  C C     . ILE A  1 160 ? 56.835  145.099 -102.721 1.00 45.80  ? 160  ILE A C     1 
ATOM   1180  O O     . ILE A  1 160 ? 56.098  144.494 -101.946 1.00 45.06  ? 160  ILE A O     1 
ATOM   1181  C CB    . ILE A  1 160 ? 59.093  145.368 -101.578 1.00 47.14  ? 160  ILE A CB    1 
ATOM   1182  C CG1   . ILE A  1 160 ? 60.189  146.423 -101.365 1.00 46.96  ? 160  ILE A CG1   1 
ATOM   1183  C CG2   . ILE A  1 160 ? 59.539  144.181 -102.446 1.00 45.55  ? 160  ILE A CG2   1 
ATOM   1184  C CD1   . ILE A  1 160 ? 61.431  145.940 -100.695 1.00 47.57  ? 160  ILE A CD1   1 
ATOM   1185  N N     . ASP A  1 161 ? 56.777  144.954 -104.041 1.00 45.34  ? 161  ASP A N     1 
ATOM   1186  C CA    . ASP A  1 161 ? 55.827  144.035 -104.650 1.00 45.90  ? 161  ASP A CA    1 
ATOM   1187  C C     . ASP A  1 161 ? 56.520  142.918 -105.410 1.00 44.87  ? 161  ASP A C     1 
ATOM   1188  O O     . ASP A  1 161 ? 55.871  142.088 -106.045 1.00 44.08  ? 161  ASP A O     1 
ATOM   1189  C CB    . ASP A  1 161 ? 54.878  144.787 -105.597 1.00 47.82  ? 161  ASP A CB    1 
ATOM   1190  C CG    . ASP A  1 161 ? 55.616  145.627 -106.633 1.00 49.52  ? 161  ASP A CG    1 
ATOM   1191  O OD1   . ASP A  1 161 ? 56.520  145.108 -107.319 1.00 50.22  ? 161  ASP A OD1   1 
ATOM   1192  O OD2   . ASP A  1 161 ? 55.279  146.820 -106.776 1.00 52.29  ? 161  ASP A OD2   1 
ATOM   1193  N N     . GLU A  1 162 ? 57.845  142.908 -105.337 1.00 43.55  ? 162  GLU A N     1 
ATOM   1194  C CA    . GLU A  1 162 ? 58.645  141.912 -106.019 1.00 42.15  ? 162  GLU A CA    1 
ATOM   1195  C C     . GLU A  1 162 ? 58.354  141.866 -107.513 1.00 43.31  ? 162  GLU A C     1 
ATOM   1196  O O     . GLU A  1 162 ? 58.656  140.876 -108.185 1.00 41.97  ? 162  GLU A O     1 
ATOM   1197  C CB    . GLU A  1 162 ? 58.437  140.535 -105.379 1.00 41.29  ? 162  GLU A CB    1 
ATOM   1198  C CG    . GLU A  1 162 ? 58.736  140.504 -103.852 1.00 41.00  ? 162  GLU A CG    1 
ATOM   1199  C CD    . GLU A  1 162 ? 60.181  140.864 -103.476 1.00 39.75  ? 162  GLU A CD    1 
ATOM   1200  O OE1   . GLU A  1 162 ? 60.937  141.365 -104.327 1.00 38.64  ? 162  GLU A OE1   1 
ATOM   1201  O OE2   . GLU A  1 162 ? 60.557  140.652 -102.303 1.00 42.58  ? 162  GLU A OE2   1 
ATOM   1202  N N     . ASP A  1 163 ? 57.747  142.935 -108.035 1.00 43.83  ? 163  ASP A N     1 
ATOM   1203  C CA    . ASP A  1 163 ? 57.487  143.028 -109.482 1.00 44.58  ? 163  ASP A CA    1 
ATOM   1204  C C     . ASP A  1 163 ? 58.339  144.160 -110.051 1.00 42.20  ? 163  ASP A C     1 
ATOM   1205  O O     . ASP A  1 163 ? 59.322  143.907 -110.740 1.00 41.50  ? 163  ASP A O     1 
ATOM   1206  C CB    . ASP A  1 163 ? 56.009  143.306 -109.812 1.00 48.30  ? 163  ASP A CB    1 
ATOM   1207  C CG    . ASP A  1 163 ? 55.786  143.570 -111.317 1.00 51.20  ? 163  ASP A CG    1 
ATOM   1208  O OD1   . ASP A  1 163 ? 56.195  142.731 -112.159 1.00 52.38  ? 163  ASP A OD1   1 
ATOM   1209  O OD2   . ASP A  1 163 ? 55.205  144.620 -111.663 1.00 54.37  ? 163  ASP A OD2   1 
ATOM   1210  N N     . THR A  1 164 ? 57.961  145.405 -109.769 1.00 39.98  ? 164  THR A N     1 
ATOM   1211  C CA    . THR A  1 164 ? 58.739  146.545 -110.252 1.00 38.63  ? 164  THR A CA    1 
ATOM   1212  C C     . THR A  1 164 ? 59.509  147.142 -109.089 1.00 36.67  ? 164  THR A C     1 
ATOM   1213  O O     . THR A  1 164 ? 60.571  147.738 -109.271 1.00 36.68  ? 164  THR A O     1 
ATOM   1214  C CB    . THR A  1 164 ? 57.842  147.636 -110.908 1.00 38.01  ? 164  THR A CB    1 
ATOM   1215  O OG1   . THR A  1 164 ? 56.821  148.054 -109.988 1.00 37.79  ? 164  THR A OG1   1 
ATOM   1216  C CG2   . THR A  1 164 ? 57.209  147.089 -112.164 1.00 37.23  ? 164  THR A CG2   1 
ATOM   1217  N N     . ILE A  1 165 ? 58.953  147.003 -107.896 1.00 36.24  ? 165  ILE A N     1 
ATOM   1218  C CA    . ILE A  1 165 ? 59.648  147.478 -106.706 1.00 36.66  ? 165  ILE A CA    1 
ATOM   1219  C C     . ILE A  1 165 ? 60.015  146.191 -105.977 1.00 35.58  ? 165  ILE A C     1 
ATOM   1220  O O     . ILE A  1 165 ? 59.180  145.549 -105.345 1.00 34.98  ? 165  ILE A O     1 
ATOM   1221  C CB    . ILE A  1 165 ? 58.766  148.399 -105.847 1.00 35.67  ? 165  ILE A CB    1 
ATOM   1222  C CG1   . ILE A  1 165 ? 58.308  149.600 -106.697 1.00 37.39  ? 165  ILE A CG1   1 
ATOM   1223  C CG2   . ILE A  1 165 ? 59.582  148.942 -104.688 1.00 35.59  ? 165  ILE A CG2   1 
ATOM   1224  C CD1   . ILE A  1 165 ? 57.417  150.568 -105.976 1.00 37.39  ? 165  ILE A CD1   1 
ATOM   1225  N N     . VAL A  1 166 ? 61.285  145.822 -106.088 1.00 35.67  ? 166  VAL A N     1 
ATOM   1226  C CA    . VAL A  1 166 ? 61.773  144.571 -105.512 1.00 34.51  ? 166  VAL A CA    1 
ATOM   1227  C C     . VAL A  1 166 ? 62.824  144.626 -104.398 1.00 34.19  ? 166  VAL A C     1 
ATOM   1228  O O     . VAL A  1 166 ? 63.512  145.630 -104.191 1.00 33.10  ? 166  VAL A O     1 
ATOM   1229  C CB    . VAL A  1 166 ? 62.360  143.685 -106.626 1.00 33.15  ? 166  VAL A CB    1 
ATOM   1230  C CG1   . VAL A  1 166 ? 61.362  143.548 -107.762 1.00 33.28  ? 166  VAL A CG1   1 
ATOM   1231  C CG2   . VAL A  1 166 ? 63.654  144.298 -107.147 1.00 32.10  ? 166  VAL A CG2   1 
ATOM   1232  N N     . SER A  1 167 ? 62.913  143.507 -103.681 1.00 34.64  ? 167  SER A N     1 
ATOM   1233  C CA    . SER A  1 167 ? 63.912  143.318 -102.634 1.00 33.00  ? 167  SER A CA    1 
ATOM   1234  C C     . SER A  1 167 ? 64.863  142.418 -103.415 1.00 32.62  ? 167  SER A C     1 
ATOM   1235  O O     . SER A  1 167 ? 64.644  142.163 -104.614 1.00 32.52  ? 167  SER A O     1 
ATOM   1236  C CB    . SER A  1 167 ? 63.337  142.551 -101.448 1.00 32.11  ? 167  SER A CB    1 
ATOM   1237  O OG    . SER A  1 167 ? 63.224  141.172 -101.755 1.00 31.48  ? 167  SER A OG    1 
ATOM   1238  N N     . SER A  1 168 ? 65.911  141.931 -102.762 1.00 30.66  ? 168  SER A N     1 
ATOM   1239  C CA    . SER A  1 168 ? 66.860  141.074 -103.440 1.00 27.37  ? 168  SER A CA    1 
ATOM   1240  C C     . SER A  1 168 ? 66.165  139.839 -104.016 1.00 26.16  ? 168  SER A C     1 
ATOM   1241  O O     . SER A  1 168 ? 66.580  139.312 -105.037 1.00 24.78  ? 168  SER A O     1 
ATOM   1242  C CB    . SER A  1 168 ? 67.999  140.684 -102.479 1.00 27.32  ? 168  SER A CB    1 
ATOM   1243  O OG    . SER A  1 168 ? 67.463  140.295 -101.224 1.00 27.94  ? 168  SER A OG    1 
ATOM   1244  N N     . THR A  1 169 ? 65.089  139.388 -103.386 1.00 28.44  ? 169  THR A N     1 
ATOM   1245  C CA    . THR A  1 169 ? 64.380  138.211 -103.905 1.00 30.10  ? 169  THR A CA    1 
ATOM   1246  C C     . THR A  1 169 ? 63.848  138.416 -105.335 1.00 30.48  ? 169  THR A C     1 
ATOM   1247  O O     . THR A  1 169 ? 64.141  137.614 -106.230 1.00 30.58  ? 169  THR A O     1 
ATOM   1248  C CB    . THR A  1 169 ? 63.231  137.795 -102.960 1.00 30.16  ? 169  THR A CB    1 
ATOM   1249  O OG1   . THR A  1 169 ? 63.783  137.486 -101.678 1.00 31.52  ? 169  THR A OG1   1 
ATOM   1250  C CG2   . THR A  1 169 ? 62.496  136.533 -103.495 1.00 29.79  ? 169  THR A CG2   1 
ATOM   1251  N N     . GLY A  1 170 ? 63.070  139.476 -105.560 1.00 31.09  ? 170  GLY A N     1 
ATOM   1252  C CA    . GLY A  1 170 ? 62.578  139.753 -106.903 1.00 28.69  ? 170  GLY A CA    1 
ATOM   1253  C C     . GLY A  1 170 ? 63.715  140.120 -107.842 1.00 28.62  ? 170  GLY A C     1 
ATOM   1254  O O     . GLY A  1 170 ? 63.697  139.786 -109.029 1.00 29.84  ? 170  GLY A O     1 
ATOM   1255  N N     . ALA A  1 171 ? 64.733  140.803 -107.325 1.00 30.15  ? 171  ALA A N     1 
ATOM   1256  C CA    . ALA A  1 171 ? 65.869  141.164 -108.165 1.00 27.65  ? 171  ALA A CA    1 
ATOM   1257  C C     . ALA A  1 171 ? 66.571  139.912 -108.687 1.00 29.13  ? 171  ALA A C     1 
ATOM   1258  O O     . ALA A  1 171 ? 67.211  139.957 -109.753 1.00 29.09  ? 171  ALA A O     1 
ATOM   1259  C CB    . ALA A  1 171 ? 66.854  142.030 -107.380 1.00 29.08  ? 171  ALA A CB    1 
ATOM   1260  N N     . LEU A  1 172 ? 66.462  138.798 -107.952 1.00 29.23  ? 172  LEU A N     1 
ATOM   1261  C CA    . LEU A  1 172 ? 67.119  137.556 -108.379 1.00 30.61  ? 172  LEU A CA    1 
ATOM   1262  C C     . LEU A  1 172 ? 66.348  136.802 -109.448 1.00 32.17  ? 172  LEU A C     1 
ATOM   1263  O O     . LEU A  1 172 ? 66.897  135.895 -110.090 1.00 32.38  ? 172  LEU A O     1 
ATOM   1264  C CB    . LEU A  1 172 ? 67.368  136.617 -107.186 1.00 31.40  ? 172  LEU A CB    1 
ATOM   1265  C CG    . LEU A  1 172 ? 68.482  137.016 -106.180 1.00 32.39  ? 172  LEU A CG    1 
ATOM   1266  C CD1   . LEU A  1 172 ? 68.485  136.049 -104.990 1.00 33.33  ? 172  LEU A CD1   1 
ATOM   1267  C CD2   . LEU A  1 172 ? 69.846  137.006 -106.861 1.00 27.72  ? 172  LEU A CD2   1 
ATOM   1268  N N     . SER A  1 173 ? 65.083  137.182 -109.633 1.00 32.89  ? 173  SER A N     1 
ATOM   1269  C CA    . SER A  1 173 ? 64.217  136.538 -110.616 1.00 36.21  ? 173  SER A CA    1 
ATOM   1270  C C     . SER A  1 173 ? 63.547  137.469 -111.628 1.00 36.64  ? 173  SER A C     1 
ATOM   1271  O O     . SER A  1 173 ? 62.510  137.103 -112.180 1.00 36.16  ? 173  SER A O     1 
ATOM   1272  C CB    . SER A  1 173 ? 63.133  135.724 -109.900 1.00 36.96  ? 173  SER A CB    1 
ATOM   1273  O OG    . SER A  1 173 ? 63.714  134.640 -109.209 1.00 39.77  ? 173  SER A OG    1 
ATOM   1274  N N     . LEU A  1 174 ? 64.124  138.651 -111.865 1.00 37.82  ? 174  LEU A N     1 
ATOM   1275  C CA    . LEU A  1 174 ? 63.553  139.584 -112.838 1.00 39.31  ? 174  LEU A CA    1 
ATOM   1276  C C     . LEU A  1 174 ? 63.305  138.800 -114.112 1.00 40.84  ? 174  LEU A C     1 
ATOM   1277  O O     . LEU A  1 174 ? 64.120  137.957 -114.488 1.00 39.87  ? 174  LEU A O     1 
ATOM   1278  C CB    . LEU A  1 174 ? 64.497  140.757 -113.124 1.00 38.23  ? 174  LEU A CB    1 
ATOM   1279  C CG    . LEU A  1 174 ? 64.747  141.703 -111.945 1.00 37.83  ? 174  LEU A CG    1 
ATOM   1280  C CD1   . LEU A  1 174 ? 65.742  142.765 -112.349 1.00 36.93  ? 174  LEU A CD1   1 
ATOM   1281  C CD2   . LEU A  1 174 ? 63.459  142.365 -111.503 1.00 37.35  ? 174  LEU A CD2   1 
ATOM   1282  N N     . LYS A  1 175 ? 62.173  139.064 -114.750 1.00 43.17  ? 175  LYS A N     1 
ATOM   1283  C CA    . LYS A  1 175 ? 61.777  138.359 -115.966 1.00 45.78  ? 175  LYS A CA    1 
ATOM   1284  C C     . LYS A  1 175 ? 62.484  138.867 -117.212 1.00 45.98  ? 175  LYS A C     1 
ATOM   1285  O O     . LYS A  1 175 ? 62.597  138.153 -118.222 1.00 45.19  ? 175  LYS A O     1 
ATOM   1286  C CB    . LYS A  1 175 ? 60.258  138.454 -116.145 1.00 48.76  ? 175  LYS A CB    1 
ATOM   1287  C CG    . LYS A  1 175 ? 59.546  137.096 -116.120 1.00 53.14  ? 175  LYS A CG    1 
ATOM   1288  C CD    . LYS A  1 175 ? 59.896  136.259 -117.352 1.00 56.55  ? 175  LYS A CD    1 
ATOM   1289  C CE    . LYS A  1 175 ? 58.872  135.143 -117.598 1.00 57.60  ? 175  LYS A CE    1 
ATOM   1290  N NZ    . LYS A  1 175 ? 59.227  134.346 -118.809 1.00 58.13  ? 175  LYS A NZ    1 
ATOM   1291  N N     . LYS A  1 176 ? 62.973  140.095 -117.128 1.00 44.93  ? 176  LYS A N     1 
ATOM   1292  C CA    . LYS A  1 176 ? 63.687  140.688 -118.236 1.00 45.57  ? 176  LYS A CA    1 
ATOM   1293  C C     . LYS A  1 176 ? 64.672  141.702 -117.721 1.00 43.92  ? 176  LYS A C     1 
ATOM   1294  O O     . LYS A  1 176 ? 64.546  142.175 -116.597 1.00 43.75  ? 176  LYS A O     1 
ATOM   1295  C CB    . LYS A  1 176 ? 62.713  141.338 -119.216 1.00 48.71  ? 176  LYS A CB    1 
ATOM   1296  C CG    . LYS A  1 176 ? 62.135  140.319 -120.192 1.00 54.02  ? 176  LYS A CG    1 
ATOM   1297  C CD    . LYS A  1 176 ? 63.270  139.582 -120.951 1.00 56.76  ? 176  LYS A CD    1 
ATOM   1298  C CE    . LYS A  1 176 ? 62.799  138.297 -121.639 1.00 58.13  ? 176  LYS A CE    1 
ATOM   1299  N NZ    . LYS A  1 176 ? 62.518  137.180 -120.676 1.00 58.91  ? 176  LYS A NZ    1 
ATOM   1300  N N     . VAL A  1 177 ? 65.657  142.028 -118.542 1.00 42.28  ? 177  VAL A N     1 
ATOM   1301  C CA    . VAL A  1 177 ? 66.673  142.989 -118.141 1.00 41.34  ? 177  VAL A CA    1 
ATOM   1302  C C     . VAL A  1 177 ? 66.048  144.384 -118.100 1.00 41.62  ? 177  VAL A C     1 
ATOM   1303  O O     . VAL A  1 177 ? 65.532  144.856 -119.112 1.00 42.18  ? 177  VAL A O     1 
ATOM   1304  C CB    . VAL A  1 177 ? 67.855  143.006 -119.150 1.00 41.03  ? 177  VAL A CB    1 
ATOM   1305  C CG1   . VAL A  1 177 ? 68.944  143.935 -118.653 1.00 39.78  ? 177  VAL A CG1   1 
ATOM   1306  C CG2   . VAL A  1 177 ? 68.400  141.596 -119.386 1.00 38.10  ? 177  VAL A CG2   1 
ATOM   1307  N N     . PRO A  1 178 ? 66.067  145.061 -116.935 1.00 41.37  ? 178  PRO A N     1 
ATOM   1308  C CA    . PRO A  1 178 ? 65.459  146.397 -116.957 1.00 40.43  ? 178  PRO A CA    1 
ATOM   1309  C C     . PRO A  1 178 ? 66.306  147.398 -117.736 1.00 41.58  ? 178  PRO A C     1 
ATOM   1310  O O     . PRO A  1 178 ? 67.539  147.339 -117.742 1.00 39.59  ? 178  PRO A O     1 
ATOM   1311  C CB    . PRO A  1 178 ? 65.343  146.747 -115.478 1.00 41.60  ? 178  PRO A CB    1 
ATOM   1312  C CG    . PRO A  1 178 ? 66.502  146.021 -114.872 1.00 39.82  ? 178  PRO A CG    1 
ATOM   1313  C CD    . PRO A  1 178 ? 66.463  144.689 -115.565 1.00 40.23  ? 178  PRO A CD    1 
ATOM   1314  N N     . GLU A  1 179 ? 65.622  148.317 -118.406 1.00 42.73  ? 179  GLU A N     1 
ATOM   1315  C CA    . GLU A  1 179 ? 66.279  149.333 -119.199 1.00 43.56  ? 179  GLU A CA    1 
ATOM   1316  C C     . GLU A  1 179 ? 67.041  150.231 -118.240 1.00 41.70  ? 179  GLU A C     1 
ATOM   1317  O O     . GLU A  1 179 ? 68.203  150.534 -118.454 1.00 41.09  ? 179  GLU A O     1 
ATOM   1318  C CB    . GLU A  1 179 ? 65.207  150.122 -119.948 1.00 46.11  ? 179  GLU A CB    1 
ATOM   1319  C CG    . GLU A  1 179 ? 65.676  151.200 -120.877 1.00 50.20  ? 179  GLU A CG    1 
ATOM   1320  C CD    . GLU A  1 179 ? 64.500  152.069 -121.320 1.00 53.07  ? 179  GLU A CD    1 
ATOM   1321  O OE1   . GLU A  1 179 ? 63.579  151.531 -121.982 1.00 54.20  ? 179  GLU A OE1   1 
ATOM   1322  O OE2   . GLU A  1 179 ? 64.491  153.279 -120.981 1.00 53.68  ? 179  GLU A OE2   1 
ATOM   1323  N N     . LYS A  1 180 ? 66.370  150.626 -117.168 1.00 41.35  ? 180  LYS A N     1 
ATOM   1324  C CA    . LYS A  1 180 ? 66.952  151.507 -116.167 1.00 42.03  ? 180  LYS A CA    1 
ATOM   1325  C C     . LYS A  1 180 ? 66.636  150.994 -114.759 1.00 40.41  ? 180  LYS A C     1 
ATOM   1326  O O     . LYS A  1 180 ? 65.495  150.649 -114.449 1.00 38.26  ? 180  LYS A O     1 
ATOM   1327  C CB    . LYS A  1 180 ? 66.383  152.918 -116.353 1.00 45.47  ? 180  LYS A CB    1 
ATOM   1328  C CG    . LYS A  1 180 ? 67.082  154.008 -115.580 1.00 49.32  ? 180  LYS A CG    1 
ATOM   1329  C CD    . LYS A  1 180 ? 67.599  155.056 -116.549 1.00 53.54  ? 180  LYS A CD    1 
ATOM   1330  C CE    . LYS A  1 180 ? 68.060  156.339 -115.838 1.00 56.43  ? 180  LYS A CE    1 
ATOM   1331  N NZ    . LYS A  1 180 ? 66.937  157.148 -115.251 1.00 56.80  ? 180  LYS A NZ    1 
ATOM   1332  N N     . MET A  1 181 ? 67.646  150.935 -113.898 1.00 40.11  ? 181  MET A N     1 
ATOM   1333  C CA    . MET A  1 181 ? 67.412  150.458 -112.531 1.00 37.25  ? 181  MET A CA    1 
ATOM   1334  C C     . MET A  1 181 ? 68.088  151.327 -111.496 1.00 35.23  ? 181  MET A C     1 
ATOM   1335  O O     . MET A  1 181 ? 69.240  151.732 -111.663 1.00 33.14  ? 181  MET A O     1 
ATOM   1336  C CB    . MET A  1 181 ? 67.908  149.008 -112.372 1.00 37.57  ? 181  MET A CB    1 
ATOM   1337  C CG    . MET A  1 181 ? 67.769  148.424 -110.951 1.00 39.54  ? 181  MET A CG    1 
ATOM   1338  S SD    . MET A  1 181 ? 68.584  146.781 -110.720 1.00 41.90  ? 181  MET A SD    1 
ATOM   1339  C CE    . MET A  1 181 ? 67.479  145.772 -111.618 1.00 42.11  ? 181  MET A CE    1 
ATOM   1340  N N     . VAL A  1 182 ? 67.354  151.623 -110.434 1.00 34.51  ? 182  VAL A N     1 
ATOM   1341  C CA    . VAL A  1 182 ? 67.917  152.385 -109.333 1.00 36.34  ? 182  VAL A CA    1 
ATOM   1342  C C     . VAL A  1 182 ? 67.959  151.446 -108.131 1.00 35.54  ? 182  VAL A C     1 
ATOM   1343  O O     . VAL A  1 182 ? 67.051  150.656 -107.924 1.00 36.24  ? 182  VAL A O     1 
ATOM   1344  C CB    . VAL A  1 182 ? 67.062  153.606 -108.946 1.00 37.07  ? 182  VAL A CB    1 
ATOM   1345  C CG1   . VAL A  1 182 ? 65.654  153.181 -108.715 1.00 40.00  ? 182  VAL A CG1   1 
ATOM   1346  C CG2   . VAL A  1 182 ? 67.591  154.233 -107.637 1.00 38.96  ? 182  VAL A CG2   1 
ATOM   1347  N N     . VAL A  1 183 ? 69.016  151.535 -107.341 1.00 36.21  ? 183  VAL A N     1 
ATOM   1348  C CA    . VAL A  1 183 ? 69.138  150.693 -106.169 1.00 34.97  ? 183  VAL A CA    1 
ATOM   1349  C C     . VAL A  1 183 ? 69.273  151.558 -104.926 1.00 34.78  ? 183  VAL A C     1 
ATOM   1350  O O     . VAL A  1 183 ? 70.089  152.493 -104.882 1.00 34.03  ? 183  VAL A O     1 
ATOM   1351  C CB    . VAL A  1 183 ? 70.380  149.782 -106.259 1.00 35.62  ? 183  VAL A CB    1 
ATOM   1352  C CG1   . VAL A  1 183 ? 70.438  148.887 -105.028 1.00 37.02  ? 183  VAL A CG1   1 
ATOM   1353  C CG2   . VAL A  1 183 ? 70.356  148.965 -107.539 1.00 33.37  ? 183  VAL A CG2   1 
ATOM   1354  N N     . ILE A  1 184 ? 68.476  151.248 -103.912 1.00 34.10  ? 184  ILE A N     1 
ATOM   1355  C CA    . ILE A  1 184 ? 68.555  151.993 -102.670 1.00 33.70  ? 184  ILE A CA    1 
ATOM   1356  C C     . ILE A  1 184 ? 69.518  151.235 -101.775 1.00 34.19  ? 184  ILE A C     1 
ATOM   1357  O O     . ILE A  1 184 ? 69.219  150.114 -101.326 1.00 33.22  ? 184  ILE A O     1 
ATOM   1358  C CB    . ILE A  1 184 ? 67.201  152.072 -101.949 1.00 32.75  ? 184  ILE A CB    1 
ATOM   1359  C CG1   . ILE A  1 184 ? 66.109  152.508 -102.932 1.00 33.37  ? 184  ILE A CG1   1 
ATOM   1360  C CG2   . ILE A  1 184 ? 67.294  153.065 -100.799 1.00 33.18  ? 184  ILE A CG2   1 
ATOM   1361  C CD1   . ILE A  1 184 ? 64.718  152.637 -102.298 1.00 32.78  ? 184  ILE A CD1   1 
ATOM   1362  N N     . GLY A  1 185 ? 70.674  151.850 -101.533 1.00 33.44  ? 185  GLY A N     1 
ATOM   1363  C CA    . GLY A  1 185 ? 71.697  151.242 -100.705 1.00 34.25  ? 185  GLY A CA    1 
ATOM   1364  C C     . GLY A  1 185 ? 72.838  150.656 -101.518 1.00 33.90  ? 185  GLY A C     1 
ATOM   1365  O O     . GLY A  1 185 ? 72.637  149.715 -102.297 1.00 36.19  ? 185  GLY A O     1 
ATOM   1366  N N     . ALA A  1 186 ? 74.027  151.227 -101.349 1.00 32.36  ? 186  ALA A N     1 
ATOM   1367  C CA    . ALA A  1 186 ? 75.226  150.762 -102.035 1.00 31.21  ? 186  ALA A CA    1 
ATOM   1368  C C     . ALA A  1 186 ? 75.996  149.817 -101.101 1.00 30.21  ? 186  ALA A C     1 
ATOM   1369  O O     . ALA A  1 186 ? 77.216  149.918 -100.952 1.00 30.01  ? 186  ALA A O     1 
ATOM   1370  C CB    . ALA A  1 186 ? 76.105  151.940 -102.433 1.00 29.98  ? 186  ALA A CB    1 
ATOM   1371  N N     . GLY A  1 187 ? 75.254  148.915 -100.460 1.00 30.35  ? 187  GLY A N     1 
ATOM   1372  C CA    . GLY A  1 187 ? 75.845  147.938 -99.569  1.00 29.72  ? 187  GLY A CA    1 
ATOM   1373  C C     . GLY A  1 187 ? 76.248  146.745 -100.405 1.00 30.48  ? 187  GLY A C     1 
ATOM   1374  O O     . GLY A  1 187 ? 76.346  146.844 -101.647 1.00 29.60  ? 187  GLY A O     1 
ATOM   1375  N N     . VAL A  1 188 ? 76.464  145.602 -99.751  1.00 30.24  ? 188  VAL A N     1 
ATOM   1376  C CA    . VAL A  1 188 ? 76.907  144.414 -100.485 1.00 29.86  ? 188  VAL A CA    1 
ATOM   1377  C C     . VAL A  1 188 ? 75.909  143.944 -101.545 1.00 29.41  ? 188  VAL A C     1 
ATOM   1378  O O     . VAL A  1 188 ? 76.295  143.719 -102.699 1.00 27.83  ? 188  VAL A O     1 
ATOM   1379  C CB    . VAL A  1 188 ? 77.266  143.238 -99.515  1.00 29.74  ? 188  VAL A CB    1 
ATOM   1380  C CG1   . VAL A  1 188 ? 78.017  142.136 -100.273 1.00 27.42  ? 188  VAL A CG1   1 
ATOM   1381  C CG2   . VAL A  1 188 ? 78.152  143.759 -98.388  1.00 29.50  ? 188  VAL A CG2   1 
ATOM   1382  N N     . ILE A  1 189 ? 74.640  143.790 -101.164 1.00 30.83  ? 189  ILE A N     1 
ATOM   1383  C CA    . ILE A  1 189 ? 73.607  143.358 -102.122 1.00 33.64  ? 189  ILE A CA    1 
ATOM   1384  C C     . ILE A  1 189 ? 73.460  144.343 -103.290 1.00 32.89  ? 189  ILE A C     1 
ATOM   1385  O O     . ILE A  1 189 ? 73.423  143.936 -104.451 1.00 32.78  ? 189  ILE A O     1 
ATOM   1386  C CB    . ILE A  1 189 ? 72.213  143.221 -101.445 1.00 34.70  ? 189  ILE A CB    1 
ATOM   1387  C CG1   . ILE A  1 189 ? 72.182  141.984 -100.566 1.00 34.95  ? 189  ILE A CG1   1 
ATOM   1388  C CG2   . ILE A  1 189 ? 71.109  143.119 -102.503 1.00 35.22  ? 189  ILE A CG2   1 
ATOM   1389  C CD1   . ILE A  1 189 ? 70.864  141.771 -99.846  1.00 36.23  ? 189  ILE A CD1   1 
ATOM   1390  N N     . GLY A  1 190 ? 73.367  145.631 -102.955 1.00 32.52  ? 190  GLY A N     1 
ATOM   1391  C CA    . GLY A  1 190 ? 73.216  146.666 -103.956 1.00 32.16  ? 190  GLY A CA    1 
ATOM   1392  C C     . GLY A  1 190 ? 74.325  146.591 -104.969 1.00 33.02  ? 190  GLY A C     1 
ATOM   1393  O O     . GLY A  1 190 ? 74.085  146.645 -106.176 1.00 34.04  ? 190  GLY A O     1 
ATOM   1394  N N     . VAL A  1 191 ? 75.552  146.444 -104.499 1.00 31.61  ? 191  VAL A N     1 
ATOM   1395  C CA    . VAL A  1 191 ? 76.666  146.368 -105.428 1.00 31.19  ? 191  VAL A CA    1 
ATOM   1396  C C     . VAL A  1 191 ? 76.680  145.055 -106.229 1.00 30.36  ? 191  VAL A C     1 
ATOM   1397  O O     . VAL A  1 191 ? 76.903  145.070 -107.435 1.00 29.83  ? 191  VAL A O     1 
ATOM   1398  C CB    . VAL A  1 191 ? 78.004  146.574 -104.684 1.00 33.10  ? 191  VAL A CB    1 
ATOM   1399  C CG1   . VAL A  1 191 ? 79.154  146.319 -105.605 1.00 35.05  ? 191  VAL A CG1   1 
ATOM   1400  C CG2   . VAL A  1 191 ? 78.098  148.017 -104.179 1.00 32.58  ? 191  VAL A CG2   1 
ATOM   1401  N N     . GLU A  1 192 ? 76.424  143.924 -105.582 1.00 28.65  ? 192  GLU A N     1 
ATOM   1402  C CA    . GLU A  1 192 ? 76.426  142.654 -106.319 1.00 27.96  ? 192  GLU A CA    1 
ATOM   1403  C C     . GLU A  1 192 ? 75.303  142.543 -107.386 1.00 27.34  ? 192  GLU A C     1 
ATOM   1404  O O     . GLU A  1 192 ? 75.570  142.319 -108.567 1.00 29.27  ? 192  GLU A O     1 
ATOM   1405  C CB    . GLU A  1 192 ? 76.343  141.449 -105.347 1.00 24.74  ? 192  GLU A CB    1 
ATOM   1406  C CG    . GLU A  1 192 ? 77.560  141.302 -104.410 1.00 26.85  ? 192  GLU A CG    1 
ATOM   1407  C CD    . GLU A  1 192 ? 77.623  139.958 -103.656 1.00 28.58  ? 192  GLU A CD    1 
ATOM   1408  O OE1   . GLU A  1 192 ? 76.584  139.266 -103.506 1.00 27.09  ? 192  GLU A OE1   1 
ATOM   1409  O OE2   . GLU A  1 192 ? 78.732  139.598 -103.195 1.00 27.41  ? 192  GLU A OE2   1 
ATOM   1410  N N     . LEU A  1 193 ? 74.056  142.706 -106.973 1.00 26.61  ? 193  LEU A N     1 
ATOM   1411  C CA    . LEU A  1 193 ? 72.948  142.589 -107.909 1.00 27.00  ? 193  LEU A CA    1 
ATOM   1412  C C     . LEU A  1 193 ? 72.936  143.733 -108.919 1.00 29.45  ? 193  LEU A C     1 
ATOM   1413  O O     . LEU A  1 193 ? 72.538  143.549 -110.068 1.00 30.39  ? 193  LEU A O     1 
ATOM   1414  C CB    . LEU A  1 193 ? 71.630  142.513 -107.134 1.00 26.36  ? 193  LEU A CB    1 
ATOM   1415  C CG    . LEU A  1 193 ? 71.679  141.419 -106.051 1.00 24.19  ? 193  LEU A CG    1 
ATOM   1416  C CD1   . LEU A  1 193 ? 70.333  141.244 -105.391 1.00 23.37  ? 193  LEU A CD1   1 
ATOM   1417  C CD2   . LEU A  1 193 ? 72.120  140.104 -106.704 1.00 25.86  ? 193  LEU A CD2   1 
ATOM   1418  N N     . GLY A  1 194 ? 73.381  144.910 -108.490 1.00 30.01  ? 194  GLY A N     1 
ATOM   1419  C CA    . GLY A  1 194 ? 73.432  146.025 -109.401 1.00 30.44  ? 194  GLY A CA    1 
ATOM   1420  C C     . GLY A  1 194 ? 74.379  145.652 -110.506 1.00 30.50  ? 194  GLY A C     1 
ATOM   1421  O O     . GLY A  1 194 ? 74.119  145.965 -111.662 1.00 31.45  ? 194  GLY A O     1 
ATOM   1422  N N     . SER A  1 195 ? 75.467  144.956 -110.159 1.00 30.52  ? 195  SER A N     1 
ATOM   1423  C CA    . SER A  1 195 ? 76.461  144.570 -111.152 1.00 30.05  ? 195  SER A CA    1 
ATOM   1424  C C     . SER A  1 195 ? 75.935  143.543 -112.100 1.00 30.53  ? 195  SER A C     1 
ATOM   1425  O O     . SER A  1 195 ? 76.221  143.595 -113.302 1.00 28.40  ? 195  SER A O     1 
ATOM   1426  C CB    . SER A  1 195 ? 77.711  144.011 -110.510 1.00 31.30  ? 195  SER A CB    1 
ATOM   1427  O OG    . SER A  1 195 ? 78.588  145.044 -110.147 1.00 35.62  ? 195  SER A OG    1 
ATOM   1428  N N     . VAL A  1 196 ? 75.208  142.574 -111.544 1.00 29.37  ? 196  VAL A N     1 
ATOM   1429  C CA    . VAL A  1 196 ? 74.613  141.529 -112.358 1.00 28.37  ? 196  VAL A CA    1 
ATOM   1430  C C     . VAL A  1 196 ? 73.804  142.173 -113.496 1.00 30.13  ? 196  VAL A C     1 
ATOM   1431  O O     . VAL A  1 196 ? 74.119  141.993 -114.682 1.00 28.48  ? 196  VAL A O     1 
ATOM   1432  C CB    . VAL A  1 196 ? 73.672  140.633 -111.509 1.00 26.39  ? 196  VAL A CB    1 
ATOM   1433  C CG1   . VAL A  1 196 ? 72.783  139.830 -112.414 1.00 24.93  ? 196  VAL A CG1   1 
ATOM   1434  C CG2   . VAL A  1 196 ? 74.505  139.693 -110.579 1.00 23.58  ? 196  VAL A CG2   1 
ATOM   1435  N N     . TRP A  1 197 ? 72.784  142.941 -113.130 1.00 30.43  ? 197  TRP A N     1 
ATOM   1436  C CA    . TRP A  1 197 ? 71.920  143.539 -114.137 1.00 32.69  ? 197  TRP A CA    1 
ATOM   1437  C C     . TRP A  1 197 ? 72.621  144.530 -115.061 1.00 32.85  ? 197  TRP A C     1 
ATOM   1438  O O     . TRP A  1 197 ? 72.343  144.581 -116.256 1.00 33.03  ? 197  TRP A O     1 
ATOM   1439  C CB    . TRP A  1 197 ? 70.687  144.128 -113.453 1.00 32.02  ? 197  TRP A CB    1 
ATOM   1440  C CG    . TRP A  1 197 ? 69.837  143.024 -112.873 1.00 33.11  ? 197  TRP A CG    1 
ATOM   1441  C CD1   . TRP A  1 197 ? 69.665  142.733 -111.545 1.00 34.19  ? 197  TRP A CD1   1 
ATOM   1442  C CD2   . TRP A  1 197 ? 69.128  141.998 -113.600 1.00 33.18  ? 197  TRP A CD2   1 
ATOM   1443  N NE1   . TRP A  1 197 ? 68.904  141.590 -111.403 1.00 34.05  ? 197  TRP A NE1   1 
ATOM   1444  C CE2   . TRP A  1 197 ? 68.560  141.121 -112.645 1.00 32.47  ? 197  TRP A CE2   1 
ATOM   1445  C CE3   . TRP A  1 197 ? 68.919  141.732 -114.962 1.00 32.75  ? 197  TRP A CE3   1 
ATOM   1446  C CZ2   . TRP A  1 197 ? 67.800  139.996 -113.008 1.00 31.66  ? 197  TRP A CZ2   1 
ATOM   1447  C CZ3   . TRP A  1 197 ? 68.163  140.608 -115.322 1.00 32.54  ? 197  TRP A CZ3   1 
ATOM   1448  C CH2   . TRP A  1 197 ? 67.612  139.757 -114.346 1.00 30.72  ? 197  TRP A CH2   1 
ATOM   1449  N N     . GLN A  1 198 ? 73.555  145.296 -114.514 1.00 34.56  ? 198  GLN A N     1 
ATOM   1450  C CA    . GLN A  1 198 ? 74.310  146.238 -115.313 1.00 35.15  ? 198  GLN A CA    1 
ATOM   1451  C C     . GLN A  1 198 ? 74.945  145.421 -116.448 1.00 36.07  ? 198  GLN A C     1 
ATOM   1452  O O     . GLN A  1 198 ? 74.762  145.697 -117.636 1.00 35.42  ? 198  GLN A O     1 
ATOM   1453  C CB    . GLN A  1 198 ? 75.362  146.901 -114.421 1.00 37.28  ? 198  GLN A CB    1 
ATOM   1454  C CG    . GLN A  1 198 ? 76.162  148.012 -115.071 1.00 38.32  ? 198  GLN A CG    1 
ATOM   1455  C CD    . GLN A  1 198 ? 77.319  147.482 -115.878 1.00 41.18  ? 198  GLN A CD    1 
ATOM   1456  O OE1   . GLN A  1 198 ? 78.146  146.708 -115.371 1.00 40.38  ? 198  GLN A OE1   1 
ATOM   1457  N NE2   . GLN A  1 198 ? 77.394  147.892 -117.141 1.00 41.61  ? 198  GLN A NE2   1 
ATOM   1458  N N     . ARG A  1 199 ? 75.669  144.383 -116.075 1.00 34.80  ? 199  ARG A N     1 
ATOM   1459  C CA    . ARG A  1 199 ? 76.301  143.505 -117.044 1.00 35.71  ? 199  ARG A CA    1 
ATOM   1460  C C     . ARG A  1 199 ? 75.353  142.969 -118.114 1.00 35.92  ? 199  ARG A C     1 
ATOM   1461  O O     . ARG A  1 199 ? 75.740  142.778 -119.266 1.00 34.67  ? 199  ARG A O     1 
ATOM   1462  C CB    . ARG A  1 199 ? 76.905  142.304 -116.322 1.00 36.93  ? 199  ARG A CB    1 
ATOM   1463  C CG    . ARG A  1 199 ? 78.020  142.646 -115.358 1.00 38.28  ? 199  ARG A CG    1 
ATOM   1464  C CD    . ARG A  1 199 ? 78.321  141.438 -114.478 1.00 37.71  ? 199  ARG A CD    1 
ATOM   1465  N NE    . ARG A  1 199 ? 79.376  141.715 -113.508 1.00 37.86  ? 199  ARG A NE    1 
ATOM   1466  C CZ    . ARG A  1 199 ? 79.786  140.835 -112.599 1.00 38.16  ? 199  ARG A CZ    1 
ATOM   1467  N NH1   . ARG A  1 199 ? 79.219  139.632 -112.542 1.00 34.42  ? 199  ARG A NH1   1 
ATOM   1468  N NH2   . ARG A  1 199 ? 80.775  141.143 -111.774 1.00 36.75  ? 199  ARG A NH2   1 
ATOM   1469  N N     . LEU A  1 200 ? 74.119  142.690 -117.727 1.00 35.64  ? 200  LEU A N     1 
ATOM   1470  C CA    . LEU A  1 200 ? 73.186  142.134 -118.681 1.00 37.06  ? 200  LEU A CA    1 
ATOM   1471  C C     . LEU A  1 200 ? 72.489  143.200 -119.546 1.00 38.00  ? 200  LEU A C     1 
ATOM   1472  O O     . LEU A  1 200 ? 71.559  142.888 -120.280 1.00 37.89  ? 200  LEU A O     1 
ATOM   1473  C CB    . LEU A  1 200 ? 72.165  141.270 -117.944 1.00 33.17  ? 200  LEU A CB    1 
ATOM   1474  C CG    . LEU A  1 200 ? 72.783  140.090 -117.173 1.00 32.12  ? 200  LEU A CG    1 
ATOM   1475  C CD1   . LEU A  1 200 ? 71.681  139.314 -116.502 1.00 30.48  ? 200  LEU A CD1   1 
ATOM   1476  C CD2   . LEU A  1 200 ? 73.569  139.185 -118.106 1.00 30.80  ? 200  LEU A CD2   1 
ATOM   1477  N N     . GLY A  1 201 ? 72.936  144.449 -119.442 1.00 39.37  ? 201  GLY A N     1 
ATOM   1478  C CA    . GLY A  1 201 ? 72.353  145.515 -120.251 1.00 39.35  ? 201  GLY A CA    1 
ATOM   1479  C C     . GLY A  1 201 ? 71.640  146.654 -119.540 1.00 38.98  ? 201  GLY A C     1 
ATOM   1480  O O     . GLY A  1 201 ? 71.355  147.680 -120.151 1.00 39.12  ? 201  GLY A O     1 
ATOM   1481  N N     . ALA A  1 202 ? 71.349  146.500 -118.255 1.00 38.04  ? 202  ALA A N     1 
ATOM   1482  C CA    . ALA A  1 202 ? 70.665  147.548 -117.518 1.00 37.61  ? 202  ALA A CA    1 
ATOM   1483  C C     . ALA A  1 202 ? 71.521  148.783 -117.205 1.00 38.51  ? 202  ALA A C     1 
ATOM   1484  O O     . ALA A  1 202 ? 72.743  148.693 -117.032 1.00 37.72  ? 202  ALA A O     1 
ATOM   1485  C CB    . ALA A  1 202 ? 70.092  146.979 -116.216 1.00 37.27  ? 202  ALA A CB    1 
ATOM   1486  N N     . ASP A  1 203 ? 70.847  149.935 -117.155 1.00 38.86  ? 203  ASP A N     1 
ATOM   1487  C CA    . ASP A  1 203 ? 71.447  151.219 -116.808 1.00 38.82  ? 203  ASP A CA    1 
ATOM   1488  C C     . ASP A  1 203 ? 71.156  151.310 -115.313 1.00 37.90  ? 203  ASP A C     1 
ATOM   1489  O O     . ASP A  1 203 ? 70.012  151.534 -114.898 1.00 36.69  ? 203  ASP A O     1 
ATOM   1490  C CB    . ASP A  1 203 ? 70.735  152.354 -117.553 1.00 42.75  ? 203  ASP A CB    1 
ATOM   1491  C CG    . ASP A  1 203 ? 71.424  153.688 -117.377 1.00 44.43  ? 203  ASP A CG    1 
ATOM   1492  O OD1   . ASP A  1 203 ? 71.610  154.100 -116.219 1.00 45.09  ? 203  ASP A OD1   1 
ATOM   1493  O OD2   . ASP A  1 203 ? 71.767  154.326 -118.398 1.00 48.57  ? 203  ASP A OD2   1 
ATOM   1494  N N     . VAL A  1 204 ? 72.206  151.141 -114.515 1.00 37.22  ? 204  VAL A N     1 
ATOM   1495  C CA    . VAL A  1 204 ? 72.083  151.110 -113.067 1.00 36.38  ? 204  VAL A CA    1 
ATOM   1496  C C     . VAL A  1 204 ? 72.694  152.242 -112.268 1.00 35.20  ? 204  VAL A C     1 
ATOM   1497  O O     . VAL A  1 204 ? 73.818  152.655 -112.512 1.00 34.32  ? 204  VAL A O     1 
ATOM   1498  C CB    . VAL A  1 204 ? 72.705  149.800 -112.520 1.00 36.86  ? 204  VAL A CB    1 
ATOM   1499  C CG1   . VAL A  1 204 ? 72.400  149.642 -111.021 1.00 36.43  ? 204  VAL A CG1   1 
ATOM   1500  C CG2   . VAL A  1 204 ? 72.204  148.614 -113.329 1.00 35.80  ? 204  VAL A CG2   1 
ATOM   1501  N N     . THR A  1 205 ? 71.934  152.711 -111.287 1.00 34.77  ? 205  THR A N     1 
ATOM   1502  C CA    . THR A  1 205 ? 72.389  153.737 -110.364 1.00 34.04  ? 205  THR A CA    1 
ATOM   1503  C C     . THR A  1 205 ? 72.008  153.308 -108.955 1.00 34.57  ? 205  THR A C     1 
ATOM   1504  O O     . THR A  1 205 ? 70.875  152.887 -108.709 1.00 34.89  ? 205  THR A O     1 
ATOM   1505  C CB    . THR A  1 205 ? 71.730  155.104 -110.604 1.00 33.42  ? 205  THR A CB    1 
ATOM   1506  O OG1   . THR A  1 205 ? 72.009  155.543 -111.935 1.00 31.26  ? 205  THR A OG1   1 
ATOM   1507  C CG2   . THR A  1 205 ? 72.280  156.120 -109.597 1.00 33.24  ? 205  THR A CG2   1 
ATOM   1508  N N     . ALA A  1 206 ? 72.968  153.398 -108.038 1.00 35.16  ? 206  ALA A N     1 
ATOM   1509  C CA    . ALA A  1 206 ? 72.722  153.059 -106.648 1.00 36.35  ? 206  ALA A CA    1 
ATOM   1510  C C     . ALA A  1 206 ? 72.754  154.378 -105.902 1.00 36.73  ? 206  ALA A C     1 
ATOM   1511  O O     . ALA A  1 206 ? 73.635  155.202 -106.141 1.00 36.04  ? 206  ALA A O     1 
ATOM   1512  C CB    . ALA A  1 206 ? 73.828  152.107 -106.104 1.00 35.70  ? 206  ALA A CB    1 
ATOM   1513  N N     . VAL A  1 207 ? 71.776  154.590 -105.025 1.00 37.99  ? 207  VAL A N     1 
ATOM   1514  C CA    . VAL A  1 207 ? 71.730  155.803 -104.222 1.00 39.18  ? 207  VAL A CA    1 
ATOM   1515  C C     . VAL A  1 207 ? 72.046  155.390 -102.799 1.00 39.31  ? 207  VAL A C     1 
ATOM   1516  O O     . VAL A  1 207 ? 71.341  154.565 -102.219 1.00 40.08  ? 207  VAL A O     1 
ATOM   1517  C CB    . VAL A  1 207 ? 70.353  156.459 -104.286 1.00 40.40  ? 207  VAL A CB    1 
ATOM   1518  C CG1   . VAL A  1 207 ? 70.289  157.634 -103.316 1.00 40.09  ? 207  VAL A CG1   1 
ATOM   1519  C CG2   . VAL A  1 207 ? 70.093  156.924 -105.724 1.00 41.04  ? 207  VAL A CG2   1 
ATOM   1520  N N     . GLU A  1 208 ? 73.108  155.967 -102.247 1.00 38.98  ? 208  GLU A N     1 
ATOM   1521  C CA    . GLU A  1 208 ? 73.572  155.631 -100.908 1.00 38.71  ? 208  GLU A CA    1 
ATOM   1522  C C     . GLU A  1 208 ? 73.603  156.816 -99.947  1.00 39.72  ? 208  GLU A C     1 
ATOM   1523  O O     . GLU A  1 208 ? 74.180  157.860 -100.241 1.00 39.04  ? 208  GLU A O     1 
ATOM   1524  C CB    . GLU A  1 208 ? 74.973  155.008 -101.024 1.00 37.36  ? 208  GLU A CB    1 
ATOM   1525  C CG    . GLU A  1 208 ? 75.726  154.812 -99.714  1.00 36.48  ? 208  GLU A CG    1 
ATOM   1526  C CD    . GLU A  1 208 ? 75.017  153.861 -98.760  1.00 35.00  ? 208  GLU A CD    1 
ATOM   1527  O OE1   . GLU A  1 208 ? 74.681  152.740 -99.186  1.00 34.65  ? 208  GLU A OE1   1 
ATOM   1528  O OE2   . GLU A  1 208 ? 74.803  154.229 -97.586  1.00 35.09  ? 208  GLU A OE2   1 
ATOM   1529  N N     . PHE A  1 209 ? 72.976  156.628 -98.791  1.00 41.58  ? 209  PHE A N     1 
ATOM   1530  C CA    . PHE A  1 209 ? 72.915  157.641 -97.746  1.00 42.32  ? 209  PHE A CA    1 
ATOM   1531  C C     . PHE A  1 209 ? 74.305  158.001 -97.204  1.00 42.43  ? 209  PHE A C     1 
ATOM   1532  O O     . PHE A  1 209 ? 74.568  159.158 -96.882  1.00 41.87  ? 209  PHE A O     1 
ATOM   1533  C CB    . PHE A  1 209 ? 72.050  157.122 -96.606  1.00 45.03  ? 209  PHE A CB    1 
ATOM   1534  C CG    . PHE A  1 209 ? 71.856  158.107 -95.490  1.00 48.85  ? 209  PHE A CG    1 
ATOM   1535  C CD1   . PHE A  1 209 ? 70.884  159.095 -95.580  1.00 50.81  ? 209  PHE A CD1   1 
ATOM   1536  C CD2   . PHE A  1 209 ? 72.635  158.039 -94.337  1.00 49.81  ? 209  PHE A CD2   1 
ATOM   1537  C CE1   . PHE A  1 209 ? 70.680  160.003 -94.528  1.00 51.90  ? 209  PHE A CE1   1 
ATOM   1538  C CE2   . PHE A  1 209 ? 72.442  158.936 -93.285  1.00 51.49  ? 209  PHE A CE2   1 
ATOM   1539  C CZ    . PHE A  1 209 ? 71.461  159.923 -93.381  1.00 51.83  ? 209  PHE A CZ    1 
ATOM   1540  N N     . LEU A  1 210 ? 75.183  157.003 -97.087  1.00 41.35  ? 210  LEU A N     1 
ATOM   1541  C CA    . LEU A  1 210 ? 76.539  157.210 -96.579  1.00 38.81  ? 210  LEU A CA    1 
ATOM   1542  C C     . LEU A  1 210 ? 77.478  157.645 -97.683  1.00 38.32  ? 210  LEU A C     1 
ATOM   1543  O O     . LEU A  1 210 ? 77.088  157.713 -98.850  1.00 37.01  ? 210  LEU A O     1 
ATOM   1544  C CB    . LEU A  1 210 ? 77.079  155.925 -95.942  1.00 37.89  ? 210  LEU A CB    1 
ATOM   1545  C CG    . LEU A  1 210 ? 76.195  155.339 -94.837  1.00 39.18  ? 210  LEU A CG    1 
ATOM   1546  C CD1   . LEU A  1 210 ? 76.807  154.047 -94.293  1.00 38.90  ? 210  LEU A CD1   1 
ATOM   1547  C CD2   . LEU A  1 210 ? 76.031  156.361 -93.710  1.00 38.10  ? 210  LEU A CD2   1 
ATOM   1548  N N     . GLY A  1 211 ? 78.729  157.917 -97.310  1.00 37.78  ? 211  GLY A N     1 
ATOM   1549  C CA    . GLY A  1 211 ? 79.705  158.365 -98.284  1.00 35.61  ? 211  GLY A CA    1 
ATOM   1550  C C     . GLY A  1 211 ? 80.602  157.309 -98.918  1.00 36.29  ? 211  GLY A C     1 
ATOM   1551  O O     . GLY A  1 211 ? 81.647  157.649 -99.485  1.00 34.30  ? 211  GLY A O     1 
ATOM   1552  N N     . HIS A  1 212 ? 80.219  156.036 -98.850  1.00 35.24  ? 212  HIS A N     1 
ATOM   1553  C CA    . HIS A  1 212 ? 81.052  154.994 -99.453  1.00 35.65  ? 212  HIS A CA    1 
ATOM   1554  C C     . HIS A  1 212 ? 80.224  153.759 -99.816  1.00 36.07  ? 212  HIS A C     1 
ATOM   1555  O O     . HIS A  1 212 ? 79.138  153.551 -99.278  1.00 35.79  ? 212  HIS A O     1 
ATOM   1556  C CB    . HIS A  1 212 ? 82.163  154.575 -98.482  1.00 36.44  ? 212  HIS A CB    1 
ATOM   1557  C CG    . HIS A  1 212 ? 81.664  153.765 -97.321  1.00 36.70  ? 212  HIS A CG    1 
ATOM   1558  N ND1   . HIS A  1 212 ? 81.205  154.339 -96.158  1.00 36.65  ? 212  HIS A ND1   1 
ATOM   1559  C CD2   . HIS A  1 212 ? 81.449  152.430 -97.195  1.00 36.06  ? 212  HIS A CD2   1 
ATOM   1560  C CE1   . HIS A  1 212 ? 80.717  153.398 -95.365  1.00 36.40  ? 212  HIS A CE1   1 
ATOM   1561  N NE2   . HIS A  1 212 ? 80.852  152.230 -95.976  1.00 36.35  ? 212  HIS A NE2   1 
ATOM   1562  N N     . VAL A  1 213 ? 80.756  152.926 -100.709 1.00 35.87  ? 213  VAL A N     1 
ATOM   1563  C CA    . VAL A  1 213 ? 80.054  151.717 -101.126 1.00 35.17  ? 213  VAL A CA    1 
ATOM   1564  C C     . VAL A  1 213 ? 80.655  150.481 -100.451 1.00 35.07  ? 213  VAL A C     1 
ATOM   1565  O O     . VAL A  1 213 ? 81.842  150.467 -100.129 1.00 33.34  ? 213  VAL A O     1 
ATOM   1566  C CB    . VAL A  1 213 ? 80.137  151.525 -102.682 1.00 34.75  ? 213  VAL A CB    1 
ATOM   1567  C CG1   . VAL A  1 213 ? 79.949  152.866 -103.401 1.00 35.91  ? 213  VAL A CG1   1 
ATOM   1568  C CG2   . VAL A  1 213 ? 81.453  150.932 -103.067 1.00 36.42  ? 213  VAL A CG2   1 
ATOM   1569  N N     . GLY A  1 214 ? 79.837  149.455 -100.226 1.00 34.94  ? 214  GLY A N     1 
ATOM   1570  C CA    . GLY A  1 214 ? 80.362  148.227 -99.654  1.00 35.32  ? 214  GLY A CA    1 
ATOM   1571  C C     . GLY A  1 214 ? 79.864  147.855 -98.285  1.00 36.63  ? 214  GLY A C     1 
ATOM   1572  O O     . GLY A  1 214 ? 80.196  146.781 -97.775  1.00 36.38  ? 214  GLY A O     1 
ATOM   1573  N N     . GLY A  1 215 ? 79.096  148.745 -97.666  1.00 36.48  ? 215  GLY A N     1 
ATOM   1574  C CA    . GLY A  1 215 ? 78.565  148.445 -96.349  1.00 37.32  ? 215  GLY A CA    1 
ATOM   1575  C C     . GLY A  1 215 ? 79.490  148.716 -95.179  1.00 37.48  ? 215  GLY A C     1 
ATOM   1576  O O     . GLY A  1 215 ? 80.463  149.457 -95.293  1.00 37.79  ? 215  GLY A O     1 
ATOM   1577  N N     . VAL A  1 216 ? 79.161  148.103 -94.041  1.00 38.04  ? 216  VAL A N     1 
ATOM   1578  C CA    . VAL A  1 216 ? 79.925  148.254 -92.807  1.00 38.87  ? 216  VAL A CA    1 
ATOM   1579  C C     . VAL A  1 216 ? 81.242  147.480 -92.794  1.00 38.53  ? 216  VAL A C     1 
ATOM   1580  O O     . VAL A  1 216 ? 81.348  146.366 -93.324  1.00 38.82  ? 216  VAL A O     1 
ATOM   1581  C CB    . VAL A  1 216 ? 79.090  147.787 -91.570  1.00 40.21  ? 216  VAL A CB    1 
ATOM   1582  C CG1   . VAL A  1 216 ? 79.935  147.887 -90.283  1.00 40.67  ? 216  VAL A CG1   1 
ATOM   1583  C CG2   . VAL A  1 216 ? 77.824  148.631 -91.443  1.00 38.81  ? 216  VAL A CG2   1 
ATOM   1584  N N     . GLY A  1 217 ? 82.253  148.099 -92.193  1.00 37.35  ? 217  GLY A N     1 
ATOM   1585  C CA    . GLY A  1 217 ? 83.533  147.447 -92.054  1.00 35.22  ? 217  GLY A CA    1 
ATOM   1586  C C     . GLY A  1 217 ? 84.516  147.543 -93.192  1.00 33.78  ? 217  GLY A C     1 
ATOM   1587  O O     . GLY A  1 217 ? 85.713  147.449 -92.946  1.00 33.83  ? 217  GLY A O     1 
ATOM   1588  N N     . ILE A  1 218 ? 84.046  147.736 -94.419  1.00 31.47  ? 218  ILE A N     1 
ATOM   1589  C CA    . ILE A  1 218 ? 84.984  147.808 -95.529  1.00 31.11  ? 218  ILE A CA    1 
ATOM   1590  C C     . ILE A  1 218 ? 86.011  148.911 -95.244  1.00 30.17  ? 218  ILE A C     1 
ATOM   1591  O O     . ILE A  1 218 ? 85.691  149.922 -94.632  1.00 30.73  ? 218  ILE A O     1 
ATOM   1592  C CB    . ILE A  1 218 ? 84.255  148.069 -96.886  1.00 30.29  ? 218  ILE A CB    1 
ATOM   1593  C CG1   . ILE A  1 218 ? 85.248  147.931 -98.042  1.00 28.02  ? 218  ILE A CG1   1 
ATOM   1594  C CG2   . ILE A  1 218 ? 83.607  149.475 -96.880  1.00 29.48  ? 218  ILE A CG2   1 
ATOM   1595  C CD1   . ILE A  1 218 ? 84.601  147.744 -99.417  1.00 24.83  ? 218  ILE A CD1   1 
ATOM   1596  N N     . ASP A  1 219 ? 87.256  148.681 -95.631  1.00 30.04  ? 219  ASP A N     1 
ATOM   1597  C CA    . ASP A  1 219 ? 88.291  149.676 -95.444  1.00 29.85  ? 219  ASP A CA    1 
ATOM   1598  C C     . ASP A  1 219 ? 88.021  150.812 -96.463  1.00 31.94  ? 219  ASP A C     1 
ATOM   1599  O O     . ASP A  1 219 ? 87.718  150.554 -97.644  1.00 30.81  ? 219  ASP A O     1 
ATOM   1600  C CB    . ASP A  1 219 ? 89.663  149.048 -95.681  1.00 26.98  ? 219  ASP A CB    1 
ATOM   1601  C CG    . ASP A  1 219 ? 90.795  150.063 -95.595  1.00 25.59  ? 219  ASP A CG    1 
ATOM   1602  O OD1   . ASP A  1 219 ? 91.164  150.463 -94.460  1.00 21.15  ? 219  ASP A OD1   1 
ATOM   1603  O OD2   . ASP A  1 219 ? 91.312  150.445 -96.667  1.00 25.69  ? 219  ASP A OD2   1 
ATOM   1604  N N     . MET A  1 220 ? 88.139  152.058 -96.007  1.00 33.05  ? 220  MET A N     1 
ATOM   1605  C CA    . MET A  1 220 ? 87.851  153.207 -96.869  1.00 33.84  ? 220  MET A CA    1 
ATOM   1606  C C     . MET A  1 220 ? 88.689  153.312 -98.123  1.00 32.45  ? 220  MET A C     1 
ATOM   1607  O O     . MET A  1 220 ? 88.169  153.623 -99.190  1.00 32.75  ? 220  MET A O     1 
ATOM   1608  C CB    . MET A  1 220 ? 87.940  154.522 -96.081  1.00 36.12  ? 220  MET A CB    1 
ATOM   1609  C CG    . MET A  1 220 ? 86.836  154.707 -95.031  1.00 39.08  ? 220  MET A CG    1 
ATOM   1610  S SD    . MET A  1 220 ? 85.146  154.841 -95.730  1.00 44.13  ? 220  MET A SD    1 
ATOM   1611  C CE    . MET A  1 220 ? 84.440  153.254 -95.246  1.00 44.42  ? 220  MET A CE    1 
ATOM   1612  N N     . GLU A  1 221 ? 89.984  153.061 -98.023  1.00 32.17  ? 221  GLU A N     1 
ATOM   1613  C CA    . GLU A  1 221 ? 90.788  153.143 -99.226  1.00 31.86  ? 221  GLU A CA    1 
ATOM   1614  C C     . GLU A  1 221 ? 90.250  152.102 -100.219 1.00 32.52  ? 221  GLU A C     1 
ATOM   1615  O O     . GLU A  1 221 ? 89.986  152.402 -101.394 1.00 31.88  ? 221  GLU A O     1 
ATOM   1616  C CB    . GLU A  1 221 ? 92.261  152.885 -98.921  1.00 31.76  ? 221  GLU A CB    1 
ATOM   1617  C CG    . GLU A  1 221 ? 93.096  152.811 -100.190 1.00 33.41  ? 221  GLU A CG    1 
ATOM   1618  C CD    . GLU A  1 221 ? 94.582  152.707 -99.937  1.00 34.47  ? 221  GLU A CD    1 
ATOM   1619  O OE1   . GLU A  1 221 ? 94.986  152.182 -98.877  1.00 36.10  ? 221  GLU A OE1   1 
ATOM   1620  O OE2   . GLU A  1 221 ? 95.352  153.141 -100.819 1.00 34.49  ? 221  GLU A OE2   1 
ATOM   1621  N N     . ILE A  1 222 ? 90.082  150.876 -99.736  1.00 30.31  ? 222  ILE A N     1 
ATOM   1622  C CA    . ILE A  1 222 ? 89.570  149.801 -100.578 1.00 28.73  ? 222  ILE A CA    1 
ATOM   1623  C C     . ILE A  1 222 ? 88.230  150.177 -101.248 1.00 28.30  ? 222  ILE A C     1 
ATOM   1624  O O     . ILE A  1 222 ? 88.067  149.993 -102.461 1.00 27.66  ? 222  ILE A O     1 
ATOM   1625  C CB    . ILE A  1 222 ? 89.359  148.504 -99.740  1.00 26.64  ? 222  ILE A CB    1 
ATOM   1626  C CG1   . ILE A  1 222 ? 90.695  148.020 -99.184  1.00 22.38  ? 222  ILE A CG1   1 
ATOM   1627  C CG2   . ILE A  1 222 ? 88.721  147.432 -100.632 1.00 26.27  ? 222  ILE A CG2   1 
ATOM   1628  C CD1   . ILE A  1 222 ? 91.618  147.521 -100.257 1.00 23.74  ? 222  ILE A CD1   1 
ATOM   1629  N N     . SER A  1 223 ? 87.296  150.694 -100.448 1.00 28.05  ? 223  SER A N     1 
ATOM   1630  C CA    . SER A  1 223 ? 85.960  151.087 -100.918 1.00 31.55  ? 223  SER A CA    1 
ATOM   1631  C C     . SER A  1 223 ? 86.018  152.095 -102.069 1.00 32.51  ? 223  SER A C     1 
ATOM   1632  O O     . SER A  1 223 ? 85.384  151.911 -103.115 1.00 32.95  ? 223  SER A O     1 
ATOM   1633  C CB    . SER A  1 223 ? 85.154  151.662 -99.746  1.00 32.16  ? 223  SER A CB    1 
ATOM   1634  O OG    . SER A  1 223 ? 83.847  152.043 -100.146 1.00 36.01  ? 223  SER A OG    1 
ATOM   1635  N N     . LYS A  1 224 ? 86.811  153.147 -101.902 1.00 34.09  ? 224  LYS A N     1 
ATOM   1636  C CA    . LYS A  1 224 ? 86.928  154.149 -102.952 1.00 35.29  ? 224  LYS A CA    1 
ATOM   1637  C C     . LYS A  1 224 ? 87.552  153.572 -104.224 1.00 34.46  ? 224  LYS A C     1 
ATOM   1638  O O     . LYS A  1 224 ? 87.152  153.929 -105.331 1.00 34.42  ? 224  LYS A O     1 
ATOM   1639  C CB    . LYS A  1 224 ? 87.757  155.326 -102.444 1.00 39.11  ? 224  LYS A CB    1 
ATOM   1640  C CG    . LYS A  1 224 ? 87.186  155.995 -101.179 1.00 44.24  ? 224  LYS A CG    1 
ATOM   1641  C CD    . LYS A  1 224 ? 85.813  156.693 -101.402 1.00 48.80  ? 224  LYS A CD    1 
ATOM   1642  C CE    . LYS A  1 224 ? 85.863  157.721 -102.548 1.00 51.07  ? 224  LYS A CE    1 
ATOM   1643  N NZ    . LYS A  1 224 ? 87.034  158.670 -102.437 1.00 54.44  ? 224  LYS A NZ    1 
ATOM   1644  N N     . ASN A  1 225 ? 88.534  152.687 -104.080 1.00 33.81  ? 225  ASN A N     1 
ATOM   1645  C CA    . ASN A  1 225 ? 89.158  152.089 -105.260 1.00 34.27  ? 225  ASN A CA    1 
ATOM   1646  C C     . ASN A  1 225 ? 88.143  151.176 -105.949 1.00 32.62  ? 225  ASN A C     1 
ATOM   1647  O O     . ASN A  1 225 ? 88.089  151.093 -107.178 1.00 33.14  ? 225  ASN A O     1 
ATOM   1648  C CB    . ASN A  1 225 ? 90.408  151.281 -104.873 1.00 37.97  ? 225  ASN A CB    1 
ATOM   1649  C CG    . ASN A  1 225 ? 91.559  152.170 -104.483 1.00 41.77  ? 225  ASN A CG    1 
ATOM   1650  O OD1   . ASN A  1 225 ? 91.449  153.382 -104.569 1.00 43.65  ? 225  ASN A OD1   1 
ATOM   1651  N ND2   . ASN A  1 225 ? 92.669  151.582 -104.058 1.00 43.75  ? 225  ASN A ND2   1 
ATOM   1652  N N     . PHE A  1 226 ? 87.341  150.499 -105.136 1.00 30.59  ? 226  PHE A N     1 
ATOM   1653  C CA    . PHE A  1 226 ? 86.313  149.582 -105.618 1.00 28.86  ? 226  PHE A CA    1 
ATOM   1654  C C     . PHE A  1 226 ? 85.265  150.418 -106.381 1.00 30.28  ? 226  PHE A C     1 
ATOM   1655  O O     . PHE A  1 226 ? 84.926  150.107 -107.516 1.00 28.66  ? 226  PHE A O     1 
ATOM   1656  C CB    . PHE A  1 226 ? 85.701  148.859 -104.405 1.00 27.61  ? 226  PHE A CB    1 
ATOM   1657  C CG    . PHE A  1 226 ? 84.567  147.909 -104.724 1.00 24.62  ? 226  PHE A CG    1 
ATOM   1658  C CD1   . PHE A  1 226 ? 84.639  147.043 -105.792 1.00 25.28  ? 226  PHE A CD1   1 
ATOM   1659  C CD2   . PHE A  1 226 ? 83.467  147.831 -103.876 1.00 26.09  ? 226  PHE A CD2   1 
ATOM   1660  C CE1   . PHE A  1 226 ? 83.607  146.082 -106.007 1.00 28.94  ? 226  PHE A CE1   1 
ATOM   1661  C CE2   . PHE A  1 226 ? 82.437  146.889 -104.075 1.00 26.98  ? 226  PHE A CE2   1 
ATOM   1662  C CZ    . PHE A  1 226 ? 82.507  146.012 -105.141 1.00 25.22  ? 226  PHE A CZ    1 
ATOM   1663  N N     . GLN A  1 227 ? 84.774  151.481 -105.753 1.00 31.28  ? 227  GLN A N     1 
ATOM   1664  C CA    . GLN A  1 227 ? 83.777  152.344 -106.374 1.00 34.61  ? 227  GLN A CA    1 
ATOM   1665  C C     . GLN A  1 227 ? 84.244  152.870 -107.714 1.00 35.57  ? 227  GLN A C     1 
ATOM   1666  O O     . GLN A  1 227 ? 83.492  152.856 -108.690 1.00 37.25  ? 227  GLN A O     1 
ATOM   1667  C CB    . GLN A  1 227 ? 83.473  153.534 -105.478 1.00 35.89  ? 227  GLN A CB    1 
ATOM   1668  C CG    . GLN A  1 227 ? 82.379  154.432 -106.018 1.00 36.59  ? 227  GLN A CG    1 
ATOM   1669  C CD    . GLN A  1 227 ? 82.321  155.741 -105.292 1.00 40.54  ? 227  GLN A CD    1 
ATOM   1670  O OE1   . GLN A  1 227 ? 82.633  155.820 -104.096 1.00 42.14  ? 227  GLN A OE1   1 
ATOM   1671  N NE2   . GLN A  1 227 ? 81.911  156.795 -106.001 1.00 42.53  ? 227  GLN A NE2   1 
ATOM   1672  N N     . ARG A  1 228 ? 85.485  153.330 -107.760 1.00 36.44  ? 228  ARG A N     1 
ATOM   1673  C CA    . ARG A  1 228 ? 86.031  153.856 -108.994 1.00 38.68  ? 228  ARG A CA    1 
ATOM   1674  C C     . ARG A  1 228 ? 86.068  152.784 -110.072 1.00 37.74  ? 228  ARG A C     1 
ATOM   1675  O O     . ARG A  1 228 ? 85.804  153.068 -111.240 1.00 37.08  ? 228  ARG A O     1 
ATOM   1676  C CB    . ARG A  1 228 ? 87.440  154.397 -108.769 1.00 43.34  ? 228  ARG A CB    1 
ATOM   1677  C CG    . ARG A  1 228 ? 88.099  154.950 -110.023 1.00 48.99  ? 228  ARG A CG    1 
ATOM   1678  C CD    . ARG A  1 228 ? 89.611  154.945 -109.860 1.00 55.94  ? 228  ARG A CD    1 
ATOM   1679  N NE    . ARG A  1 228 ? 90.086  153.600 -109.510 1.00 62.07  ? 228  ARG A NE    1 
ATOM   1680  C CZ    . ARG A  1 228 ? 90.839  153.313 -108.444 1.00 64.60  ? 228  ARG A CZ    1 
ATOM   1681  N NH1   . ARG A  1 228 ? 91.219  154.282 -107.606 1.00 65.32  ? 228  ARG A NH1   1 
ATOM   1682  N NH2   . ARG A  1 228 ? 91.199  152.049 -108.208 1.00 64.97  ? 228  ARG A NH2   1 
ATOM   1683  N N     . ILE A  1 229 ? 86.395  151.553 -109.693 1.00 35.53  ? 229  ILE A N     1 
ATOM   1684  C CA    . ILE A  1 229 ? 86.457  150.485 -110.683 1.00 34.64  ? 229  ILE A CA    1 
ATOM   1685  C C     . ILE A  1 229 ? 85.043  150.162 -111.188 1.00 33.96  ? 229  ILE A C     1 
ATOM   1686  O O     . ILE A  1 229 ? 84.843  149.922 -112.370 1.00 33.30  ? 229  ILE A O     1 
ATOM   1687  C CB    . ILE A  1 229 ? 87.145  149.203 -110.110 1.00 34.02  ? 229  ILE A CB    1 
ATOM   1688  C CG1   . ILE A  1 229 ? 88.587  149.513 -109.715 1.00 33.64  ? 229  ILE A CG1   1 
ATOM   1689  C CG2   . ILE A  1 229 ? 87.161  148.090 -111.161 1.00 33.10  ? 229  ILE A CG2   1 
ATOM   1690  C CD1   . ILE A  1 229 ? 89.295  148.347 -108.995 1.00 35.16  ? 229  ILE A CD1   1 
ATOM   1691  N N     . LEU A  1 230 ? 84.067  150.184 -110.290 1.00 34.14  ? 230  LEU A N     1 
ATOM   1692  C CA    . LEU A  1 230 ? 82.681  149.910 -110.661 1.00 34.23  ? 230  LEU A CA    1 
ATOM   1693  C C     . LEU A  1 230 ? 82.147  151.010 -111.597 1.00 35.71  ? 230  LEU A C     1 
ATOM   1694  O O     . LEU A  1 230 ? 81.460  150.714 -112.579 1.00 32.99  ? 230  LEU A O     1 
ATOM   1695  C CB    . LEU A  1 230 ? 81.798  149.805 -109.412 1.00 33.50  ? 230  LEU A CB    1 
ATOM   1696  C CG    . LEU A  1 230 ? 82.054  148.588 -108.499 1.00 33.89  ? 230  LEU A CG    1 
ATOM   1697  C CD1   . LEU A  1 230 ? 81.006  148.533 -107.379 1.00 32.29  ? 230  LEU A CD1   1 
ATOM   1698  C CD2   . LEU A  1 230 ? 82.003  147.307 -109.326 1.00 31.97  ? 230  LEU A CD2   1 
ATOM   1699  N N     . GLN A  1 231 ? 82.470  152.267 -111.298 1.00 36.34  ? 231  GLN A N     1 
ATOM   1700  C CA    . GLN A  1 231 ? 82.035  153.370 -112.146 1.00 37.94  ? 231  GLN A CA    1 
ATOM   1701  C C     . GLN A  1 231 ? 82.601  153.245 -113.555 1.00 39.01  ? 231  GLN A C     1 
ATOM   1702  O O     . GLN A  1 231 ? 81.939  153.606 -114.526 1.00 39.06  ? 231  GLN A O     1 
ATOM   1703  C CB    . GLN A  1 231 ? 82.436  154.707 -111.521 1.00 37.41  ? 231  GLN A CB    1 
ATOM   1704  C CG    . GLN A  1 231 ? 81.639  155.009 -110.252 1.00 38.31  ? 231  GLN A CG    1 
ATOM   1705  C CD    . GLN A  1 231 ? 82.102  156.256 -109.523 1.00 38.65  ? 231  GLN A CD    1 
ATOM   1706  O OE1   . GLN A  1 231 ? 81.403  156.781 -108.656 1.00 37.50  ? 231  GLN A OE1   1 
ATOM   1707  N NE2   . GLN A  1 231 ? 83.296  156.728 -109.865 1.00 40.51  ? 231  GLN A NE2   1 
ATOM   1708  N N     . LYS A  1 232 ? 83.815  152.716 -113.672 1.00 39.67  ? 232  LYS A N     1 
ATOM   1709  C CA    . LYS A  1 232 ? 84.428  152.546 -114.980 1.00 41.21  ? 232  LYS A CA    1 
ATOM   1710  C C     . LYS A  1 232 ? 83.660  151.470 -115.761 1.00 40.86  ? 232  LYS A C     1 
ATOM   1711  O O     . LYS A  1 232 ? 83.679  151.420 -116.992 1.00 40.29  ? 232  LYS A O     1 
ATOM   1712  C CB    . LYS A  1 232 ? 85.894  152.144 -114.815 1.00 44.73  ? 232  LYS A CB    1 
ATOM   1713  C CG    . LYS A  1 232 ? 86.867  152.844 -115.777 1.00 49.99  ? 232  LYS A CG    1 
ATOM   1714  C CD    . LYS A  1 232 ? 86.592  152.497 -117.247 1.00 53.35  ? 232  LYS A CD    1 
ATOM   1715  C CE    . LYS A  1 232 ? 86.882  151.020 -117.542 1.00 55.69  ? 232  LYS A CE    1 
ATOM   1716  N NZ    . LYS A  1 232 ? 86.571  150.625 -118.952 1.00 56.53  ? 232  LYS A NZ    1 
ATOM   1717  N N     . GLN A  1 233 ? 82.986  150.600 -115.022 1.00 40.02  ? 233  GLN A N     1 
ATOM   1718  C CA    . GLN A  1 233 ? 82.187  149.527 -115.603 1.00 39.13  ? 233  GLN A CA    1 
ATOM   1719  C C     . GLN A  1 233 ? 80.819  150.046 -116.033 1.00 38.16  ? 233  GLN A C     1 
ATOM   1720  O O     . GLN A  1 233 ? 80.092  149.360 -116.742 1.00 38.75  ? 233  GLN A O     1 
ATOM   1721  C CB    . GLN A  1 233 ? 82.026  148.390 -114.582 1.00 37.22  ? 233  GLN A CB    1 
ATOM   1722  C CG    . GLN A  1 233 ? 83.289  147.546 -114.454 1.00 35.18  ? 233  GLN A CG    1 
ATOM   1723  C CD    . GLN A  1 233 ? 83.236  146.535 -113.311 1.00 34.68  ? 233  GLN A CD    1 
ATOM   1724  O OE1   . GLN A  1 233 ? 82.165  146.138 -112.851 1.00 29.55  ? 233  GLN A OE1   1 
ATOM   1725  N NE2   . GLN A  1 233 ? 84.404  146.109 -112.864 1.00 32.43  ? 233  GLN A NE2   1 
ATOM   1726  N N     . GLY A  1 234 ? 80.474  151.253 -115.599 1.00 37.95  ? 234  GLY A N     1 
ATOM   1727  C CA    . GLY A  1 234 ? 79.192  151.828 -115.968 1.00 36.32  ? 234  GLY A CA    1 
ATOM   1728  C C     . GLY A  1 234 ? 78.252  151.927 -114.797 1.00 36.52  ? 234  GLY A C     1 
ATOM   1729  O O     . GLY A  1 234 ? 77.160  152.468 -114.910 1.00 36.08  ? 234  GLY A O     1 
ATOM   1730  N N     . PHE A  1 235 ? 78.678  151.414 -113.652 1.00 36.22  ? 235  PHE A N     1 
ATOM   1731  C CA    . PHE A  1 235 ? 77.844  151.438 -112.456 1.00 37.82  ? 235  PHE A CA    1 
ATOM   1732  C C     . PHE A  1 235 ? 77.880  152.867 -111.924 1.00 38.45  ? 235  PHE A C     1 
ATOM   1733  O O     . PHE A  1 235 ? 78.952  153.410 -111.675 1.00 39.28  ? 235  PHE A O     1 
ATOM   1734  C CB    . PHE A  1 235 ? 78.404  150.422 -111.415 1.00 36.74  ? 235  PHE A CB    1 
ATOM   1735  C CG    . PHE A  1 235 ? 77.396  149.957 -110.367 1.00 37.19  ? 235  PHE A CG    1 
ATOM   1736  C CD1   . PHE A  1 235 ? 76.504  150.854 -109.766 1.00 34.70  ? 235  PHE A CD1   1 
ATOM   1737  C CD2   . PHE A  1 235 ? 77.395  148.620 -109.931 1.00 35.54  ? 235  PHE A CD2   1 
ATOM   1738  C CE1   . PHE A  1 235 ? 75.639  150.427 -108.751 1.00 35.08  ? 235  PHE A CE1   1 
ATOM   1739  C CE2   . PHE A  1 235 ? 76.534  148.187 -108.917 1.00 34.05  ? 235  PHE A CE2   1 
ATOM   1740  C CZ    . PHE A  1 235 ? 75.655  149.091 -108.326 1.00 33.89  ? 235  PHE A CZ    1 
ATOM   1741  N N     . LYS A  1 236 ? 76.705  153.469 -111.763 1.00 40.29  ? 236  LYS A N     1 
ATOM   1742  C CA    . LYS A  1 236 ? 76.573  154.838 -111.274 1.00 41.65  ? 236  LYS A CA    1 
ATOM   1743  C C     . LYS A  1 236 ? 76.201  154.872 -109.800 1.00 41.16  ? 236  LYS A C     1 
ATOM   1744  O O     . LYS A  1 236 ? 75.461  154.010 -109.322 1.00 40.73  ? 236  LYS A O     1 
ATOM   1745  C CB    . LYS A  1 236 ? 75.502  155.588 -112.091 1.00 44.12  ? 236  LYS A CB    1 
ATOM   1746  C CG    . LYS A  1 236 ? 75.964  156.043 -113.486 1.00 47.45  ? 236  LYS A CG    1 
ATOM   1747  C CD    . LYS A  1 236 ? 74.801  156.112 -114.499 1.00 50.14  ? 236  LYS A CD    1 
ATOM   1748  C CE    . LYS A  1 236 ? 74.867  154.929 -115.420 1.00 51.62  ? 236  LYS A CE    1 
ATOM   1749  N NZ    . LYS A  1 236 ? 73.732  154.027 -115.278 1.00 53.67  ? 236  LYS A NZ    1 
ATOM   1750  N N     . PHE A  1 237 ? 76.721  155.871 -109.088 1.00 40.21  ? 237  PHE A N     1 
ATOM   1751  C CA    . PHE A  1 237 ? 76.449  156.026 -107.659 1.00 40.08  ? 237  PHE A CA    1 
ATOM   1752  C C     . PHE A  1 237 ? 76.102  157.465 -107.274 1.00 40.69  ? 237  PHE A C     1 
ATOM   1753  O O     . PHE A  1 237 ? 76.678  158.422 -107.790 1.00 41.63  ? 237  PHE A O     1 
ATOM   1754  C CB    . PHE A  1 237 ? 77.673  155.615 -106.811 1.00 39.02  ? 237  PHE A CB    1 
ATOM   1755  C CG    . PHE A  1 237 ? 78.101  154.178 -106.979 1.00 36.52  ? 237  PHE A CG    1 
ATOM   1756  C CD1   . PHE A  1 237 ? 77.462  153.158 -106.280 1.00 37.18  ? 237  PHE A CD1   1 
ATOM   1757  C CD2   . PHE A  1 237 ? 79.158  153.855 -107.832 1.00 36.40  ? 237  PHE A CD2   1 
ATOM   1758  C CE1   . PHE A  1 237 ? 77.867  151.822 -106.424 1.00 35.63  ? 237  PHE A CE1   1 
ATOM   1759  C CE2   . PHE A  1 237 ? 79.581  152.536 -107.995 1.00 36.04  ? 237  PHE A CE2   1 
ATOM   1760  C CZ    . PHE A  1 237 ? 78.932  151.513 -107.286 1.00 36.65  ? 237  PHE A CZ    1 
ATOM   1761  N N     . LYS A  1 238 ? 75.142  157.600 -106.369 1.00 41.12  ? 238  LYS A N     1 
ATOM   1762  C CA    . LYS A  1 238 ? 74.762  158.887 -105.831 1.00 39.81  ? 238  LYS A CA    1 
ATOM   1763  C C     . LYS A  1 238 ? 74.975  158.720 -104.341 1.00 39.12  ? 238  LYS A C     1 
ATOM   1764  O O     . LYS A  1 238 ? 74.098  158.241 -103.631 1.00 39.34  ? 238  LYS A O     1 
ATOM   1765  C CB    . LYS A  1 238 ? 73.307  159.217 -106.141 1.00 40.62  ? 238  LYS A CB    1 
ATOM   1766  C CG    . LYS A  1 238 ? 73.116  159.805 -107.526 1.00 41.24  ? 238  LYS A CG    1 
ATOM   1767  C CD    . LYS A  1 238 ? 71.713  160.318 -107.715 1.00 42.33  ? 238  LYS A CD    1 
ATOM   1768  C CE    . LYS A  1 238 ? 71.444  160.597 -109.190 1.00 43.67  ? 238  LYS A CE    1 
ATOM   1769  N NZ    . LYS A  1 238 ? 72.370  161.586 -109.793 1.00 43.06  ? 238  LYS A NZ    1 
ATOM   1770  N N     . LEU A  1 239 ? 76.163  159.100 -103.881 1.00 39.72  ? 239  LEU A N     1 
ATOM   1771  C CA    . LEU A  1 239 ? 76.528  158.977 -102.472 1.00 40.18  ? 239  LEU A CA    1 
ATOM   1772  C C     . LEU A  1 239 ? 76.024  160.133 -101.622 1.00 40.30  ? 239  LEU A C     1 
ATOM   1773  O O     . LEU A  1 239 ? 75.685  161.196 -102.140 1.00 40.14  ? 239  LEU A O     1 
ATOM   1774  C CB    . LEU A  1 239 ? 78.055  158.873 -102.317 1.00 39.71  ? 239  LEU A CB    1 
ATOM   1775  C CG    . LEU A  1 239 ? 78.839  157.802 -103.087 1.00 39.62  ? 239  LEU A CG    1 
ATOM   1776  C CD1   . LEU A  1 239 ? 80.216  157.667 -102.442 1.00 39.11  ? 239  LEU A CD1   1 
ATOM   1777  C CD2   . LEU A  1 239 ? 78.136  156.459 -103.035 1.00 38.16  ? 239  LEU A CD2   1 
ATOM   1778  N N     . ASN A  1 240 ? 75.977  159.913 -100.311 1.00 40.46  ? 240  ASN A N     1 
ATOM   1779  C CA    . ASN A  1 240 ? 75.520  160.940 -99.379  1.00 41.93  ? 240  ASN A CA    1 
ATOM   1780  C C     . ASN A  1 240 ? 74.184  161.486 -99.869  1.00 43.23  ? 240  ASN A C     1 
ATOM   1781  O O     . ASN A  1 240 ? 73.930  162.695 -99.808  1.00 44.03  ? 240  ASN A O     1 
ATOM   1782  C CB    . ASN A  1 240 ? 76.554  162.061 -99.321  1.00 42.04  ? 240  ASN A CB    1 
ATOM   1783  C CG    . ASN A  1 240 ? 77.895  161.585 -98.805  1.00 39.92  ? 240  ASN A CG    1 
ATOM   1784  O OD1   . ASN A  1 240 ? 78.012  161.179 -97.648  1.00 40.71  ? 240  ASN A OD1   1 
ATOM   1785  N ND2   . ASN A  1 240 ? 78.911  161.627 -99.662  1.00 38.49  ? 240  ASN A ND2   1 
ATOM   1786  N N     . THR A  1 241 ? 73.349  160.570 -100.352 1.00 43.21  ? 241  THR A N     1 
ATOM   1787  C CA    . THR A  1 241 ? 72.038  160.876 -100.903 1.00 43.00  ? 241  THR A CA    1 
ATOM   1788  C C     . THR A  1 241 ? 71.006  159.941 -100.300 1.00 44.49  ? 241  THR A C     1 
ATOM   1789  O O     . THR A  1 241 ? 71.230  158.731 -100.170 1.00 44.92  ? 241  THR A O     1 
ATOM   1790  C CB    . THR A  1 241 ? 72.032  160.687 -102.432 1.00 42.18  ? 241  THR A CB    1 
ATOM   1791  O OG1   . THR A  1 241 ? 72.996  161.563 -103.019 1.00 41.53  ? 241  THR A OG1   1 
ATOM   1792  C CG2   . THR A  1 241 ? 70.653  160.976 -103.016 1.00 41.90  ? 241  THR A CG2   1 
ATOM   1793  N N     . LYS A  1 242 ? 69.862  160.504 -99.955  1.00 44.20  ? 242  LYS A N     1 
ATOM   1794  C CA    . LYS A  1 242 ? 68.806  159.738 -99.346  1.00 44.81  ? 242  LYS A CA    1 
ATOM   1795  C C     . LYS A  1 242 ? 67.563  159.706 -100.213 1.00 44.52  ? 242  LYS A C     1 
ATOM   1796  O O     . LYS A  1 242 ? 67.203  160.700 -100.831 1.00 43.87  ? 242  LYS A O     1 
ATOM   1797  C CB    . LYS A  1 242 ? 68.517  160.340 -97.973  1.00 45.27  ? 242  LYS A CB    1 
ATOM   1798  C CG    . LYS A  1 242 ? 67.128  160.137 -97.447  1.00 47.26  ? 242  LYS A CG    1 
ATOM   1799  C CD    . LYS A  1 242 ? 66.444  161.486 -97.282  1.00 50.63  ? 242  LYS A CD    1 
ATOM   1800  C CE    . LYS A  1 242 ? 67.212  162.400 -96.321  1.00 51.99  ? 242  LYS A CE    1 
ATOM   1801  N NZ    . LYS A  1 242 ? 66.706  163.811 -96.359  1.00 52.20  ? 242  LYS A NZ    1 
ATOM   1802  N N     . VAL A  1 243 ? 66.919  158.546 -100.272 1.00 45.22  ? 243  VAL A N     1 
ATOM   1803  C CA    . VAL A  1 243 ? 65.692  158.394 -101.048 1.00 46.59  ? 243  VAL A CA    1 
ATOM   1804  C C     . VAL A  1 243 ? 64.552  158.795 -100.124 1.00 48.45  ? 243  VAL A C     1 
ATOM   1805  O O     . VAL A  1 243 ? 64.408  158.225 -99.050  1.00 48.88  ? 243  VAL A O     1 
ATOM   1806  C CB    . VAL A  1 243 ? 65.477  156.928 -101.495 1.00 45.49  ? 243  VAL A CB    1 
ATOM   1807  C CG1   . VAL A  1 243 ? 64.127  156.784 -102.165 1.00 45.68  ? 243  VAL A CG1   1 
ATOM   1808  C CG2   . VAL A  1 243 ? 66.579  156.499 -102.444 1.00 44.49  ? 243  VAL A CG2   1 
ATOM   1809  N N     . THR A  1 244 ? 63.744  159.773 -100.532 1.00 51.07  ? 244  THR A N     1 
ATOM   1810  C CA    . THR A  1 244 ? 62.632  160.237 -99.700  1.00 52.10  ? 244  THR A CA    1 
ATOM   1811  C C     . THR A  1 244 ? 61.312  159.566 -100.052 1.00 53.36  ? 244  THR A C     1 
ATOM   1812  O O     . THR A  1 244 ? 60.312  159.697 -99.328  1.00 53.46  ? 244  THR A O     1 
ATOM   1813  C CB    . THR A  1 244 ? 62.434  161.760 -99.814  1.00 52.30  ? 244  THR A CB    1 
ATOM   1814  O OG1   . THR A  1 244 ? 62.183  162.109 -101.177 1.00 52.95  ? 244  THR A OG1   1 
ATOM   1815  C CG2   . THR A  1 244 ? 63.672  162.496 -99.347  1.00 53.45  ? 244  THR A CG2   1 
ATOM   1816  N N     . GLY A  1 245 ? 61.298  158.851 -101.167 1.00 53.32  ? 245  GLY A N     1 
ATOM   1817  C CA    . GLY A  1 245 ? 60.077  158.179 -101.561 1.00 53.49  ? 245  GLY A CA    1 
ATOM   1818  C C     . GLY A  1 245 ? 60.102  157.712 -102.998 1.00 54.02  ? 245  GLY A C     1 
ATOM   1819  O O     . GLY A  1 245 ? 60.972  158.093 -103.792 1.00 53.04  ? 245  GLY A O     1 
ATOM   1820  N N     . ALA A  1 246 ? 59.135  156.868 -103.326 1.00 54.60  ? 246  ALA A N     1 
ATOM   1821  C CA    . ALA A  1 246 ? 59.015  156.332 -104.668 1.00 55.65  ? 246  ALA A CA    1 
ATOM   1822  C C     . ALA A  1 246 ? 57.543  156.231 -104.993 1.00 56.53  ? 246  ALA A C     1 
ATOM   1823  O O     . ALA A  1 246 ? 56.716  155.978 -104.117 1.00 55.92  ? 246  ALA A O     1 
ATOM   1824  C CB    . ALA A  1 246 ? 59.658  154.953 -104.749 1.00 55.42  ? 246  ALA A CB    1 
ATOM   1825  N N     . THR A  1 247 ? 57.219  156.434 -106.258 1.00 57.74  ? 247  THR A N     1 
ATOM   1826  C CA    . THR A  1 247 ? 55.842  156.341 -106.686 1.00 59.65  ? 247  THR A CA    1 
ATOM   1827  C C     . THR A  1 247 ? 55.804  155.813 -108.112 1.00 60.42  ? 247  THR A C     1 
ATOM   1828  O O     . THR A  1 247 ? 56.656  156.153 -108.928 1.00 60.55  ? 247  THR A O     1 
ATOM   1829  C CB    . THR A  1 247 ? 55.126  157.714 -106.568 1.00 60.34  ? 247  THR A CB    1 
ATOM   1830  O OG1   . THR A  1 247 ? 53.838  157.619 -107.180 1.00 62.34  ? 247  THR A OG1   1 
ATOM   1831  C CG2   . THR A  1 247 ? 55.932  158.827 -107.235 1.00 60.41  ? 247  THR A CG2   1 
ATOM   1832  N N     . LYS A  1 248 ? 54.829  154.958 -108.397 1.00 62.25  ? 248  LYS A N     1 
ATOM   1833  C CA    . LYS A  1 248 ? 54.693  154.355 -109.721 1.00 65.15  ? 248  LYS A CA    1 
ATOM   1834  C C     . LYS A  1 248 ? 53.661  155.068 -110.602 1.00 65.82  ? 248  LYS A C     1 
ATOM   1835  O O     . LYS A  1 248 ? 52.498  155.215 -110.231 1.00 65.89  ? 248  LYS A O     1 
ATOM   1836  C CB    . LYS A  1 248 ? 54.341  152.868 -109.573 1.00 66.36  ? 248  LYS A CB    1 
ATOM   1837  C CG    . LYS A  1 248 ? 53.140  152.611 -108.669 1.00 69.12  ? 248  LYS A CG    1 
ATOM   1838  C CD    . LYS A  1 248 ? 53.390  151.478 -107.674 1.00 70.33  ? 248  LYS A CD    1 
ATOM   1839  C CE    . LYS A  1 248 ? 53.716  150.163 -108.370 1.00 70.67  ? 248  LYS A CE    1 
ATOM   1840  N NZ    . LYS A  1 248 ? 53.802  149.049 -107.390 1.00 70.51  ? 248  LYS A NZ    1 
ATOM   1841  N N     . LYS A  1 249 ? 54.111  155.505 -111.774 1.00 66.90  ? 249  LYS A N     1 
ATOM   1842  C CA    . LYS A  1 249 ? 53.272  156.217 -112.727 1.00 67.53  ? 249  LYS A CA    1 
ATOM   1843  C C     . LYS A  1 249 ? 52.391  155.298 -113.575 1.00 67.61  ? 249  LYS A C     1 
ATOM   1844  O O     . LYS A  1 249 ? 52.587  154.080 -113.599 1.00 67.04  ? 249  LYS A O     1 
ATOM   1845  C CB    . LYS A  1 249 ? 54.157  157.081 -113.633 1.00 68.36  ? 249  LYS A CB    1 
ATOM   1846  C CG    . LYS A  1 249 ? 54.894  158.189 -112.878 1.00 70.22  ? 249  LYS A CG    1 
ATOM   1847  C CD    . LYS A  1 249 ? 55.733  159.076 -113.800 1.00 71.87  ? 249  LYS A CD    1 
ATOM   1848  C CE    . LYS A  1 249 ? 56.893  158.314 -114.415 1.00 72.08  ? 249  LYS A CE    1 
ATOM   1849  N NZ    . LYS A  1 249 ? 57.801  159.202 -115.185 1.00 72.85  ? 249  LYS A NZ    1 
ATOM   1850  N N     . SER A  1 250 ? 51.410  155.897 -114.253 1.00 67.28  ? 250  SER A N     1 
ATOM   1851  C CA    . SER A  1 250 ? 50.490  155.174 -115.131 1.00 67.22  ? 250  SER A CA    1 
ATOM   1852  C C     . SER A  1 250 ? 51.340  154.614 -116.264 1.00 66.80  ? 250  SER A C     1 
ATOM   1853  O O     . SER A  1 250 ? 50.973  153.653 -116.942 1.00 67.07  ? 250  SER A O     1 
ATOM   1854  C CB    . SER A  1 250 ? 49.455  156.143 -115.696 1.00 67.77  ? 250  SER A CB    1 
ATOM   1855  O OG    . SER A  1 250 ? 50.107  157.239 -116.319 1.00 68.82  ? 250  SER A OG    1 
ATOM   1856  N N     . ASP A  1 251 ? 52.483  155.261 -116.447 1.00 66.15  ? 251  ASP A N     1 
ATOM   1857  C CA    . ASP A  1 251 ? 53.475  154.910 -117.444 1.00 65.13  ? 251  ASP A CA    1 
ATOM   1858  C C     . ASP A  1 251 ? 53.980  153.493 -117.177 1.00 63.62  ? 251  ASP A C     1 
ATOM   1859  O O     . ASP A  1 251 ? 54.263  152.725 -118.093 1.00 63.32  ? 251  ASP A O     1 
ATOM   1860  C CB    . ASP A  1 251 ? 54.628  155.906 -117.330 1.00 67.65  ? 251  ASP A CB    1 
ATOM   1861  C CG    . ASP A  1 251 ? 55.667  155.719 -118.393 1.00 69.66  ? 251  ASP A CG    1 
ATOM   1862  O OD1   . ASP A  1 251 ? 55.361  155.052 -119.403 1.00 72.11  ? 251  ASP A OD1   1 
ATOM   1863  O OD2   . ASP A  1 251 ? 56.784  156.253 -118.225 1.00 71.46  ? 251  ASP A OD2   1 
ATOM   1864  N N     . GLY A  1 252 ? 54.074  153.154 -115.899 1.00 61.57  ? 252  GLY A N     1 
ATOM   1865  C CA    . GLY A  1 252 ? 54.567  151.849 -115.510 1.00 59.85  ? 252  GLY A CA    1 
ATOM   1866  C C     . GLY A  1 252 ? 55.896  152.050 -114.802 1.00 57.66  ? 252  GLY A C     1 
ATOM   1867  O O     . GLY A  1 252 ? 56.267  151.285 -113.908 1.00 58.13  ? 252  GLY A O     1 
ATOM   1868  N N     . LYS A  1 253 ? 56.616  153.095 -115.205 1.00 55.16  ? 253  LYS A N     1 
ATOM   1869  C CA    . LYS A  1 253 ? 57.901  153.414 -114.602 1.00 52.42  ? 253  LYS A CA    1 
ATOM   1870  C C     . LYS A  1 253 ? 57.667  153.930 -113.184 1.00 50.58  ? 253  LYS A C     1 
ATOM   1871  O O     . LYS A  1 253 ? 56.526  154.122 -112.764 1.00 50.76  ? 253  LYS A O     1 
ATOM   1872  C CB    . LYS A  1 253 ? 58.634  154.467 -115.442 1.00 52.05  ? 253  LYS A CB    1 
ATOM   1873  C CG    . LYS A  1 253 ? 58.967  154.014 -116.856 1.00 51.47  ? 253  LYS A CG    1 
ATOM   1874  C CD    . LYS A  1 253 ? 59.838  155.034 -117.538 1.00 51.35  ? 253  LYS A CD    1 
ATOM   1875  C CE    . LYS A  1 253 ? 59.979  154.724 -118.999 1.00 52.78  ? 253  LYS A CE    1 
ATOM   1876  N NZ    . LYS A  1 253 ? 60.460  153.330 -119.189 1.00 53.56  ? 253  LYS A NZ    1 
ATOM   1877  N N     . ILE A  1 254 ? 58.738  154.134 -112.433 1.00 47.82  ? 254  ILE A N     1 
ATOM   1878  C CA    . ILE A  1 254 ? 58.581  154.634 -111.080 1.00 46.31  ? 254  ILE A CA    1 
ATOM   1879  C C     . ILE A  1 254 ? 59.510  155.847 -110.886 1.00 44.25  ? 254  ILE A C     1 
ATOM   1880  O O     . ILE A  1 254 ? 60.638  155.867 -111.380 1.00 43.79  ? 254  ILE A O     1 
ATOM   1881  C CB    . ILE A  1 254 ? 58.856  153.488 -110.010 1.00 47.18  ? 254  ILE A CB    1 
ATOM   1882  C CG1   . ILE A  1 254 ? 60.281  153.557 -109.503 1.00 46.42  ? 254  ILE A CG1   1 
ATOM   1883  C CG2   . ILE A  1 254 ? 58.613  152.091 -110.602 1.00 45.55  ? 254  ILE A CG2   1 
ATOM   1884  C CD1   . ILE A  1 254 ? 60.343  154.081 -108.110 1.00 48.90  ? 254  ILE A CD1   1 
ATOM   1885  N N     . ASP A  1 255 ? 59.013  156.886 -110.225 1.00 43.27  ? 255  ASP A N     1 
ATOM   1886  C CA    . ASP A  1 255 ? 59.833  158.074 -109.985 1.00 42.52  ? 255  ASP A CA    1 
ATOM   1887  C C     . ASP A  1 255 ? 60.389  157.966 -108.575 1.00 41.20  ? 255  ASP A C     1 
ATOM   1888  O O     . ASP A  1 255 ? 59.649  157.678 -107.633 1.00 40.14  ? 255  ASP A O     1 
ATOM   1889  C CB    . ASP A  1 255 ? 59.012  159.375 -110.070 1.00 43.74  ? 255  ASP A CB    1 
ATOM   1890  C CG    . ASP A  1 255 ? 58.581  159.724 -111.487 1.00 45.57  ? 255  ASP A CG    1 
ATOM   1891  O OD1   . ASP A  1 255 ? 59.353  159.478 -112.444 1.00 44.77  ? 255  ASP A OD1   1 
ATOM   1892  O OD2   . ASP A  1 255 ? 57.464  160.271 -111.628 1.00 46.52  ? 255  ASP A OD2   1 
ATOM   1893  N N     . VAL A  1 256 ? 61.683  158.206 -108.424 1.00 41.16  ? 256  VAL A N     1 
ATOM   1894  C CA    . VAL A  1 256 ? 62.289  158.126 -107.099 1.00 41.75  ? 256  VAL A CA    1 
ATOM   1895  C C     . VAL A  1 256 ? 62.720  159.512 -106.677 1.00 41.98  ? 256  VAL A C     1 
ATOM   1896  O O     . VAL A  1 256 ? 63.526  160.144 -107.347 1.00 41.20  ? 256  VAL A O     1 
ATOM   1897  C CB    . VAL A  1 256 ? 63.547  157.190 -107.076 1.00 41.22  ? 256  VAL A CB    1 
ATOM   1898  C CG1   . VAL A  1 256 ? 64.047  157.033 -105.662 1.00 39.81  ? 256  VAL A CG1   1 
ATOM   1899  C CG2   . VAL A  1 256 ? 63.213  155.832 -107.653 1.00 39.47  ? 256  VAL A CG2   1 
ATOM   1900  N N     . SER A  1 257 ? 62.163  159.988 -105.571 1.00 43.98  ? 257  SER A N     1 
ATOM   1901  C CA    . SER A  1 257 ? 62.527  161.301 -105.063 1.00 46.90  ? 257  SER A CA    1 
ATOM   1902  C C     . SER A  1 257 ? 63.696  161.119 -104.108 1.00 47.40  ? 257  SER A C     1 
ATOM   1903  O O     . SER A  1 257 ? 63.636  160.316 -103.175 1.00 47.74  ? 257  SER A O     1 
ATOM   1904  C CB    . SER A  1 257 ? 61.341  161.971 -104.353 1.00 47.05  ? 257  SER A CB    1 
ATOM   1905  O OG    . SER A  1 257 ? 60.789  161.129 -103.359 1.00 51.74  ? 257  SER A OG    1 
ATOM   1906  N N     . ILE A  1 258 ? 64.772  161.850 -104.378 1.00 48.32  ? 258  ILE A N     1 
ATOM   1907  C CA    . ILE A  1 258 ? 65.991  161.796 -103.579 1.00 48.77  ? 258  ILE A CA    1 
ATOM   1908  C C     . ILE A  1 258 ? 66.465  163.204 -103.269 1.00 51.30  ? 258  ILE A C     1 
ATOM   1909  O O     . ILE A  1 258 ? 65.945  164.191 -103.803 1.00 51.86  ? 258  ILE A O     1 
ATOM   1910  C CB    . ILE A  1 258 ? 67.145  161.096 -104.337 1.00 46.91  ? 258  ILE A CB    1 
ATOM   1911  C CG1   . ILE A  1 258 ? 67.482  161.900 -105.600 1.00 44.57  ? 258  ILE A CG1   1 
ATOM   1912  C CG2   . ILE A  1 258 ? 66.769  159.651 -104.649 1.00 45.74  ? 258  ILE A CG2   1 
ATOM   1913  C CD1   . ILE A  1 258 ? 68.625  161.347 -106.408 1.00 42.61  ? 258  ILE A CD1   1 
ATOM   1914  N N     . GLU A  1 259 ? 67.467  163.279 -102.404 1.00 53.03  ? 259  GLU A N     1 
ATOM   1915  C CA    . GLU A  1 259 ? 68.062  164.545 -102.024 1.00 54.91  ? 259  GLU A CA    1 
ATOM   1916  C C     . GLU A  1 259 ? 69.256  164.269 -101.149 1.00 54.88  ? 259  GLU A C     1 
ATOM   1917  O O     . GLU A  1 259 ? 69.443  163.143 -100.691 1.00 54.30  ? 259  GLU A O     1 
ATOM   1918  C CB    . GLU A  1 259 ? 67.062  165.411 -101.270 1.00 56.38  ? 259  GLU A CB    1 
ATOM   1919  C CG    . GLU A  1 259 ? 66.675  164.912 -99.906  1.00 58.72  ? 259  GLU A CG    1 
ATOM   1920  C CD    . GLU A  1 259 ? 65.696  165.863 -99.226  1.00 61.75  ? 259  GLU A CD    1 
ATOM   1921  O OE1   . GLU A  1 259 ? 64.608  166.109 -99.793  1.00 61.40  ? 259  GLU A OE1   1 
ATOM   1922  O OE2   . GLU A  1 259 ? 66.012  166.376 -98.131  1.00 62.83  ? 259  GLU A OE2   1 
ATOM   1923  N N     . ALA A  1 260 ? 70.064  165.296 -100.926 1.00 54.68  ? 260  ALA A N     1 
ATOM   1924  C CA    . ALA A  1 260 ? 71.244  165.166 -100.090 1.00 55.08  ? 260  ALA A CA    1 
ATOM   1925  C C     . ALA A  1 260 ? 70.854  164.514 -98.769  1.00 55.43  ? 260  ALA A C     1 
ATOM   1926  O O     . ALA A  1 260 ? 69.774  164.771 -98.237  1.00 54.36  ? 260  ALA A O     1 
ATOM   1927  C CB    . ALA A  1 260 ? 71.857  166.537 -99.842  1.00 54.63  ? 260  ALA A CB    1 
ATOM   1928  N N     . ALA A  1 261 ? 71.734  163.667 -98.250  1.00 56.08  ? 261  ALA A N     1 
ATOM   1929  C CA    . ALA A  1 261 ? 71.485  162.975 -96.990  1.00 56.79  ? 261  ALA A CA    1 
ATOM   1930  C C     . ALA A  1 261 ? 71.197  163.956 -95.846  1.00 57.40  ? 261  ALA A C     1 
ATOM   1931  O O     . ALA A  1 261 ? 70.375  163.674 -94.966  1.00 56.34  ? 261  ALA A O     1 
ATOM   1932  C CB    . ALA A  1 261 ? 72.681  162.090 -96.638  1.00 56.84  ? 261  ALA A CB    1 
ATOM   1933  N N     . SER A  1 262 ? 71.863  165.106 -95.868  1.00 57.63  ? 262  SER A N     1 
ATOM   1934  C CA    . SER A  1 262 ? 71.677  166.124 -94.833  1.00 58.60  ? 262  SER A CA    1 
ATOM   1935  C C     . SER A  1 262 ? 70.435  166.991 -95.090  1.00 59.40  ? 262  SER A C     1 
ATOM   1936  O O     . SER A  1 262 ? 69.963  167.697 -94.194  1.00 59.20  ? 262  SER A O     1 
ATOM   1937  C CB    . SER A  1 262 ? 72.908  167.026 -94.770  1.00 57.36  ? 262  SER A CB    1 
ATOM   1938  O OG    . SER A  1 262 ? 73.060  167.724 -95.988  1.00 56.33  ? 262  SER A OG    1 
ATOM   1939  N N     . GLY A  1 263 ? 69.918  166.938 -96.317  1.00 60.22  ? 263  GLY A N     1 
ATOM   1940  C CA    . GLY A  1 263 ? 68.746  167.726 -96.666  1.00 60.00  ? 263  GLY A CA    1 
ATOM   1941  C C     . GLY A  1 263 ? 68.966  168.683 -97.827  1.00 60.40  ? 263  GLY A C     1 
ATOM   1942  O O     . GLY A  1 263 ? 70.089  169.123 -98.096  1.00 59.97  ? 263  GLY A O     1 
ATOM   1943  N N     . GLY A  1 264 ? 67.878  169.008 -98.520  1.00 60.97  ? 264  GLY A N     1 
ATOM   1944  C CA    . GLY A  1 264 ? 67.958  169.916 -99.650  1.00 61.53  ? 264  GLY A CA    1 
ATOM   1945  C C     . GLY A  1 264 ? 68.323  169.195 -100.931 1.00 61.62  ? 264  GLY A C     1 
ATOM   1946  O O     . GLY A  1 264 ? 68.194  167.977 -101.017 1.00 60.92  ? 264  GLY A O     1 
ATOM   1947  N N     . LYS A  1 265 ? 68.758  169.948 -101.936 1.00 61.59  ? 265  LYS A N     1 
ATOM   1948  C CA    . LYS A  1 265 ? 69.169  169.368 -103.212 1.00 61.53  ? 265  LYS A CA    1 
ATOM   1949  C C     . LYS A  1 265 ? 68.166  168.383 -103.831 1.00 60.43  ? 265  LYS A C     1 
ATOM   1950  O O     . LYS A  1 265 ? 68.520  167.621 -104.737 1.00 60.24  ? 265  LYS A O     1 
ATOM   1951  C CB    . LYS A  1 265 ? 70.522  168.674 -103.022 1.00 62.95  ? 265  LYS A CB    1 
ATOM   1952  C CG    . LYS A  1 265 ? 71.606  169.581 -102.448 1.00 64.97  ? 265  LYS A CG    1 
ATOM   1953  C CD    . LYS A  1 265 ? 72.044  170.637 -103.458 1.00 66.75  ? 265  LYS A CD    1 
ATOM   1954  C CE    . LYS A  1 265 ? 72.859  170.023 -104.600 1.00 67.94  ? 265  LYS A CE    1 
ATOM   1955  N NZ    . LYS A  1 265 ? 72.099  169.024 -105.420 1.00 68.69  ? 265  LYS A NZ    1 
ATOM   1956  N N     . ALA A  1 266 ? 66.919  168.418 -103.359 1.00 58.84  ? 266  ALA A N     1 
ATOM   1957  C CA    . ALA A  1 266 ? 65.853  167.522 -103.832 1.00 57.33  ? 266  ALA A CA    1 
ATOM   1958  C C     . ALA A  1 266 ? 65.712  167.335 -105.342 1.00 56.14  ? 266  ALA A C     1 
ATOM   1959  O O     . ALA A  1 266 ? 65.871  168.273 -106.111 1.00 56.89  ? 266  ALA A O     1 
ATOM   1960  C CB    . ALA A  1 266 ? 64.523  167.977 -103.262 1.00 56.52  ? 266  ALA A CB    1 
ATOM   1961  N N     . GLU A  1 267 ? 65.416  166.111 -105.765 1.00 54.43  ? 267  GLU A N     1 
ATOM   1962  C CA    . GLU A  1 267 ? 65.222  165.833 -107.181 1.00 53.66  ? 267  GLU A CA    1 
ATOM   1963  C C     . GLU A  1 267 ? 64.568  164.475 -107.414 1.00 52.60  ? 267  GLU A C     1 
ATOM   1964  O O     . GLU A  1 267 ? 64.357  163.697 -106.479 1.00 52.95  ? 267  GLU A O     1 
ATOM   1965  C CB    . GLU A  1 267 ? 66.541  165.910 -107.955 1.00 54.95  ? 267  GLU A CB    1 
ATOM   1966  C CG    . GLU A  1 267 ? 67.537  164.809 -107.667 1.00 57.09  ? 267  GLU A CG    1 
ATOM   1967  C CD    . GLU A  1 267 ? 68.730  164.869 -108.598 1.00 58.71  ? 267  GLU A CD    1 
ATOM   1968  O OE1   . GLU A  1 267 ? 68.538  164.668 -109.819 1.00 60.00  ? 267  GLU A OE1   1 
ATOM   1969  O OE2   . GLU A  1 267 ? 69.857  165.121 -108.111 1.00 58.27  ? 267  GLU A OE2   1 
ATOM   1970  N N     . VAL A  1 268 ? 64.236  164.205 -108.672 1.00 50.71  ? 268  VAL A N     1 
ATOM   1971  C CA    . VAL A  1 268 ? 63.603  162.956 -109.045 1.00 48.51  ? 268  VAL A CA    1 
ATOM   1972  C C     . VAL A  1 268 ? 64.346  162.253 -110.178 1.00 48.13  ? 268  VAL A C     1 
ATOM   1973  O O     . VAL A  1 268 ? 64.884  162.884 -111.096 1.00 48.49  ? 268  VAL A O     1 
ATOM   1974  C CB    . VAL A  1 268 ? 62.128  163.181 -109.463 1.00 48.30  ? 268  VAL A CB    1 
ATOM   1975  C CG1   . VAL A  1 268 ? 61.482  161.856 -109.881 1.00 48.33  ? 268  VAL A CG1   1 
ATOM   1976  C CG2   . VAL A  1 268 ? 61.350  163.800 -108.305 1.00 47.10  ? 268  VAL A CG2   1 
ATOM   1977  N N     . ILE A  1 269 ? 64.388  160.932 -110.088 1.00 45.43  ? 269  ILE A N     1 
ATOM   1978  C CA    . ILE A  1 269 ? 65.029  160.127 -111.101 1.00 44.08  ? 269  ILE A CA    1 
ATOM   1979  C C     . ILE A  1 269 ? 63.982  159.098 -111.466 1.00 43.08  ? 269  ILE A C     1 
ATOM   1980  O O     . ILE A  1 269 ? 63.050  158.870 -110.705 1.00 43.40  ? 269  ILE A O     1 
ATOM   1981  C CB    . ILE A  1 269 ? 66.307  159.483 -110.547 1.00 44.46  ? 269  ILE A CB    1 
ATOM   1982  C CG1   . ILE A  1 269 ? 66.043  158.917 -109.154 1.00 43.91  ? 269  ILE A CG1   1 
ATOM   1983  C CG2   . ILE A  1 269 ? 67.416  160.529 -110.476 1.00 42.96  ? 269  ILE A CG2   1 
ATOM   1984  C CD1   . ILE A  1 269 ? 67.289  158.473 -108.455 1.00 46.00  ? 269  ILE A CD1   1 
ATOM   1985  N N     . THR A  1 270 ? 64.115  158.476 -112.626 1.00 42.98  ? 270  THR A N     1 
ATOM   1986  C CA    . THR A  1 270 ? 63.108  157.512 -113.060 1.00 42.42  ? 270  THR A CA    1 
ATOM   1987  C C     . THR A  1 270 ? 63.713  156.184 -113.494 1.00 41.95  ? 270  THR A C     1 
ATOM   1988  O O     . THR A  1 270 ? 64.782  156.154 -114.080 1.00 43.42  ? 270  THR A O     1 
ATOM   1989  C CB    . THR A  1 270 ? 62.275  158.136 -114.201 1.00 41.58  ? 270  THR A CB    1 
ATOM   1990  O OG1   . THR A  1 270 ? 61.633  159.316 -113.705 1.00 41.28  ? 270  THR A OG1   1 
ATOM   1991  C CG2   . THR A  1 270 ? 61.223  157.179 -114.704 1.00 42.33  ? 270  THR A CG2   1 
ATOM   1992  N N     . CYS A  1 271 ? 63.017  155.084 -113.222 1.00 41.79  ? 271  CYS A N     1 
ATOM   1993  C CA    . CYS A  1 271 ? 63.543  153.762 -113.572 1.00 41.09  ? 271  CYS A CA    1 
ATOM   1994  C C     . CYS A  1 271 ? 62.449  152.740 -113.853 1.00 40.28  ? 271  CYS A C     1 
ATOM   1995  O O     . CYS A  1 271 ? 61.274  152.959 -113.543 1.00 39.38  ? 271  CYS A O     1 
ATOM   1996  C CB    . CYS A  1 271 ? 64.415  153.236 -112.422 1.00 38.99  ? 271  CYS A CB    1 
ATOM   1997  S SG    . CYS A  1 271 ? 63.461  152.936 -110.913 1.00 41.57  ? 271  CYS A SG    1 
ATOM   1998  N N     . ASP A  1 272 ? 62.858  151.614 -114.428 1.00 39.29  ? 272  ASP A N     1 
ATOM   1999  C CA    . ASP A  1 272 ? 61.952  150.522 -114.738 1.00 38.60  ? 272  ASP A CA    1 
ATOM   2000  C C     . ASP A  1 272 ? 61.805  149.624 -113.511 1.00 38.65  ? 272  ASP A C     1 
ATOM   2001  O O     . ASP A  1 272 ? 60.712  149.146 -113.189 1.00 36.53  ? 272  ASP A O     1 
ATOM   2002  C CB    . ASP A  1 272 ? 62.512  149.736 -115.911 1.00 40.32  ? 272  ASP A CB    1 
ATOM   2003  C CG    . ASP A  1 272 ? 62.654  150.591 -117.141 1.00 43.08  ? 272  ASP A CG    1 
ATOM   2004  O OD1   . ASP A  1 272 ? 61.622  151.141 -117.573 1.00 45.05  ? 272  ASP A OD1   1 
ATOM   2005  O OD2   . ASP A  1 272 ? 63.780  150.727 -117.669 1.00 45.44  ? 272  ASP A OD2   1 
ATOM   2006  N N     . VAL A  1 273 ? 62.917  149.402 -112.814 1.00 37.82  ? 273  VAL A N     1 
ATOM   2007  C CA    . VAL A  1 273 ? 62.889  148.566 -111.620 1.00 36.40  ? 273  VAL A CA    1 
ATOM   2008  C C     . VAL A  1 273 ? 63.516  149.293 -110.447 1.00 35.08  ? 273  VAL A C     1 
ATOM   2009  O O     . VAL A  1 273 ? 64.514  149.994 -110.596 1.00 34.68  ? 273  VAL A O     1 
ATOM   2010  C CB    . VAL A  1 273 ? 63.640  147.216 -111.857 1.00 37.09  ? 273  VAL A CB    1 
ATOM   2011  C CG1   . VAL A  1 273 ? 63.876  146.503 -110.514 1.00 36.20  ? 273  VAL A CG1   1 
ATOM   2012  C CG2   . VAL A  1 273 ? 62.818  146.323 -112.783 1.00 34.49  ? 273  VAL A CG2   1 
ATOM   2013  N N     . LEU A  1 274 ? 62.892  149.163 -109.281 1.00 35.19  ? 274  LEU A N     1 
ATOM   2014  C CA    . LEU A  1 274 ? 63.441  149.774 -108.085 1.00 34.15  ? 274  LEU A CA    1 
ATOM   2015  C C     . LEU A  1 274 ? 63.834  148.646 -107.119 1.00 33.53  ? 274  LEU A C     1 
ATOM   2016  O O     . LEU A  1 274 ? 62.985  147.875 -106.654 1.00 31.36  ? 274  LEU A O     1 
ATOM   2017  C CB    . LEU A  1 274 ? 62.434  150.720 -107.420 1.00 32.93  ? 274  LEU A CB    1 
ATOM   2018  C CG    . LEU A  1 274 ? 62.860  151.317 -106.070 1.00 31.88  ? 274  LEU A CG    1 
ATOM   2019  C CD1   . LEU A  1 274 ? 64.129  152.117 -106.243 1.00 34.19  ? 274  LEU A CD1   1 
ATOM   2020  C CD2   . LEU A  1 274 ? 61.788  152.187 -105.498 1.00 33.81  ? 274  LEU A CD2   1 
ATOM   2021  N N     . LEU A  1 275 ? 65.133  148.532 -106.850 1.00 33.87  ? 275  LEU A N     1 
ATOM   2022  C CA    . LEU A  1 275 ? 65.622  147.511 -105.916 1.00 32.70  ? 275  LEU A CA    1 
ATOM   2023  C C     . LEU A  1 275 ? 65.833  148.115 -104.534 1.00 32.08  ? 275  LEU A C     1 
ATOM   2024  O O     . LEU A  1 275 ? 66.635  149.032 -104.361 1.00 31.21  ? 275  LEU A O     1 
ATOM   2025  C CB    . LEU A  1 275 ? 66.933  146.897 -106.412 1.00 32.87  ? 275  LEU A CB    1 
ATOM   2026  C CG    . LEU A  1 275 ? 67.690  146.046 -105.374 1.00 32.74  ? 275  LEU A CG    1 
ATOM   2027  C CD1   . LEU A  1 275 ? 66.763  144.970 -104.815 1.00 30.95  ? 275  LEU A CD1   1 
ATOM   2028  C CD2   . LEU A  1 275 ? 68.964  145.440 -106.011 1.00 29.76  ? 275  LEU A CD2   1 
ATOM   2029  N N     . VAL A  1 276 ? 65.091  147.612 -103.557 1.00 32.00  ? 276  VAL A N     1 
ATOM   2030  C CA    . VAL A  1 276 ? 65.225  148.096 -102.198 1.00 33.82  ? 276  VAL A CA    1 
ATOM   2031  C C     . VAL A  1 276 ? 66.123  147.158 -101.370 1.00 35.23  ? 276  VAL A C     1 
ATOM   2032  O O     . VAL A  1 276 ? 65.707  146.066 -101.008 1.00 35.62  ? 276  VAL A O     1 
ATOM   2033  C CB    . VAL A  1 276 ? 63.871  148.176 -101.494 1.00 32.99  ? 276  VAL A CB    1 
ATOM   2034  C CG1   . VAL A  1 276 ? 64.078  148.653 -100.064 1.00 33.84  ? 276  VAL A CG1   1 
ATOM   2035  C CG2   . VAL A  1 276 ? 62.918  149.116 -102.254 1.00 33.69  ? 276  VAL A CG2   1 
ATOM   2036  N N     . CYS A  1 277 ? 67.358  147.566 -101.098 1.00 36.27  ? 277  CYS A N     1 
ATOM   2037  C CA    . CYS A  1 277 ? 68.244  146.738 -100.285 1.00 36.55  ? 277  CYS A CA    1 
ATOM   2038  C C     . CYS A  1 277 ? 69.030  147.601 -99.310  1.00 35.99  ? 277  CYS A C     1 
ATOM   2039  O O     . CYS A  1 277 ? 70.228  147.854 -99.465  1.00 35.72  ? 277  CYS A O     1 
ATOM   2040  C CB    . CYS A  1 277 ? 69.187  145.898 -101.163 1.00 37.60  ? 277  CYS A CB    1 
ATOM   2041  S SG    . CYS A  1 277 ? 70.069  146.809 -102.451 1.00 41.10  ? 277  CYS A SG    1 
ATOM   2042  N N     . ILE A  1 278 ? 68.332  148.052 -98.288  1.00 36.36  ? 278  ILE A N     1 
ATOM   2043  C CA    . ILE A  1 278 ? 68.946  148.899 -97.290  1.00 38.93  ? 278  ILE A CA    1 
ATOM   2044  C C     . ILE A  1 278 ? 69.302  148.107 -96.035  1.00 39.53  ? 278  ILE A C     1 
ATOM   2045  O O     . ILE A  1 278 ? 69.464  148.685 -94.962  1.00 40.11  ? 278  ILE A O     1 
ATOM   2046  C CB    . ILE A  1 278 ? 68.001  150.056 -96.908  1.00 40.08  ? 278  ILE A CB    1 
ATOM   2047  C CG1   . ILE A  1 278 ? 66.672  149.481 -96.404  1.00 39.50  ? 278  ILE A CG1   1 
ATOM   2048  C CG2   . ILE A  1 278 ? 67.793  150.972 -98.122  1.00 39.66  ? 278  ILE A CG2   1 
ATOM   2049  C CD1   . ILE A  1 278 ? 65.780  150.487 -95.696  1.00 40.33  ? 278  ILE A CD1   1 
ATOM   2050  N N     . GLY A  1 279 ? 69.416  146.784 -96.173  1.00 39.66  ? 279  GLY A N     1 
ATOM   2051  C CA    . GLY A  1 279 ? 69.762  145.941 -95.037  1.00 36.94  ? 279  GLY A CA    1 
ATOM   2052  C C     . GLY A  1 279 ? 68.774  144.824 -94.723  1.00 35.60  ? 279  GLY A C     1 
ATOM   2053  O O     . GLY A  1 279 ? 67.704  144.714 -95.337  1.00 34.67  ? 279  GLY A O     1 
ATOM   2054  N N     . ARG A  1 280 ? 69.144  143.967 -93.769  1.00 33.78  ? 280  ARG A N     1 
ATOM   2055  C CA    . ARG A  1 280 ? 68.265  142.881 -93.342  1.00 31.82  ? 280  ARG A CA    1 
ATOM   2056  C C     . ARG A  1 280 ? 68.156  142.941 -91.825  1.00 30.98  ? 280  ARG A C     1 
ATOM   2057  O O     . ARG A  1 280 ? 68.946  143.604 -91.150  1.00 32.00  ? 280  ARG A O     1 
ATOM   2058  C CB    . ARG A  1 280 ? 68.788  141.516 -93.808  1.00 29.63  ? 280  ARG A CB    1 
ATOM   2059  C CG    . ARG A  1 280 ? 68.779  141.322 -95.313  1.00 29.18  ? 280  ARG A CG    1 
ATOM   2060  C CD    . ARG A  1 280 ? 69.388  139.966 -95.719  1.00 28.43  ? 280  ARG A CD    1 
ATOM   2061  N NE    . ARG A  1 280 ? 68.561  138.844 -95.277  1.00 29.60  ? 280  ARG A NE    1 
ATOM   2062  C CZ    . ARG A  1 280 ? 67.396  138.502 -95.816  1.00 29.77  ? 280  ARG A CZ    1 
ATOM   2063  N NH1   . ARG A  1 280 ? 66.898  139.193 -96.841  1.00 29.98  ? 280  ARG A NH1   1 
ATOM   2064  N NH2   . ARG A  1 280 ? 66.721  137.469 -95.327  1.00 28.60  ? 280  ARG A NH2   1 
ATOM   2065  N N     . ARG A  1 281 ? 67.170  142.258 -91.265  1.00 30.33  ? 281  ARG A N     1 
ATOM   2066  C CA    . ARG A  1 281 ? 67.003  142.339 -89.832  1.00 29.09  ? 281  ARG A CA    1 
ATOM   2067  C C     . ARG A  1 281 ? 66.568  141.006 -89.268  1.00 28.82  ? 281  ARG A C     1 
ATOM   2068  O O     . ARG A  1 281 ? 65.964  140.184 -89.972  1.00 28.18  ? 281  ARG A O     1 
ATOM   2069  C CB    . ARG A  1 281 ? 65.976  143.427 -89.492  1.00 30.68  ? 281  ARG A CB    1 
ATOM   2070  C CG    . ARG A  1 281 ? 64.606  143.183 -90.074  1.00 33.49  ? 281  ARG A CG    1 
ATOM   2071  C CD    . ARG A  1 281 ? 63.660  144.378 -89.832  1.00 36.55  ? 281  ARG A CD    1 
ATOM   2072  N NE    . ARG A  1 281 ? 62.267  144.006 -90.092  1.00 38.33  ? 281  ARG A NE    1 
ATOM   2073  C CZ    . ARG A  1 281 ? 61.231  144.838 -89.967  1.00 40.46  ? 281  ARG A CZ    1 
ATOM   2074  N NH1   . ARG A  1 281 ? 61.434  146.093 -89.593  1.00 37.75  ? 281  ARG A NH1   1 
ATOM   2075  N NH2   . ARG A  1 281 ? 59.988  144.406 -90.191  1.00 40.74  ? 281  ARG A NH2   1 
ATOM   2076  N N     . PRO A  1 282 ? 66.858  140.778 -87.985  1.00 28.18  ? 282  PRO A N     1 
ATOM   2077  C CA    . PRO A  1 282 ? 66.501  139.526 -87.312  1.00 27.74  ? 282  PRO A CA    1 
ATOM   2078  C C     . PRO A  1 282 ? 65.022  139.201 -87.324  1.00 27.83  ? 282  PRO A C     1 
ATOM   2079  O O     . PRO A  1 282 ? 64.185  140.060 -87.047  1.00 29.64  ? 282  PRO A O     1 
ATOM   2080  C CB    . PRO A  1 282 ? 67.061  139.709 -85.891  1.00 26.26  ? 282  PRO A CB    1 
ATOM   2081  C CG    . PRO A  1 282 ? 67.238  141.218 -85.745  1.00 28.13  ? 282  PRO A CG    1 
ATOM   2082  C CD    . PRO A  1 282 ? 67.679  141.638 -87.114  1.00 27.93  ? 282  PRO A CD    1 
ATOM   2083  N N     . PHE A  1 283 ? 64.711  137.944 -87.627  1.00 28.23  ? 283  PHE A N     1 
ATOM   2084  C CA    . PHE A  1 283 ? 63.330  137.471 -87.683  1.00 29.11  ? 283  PHE A CA    1 
ATOM   2085  C C     . PHE A  1 283 ? 62.995  136.556 -86.515  1.00 30.50  ? 283  PHE A C     1 
ATOM   2086  O O     . PHE A  1 283 ? 63.546  135.461 -86.424  1.00 30.97  ? 283  PHE A O     1 
ATOM   2087  C CB    . PHE A  1 283 ? 63.095  136.709 -88.985  1.00 29.58  ? 283  PHE A CB    1 
ATOM   2088  C CG    . PHE A  1 283 ? 61.673  136.270 -89.170  1.00 31.62  ? 283  PHE A CG    1 
ATOM   2089  C CD1   . PHE A  1 283 ? 60.697  137.179 -89.622  1.00 31.80  ? 283  PHE A CD1   1 
ATOM   2090  C CD2   . PHE A  1 283 ? 61.294  134.958 -88.873  1.00 28.40  ? 283  PHE A CD2   1 
ATOM   2091  C CE1   . PHE A  1 283 ? 59.359  136.771 -89.774  1.00 31.24  ? 283  PHE A CE1   1 
ATOM   2092  C CE2   . PHE A  1 283 ? 59.972  134.540 -89.017  1.00 30.49  ? 283  PHE A CE2   1 
ATOM   2093  C CZ    . PHE A  1 283 ? 58.996  135.450 -89.471  1.00 31.06  ? 283  PHE A CZ    1 
ATOM   2094  N N     . THR A  1 284 ? 62.092  136.986 -85.635  1.00 30.52  ? 284  THR A N     1 
ATOM   2095  C CA    . THR A  1 284 ? 61.714  136.196 -84.468  1.00 32.54  ? 284  THR A CA    1 
ATOM   2096  C C     . THR A  1 284 ? 60.206  136.119 -84.315  1.00 34.68  ? 284  THR A C     1 
ATOM   2097  O O     . THR A  1 284 ? 59.714  135.722 -83.261  1.00 32.05  ? 284  THR A O     1 
ATOM   2098  C CB    . THR A  1 284 ? 62.247  136.818 -83.151  1.00 32.95  ? 284  THR A CB    1 
ATOM   2099  O OG1   . THR A  1 284 ? 62.049  138.240 -83.173  1.00 32.56  ? 284  THR A OG1   1 
ATOM   2100  C CG2   . THR A  1 284 ? 63.703  136.528 -82.968  1.00 31.14  ? 284  THR A CG2   1 
ATOM   2101  N N     . LYS A  1 285 ? 59.484  136.479 -85.369  1.00 37.00  ? 285  LYS A N     1 
ATOM   2102  C CA    . LYS A  1 285 ? 58.028  136.534 -85.312  1.00 40.63  ? 285  LYS A CA    1 
ATOM   2103  C C     . LYS A  1 285 ? 57.267  135.308 -84.819  1.00 39.50  ? 285  LYS A C     1 
ATOM   2104  O O     . LYS A  1 285 ? 57.490  134.180 -85.270  1.00 39.43  ? 285  LYS A O     1 
ATOM   2105  C CB    . LYS A  1 285 ? 57.467  136.971 -86.677  1.00 42.66  ? 285  LYS A CB    1 
ATOM   2106  C CG    . LYS A  1 285 ? 56.014  137.385 -86.614  1.00 47.85  ? 285  LYS A CG    1 
ATOM   2107  C CD    . LYS A  1 285 ? 55.467  137.794 -87.992  1.00 51.53  ? 285  LYS A CD    1 
ATOM   2108  C CE    . LYS A  1 285 ? 53.969  138.181 -87.895  1.00 53.81  ? 285  LYS A CE    1 
ATOM   2109  N NZ    . LYS A  1 285 ? 53.334  138.583 -89.200  1.00 54.68  ? 285  LYS A NZ    1 
ATOM   2110  N N     . ASN A  1 286 ? 56.364  135.552 -83.874  1.00 38.87  ? 286  ASN A N     1 
ATOM   2111  C CA    . ASN A  1 286 ? 55.504  134.505 -83.326  1.00 38.78  ? 286  ASN A CA    1 
ATOM   2112  C C     . ASN A  1 286 ? 56.263  133.280 -82.847  1.00 37.11  ? 286  ASN A C     1 
ATOM   2113  O O     . ASN A  1 286 ? 55.769  132.170 -82.961  1.00 34.88  ? 286  ASN A O     1 
ATOM   2114  C CB    . ASN A  1 286 ? 54.486  134.089 -84.383  1.00 41.50  ? 286  ASN A CB    1 
ATOM   2115  C CG    . ASN A  1 286 ? 53.632  135.255 -84.884  1.00 46.46  ? 286  ASN A CG    1 
ATOM   2116  O OD1   . ASN A  1 286 ? 53.332  135.348 -86.099  1.00 48.32  ? 286  ASN A OD1   1 
ATOM   2117  N ND2   . ASN A  1 286 ? 53.237  136.134 -83.989  1.00 45.80  ? 286  ASN A ND2   1 
ATOM   2118  N N     . LEU A  1 287 ? 57.461  133.485 -82.304  1.00 35.69  ? 287  LEU A N     1 
ATOM   2119  C CA    . LEU A  1 287 ? 58.268  132.372 -81.820  1.00 34.77  ? 287  LEU A CA    1 
ATOM   2120  C C     . LEU A  1 287 ? 57.929  132.047 -80.359  1.00 34.09  ? 287  LEU A C     1 
ATOM   2121  O O     . LEU A  1 287 ? 58.263  130.972 -79.853  1.00 33.21  ? 287  LEU A O     1 
ATOM   2122  C CB    . LEU A  1 287 ? 59.746  132.749 -81.964  1.00 33.77  ? 287  LEU A CB    1 
ATOM   2123  C CG    . LEU A  1 287 ? 60.846  131.710 -81.816  1.00 33.14  ? 287  LEU A CG    1 
ATOM   2124  C CD1   . LEU A  1 287 ? 60.596  130.493 -82.708  1.00 27.95  ? 287  LEU A CD1   1 
ATOM   2125  C CD2   . LEU A  1 287 ? 62.174  132.411 -82.142  1.00 32.73  ? 287  LEU A CD2   1 
ATOM   2126  N N     . GLY A  1 288 ? 57.263  132.989 -79.693  1.00 33.40  ? 288  GLY A N     1 
ATOM   2127  C CA    . GLY A  1 288 ? 56.864  132.808 -78.307  1.00 33.84  ? 288  GLY A CA    1 
ATOM   2128  C C     . GLY A  1 288 ? 57.831  133.407 -77.315  1.00 34.17  ? 288  GLY A C     1 
ATOM   2129  O O     . GLY A  1 288 ? 57.770  133.120 -76.115  1.00 35.15  ? 288  GLY A O     1 
ATOM   2130  N N     . LEU A  1 289 ? 58.729  134.244 -77.811  1.00 34.35  ? 289  LEU A N     1 
ATOM   2131  C CA    . LEU A  1 289 ? 59.727  134.847 -76.955  1.00 35.80  ? 289  LEU A CA    1 
ATOM   2132  C C     . LEU A  1 289 ? 59.125  135.709 -75.854  1.00 38.13  ? 289  LEU A C     1 
ATOM   2133  O O     . LEU A  1 289 ? 59.620  135.708 -74.723  1.00 37.62  ? 289  LEU A O     1 
ATOM   2134  C CB    . LEU A  1 289 ? 60.686  135.691 -77.795  1.00 33.94  ? 289  LEU A CB    1 
ATOM   2135  C CG    . LEU A  1 289 ? 61.401  134.951 -78.929  1.00 35.50  ? 289  LEU A CG    1 
ATOM   2136  C CD1   . LEU A  1 289 ? 62.323  135.902 -79.673  1.00 33.68  ? 289  LEU A CD1   1 
ATOM   2137  C CD2   . LEU A  1 289 ? 62.189  133.764 -78.366  1.00 33.51  ? 289  LEU A CD2   1 
ATOM   2138  N N     . GLU A  1 290 ? 58.066  136.445 -76.179  1.00 40.49  ? 290  GLU A N     1 
ATOM   2139  C CA    . GLU A  1 290 ? 57.474  137.331 -75.191  1.00 44.51  ? 290  GLU A CA    1 
ATOM   2140  C C     . GLU A  1 290 ? 56.934  136.572 -73.985  1.00 44.67  ? 290  GLU A C     1 
ATOM   2141  O O     . GLU A  1 290 ? 57.103  137.028 -72.855  1.00 45.77  ? 290  GLU A O     1 
ATOM   2142  C CB    . GLU A  1 290 ? 56.387  138.222 -75.823  1.00 47.21  ? 290  GLU A CB    1 
ATOM   2143  C CG    . GLU A  1 290 ? 56.041  139.440 -74.951  1.00 52.97  ? 290  GLU A CG    1 
ATOM   2144  C CD    . GLU A  1 290 ? 54.986  140.359 -75.569  1.00 55.75  ? 290  GLU A CD    1 
ATOM   2145  O OE1   . GLU A  1 290 ? 55.276  141.015 -76.595  1.00 57.76  ? 290  GLU A OE1   1 
ATOM   2146  O OE2   . GLU A  1 290 ? 53.862  140.423 -75.024  1.00 57.76  ? 290  GLU A OE2   1 
ATOM   2147  N N     . GLU A  1 291 ? 56.316  135.414 -74.209  1.00 44.82  ? 291  GLU A N     1 
ATOM   2148  C CA    . GLU A  1 291 ? 55.797  134.615 -73.100  1.00 46.00  ? 291  GLU A CA    1 
ATOM   2149  C C     . GLU A  1 291 ? 56.933  134.013 -72.261  1.00 45.97  ? 291  GLU A C     1 
ATOM   2150  O O     . GLU A  1 291 ? 56.795  133.857 -71.048  1.00 46.00  ? 291  GLU A O     1 
ATOM   2151  C CB    . GLU A  1 291 ? 54.911  133.467 -73.602  1.00 48.38  ? 291  GLU A CB    1 
ATOM   2152  C CG    . GLU A  1 291 ? 53.695  133.888 -74.402  1.00 52.04  ? 291  GLU A CG    1 
ATOM   2153  C CD    . GLU A  1 291 ? 53.951  133.923 -75.903  1.00 54.60  ? 291  GLU A CD    1 
ATOM   2154  O OE1   . GLU A  1 291 ? 54.836  134.702 -76.347  1.00 54.41  ? 291  GLU A OE1   1 
ATOM   2155  O OE2   . GLU A  1 291 ? 53.263  133.171 -76.640  1.00 55.26  ? 291  GLU A OE2   1 
ATOM   2156  N N     . LEU A  1 292 ? 58.049  133.668 -72.903  1.00 44.33  ? 292  LEU A N     1 
ATOM   2157  C CA    . LEU A  1 292 ? 59.183  133.075 -72.193  1.00 41.90  ? 292  LEU A CA    1 
ATOM   2158  C C     . LEU A  1 292 ? 59.919  134.087 -71.345  1.00 41.17  ? 292  LEU A C     1 
ATOM   2159  O O     . LEU A  1 292 ? 60.661  133.721 -70.438  1.00 41.70  ? 292  LEU A O     1 
ATOM   2160  C CB    . LEU A  1 292 ? 60.171  132.440 -73.180  1.00 40.98  ? 292  LEU A CB    1 
ATOM   2161  C CG    . LEU A  1 292 ? 59.767  131.120 -73.836  1.00 40.76  ? 292  LEU A CG    1 
ATOM   2162  C CD1   . LEU A  1 292 ? 60.772  130.742 -74.915  1.00 40.66  ? 292  LEU A CD1   1 
ATOM   2163  C CD2   . LEU A  1 292 ? 59.702  130.043 -72.777  1.00 40.41  ? 292  LEU A CD2   1 
ATOM   2164  N N     . GLY A  1 293 ? 59.713  135.365 -71.630  1.00 40.60  ? 293  GLY A N     1 
ATOM   2165  C CA    . GLY A  1 293 ? 60.411  136.396 -70.879  1.00 39.63  ? 293  GLY A CA    1 
ATOM   2166  C C     . GLY A  1 293 ? 61.751  136.723 -71.532  1.00 39.68  ? 293  GLY A C     1 
ATOM   2167  O O     . GLY A  1 293 ? 62.621  137.352 -70.911  1.00 38.97  ? 293  GLY A O     1 
ATOM   2168  N N     . ILE A  1 294 ? 61.918  136.275 -72.781  1.00 37.46  ? 294  ILE A N     1 
ATOM   2169  C CA    . ILE A  1 294 ? 63.141  136.526 -73.542  1.00 36.47  ? 294  ILE A CA    1 
ATOM   2170  C C     . ILE A  1 294 ? 62.951  137.801 -74.337  1.00 37.08  ? 294  ILE A C     1 
ATOM   2171  O O     . ILE A  1 294 ? 62.262  137.807 -75.365  1.00 37.26  ? 294  ILE A O     1 
ATOM   2172  C CB    . ILE A  1 294 ? 63.452  135.368 -74.530  1.00 35.55  ? 294  ILE A CB    1 
ATOM   2173  C CG1   . ILE A  1 294 ? 63.866  134.126 -73.742  1.00 33.11  ? 294  ILE A CG1   1 
ATOM   2174  C CG2   . ILE A  1 294 ? 64.536  135.794 -75.528  1.00 33.35  ? 294  ILE A CG2   1 
ATOM   2175  C CD1   . ILE A  1 294 ? 64.058  132.892 -74.596  1.00 35.73  ? 294  ILE A CD1   1 
ATOM   2176  N N     . GLU A  1 295 ? 63.573  138.875 -73.866  1.00 37.45  ? 295  GLU A N     1 
ATOM   2177  C CA    . GLU A  1 295 ? 63.461  140.164 -74.527  1.00 38.32  ? 295  GLU A CA    1 
ATOM   2178  C C     . GLU A  1 295 ? 64.532  140.388 -75.563  1.00 36.63  ? 295  GLU A C     1 
ATOM   2179  O O     . GLU A  1 295 ? 65.689  140.020 -75.367  1.00 37.15  ? 295  GLU A O     1 
ATOM   2180  C CB    . GLU A  1 295 ? 63.526  141.277 -73.490  1.00 42.07  ? 295  GLU A CB    1 
ATOM   2181  C CG    . GLU A  1 295 ? 62.420  141.183 -72.475  1.00 47.99  ? 295  GLU A CG    1 
ATOM   2182  C CD    . GLU A  1 295 ? 62.726  141.966 -71.215  1.00 52.66  ? 295  GLU A CD    1 
ATOM   2183  O OE1   . GLU A  1 295 ? 62.696  143.223 -71.239  1.00 53.36  ? 295  GLU A OE1   1 
ATOM   2184  O OE2   . GLU A  1 295 ? 63.011  141.307 -70.193  1.00 55.95  ? 295  GLU A OE2   1 
ATOM   2185  N N     . LEU A  1 296 ? 64.132  141.027 -76.655  1.00 34.33  ? 296  LEU A N     1 
ATOM   2186  C CA    . LEU A  1 296 ? 65.011  141.350 -77.765  1.00 33.43  ? 296  LEU A CA    1 
ATOM   2187  C C     . LEU A  1 296 ? 65.774  142.639 -77.480  1.00 34.71  ? 296  LEU A C     1 
ATOM   2188  O O     . LEU A  1 296 ? 65.316  143.445 -76.665  1.00 35.48  ? 296  LEU A O     1 
ATOM   2189  C CB    . LEU A  1 296 ? 64.161  141.535 -79.023  1.00 32.47  ? 296  LEU A CB    1 
ATOM   2190  C CG    . LEU A  1 296 ? 63.352  140.314 -79.458  1.00 30.99  ? 296  LEU A CG    1 
ATOM   2191  C CD1   . LEU A  1 296 ? 62.484  140.652 -80.661  1.00 29.48  ? 296  LEU A CD1   1 
ATOM   2192  C CD2   . LEU A  1 296 ? 64.304  139.198 -79.788  1.00 29.28  ? 296  LEU A CD2   1 
ATOM   2193  N N     . ASP A  1 297 ? 66.932  142.843 -78.117  1.00 33.15  ? 297  ASP A N     1 
ATOM   2194  C CA    . ASP A  1 297 ? 67.646  144.097 -77.906  1.00 34.92  ? 297  ASP A CA    1 
ATOM   2195  C C     . ASP A  1 297 ? 66.978  145.135 -78.818  1.00 35.25  ? 297  ASP A C     1 
ATOM   2196  O O     . ASP A  1 297 ? 65.986  144.829 -79.474  1.00 36.79  ? 297  ASP A O     1 
ATOM   2197  C CB    . ASP A  1 297 ? 69.169  143.980 -78.177  1.00 32.75  ? 297  ASP A CB    1 
ATOM   2198  C CG    . ASP A  1 297 ? 69.518  143.775 -79.640  1.00 33.77  ? 297  ASP A CG    1 
ATOM   2199  O OD1   . ASP A  1 297 ? 68.612  143.759 -80.507  1.00 32.87  ? 297  ASP A OD1   1 
ATOM   2200  O OD2   . ASP A  1 297 ? 70.733  143.621 -79.909  1.00 32.02  ? 297  ASP A OD2   1 
ATOM   2201  N N     . PRO A  1 298 ? 67.493  146.372 -78.865  1.00 36.93  ? 298  PRO A N     1 
ATOM   2202  C CA    . PRO A  1 298 ? 66.876  147.398 -79.723  1.00 37.99  ? 298  PRO A CA    1 
ATOM   2203  C C     . PRO A  1 298 ? 66.775  147.078 -81.209  1.00 38.23  ? 298  PRO A C     1 
ATOM   2204  O O     . PRO A  1 298 ? 65.868  147.557 -81.907  1.00 37.46  ? 298  PRO A O     1 
ATOM   2205  C CB    . PRO A  1 298 ? 67.755  148.624 -79.477  1.00 39.17  ? 298  PRO A CB    1 
ATOM   2206  C CG    . PRO A  1 298 ? 68.155  148.445 -78.040  1.00 39.07  ? 298  PRO A CG    1 
ATOM   2207  C CD    . PRO A  1 298 ? 68.532  146.970 -78.003  1.00 36.96  ? 298  PRO A CD    1 
ATOM   2208  N N     . ARG A  1 299 ? 67.716  146.272 -81.696  1.00 38.10  ? 299  ARG A N     1 
ATOM   2209  C CA    . ARG A  1 299 ? 67.742  145.902 -83.105  1.00 37.22  ? 299  ARG A CA    1 
ATOM   2210  C C     . ARG A  1 299 ? 66.951  144.627 -83.383  1.00 35.55  ? 299  ARG A C     1 
ATOM   2211  O O     . ARG A  1 299 ? 67.010  144.093 -84.495  1.00 36.51  ? 299  ARG A O     1 
ATOM   2212  C CB    . ARG A  1 299 ? 69.184  145.724 -83.572  1.00 38.65  ? 299  ARG A CB    1 
ATOM   2213  C CG    . ARG A  1 299 ? 70.190  146.610 -82.854  1.00 43.12  ? 299  ARG A CG    1 
ATOM   2214  C CD    . ARG A  1 299 ? 70.831  147.619 -83.767  1.00 44.86  ? 299  ARG A CD    1 
ATOM   2215  N NE    . ARG A  1 299 ? 71.585  146.998 -84.857  1.00 47.13  ? 299  ARG A NE    1 
ATOM   2216  C CZ    . ARG A  1 299 ? 72.867  146.631 -84.796  1.00 48.53  ? 299  ARG A CZ    1 
ATOM   2217  N NH1   . ARG A  1 299 ? 73.578  146.809 -83.688  1.00 48.99  ? 299  ARG A NH1   1 
ATOM   2218  N NH2   . ARG A  1 299 ? 73.453  146.103 -85.867  1.00 49.11  ? 299  ARG A NH2   1 
ATOM   2219  N N     . GLY A  1 300 ? 66.201  144.152 -82.394  1.00 32.91  ? 300  GLY A N     1 
ATOM   2220  C CA    . GLY A  1 300 ? 65.423  142.936 -82.569  1.00 31.15  ? 300  GLY A CA    1 
ATOM   2221  C C     . GLY A  1 300 ? 66.201  141.617 -82.440  1.00 30.58  ? 300  GLY A C     1 
ATOM   2222  O O     . GLY A  1 300 ? 65.682  140.543 -82.756  1.00 27.33  ? 300  GLY A O     1 
ATOM   2223  N N     . ARG A  1 301 ? 67.446  141.682 -81.992  1.00 30.09  ? 301  ARG A N     1 
ATOM   2224  C CA    . ARG A  1 301 ? 68.237  140.457 -81.816  1.00 30.13  ? 301  ARG A CA    1 
ATOM   2225  C C     . ARG A  1 301 ? 68.061  139.787 -80.451  1.00 29.45  ? 301  ARG A C     1 
ATOM   2226  O O     . ARG A  1 301 ? 67.717  140.432 -79.458  1.00 27.41  ? 301  ARG A O     1 
ATOM   2227  C CB    . ARG A  1 301 ? 69.706  140.767 -82.068  1.00 31.26  ? 301  ARG A CB    1 
ATOM   2228  C CG    . ARG A  1 301 ? 69.847  141.385 -83.436  1.00 35.10  ? 301  ARG A CG    1 
ATOM   2229  C CD    . ARG A  1 301 ? 71.178  142.000 -83.683  1.00 35.63  ? 301  ARG A CD    1 
ATOM   2230  N NE    . ARG A  1 301 ? 71.634  142.841 -82.589  1.00 35.67  ? 301  ARG A NE    1 
ATOM   2231  C CZ    . ARG A  1 301 ? 72.779  143.511 -82.645  1.00 36.85  ? 301  ARG A CZ    1 
ATOM   2232  N NH1   . ARG A  1 301 ? 73.519  143.430 -83.747  1.00 31.24  ? 301  ARG A NH1   1 
ATOM   2233  N NH2   . ARG A  1 301 ? 73.219  144.198 -81.589  1.00 37.73  ? 301  ARG A NH2   1 
ATOM   2234  N N     . ILE A  1 302 ? 68.270  138.478 -80.424  1.00 28.62  ? 302  ILE A N     1 
ATOM   2235  C CA    . ILE A  1 302 ? 68.156  137.723 -79.184  1.00 26.37  ? 302  ILE A CA    1 
ATOM   2236  C C     . ILE A  1 302 ? 69.490  137.787 -78.431  1.00 25.82  ? 302  ILE A C     1 
ATOM   2237  O O     . ILE A  1 302 ? 70.533  137.382 -78.965  1.00 23.42  ? 302  ILE A O     1 
ATOM   2238  C CB    . ILE A  1 302 ? 67.818  136.245 -79.464  1.00 26.50  ? 302  ILE A CB    1 
ATOM   2239  C CG1   . ILE A  1 302 ? 66.454  136.142 -80.164  1.00 27.00  ? 302  ILE A CG1   1 
ATOM   2240  C CG2   . ILE A  1 302 ? 67.782  135.453 -78.137  1.00 26.86  ? 302  ILE A CG2   1 
ATOM   2241  C CD1   . ILE A  1 302 ? 66.120  134.737 -80.688  1.00 24.65  ? 302  ILE A CD1   1 
ATOM   2242  N N     . PRO A  1 303 ? 69.484  138.328 -77.199  1.00 23.92  ? 303  PRO A N     1 
ATOM   2243  C CA    . PRO A  1 303 ? 70.724  138.412 -76.423  1.00 24.59  ? 303  PRO A CA    1 
ATOM   2244  C C     . PRO A  1 303 ? 71.154  137.004 -75.989  1.00 22.92  ? 303  PRO A C     1 
ATOM   2245  O O     . PRO A  1 303 ? 70.333  136.218 -75.517  1.00 24.78  ? 303  PRO A O     1 
ATOM   2246  C CB    . PRO A  1 303 ? 70.334  139.279 -75.213  1.00 25.57  ? 303  PRO A CB    1 
ATOM   2247  C CG    . PRO A  1 303 ? 69.168  140.104 -75.719  1.00 25.32  ? 303  PRO A CG    1 
ATOM   2248  C CD    . PRO A  1 303 ? 68.398  139.061 -76.527  1.00 24.24  ? 303  PRO A CD    1 
ATOM   2249  N N     . VAL A  1 304 ? 72.433  136.683 -76.169  1.00 24.06  ? 304  VAL A N     1 
ATOM   2250  C CA    . VAL A  1 304 ? 72.962  135.369 -75.775  1.00 23.33  ? 304  VAL A CA    1 
ATOM   2251  C C     . VAL A  1 304 ? 74.322  135.535 -75.088  1.00 23.54  ? 304  VAL A C     1 
ATOM   2252  O O     . VAL A  1 304 ? 74.992  136.554 -75.270  1.00 21.68  ? 304  VAL A O     1 
ATOM   2253  C CB    . VAL A  1 304 ? 73.095  134.418 -77.007  1.00 23.57  ? 304  VAL A CB    1 
ATOM   2254  C CG1   . VAL A  1 304 ? 71.713  134.098 -77.590  1.00 24.13  ? 304  VAL A CG1   1 
ATOM   2255  C CG2   . VAL A  1 304 ? 73.987  135.027 -78.038  1.00 23.57  ? 304  VAL A CG2   1 
ATOM   2256  N N     . ASN A  1 305 ? 74.705  134.544 -74.280  1.00 23.44  ? 305  ASN A N     1 
ATOM   2257  C CA    . ASN A  1 305 ? 75.973  134.591 -73.574  1.00 23.59  ? 305  ASN A CA    1 
ATOM   2258  C C     . ASN A  1 305 ? 77.044  133.867 -74.414  1.00 24.32  ? 305  ASN A C     1 
ATOM   2259  O O     . ASN A  1 305 ? 76.779  133.523 -75.565  1.00 24.94  ? 305  ASN A O     1 
ATOM   2260  C CB    . ASN A  1 305 ? 75.850  133.958 -72.176  1.00 23.37  ? 305  ASN A CB    1 
ATOM   2261  C CG    . ASN A  1 305 ? 75.510  132.475 -72.223  1.00 22.64  ? 305  ASN A CG    1 
ATOM   2262  O OD1   . ASN A  1 305 ? 75.734  131.797 -73.225  1.00 20.39  ? 305  ASN A OD1   1 
ATOM   2263  N ND2   . ASN A  1 305 ? 74.966  131.965 -71.120  1.00 24.03  ? 305  ASN A ND2   1 
ATOM   2264  N N     . THR A  1 306 ? 78.233  133.624 -73.855  1.00 22.14  ? 306  THR A N     1 
ATOM   2265  C CA    . THR A  1 306 ? 79.287  132.999 -74.659  1.00 21.78  ? 306  THR A CA    1 
ATOM   2266  C C     . THR A  1 306 ? 79.045  131.549 -75.134  1.00 21.22  ? 306  THR A C     1 
ATOM   2267  O O     . THR A  1 306 ? 79.782  131.056 -75.981  1.00 19.84  ? 306  THR A O     1 
ATOM   2268  C CB    . THR A  1 306 ? 80.676  133.090 -73.985  1.00 21.09  ? 306  THR A CB    1 
ATOM   2269  O OG1   . THR A  1 306 ? 80.715  132.245 -72.826  1.00 21.69  ? 306  THR A OG1   1 
ATOM   2270  C CG2   . THR A  1 306 ? 80.991  134.571 -73.597  1.00 17.91  ? 306  THR A CG2   1 
ATOM   2271  N N     . ARG A  1 307 ? 78.007  130.896 -74.604  1.00 20.47  ? 307  ARG A N     1 
ATOM   2272  C CA    . ARG A  1 307 ? 77.632  129.548 -75.017  1.00 21.26  ? 307  ARG A CA    1 
ATOM   2273  C C     . ARG A  1 307 ? 76.390  129.612 -75.914  1.00 20.82  ? 307  ARG A C     1 
ATOM   2274  O O     . ARG A  1 307 ? 75.801  128.591 -76.272  1.00 20.03  ? 307  ARG A O     1 
ATOM   2275  C CB    . ARG A  1 307 ? 77.324  128.657 -73.805  1.00 22.21  ? 307  ARG A CB    1 
ATOM   2276  C CG    . ARG A  1 307 ? 78.514  127.804 -73.353  1.00 20.73  ? 307  ARG A CG    1 
ATOM   2277  C CD    . ARG A  1 307 ? 79.657  128.662 -72.826  1.00 19.17  ? 307  ARG A CD    1 
ATOM   2278  N NE    . ARG A  1 307 ? 80.793  127.852 -72.380  1.00 22.53  ? 307  ARG A NE    1 
ATOM   2279  C CZ    . ARG A  1 307 ? 81.937  128.363 -71.911  1.00 19.31  ? 307  ARG A CZ    1 
ATOM   2280  N NH1   . ARG A  1 307 ? 82.108  129.664 -71.832  1.00 18.71  ? 307  ARG A NH1   1 
ATOM   2281  N NH2   . ARG A  1 307 ? 82.899  127.564 -71.483  1.00 21.91  ? 307  ARG A NH2   1 
ATOM   2282  N N     . PHE A  1 308 ? 76.019  130.841 -76.261  1.00 21.86  ? 308  PHE A N     1 
ATOM   2283  C CA    . PHE A  1 308 ? 74.871  131.152 -77.106  1.00 21.97  ? 308  PHE A CA    1 
ATOM   2284  C C     . PHE A  1 308 ? 73.543  130.857 -76.413  1.00 21.89  ? 308  PHE A C     1 
ATOM   2285  O O     . PHE A  1 308 ? 72.501  130.741 -77.064  1.00 20.73  ? 308  PHE A O     1 
ATOM   2286  C CB    . PHE A  1 308 ? 74.985  130.438 -78.452  1.00 19.48  ? 308  PHE A CB    1 
ATOM   2287  C CG    . PHE A  1 308 ? 76.073  131.021 -79.333  1.00 20.19  ? 308  PHE A CG    1 
ATOM   2288  C CD1   . PHE A  1 308 ? 77.398  130.570 -79.223  1.00 17.88  ? 308  PHE A CD1   1 
ATOM   2289  C CD2   . PHE A  1 308 ? 75.797  132.091 -80.196  1.00 15.94  ? 308  PHE A CD2   1 
ATOM   2290  C CE1   . PHE A  1 308 ? 78.434  131.184 -79.948  1.00 18.94  ? 308  PHE A CE1   1 
ATOM   2291  C CE2   . PHE A  1 308 ? 76.835  132.721 -80.935  1.00 19.11  ? 308  PHE A CE2   1 
ATOM   2292  C CZ    . PHE A  1 308 ? 78.151  132.272 -80.811  1.00 19.63  ? 308  PHE A CZ    1 
ATOM   2293  N N     . GLN A  1 309 ? 73.605  130.755 -75.080  1.00 21.15  ? 309  GLN A N     1 
ATOM   2294  C CA    . GLN A  1 309 ? 72.400  130.531 -74.276  1.00 21.69  ? 309  GLN A CA    1 
ATOM   2295  C C     . GLN A  1 309 ? 71.647  131.882 -74.121  1.00 22.65  ? 309  GLN A C     1 
ATOM   2296  O O     . GLN A  1 309 ? 72.270  132.936 -73.918  1.00 19.80  ? 309  GLN A O     1 
ATOM   2297  C CB    . GLN A  1 309 ? 72.748  130.023 -72.869  1.00 21.00  ? 309  GLN A CB    1 
ATOM   2298  C CG    . GLN A  1 309 ? 73.516  128.696 -72.781  1.00 23.03  ? 309  GLN A CG    1 
ATOM   2299  C CD    . GLN A  1 309 ? 73.865  128.382 -71.335  1.00 24.35  ? 309  GLN A CD    1 
ATOM   2300  O OE1   . GLN A  1 309 ? 73.994  129.297 -70.539  1.00 24.42  ? 309  GLN A OE1   1 
ATOM   2301  N NE2   . GLN A  1 309 ? 74.035  127.102 -70.996  1.00 22.95  ? 309  GLN A NE2   1 
ATOM   2302  N N     . THR A  1 310 ? 70.319  131.826 -74.242  1.00 24.02  ? 310  THR A N     1 
ATOM   2303  C CA    . THR A  1 310 ? 69.453  132.993 -74.043  1.00 23.96  ? 310  THR A CA    1 
ATOM   2304  C C     . THR A  1 310 ? 69.365  133.047 -72.512  1.00 26.49  ? 310  THR A C     1 
ATOM   2305  O O     . THR A  1 310 ? 70.044  132.293 -71.801  1.00 24.62  ? 310  THR A O     1 
ATOM   2306  C CB    . THR A  1 310 ? 67.994  132.755 -74.587  1.00 21.53  ? 310  THR A CB    1 
ATOM   2307  O OG1   . THR A  1 310 ? 67.386  131.679 -73.860  1.00 22.12  ? 310  THR A OG1   1 
ATOM   2308  C CG2   . THR A  1 310 ? 67.989  132.411 -76.089  1.00 17.20  ? 310  THR A CG2   1 
ATOM   2309  N N     . LYS A  1 311 ? 68.511  133.929 -72.026  1.00 28.34  ? 311  LYS A N     1 
ATOM   2310  C CA    . LYS A  1 311 ? 68.233  134.110 -70.600  1.00 31.93  ? 311  LYS A CA    1 
ATOM   2311  C C     . LYS A  1 311 ? 67.819  132.755 -69.975  1.00 31.97  ? 311  LYS A C     1 
ATOM   2312  O O     . LYS A  1 311 ? 68.104  132.473 -68.800  1.00 33.91  ? 311  LYS A O     1 
ATOM   2313  C CB    . LYS A  1 311 ? 67.093  135.141 -70.501  1.00 34.17  ? 311  LYS A CB    1 
ATOM   2314  C CG    . LYS A  1 311 ? 66.625  135.584 -69.129  1.00 40.09  ? 311  LYS A CG    1 
ATOM   2315  C CD    . LYS A  1 311 ? 65.534  136.656 -69.351  1.00 42.28  ? 311  LYS A CD    1 
ATOM   2316  C CE    . LYS A  1 311 ? 64.993  137.237 -68.061  1.00 44.03  ? 311  LYS A CE    1 
ATOM   2317  N NZ    . LYS A  1 311 ? 63.910  138.231 -68.370  1.00 45.53  ? 311  LYS A NZ    1 
ATOM   2318  N N     . ILE A  1 312 ? 67.127  131.927 -70.749  1.00 30.83  ? 312  ILE A N     1 
ATOM   2319  C CA    . ILE A  1 312 ? 66.709  130.591 -70.294  1.00 30.56  ? 312  ILE A CA    1 
ATOM   2320  C C     . ILE A  1 312 ? 67.807  129.649 -70.855  1.00 28.91  ? 312  ILE A C     1 
ATOM   2321  O O     . ILE A  1 312 ? 67.812  129.338 -72.044  1.00 27.51  ? 312  ILE A O     1 
ATOM   2322  C CB    . ILE A  1 312 ? 65.276  130.269 -70.863  1.00 31.42  ? 312  ILE A CB    1 
ATOM   2323  C CG1   . ILE A  1 312 ? 64.260  131.262 -70.260  1.00 32.16  ? 312  ILE A CG1   1 
ATOM   2324  C CG2   . ILE A  1 312 ? 64.879  128.820 -70.556  1.00 30.68  ? 312  ILE A CG2   1 
ATOM   2325  C CD1   . ILE A  1 312 ? 62.831  131.085 -70.759  1.00 32.60  ? 312  ILE A CD1   1 
ATOM   2326  N N     . PRO A  1 313 ? 68.750  129.188 -69.994  1.00 30.36  ? 313  PRO A N     1 
ATOM   2327  C CA    . PRO A  1 313 ? 69.888  128.319 -70.349  1.00 27.82  ? 313  PRO A CA    1 
ATOM   2328  C C     . PRO A  1 313 ? 69.828  127.088 -71.258  1.00 27.62  ? 313  PRO A C     1 
ATOM   2329  O O     . PRO A  1 313 ? 70.863  126.685 -71.796  1.00 27.76  ? 313  PRO A O     1 
ATOM   2330  C CB    . PRO A  1 313 ? 70.524  128.009 -68.997  1.00 29.82  ? 313  PRO A CB    1 
ATOM   2331  C CG    . PRO A  1 313 ? 69.385  128.045 -68.061  1.00 30.94  ? 313  PRO A CG    1 
ATOM   2332  C CD    . PRO A  1 313 ? 68.658  129.305 -68.527  1.00 30.07  ? 313  PRO A CD    1 
ATOM   2333  N N     . ASN A  1 314 ? 68.657  126.491 -71.445  1.00 26.33  ? 314  ASN A N     1 
ATOM   2334  C CA    . ASN A  1 314 ? 68.549  125.324 -72.309  1.00 24.87  ? 314  ASN A CA    1 
ATOM   2335  C C     . ASN A  1 314 ? 67.978  125.796 -73.647  1.00 23.85  ? 314  ASN A C     1 
ATOM   2336  O O     . ASN A  1 314 ? 67.683  124.987 -74.529  1.00 21.85  ? 314  ASN A O     1 
ATOM   2337  C CB    . ASN A  1 314 ? 67.628  124.275 -71.679  1.00 25.83  ? 314  ASN A CB    1 
ATOM   2338  C CG    . ASN A  1 314 ? 66.155  124.680 -71.746  1.00 28.56  ? 314  ASN A CG    1 
ATOM   2339  O OD1   . ASN A  1 314 ? 65.764  125.727 -71.213  1.00 29.82  ? 314  ASN A OD1   1 
ATOM   2340  N ND2   . ASN A  1 314 ? 65.340  123.869 -72.416  1.00 26.88  ? 314  ASN A ND2   1 
ATOM   2341  N N     . ILE A  1 315 ? 67.799  127.112 -73.775  1.00 23.50  ? 315  ILE A N     1 
ATOM   2342  C CA    . ILE A  1 315 ? 67.297  127.704 -75.016  1.00 22.53  ? 315  ILE A CA    1 
ATOM   2343  C C     . ILE A  1 315 ? 68.406  128.597 -75.578  1.00 21.25  ? 315  ILE A C     1 
ATOM   2344  O O     . ILE A  1 315 ? 68.889  129.509 -74.921  1.00 21.85  ? 315  ILE A O     1 
ATOM   2345  C CB    . ILE A  1 315 ? 65.978  128.534 -74.802  1.00 24.13  ? 315  ILE A CB    1 
ATOM   2346  C CG1   . ILE A  1 315 ? 64.864  127.624 -74.256  1.00 23.17  ? 315  ILE A CG1   1 
ATOM   2347  C CG2   . ILE A  1 315 ? 65.504  129.139 -76.152  1.00 21.20  ? 315  ILE A CG2   1 
ATOM   2348  C CD1   . ILE A  1 315 ? 63.534  128.378 -73.956  1.00 23.45  ? 315  ILE A CD1   1 
ATOM   2349  N N     . TYR A  1 316 ? 68.787  128.313 -76.811  1.00 21.26  ? 316  TYR A N     1 
ATOM   2350  C CA    . TYR A  1 316 ? 69.878  128.996 -77.472  1.00 19.76  ? 316  TYR A CA    1 
ATOM   2351  C C     . TYR A  1 316 ? 69.433  129.728 -78.747  1.00 21.12  ? 316  TYR A C     1 
ATOM   2352  O O     . TYR A  1 316 ? 68.314  129.513 -79.251  1.00 20.57  ? 316  TYR A O     1 
ATOM   2353  C CB    . TYR A  1 316 ? 70.934  127.943 -77.852  1.00 20.33  ? 316  TYR A CB    1 
ATOM   2354  C CG    . TYR A  1 316 ? 71.508  127.101 -76.706  1.00 19.70  ? 316  TYR A CG    1 
ATOM   2355  C CD1   . TYR A  1 316 ? 70.771  126.070 -76.101  1.00 19.54  ? 316  TYR A CD1   1 
ATOM   2356  C CD2   . TYR A  1 316 ? 72.816  127.309 -76.277  1.00 19.50  ? 316  TYR A CD2   1 
ATOM   2357  C CE1   . TYR A  1 316 ? 71.348  125.257 -75.075  1.00 17.74  ? 316  TYR A CE1   1 
ATOM   2358  C CE2   . TYR A  1 316 ? 73.396  126.527 -75.290  1.00 19.96  ? 316  TYR A CE2   1 
ATOM   2359  C CZ    . TYR A  1 316 ? 72.672  125.511 -74.691  1.00 22.26  ? 316  TYR A CZ    1 
ATOM   2360  O OH    . TYR A  1 316 ? 73.308  124.778 -73.698  1.00 22.93  ? 316  TYR A OH    1 
ATOM   2361  N N     . ALA A  1 317 ? 70.324  130.589 -79.256  1.00 20.83  ? 317  ALA A N     1 
ATOM   2362  C CA    . ALA A  1 317 ? 70.119  131.343 -80.497  1.00 20.71  ? 317  ALA A CA    1 
ATOM   2363  C C     . ALA A  1 317 ? 71.478  131.603 -81.173  1.00 21.00  ? 317  ALA A C     1 
ATOM   2364  O O     . ALA A  1 317 ? 72.473  131.900 -80.510  1.00 19.67  ? 317  ALA A O     1 
ATOM   2365  C CB    . ALA A  1 317 ? 69.408  132.687 -80.218  1.00 20.02  ? 317  ALA A CB    1 
ATOM   2366  N N     . ILE A  1 318 ? 71.489  131.518 -82.500  1.00 22.27  ? 318  ILE A N     1 
ATOM   2367  C CA    . ILE A  1 318 ? 72.688  131.726 -83.307  1.00 21.74  ? 318  ILE A CA    1 
ATOM   2368  C C     . ILE A  1 318 ? 72.306  132.286 -84.685  1.00 22.93  ? 318  ILE A C     1 
ATOM   2369  O O     . ILE A  1 318 ? 71.132  132.360 -85.022  1.00 20.47  ? 318  ILE A O     1 
ATOM   2370  C CB    . ILE A  1 318 ? 73.434  130.397 -83.572  1.00 22.06  ? 318  ILE A CB    1 
ATOM   2371  C CG1   . ILE A  1 318 ? 72.495  129.400 -84.267  1.00 25.09  ? 318  ILE A CG1   1 
ATOM   2372  C CG2   . ILE A  1 318 ? 73.935  129.774 -82.269  1.00 22.49  ? 318  ILE A CG2   1 
ATOM   2373  C CD1   . ILE A  1 318 ? 72.651  129.316 -85.754  1.00 26.04  ? 318  ILE A CD1   1 
ATOM   2374  N N     . GLY A  1 319 ? 73.315  132.683 -85.463  1.00 22.27  ? 319  GLY A N     1 
ATOM   2375  C CA    . GLY A  1 319 ? 73.082  133.171 -86.808  1.00 21.49  ? 319  GLY A CA    1 
ATOM   2376  C C     . GLY A  1 319 ? 72.567  134.592 -86.894  1.00 24.07  ? 319  GLY A C     1 
ATOM   2377  O O     . GLY A  1 319 ? 72.861  135.430 -86.026  1.00 22.82  ? 319  GLY A O     1 
ATOM   2378  N N     . ASP A  1 320 ? 71.791  134.858 -87.949  1.00 24.30  ? 320  ASP A N     1 
ATOM   2379  C CA    . ASP A  1 320 ? 71.240  136.188 -88.186  1.00 25.25  ? 320  ASP A CA    1 
ATOM   2380  C C     . ASP A  1 320 ? 70.368  136.741 -87.055  1.00 25.03  ? 320  ASP A C     1 
ATOM   2381  O O     . ASP A  1 320 ? 70.154  137.936 -86.994  1.00 28.39  ? 320  ASP A O     1 
ATOM   2382  C CB    . ASP A  1 320 ? 70.461  136.207 -89.511  1.00 25.07  ? 320  ASP A CB    1 
ATOM   2383  C CG    . ASP A  1 320 ? 71.350  136.455 -90.730  1.00 26.13  ? 320  ASP A CG    1 
ATOM   2384  O OD1   . ASP A  1 320 ? 72.593  136.429 -90.641  1.00 26.88  ? 320  ASP A OD1   1 
ATOM   2385  O OD2   . ASP A  1 320 ? 70.788  136.672 -91.817  1.00 27.60  ? 320  ASP A OD2   1 
ATOM   2386  N N     . VAL A  1 321 ? 69.833  135.912 -86.168  1.00 26.57  ? 321  VAL A N     1 
ATOM   2387  C CA    . VAL A  1 321 ? 69.028  136.471 -85.068  1.00 26.99  ? 321  VAL A CA    1 
ATOM   2388  C C     . VAL A  1 321 ? 69.841  137.016 -83.922  1.00 26.72  ? 321  VAL A C     1 
ATOM   2389  O O     . VAL A  1 321 ? 69.283  137.618 -82.993  1.00 26.15  ? 321  VAL A O     1 
ATOM   2390  C CB    . VAL A  1 321 ? 68.063  135.479 -84.375  1.00 28.40  ? 321  VAL A CB    1 
ATOM   2391  C CG1   . VAL A  1 321 ? 66.819  135.353 -85.155  1.00 27.89  ? 321  VAL A CG1   1 
ATOM   2392  C CG2   . VAL A  1 321 ? 68.757  134.125 -84.082  1.00 27.33  ? 321  VAL A CG2   1 
ATOM   2393  N N     . VAL A  1 322 ? 71.145  136.786 -83.946  1.00 24.51  ? 322  VAL A N     1 
ATOM   2394  C CA    . VAL A  1 322 ? 71.949  137.289 -82.859  1.00 23.49  ? 322  VAL A CA    1 
ATOM   2395  C C     . VAL A  1 322 ? 72.959  138.298 -83.369  1.00 23.88  ? 322  VAL A C     1 
ATOM   2396  O O     . VAL A  1 322 ? 73.133  138.478 -84.588  1.00 23.04  ? 322  VAL A O     1 
ATOM   2397  C CB    . VAL A  1 322 ? 72.666  136.109 -82.056  1.00 23.35  ? 322  VAL A CB    1 
ATOM   2398  C CG1   . VAL A  1 322 ? 71.628  135.118 -81.572  1.00 22.06  ? 322  VAL A CG1   1 
ATOM   2399  C CG2   . VAL A  1 322 ? 73.732  135.411 -82.903  1.00 19.80  ? 322  VAL A CG2   1 
ATOM   2400  N N     . ALA A  1 323 ? 73.615  138.967 -82.441  1.00 24.65  ? 323  ALA A N     1 
ATOM   2401  C CA    . ALA A  1 323 ? 74.629  139.963 -82.808  1.00 26.22  ? 323  ALA A CA    1 
ATOM   2402  C C     . ALA A  1 323 ? 75.799  139.380 -83.647  1.00 26.38  ? 323  ALA A C     1 
ATOM   2403  O O     . ALA A  1 323 ? 76.054  138.179 -83.642  1.00 27.92  ? 323  ALA A O     1 
ATOM   2404  C CB    . ALA A  1 323 ? 75.176  140.618 -81.538  1.00 24.95  ? 323  ALA A CB    1 
ATOM   2405  N N     . GLY A  1 324 ? 76.512  140.262 -84.352  1.00 27.04  ? 324  GLY A N     1 
ATOM   2406  C CA    . GLY A  1 324 ? 77.640  139.873 -85.179  1.00 24.89  ? 324  GLY A CA    1 
ATOM   2407  C C     . GLY A  1 324 ? 77.292  140.008 -86.651  1.00 25.83  ? 324  GLY A C     1 
ATOM   2408  O O     . GLY A  1 324 ? 76.129  140.247 -86.977  1.00 25.95  ? 324  GLY A O     1 
ATOM   2409  N N     . PRO A  1 325 ? 78.262  139.863 -87.563  1.00 25.62  ? 325  PRO A N     1 
ATOM   2410  C CA    . PRO A  1 325 ? 77.970  139.985 -89.003  1.00 25.93  ? 325  PRO A CA    1 
ATOM   2411  C C     . PRO A  1 325 ? 76.929  138.984 -89.505  1.00 25.46  ? 325  PRO A C     1 
ATOM   2412  O O     . PRO A  1 325 ? 76.997  137.787 -89.202  1.00 23.64  ? 325  PRO A O     1 
ATOM   2413  C CB    . PRO A  1 325 ? 79.332  139.775 -89.663  1.00 25.69  ? 325  PRO A CB    1 
ATOM   2414  C CG    . PRO A  1 325 ? 80.136  139.010 -88.625  1.00 27.84  ? 325  PRO A CG    1 
ATOM   2415  C CD    . PRO A  1 325 ? 79.702  139.653 -87.331  1.00 26.95  ? 325  PRO A CD    1 
ATOM   2416  N N     . MET A  1 326 ? 75.977  139.489 -90.283  1.00 26.10  ? 326  MET A N     1 
ATOM   2417  C CA    . MET A  1 326 ? 74.913  138.662 -90.817  1.00 25.76  ? 326  MET A CA    1 
ATOM   2418  C C     . MET A  1 326 ? 75.401  138.000 -92.087  1.00 25.21  ? 326  MET A C     1 
ATOM   2419  O O     . MET A  1 326 ? 75.054  138.396 -93.216  1.00 24.68  ? 326  MET A O     1 
ATOM   2420  C CB    . MET A  1 326 ? 73.660  139.509 -91.044  1.00 27.40  ? 326  MET A CB    1 
ATOM   2421  C CG    . MET A  1 326 ? 73.074  140.092 -89.734  1.00 29.70  ? 326  MET A CG    1 
ATOM   2422  S SD    . MET A  1 326 ? 71.722  141.374 -89.912  1.00 33.54  ? 326  MET A SD    1 
ATOM   2423  C CE    . MET A  1 326 ? 70.276  140.272 -90.321  1.00 26.36  ? 326  MET A CE    1 
ATOM   2424  N N     . LEU A  1 327 ? 76.217  136.972 -91.875  1.00 23.07  ? 327  LEU A N     1 
ATOM   2425  C CA    . LEU A  1 327 ? 76.816  136.195 -92.953  1.00 22.89  ? 327  LEU A CA    1 
ATOM   2426  C C     . LEU A  1 327 ? 76.586  134.678 -92.776  1.00 23.67  ? 327  LEU A C     1 
ATOM   2427  O O     . LEU A  1 327 ? 76.508  134.169 -91.656  1.00 21.80  ? 327  LEU A O     1 
ATOM   2428  C CB    . LEU A  1 327 ? 78.314  136.512 -93.010  1.00 22.00  ? 327  LEU A CB    1 
ATOM   2429  C CG    . LEU A  1 327 ? 78.636  137.986 -93.279  1.00 22.89  ? 327  LEU A CG    1 
ATOM   2430  C CD1   . LEU A  1 327 ? 80.131  138.277 -93.073  1.00 22.15  ? 327  LEU A CD1   1 
ATOM   2431  C CD2   . LEU A  1 327 ? 78.225  138.316 -94.717  1.00 22.89  ? 327  LEU A CD2   1 
ATOM   2432  N N     . ALA A  1 328 ? 76.510  133.958 -93.890  1.00 22.92  ? 328  ALA A N     1 
ATOM   2433  C CA    . ALA A  1 328 ? 76.268  132.518 -93.842  1.00 22.22  ? 328  ALA A CA    1 
ATOM   2434  C C     . ALA A  1 328 ? 77.357  131.742 -93.061  1.00 22.61  ? 328  ALA A C     1 
ATOM   2435  O O     . ALA A  1 328 ? 77.037  130.918 -92.206  1.00 21.75  ? 328  ALA A O     1 
ATOM   2436  C CB    . ALA A  1 328 ? 76.125  131.968 -95.283  1.00 21.29  ? 328  ALA A CB    1 
ATOM   2437  N N     . HIS A  1 329 ? 78.634  132.025 -93.315  1.00 23.05  ? 329  HIS A N     1 
ATOM   2438  C CA    . HIS A  1 329 ? 79.677  131.280 -92.601  1.00 22.88  ? 329  HIS A CA    1 
ATOM   2439  C C     . HIS A  1 329 ? 79.677  131.586 -91.093  1.00 22.00  ? 329  HIS A C     1 
ATOM   2440  O O     . HIS A  1 329 ? 79.998  130.725 -90.278  1.00 21.68  ? 329  HIS A O     1 
ATOM   2441  C CB    . HIS A  1 329 ? 81.070  131.521 -93.222  1.00 23.17  ? 329  HIS A CB    1 
ATOM   2442  C CG    . HIS A  1 329 ? 81.353  132.952 -93.570  1.00 26.10  ? 329  HIS A CG    1 
ATOM   2443  N ND1   . HIS A  1 329 ? 80.753  133.592 -94.638  1.00 28.65  ? 329  HIS A ND1   1 
ATOM   2444  C CD2   . HIS A  1 329 ? 82.184  133.857 -93.008  1.00 26.77  ? 329  HIS A CD2   1 
ATOM   2445  C CE1   . HIS A  1 329 ? 81.206  134.831 -94.714  1.00 27.56  ? 329  HIS A CE1   1 
ATOM   2446  N NE2   . HIS A  1 329 ? 82.075  135.019 -93.735  1.00 27.26  ? 329  HIS A NE2   1 
ATOM   2447  N N     . LYS A  1 330 ? 79.274  132.792 -90.727  1.00 20.78  ? 330  LYS A N     1 
ATOM   2448  C CA    . LYS A  1 330 ? 79.224  133.169 -89.327  1.00 20.55  ? 330  LYS A CA    1 
ATOM   2449  C C     . LYS A  1 330 ? 78.153  132.329 -88.636  1.00 19.56  ? 330  LYS A C     1 
ATOM   2450  O O     . LYS A  1 330 ? 78.394  131.738 -87.578  1.00 19.24  ? 330  LYS A O     1 
ATOM   2451  C CB    . LYS A  1 330 ? 78.935  134.678 -89.211  1.00 21.74  ? 330  LYS A CB    1 
ATOM   2452  C CG    . LYS A  1 330 ? 78.811  135.220 -87.772  1.00 21.18  ? 330  LYS A CG    1 
ATOM   2453  C CD    . LYS A  1 330 ? 77.410  135.130 -87.269  1.00 23.13  ? 330  LYS A CD    1 
ATOM   2454  C CE    . LYS A  1 330 ? 77.076  136.321 -86.398  1.00 24.92  ? 330  LYS A CE    1 
ATOM   2455  N NZ    . LYS A  1 330 ? 75.717  136.156 -85.812  1.00 24.18  ? 330  LYS A NZ    1 
ATOM   2456  N N     . ALA A  1 331 ? 76.978  132.269 -89.246  1.00 19.45  ? 331  ALA A N     1 
ATOM   2457  C CA    . ALA A  1 331 ? 75.867  131.480 -88.713  1.00 21.22  ? 331  ALA A CA    1 
ATOM   2458  C C     . ALA A  1 331 ? 76.223  129.976 -88.610  1.00 20.54  ? 331  ALA A C     1 
ATOM   2459  O O     . ALA A  1 331 ? 75.870  129.288 -87.635  1.00 21.42  ? 331  ALA A O     1 
ATOM   2460  C CB    . ALA A  1 331 ? 74.626  131.651 -89.624  1.00 21.99  ? 331  ALA A CB    1 
ATOM   2461  N N     . GLU A  1 332 ? 76.905  129.461 -89.625  1.00 19.25  ? 332  GLU A N     1 
ATOM   2462  C CA    . GLU A  1 332 ? 77.260  128.055 -89.611  1.00 20.25  ? 332  GLU A CA    1 
ATOM   2463  C C     . GLU A  1 332 ? 78.227  127.730 -88.468  1.00 20.98  ? 332  GLU A C     1 
ATOM   2464  O O     . GLU A  1 332 ? 78.045  126.722 -87.774  1.00 20.28  ? 332  GLU A O     1 
ATOM   2465  C CB    . GLU A  1 332 ? 77.879  127.644 -90.947  1.00 21.01  ? 332  GLU A CB    1 
ATOM   2466  C CG    . GLU A  1 332 ? 76.926  127.666 -92.111  1.00 23.61  ? 332  GLU A CG    1 
ATOM   2467  C CD    . GLU A  1 332 ? 77.541  127.087 -93.378  1.00 29.91  ? 332  GLU A CD    1 
ATOM   2468  O OE1   . GLU A  1 332 ? 78.619  126.434 -93.315  1.00 31.30  ? 332  GLU A OE1   1 
ATOM   2469  O OE2   . GLU A  1 332 ? 76.928  127.281 -94.443  1.00 30.95  ? 332  GLU A OE2   1 
ATOM   2470  N N     . ASP A  1 333 ? 79.249  128.566 -88.289  1.00 19.25  ? 333  ASP A N     1 
ATOM   2471  C CA    . ASP A  1 333 ? 80.232  128.364 -87.219  1.00 22.15  ? 333  ASP A CA    1 
ATOM   2472  C C     . ASP A  1 333 ? 79.576  128.485 -85.868  1.00 21.87  ? 333  ASP A C     1 
ATOM   2473  O O     . ASP A  1 333 ? 79.861  127.684 -84.983  1.00 20.75  ? 333  ASP A O     1 
ATOM   2474  C CB    . ASP A  1 333 ? 81.378  129.374 -87.335  1.00 26.04  ? 333  ASP A CB    1 
ATOM   2475  C CG    . ASP A  1 333 ? 82.366  129.009 -88.441  1.00 30.84  ? 333  ASP A CG    1 
ATOM   2476  O OD1   . ASP A  1 333 ? 81.925  128.406 -89.455  1.00 36.60  ? 333  ASP A OD1   1 
ATOM   2477  O OD2   . ASP A  1 333 ? 83.578  129.328 -88.311  1.00 34.20  ? 333  ASP A OD2   1 
ATOM   2478  N N     . GLU A  1 334 ? 78.673  129.470 -85.718  1.00 22.18  ? 334  GLU A N     1 
ATOM   2479  C CA    . GLU A  1 334 ? 77.969  129.652 -84.448  1.00 22.45  ? 334  GLU A CA    1 
ATOM   2480  C C     . GLU A  1 334 ? 77.123  128.428 -84.126  1.00 22.32  ? 334  GLU A C     1 
ATOM   2481  O O     . GLU A  1 334 ? 76.986  128.049 -82.956  1.00 22.42  ? 334  GLU A O     1 
ATOM   2482  C CB    . GLU A  1 334 ? 77.071  130.896 -84.464  1.00 22.02  ? 334  GLU A CB    1 
ATOM   2483  C CG    . GLU A  1 334 ? 77.879  132.181 -84.402  1.00 25.55  ? 334  GLU A CG    1 
ATOM   2484  C CD    . GLU A  1 334 ? 77.017  133.421 -84.291  1.00 26.80  ? 334  GLU A CD    1 
ATOM   2485  O OE1   . GLU A  1 334 ? 75.852  133.402 -84.751  1.00 27.93  ? 334  GLU A OE1   1 
ATOM   2486  O OE2   . GLU A  1 334 ? 77.513  134.433 -83.775  1.00 28.73  ? 334  GLU A OE2   1 
ATOM   2487  N N     . GLY A  1 335 ? 76.557  127.820 -85.162  1.00 20.18  ? 335  GLY A N     1 
ATOM   2488  C CA    . GLY A  1 335 ? 75.751  126.626 -84.949  1.00 20.10  ? 335  GLY A CA    1 
ATOM   2489  C C     . GLY A  1 335 ? 76.585  125.450 -84.458  1.00 19.94  ? 335  GLY A C     1 
ATOM   2490  O O     . GLY A  1 335 ? 76.209  124.740 -83.506  1.00 19.07  ? 335  GLY A O     1 
ATOM   2491  N N     . ILE A  1 336 ? 77.726  125.225 -85.100  1.00 19.23  ? 336  ILE A N     1 
ATOM   2492  C CA    . ILE A  1 336 ? 78.606  124.127 -84.684  1.00 19.13  ? 336  ILE A CA    1 
ATOM   2493  C C     . ILE A  1 336 ? 79.140  124.281 -83.243  1.00 17.21  ? 336  ILE A C     1 
ATOM   2494  O O     . ILE A  1 336 ? 79.016  123.366 -82.434  1.00 17.43  ? 336  ILE A O     1 
ATOM   2495  C CB    . ILE A  1 336 ? 79.790  124.008 -85.654  1.00 20.73  ? 336  ILE A CB    1 
ATOM   2496  C CG1   . ILE A  1 336 ? 79.288  123.518 -87.014  1.00 21.60  ? 336  ILE A CG1   1 
ATOM   2497  C CG2   . ILE A  1 336 ? 80.838  123.043 -85.090  1.00 23.57  ? 336  ILE A CG2   1 
ATOM   2498  C CD1   . ILE A  1 336 ? 80.308  123.713 -88.159  1.00 22.41  ? 336  ILE A CD1   1 
ATOM   2499  N N     . ILE A  1 337 ? 79.723  125.439 -82.930  1.00 18.04  ? 337  ILE A N     1 
ATOM   2500  C CA    . ILE A  1 337 ? 80.298  125.636 -81.606  1.00 17.88  ? 337  ILE A CA    1 
ATOM   2501  C C     . ILE A  1 337 ? 79.206  125.651 -80.558  1.00 20.73  ? 337  ILE A C     1 
ATOM   2502  O O     . ILE A  1 337 ? 79.422  125.253 -79.413  1.00 20.30  ? 337  ILE A O     1 
ATOM   2503  C CB    . ILE A  1 337 ? 81.165  126.947 -81.503  1.00 16.93  ? 337  ILE A CB    1 
ATOM   2504  C CG1   . ILE A  1 337 ? 80.299  128.209 -81.635  1.00 16.79  ? 337  ILE A CG1   1 
ATOM   2505  C CG2   . ILE A  1 337 ? 82.273  126.938 -82.591  1.00 17.42  ? 337  ILE A CG2   1 
ATOM   2506  C CD1   . ILE A  1 337 ? 81.158  129.497 -81.832  1.00 14.07  ? 337  ILE A CD1   1 
ATOM   2507  N N     . CYS A  1 338 ? 78.022  126.120 -80.935  1.00 18.21  ? 338  CYS A N     1 
ATOM   2508  C CA    . CYS A  1 338 ? 76.927  126.135 -79.966  1.00 19.85  ? 338  CYS A CA    1 
ATOM   2509  C C     . CYS A  1 338 ? 76.610  124.709 -79.540  1.00 18.64  ? 338  CYS A C     1 
ATOM   2510  O O     . CYS A  1 338 ? 76.454  124.415 -78.359  1.00 19.51  ? 338  CYS A O     1 
ATOM   2511  C CB    . CYS A  1 338 ? 75.654  126.753 -80.564  1.00 19.25  ? 338  CYS A CB    1 
ATOM   2512  S SG    . CYS A  1 338 ? 74.273  126.716 -79.435  1.00 20.93  ? 338  CYS A SG    1 
ATOM   2513  N N     . VAL A  1 339 ? 76.475  123.838 -80.528  1.00 18.96  ? 339  VAL A N     1 
ATOM   2514  C CA    . VAL A  1 339 ? 76.165  122.414 -80.301  1.00 18.74  ? 339  VAL A CA    1 
ATOM   2515  C C     . VAL A  1 339 ? 77.330  121.683 -79.604  1.00 18.04  ? 339  VAL A C     1 
ATOM   2516  O O     . VAL A  1 339 ? 77.127  120.820 -78.739  1.00 18.64  ? 339  VAL A O     1 
ATOM   2517  C CB    . VAL A  1 339 ? 75.760  121.775 -81.687  1.00 21.20  ? 339  VAL A CB    1 
ATOM   2518  C CG1   . VAL A  1 339 ? 76.006  120.273 -81.729  1.00 23.68  ? 339  VAL A CG1   1 
ATOM   2519  C CG2   . VAL A  1 339 ? 74.312  122.148 -81.962  1.00 20.27  ? 339  VAL A CG2   1 
ATOM   2520  N N     . GLU A  1 340 ? 78.555  122.035 -79.972  1.00 19.16  ? 340  GLU A N     1 
ATOM   2521  C CA    . GLU A  1 340 ? 79.722  121.455 -79.300  1.00 18.54  ? 340  GLU A CA    1 
ATOM   2522  C C     . GLU A  1 340 ? 79.687  121.849 -77.799  1.00 19.18  ? 340  GLU A C     1 
ATOM   2523  O O     . GLU A  1 340 ? 80.079  121.057 -76.915  1.00 19.27  ? 340  GLU A O     1 
ATOM   2524  C CB    . GLU A  1 340 ? 81.026  121.954 -79.964  1.00 19.23  ? 340  GLU A CB    1 
ATOM   2525  C CG    . GLU A  1 340 ? 81.280  121.301 -81.364  1.00 19.12  ? 340  GLU A CG    1 
ATOM   2526  C CD    . GLU A  1 340 ? 82.555  121.770 -82.026  1.00 22.20  ? 340  GLU A CD    1 
ATOM   2527  O OE1   . GLU A  1 340 ? 82.936  122.937 -81.840  1.00 23.46  ? 340  GLU A OE1   1 
ATOM   2528  O OE2   . GLU A  1 340 ? 83.175  120.984 -82.756  1.00 24.92  ? 340  GLU A OE2   1 
ATOM   2529  N N     . GLY A  1 341 ? 79.226  123.064 -77.521  1.00 19.64  ? 341  GLY A N     1 
ATOM   2530  C CA    . GLY A  1 341 ? 79.142  123.540 -76.144  1.00 18.34  ? 341  GLY A CA    1 
ATOM   2531  C C     . GLY A  1 341 ? 78.100  122.753 -75.391  1.00 18.64  ? 341  GLY A C     1 
ATOM   2532  O O     . GLY A  1 341 ? 78.306  122.414 -74.223  1.00 17.86  ? 341  GLY A O     1 
ATOM   2533  N N     . MET A  1 342 ? 76.963  122.486 -76.057  1.00 19.03  ? 342  MET A N     1 
ATOM   2534  C CA    . MET A  1 342 ? 75.901  121.673 -75.470  1.00 19.45  ? 342  MET A CA    1 
ATOM   2535  C C     . MET A  1 342 ? 76.481  120.297 -75.099  1.00 19.20  ? 342  MET A C     1 
ATOM   2536  O O     . MET A  1 342 ? 75.989  119.638 -74.180  1.00 19.34  ? 342  MET A O     1 
ATOM   2537  C CB    . MET A  1 342 ? 74.754  121.443 -76.449  1.00 20.25  ? 342  MET A CB    1 
ATOM   2538  C CG    . MET A  1 342 ? 73.938  122.698 -76.869  1.00 22.08  ? 342  MET A CG    1 
ATOM   2539  S SD    . MET A  1 342 ? 72.561  122.118 -77.920  1.00 23.94  ? 342  MET A SD    1 
ATOM   2540  C CE    . MET A  1 342 ? 71.943  123.723 -78.622  1.00 19.50  ? 342  MET A CE    1 
ATOM   2541  N N     . ALA A  1 343 ? 77.516  119.855 -75.821  1.00 18.01  ? 343  ALA A N     1 
ATOM   2542  C CA    . ALA A  1 343 ? 78.132  118.555 -75.521  1.00 19.26  ? 343  ALA A CA    1 
ATOM   2543  C C     . ALA A  1 343 ? 79.316  118.733 -74.552  1.00 20.89  ? 343  ALA A C     1 
ATOM   2544  O O     . ALA A  1 343 ? 80.201  117.857 -74.453  1.00 19.54  ? 343  ALA A O     1 
ATOM   2545  C CB    . ALA A  1 343 ? 78.590  117.883 -76.812  1.00 16.12  ? 343  ALA A CB    1 
ATOM   2546  N N     . GLY A  1 344 ? 79.342  119.894 -73.887  1.00 19.26  ? 344  GLY A N     1 
ATOM   2547  C CA    . GLY A  1 344 ? 80.374  120.201 -72.910  1.00 17.69  ? 344  GLY A CA    1 
ATOM   2548  C C     . GLY A  1 344 ? 81.695  120.832 -73.368  1.00 20.39  ? 344  GLY A C     1 
ATOM   2549  O O     . GLY A  1 344 ? 82.540  121.160 -72.524  1.00 18.59  ? 344  GLY A O     1 
ATOM   2550  N N     . GLY A  1 345 ? 81.877  121.028 -74.668  1.00 17.07  ? 345  GLY A N     1 
ATOM   2551  C CA    . GLY A  1 345 ? 83.127  121.593 -75.137  1.00 17.86  ? 345  GLY A CA    1 
ATOM   2552  C C     . GLY A  1 345 ? 83.269  123.094 -75.091  1.00 17.07  ? 345  GLY A C     1 
ATOM   2553  O O     . GLY A  1 345 ? 82.312  123.817 -74.856  1.00 19.63  ? 345  GLY A O     1 
ATOM   2554  N N     . ALA A  1 346 ? 84.486  123.563 -75.333  1.00 17.05  ? 346  ALA A N     1 
ATOM   2555  C CA    . ALA A  1 346 ? 84.778  124.975 -75.331  1.00 19.06  ? 346  ALA A CA    1 
ATOM   2556  C C     . ALA A  1 346 ? 84.037  125.566 -76.521  1.00 18.69  ? 346  ALA A C     1 
ATOM   2557  O O     . ALA A  1 346 ? 83.818  124.895 -77.520  1.00 19.65  ? 346  ALA A O     1 
ATOM   2558  C CB    . ALA A  1 346 ? 86.278  125.212 -75.471  1.00 18.51  ? 346  ALA A CB    1 
ATOM   2559  N N     . VAL A  1 347 ? 83.669  126.832 -76.396  1.00 20.99  ? 347  VAL A N     1 
ATOM   2560  C CA    . VAL A  1 347 ? 82.919  127.569 -77.416  1.00 22.26  ? 347  VAL A CA    1 
ATOM   2561  C C     . VAL A  1 347 ? 83.704  128.859 -77.694  1.00 24.78  ? 347  VAL A C     1 
ATOM   2562  O O     . VAL A  1 347 ? 83.826  129.716 -76.816  1.00 25.95  ? 347  VAL A O     1 
ATOM   2563  C CB    . VAL A  1 347 ? 81.497  127.942 -76.884  1.00 23.34  ? 347  VAL A CB    1 
ATOM   2564  C CG1   . VAL A  1 347 ? 80.767  128.788 -77.902  1.00 22.88  ? 347  VAL A CG1   1 
ATOM   2565  C CG2   . VAL A  1 347 ? 80.705  126.665 -76.534  1.00 20.98  ? 347  VAL A CG2   1 
ATOM   2566  N N     . HIS A  1 348 ? 84.235  129.011 -78.901  1.00 24.90  ? 348  HIS A N     1 
ATOM   2567  C CA    . HIS A  1 348 ? 85.014  130.213 -79.210  1.00 27.74  ? 348  HIS A CA    1 
ATOM   2568  C C     . HIS A  1 348 ? 84.815  130.741 -80.604  1.00 26.52  ? 348  HIS A C     1 
ATOM   2569  O O     . HIS A  1 348 ? 84.911  130.001 -81.567  1.00 25.37  ? 348  HIS A O     1 
ATOM   2570  C CB    . HIS A  1 348 ? 86.527  129.958 -79.054  1.00 31.18  ? 348  HIS A CB    1 
ATOM   2571  C CG    . HIS A  1 348 ? 86.960  129.740 -77.642  1.00 35.55  ? 348  HIS A CG    1 
ATOM   2572  N ND1   . HIS A  1 348 ? 86.972  130.754 -76.703  1.00 37.62  ? 348  HIS A ND1   1 
ATOM   2573  C CD2   . HIS A  1 348 ? 87.328  128.613 -76.984  1.00 35.53  ? 348  HIS A CD2   1 
ATOM   2574  C CE1   . HIS A  1 348 ? 87.323  130.257 -75.527  1.00 38.09  ? 348  HIS A CE1   1 
ATOM   2575  N NE2   . HIS A  1 348 ? 87.542  128.960 -75.670  1.00 36.91  ? 348  HIS A NE2   1 
ATOM   2576  N N     . ILE A  1 349 ? 84.548  132.033 -80.697  1.00 27.22  ? 349  ILE A N     1 
ATOM   2577  C CA    . ILE A  1 349 ? 84.422  132.673 -81.983  1.00 28.49  ? 349  ILE A CA    1 
ATOM   2578  C C     . ILE A  1 349 ? 84.879  134.104 -81.836  1.00 28.62  ? 349  ILE A C     1 
ATOM   2579  O O     . ILE A  1 349 ? 84.516  134.805 -80.905  1.00 29.84  ? 349  ILE A O     1 
ATOM   2580  C CB    . ILE A  1 349 ? 82.984  132.613 -82.580  1.00 27.96  ? 349  ILE A CB    1 
ATOM   2581  C CG1   . ILE A  1 349 ? 83.019  133.204 -83.995  1.00 30.44  ? 349  ILE A CG1   1 
ATOM   2582  C CG2   . ILE A  1 349 ? 81.981  133.347 -81.700  1.00 26.26  ? 349  ILE A CG2   1 
ATOM   2583  C CD1   . ILE A  1 349 ? 81.788  132.856 -84.850  1.00 32.44  ? 349  ILE A CD1   1 
ATOM   2584  N N     . ASP A  1 350 ? 85.742  134.506 -82.743  1.00 31.41  ? 350  ASP A N     1 
ATOM   2585  C CA    . ASP A  1 350 ? 86.268  135.857 -82.742  1.00 31.47  ? 350  ASP A CA    1 
ATOM   2586  C C     . ASP A  1 350 ? 85.770  136.495 -84.034  1.00 30.91  ? 350  ASP A C     1 
ATOM   2587  O O     . ASP A  1 350 ? 86.228  136.151 -85.130  1.00 29.30  ? 350  ASP A O     1 
ATOM   2588  C CB    . ASP A  1 350 ? 87.790  135.788 -82.704  1.00 34.10  ? 350  ASP A CB    1 
ATOM   2589  C CG    . ASP A  1 350 ? 88.445  137.114 -83.001  1.00 37.28  ? 350  ASP A CG    1 
ATOM   2590  O OD1   . ASP A  1 350 ? 87.842  138.177 -82.743  1.00 36.73  ? 350  ASP A OD1   1 
ATOM   2591  O OD2   . ASP A  1 350 ? 89.586  137.079 -83.491  1.00 41.32  ? 350  ASP A OD2   1 
ATOM   2592  N N     . TYR A  1 351 ? 84.804  137.394 -83.904  1.00 30.13  ? 351  TYR A N     1 
ATOM   2593  C CA    . TYR A  1 351 ? 84.238  138.061 -85.069  1.00 31.27  ? 351  TYR A CA    1 
ATOM   2594  C C     . TYR A  1 351 ? 85.231  138.897 -85.875  1.00 31.79  ? 351  TYR A C     1 
ATOM   2595  O O     . TYR A  1 351 ? 84.926  139.270 -86.997  1.00 31.02  ? 351  TYR A O     1 
ATOM   2596  C CB    . TYR A  1 351 ? 83.037  138.896 -84.643  1.00 31.44  ? 351  TYR A CB    1 
ATOM   2597  C CG    . TYR A  1 351 ? 81.937  138.031 -84.051  1.00 34.21  ? 351  TYR A CG    1 
ATOM   2598  C CD1   . TYR A  1 351 ? 81.256  137.095 -84.837  1.00 32.23  ? 351  TYR A CD1   1 
ATOM   2599  C CD2   . TYR A  1 351 ? 81.628  138.101 -82.693  1.00 36.33  ? 351  TYR A CD2   1 
ATOM   2600  C CE1   . TYR A  1 351 ? 80.311  136.250 -84.290  1.00 33.61  ? 351  TYR A CE1   1 
ATOM   2601  C CE2   . TYR A  1 351 ? 80.672  137.254 -82.121  1.00 37.16  ? 351  TYR A CE2   1 
ATOM   2602  C CZ    . TYR A  1 351 ? 80.019  136.323 -82.930  1.00 35.13  ? 351  TYR A CZ    1 
ATOM   2603  O OH    . TYR A  1 351 ? 79.123  135.455 -82.352  1.00 32.49  ? 351  TYR A OH    1 
ATOM   2604  N N     . ASN A  1 352 ? 86.412  139.166 -85.310  1.00 32.66  ? 352  ASN A N     1 
ATOM   2605  C CA    . ASN A  1 352 ? 87.468  139.922 -85.992  1.00 33.52  ? 352  ASN A CA    1 
ATOM   2606  C C     . ASN A  1 352 ? 88.110  139.010 -87.036  1.00 33.66  ? 352  ASN A C     1 
ATOM   2607  O O     . ASN A  1 352 ? 88.737  139.494 -87.977  1.00 36.14  ? 352  ASN A O     1 
ATOM   2608  C CB    . ASN A  1 352 ? 88.553  140.388 -84.992  1.00 34.74  ? 352  ASN A CB    1 
ATOM   2609  C CG    . ASN A  1 352 ? 89.703  141.196 -85.660  1.00 36.77  ? 352  ASN A CG    1 
ATOM   2610  O OD1   . ASN A  1 352 ? 89.472  142.221 -86.311  1.00 37.77  ? 352  ASN A OD1   1 
ATOM   2611  N ND2   . ASN A  1 352 ? 90.944  140.734 -85.476  1.00 34.07  ? 352  ASN A ND2   1 
ATOM   2612  N N     . CYS A  1 353 ? 87.959  137.695 -86.875  1.00 32.21  ? 353  CYS A N     1 
ATOM   2613  C CA    . CYS A  1 353 ? 88.546  136.751 -87.821  1.00 31.03  ? 353  CYS A CA    1 
ATOM   2614  C C     . CYS A  1 353 ? 87.522  136.147 -88.798  1.00 29.61  ? 353  CYS A C     1 
ATOM   2615  O O     . CYS A  1 353 ? 87.829  135.197 -89.528  1.00 29.48  ? 353  CYS A O     1 
ATOM   2616  C CB    . CYS A  1 353 ? 89.296  135.631 -87.074  1.00 33.80  ? 353  CYS A CB    1 
ATOM   2617  S SG    . CYS A  1 353 ? 90.797  136.171 -86.111  1.00 37.23  ? 353  CYS A SG    1 
ATOM   2618  N N     . VAL A  1 354 ? 86.312  136.698 -88.789  1.00 26.71  ? 354  VAL A N     1 
ATOM   2619  C CA    . VAL A  1 354 ? 85.241  136.267 -89.691  1.00 26.17  ? 354  VAL A CA    1 
ATOM   2620  C C     . VAL A  1 354 ? 85.429  137.094 -90.978  1.00 25.21  ? 354  VAL A C     1 
ATOM   2621  O O     . VAL A  1 354 ? 85.205  138.296 -90.995  1.00 22.74  ? 354  VAL A O     1 
ATOM   2622  C CB    . VAL A  1 354 ? 83.849  136.574 -89.099  1.00 24.26  ? 354  VAL A CB    1 
ATOM   2623  C CG1   . VAL A  1 354 ? 82.768  136.307 -90.158  1.00 23.85  ? 354  VAL A CG1   1 
ATOM   2624  C CG2   . VAL A  1 354 ? 83.607  135.706 -87.871  1.00 24.72  ? 354  VAL A CG2   1 
ATOM   2625  N N     . PRO A  1 355 ? 85.868  136.459 -92.059  1.00 23.37  ? 355  PRO A N     1 
ATOM   2626  C CA    . PRO A  1 355 ? 86.040  137.284 -93.243  1.00 24.07  ? 355  PRO A CA    1 
ATOM   2627  C C     . PRO A  1 355 ? 84.752  137.823 -93.879  1.00 25.19  ? 355  PRO A C     1 
ATOM   2628  O O     . PRO A  1 355 ? 83.648  137.374 -93.593  1.00 23.90  ? 355  PRO A O     1 
ATOM   2629  C CB    . PRO A  1 355 ? 86.815  136.374 -94.181  1.00 23.99  ? 355  PRO A CB    1 
ATOM   2630  C CG    . PRO A  1 355 ? 86.270  135.031 -93.853  1.00 25.66  ? 355  PRO A CG    1 
ATOM   2631  C CD    . PRO A  1 355 ? 86.233  135.063 -92.319  1.00 24.29  ? 355  PRO A CD    1 
ATOM   2632  N N     . SER A  1 356 ? 84.935  138.800 -94.757  1.00 24.03  ? 356  SER A N     1 
ATOM   2633  C CA    . SER A  1 356 ? 83.840  139.406 -95.503  1.00 24.90  ? 356  SER A CA    1 
ATOM   2634  C C     . SER A  1 356 ? 84.262  139.334 -96.967  1.00 25.36  ? 356  SER A C     1 
ATOM   2635  O O     . SER A  1 356 ? 85.440  139.557 -97.260  1.00 25.41  ? 356  SER A O     1 
ATOM   2636  C CB    . SER A  1 356 ? 83.664  140.892 -95.122  1.00 25.32  ? 356  SER A CB    1 
ATOM   2637  O OG    . SER A  1 356 ? 82.755  141.059 -94.050  1.00 24.03  ? 356  SER A OG    1 
ATOM   2638  N N     . VAL A  1 357 ? 83.332  139.016 -97.873  1.00 23.60  ? 357  VAL A N     1 
ATOM   2639  C CA    . VAL A  1 357 ? 83.644  138.984 -99.310  1.00 24.27  ? 357  VAL A CA    1 
ATOM   2640  C C     . VAL A  1 357 ? 82.520  139.631 -100.156 1.00 25.99  ? 357  VAL A C     1 
ATOM   2641  O O     . VAL A  1 357 ? 81.343  139.497 -99.842  1.00 25.79  ? 357  VAL A O     1 
ATOM   2642  C CB    . VAL A  1 357 ? 83.842  137.534 -99.862  1.00 24.13  ? 357  VAL A CB    1 
ATOM   2643  C CG1   . VAL A  1 357 ? 84.014  137.583 -101.378 1.00 23.25  ? 357  VAL A CG1   1 
ATOM   2644  C CG2   . VAL A  1 357 ? 85.065  136.847 -99.194  1.00 24.25  ? 357  VAL A CG2   1 
ATOM   2645  N N     . ILE A  1 358 ? 82.889  140.356 -101.207 1.00 24.80  ? 358  ILE A N     1 
ATOM   2646  C CA    . ILE A  1 358 ? 81.889  140.922 -102.111 1.00 24.47  ? 358  ILE A CA    1 
ATOM   2647  C C     . ILE A  1 358 ? 82.208  140.227 -103.427 1.00 23.37  ? 358  ILE A C     1 
ATOM   2648  O O     . ILE A  1 358 ? 83.322  140.348 -103.929 1.00 23.42  ? 358  ILE A O     1 
ATOM   2649  C CB    . ILE A  1 358 ? 82.022  142.446 -102.252 1.00 25.82  ? 358  ILE A CB    1 
ATOM   2650  C CG1   . ILE A  1 358 ? 81.852  143.093 -100.860 1.00 23.65  ? 358  ILE A CG1   1 
ATOM   2651  C CG2   . ILE A  1 358 ? 80.942  142.976 -103.248 1.00 22.65  ? 358  ILE A CG2   1 
ATOM   2652  C CD1   . ILE A  1 358 ? 81.886  144.609 -100.870 1.00 28.03  ? 358  ILE A CD1   1 
ATOM   2653  N N     . TYR A  1 359 ? 81.239  139.489 -103.979 1.00 22.30  ? 359  TYR A N     1 
ATOM   2654  C CA    . TYR A  1 359 ? 81.488  138.700 -105.200 1.00 23.40  ? 359  TYR A CA    1 
ATOM   2655  C C     . TYR A  1 359 ? 81.325  139.350 -106.586 1.00 23.71  ? 359  TYR A C     1 
ATOM   2656  O O     . TYR A  1 359 ? 80.979  138.700 -107.565 1.00 23.41  ? 359  TYR A O     1 
ATOM   2657  C CB    . TYR A  1 359 ? 80.686  137.389 -105.158 1.00 23.48  ? 359  TYR A CB    1 
ATOM   2658  C CG    . TYR A  1 359 ? 81.039  136.471 -104.009 1.00 24.74  ? 359  TYR A CG    1 
ATOM   2659  C CD1   . TYR A  1 359 ? 80.564  136.718 -102.731 1.00 26.13  ? 359  TYR A CD1   1 
ATOM   2660  C CD2   . TYR A  1 359 ? 81.868  135.380 -104.195 1.00 28.81  ? 359  TYR A CD2   1 
ATOM   2661  C CE1   . TYR A  1 359 ? 80.905  135.906 -101.641 1.00 26.52  ? 359  TYR A CE1   1 
ATOM   2662  C CE2   . TYR A  1 359 ? 82.234  134.551 -103.109 1.00 29.22  ? 359  TYR A CE2   1 
ATOM   2663  C CZ    . TYR A  1 359 ? 81.750  134.829 -101.828 1.00 28.40  ? 359  TYR A CZ    1 
ATOM   2664  O OH    . TYR A  1 359 ? 82.170  134.096 -100.737 1.00 26.59  ? 359  TYR A OH    1 
ATOM   2665  N N     . THR A  1 360 ? 81.608  140.634 -106.662 1.00 25.47  ? 360  THR A N     1 
ATOM   2666  C CA    . THR A  1 360 ? 81.564  141.352 -107.926 1.00 27.00  ? 360  THR A CA    1 
ATOM   2667  C C     . THR A  1 360 ? 82.841  140.949 -108.648 1.00 28.07  ? 360  THR A C     1 
ATOM   2668  O O     . THR A  1 360 ? 83.558  140.042 -108.216 1.00 26.67  ? 360  THR A O     1 
ATOM   2669  C CB    . THR A  1 360 ? 81.612  142.871 -107.658 1.00 27.60  ? 360  THR A CB    1 
ATOM   2670  O OG1   . THR A  1 360 ? 82.638  143.135 -106.686 1.00 27.51  ? 360  THR A OG1   1 
ATOM   2671  C CG2   . THR A  1 360 ? 80.259  143.368 -107.107 1.00 26.55  ? 360  THR A CG2   1 
ATOM   2672  N N     . HIS A  1 361 ? 83.114  141.601 -109.769 1.00 28.58  ? 361  HIS A N     1 
ATOM   2673  C CA    . HIS A  1 361 ? 84.354  141.351 -110.465 1.00 31.51  ? 361  HIS A CA    1 
ATOM   2674  C C     . HIS A  1 361 ? 84.962  142.730 -110.769 1.00 33.26  ? 361  HIS A C     1 
ATOM   2675  O O     . HIS A  1 361 ? 84.429  143.489 -111.575 1.00 34.16  ? 361  HIS A O     1 
ATOM   2676  C CB    . HIS A  1 361 ? 84.135  140.567 -111.755 1.00 32.58  ? 361  HIS A CB    1 
ATOM   2677  C CG    . HIS A  1 361 ? 85.408  140.289 -112.486 1.00 34.59  ? 361  HIS A CG    1 
ATOM   2678  N ND1   . HIS A  1 361 ? 86.245  139.241 -112.163 1.00 36.84  ? 361  HIS A ND1   1 
ATOM   2679  C CD2   . HIS A  1 361 ? 86.044  140.988 -113.455 1.00 35.17  ? 361  HIS A CD2   1 
ATOM   2680  C CE1   . HIS A  1 361 ? 87.339  139.309 -112.898 1.00 34.30  ? 361  HIS A CE1   1 
ATOM   2681  N NE2   . HIS A  1 361 ? 87.239  140.362 -113.691 1.00 36.15  ? 361  HIS A NE2   1 
ATOM   2682  N N     . PRO A  1 362 ? 86.093  143.070 -110.144 1.00 32.73  ? 362  PRO A N     1 
ATOM   2683  C CA    . PRO A  1 362 ? 86.912  142.339 -109.182 1.00 32.51  ? 362  PRO A CA    1 
ATOM   2684  C C     . PRO A  1 362 ? 86.180  142.107 -107.870 1.00 31.75  ? 362  PRO A C     1 
ATOM   2685  O O     . PRO A  1 362 ? 85.251  142.845 -107.527 1.00 29.45  ? 362  PRO A O     1 
ATOM   2686  C CB    . PRO A  1 362 ? 88.122  143.252 -109.015 1.00 34.20  ? 362  PRO A CB    1 
ATOM   2687  C CG    . PRO A  1 362 ? 87.490  144.604 -109.063 1.00 32.83  ? 362  PRO A CG    1 
ATOM   2688  C CD    . PRO A  1 362 ? 86.547  144.468 -110.250 1.00 34.88  ? 362  PRO A CD    1 
ATOM   2689  N N     . GLU A  1 363 ? 86.584  141.065 -107.148 1.00 29.68  ? 363  GLU A N     1 
ATOM   2690  C CA    . GLU A  1 363 ? 85.974  140.766 -105.858 1.00 29.32  ? 363  GLU A CA    1 
ATOM   2691  C C     . GLU A  1 363 ? 86.670  141.636 -104.815 1.00 27.80  ? 363  GLU A C     1 
ATOM   2692  O O     . GLU A  1 363 ? 87.756  142.172 -105.051 1.00 29.03  ? 363  GLU A O     1 
ATOM   2693  C CB    . GLU A  1 363 ? 86.177  139.277 -105.497 1.00 28.56  ? 363  GLU A CB    1 
ATOM   2694  C CG    . GLU A  1 363 ? 85.749  138.342 -106.614 1.00 30.82  ? 363  GLU A CG    1 
ATOM   2695  C CD    . GLU A  1 363 ? 85.969  136.889 -106.287 1.00 32.55  ? 363  GLU A CD    1 
ATOM   2696  O OE1   . GLU A  1 363 ? 86.906  136.592 -105.508 1.00 32.20  ? 363  GLU A OE1   1 
ATOM   2697  O OE2   . GLU A  1 363 ? 85.210  136.049 -106.822 1.00 31.03  ? 363  GLU A OE2   1 
ATOM   2698  N N     . VAL A  1 364 ? 86.023  141.760 -103.669 1.00 25.99  ? 364  VAL A N     1 
ATOM   2699  C CA    . VAL A  1 364 ? 86.560  142.495 -102.536 1.00 26.12  ? 364  VAL A CA    1 
ATOM   2700  C C     . VAL A  1 364 ? 86.552  141.507 -101.353 1.00 26.12  ? 364  VAL A C     1 
ATOM   2701  O O     . VAL A  1 364 ? 85.570  140.796 -101.163 1.00 23.18  ? 364  VAL A O     1 
ATOM   2702  C CB    . VAL A  1 364 ? 85.667  143.670 -102.134 1.00 25.69  ? 364  VAL A CB    1 
ATOM   2703  C CG1   . VAL A  1 364 ? 86.457  144.581 -101.199 1.00 27.53  ? 364  VAL A CG1   1 
ATOM   2704  C CG2   . VAL A  1 364 ? 85.187  144.445 -103.393 1.00 27.24  ? 364  VAL A CG2   1 
ATOM   2705  N N     . ALA A  1 365 ? 87.619  141.457 -100.561 1.00 24.50  ? 365  ALA A N     1 
ATOM   2706  C CA    . ALA A  1 365 ? 87.602  140.541 -99.411  1.00 24.76  ? 365  ALA A CA    1 
ATOM   2707  C C     . ALA A  1 365 ? 88.454  141.055 -98.275  1.00 24.27  ? 365  ALA A C     1 
ATOM   2708  O O     . ALA A  1 365 ? 89.540  141.598 -98.502  1.00 25.06  ? 365  ALA A O     1 
ATOM   2709  C CB    . ALA A  1 365 ? 88.087  139.120 -99.831  1.00 23.72  ? 365  ALA A CB    1 
ATOM   2710  N N     . TRP A  1 366 ? 87.970  140.893 -97.047  1.00 23.25  ? 366  TRP A N     1 
ATOM   2711  C CA    . TRP A  1 366 ? 88.771  141.323 -95.923  1.00 23.52  ? 366  TRP A CA    1 
ATOM   2712  C C     . TRP A  1 366 ? 88.507  140.544 -94.641  1.00 22.34  ? 366  TRP A C     1 
ATOM   2713  O O     . TRP A  1 366 ? 87.479  139.899 -94.475  1.00 23.07  ? 366  TRP A O     1 
ATOM   2714  C CB    . TRP A  1 366 ? 88.612  142.840 -95.689  1.00 21.98  ? 366  TRP A CB    1 
ATOM   2715  C CG    . TRP A  1 366 ? 87.254  143.282 -95.222  1.00 22.14  ? 366  TRP A CG    1 
ATOM   2716  C CD1   . TRP A  1 366 ? 86.836  143.443 -93.922  1.00 24.44  ? 366  TRP A CD1   1 
ATOM   2717  C CD2   . TRP A  1 366 ? 86.119  143.599 -96.050  1.00 22.51  ? 366  TRP A CD2   1 
ATOM   2718  N NE1   . TRP A  1 366 ? 85.510  143.837 -93.895  1.00 24.47  ? 366  TRP A NE1   1 
ATOM   2719  C CE2   . TRP A  1 366 ? 85.050  143.940 -95.184  1.00 23.47  ? 366  TRP A CE2   1 
ATOM   2720  C CE3   . TRP A  1 366 ? 85.903  143.620 -97.433  1.00 23.15  ? 366  TRP A CE3   1 
ATOM   2721  C CZ2   . TRP A  1 366 ? 83.778  144.311 -95.664  1.00 23.92  ? 366  TRP A CZ2   1 
ATOM   2722  C CZ3   . TRP A  1 366 ? 84.625  143.987 -97.918  1.00 25.31  ? 366  TRP A CZ3   1 
ATOM   2723  C CH2   . TRP A  1 366 ? 83.584  144.325 -97.027  1.00 23.87  ? 366  TRP A CH2   1 
ATOM   2724  N N     . VAL A  1 367 ? 89.479  140.591 -93.741  1.00 23.25  ? 367  VAL A N     1 
ATOM   2725  C CA    . VAL A  1 367 ? 89.344  139.925 -92.445  1.00 23.02  ? 367  VAL A CA    1 
ATOM   2726  C C     . VAL A  1 367 ? 90.282  140.727 -91.557  1.00 23.17  ? 367  VAL A C     1 
ATOM   2727  O O     . VAL A  1 367 ? 91.288  141.282 -92.024  1.00 21.59  ? 367  VAL A O     1 
ATOM   2728  C CB    . VAL A  1 367 ? 89.748  138.425 -92.527  1.00 23.70  ? 367  VAL A CB    1 
ATOM   2729  C CG1   . VAL A  1 367 ? 91.253  138.308 -92.875  1.00 22.35  ? 367  VAL A CG1   1 
ATOM   2730  C CG2   . VAL A  1 367 ? 89.367  137.699 -91.231  1.00 23.22  ? 367  VAL A CG2   1 
ATOM   2731  N N     . GLY A  1 368 ? 89.928  140.839 -90.291  1.00 23.84  ? 368  GLY A N     1 
ATOM   2732  C CA    . GLY A  1 368 ? 90.741  141.643 -89.412  1.00 24.21  ? 368  GLY A CA    1 
ATOM   2733  C C     . GLY A  1 368 ? 90.235  143.084 -89.433  1.00 27.11  ? 368  GLY A C     1 
ATOM   2734  O O     . GLY A  1 368 ? 89.093  143.367 -89.832  1.00 25.57  ? 368  GLY A O     1 
ATOM   2735  N N     . LYS A  1 369 ? 91.105  144.008 -89.050  1.00 26.54  ? 369  LYS A N     1 
ATOM   2736  C CA    . LYS A  1 369 ? 90.728  145.411 -88.937  1.00 28.42  ? 369  LYS A CA    1 
ATOM   2737  C C     . LYS A  1 369 ? 91.008  146.278 -90.160  1.00 27.81  ? 369  LYS A C     1 
ATOM   2738  O O     . LYS A  1 369 ? 91.914  145.993 -90.940  1.00 26.72  ? 369  LYS A O     1 
ATOM   2739  C CB    . LYS A  1 369 ? 91.441  146.007 -87.716  1.00 29.47  ? 369  LYS A CB    1 
ATOM   2740  C CG    . LYS A  1 369 ? 91.218  145.258 -86.381  1.00 31.02  ? 369  LYS A CG    1 
ATOM   2741  C CD    . LYS A  1 369 ? 89.843  145.573 -85.792  1.00 33.25  ? 369  LYS A CD    1 
ATOM   2742  C CE    . LYS A  1 369 ? 89.629  144.965 -84.381  1.00 32.85  ? 369  LYS A CE    1 
ATOM   2743  N NZ    . LYS A  1 369 ? 90.680  145.344 -83.401  1.00 33.83  ? 369  LYS A NZ    1 
ATOM   2744  N N     . SER A  1 370 ? 90.221  147.337 -90.322  1.00 27.56  ? 370  SER A N     1 
ATOM   2745  C CA    . SER A  1 370 ? 90.420  148.284 -91.425  1.00 29.03  ? 370  SER A CA    1 
ATOM   2746  C C     . SER A  1 370 ? 91.322  149.373 -90.850  1.00 29.65  ? 370  SER A C     1 
ATOM   2747  O O     . SER A  1 370 ? 91.537  149.406 -89.646  1.00 29.50  ? 370  SER A O     1 
ATOM   2748  C CB    . SER A  1 370 ? 89.091  148.931 -91.814  1.00 30.77  ? 370  SER A CB    1 
ATOM   2749  O OG    . SER A  1 370 ? 88.630  149.751 -90.746  1.00 29.49  ? 370  SER A OG    1 
ATOM   2750  N N     . GLU A  1 371 ? 91.848  150.261 -91.688  1.00 32.16  ? 371  GLU A N     1 
ATOM   2751  C CA    . GLU A  1 371 ? 92.692  151.341 -91.160  1.00 32.94  ? 371  GLU A CA    1 
ATOM   2752  C C     . GLU A  1 371 ? 91.895  152.229 -90.223  1.00 32.81  ? 371  GLU A C     1 
ATOM   2753  O O     . GLU A  1 371 ? 92.413  152.698 -89.208  1.00 32.66  ? 371  GLU A O     1 
ATOM   2754  C CB    . GLU A  1 371 ? 93.243  152.217 -92.268  1.00 34.25  ? 371  GLU A CB    1 
ATOM   2755  C CG    . GLU A  1 371 ? 94.315  151.578 -93.061  1.00 37.97  ? 371  GLU A CG    1 
ATOM   2756  C CD    . GLU A  1 371 ? 95.126  152.600 -93.822  1.00 38.83  ? 371  GLU A CD    1 
ATOM   2757  O OE1   . GLU A  1 371 ? 95.630  153.553 -93.187  1.00 41.81  ? 371  GLU A OE1   1 
ATOM   2758  O OE2   . GLU A  1 371 ? 95.271  152.456 -95.049  1.00 41.59  ? 371  GLU A OE2   1 
ATOM   2759  N N     . GLU A  1 372 ? 90.632  152.466 -90.557  1.00 32.62  ? 372  GLU A N     1 
ATOM   2760  C CA    . GLU A  1 372 ? 89.808  153.315 -89.704  1.00 34.37  ? 372  GLU A CA    1 
ATOM   2761  C C     . GLU A  1 372 ? 89.589  152.702 -88.324  1.00 35.33  ? 372  GLU A C     1 
ATOM   2762  O O     . GLU A  1 372 ? 89.522  153.425 -87.331  1.00 34.87  ? 372  GLU A O     1 
ATOM   2763  C CB    . GLU A  1 372 ? 88.454  153.613 -90.355  1.00 33.69  ? 372  GLU A CB    1 
ATOM   2764  C CG    . GLU A  1 372 ? 88.544  154.477 -91.624  1.00 33.26  ? 372  GLU A CG    1 
ATOM   2765  C CD    . GLU A  1 372 ? 89.206  153.761 -92.802  1.00 34.42  ? 372  GLU A CD    1 
ATOM   2766  O OE1   . GLU A  1 372 ? 88.848  152.582 -93.072  1.00 34.31  ? 372  GLU A OE1   1 
ATOM   2767  O OE2   . GLU A  1 372 ? 90.069  154.391 -93.456  1.00 30.77  ? 372  GLU A OE2   1 
ATOM   2768  N N     . GLN A  1 373 ? 89.477  151.380 -88.249  1.00 35.59  ? 373  GLN A N     1 
ATOM   2769  C CA    . GLN A  1 373 ? 89.273  150.739 -86.953  1.00 36.70  ? 373  GLN A CA    1 
ATOM   2770  C C     . GLN A  1 373 ? 90.528  150.866 -86.099  1.00 36.32  ? 373  GLN A C     1 
ATOM   2771  O O     . GLN A  1 373 ? 90.445  151.181 -84.917  1.00 35.36  ? 373  GLN A O     1 
ATOM   2772  C CB    . GLN A  1 373 ? 88.930  149.258 -87.115  1.00 37.98  ? 373  GLN A CB    1 
ATOM   2773  C CG    . GLN A  1 373 ? 87.514  148.965 -87.572  1.00 39.93  ? 373  GLN A CG    1 
ATOM   2774  C CD    . GLN A  1 373 ? 87.347  147.508 -87.946  1.00 39.32  ? 373  GLN A CD    1 
ATOM   2775  O OE1   . GLN A  1 373 ? 87.846  147.050 -88.976  1.00 39.18  ? 373  GLN A OE1   1 
ATOM   2776  N NE2   . GLN A  1 373 ? 86.668  146.767 -87.093  1.00 40.21  ? 373  GLN A NE2   1 
ATOM   2777  N N     . LEU A  1 374 ? 91.684  150.608 -86.702  1.00 36.12  ? 374  LEU A N     1 
ATOM   2778  C CA    . LEU A  1 374 ? 92.944  150.703 -85.986  1.00 37.65  ? 374  LEU A CA    1 
ATOM   2779  C C     . LEU A  1 374 ? 93.169  152.137 -85.488  1.00 40.81  ? 374  LEU A C     1 
ATOM   2780  O O     . LEU A  1 374 ? 93.707  152.363 -84.396  1.00 41.12  ? 374  LEU A O     1 
ATOM   2781  C CB    . LEU A  1 374 ? 94.096  150.279 -86.888  1.00 35.38  ? 374  LEU A CB    1 
ATOM   2782  C CG    . LEU A  1 374 ? 94.100  148.826 -87.364  1.00 33.68  ? 374  LEU A CG    1 
ATOM   2783  C CD1   . LEU A  1 374 ? 95.261  148.650 -88.309  1.00 28.49  ? 374  LEU A CD1   1 
ATOM   2784  C CD2   . LEU A  1 374 ? 94.183  147.862 -86.174  1.00 31.60  ? 374  LEU A CD2   1 
ATOM   2785  N N     . LYS A  1 375 ? 92.767  153.109 -86.295  1.00 43.11  ? 375  LYS A N     1 
ATOM   2786  C CA    . LYS A  1 375 ? 92.913  154.500 -85.900  1.00 45.57  ? 375  LYS A CA    1 
ATOM   2787  C C     . LYS A  1 375 ? 92.046  154.822 -84.685  1.00 47.03  ? 375  LYS A C     1 
ATOM   2788  O O     . LYS A  1 375 ? 92.551  155.318 -83.677  1.00 47.73  ? 375  LYS A O     1 
ATOM   2789  C CB    . LYS A  1 375 ? 92.565  155.421 -87.066  1.00 44.94  ? 375  LYS A CB    1 
ATOM   2790  C CG    . LYS A  1 375 ? 93.788  155.856 -87.834  1.00 46.05  ? 375  LYS A CG    1 
ATOM   2791  C CD    . LYS A  1 375 ? 93.433  156.419 -89.195  1.00 47.58  ? 375  LYS A CD    1 
ATOM   2792  C CE    . LYS A  1 375 ? 94.570  157.257 -89.755  1.00 50.46  ? 375  LYS A CE    1 
ATOM   2793  N NZ    . LYS A  1 375 ? 95.897  156.540 -89.759  1.00 51.53  ? 375  LYS A NZ    1 
ATOM   2794  N N     . GLU A  1 376 ? 90.752  154.530 -84.750  1.00 48.35  ? 376  GLU A N     1 
ATOM   2795  C CA    . GLU A  1 376 ? 89.902  154.837 -83.607  1.00 51.32  ? 376  GLU A CA    1 
ATOM   2796  C C     . GLU A  1 376 ? 90.298  154.039 -82.354  1.00 51.15  ? 376  GLU A C     1 
ATOM   2797  O O     . GLU A  1 376 ? 89.983  154.433 -81.229  1.00 50.97  ? 376  GLU A O     1 
ATOM   2798  C CB    . GLU A  1 376 ? 88.437  154.575 -83.953  1.00 54.35  ? 376  GLU A CB    1 
ATOM   2799  C CG    . GLU A  1 376 ? 88.158  153.142 -84.342  1.00 60.41  ? 376  GLU A CG    1 
ATOM   2800  C CD    . GLU A  1 376 ? 86.689  152.779 -84.214  1.00 63.95  ? 376  GLU A CD    1 
ATOM   2801  O OE1   . GLU A  1 376 ? 86.112  153.016 -83.126  1.00 65.59  ? 376  GLU A OE1   1 
ATOM   2802  O OE2   . GLU A  1 376 ? 86.115  152.250 -85.195  1.00 65.88  ? 376  GLU A OE2   1 
ATOM   2803  N N     . GLU A  1 377 ? 90.978  152.914 -82.550  1.00 50.36  ? 377  GLU A N     1 
ATOM   2804  C CA    . GLU A  1 377 ? 91.411  152.086 -81.433  1.00 49.68  ? 377  GLU A CA    1 
ATOM   2805  C C     . GLU A  1 377 ? 92.776  152.528 -80.911  1.00 48.86  ? 377  GLU A C     1 
ATOM   2806  O O     . GLU A  1 377 ? 93.224  152.082 -79.859  1.00 47.74  ? 377  GLU A O     1 
ATOM   2807  C CB    . GLU A  1 377 ? 91.473  150.622 -81.862  1.00 50.51  ? 377  GLU A CB    1 
ATOM   2808  C CG    . GLU A  1 377 ? 90.109  149.985 -82.072  1.00 51.80  ? 377  GLU A CG    1 
ATOM   2809  C CD    . GLU A  1 377 ? 90.201  148.534 -82.558  1.00 52.66  ? 377  GLU A CD    1 
ATOM   2810  O OE1   . GLU A  1 377 ? 91.318  147.975 -82.583  1.00 53.63  ? 377  GLU A OE1   1 
ATOM   2811  O OE2   . GLU A  1 377 ? 89.155  147.952 -82.915  1.00 52.90  ? 377  GLU A OE2   1 
ATOM   2812  N N     . GLY A  1 378 ? 93.438  153.395 -81.668  1.00 48.37  ? 378  GLY A N     1 
ATOM   2813  C CA    . GLY A  1 378 ? 94.738  153.895 -81.267  1.00 48.47  ? 378  GLY A CA    1 
ATOM   2814  C C     . GLY A  1 378 ? 95.908  152.970 -81.549  1.00 49.34  ? 378  GLY A C     1 
ATOM   2815  O O     . GLY A  1 378 ? 97.033  153.242 -81.103  1.00 48.98  ? 378  GLY A O     1 
ATOM   2816  N N     . ILE A  1 379 ? 95.662  151.888 -82.288  1.00 47.55  ? 379  ILE A N     1 
ATOM   2817  C CA    . ILE A  1 379 ? 96.724  150.938 -82.609  1.00 46.99  ? 379  ILE A CA    1 
ATOM   2818  C C     . ILE A  1 379 ? 97.756  151.513 -83.579  1.00 46.32  ? 379  ILE A C     1 
ATOM   2819  O O     . ILE A  1 379 ? 97.418  151.965 -84.664  1.00 47.89  ? 379  ILE A O     1 
ATOM   2820  C CB    . ILE A  1 379 ? 96.162  149.647 -83.250  1.00 46.42  ? 379  ILE A CB    1 
ATOM   2821  C CG1   . ILE A  1 379 ? 94.980  149.124 -82.431  1.00 46.88  ? 379  ILE A CG1   1 
ATOM   2822  C CG2   . ILE A  1 379 ? 97.277  148.601 -83.373  1.00 45.62  ? 379  ILE A CG2   1 
ATOM   2823  C CD1   . ILE A  1 379 ? 95.309  148.769 -80.978  1.00 47.12  ? 379  ILE A CD1   1 
ATOM   2824  N N     . GLU A  1 380 ? 99.025  151.472 -83.196  1.00 46.05  ? 380  GLU A N     1 
ATOM   2825  C CA    . GLU A  1 380 ? 100.101 151.971 -84.049  1.00 45.81  ? 380  GLU A CA    1 
ATOM   2826  C C     . GLU A  1 380 ? 100.342 150.900 -85.114  1.00 43.56  ? 380  GLU A C     1 
ATOM   2827  O O     . GLU A  1 380 ? 100.611 149.753 -84.776  1.00 43.32  ? 380  GLU A O     1 
ATOM   2828  C CB    . GLU A  1 380 ? 101.335 152.167 -83.181  1.00 48.82  ? 380  GLU A CB    1 
ATOM   2829  C CG    . GLU A  1 380 ? 102.394 153.055 -83.759  1.00 54.61  ? 380  GLU A CG    1 
ATOM   2830  C CD    . GLU A  1 380 ? 103.031 153.924 -82.682  1.00 57.50  ? 380  GLU A CD    1 
ATOM   2831  O OE1   . GLU A  1 380 ? 103.380 153.377 -81.614  1.00 57.81  ? 380  GLU A OE1   1 
ATOM   2832  O OE2   . GLU A  1 380 ? 103.179 155.150 -82.902  1.00 59.87  ? 380  GLU A OE2   1 
ATOM   2833  N N     . TYR A  1 381 ? 100.259 151.247 -86.394  1.00 42.10  ? 381  TYR A N     1 
ATOM   2834  C CA    . TYR A  1 381 ? 100.433 150.220 -87.426  1.00 40.59  ? 381  TYR A CA    1 
ATOM   2835  C C     . TYR A  1 381 ? 101.201 150.650 -88.659  1.00 39.67  ? 381  TYR A C     1 
ATOM   2836  O O     . TYR A  1 381 ? 101.423 151.832 -88.881  1.00 40.63  ? 381  TYR A O     1 
ATOM   2837  C CB    . TYR A  1 381 ? 99.056  149.726 -87.869  1.00 41.10  ? 381  TYR A CB    1 
ATOM   2838  C CG    . TYR A  1 381 ? 98.249  150.784 -88.602  1.00 40.14  ? 381  TYR A CG    1 
ATOM   2839  C CD1   . TYR A  1 381 ? 98.393  150.967 -89.982  1.00 40.39  ? 381  TYR A CD1   1 
ATOM   2840  C CD2   . TYR A  1 381 ? 97.354  151.609 -87.913  1.00 40.74  ? 381  TYR A CD2   1 
ATOM   2841  C CE1   . TYR A  1 381 ? 97.661  151.938 -90.668  1.00 40.38  ? 381  TYR A CE1   1 
ATOM   2842  C CE2   . TYR A  1 381 ? 96.613  152.589 -88.582  1.00 41.02  ? 381  TYR A CE2   1 
ATOM   2843  C CZ    . TYR A  1 381 ? 96.770  152.746 -89.960  1.00 41.58  ? 381  TYR A CZ    1 
ATOM   2844  O OH    . TYR A  1 381 ? 96.023  153.690 -90.634  1.00 41.95  ? 381  TYR A OH    1 
ATOM   2845  N N     . LYS A  1 382 ? 101.599 149.668 -89.462  1.00 38.37  ? 382  LYS A N     1 
ATOM   2846  C CA    . LYS A  1 382 ? 102.304 149.910 -90.718  1.00 37.26  ? 382  LYS A CA    1 
ATOM   2847  C C     . LYS A  1 382 ? 101.486 149.319 -91.888  1.00 36.51  ? 382  LYS A C     1 
ATOM   2848  O O     . LYS A  1 382 ? 100.595 148.487 -91.679  1.00 34.45  ? 382  LYS A O     1 
ATOM   2849  C CB    . LYS A  1 382 ? 103.703 149.303 -90.683  1.00 38.26  ? 382  LYS A CB    1 
ATOM   2850  C CG    . LYS A  1 382 ? 103.743 147.852 -90.237  1.00 40.80  ? 382  LYS A CG    1 
ATOM   2851  C CD    . LYS A  1 382 ? 105.163 147.325 -90.298  1.00 40.93  ? 382  LYS A CD    1 
ATOM   2852  C CE    . LYS A  1 382 ? 105.251 145.910 -89.768  1.00 40.80  ? 382  LYS A CE    1 
ATOM   2853  N NZ    . LYS A  1 382 ? 106.666 145.449 -89.753  1.00 41.58  ? 382  LYS A NZ    1 
ATOM   2854  N N     . VAL A  1 383 ? 101.799 149.730 -93.115  1.00 35.07  ? 383  VAL A N     1 
ATOM   2855  C CA    . VAL A  1 383 ? 101.041 149.279 -94.272  1.00 33.65  ? 383  VAL A CA    1 
ATOM   2856  C C     . VAL A  1 383 ? 101.879 148.674 -95.388  1.00 33.94  ? 383  VAL A C     1 
ATOM   2857  O O     . VAL A  1 383 ? 102.965 149.145 -95.677  1.00 34.94  ? 383  VAL A O     1 
ATOM   2858  C CB    . VAL A  1 383 ? 100.256 150.450 -94.868  1.00 32.85  ? 383  VAL A CB    1 
ATOM   2859  C CG1   . VAL A  1 383 ? 99.253  149.943 -95.906  1.00 33.22  ? 383  VAL A CG1   1 
ATOM   2860  C CG2   . VAL A  1 383 ? 99.588  151.227 -93.757  1.00 31.28  ? 383  VAL A CG2   1 
ATOM   2861  N N     . GLY A  1 384 ? 101.355 147.622 -96.009  1.00 31.76  ? 384  GLY A N     1 
ATOM   2862  C CA    . GLY A  1 384 ? 102.049 146.990 -97.106  1.00 30.32  ? 384  GLY A CA    1 
ATOM   2863  C C     . GLY A  1 384 ? 101.045 146.813 -98.227  1.00 31.75  ? 384  GLY A C     1 
ATOM   2864  O O     . GLY A  1 384 ? 99.954  146.287 -97.990  1.00 29.11  ? 384  GLY A O     1 
ATOM   2865  N N     . LYS A  1 385 ? 101.391 147.263 -99.433  1.00 31.68  ? 385  LYS A N     1 
ATOM   2866  C CA    . LYS A  1 385 ? 100.496 147.129 -100.576 1.00 35.05  ? 385  LYS A CA    1 
ATOM   2867  C C     . LYS A  1 385 ? 101.194 146.488 -101.757 1.00 35.90  ? 385  LYS A C     1 
ATOM   2868  O O     . LYS A  1 385 ? 102.403 146.632 -101.923 1.00 37.60  ? 385  LYS A O     1 
ATOM   2869  C CB    . LYS A  1 385 ? 99.994  148.495 -101.032 1.00 36.17  ? 385  LYS A CB    1 
ATOM   2870  C CG    . LYS A  1 385 ? 99.222  149.274 -99.977  1.00 38.92  ? 385  LYS A CG    1 
ATOM   2871  C CD    . LYS A  1 385 ? 98.831  150.647 -100.510 1.00 41.85  ? 385  LYS A CD    1 
ATOM   2872  C CE    . LYS A  1 385 ? 98.245  151.518 -99.414  1.00 44.07  ? 385  LYS A CE    1 
ATOM   2873  N NZ    . LYS A  1 385 ? 98.014  152.916 -99.890  1.00 45.76  ? 385  LYS A NZ    1 
ATOM   2874  N N     . PHE A  1 386 ? 100.422 145.774 -102.571 1.00 34.63  ? 386  PHE A N     1 
ATOM   2875  C CA    . PHE A  1 386 ? 100.939 145.176 -103.790 1.00 33.56  ? 386  PHE A CA    1 
ATOM   2876  C C     . PHE A  1 386 ? 99.792  145.197 -104.799 1.00 33.79  ? 386  PHE A C     1 
ATOM   2877  O O     . PHE A  1 386 ? 98.716  144.667 -104.516 1.00 34.65  ? 386  PHE A O     1 
ATOM   2878  C CB    . PHE A  1 386 ? 101.397 143.735 -103.571 1.00 32.67  ? 386  PHE A CB    1 
ATOM   2879  C CG    . PHE A  1 386 ? 102.207 143.204 -104.716 1.00 29.88  ? 386  PHE A CG    1 
ATOM   2880  C CD1   . PHE A  1 386 ? 103.558 143.464 -104.782 1.00 28.57  ? 386  PHE A CD1   1 
ATOM   2881  C CD2   . PHE A  1 386 ? 101.606 142.514 -105.761 1.00 27.79  ? 386  PHE A CD2   1 
ATOM   2882  C CE1   . PHE A  1 386 ? 104.303 143.047 -105.877 1.00 30.05  ? 386  PHE A CE1   1 
ATOM   2883  C CE2   . PHE A  1 386 ? 102.338 142.098 -106.849 1.00 27.59  ? 386  PHE A CE2   1 
ATOM   2884  C CZ    . PHE A  1 386 ? 103.695 142.363 -106.907 1.00 29.82  ? 386  PHE A CZ    1 
ATOM   2885  N N     . PRO A  1 387 ? 100.000 145.810 -105.984 1.00 33.39  ? 387  PRO A N     1 
ATOM   2886  C CA    . PRO A  1 387 ? 98.942  145.880 -106.999 1.00 32.96  ? 387  PRO A CA    1 
ATOM   2887  C C     . PRO A  1 387 ? 98.858  144.602 -107.851 1.00 33.59  ? 387  PRO A C     1 
ATOM   2888  O O     . PRO A  1 387 ? 99.882  143.971 -108.143 1.00 33.44  ? 387  PRO A O     1 
ATOM   2889  C CB    . PRO A  1 387 ? 99.351  147.101 -107.817 1.00 32.66  ? 387  PRO A CB    1 
ATOM   2890  C CG    . PRO A  1 387 ? 100.870 146.927 -107.873 1.00 32.45  ? 387  PRO A CG    1 
ATOM   2891  C CD    . PRO A  1 387 ? 101.243 146.447 -106.472 1.00 33.53  ? 387  PRO A CD    1 
ATOM   2892  N N     . PHE A  1 388 ? 97.653  144.206 -108.243 1.00 31.80  ? 388  PHE A N     1 
ATOM   2893  C CA    . PHE A  1 388 ? 97.553  143.007 -109.065 1.00 31.95  ? 388  PHE A CA    1 
ATOM   2894  C C     . PHE A  1 388 ? 98.174  143.200 -110.461 1.00 32.44  ? 388  PHE A C     1 
ATOM   2895  O O     . PHE A  1 388 ? 98.444  142.221 -111.163 1.00 31.25  ? 388  PHE A O     1 
ATOM   2896  C CB    . PHE A  1 388 ? 96.109  142.547 -109.158 1.00 30.85  ? 388  PHE A CB    1 
ATOM   2897  C CG    . PHE A  1 388 ? 95.668  141.733 -107.971 1.00 31.74  ? 388  PHE A CG    1 
ATOM   2898  C CD1   . PHE A  1 388 ? 96.193  140.461 -107.755 1.00 30.69  ? 388  PHE A CD1   1 
ATOM   2899  C CD2   . PHE A  1 388 ? 94.748  142.242 -107.052 1.00 31.18  ? 388  PHE A CD2   1 
ATOM   2900  C CE1   . PHE A  1 388 ? 95.817  139.694 -106.648 1.00 28.44  ? 388  PHE A CE1   1 
ATOM   2901  C CE2   . PHE A  1 388 ? 94.363  141.475 -105.927 1.00 30.60  ? 388  PHE A CE2   1 
ATOM   2902  C CZ    . PHE A  1 388 ? 94.905  140.199 -105.736 1.00 29.39  ? 388  PHE A CZ    1 
ATOM   2903  N N     . ALA A  1 389 ? 98.437  144.452 -110.840 1.00 31.88  ? 389  ALA A N     1 
ATOM   2904  C CA    . ALA A  1 389 ? 99.075  144.731 -112.134 1.00 32.86  ? 389  ALA A CA    1 
ATOM   2905  C C     . ALA A  1 389 ? 100.480 144.148 -112.173 1.00 32.67  ? 389  ALA A C     1 
ATOM   2906  O O     . ALA A  1 389 ? 100.983 143.798 -113.242 1.00 34.24  ? 389  ALA A O     1 
ATOM   2907  C CB    . ALA A  1 389 ? 99.149  146.229 -112.401 1.00 32.07  ? 389  ALA A CB    1 
ATOM   2908  N N     . ALA A  1 390 ? 101.114 144.030 -111.008 1.00 33.21  ? 390  ALA A N     1 
ATOM   2909  C CA    . ALA A  1 390 ? 102.465 143.479 -110.938 1.00 32.93  ? 390  ALA A CA    1 
ATOM   2910  C C     . ALA A  1 390 ? 102.484 141.984 -110.600 1.00 33.17  ? 390  ALA A C     1 
ATOM   2911  O O     . ALA A  1 390 ? 103.569 141.376 -110.423 1.00 31.32  ? 390  ALA A O     1 
ATOM   2912  C CB    . ALA A  1 390 ? 103.307 144.256 -109.907 1.00 33.86  ? 390  ALA A CB    1 
ATOM   2913  N N     . ASN A  1 391 ? 101.290 141.399 -110.476 1.00 33.42  ? 391  ASN A N     1 
ATOM   2914  C CA    . ASN A  1 391 ? 101.171 139.968 -110.174 1.00 31.31  ? 391  ASN A CA    1 
ATOM   2915  C C     . ASN A  1 391 ? 101.142 139.135 -111.450 1.00 33.16  ? 391  ASN A C     1 
ATOM   2916  O O     . ASN A  1 391 ? 100.308 139.355 -112.330 1.00 30.25  ? 391  ASN A O     1 
ATOM   2917  C CB    . ASN A  1 391 ? 99.912  139.687 -109.361 1.00 30.90  ? 391  ASN A CB    1 
ATOM   2918  C CG    . ASN A  1 391 ? 99.664  138.198 -109.195 1.00 29.84  ? 391  ASN A CG    1 
ATOM   2919  O OD1   . ASN A  1 391 ? 98.955  137.591 -110.007 1.00 29.13  ? 391  ASN A OD1   1 
ATOM   2920  N ND2   . ASN A  1 391 ? 100.285 137.590 -108.167 1.00 26.40  ? 391  ASN A ND2   1 
ATOM   2921  N N     . SER A  1 392 ? 102.036 138.150 -111.528 1.00 34.58  ? 392  SER A N     1 
ATOM   2922  C CA    . SER A  1 392 ? 102.133 137.324 -112.721 1.00 35.58  ? 392  SER A CA    1 
ATOM   2923  C C     . SER A  1 392 ? 100.895 136.597 -113.191 1.00 35.44  ? 392  SER A C     1 
ATOM   2924  O O     . SER A  1 392 ? 100.581 136.654 -114.381 1.00 35.16  ? 392  SER A O     1 
ATOM   2925  C CB    . SER A  1 392 ? 103.281 136.337 -112.595 1.00 35.96  ? 392  SER A CB    1 
ATOM   2926  O OG    . SER A  1 392 ? 104.492 137.047 -112.753 1.00 37.81  ? 392  SER A OG    1 
ATOM   2927  N N     . ARG A  1 393 ? 100.189 135.906 -112.303 1.00 35.11  ? 393  ARG A N     1 
ATOM   2928  C CA    . ARG A  1 393 ? 99.003  135.226 -112.776 1.00 34.75  ? 393  ARG A CA    1 
ATOM   2929  C C     . ARG A  1 393 ? 97.996  136.248 -113.254 1.00 34.08  ? 393  ARG A C     1 
ATOM   2930  O O     . ARG A  1 393 ? 97.386  136.074 -114.310 1.00 34.65  ? 393  ARG A O     1 
ATOM   2931  C CB    . ARG A  1 393 ? 98.364  134.322 -111.717 1.00 35.60  ? 393  ARG A CB    1 
ATOM   2932  C CG    . ARG A  1 393 ? 97.385  133.353 -112.383 1.00 35.42  ? 393  ARG A CG    1 
ATOM   2933  C CD    . ARG A  1 393 ? 96.847  132.308 -111.431 1.00 36.33  ? 393  ARG A CD    1 
ATOM   2934  N NE    . ARG A  1 393 ? 96.092  131.278 -112.141 1.00 34.65  ? 393  ARG A NE    1 
ATOM   2935  C CZ    . ARG A  1 393 ? 95.619  130.168 -111.573 1.00 35.76  ? 393  ARG A CZ    1 
ATOM   2936  N NH1   . ARG A  1 393 ? 95.810  129.919 -110.272 1.00 33.76  ? 393  ARG A NH1   1 
ATOM   2937  N NH2   . ARG A  1 393 ? 94.957  129.290 -112.306 1.00 34.22  ? 393  ARG A NH2   1 
ATOM   2938  N N     . ALA A  1 394 ? 97.837  137.329 -112.500 1.00 33.56  ? 394  ALA A N     1 
ATOM   2939  C CA    . ALA A  1 394 ? 96.894  138.367 -112.892 1.00 34.64  ? 394  ALA A CA    1 
ATOM   2940  C C     . ALA A  1 394 ? 97.238  138.980 -114.260 1.00 35.70  ? 394  ALA A C     1 
ATOM   2941  O O     . ALA A  1 394 ? 96.344  139.215 -115.072 1.00 34.76  ? 394  ALA A O     1 
ATOM   2942  C CB    . ALA A  1 394 ? 96.831  139.477 -111.810 1.00 33.34  ? 394  ALA A CB    1 
ATOM   2943  N N     . LYS A  1 395 ? 98.522  139.234 -114.514 1.00 37.53  ? 395  LYS A N     1 
ATOM   2944  C CA    . LYS A  1 395 ? 98.929  139.838 -115.783 1.00 39.79  ? 395  LYS A CA    1 
ATOM   2945  C C     . LYS A  1 395 ? 98.724  138.913 -116.988 1.00 40.71  ? 395  LYS A C     1 
ATOM   2946  O O     . LYS A  1 395 ? 98.216  139.331 -118.023 1.00 40.46  ? 395  LYS A O     1 
ATOM   2947  C CB    . LYS A  1 395 ? 100.393 140.299 -115.720 1.00 39.36  ? 395  LYS A CB    1 
ATOM   2948  C CG    . LYS A  1 395 ? 100.816 141.183 -116.910 1.00 41.51  ? 395  LYS A CG    1 
ATOM   2949  C CD    . LYS A  1 395 ? 99.836  142.360 -117.106 1.00 42.30  ? 395  LYS A CD    1 
ATOM   2950  C CE    . LYS A  1 395 ? 100.340 143.399 -118.125 1.00 44.73  ? 395  LYS A CE    1 
ATOM   2951  N NZ    . LYS A  1 395 ? 99.278  144.418 -118.472 1.00 44.02  ? 395  LYS A NZ    1 
ATOM   2952  N N     . THR A  1 396 ? 99.103  137.653 -116.839 1.00 42.08  ? 396  THR A N     1 
ATOM   2953  C CA    . THR A  1 396 ? 98.959  136.672 -117.909 1.00 43.61  ? 396  THR A CA    1 
ATOM   2954  C C     . THR A  1 396 ? 97.499  136.424 -118.330 1.00 45.23  ? 396  THR A C     1 
ATOM   2955  O O     . THR A  1 396 ? 97.218  136.085 -119.487 1.00 44.46  ? 396  THR A O     1 
ATOM   2956  C CB    . THR A  1 396 ? 99.570  135.340 -117.483 1.00 43.75  ? 396  THR A CB    1 
ATOM   2957  O OG1   . THR A  1 396 ? 100.908 135.564 -117.019 1.00 44.08  ? 396  THR A OG1   1 
ATOM   2958  C CG2   . THR A  1 396 ? 99.594  134.373 -118.657 1.00 44.21  ? 396  THR A CG2   1 
ATOM   2959  N N     . ASN A  1 397 ? 96.583  136.590 -117.381 1.00 45.94  ? 397  ASN A N     1 
ATOM   2960  C CA    . ASN A  1 397 ? 95.161  136.383 -117.625 1.00 46.96  ? 397  ASN A CA    1 
ATOM   2961  C C     . ASN A  1 397 ? 94.481  137.701 -118.000 1.00 46.09  ? 397  ASN A C     1 
ATOM   2962  O O     . ASN A  1 397 ? 93.283  137.713 -118.265 1.00 45.37  ? 397  ASN A O     1 
ATOM   2963  C CB    . ASN A  1 397 ? 94.490  135.800 -116.371 1.00 49.86  ? 397  ASN A CB    1 
ATOM   2964  C CG    . ASN A  1 397 ? 95.182  134.528 -115.854 1.00 53.54  ? 397  ASN A CG    1 
ATOM   2965  O OD1   . ASN A  1 397 ? 96.407  134.371 -115.962 1.00 56.94  ? 397  ASN A OD1   1 
ATOM   2966  N ND2   . ASN A  1 397 ? 94.398  133.627 -115.265 1.00 55.50  ? 397  ASN A ND2   1 
ATOM   2967  N N     . ALA A  1 398 ? 95.241  138.799 -118.014 1.00 45.90  ? 398  ALA A N     1 
ATOM   2968  C CA    . ALA A  1 398 ? 94.720  140.142 -118.344 1.00 46.56  ? 398  ALA A CA    1 
ATOM   2969  C C     . ALA A  1 398 ? 93.537  140.537 -117.444 1.00 47.58  ? 398  ALA A C     1 
ATOM   2970  O O     . ALA A  1 398 ? 92.494  141.008 -117.910 1.00 47.11  ? 398  ALA A O     1 
ATOM   2971  C CB    . ALA A  1 398 ? 94.303  140.208 -119.828 1.00 46.87  ? 398  ALA A CB    1 
ATOM   2972  N N     . ASP A  1 399 ? 93.727  140.351 -116.144 1.00 47.30  ? 399  ASP A N     1 
ATOM   2973  C CA    . ASP A  1 399 ? 92.716  140.630 -115.134 1.00 47.69  ? 399  ASP A CA    1 
ATOM   2974  C C     . ASP A  1 399 ? 93.567  141.247 -114.019 1.00 47.65  ? 399  ASP A C     1 
ATOM   2975  O O     . ASP A  1 399 ? 93.837  140.615 -113.005 1.00 47.50  ? 399  ASP A O     1 
ATOM   2976  C CB    . ASP A  1 399 ? 92.099  139.282 -114.717 1.00 47.89  ? 399  ASP A CB    1 
ATOM   2977  C CG    . ASP A  1 399 ? 90.825  139.428 -113.910 1.00 49.75  ? 399  ASP A CG    1 
ATOM   2978  O OD1   . ASP A  1 399 ? 90.172  140.491 -113.991 1.00 48.71  ? 399  ASP A OD1   1 
ATOM   2979  O OD2   . ASP A  1 399 ? 90.466  138.450 -113.208 1.00 49.37  ? 399  ASP A OD2   1 
ATOM   2980  N N     . THR A  1 400 ? 93.994  142.489 -114.226 1.00 47.30  ? 400  THR A N     1 
ATOM   2981  C CA    . THR A  1 400 ? 94.887  143.161 -113.290 1.00 47.42  ? 400  THR A CA    1 
ATOM   2982  C C     . THR A  1 400 ? 94.391  144.277 -112.347 1.00 46.47  ? 400  THR A C     1 
ATOM   2983  O O     . THR A  1 400 ? 95.212  144.945 -111.719 1.00 45.98  ? 400  THR A O     1 
ATOM   2984  C CB    . THR A  1 400 ? 96.095  143.681 -114.068 1.00 47.98  ? 400  THR A CB    1 
ATOM   2985  O OG1   . THR A  1 400 ? 95.649  144.648 -115.029 1.00 49.05  ? 400  THR A OG1   1 
ATOM   2986  C CG2   . THR A  1 400 ? 96.773  142.523 -114.812 1.00 46.55  ? 400  THR A CG2   1 
ATOM   2987  N N     . ASP A  1 401 ? 93.076  144.475 -112.242 1.00 45.44  ? 401  ASP A N     1 
ATOM   2988  C CA    . ASP A  1 401 ? 92.510  145.493 -111.337 1.00 45.07  ? 401  ASP A CA    1 
ATOM   2989  C C     . ASP A  1 401 ? 92.799  145.173 -109.852 1.00 44.10  ? 401  ASP A C     1 
ATOM   2990  O O     . ASP A  1 401 ? 92.729  144.010 -109.434 1.00 43.73  ? 401  ASP A O     1 
ATOM   2991  C CB    . ASP A  1 401 ? 90.977  145.549 -111.440 1.00 46.38  ? 401  ASP A CB    1 
ATOM   2992  C CG    . ASP A  1 401 ? 90.465  146.366 -112.618 1.00 48.83  ? 401  ASP A CG    1 
ATOM   2993  O OD1   . ASP A  1 401 ? 91.195  147.217 -113.183 1.00 48.74  ? 401  ASP A OD1   1 
ATOM   2994  O OD2   . ASP A  1 401 ? 89.276  146.158 -112.957 1.00 50.41  ? 401  ASP A OD2   1 
ATOM   2995  N N     . GLY A  1 402 ? 93.110  146.200 -109.061 1.00 42.03  ? 402  GLY A N     1 
ATOM   2996  C CA    . GLY A  1 402 ? 93.291  146.002 -107.634 1.00 39.46  ? 402  GLY A CA    1 
ATOM   2997  C C     . GLY A  1 402 ? 94.624  145.790 -106.956 1.00 39.03  ? 402  GLY A C     1 
ATOM   2998  O O     . GLY A  1 402 ? 95.701  145.909 -107.549 1.00 37.85  ? 402  GLY A O     1 
ATOM   2999  N N     . MET A  1 403 ? 94.530  145.435 -105.674 1.00 37.51  ? 403  MET A N     1 
ATOM   3000  C CA    . MET A  1 403 ? 95.716  145.223 -104.858 1.00 34.89  ? 403  MET A CA    1 
ATOM   3001  C C     . MET A  1 403 ? 95.394  144.480 -103.568 1.00 32.73  ? 403  MET A C     1 
ATOM   3002  O O     . MET A  1 403 ? 94.234  144.278 -103.206 1.00 29.81  ? 403  MET A O     1 
ATOM   3003  C CB    . MET A  1 403 ? 96.269  146.583 -104.449 1.00 36.55  ? 403  MET A CB    1 
ATOM   3004  C CG    . MET A  1 403 ? 95.253  147.330 -103.570 1.00 38.11  ? 403  MET A CG    1 
ATOM   3005  S SD    . MET A  1 403 ? 95.880  148.837 -102.772 1.00 44.51  ? 403  MET A SD    1 
ATOM   3006  C CE    . MET A  1 403 ? 94.534  149.229 -101.625 1.00 42.36  ? 403  MET A CE    1 
ATOM   3007  N N     . VAL A  1 404 ? 96.452  144.080 -102.873 1.00 31.48  ? 404  VAL A N     1 
ATOM   3008  C CA    . VAL A  1 404 ? 96.318  143.480 -101.552 1.00 28.42  ? 404  VAL A CA    1 
ATOM   3009  C C     . VAL A  1 404 ? 96.929  144.541 -100.616 1.00 27.93  ? 404  VAL A C     1 
ATOM   3010  O O     . VAL A  1 404 ? 97.959  145.137 -100.929 1.00 25.41  ? 404  VAL A O     1 
ATOM   3011  C CB    . VAL A  1 404 ? 97.154  142.207 -101.394 1.00 29.31  ? 404  VAL A CB    1 
ATOM   3012  C CG1   . VAL A  1 404 ? 97.015  141.685 -99.955  1.00 27.97  ? 404  VAL A CG1   1 
ATOM   3013  C CG2   . VAL A  1 404 ? 96.720  141.169 -102.408 1.00 28.12  ? 404  VAL A CG2   1 
ATOM   3014  N N     . LYS A  1 405 ? 96.276  144.784 -99.488  1.00 28.18  ? 405  LYS A N     1 
ATOM   3015  C CA    . LYS A  1 405 ? 96.764  145.733 -98.510  1.00 27.37  ? 405  LYS A CA    1 
ATOM   3016  C C     . LYS A  1 405 ? 96.811  145.026 -97.175  1.00 27.86  ? 405  LYS A C     1 
ATOM   3017  O O     . LYS A  1 405 ? 95.808  144.480 -96.693  1.00 29.24  ? 405  LYS A O     1 
ATOM   3018  C CB    . LYS A  1 405 ? 95.860  146.974 -98.390  1.00 26.99  ? 405  LYS A CB    1 
ATOM   3019  C CG    . LYS A  1 405 ? 96.362  147.958 -97.299  1.00 27.51  ? 405  LYS A CG    1 
ATOM   3020  C CD    . LYS A  1 405 ? 95.786  149.371 -97.444  1.00 25.37  ? 405  LYS A CD    1 
ATOM   3021  C CE    . LYS A  1 405 ? 94.534  149.581 -96.637  1.00 26.31  ? 405  LYS A CE    1 
ATOM   3022  N NZ    . LYS A  1 405 ? 93.993  150.958 -96.813  1.00 25.59  ? 405  LYS A NZ    1 
ATOM   3023  N N     . ILE A  1 406 ? 97.991  145.038 -96.580  1.00 28.35  ? 406  ILE A N     1 
ATOM   3024  C CA    . ILE A  1 406 ? 98.206  144.408 -95.299  1.00 27.04  ? 406  ILE A CA    1 
ATOM   3025  C C     . ILE A  1 406 ? 98.483  145.461 -94.225  1.00 27.84  ? 406  ILE A C     1 
ATOM   3026  O O     . ILE A  1 406 ? 99.235  146.397 -94.450  1.00 29.40  ? 406  ILE A O     1 
ATOM   3027  C CB    . ILE A  1 406 ? 99.391  143.425 -95.404  1.00 26.65  ? 406  ILE A CB    1 
ATOM   3028  C CG1   . ILE A  1 406 ? 99.057  142.332 -96.428  1.00 25.12  ? 406  ILE A CG1   1 
ATOM   3029  C CG2   . ILE A  1 406 ? 99.704  142.820 -94.045  1.00 24.18  ? 406  ILE A CG2   1 
ATOM   3030  C CD1   . ILE A  1 406 ? 97.811  141.489 -96.071  1.00 23.72  ? 406  ILE A CD1   1 
ATOM   3031  N N     . LEU A  1 407 ? 97.836  145.329 -93.073  1.00 27.73  ? 407  LEU A N     1 
ATOM   3032  C CA    . LEU A  1 407 ? 98.066  146.234 -91.962  1.00 28.37  ? 407  LEU A CA    1 
ATOM   3033  C C     . LEU A  1 407 ? 98.740  145.412 -90.850  1.00 30.24  ? 407  LEU A C     1 
ATOM   3034  O O     . LEU A  1 407 ? 98.175  144.421 -90.384  1.00 31.26  ? 407  LEU A O     1 
ATOM   3035  C CB    . LEU A  1 407 ? 96.733  146.823 -91.478  1.00 27.60  ? 407  LEU A CB    1 
ATOM   3036  C CG    . LEU A  1 407 ? 95.943  147.569 -92.584  1.00 30.20  ? 407  LEU A CG    1 
ATOM   3037  C CD1   . LEU A  1 407 ? 94.558  147.982 -92.078  1.00 28.92  ? 407  LEU A CD1   1 
ATOM   3038  C CD2   . LEU A  1 407 ? 96.739  148.805 -93.059  1.00 28.42  ? 407  LEU A CD2   1 
ATOM   3039  N N     . GLY A  1 408 ? 99.962  145.792 -90.464  1.00 31.14  ? 408  GLY A N     1 
ATOM   3040  C CA    . GLY A  1 408 ? 100.679 145.093 -89.405  1.00 32.48  ? 408  GLY A CA    1 
ATOM   3041  C C     . GLY A  1 408 ? 100.939 145.991 -88.196  1.00 33.13  ? 408  GLY A C     1 
ATOM   3042  O O     . GLY A  1 408 ? 101.025 147.208 -88.338  1.00 33.29  ? 408  GLY A O     1 
ATOM   3043  N N     . GLN A  1 409 ? 101.050 145.413 -87.004  1.00 35.18  ? 409  GLN A N     1 
ATOM   3044  C CA    . GLN A  1 409 ? 101.319 146.220 -85.808  1.00 36.92  ? 409  GLN A CA    1 
ATOM   3045  C C     . GLN A  1 409 ? 102.768 146.735 -85.924  1.00 37.70  ? 409  GLN A C     1 
ATOM   3046  O O     . GLN A  1 409 ? 103.708 145.969 -86.190  1.00 35.22  ? 409  GLN A O     1 
ATOM   3047  C CB    . GLN A  1 409 ? 101.112 145.387 -84.539  1.00 38.63  ? 409  GLN A CB    1 
ATOM   3048  C CG    . GLN A  1 409 ? 100.725 146.223 -83.315  1.00 41.15  ? 409  GLN A CG    1 
ATOM   3049  C CD    . GLN A  1 409 ? 101.876 147.083 -82.789  1.00 44.13  ? 409  GLN A CD    1 
ATOM   3050  O OE1   . GLN A  1 409 ? 102.968 146.571 -82.529  1.00 44.25  ? 409  GLN A OE1   1 
ATOM   3051  N NE2   . GLN A  1 409 ? 101.630 148.390 -82.612  1.00 44.52  ? 409  GLN A NE2   1 
ATOM   3052  N N     . LYS A  1 410 ? 102.932 148.045 -85.767  1.00 39.81  ? 410  LYS A N     1 
ATOM   3053  C CA    . LYS A  1 410 ? 104.229 148.700 -85.919  1.00 42.61  ? 410  LYS A CA    1 
ATOM   3054  C C     . LYS A  1 410 ? 105.427 148.023 -85.250  1.00 42.72  ? 410  LYS A C     1 
ATOM   3055  O O     . LYS A  1 410 ? 106.497 147.907 -85.852  1.00 42.72  ? 410  LYS A O     1 
ATOM   3056  C CB    . LYS A  1 410 ? 104.120 150.155 -85.446  1.00 45.53  ? 410  LYS A CB    1 
ATOM   3057  C CG    . LYS A  1 410 ? 105.463 150.892 -85.378  1.00 49.90  ? 410  LYS A CG    1 
ATOM   3058  C CD    . LYS A  1 410 ? 106.005 151.249 -86.757  1.00 52.70  ? 410  LYS A CD    1 
ATOM   3059  C CE    . LYS A  1 410 ? 105.523 152.640 -87.210  1.00 55.31  ? 410  LYS A CE    1 
ATOM   3060  N NZ    . LYS A  1 410 ? 104.028 152.758 -87.314  1.00 56.06  ? 410  LYS A NZ    1 
ATOM   3061  N N     . SER A  1 411 ? 105.242 147.561 -84.018  1.00 42.65  ? 411  SER A N     1 
ATOM   3062  C CA    . SER A  1 411 ? 106.329 146.927 -83.287  1.00 44.69  ? 411  SER A CA    1 
ATOM   3063  C C     . SER A  1 411 ? 106.459 145.405 -83.420  1.00 44.05  ? 411  SER A C     1 
ATOM   3064  O O     . SER A  1 411 ? 107.554 144.892 -83.707  1.00 44.20  ? 411  SER A O     1 
ATOM   3065  C CB    . SER A  1 411 ? 106.229 147.304 -81.802  1.00 46.00  ? 411  SER A CB    1 
ATOM   3066  O OG    . SER A  1 411 ? 104.904 147.128 -81.317  1.00 48.28  ? 411  SER A OG    1 
ATOM   3067  N N     . THR A  1 412 ? 105.355 144.692 -83.209  1.00 42.38  ? 412  THR A N     1 
ATOM   3068  C CA    . THR A  1 412 ? 105.347 143.231 -83.277  1.00 40.77  ? 412  THR A CA    1 
ATOM   3069  C C     . THR A  1 412 ? 105.332 142.648 -84.693  1.00 39.49  ? 412  THR A C     1 
ATOM   3070  O O     . THR A  1 412 ? 105.697 141.500 -84.895  1.00 40.30  ? 412  THR A O     1 
ATOM   3071  C CB    . THR A  1 412 ? 104.140 142.691 -82.533  1.00 40.43  ? 412  THR A CB    1 
ATOM   3072  O OG1   . THR A  1 412 ? 102.945 143.187 -83.154  1.00 40.35  ? 412  THR A OG1   1 
ATOM   3073  C CG2   . THR A  1 412 ? 104.181 143.153 -81.082  1.00 41.41  ? 412  THR A CG2   1 
ATOM   3074  N N     . ASP A  1 413 ? 104.917 143.442 -85.667  1.00 37.63  ? 413  ASP A N     1 
ATOM   3075  C CA    . ASP A  1 413 ? 104.828 142.994 -87.049  1.00 36.95  ? 413  ASP A CA    1 
ATOM   3076  C C     . ASP A  1 413 ? 103.676 141.982 -87.181  1.00 35.66  ? 413  ASP A C     1 
ATOM   3077  O O     . ASP A  1 413 ? 103.594 141.246 -88.159  1.00 33.57  ? 413  ASP A O     1 
ATOM   3078  C CB    . ASP A  1 413 ? 106.161 142.377 -87.528  1.00 37.83  ? 413  ASP A CB    1 
ATOM   3079  C CG    . ASP A  1 413 ? 106.175 142.091 -89.042  1.00 40.11  ? 413  ASP A CG    1 
ATOM   3080  O OD1   . ASP A  1 413 ? 105.635 142.922 -89.816  1.00 39.85  ? 413  ASP A OD1   1 
ATOM   3081  O OD2   . ASP A  1 413 ? 106.736 141.044 -89.463  1.00 38.87  ? 413  ASP A OD2   1 
ATOM   3082  N N     . ARG A  1 414 ? 102.792 141.933 -86.187  1.00 34.69  ? 414  ARG A N     1 
ATOM   3083  C CA    . ARG A  1 414 ? 101.652 141.028 -86.284  1.00 35.19  ? 414  ARG A CA    1 
ATOM   3084  C C     . ARG A  1 414 ? 100.616 141.550 -87.264  1.00 32.64  ? 414  ARG A C     1 
ATOM   3085  O O     . ARG A  1 414 ? 100.263 142.730 -87.253  1.00 29.46  ? 414  ARG A O     1 
ATOM   3086  C CB    . ARG A  1 414 ? 100.991 140.795 -84.924  1.00 38.52  ? 414  ARG A CB    1 
ATOM   3087  C CG    . ARG A  1 414 ? 101.635 139.612 -84.188  1.00 45.43  ? 414  ARG A CG    1 
ATOM   3088  C CD    . ARG A  1 414 ? 100.777 139.107 -83.069  1.00 49.84  ? 414  ARG A CD    1 
ATOM   3089  N NE    . ARG A  1 414 ? 99.424  138.810 -83.538  1.00 52.94  ? 414  ARG A NE    1 
ATOM   3090  C CZ    . ARG A  1 414 ? 98.441  138.407 -82.735  1.00 54.07  ? 414  ARG A CZ    1 
ATOM   3091  N NH1   . ARG A  1 414 ? 98.676  138.260 -81.438  1.00 54.17  ? 414  ARG A NH1   1 
ATOM   3092  N NH2   . ARG A  1 414 ? 97.225  138.163 -83.217  1.00 53.41  ? 414  ARG A NH2   1 
ATOM   3093  N N     . VAL A  1 415 ? 100.138 140.658 -88.123  1.00 31.12  ? 415  VAL A N     1 
ATOM   3094  C CA    . VAL A  1 415 ? 99.128  141.043 -89.104  1.00 30.00  ? 415  VAL A CA    1 
ATOM   3095  C C     . VAL A  1 415 ? 97.871  141.405 -88.349  1.00 27.86  ? 415  VAL A C     1 
ATOM   3096  O O     . VAL A  1 415 ? 97.411  140.654 -87.495  1.00 26.35  ? 415  VAL A O     1 
ATOM   3097  C CB    . VAL A  1 415 ? 98.824  139.904 -90.105  1.00 31.47  ? 415  VAL A CB    1 
ATOM   3098  C CG1   . VAL A  1 415 ? 97.684  140.317 -91.046  1.00 29.26  ? 415  VAL A CG1   1 
ATOM   3099  C CG2   . VAL A  1 415 ? 100.092 139.569 -90.892  1.00 32.12  ? 415  VAL A CG2   1 
ATOM   3100  N N     . LEU A  1 416 ? 97.338  142.580 -88.648  1.00 27.11  ? 416  LEU A N     1 
ATOM   3101  C CA    . LEU A  1 416 ? 96.142  143.046 -87.973  1.00 27.14  ? 416  LEU A CA    1 
ATOM   3102  C C     . LEU A  1 416 ? 94.938  143.048 -88.897  1.00 26.29  ? 416  LEU A C     1 
ATOM   3103  O O     . LEU A  1 416 ? 93.795  142.948 -88.433  1.00 26.43  ? 416  LEU A O     1 
ATOM   3104  C CB    . LEU A  1 416 ? 96.364  144.457 -87.424  1.00 28.79  ? 416  LEU A CB    1 
ATOM   3105  C CG    . LEU A  1 416 ? 97.324  144.600 -86.246  1.00 29.96  ? 416  LEU A CG    1 
ATOM   3106  C CD1   . LEU A  1 416 ? 97.396  146.086 -85.818  1.00 30.53  ? 416  LEU A CD1   1 
ATOM   3107  C CD2   . LEU A  1 416 ? 96.831  143.716 -85.078  1.00 30.64  ? 416  LEU A CD2   1 
ATOM   3108  N N     . GLY A  1 417 ? 95.195  143.177 -90.193  1.00 25.66  ? 417  GLY A N     1 
ATOM   3109  C CA    . GLY A  1 417 ? 94.112  143.199 -91.165  1.00 23.98  ? 417  GLY A CA    1 
ATOM   3110  C C     . GLY A  1 417 ? 94.586  142.908 -92.578  1.00 22.89  ? 417  GLY A C     1 
ATOM   3111  O O     . GLY A  1 417 ? 95.719  143.240 -92.946  1.00 22.04  ? 417  GLY A O     1 
ATOM   3112  N N     . ALA A  1 418 ? 93.729  142.265 -93.374  1.00 22.08  ? 418  ALA A N     1 
ATOM   3113  C CA    . ALA A  1 418 ? 94.075  141.963 -94.767  1.00 23.53  ? 418  ALA A CA    1 
ATOM   3114  C C     . ALA A  1 418 ? 92.926  142.431 -95.632  1.00 24.87  ? 418  ALA A C     1 
ATOM   3115  O O     . ALA A  1 418 ? 91.771  142.093 -95.372  1.00 25.96  ? 418  ALA A O     1 
ATOM   3116  C CB    . ALA A  1 418 ? 94.318  140.455 -94.960  1.00 21.51  ? 418  ALA A CB    1 
ATOM   3117  N N     . HIS A  1 419 ? 93.244  143.209 -96.667  1.00 24.81  ? 419  HIS A N     1 
ATOM   3118  C CA    . HIS A  1 419 ? 92.221  143.761 -97.540  1.00 24.22  ? 419  HIS A CA    1 
ATOM   3119  C C     . HIS A  1 419 ? 92.625  143.477 -98.973  1.00 26.43  ? 419  HIS A C     1 
ATOM   3120  O O     . HIS A  1 419 ? 93.738  143.794 -99.402  1.00 26.91  ? 419  HIS A O     1 
ATOM   3121  C CB    . HIS A  1 419 ? 92.097  145.267 -97.256  1.00 24.12  ? 419  HIS A CB    1 
ATOM   3122  C CG    . HIS A  1 419 ? 91.777  145.559 -95.825  1.00 21.46  ? 419  HIS A CG    1 
ATOM   3123  N ND1   . HIS A  1 419 ? 90.486  145.627 -95.354  1.00 20.71  ? 419  HIS A ND1   1 
ATOM   3124  C CD2   . HIS A  1 419 ? 92.578  145.656 -94.736  1.00 21.16  ? 419  HIS A CD2   1 
ATOM   3125  C CE1   . HIS A  1 419 ? 90.504  145.745 -94.037  1.00 22.79  ? 419  HIS A CE1   1 
ATOM   3126  N NE2   . HIS A  1 419 ? 91.765  145.764 -93.639  1.00 22.13  ? 419  HIS A NE2   1 
ATOM   3127  N N     . ILE A  1 420 ? 91.717  142.860 -99.711  1.00 26.44  ? 420  ILE A N     1 
ATOM   3128  C CA    . ILE A  1 420 ? 92.028  142.462 -101.064 1.00 28.14  ? 420  ILE A CA    1 
ATOM   3129  C C     . ILE A  1 420 ? 91.005  142.972 -102.057 1.00 27.95  ? 420  ILE A C     1 
ATOM   3130  O O     . ILE A  1 420 ? 89.810  142.764 -101.904 1.00 28.91  ? 420  ILE A O     1 
ATOM   3131  C CB    . ILE A  1 420 ? 92.101  140.927 -101.154 1.00 27.29  ? 420  ILE A CB    1 
ATOM   3132  C CG1   . ILE A  1 420 ? 93.064  140.376 -100.095 1.00 28.14  ? 420  ILE A CG1   1 
ATOM   3133  C CG2   . ILE A  1 420 ? 92.577  140.504 -102.527 1.00 27.81  ? 420  ILE A CG2   1 
ATOM   3134  C CD1   . ILE A  1 420 ? 92.575  139.103 -99.450  1.00 26.82  ? 420  ILE A CD1   1 
ATOM   3135  N N     . LEU A  1 421 ? 91.494  143.655 -103.076 1.00 30.67  ? 421  LEU A N     1 
ATOM   3136  C CA    . LEU A  1 421 ? 90.624  144.174 -104.122 1.00 30.23  ? 421  LEU A CA    1 
ATOM   3137  C C     . LEU A  1 421 ? 91.184  143.619 -105.415 1.00 28.69  ? 421  LEU A C     1 
ATOM   3138  O O     . LEU A  1 421 ? 92.303  143.929 -105.798 1.00 28.98  ? 421  LEU A O     1 
ATOM   3139  C CB    . LEU A  1 421 ? 90.646  145.702 -104.156 1.00 30.90  ? 421  LEU A CB    1 
ATOM   3140  C CG    . LEU A  1 421 ? 89.867  146.332 -105.336 1.00 32.68  ? 421  LEU A CG    1 
ATOM   3141  C CD1   . LEU A  1 421 ? 88.360  146.110 -105.204 1.00 30.80  ? 421  LEU A CD1   1 
ATOM   3142  C CD2   . LEU A  1 421 ? 90.184  147.815 -105.383 1.00 33.74  ? 421  LEU A CD2   1 
ATOM   3143  N N     . GLY A  1 422 ? 90.412  142.772 -106.081 1.00 28.29  ? 422  GLY A N     1 
ATOM   3144  C CA    . GLY A  1 422 ? 90.909  142.212 -107.313 1.00 27.63  ? 422  GLY A CA    1 
ATOM   3145  C C     . GLY A  1 422 ? 90.453  140.791 -107.489 1.00 27.63  ? 422  GLY A C     1 
ATOM   3146  O O     . GLY A  1 422 ? 89.588  140.307 -106.759 1.00 29.41  ? 422  GLY A O     1 
ATOM   3147  N N     . PRO A  1 423 ? 91.034  140.101 -108.469 1.00 27.20  ? 423  PRO A N     1 
ATOM   3148  C CA    . PRO A  1 423 ? 90.753  138.709 -108.826 1.00 28.21  ? 423  PRO A CA    1 
ATOM   3149  C C     . PRO A  1 423 ? 91.118  137.696 -107.729 1.00 28.79  ? 423  PRO A C     1 
ATOM   3150  O O     . PRO A  1 423 ? 92.195  137.779 -107.132 1.00 30.33  ? 423  PRO A O     1 
ATOM   3151  C CB    . PRO A  1 423 ? 91.586  138.514 -110.088 1.00 28.33  ? 423  PRO A CB    1 
ATOM   3152  C CG    . PRO A  1 423 ? 92.779  139.481 -109.865 1.00 27.91  ? 423  PRO A CG    1 
ATOM   3153  C CD    . PRO A  1 423 ? 92.064  140.691 -109.353 1.00 26.43  ? 423  PRO A CD    1 
ATOM   3154  N N     . GLY A  1 424 ? 90.216  136.752 -107.468 1.00 28.49  ? 424  GLY A N     1 
ATOM   3155  C CA    . GLY A  1 424 ? 90.481  135.718 -106.472 1.00 26.44  ? 424  GLY A CA    1 
ATOM   3156  C C     . GLY A  1 424 ? 90.457  136.139 -105.013 1.00 25.64  ? 424  GLY A C     1 
ATOM   3157  O O     . GLY A  1 424 ? 90.915  135.391 -104.138 1.00 23.46  ? 424  GLY A O     1 
ATOM   3158  N N     . ALA A  1 425 ? 89.889  137.320 -104.753 1.00 25.48  ? 425  ALA A N     1 
ATOM   3159  C CA    . ALA A  1 425 ? 89.810  137.863 -103.401 1.00 24.89  ? 425  ALA A CA    1 
ATOM   3160  C C     . ALA A  1 425 ? 89.075  136.946 -102.427 1.00 26.04  ? 425  ALA A C     1 
ATOM   3161  O O     . ALA A  1 425 ? 89.585  136.660 -101.344 1.00 25.53  ? 425  ALA A O     1 
ATOM   3162  C CB    . ALA A  1 425 ? 89.142  139.234 -103.416 1.00 24.59  ? 425  ALA A CB    1 
ATOM   3163  N N     . GLY A  1 426 ? 87.886  136.494 -102.820 1.00 25.87  ? 426  GLY A N     1 
ATOM   3164  C CA    . GLY A  1 426 ? 87.067  135.635 -101.978 1.00 24.09  ? 426  GLY A CA    1 
ATOM   3165  C C     . GLY A  1 426 ? 87.787  134.398 -101.490 1.00 25.13  ? 426  GLY A C     1 
ATOM   3166  O O     . GLY A  1 426 ? 87.647  134.012 -100.325 1.00 24.12  ? 426  GLY A O     1 
ATOM   3167  N N     . GLU A  1 427 ? 88.544  133.771 -102.385 1.00 23.95  ? 427  GLU A N     1 
ATOM   3168  C CA    . GLU A  1 427 ? 89.308  132.577 -102.050 1.00 24.37  ? 427  GLU A CA    1 
ATOM   3169  C C     . GLU A  1 427 ? 90.554  132.932 -101.216 1.00 24.08  ? 427  GLU A C     1 
ATOM   3170  O O     . GLU A  1 427 ? 90.830  132.293 -100.214 1.00 23.10  ? 427  GLU A O     1 
ATOM   3171  C CB    . GLU A  1 427 ? 89.752  131.803 -103.325 1.00 23.59  ? 427  GLU A CB    1 
ATOM   3172  C CG    . GLU A  1 427 ? 88.606  131.170 -104.190 1.00 23.94  ? 427  GLU A CG    1 
ATOM   3173  C CD    . GLU A  1 427 ? 87.647  130.301 -103.384 1.00 25.35  ? 427  GLU A CD    1 
ATOM   3174  O OE1   . GLU A  1 427 ? 88.074  129.637 -102.403 1.00 26.28  ? 427  GLU A OE1   1 
ATOM   3175  O OE2   . GLU A  1 427 ? 86.454  130.277 -103.750 1.00 23.80  ? 427  GLU A OE2   1 
ATOM   3176  N N     . MET A  1 428 ? 91.283  133.963 -101.636 1.00 24.63  ? 428  MET A N     1 
ATOM   3177  C CA    . MET A  1 428 ? 92.508  134.395 -100.973 1.00 22.57  ? 428  MET A CA    1 
ATOM   3178  C C     . MET A  1 428 ? 92.361  134.808 -99.506  1.00 23.05  ? 428  MET A C     1 
ATOM   3179  O O     . MET A  1 428 ? 93.287  134.626 -98.702  1.00 23.40  ? 428  MET A O     1 
ATOM   3180  C CB    . MET A  1 428 ? 93.095  135.551 -101.778 1.00 23.88  ? 428  MET A CB    1 
ATOM   3181  C CG    . MET A  1 428 ? 94.498  135.956 -101.411 1.00 24.97  ? 428  MET A CG    1 
ATOM   3182  S SD    . MET A  1 428 ? 94.981  137.444 -102.397 1.00 30.26  ? 428  MET A SD    1 
ATOM   3183  C CE    . MET A  1 428 ? 94.724  136.813 -104.082 1.00 24.45  ? 428  MET A CE    1 
ATOM   3184  N N     . VAL A  1 429 ? 91.198  135.358 -99.161  1.00 21.48  ? 429  VAL A N     1 
ATOM   3185  C CA    . VAL A  1 429 ? 90.931  135.852 -97.813  1.00 20.49  ? 429  VAL A CA    1 
ATOM   3186  C C     . VAL A  1 429 ? 90.972  134.728 -96.749  1.00 20.98  ? 429  VAL A C     1 
ATOM   3187  O O     . VAL A  1 429 ? 91.156  134.967 -95.551  1.00 21.47  ? 429  VAL A O     1 
ATOM   3188  C CB    . VAL A  1 429 ? 89.547  136.580 -97.779  1.00 20.72  ? 429  VAL A CB    1 
ATOM   3189  C CG1   . VAL A  1 429 ? 88.392  135.547 -97.743  1.00 16.80  ? 429  VAL A CG1   1 
ATOM   3190  C CG2   . VAL A  1 429 ? 89.500  137.539 -96.585  1.00 19.03  ? 429  VAL A CG2   1 
ATOM   3191  N N     . ASN A  1 430 ? 90.799  133.498 -97.201  1.00 21.20  ? 430  ASN A N     1 
ATOM   3192  C CA    . ASN A  1 430 ? 90.821  132.363 -96.288  1.00 21.42  ? 430  ASN A CA    1 
ATOM   3193  C C     . ASN A  1 430 ? 92.236  132.030 -95.811  1.00 20.22  ? 430  ASN A C     1 
ATOM   3194  O O     . ASN A  1 430 ? 92.440  131.635 -94.665  1.00 18.60  ? 430  ASN A O     1 
ATOM   3195  C CB    . ASN A  1 430 ? 90.113  131.192 -96.957  1.00 21.62  ? 430  ASN A CB    1 
ATOM   3196  C CG    . ASN A  1 430 ? 88.678  131.561 -97.307  1.00 22.91  ? 430  ASN A CG    1 
ATOM   3197  O OD1   . ASN A  1 430 ? 87.881  131.836 -96.411  1.00 21.09  ? 430  ASN A OD1   1 
ATOM   3198  N ND2   . ASN A  1 430 ? 88.366  131.643 -98.605  1.00 22.87  ? 430  ASN A ND2   1 
ATOM   3199  N N     . GLU A  1 431 ? 93.216  132.227 -96.671  1.00 19.81  ? 431  GLU A N     1 
ATOM   3200  C CA    . GLU A  1 431 ? 94.587  131.999 -96.225  1.00 21.69  ? 431  GLU A CA    1 
ATOM   3201  C C     . GLU A  1 431 ? 94.901  133.096 -95.178  1.00 20.86  ? 431  GLU A C     1 
ATOM   3202  O O     . GLU A  1 431 ? 95.615  132.864 -94.180  1.00 23.25  ? 431  GLU A O     1 
ATOM   3203  C CB    . GLU A  1 431 ? 95.559  132.064 -97.418  1.00 20.82  ? 431  GLU A CB    1 
ATOM   3204  C CG    . GLU A  1 431 ? 96.803  132.817 -97.136  1.00 25.51  ? 431  GLU A CG    1 
ATOM   3205  C CD    . GLU A  1 431 ? 97.952  132.584 -98.124  1.00 27.92  ? 431  GLU A CD    1 
ATOM   3206  O OE1   . GLU A  1 431 ? 97.755  132.475 -99.353  1.00 28.72  ? 431  GLU A OE1   1 
ATOM   3207  O OE2   . GLU A  1 431 ? 99.095  132.547 -97.641  1.00 28.74  ? 431  GLU A OE2   1 
ATOM   3208  N N     . ALA A  1 432 ? 94.334  134.282 -95.404  1.00 19.78  ? 432  ALA A N     1 
ATOM   3209  C CA    . ALA A  1 432 ? 94.548  135.413 -94.518  1.00 19.70  ? 432  ALA A CA    1 
ATOM   3210  C C     . ALA A  1 432 ? 93.902  135.116 -93.185  1.00 20.75  ? 432  ALA A C     1 
ATOM   3211  O O     . ALA A  1 432 ? 94.461  135.421 -92.139  1.00 20.32  ? 432  ALA A O     1 
ATOM   3212  C CB    . ALA A  1 432 ? 93.950  136.704 -95.133  1.00 18.06  ? 432  ALA A CB    1 
ATOM   3213  N N     . ALA A  1 433 ? 92.698  134.526 -93.224  1.00 21.24  ? 433  ALA A N     1 
ATOM   3214  C CA    . ALA A  1 433 ? 92.001  134.174 -91.988  1.00 21.91  ? 433  ALA A CA    1 
ATOM   3215  C C     . ALA A  1 433 ? 92.813  133.139 -91.195  1.00 21.52  ? 433  ALA A C     1 
ATOM   3216  O O     . ALA A  1 433 ? 92.883  133.207 -89.965  1.00 21.10  ? 433  ALA A O     1 
ATOM   3217  C CB    . ALA A  1 433 ? 90.594  133.621 -92.287  1.00 19.74  ? 433  ALA A CB    1 
ATOM   3218  N N     . LEU A  1 434 ? 93.418  132.185 -91.890  1.00 22.77  ? 434  LEU A N     1 
ATOM   3219  C CA    . LEU A  1 434 ? 94.226  131.176 -91.210  1.00 22.63  ? 434  LEU A CA    1 
ATOM   3220  C C     . LEU A  1 434 ? 95.380  131.933 -90.565  1.00 24.35  ? 434  LEU A C     1 
ATOM   3221  O O     . LEU A  1 434 ? 95.735  131.678 -89.405  1.00 23.16  ? 434  LEU A O     1 
ATOM   3222  C CB    . LEU A  1 434 ? 94.780  130.154 -92.208  1.00 21.45  ? 434  LEU A CB    1 
ATOM   3223  C CG    . LEU A  1 434 ? 95.827  129.179 -91.668  1.00 21.69  ? 434  LEU A CG    1 
ATOM   3224  C CD1   . LEU A  1 434 ? 95.276  128.491 -90.401  1.00 22.85  ? 434  LEU A CD1   1 
ATOM   3225  C CD2   . LEU A  1 434 ? 96.155  128.105 -92.723  1.00 21.66  ? 434  LEU A CD2   1 
ATOM   3226  N N     . ALA A  1 435 ? 95.952  132.884 -91.302  1.00 22.91  ? 435  ALA A N     1 
ATOM   3227  C CA    . ALA A  1 435 ? 97.061  133.652 -90.741  1.00 24.83  ? 435  ALA A CA    1 
ATOM   3228  C C     . ALA A  1 435 ? 96.672  134.393 -89.431  1.00 26.32  ? 435  ALA A C     1 
ATOM   3229  O O     . ALA A  1 435 ? 97.378  134.303 -88.393  1.00 24.08  ? 435  ALA A O     1 
ATOM   3230  C CB    . ALA A  1 435 ? 97.602  134.642 -91.801  1.00 25.97  ? 435  ALA A CB    1 
ATOM   3231  N N     . LEU A  1 436 ? 95.539  135.096 -89.469  1.00 26.53  ? 436  LEU A N     1 
ATOM   3232  C CA    . LEU A  1 436 ? 95.077  135.819 -88.288  1.00 25.94  ? 436  LEU A CA    1 
ATOM   3233  C C     . LEU A  1 436 ? 94.833  134.888 -87.100  1.00 26.07  ? 436  LEU A C     1 
ATOM   3234  O O     . LEU A  1 436 ? 95.173  135.246 -85.966  1.00 23.93  ? 436  LEU A O     1 
ATOM   3235  C CB    . LEU A  1 436 ? 93.798  136.619 -88.575  1.00 27.80  ? 436  LEU A CB    1 
ATOM   3236  C CG    . LEU A  1 436 ? 93.908  137.975 -89.294  1.00 29.62  ? 436  LEU A CG    1 
ATOM   3237  C CD1   . LEU A  1 436 ? 92.520  138.612 -89.326  1.00 31.17  ? 436  LEU A CD1   1 
ATOM   3238  C CD2   . LEU A  1 436 ? 94.870  138.909 -88.571  1.00 30.60  ? 436  LEU A CD2   1 
ATOM   3239  N N     . GLU A  1 437 ? 94.241  133.713 -87.340  1.00 23.59  ? 437  GLU A N     1 
ATOM   3240  C CA    . GLU A  1 437 ? 93.971  132.766 -86.245  1.00 23.74  ? 437  GLU A CA    1 
ATOM   3241  C C     . GLU A  1 437 ? 95.248  132.366 -85.512  1.00 22.42  ? 437  GLU A C     1 
ATOM   3242  O O     . GLU A  1 437 ? 95.260  132.207 -84.292  1.00 22.01  ? 437  GLU A O     1 
ATOM   3243  C CB    . GLU A  1 437 ? 93.294  131.500 -86.781  1.00 26.85  ? 437  GLU A CB    1 
ATOM   3244  C CG    . GLU A  1 437 ? 93.357  130.281 -85.817  1.00 29.34  ? 437  GLU A CG    1 
ATOM   3245  C CD    . GLU A  1 437 ? 92.500  130.484 -84.579  1.00 32.81  ? 437  GLU A CD    1 
ATOM   3246  O OE1   . GLU A  1 437 ? 91.558  131.316 -84.667  1.00 38.69  ? 437  GLU A OE1   1 
ATOM   3247  O OE2   . GLU A  1 437 ? 92.749  129.826 -83.537  1.00 29.27  ? 437  GLU A OE2   1 
ATOM   3248  N N     . TYR A  1 438 ? 96.314  132.202 -86.272  1.00 21.50  ? 438  TYR A N     1 
ATOM   3249  C CA    . TYR A  1 438 ? 97.588  131.824 -85.714  1.00 21.44  ? 438  TYR A CA    1 
ATOM   3250  C C     . TYR A  1 438 ? 98.380  132.995 -85.139  1.00 22.94  ? 438  TYR A C     1 
ATOM   3251  O O     . TYR A  1 438 ? 99.425  132.800 -84.488  1.00 22.40  ? 438  TYR A O     1 
ATOM   3252  C CB    . TYR A  1 438 ? 98.420  131.088 -86.777  1.00 23.04  ? 438  TYR A CB    1 
ATOM   3253  C CG    . TYR A  1 438 ? 98.528  129.608 -86.456  1.00 21.49  ? 438  TYR A CG    1 
ATOM   3254  C CD1   . TYR A  1 438 ? 97.481  128.741 -86.736  1.00 22.12  ? 438  TYR A CD1   1 
ATOM   3255  C CD2   . TYR A  1 438 ? 99.642  129.104 -85.794  1.00 20.74  ? 438  TYR A CD2   1 
ATOM   3256  C CE1   . TYR A  1 438 ? 97.538  127.406 -86.364  1.00 20.32  ? 438  TYR A CE1   1 
ATOM   3257  C CE2   . TYR A  1 438 ? 99.711  127.778 -85.408  1.00 20.70  ? 438  TYR A CE2   1 
ATOM   3258  C CZ    . TYR A  1 438 ? 98.651  126.930 -85.701  1.00 21.30  ? 438  TYR A CZ    1 
ATOM   3259  O OH    . TYR A  1 438 ? 98.720  125.612 -85.327  1.00 19.30  ? 438  TYR A OH    1 
ATOM   3260  N N     . GLY A  1 439 ? 97.883  134.212 -85.358  1.00 22.00  ? 439  GLY A N     1 
ATOM   3261  C CA    . GLY A  1 439 ? 98.608  135.370 -84.868  1.00 22.92  ? 439  GLY A CA    1 
ATOM   3262  C C     . GLY A  1 439 ? 99.890  135.537 -85.669  1.00 23.35  ? 439  GLY A C     1 
ATOM   3263  O O     . GLY A  1 439 ? 100.950 135.887 -85.139  1.00 24.64  ? 439  GLY A O     1 
ATOM   3264  N N     . ALA A  1 440 ? 99.805  135.300 -86.970  1.00 24.45  ? 440  ALA A N     1 
ATOM   3265  C CA    . ALA A  1 440 ? 100.967 135.438 -87.830  1.00 24.76  ? 440  ALA A CA    1 
ATOM   3266  C C     . ALA A  1 440 ? 101.543 136.845 -87.880  1.00 26.15  ? 440  ALA A C     1 
ATOM   3267  O O     . ALA A  1 440 ? 100.859 137.827 -87.610  1.00 24.26  ? 440  ALA A O     1 
ATOM   3268  C CB    . ALA A  1 440 ? 100.620 135.001 -89.254  1.00 26.73  ? 440  ALA A CB    1 
ATOM   3269  N N     . SER A  1 441 ? 102.828 136.917 -88.212  1.00 26.41  ? 441  SER A N     1 
ATOM   3270  C CA    . SER A  1 441 ? 103.498 138.190 -88.396  1.00 27.47  ? 441  SER A CA    1 
ATOM   3271  C C     . SER A  1 441 ? 103.551 138.338 -89.928  1.00 29.52  ? 441  SER A C     1 
ATOM   3272  O O     . SER A  1 441 ? 103.432 137.348 -90.660  1.00 28.38  ? 441  SER A O     1 
ATOM   3273  C CB    . SER A  1 441 ? 104.926 138.128 -87.842  1.00 26.90  ? 441  SER A CB    1 
ATOM   3274  O OG    . SER A  1 441 ? 105.738 137.225 -88.571  1.00 29.05  ? 441  SER A OG    1 
ATOM   3275  N N     . CYS A  1 442 ? 103.715 139.565 -90.412  1.00 31.66  ? 442  CYS A N     1 
ATOM   3276  C CA    . CYS A  1 442 ? 103.819 139.809 -91.850  1.00 32.87  ? 442  CYS A CA    1 
ATOM   3277  C C     . CYS A  1 442 ? 104.989 139.008 -92.408  1.00 33.49  ? 442  CYS A C     1 
ATOM   3278  O O     . CYS A  1 442 ? 104.935 138.479 -93.533  1.00 33.70  ? 442  CYS A O     1 
ATOM   3279  C CB    . CYS A  1 442 ? 104.035 141.305 -92.112  1.00 33.43  ? 442  CYS A CB    1 
ATOM   3280  S SG    . CYS A  1 442 ? 102.622 142.291 -91.516  1.00 35.50  ? 442  CYS A SG    1 
ATOM   3281  N N     . GLU A  1 443 ? 106.046 138.924 -91.606  1.00 34.37  ? 443  GLU A N     1 
ATOM   3282  C CA    . GLU A  1 443 ? 107.241 138.193 -91.995  1.00 35.09  ? 443  GLU A CA    1 
ATOM   3283  C C     . GLU A  1 443 ? 106.962 136.705 -92.169  1.00 32.03  ? 443  GLU A C     1 
ATOM   3284  O O     . GLU A  1 443 ? 107.448 136.096 -93.112  1.00 32.39  ? 443  GLU A O     1 
ATOM   3285  C CB    . GLU A  1 443 ? 108.355 138.378 -90.959  1.00 36.14  ? 443  GLU A CB    1 
ATOM   3286  C CG    . GLU A  1 443 ? 109.686 137.784 -91.407  1.00 39.41  ? 443  GLU A CG    1 
ATOM   3287  C CD    . GLU A  1 443 ? 110.776 137.905 -90.349  1.00 41.17  ? 443  GLU A CD    1 
ATOM   3288  O OE1   . GLU A  1 443 ? 110.662 138.769 -89.458  1.00 43.03  ? 443  GLU A OE1   1 
ATOM   3289  O OE2   . GLU A  1 443 ? 111.758 137.139 -90.417  1.00 41.81  ? 443  GLU A OE2   1 
ATOM   3290  N N     . ASP A  1 444 ? 106.210 136.116 -91.243  1.00 33.18  ? 444  ASP A N     1 
ATOM   3291  C CA    . ASP A  1 444 ? 105.868 134.693 -91.331  1.00 32.74  ? 444  ASP A CA    1 
ATOM   3292  C C     . ASP A  1 444 ? 105.236 134.409 -92.703  1.00 33.55  ? 444  ASP A C     1 
ATOM   3293  O O     . ASP A  1 444 ? 105.515 133.396 -93.358  1.00 34.06  ? 444  ASP A O     1 
ATOM   3294  C CB    . ASP A  1 444 ? 104.805 134.311 -90.305  1.00 35.28  ? 444  ASP A CB    1 
ATOM   3295  C CG    . ASP A  1 444 ? 105.316 134.261 -88.869  1.00 37.07  ? 444  ASP A CG    1 
ATOM   3296  O OD1   . ASP A  1 444 ? 106.545 134.185 -88.632  1.00 38.07  ? 444  ASP A OD1   1 
ATOM   3297  O OD2   . ASP A  1 444 ? 104.443 134.270 -87.966  1.00 35.74  ? 444  ASP A OD2   1 
ATOM   3298  N N     . ILE A  1 445 ? 104.338 135.291 -93.114  1.00 31.42  ? 445  ILE A N     1 
ATOM   3299  C CA    . ILE A  1 445 ? 103.653 135.100 -94.380  1.00 31.07  ? 445  ILE A CA    1 
ATOM   3300  C C     . ILE A  1 445 ? 104.580 135.248 -95.573  1.00 30.72  ? 445  ILE A C     1 
ATOM   3301  O O     . ILE A  1 445 ? 104.627 134.379 -96.446  1.00 28.10  ? 445  ILE A O     1 
ATOM   3302  C CB    . ILE A  1 445 ? 102.449 136.074 -94.488  1.00 29.92  ? 445  ILE A CB    1 
ATOM   3303  C CG1   . ILE A  1 445 ? 101.413 135.692 -93.412  1.00 27.87  ? 445  ILE A CG1   1 
ATOM   3304  C CG2   . ILE A  1 445 ? 101.811 135.993 -95.870  1.00 29.60  ? 445  ILE A CG2   1 
ATOM   3305  C CD1   . ILE A  1 445 ? 100.348 136.699 -93.205  1.00 26.58  ? 445  ILE A CD1   1 
ATOM   3306  N N     . ALA A  1 446 ? 105.325 136.349 -95.606  1.00 30.74  ? 446  ALA A N     1 
ATOM   3307  C CA    . ALA A  1 446 ? 106.245 136.594 -96.716  1.00 30.25  ? 446  ALA A CA    1 
ATOM   3308  C C     . ALA A  1 446 ? 107.258 135.429 -96.882  1.00 30.87  ? 446  ALA A C     1 
ATOM   3309  O O     . ALA A  1 446 ? 107.743 135.165 -97.987  1.00 29.52  ? 446  ALA A O     1 
ATOM   3310  C CB    . ALA A  1 446 ? 106.987 137.921 -96.487  1.00 28.35  ? 446  ALA A CB    1 
ATOM   3311  N N     . ARG A  1 447 ? 107.553 134.721 -95.793  1.00 30.80  ? 447  ARG A N     1 
ATOM   3312  C CA    . ARG A  1 447 ? 108.510 133.623 -95.864  1.00 32.85  ? 447  ARG A CA    1 
ATOM   3313  C C     . ARG A  1 447 ? 107.944 132.255 -96.255  1.00 33.26  ? 447  ARG A C     1 
ATOM   3314  O O     . ARG A  1 447 ? 108.708 131.330 -96.493  1.00 32.39  ? 447  ARG A O     1 
ATOM   3315  C CB    . ARG A  1 447 ? 109.295 133.499 -94.548  1.00 33.81  ? 447  ARG A CB    1 
ATOM   3316  C CG    . ARG A  1 447 ? 110.233 134.675 -94.301  1.00 35.59  ? 447  ARG A CG    1 
ATOM   3317  C CD    . ARG A  1 447 ? 111.192 134.436 -93.133  1.00 37.94  ? 447  ARG A CD    1 
ATOM   3318  N NE    . ARG A  1 447 ? 112.094 135.579 -92.971  1.00 38.66  ? 447  ARG A NE    1 
ATOM   3319  C CZ    . ARG A  1 447 ? 113.005 135.957 -93.866  1.00 39.96  ? 447  ARG A CZ    1 
ATOM   3320  N NH1   . ARG A  1 447 ? 113.163 135.273 -95.002  1.00 40.07  ? 447  ARG A NH1   1 
ATOM   3321  N NH2   . ARG A  1 447 ? 113.741 137.042 -93.639  1.00 39.65  ? 447  ARG A NH2   1 
ATOM   3322  N N     . VAL A  1 448 ? 106.625 132.092 -96.301  1.00 33.64  ? 448  VAL A N     1 
ATOM   3323  C CA    . VAL A  1 448 ? 106.125 130.786 -96.727  1.00 33.94  ? 448  VAL A CA    1 
ATOM   3324  C C     . VAL A  1 448 ? 106.194 130.754 -98.261  1.00 32.65  ? 448  VAL A C     1 
ATOM   3325  O O     . VAL A  1 448 ? 105.922 131.745 -98.950  1.00 29.15  ? 448  VAL A O     1 
ATOM   3326  C CB    . VAL A  1 448 ? 104.667 130.493 -96.250  1.00 36.49  ? 448  VAL A CB    1 
ATOM   3327  C CG1   . VAL A  1 448 ? 104.587 130.484 -94.722  1.00 37.26  ? 448  VAL A CG1   1 
ATOM   3328  C CG2   . VAL A  1 448 ? 103.742 131.511 -96.779  1.00 40.52  ? 448  VAL A CG2   1 
ATOM   3329  N N     . CYS A  1 449 ? 106.611 129.614 -98.788  1.00 31.99  ? 449  CYS A N     1 
ATOM   3330  C CA    . CYS A  1 449 ? 106.726 129.450 -100.220 1.00 33.25  ? 449  CYS A CA    1 
ATOM   3331  C C     . CYS A  1 449 ? 105.350 129.332 -100.876 1.00 33.25  ? 449  CYS A C     1 
ATOM   3332  O O     . CYS A  1 449 ? 104.651 128.316 -100.693 1.00 32.65  ? 449  CYS A O     1 
ATOM   3333  C CB    . CYS A  1 449 ? 107.551 128.188 -100.540 1.00 34.58  ? 449  CYS A CB    1 
ATOM   3334  S SG    . CYS A  1 449 ? 107.930 128.029 -102.300 1.00 38.56  ? 449  CYS A SG    1 
ATOM   3335  N N     . HIS A  1 450 ? 104.967 130.367 -101.628 1.00 30.81  ? 450  HIS A N     1 
ATOM   3336  C CA    . HIS A  1 450 ? 103.705 130.372 -102.353 1.00 30.41  ? 450  HIS A CA    1 
ATOM   3337  C C     . HIS A  1 450 ? 104.020 129.928 -103.790 1.00 30.74  ? 450  HIS A C     1 
ATOM   3338  O O     . HIS A  1 450 ? 105.041 130.303 -104.349 1.00 29.67  ? 450  HIS A O     1 
ATOM   3339  C CB    . HIS A  1 450 ? 103.087 131.775 -102.403 1.00 30.69  ? 450  HIS A CB    1 
ATOM   3340  C CG    . HIS A  1 450 ? 102.399 132.199 -101.139 1.00 31.85  ? 450  HIS A CG    1 
ATOM   3341  N ND1   . HIS A  1 450 ? 103.073 132.425 -99.953  1.00 30.47  ? 450  HIS A ND1   1 
ATOM   3342  C CD2   . HIS A  1 450 ? 101.104 132.530 -100.904 1.00 31.20  ? 450  HIS A CD2   1 
ATOM   3343  C CE1   . HIS A  1 450 ? 102.224 132.886 -99.050  1.00 31.04  ? 450  HIS A CE1   1 
ATOM   3344  N NE2   . HIS A  1 450 ? 101.025 132.961 -99.600  1.00 31.17  ? 450  HIS A NE2   1 
ATOM   3345  N N     . ALA A  1 451 ? 103.128 129.139 -104.378 1.00 29.17  ? 451  ALA A N     1 
ATOM   3346  C CA    . ALA A  1 451 ? 103.311 128.646 -105.731 1.00 30.21  ? 451  ALA A CA    1 
ATOM   3347  C C     . ALA A  1 451 ? 103.332 129.776 -106.751 1.00 30.40  ? 451  ALA A C     1 
ATOM   3348  O O     . ALA A  1 451 ? 102.578 130.758 -106.635 1.00 29.53  ? 451  ALA A O     1 
ATOM   3349  C CB    . ALA A  1 451 ? 102.192 127.640 -106.087 1.00 27.26  ? 451  ALA A CB    1 
ATOM   3350  N N     . HIS A  1 452 ? 104.205 129.620 -107.748 1.00 30.71  ? 452  HIS A N     1 
ATOM   3351  C CA    . HIS A  1 452 ? 104.329 130.585 -108.834 1.00 31.45  ? 452  HIS A CA    1 
ATOM   3352  C C     . HIS A  1 452 ? 103.837 129.908 -110.108 1.00 31.56  ? 452  HIS A C     1 
ATOM   3353  O O     . HIS A  1 452 ? 104.233 128.790 -110.412 1.00 33.95  ? 452  HIS A O     1 
ATOM   3354  C CB    . HIS A  1 452 ? 105.783 131.026 -109.036 1.00 31.39  ? 452  HIS A CB    1 
ATOM   3355  C CG    . HIS A  1 452 ? 105.947 132.025 -110.143 1.00 32.80  ? 452  HIS A CG    1 
ATOM   3356  N ND1   . HIS A  1 452 ? 105.588 133.349 -110.008 1.00 34.10  ? 452  HIS A ND1   1 
ATOM   3357  C CD2   . HIS A  1 452 ? 106.308 131.866 -111.438 1.00 31.01  ? 452  HIS A CD2   1 
ATOM   3358  C CE1   . HIS A  1 452 ? 105.719 133.962 -111.173 1.00 32.84  ? 452  HIS A CE1   1 
ATOM   3359  N NE2   . HIS A  1 452 ? 106.154 133.084 -112.057 1.00 29.89  ? 452  HIS A NE2   1 
ATOM   3360  N N     . PRO A  1 453 ? 102.971 130.574 -110.881 1.00 32.62  ? 453  PRO A N     1 
ATOM   3361  C CA    . PRO A  1 453 ? 102.390 131.916 -110.691 1.00 31.24  ? 453  PRO A CA    1 
ATOM   3362  C C     . PRO A  1 453 ? 100.968 131.892 -110.127 1.00 32.10  ? 453  PRO A C     1 
ATOM   3363  O O     . PRO A  1 453 ? 100.072 131.332 -110.751 1.00 33.68  ? 453  PRO A O     1 
ATOM   3364  C CB    . PRO A  1 453 ? 102.408 132.485 -112.094 1.00 33.01  ? 453  PRO A CB    1 
ATOM   3365  C CG    . PRO A  1 453 ? 102.011 131.228 -112.927 1.00 32.90  ? 453  PRO A CG    1 
ATOM   3366  C CD    . PRO A  1 453 ? 102.755 130.077 -112.257 1.00 31.64  ? 453  PRO A CD    1 
ATOM   3367  N N     . THR A  1 454 ? 100.750 132.490 -108.960 1.00 30.18  ? 454  THR A N     1 
ATOM   3368  C CA    . THR A  1 454 ? 99.409  132.522 -108.397 1.00 29.57  ? 454  THR A CA    1 
ATOM   3369  C C     . THR A  1 454 ? 99.053  133.923 -107.924 1.00 28.65  ? 454  THR A C     1 
ATOM   3370  O O     . THR A  1 454 ? 99.933  134.754 -107.659 1.00 29.62  ? 454  THR A O     1 
ATOM   3371  C CB    . THR A  1 454 ? 99.230  131.517 -107.216 1.00 28.88  ? 454  THR A CB    1 
ATOM   3372  O OG1   . THR A  1 454 ? 100.144 131.834 -106.160 1.00 29.57  ? 454  THR A OG1   1 
ATOM   3373  C CG2   . THR A  1 454 ? 99.480  130.086 -107.691 1.00 27.84  ? 454  THR A CG2   1 
ATOM   3374  N N     . LEU A  1 455 ? 97.757  134.181 -107.850 1.00 28.60  ? 455  LEU A N     1 
ATOM   3375  C CA    . LEU A  1 455 ? 97.253  135.462 -107.381 1.00 29.92  ? 455  LEU A CA    1 
ATOM   3376  C C     . LEU A  1 455 ? 97.665  135.638 -105.908 1.00 30.64  ? 455  LEU A C     1 
ATOM   3377  O O     . LEU A  1 455 ? 97.864  136.765 -105.439 1.00 32.47  ? 455  LEU A O     1 
ATOM   3378  C CB    . LEU A  1 455 ? 95.718  135.524 -107.533 1.00 27.63  ? 455  LEU A CB    1 
ATOM   3379  C CG    . LEU A  1 455 ? 95.089  135.520 -108.951 1.00 29.19  ? 455  LEU A CG    1 
ATOM   3380  C CD1   . LEU A  1 455 ? 93.590  135.199 -108.849 1.00 25.22  ? 455  LEU A CD1   1 
ATOM   3381  C CD2   . LEU A  1 455 ? 95.307  136.886 -109.659 1.00 25.34  ? 455  LEU A CD2   1 
ATOM   3382  N N     . SER A  1 456 ? 97.811  134.522 -105.201 1.00 31.18  ? 456  SER A N     1 
ATOM   3383  C CA    . SER A  1 456 ? 98.178  134.527 -103.780 1.00 32.16  ? 456  SER A CA    1 
ATOM   3384  C C     . SER A  1 456 ? 99.547  135.170 -103.537 1.00 32.65  ? 456  SER A C     1 
ATOM   3385  O O     . SER A  1 456 ? 99.816  135.677 -102.440 1.00 32.53  ? 456  SER A O     1 
ATOM   3386  C CB    . SER A  1 456 ? 98.188  133.100 -103.220 1.00 30.12  ? 456  SER A CB    1 
ATOM   3387  O OG    . SER A  1 456 ? 99.401  132.448 -103.596 1.00 31.51  ? 456  SER A OG    1 
ATOM   3388  N N     . GLU A  1 457 ? 100.418 135.137 -104.546 1.00 33.36  ? 457  GLU A N     1 
ATOM   3389  C CA    . GLU A  1 457 ? 101.744 135.749 -104.418 1.00 32.54  ? 457  GLU A CA    1 
ATOM   3390  C C     . GLU A  1 457 ? 101.632 137.238 -104.108 1.00 32.53  ? 457  GLU A C     1 
ATOM   3391  O O     . GLU A  1 457 ? 102.558 137.823 -103.534 1.00 33.03  ? 457  GLU A O     1 
ATOM   3392  C CB    . GLU A  1 457 ? 102.554 135.560 -105.701 1.00 33.48  ? 457  GLU A CB    1 
ATOM   3393  C CG    . GLU A  1 457 ? 102.864 134.102 -106.008 1.00 33.77  ? 457  GLU A CG    1 
ATOM   3394  C CD    . GLU A  1 457 ? 103.689 133.943 -107.266 1.00 35.90  ? 457  GLU A CD    1 
ATOM   3395  O OE1   . GLU A  1 457 ? 104.935 134.104 -107.206 1.00 37.18  ? 457  GLU A OE1   1 
ATOM   3396  O OE2   . GLU A  1 457 ? 103.077 133.669 -108.322 1.00 35.61  ? 457  GLU A OE2   1 
ATOM   3397  N N     . ALA A  1 458 ? 100.510 137.845 -104.507 1.00 30.16  ? 458  ALA A N     1 
ATOM   3398  C CA    . ALA A  1 458 ? 100.275 139.253 -104.236 1.00 30.37  ? 458  ALA A CA    1 
ATOM   3399  C C     . ALA A  1 458 ? 100.102 139.380 -102.729 1.00 30.63  ? 458  ALA A C     1 
ATOM   3400  O O     . ALA A  1 458 ? 100.603 140.332 -102.124 1.00 31.88  ? 458  ALA A O     1 
ATOM   3401  C CB    . ALA A  1 458 ? 99.035  139.758 -104.969 1.00 28.38  ? 458  ALA A CB    1 
ATOM   3402  N N     . PHE A  1 459 ? 99.420  138.408 -102.121 1.00 30.17  ? 459  PHE A N     1 
ATOM   3403  C CA    . PHE A  1 459 ? 99.210  138.413 -100.665 1.00 30.09  ? 459  PHE A CA    1 
ATOM   3404  C C     . PHE A  1 459 ? 100.569 138.354 -99.947  1.00 29.22  ? 459  PHE A C     1 
ATOM   3405  O O     . PHE A  1 459 ? 100.831 139.094 -98.981  1.00 27.03  ? 459  PHE A O     1 
ATOM   3406  C CB    . PHE A  1 459 ? 98.351  137.211 -100.242 1.00 30.57  ? 459  PHE A CB    1 
ATOM   3407  C CG    . PHE A  1 459 ? 98.041  137.167 -98.762  1.00 29.48  ? 459  PHE A CG    1 
ATOM   3408  C CD1   . PHE A  1 459 ? 97.232  138.139 -98.173  1.00 28.97  ? 459  PHE A CD1   1 
ATOM   3409  C CD2   . PHE A  1 459 ? 98.575  136.167 -97.958  1.00 29.22  ? 459  PHE A CD2   1 
ATOM   3410  C CE1   . PHE A  1 459 ? 96.962  138.115 -96.797  1.00 27.85  ? 459  PHE A CE1   1 
ATOM   3411  C CE2   . PHE A  1 459 ? 98.310  136.135 -96.579  1.00 28.48  ? 459  PHE A CE2   1 
ATOM   3412  C CZ    . PHE A  1 459 ? 97.506  137.111 -96.004  1.00 28.44  ? 459  PHE A CZ    1 
ATOM   3413  N N     . ARG A  1 460 ? 101.413 137.453 -100.438 1.00 29.28  ? 460  ARG A N     1 
ATOM   3414  C CA    . ARG A  1 460 ? 102.753 137.230 -99.916  1.00 30.85  ? 460  ARG A CA    1 
ATOM   3415  C C     . ARG A  1 460 ? 103.587 138.514 -100.021 1.00 31.89  ? 460  ARG A C     1 
ATOM   3416  O O     . ARG A  1 460 ? 104.126 138.978 -99.029  1.00 31.73  ? 460  ARG A O     1 
ATOM   3417  C CB    . ARG A  1 460 ? 103.413 136.102 -100.710 1.00 30.68  ? 460  ARG A CB    1 
ATOM   3418  C CG    . ARG A  1 460 ? 104.736 135.657 -100.163 1.00 30.81  ? 460  ARG A CG    1 
ATOM   3419  C CD    . ARG A  1 460 ? 105.471 134.769 -101.128 1.00 33.16  ? 460  ARG A CD    1 
ATOM   3420  N NE    . ARG A  1 460 ? 106.685 134.252 -100.502 1.00 35.04  ? 460  ARG A NE    1 
ATOM   3421  C CZ    . ARG A  1 460 ? 107.459 133.293 -101.012 1.00 35.55  ? 460  ARG A CZ    1 
ATOM   3422  N NH1   . ARG A  1 460 ? 107.156 132.720 -102.185 1.00 36.43  ? 460  ARG A NH1   1 
ATOM   3423  N NH2   . ARG A  1 460 ? 108.529 132.899 -100.334 1.00 32.65  ? 460  ARG A NH2   1 
ATOM   3424  N N     . GLU A  1 461 ? 103.669 139.070 -101.231 1.00 32.83  ? 461  GLU A N     1 
ATOM   3425  C CA    . GLU A  1 461 ? 104.418 140.307 -101.514 1.00 33.62  ? 461  GLU A CA    1 
ATOM   3426  C C     . GLU A  1 461 ? 103.980 141.488 -100.649 1.00 31.96  ? 461  GLU A C     1 
ATOM   3427  O O     . GLU A  1 461 ? 104.824 142.248 -100.191 1.00 32.42  ? 461  GLU A O     1 
ATOM   3428  C CB    . GLU A  1 461 ? 104.263 140.709 -102.999 1.00 35.27  ? 461  GLU A CB    1 
ATOM   3429  C CG    . GLU A  1 461 ? 105.021 139.848 -104.019 1.00 37.65  ? 461  GLU A CG    1 
ATOM   3430  C CD    . GLU A  1 461 ? 106.453 140.330 -104.291 1.00 40.63  ? 461  GLU A CD    1 
ATOM   3431  O OE1   . GLU A  1 461 ? 107.288 140.345 -103.359 1.00 43.43  ? 461  GLU A OE1   1 
ATOM   3432  O OE2   . GLU A  1 461 ? 106.754 140.695 -105.444 1.00 40.03  ? 461  GLU A OE2   1 
ATOM   3433  N N     . ALA A  1 462 ? 102.671 141.662 -100.457 1.00 31.50  ? 462  ALA A N     1 
ATOM   3434  C CA    . ALA A  1 462 ? 102.154 142.757 -99.639  1.00 29.30  ? 462  ALA A CA    1 
ATOM   3435  C C     . ALA A  1 462 ? 102.571 142.591 -98.179  1.00 30.75  ? 462  ALA A C     1 
ATOM   3436  O O     . ALA A  1 462 ? 102.770 143.578 -97.461  1.00 29.72  ? 462  ALA A O     1 
ATOM   3437  C CB    . ALA A  1 462 ? 100.644 142.843 -99.747  1.00 30.27  ? 462  ALA A CB    1 
ATOM   3438  N N     . ASN A  1 463 ? 102.686 141.348 -97.720  1.00 30.25  ? 463  ASN A N     1 
ATOM   3439  C CA    . ASN A  1 463 ? 103.146 141.126 -96.349  1.00 31.36  ? 463  ASN A CA    1 
ATOM   3440  C C     . ASN A  1 463 ? 104.643 141.438 -96.292  1.00 31.99  ? 463  ASN A C     1 
ATOM   3441  O O     . ASN A  1 463 ? 105.145 141.994 -95.313  1.00 32.26  ? 463  ASN A O     1 
ATOM   3442  C CB    . ASN A  1 463 ? 102.879 139.684 -95.920  1.00 29.34  ? 463  ASN A CB    1 
ATOM   3443  C CG    . ASN A  1 463 ? 101.496 139.514 -95.336  1.00 30.06  ? 463  ASN A CG    1 
ATOM   3444  O OD1   . ASN A  1 463 ? 101.242 139.898 -94.190  1.00 29.45  ? 463  ASN A OD1   1 
ATOM   3445  N ND2   . ASN A  1 463 ? 100.580 138.957 -96.131  1.00 29.29  ? 463  ASN A ND2   1 
ATOM   3446  N N     . LEU A  1 464 ? 105.351 141.062 -97.358  1.00 32.65  ? 464  LEU A N     1 
ATOM   3447  C CA    . LEU A  1 464 ? 106.768 141.329 -97.454  1.00 32.76  ? 464  LEU A CA    1 
ATOM   3448  C C     . LEU A  1 464 ? 106.973 142.841 -97.416  1.00 33.49  ? 464  LEU A C     1 
ATOM   3449  O O     . LEU A  1 464 ? 107.889 143.327 -96.756  1.00 33.49  ? 464  LEU A O     1 
ATOM   3450  C CB    . LEU A  1 464 ? 107.342 140.778 -98.761  1.00 33.41  ? 464  LEU A CB    1 
ATOM   3451  C CG    . LEU A  1 464 ? 108.859 140.970 -98.906  1.00 33.63  ? 464  LEU A CG    1 
ATOM   3452  C CD1   . LEU A  1 464 ? 109.593 140.361 -97.708  1.00 33.57  ? 464  LEU A CD1   1 
ATOM   3453  C CD2   . LEU A  1 464 ? 109.331 140.316 -100.172 1.00 33.71  ? 464  LEU A CD2   1 
ATOM   3454  N N     . ALA A  1 465 ? 106.125 143.581 -98.124  1.00 33.13  ? 465  ALA A N     1 
ATOM   3455  C CA    . ALA A  1 465 ? 106.250 145.032 -98.134  1.00 35.28  ? 465  ALA A CA    1 
ATOM   3456  C C     . ALA A  1 465 ? 106.015 145.609 -96.739  1.00 36.13  ? 465  ALA A C     1 
ATOM   3457  O O     . ALA A  1 465 ? 106.772 146.465 -96.311  1.00 36.94  ? 465  ALA A O     1 
ATOM   3458  C CB    . ALA A  1 465 ? 105.285 145.655 -99.147  1.00 35.23  ? 465  ALA A CB    1 
ATOM   3459  N N     . ALA A  1 466 ? 104.987 145.135 -96.035  1.00 37.65  ? 466  ALA A N     1 
ATOM   3460  C CA    . ALA A  1 466 ? 104.682 145.615 -94.680  1.00 39.31  ? 466  ALA A CA    1 
ATOM   3461  C C     . ALA A  1 466 ? 105.798 145.249 -93.702  1.00 39.95  ? 466  ALA A C     1 
ATOM   3462  O O     . ALA A  1 466 ? 106.164 146.041 -92.840  1.00 41.71  ? 466  ALA A O     1 
ATOM   3463  C CB    . ALA A  1 466 ? 103.363 145.027 -94.190  1.00 37.66  ? 466  ALA A CB    1 
ATOM   3464  N N     . SER A  1 467 ? 106.330 144.042 -93.844  1.00 40.70  ? 467  SER A N     1 
ATOM   3465  C CA    . SER A  1 467 ? 107.400 143.546 -92.979  1.00 41.10  ? 467  SER A CA    1 
ATOM   3466  C C     . SER A  1 467 ? 108.788 144.154 -93.246  1.00 42.44  ? 467  SER A C     1 
ATOM   3467  O O     . SER A  1 467 ? 109.378 144.779 -92.367  1.00 42.63  ? 467  SER A O     1 
ATOM   3468  C CB    . SER A  1 467 ? 107.499 142.027 -93.107  1.00 40.88  ? 467  SER A CB    1 
ATOM   3469  O OG    . SER A  1 467 ? 108.518 141.527 -92.268  1.00 42.11  ? 467  SER A OG    1 
ATOM   3470  N N     . PHE A  1 468 ? 109.298 143.959 -94.461  1.00 42.63  ? 468  PHE A N     1 
ATOM   3471  C CA    . PHE A  1 468 ? 110.620 144.445 -94.860  1.00 43.97  ? 468  PHE A CA    1 
ATOM   3472  C C     . PHE A  1 468 ? 110.677 145.900 -95.359  1.00 44.01  ? 468  PHE A C     1 
ATOM   3473  O O     . PHE A  1 468 ? 111.708 146.558 -95.242  1.00 44.18  ? 468  PHE A O     1 
ATOM   3474  C CB    . PHE A  1 468 ? 111.179 143.504 -95.933  1.00 45.21  ? 468  PHE A CB    1 
ATOM   3475  C CG    . PHE A  1 468 ? 112.526 143.903 -96.466  1.00 45.96  ? 468  PHE A CG    1 
ATOM   3476  C CD1   . PHE A  1 468 ? 113.683 143.690 -95.717  1.00 45.84  ? 468  PHE A CD1   1 
ATOM   3477  C CD2   . PHE A  1 468 ? 112.639 144.456 -97.744  1.00 46.03  ? 468  PHE A CD2   1 
ATOM   3478  C CE1   . PHE A  1 468 ? 114.942 144.021 -96.238  1.00 47.01  ? 468  PHE A CE1   1 
ATOM   3479  C CE2   . PHE A  1 468 ? 113.884 144.790 -98.273  1.00 46.37  ? 468  PHE A CE2   1 
ATOM   3480  C CZ    . PHE A  1 468 ? 115.040 144.572 -97.521  1.00 46.69  ? 468  PHE A CZ    1 
ATOM   3481  N N     . GLY A  1 469 ? 109.575 146.392 -95.920  1.00 43.29  ? 469  GLY A N     1 
ATOM   3482  C CA    . GLY A  1 469 ? 109.542 147.754 -96.418  1.00 42.35  ? 469  GLY A CA    1 
ATOM   3483  C C     . GLY A  1 469 ? 109.358 147.811 -97.929  1.00 42.94  ? 469  GLY A C     1 
ATOM   3484  O O     . GLY A  1 469 ? 108.817 148.795 -98.461  1.00 42.65  ? 469  GLY A O     1 
ATOM   3485  N N     . LYS A  1 470 ? 109.809 146.764 -98.622  1.00 41.77  ? 470  LYS A N     1 
ATOM   3486  C CA    . LYS A  1 470 ? 109.695 146.684 -100.084 1.00 42.61  ? 470  LYS A CA    1 
ATOM   3487  C C     . LYS A  1 470 ? 109.316 145.262 -100.499 1.00 41.62  ? 470  LYS A C     1 
ATOM   3488  O O     . LYS A  1 470 ? 109.775 144.303 -99.904  1.00 39.90  ? 470  LYS A O     1 
ATOM   3489  C CB    . LYS A  1 470 ? 111.035 147.002 -100.780 1.00 43.48  ? 470  LYS A CB    1 
ATOM   3490  C CG    . LYS A  1 470 ? 111.722 148.329 -100.451 1.00 46.21  ? 470  LYS A CG    1 
ATOM   3491  C CD    . LYS A  1 470 ? 113.138 148.325 -101.068 1.00 48.13  ? 470  LYS A CD    1 
ATOM   3492  C CE    . LYS A  1 470 ? 113.922 149.596 -100.776 1.00 49.08  ? 470  LYS A CE    1 
ATOM   3493  N NZ    . LYS A  1 470 ? 113.189 150.768 -101.300 1.00 51.27  ? 470  LYS A NZ    1 
ATOM   3494  N N     . SER A  1 471 ? 108.488 145.131 -101.528 1.00 42.70  ? 471  SER A N     1 
ATOM   3495  C CA    . SER A  1 471 ? 108.135 143.808 -102.032 1.00 43.78  ? 471  SER A CA    1 
ATOM   3496  C C     . SER A  1 471 ? 109.166 143.620 -103.146 1.00 44.81  ? 471  SER A C     1 
ATOM   3497  O O     . SER A  1 471 ? 109.904 144.567 -103.471 1.00 44.89  ? 471  SER A O     1 
ATOM   3498  C CB    . SER A  1 471 ? 106.703 143.784 -102.592 1.00 42.85  ? 471  SER A CB    1 
ATOM   3499  O OG    . SER A  1 471 ? 106.618 144.422 -103.851 1.00 42.16  ? 471  SER A OG    1 
ATOM   3500  N N     . ILE A  1 472 ? 109.241 142.427 -103.728 1.00 45.18  ? 472  ILE A N     1 
ATOM   3501  C CA    . ILE A  1 472 ? 110.223 142.174 -104.780 1.00 44.99  ? 472  ILE A CA    1 
ATOM   3502  C C     . ILE A  1 472 ? 109.813 142.644 -106.186 1.00 45.51  ? 472  ILE A C     1 
ATOM   3503  O O     . ILE A  1 472 ? 110.617 143.260 -106.893 1.00 45.75  ? 472  ILE A O     1 
ATOM   3504  C CB    . ILE A  1 472 ? 110.619 140.650 -104.835 1.00 44.90  ? 472  ILE A CB    1 
ATOM   3505  C CG1   . ILE A  1 472 ? 112.008 140.417 -104.228 1.00 43.83  ? 472  ILE A CG1   1 
ATOM   3506  C CG2   . ILE A  1 472 ? 110.666 140.170 -106.272 1.00 45.18  ? 472  ILE A CG2   1 
ATOM   3507  C CD1   . ILE A  1 472 ? 112.066 140.367 -102.739 1.00 46.91  ? 472  ILE A CD1   1 
ATOM   3508  N N     . ASN A  1 473 ? 108.565 142.387 -106.577 1.00 45.65  ? 473  ASN A N     1 
ATOM   3509  C CA    . ASN A  1 473 ? 108.090 142.730 -107.916 1.00 45.79  ? 473  ASN A CA    1 
ATOM   3510  C C     . ASN A  1 473 ? 107.389 144.065 -108.134 1.00 46.95  ? 473  ASN A C     1 
ATOM   3511  O O     . ASN A  1 473 ? 106.778 144.285 -109.183 1.00 46.17  ? 473  ASN A O     1 
ATOM   3512  C CB    . ASN A  1 473 ? 107.204 141.592 -108.446 1.00 45.27  ? 473  ASN A CB    1 
ATOM   3513  C CG    . ASN A  1 473 ? 107.999 140.320 -108.728 1.00 44.64  ? 473  ASN A CG    1 
ATOM   3514  O OD1   . ASN A  1 473 ? 108.646 140.186 -109.775 1.00 43.27  ? 473  ASN A OD1   1 
ATOM   3515  N ND2   . ASN A  1 473 ? 107.970 139.390 -107.781 1.00 41.95  ? 473  ASN A ND2   1 
ATOM   3516  N N     . PHE A  1 474 ? 107.463 144.952 -107.148 1.00 48.07  ? 474  PHE A N     1 
ATOM   3517  C CA    . PHE A  1 474 ? 106.879 146.284 -107.286 1.00 48.69  ? 474  PHE A CA    1 
ATOM   3518  C C     . PHE A  1 474 ? 107.683 147.267 -106.439 1.00 49.74  ? 474  PHE A C     1 
ATOM   3519  O O     . PHE A  1 474 ? 108.475 146.790 -105.594 1.00 50.40  ? 474  PHE A O     1 
ATOM   3520  C CB    . PHE A  1 474 ? 105.414 146.303 -106.848 1.00 47.05  ? 474  PHE A CB    1 
ATOM   3521  C CG    . PHE A  1 474 ? 104.716 147.609 -107.139 1.00 47.24  ? 474  PHE A CG    1 
ATOM   3522  C CD1   . PHE A  1 474 ? 104.549 148.044 -108.452 1.00 46.81  ? 474  PHE A CD1   1 
ATOM   3523  C CD2   . PHE A  1 474 ? 104.246 148.413 -106.105 1.00 46.87  ? 474  PHE A CD2   1 
ATOM   3524  C CE1   . PHE A  1 474 ? 103.925 149.258 -108.724 1.00 47.01  ? 474  PHE A CE1   1 
ATOM   3525  C CE2   . PHE A  1 474 ? 103.622 149.627 -106.367 1.00 45.89  ? 474  PHE A CE2   1 
ATOM   3526  C CZ    . PHE A  1 474 ? 103.460 150.051 -107.675 1.00 46.81  ? 474  PHE A CZ    1 
ATOM   3527  O OXT   . PHE A  1 474 ? 107.510 148.493 -106.623 1.00 50.93  ? 474  PHE A OXT   1 
ATOM   3528  N N     . PRO B  1 4   ? 135.640 147.616 -117.710 1.00 68.07  ? 4    PRO B N     1 
ATOM   3529  C CA    . PRO B  1 4   ? 135.745 146.809 -116.470 1.00 68.49  ? 4    PRO B CA    1 
ATOM   3530  C C     . PRO B  1 4   ? 135.018 147.460 -115.294 1.00 69.23  ? 4    PRO B C     1 
ATOM   3531  O O     . PRO B  1 4   ? 135.111 148.671 -115.095 1.00 69.12  ? 4    PRO B O     1 
ATOM   3532  C CB    . PRO B  1 4   ? 137.225 146.650 -116.181 1.00 67.66  ? 4    PRO B CB    1 
ATOM   3533  C CG    . PRO B  1 4   ? 137.784 146.674 -117.588 1.00 67.78  ? 4    PRO B CG    1 
ATOM   3534  C CD    . PRO B  1 4   ? 136.973 147.772 -118.313 1.00 67.87  ? 4    PRO B CD    1 
ATOM   3535  N N     . ILE B  1 5   ? 134.282 146.651 -114.528 1.00 70.10  ? 5    ILE B N     1 
ATOM   3536  C CA    . ILE B  1 5   ? 133.524 147.139 -113.368 1.00 69.84  ? 5    ILE B CA    1 
ATOM   3537  C C     . ILE B  1 5   ? 133.447 146.116 -112.242 1.00 69.13  ? 5    ILE B C     1 
ATOM   3538  O O     . ILE B  1 5   ? 133.726 144.934 -112.444 1.00 69.46  ? 5    ILE B O     1 
ATOM   3539  C CB    . ILE B  1 5   ? 132.079 147.575 -113.764 1.00 70.25  ? 5    ILE B CB    1 
ATOM   3540  C CG1   . ILE B  1 5   ? 131.431 146.544 -114.691 1.00 70.26  ? 5    ILE B CG1   1 
ATOM   3541  C CG2   . ILE B  1 5   ? 132.116 148.937 -114.426 1.00 70.74  ? 5    ILE B CG2   1 
ATOM   3542  C CD1   . ILE B  1 5   ? 130.947 145.302 -113.987 1.00 70.70  ? 5    ILE B CD1   1 
ATOM   3543  N N     . ASP B  1 6   ? 133.061 146.572 -111.054 1.00 68.46  ? 6    ASP B N     1 
ATOM   3544  C CA    . ASP B  1 6   ? 132.990 145.681 -109.901 1.00 68.05  ? 6    ASP B CA    1 
ATOM   3545  C C     . ASP B  1 6   ? 131.637 145.604 -109.194 1.00 66.43  ? 6    ASP B C     1 
ATOM   3546  O O     . ASP B  1 6   ? 130.710 146.367 -109.493 1.00 66.10  ? 6    ASP B O     1 
ATOM   3547  C CB    . ASP B  1 6   ? 134.065 146.072 -108.881 1.00 70.19  ? 6    ASP B CB    1 
ATOM   3548  C CG    . ASP B  1 6   ? 133.928 147.511 -108.412 1.00 71.96  ? 6    ASP B CG    1 
ATOM   3549  O OD1   . ASP B  1 6   ? 134.034 148.431 -109.261 1.00 73.83  ? 6    ASP B OD1   1 
ATOM   3550  O OD2   . ASP B  1 6   ? 133.713 147.718 -107.195 1.00 72.81  ? 6    ASP B OD2   1 
ATOM   3551  N N     . ALA B  1 7   ? 131.545 144.681 -108.238 1.00 64.26  ? 7    ALA B N     1 
ATOM   3552  C CA    . ALA B  1 7   ? 130.312 144.488 -107.490 1.00 62.06  ? 7    ALA B CA    1 
ATOM   3553  C C     . ALA B  1 7   ? 130.478 143.609 -106.255 1.00 59.92  ? 7    ALA B C     1 
ATOM   3554  O O     . ALA B  1 7   ? 131.496 142.935 -106.081 1.00 58.83  ? 7    ALA B O     1 
ATOM   3555  C CB    . ALA B  1 7   ? 129.261 143.880 -108.407 1.00 62.59  ? 7    ALA B CB    1 
ATOM   3556  N N     . ASP B  1 8   ? 129.463 143.636 -105.394 1.00 58.40  ? 8    ASP B N     1 
ATOM   3557  C CA    . ASP B  1 8   ? 129.449 142.798 -104.198 1.00 56.92  ? 8    ASP B CA    1 
ATOM   3558  C C     . ASP B  1 8   ? 128.932 141.425 -104.623 1.00 55.32  ? 8    ASP B C     1 
ATOM   3559  O O     . ASP B  1 8   ? 129.500 140.388 -104.263 1.00 54.16  ? 8    ASP B O     1 
ATOM   3560  C CB    . ASP B  1 8   ? 128.506 143.359 -103.132 1.00 57.25  ? 8    ASP B CB    1 
ATOM   3561  C CG    . ASP B  1 8   ? 129.044 144.598 -102.476 1.00 58.56  ? 8    ASP B CG    1 
ATOM   3562  O OD1   . ASP B  1 8   ? 128.847 145.695 -103.029 1.00 58.82  ? 8    ASP B OD1   1 
ATOM   3563  O OD2   . ASP B  1 8   ? 129.676 144.473 -101.407 1.00 59.56  ? 8    ASP B OD2   1 
ATOM   3564  N N     . VAL B  1 9   ? 127.847 141.433 -105.396 1.00 54.35  ? 9    VAL B N     1 
ATOM   3565  C CA    . VAL B  1 9   ? 127.247 140.190 -105.866 1.00 52.34  ? 9    VAL B CA    1 
ATOM   3566  C C     . VAL B  1 9   ? 127.020 140.183 -107.376 1.00 51.03  ? 9    VAL B C     1 
ATOM   3567  O O     . VAL B  1 9   ? 126.448 141.116 -107.944 1.00 49.11  ? 9    VAL B O     1 
ATOM   3568  C CB    . VAL B  1 9   ? 125.884 139.903 -105.151 1.00 52.09  ? 9    VAL B CB    1 
ATOM   3569  C CG1   . VAL B  1 9   ? 125.462 138.454 -105.383 1.00 51.30  ? 9    VAL B CG1   1 
ATOM   3570  C CG2   . VAL B  1 9   ? 126.001 140.167 -103.660 1.00 51.09  ? 9    VAL B CG2   1 
ATOM   3571  N N     . THR B  1 10  ? 127.505 139.121 -108.014 1.00 50.77  ? 10   THR B N     1 
ATOM   3572  C CA    . THR B  1 10  ? 127.331 138.927 -109.448 1.00 51.72  ? 10   THR B CA    1 
ATOM   3573  C C     . THR B  1 10  ? 126.499 137.647 -109.658 1.00 50.36  ? 10   THR B C     1 
ATOM   3574  O O     . THR B  1 10  ? 126.931 136.529 -109.349 1.00 49.96  ? 10   THR B O     1 
ATOM   3575  C CB    . THR B  1 10  ? 128.694 138.812 -110.198 1.00 52.29  ? 10   THR B CB    1 
ATOM   3576  O OG1   . THR B  1 10  ? 129.393 140.063 -110.111 1.00 53.89  ? 10   THR B OG1   1 
ATOM   3577  C CG2   . THR B  1 10  ? 128.471 138.491 -111.678 1.00 52.70  ? 10   THR B CG2   1 
ATOM   3578  N N     . VAL B  1 11  ? 125.284 137.834 -110.158 1.00 49.43  ? 11   VAL B N     1 
ATOM   3579  C CA    . VAL B  1 11  ? 124.376 136.720 -110.410 1.00 48.21  ? 11   VAL B CA    1 
ATOM   3580  C C     . VAL B  1 11  ? 124.342 136.434 -111.915 1.00 45.32  ? 11   VAL B C     1 
ATOM   3581  O O     . VAL B  1 11  ? 124.091 137.320 -112.721 1.00 43.35  ? 11   VAL B O     1 
ATOM   3582  C CB    . VAL B  1 11  ? 122.926 137.046 -109.854 1.00 49.52  ? 11   VAL B CB    1 
ATOM   3583  C CG1   . VAL B  1 11  ? 122.407 138.340 -110.456 1.00 50.02  ? 11   VAL B CG1   1 
ATOM   3584  C CG2   . VAL B  1 11  ? 121.955 135.897 -110.156 1.00 49.47  ? 11   VAL B CG2   1 
ATOM   3585  N N     . ILE B  1 12  ? 124.655 135.195 -112.279 1.00 44.25  ? 12   ILE B N     1 
ATOM   3586  C CA    . ILE B  1 12  ? 124.639 134.783 -113.678 1.00 42.72  ? 12   ILE B CA    1 
ATOM   3587  C C     . ILE B  1 12  ? 123.300 134.096 -113.944 1.00 42.23  ? 12   ILE B C     1 
ATOM   3588  O O     . ILE B  1 12  ? 123.116 132.923 -113.607 1.00 40.02  ? 12   ILE B O     1 
ATOM   3589  C CB    . ILE B  1 12  ? 125.754 133.774 -113.987 1.00 43.74  ? 12   ILE B CB    1 
ATOM   3590  C CG1   . ILE B  1 12  ? 127.083 134.247 -113.381 1.00 43.96  ? 12   ILE B CG1   1 
ATOM   3591  C CG2   . ILE B  1 12  ? 125.875 133.604 -115.499 1.00 42.92  ? 12   ILE B CG2   1 
ATOM   3592  C CD1   . ILE B  1 12  ? 128.105 133.132 -113.181 1.00 43.37  ? 12   ILE B CD1   1 
ATOM   3593  N N     . GLY B  1 13  ? 122.365 134.842 -114.528 1.00 42.22  ? 13   GLY B N     1 
ATOM   3594  C CA    . GLY B  1 13  ? 121.055 134.294 -114.827 1.00 42.19  ? 13   GLY B CA    1 
ATOM   3595  C C     . GLY B  1 13  ? 119.954 135.255 -114.418 1.00 42.13  ? 13   GLY B C     1 
ATOM   3596  O O     . GLY B  1 13  ? 119.921 135.717 -113.275 1.00 42.20  ? 13   GLY B O     1 
ATOM   3597  N N     . SER B  1 14  ? 119.053 135.571 -115.342 1.00 41.81  ? 14   SER B N     1 
ATOM   3598  C CA    . SER B  1 14  ? 117.963 136.481 -115.024 1.00 41.97  ? 14   SER B CA    1 
ATOM   3599  C C     . SER B  1 14  ? 116.618 135.745 -114.915 1.00 41.23  ? 14   SER B C     1 
ATOM   3600  O O     . SER B  1 14  ? 115.554 136.329 -115.148 1.00 40.86  ? 14   SER B O     1 
ATOM   3601  C CB    . SER B  1 14  ? 117.869 137.587 -116.072 1.00 41.63  ? 14   SER B CB    1 
ATOM   3602  O OG    . SER B  1 14  ? 117.389 137.072 -117.302 1.00 43.74  ? 14   SER B OG    1 
ATOM   3603  N N     . GLY B  1 15  ? 116.678 134.463 -114.563 1.00 41.13  ? 15   GLY B N     1 
ATOM   3604  C CA    . GLY B  1 15  ? 115.456 133.684 -114.392 1.00 41.38  ? 15   GLY B CA    1 
ATOM   3605  C C     . GLY B  1 15  ? 114.849 133.916 -113.011 1.00 40.19  ? 15   GLY B C     1 
ATOM   3606  O O     . GLY B  1 15  ? 115.335 134.776 -112.259 1.00 38.61  ? 15   GLY B O     1 
ATOM   3607  N N     . PRO B  1 16  ? 113.781 133.180 -112.649 1.00 39.34  ? 16   PRO B N     1 
ATOM   3608  C CA    . PRO B  1 16  ? 113.144 133.344 -111.337 1.00 38.43  ? 16   PRO B CA    1 
ATOM   3609  C C     . PRO B  1 16  ? 114.156 133.427 -110.193 1.00 37.74  ? 16   PRO B C     1 
ATOM   3610  O O     . PRO B  1 16  ? 114.110 134.356 -109.381 1.00 37.29  ? 16   PRO B O     1 
ATOM   3611  C CB    . PRO B  1 16  ? 112.250 132.105 -111.237 1.00 38.77  ? 16   PRO B CB    1 
ATOM   3612  C CG    . PRO B  1 16  ? 111.785 131.950 -112.632 1.00 38.41  ? 16   PRO B CG    1 
ATOM   3613  C CD    . PRO B  1 16  ? 113.053 132.181 -113.453 1.00 39.51  ? 16   PRO B CD    1 
ATOM   3614  N N     . GLY B  1 17  ? 115.060 132.459 -110.123 1.00 36.64  ? 17   GLY B N     1 
ATOM   3615  C CA    . GLY B  1 17  ? 116.041 132.492 -109.061 1.00 37.25  ? 17   GLY B CA    1 
ATOM   3616  C C     . GLY B  1 17  ? 116.953 133.709 -109.167 1.00 37.78  ? 17   GLY B C     1 
ATOM   3617  O O     . GLY B  1 17  ? 117.136 134.466 -108.205 1.00 36.68  ? 17   GLY B O     1 
ATOM   3618  N N     . GLY B  1 18  ? 117.500 133.900 -110.363 1.00 36.92  ? 18   GLY B N     1 
ATOM   3619  C CA    . GLY B  1 18  ? 118.435 134.979 -110.626 1.00 36.47  ? 18   GLY B CA    1 
ATOM   3620  C C     . GLY B  1 18  ? 118.020 136.420 -110.464 1.00 35.90  ? 18   GLY B C     1 
ATOM   3621  O O     . GLY B  1 18  ? 118.664 137.177 -109.732 1.00 36.98  ? 18   GLY B O     1 
ATOM   3622  N N     . TYR B  1 19  ? 116.954 136.818 -111.138 1.00 36.18  ? 19   TYR B N     1 
ATOM   3623  C CA    . TYR B  1 19  ? 116.512 138.202 -111.070 1.00 36.14  ? 19   TYR B CA    1 
ATOM   3624  C C     . TYR B  1 19  ? 115.925 138.583 -109.710 1.00 36.10  ? 19   TYR B C     1 
ATOM   3625  O O     . TYR B  1 19  ? 116.056 139.732 -109.253 1.00 34.15  ? 19   TYR B O     1 
ATOM   3626  C CB    . TYR B  1 19  ? 115.537 138.472 -112.228 1.00 37.20  ? 19   TYR B CB    1 
ATOM   3627  C CG    . TYR B  1 19  ? 114.078 138.410 -111.876 1.00 39.35  ? 19   TYR B CG    1 
ATOM   3628  C CD1   . TYR B  1 19  ? 113.451 139.489 -111.253 1.00 38.66  ? 19   TYR B CD1   1 
ATOM   3629  C CD2   . TYR B  1 19  ? 113.320 137.274 -112.162 1.00 39.81  ? 19   TYR B CD2   1 
ATOM   3630  C CE1   . TYR B  1 19  ? 112.118 139.449 -110.921 1.00 40.21  ? 19   TYR B CE1   1 
ATOM   3631  C CE2   . TYR B  1 19  ? 111.963 137.218 -111.834 1.00 41.76  ? 19   TYR B CE2   1 
ATOM   3632  C CZ    . TYR B  1 19  ? 111.367 138.313 -111.211 1.00 41.54  ? 19   TYR B CZ    1 
ATOM   3633  O OH    . TYR B  1 19  ? 110.019 138.287 -110.898 1.00 41.96  ? 19   TYR B OH    1 
ATOM   3634  N N     . VAL B  1 20  ? 115.286 137.621 -109.056 1.00 35.95  ? 20   VAL B N     1 
ATOM   3635  C CA    . VAL B  1 20  ? 114.719 137.889 -107.739 1.00 36.89  ? 20   VAL B CA    1 
ATOM   3636  C C     . VAL B  1 20  ? 115.886 138.078 -106.757 1.00 36.93  ? 20   VAL B C     1 
ATOM   3637  O O     . VAL B  1 20  ? 115.837 138.944 -105.889 1.00 37.19  ? 20   VAL B O     1 
ATOM   3638  C CB    . VAL B  1 20  ? 113.790 136.725 -107.262 1.00 37.20  ? 20   VAL B CB    1 
ATOM   3639  C CG1   . VAL B  1 20  ? 113.529 136.831 -105.754 1.00 35.90  ? 20   VAL B CG1   1 
ATOM   3640  C CG2   . VAL B  1 20  ? 112.449 136.787 -108.023 1.00 37.19  ? 20   VAL B CG2   1 
ATOM   3641  N N     . ALA B  1 21  ? 116.927 137.262 -106.909 1.00 37.57  ? 21   ALA B N     1 
ATOM   3642  C CA    . ALA B  1 21  ? 118.112 137.347 -106.064 1.00 38.75  ? 21   ALA B CA    1 
ATOM   3643  C C     . ALA B  1 21  ? 118.827 138.699 -106.273 1.00 39.27  ? 21   ALA B C     1 
ATOM   3644  O O     . ALA B  1 21  ? 119.245 139.352 -105.304 1.00 38.71  ? 21   ALA B O     1 
ATOM   3645  C CB    . ALA B  1 21  ? 119.065 136.182 -106.383 1.00 37.02  ? 21   ALA B CB    1 
ATOM   3646  N N     . ALA B  1 22  ? 118.965 139.105 -107.536 1.00 39.34  ? 22   ALA B N     1 
ATOM   3647  C CA    . ALA B  1 22  ? 119.612 140.376 -107.887 1.00 41.04  ? 22   ALA B CA    1 
ATOM   3648  C C     . ALA B  1 22  ? 118.921 141.514 -107.144 1.00 41.51  ? 22   ALA B C     1 
ATOM   3649  O O     . ALA B  1 22  ? 119.564 142.306 -106.432 1.00 41.13  ? 22   ALA B O     1 
ATOM   3650  C CB    . ALA B  1 22  ? 119.531 140.617 -109.414 1.00 40.04  ? 22   ALA B CB    1 
ATOM   3651  N N     . ILE B  1 23  ? 117.605 141.574 -107.324 1.00 41.77  ? 23   ILE B N     1 
ATOM   3652  C CA    . ILE B  1 23  ? 116.764 142.580 -106.700 1.00 41.80  ? 23   ILE B CA    1 
ATOM   3653  C C     . ILE B  1 23  ? 116.907 142.586 -105.176 1.00 42.36  ? 23   ILE B C     1 
ATOM   3654  O O     . ILE B  1 23  ? 117.193 143.629 -104.587 1.00 41.28  ? 23   ILE B O     1 
ATOM   3655  C CB    . ILE B  1 23  ? 115.278 142.354 -107.084 1.00 41.56  ? 23   ILE B CB    1 
ATOM   3656  C CG1   . ILE B  1 23  ? 115.106 142.610 -108.587 1.00 42.92  ? 23   ILE B CG1   1 
ATOM   3657  C CG2   . ILE B  1 23  ? 114.352 143.249 -106.242 1.00 41.35  ? 23   ILE B CG2   1 
ATOM   3658  C CD1   . ILE B  1 23  ? 113.690 142.419 -109.106 1.00 42.73  ? 23   ILE B CD1   1 
ATOM   3659  N N     . LYS B  1 24  ? 116.721 141.423 -104.550 1.00 42.17  ? 24   LYS B N     1 
ATOM   3660  C CA    . LYS B  1 24  ? 116.815 141.303 -103.092 1.00 43.04  ? 24   LYS B CA    1 
ATOM   3661  C C     . LYS B  1 24  ? 118.204 141.661 -102.542 1.00 43.36  ? 24   LYS B C     1 
ATOM   3662  O O     . LYS B  1 24  ? 118.313 142.207 -101.443 1.00 42.42  ? 24   LYS B O     1 
ATOM   3663  C CB    . LYS B  1 24  ? 116.444 139.884 -102.639 1.00 41.24  ? 24   LYS B CB    1 
ATOM   3664  C CG    . LYS B  1 24  ? 116.318 139.726 -101.120 1.00 40.18  ? 24   LYS B CG    1 
ATOM   3665  C CD    . LYS B  1 24  ? 115.119 140.489 -100.576 1.00 38.82  ? 24   LYS B CD    1 
ATOM   3666  C CE    . LYS B  1 24  ? 115.052 140.398 -99.052  1.00 38.32  ? 24   LYS B CE    1 
ATOM   3667  N NZ    . LYS B  1 24  ? 113.821 141.030 -98.511  1.00 36.76  ? 24   LYS B NZ    1 
ATOM   3668  N N     . ALA B  1 25  ? 119.255 141.342 -103.295 1.00 43.36  ? 25   ALA B N     1 
ATOM   3669  C CA    . ALA B  1 25  ? 120.618 141.647 -102.870 1.00 44.71  ? 25   ALA B CA    1 
ATOM   3670  C C     . ALA B  1 25  ? 120.807 143.165 -102.890 1.00 45.93  ? 25   ALA B C     1 
ATOM   3671  O O     . ALA B  1 25  ? 121.384 143.757 -101.968 1.00 44.47  ? 25   ALA B O     1 
ATOM   3672  C CB    . ALA B  1 25  ? 121.622 140.980 -103.808 1.00 44.57  ? 25   ALA B CB    1 
ATOM   3673  N N     . ALA B  1 26  ? 120.299 143.783 -103.949 1.00 46.72  ? 26   ALA B N     1 
ATOM   3674  C CA    . ALA B  1 26  ? 120.373 145.224 -104.110 1.00 48.09  ? 26   ALA B CA    1 
ATOM   3675  C C     . ALA B  1 26  ? 119.620 145.907 -102.968 1.00 48.94  ? 26   ALA B C     1 
ATOM   3676  O O     . ALA B  1 26  ? 120.109 146.880 -102.381 1.00 49.59  ? 26   ALA B O     1 
ATOM   3677  C CB    . ALA B  1 26  ? 119.766 145.620 -105.442 1.00 48.08  ? 26   ALA B CB    1 
ATOM   3678  N N     . GLN B  1 27  ? 118.429 145.398 -102.662 1.00 48.33  ? 27   GLN B N     1 
ATOM   3679  C CA    . GLN B  1 27  ? 117.605 145.960 -101.593 1.00 48.58  ? 27   GLN B CA    1 
ATOM   3680  C C     . GLN B  1 27  ? 118.266 145.766 -100.233 1.00 48.21  ? 27   GLN B C     1 
ATOM   3681  O O     . GLN B  1 27  ? 117.909 146.428 -99.256  1.00 47.92  ? 27   GLN B O     1 
ATOM   3682  C CB    . GLN B  1 27  ? 116.221 145.293 -101.561 1.00 48.43  ? 27   GLN B CB    1 
ATOM   3683  C CG    . GLN B  1 27  ? 115.453 145.323 -102.872 1.00 48.96  ? 27   GLN B CG    1 
ATOM   3684  C CD    . GLN B  1 27  ? 114.020 144.858 -102.704 1.00 48.38  ? 27   GLN B CD    1 
ATOM   3685  O OE1   . GLN B  1 27  ? 113.734 143.978 -101.887 1.00 48.07  ? 27   GLN B OE1   1 
ATOM   3686  N NE2   . GLN B  1 27  ? 113.111 145.440 -103.483 1.00 47.55  ? 27   GLN B NE2   1 
ATOM   3687  N N     . LEU B  1 28  ? 119.215 144.836 -100.178 1.00 48.84  ? 28   LEU B N     1 
ATOM   3688  C CA    . LEU B  1 28  ? 119.929 144.523 -98.951  1.00 49.12  ? 28   LEU B CA    1 
ATOM   3689  C C     . LEU B  1 28  ? 121.174 145.391 -98.758  1.00 50.46  ? 28   LEU B C     1 
ATOM   3690  O O     . LEU B  1 28  ? 121.757 145.396 -97.675  1.00 50.28  ? 28   LEU B O     1 
ATOM   3691  C CB    . LEU B  1 28  ? 120.334 143.043 -98.939  1.00 48.51  ? 28   LEU B CB    1 
ATOM   3692  C CG    . LEU B  1 28  ? 119.239 142.009 -98.669  1.00 48.30  ? 28   LEU B CG    1 
ATOM   3693  C CD1   . LEU B  1 28  ? 119.795 140.602 -98.831  1.00 46.83  ? 28   LEU B CD1   1 
ATOM   3694  C CD2   . LEU B  1 28  ? 118.685 142.222 -97.265  1.00 47.99  ? 28   LEU B CD2   1 
ATOM   3695  N N     . GLY B  1 29  ? 121.576 146.113 -99.804  1.00 51.48  ? 29   GLY B N     1 
ATOM   3696  C CA    . GLY B  1 29  ? 122.752 146.969 -99.715  1.00 52.41  ? 29   GLY B CA    1 
ATOM   3697  C C     . GLY B  1 29  ? 123.974 146.499 -100.503 1.00 53.34  ? 29   GLY B C     1 
ATOM   3698  O O     . GLY B  1 29  ? 125.097 146.980 -100.279 1.00 54.07  ? 29   GLY B O     1 
ATOM   3699  N N     . PHE B  1 30  ? 123.774 145.559 -101.426 1.00 52.37  ? 30   PHE B N     1 
ATOM   3700  C CA    . PHE B  1 30  ? 124.881 145.056 -102.231 1.00 51.58  ? 30   PHE B CA    1 
ATOM   3701  C C     . PHE B  1 30  ? 124.941 145.787 -103.563 1.00 52.28  ? 30   PHE B C     1 
ATOM   3702  O O     . PHE B  1 30  ? 123.914 146.246 -104.072 1.00 53.16  ? 30   PHE B O     1 
ATOM   3703  C CB    . PHE B  1 30  ? 124.724 143.556 -102.502 1.00 48.66  ? 30   PHE B CB    1 
ATOM   3704  C CG    . PHE B  1 30  ? 124.940 142.680 -101.297 1.00 46.45  ? 30   PHE B CG    1 
ATOM   3705  C CD1   . PHE B  1 30  ? 126.183 142.629 -100.664 1.00 45.42  ? 30   PHE B CD1   1 
ATOM   3706  C CD2   . PHE B  1 30  ? 123.908 141.857 -100.821 1.00 46.22  ? 30   PHE B CD2   1 
ATOM   3707  C CE1   . PHE B  1 30  ? 126.399 141.771 -99.580  1.00 42.96  ? 30   PHE B CE1   1 
ATOM   3708  C CE2   . PHE B  1 30  ? 124.111 140.992 -99.736  1.00 43.46  ? 30   PHE B CE2   1 
ATOM   3709  C CZ    . PHE B  1 30  ? 125.356 140.947 -99.116  1.00 44.64  ? 30   PHE B CZ    1 
ATOM   3710  N N     . LYS B  1 31  ? 126.151 145.928 -104.100 1.00 52.98  ? 31   LYS B N     1 
ATOM   3711  C CA    . LYS B  1 31  ? 126.349 146.547 -105.410 1.00 53.65  ? 31   LYS B CA    1 
ATOM   3712  C C     . LYS B  1 31  ? 126.080 145.312 -106.270 1.00 52.07  ? 31   LYS B C     1 
ATOM   3713  O O     . LYS B  1 31  ? 126.856 144.349 -106.254 1.00 51.89  ? 31   LYS B O     1 
ATOM   3714  C CB    . LYS B  1 31  ? 127.799 147.029 -105.567 1.00 55.07  ? 31   LYS B CB    1 
ATOM   3715  C CG    . LYS B  1 31  ? 128.072 147.772 -106.866 1.00 58.17  ? 31   LYS B CG    1 
ATOM   3716  C CD    . LYS B  1 31  ? 129.511 148.293 -106.920 1.00 61.03  ? 31   LYS B CD    1 
ATOM   3717  C CE    . LYS B  1 31  ? 129.803 149.041 -108.232 1.00 62.71  ? 31   LYS B CE    1 
ATOM   3718  N NZ    . LYS B  1 31  ? 131.205 149.557 -108.293 1.00 62.15  ? 31   LYS B NZ    1 
ATOM   3719  N N     . THR B  1 32  ? 124.980 145.328 -107.012 1.00 50.39  ? 32   THR B N     1 
ATOM   3720  C CA    . THR B  1 32  ? 124.609 144.138 -107.766 1.00 49.25  ? 32   THR B CA    1 
ATOM   3721  C C     . THR B  1 32  ? 124.626 144.192 -109.286 1.00 48.75  ? 32   THR B C     1 
ATOM   3722  O O     . THR B  1 32  ? 124.136 145.143 -109.885 1.00 47.48  ? 32   THR B O     1 
ATOM   3723  C CB    . THR B  1 32  ? 123.196 143.664 -107.330 1.00 48.47  ? 32   THR B CB    1 
ATOM   3724  O OG1   . THR B  1 32  ? 123.103 143.672 -105.900 1.00 46.54  ? 32   THR B OG1   1 
ATOM   3725  C CG2   . THR B  1 32  ? 122.931 142.257 -107.828 1.00 47.18  ? 32   THR B CG2   1 
ATOM   3726  N N     . VAL B  1 33  ? 125.184 143.146 -109.897 1.00 49.87  ? 33   VAL B N     1 
ATOM   3727  C CA    . VAL B  1 33  ? 125.226 143.025 -111.356 1.00 51.46  ? 33   VAL B CA    1 
ATOM   3728  C C     . VAL B  1 33  ? 124.551 141.698 -111.751 1.00 51.83  ? 33   VAL B C     1 
ATOM   3729  O O     . VAL B  1 33  ? 124.763 140.665 -111.101 1.00 52.19  ? 33   VAL B O     1 
ATOM   3730  C CB    . VAL B  1 33  ? 126.686 143.017 -111.925 1.00 51.65  ? 33   VAL B CB    1 
ATOM   3731  C CG1   . VAL B  1 33  ? 127.499 144.148 -111.319 1.00 51.22  ? 33   VAL B CG1   1 
ATOM   3732  C CG2   . VAL B  1 33  ? 127.353 141.671 -111.657 1.00 53.19  ? 33   VAL B CG2   1 
ATOM   3733  N N     . CYS B  1 34  ? 123.729 141.733 -112.801 1.00 51.47  ? 34   CYS B N     1 
ATOM   3734  C CA    . CYS B  1 34  ? 123.053 140.525 -113.281 1.00 50.20  ? 34   CYS B CA    1 
ATOM   3735  C C     . CYS B  1 34  ? 123.401 140.315 -114.755 1.00 49.67  ? 34   CYS B C     1 
ATOM   3736  O O     . CYS B  1 34  ? 123.181 141.194 -115.582 1.00 47.94  ? 34   CYS B O     1 
ATOM   3737  C CB    . CYS B  1 34  ? 121.524 140.638 -113.093 1.00 49.70  ? 34   CYS B CB    1 
ATOM   3738  S SG    . CYS B  1 34  ? 120.539 139.168 -113.620 1.00 46.10  ? 34   CYS B SG    1 
ATOM   3739  N N     . ILE B  1 35  ? 123.951 139.138 -115.059 1.00 50.10  ? 35   ILE B N     1 
ATOM   3740  C CA    . ILE B  1 35  ? 124.368 138.762 -116.415 1.00 51.06  ? 35   ILE B CA    1 
ATOM   3741  C C     . ILE B  1 35  ? 123.355 137.807 -117.072 1.00 51.52  ? 35   ILE B C     1 
ATOM   3742  O O     . ILE B  1 35  ? 123.043 136.749 -116.518 1.00 52.48  ? 35   ILE B O     1 
ATOM   3743  C CB    . ILE B  1 35  ? 125.767 138.072 -116.370 1.00 51.21  ? 35   ILE B CB    1 
ATOM   3744  C CG1   . ILE B  1 35  ? 126.815 139.058 -115.830 1.00 51.06  ? 35   ILE B CG1   1 
ATOM   3745  C CG2   . ILE B  1 35  ? 126.154 137.564 -117.750 1.00 50.35  ? 35   ILE B CG2   1 
ATOM   3746  C CD1   . ILE B  1 35  ? 128.066 138.391 -115.295 1.00 50.44  ? 35   ILE B CD1   1 
ATOM   3747  N N     . GLU B  1 36  ? 122.853 138.191 -118.247 1.00 51.22  ? 36   GLU B N     1 
ATOM   3748  C CA    . GLU B  1 36  ? 121.874 137.395 -118.997 1.00 50.26  ? 36   GLU B CA    1 
ATOM   3749  C C     . GLU B  1 36  ? 122.261 137.219 -120.467 1.00 51.10  ? 36   GLU B C     1 
ATOM   3750  O O     . GLU B  1 36  ? 122.323 138.198 -121.213 1.00 51.35  ? 36   GLU B O     1 
ATOM   3751  C CB    . GLU B  1 36  ? 120.491 138.057 -118.945 1.00 48.24  ? 36   GLU B CB    1 
ATOM   3752  C CG    . GLU B  1 36  ? 119.432 137.327 -119.787 1.00 46.46  ? 36   GLU B CG    1 
ATOM   3753  C CD    . GLU B  1 36  ? 119.327 135.843 -119.438 1.00 44.18  ? 36   GLU B CD    1 
ATOM   3754  O OE1   . GLU B  1 36  ? 118.942 135.529 -118.290 1.00 42.81  ? 36   GLU B OE1   1 
ATOM   3755  O OE2   . GLU B  1 36  ? 119.635 134.996 -120.302 1.00 42.70  ? 36   GLU B OE2   1 
ATOM   3756  N N     . LYS B  1 37  ? 122.481 135.973 -120.886 1.00 51.28  ? 37   LYS B N     1 
ATOM   3757  C CA    . LYS B  1 37  ? 122.856 135.679 -122.268 1.00 52.05  ? 37   LYS B CA    1 
ATOM   3758  C C     . LYS B  1 37  ? 121.745 135.883 -123.302 1.00 52.76  ? 37   LYS B C     1 
ATOM   3759  O O     . LYS B  1 37  ? 122.031 136.247 -124.444 1.00 53.59  ? 37   LYS B O     1 
ATOM   3760  C CB    . LYS B  1 37  ? 123.391 134.244 -122.379 1.00 51.78  ? 37   LYS B CB    1 
ATOM   3761  C CG    . LYS B  1 37  ? 122.352 133.150 -122.119 1.00 50.72  ? 37   LYS B CG    1 
ATOM   3762  C CD    . LYS B  1 37  ? 122.966 131.768 -122.271 1.00 50.26  ? 37   LYS B CD    1 
ATOM   3763  C CE    . LYS B  1 37  ? 121.987 130.647 -121.927 1.00 49.62  ? 37   LYS B CE    1 
ATOM   3764  N NZ    . LYS B  1 37  ? 120.792 130.699 -122.791 1.00 48.90  ? 37   LYS B NZ    1 
ATOM   3765  N N     . ASN B  1 38  ? 120.486 135.661 -122.919 1.00 52.70  ? 38   ASN B N     1 
ATOM   3766  C CA    . ASN B  1 38  ? 119.372 135.816 -123.860 1.00 52.87  ? 38   ASN B CA    1 
ATOM   3767  C C     . ASN B  1 38  ? 118.986 137.265 -124.156 1.00 52.35  ? 38   ASN B C     1 
ATOM   3768  O O     . ASN B  1 38  ? 119.464 138.194 -123.511 1.00 51.84  ? 38   ASN B O     1 
ATOM   3769  C CB    . ASN B  1 38  ? 118.139 135.045 -123.365 1.00 53.51  ? 38   ASN B CB    1 
ATOM   3770  C CG    . ASN B  1 38  ? 118.394 133.548 -123.246 1.00 54.43  ? 38   ASN B CG    1 
ATOM   3771  O OD1   . ASN B  1 38  ? 119.403 133.033 -123.736 1.00 52.27  ? 38   ASN B OD1   1 
ATOM   3772  N ND2   . ASN B  1 38  ? 117.470 132.840 -122.592 1.00 55.22  ? 38   ASN B ND2   1 
ATOM   3773  N N     . GLU B  1 39  ? 118.119 137.444 -125.145 1.00 52.56  ? 39   GLU B N     1 
ATOM   3774  C CA    . GLU B  1 39  ? 117.668 138.772 -125.554 1.00 52.87  ? 39   GLU B CA    1 
ATOM   3775  C C     . GLU B  1 39  ? 116.727 139.425 -124.564 1.00 52.17  ? 39   GLU B C     1 
ATOM   3776  O O     . GLU B  1 39  ? 116.386 140.601 -124.709 1.00 52.48  ? 39   GLU B O     1 
ATOM   3777  C CB    . GLU B  1 39  ? 116.962 138.702 -126.900 1.00 55.51  ? 39   GLU B CB    1 
ATOM   3778  C CG    . GLU B  1 39  ? 117.847 138.253 -128.045 1.00 59.57  ? 39   GLU B CG    1 
ATOM   3779  C CD    . GLU B  1 39  ? 117.082 138.168 -129.357 1.00 61.93  ? 39   GLU B CD    1 
ATOM   3780  O OE1   . GLU B  1 39  ? 115.899 138.588 -129.389 1.00 61.71  ? 39   GLU B OE1   1 
ATOM   3781  O OE2   . GLU B  1 39  ? 117.668 137.685 -130.358 1.00 64.16  ? 39   GLU B OE2   1 
ATOM   3782  N N     . THR B  1 40  ? 116.285 138.661 -123.572 1.00 50.10  ? 40   THR B N     1 
ATOM   3783  C CA    . THR B  1 40  ? 115.384 139.193 -122.560 1.00 47.82  ? 40   THR B CA    1 
ATOM   3784  C C     . THR B  1 40  ? 115.673 138.588 -121.209 1.00 45.73  ? 40   THR B C     1 
ATOM   3785  O O     . THR B  1 40  ? 116.324 137.550 -121.103 1.00 46.12  ? 40   THR B O     1 
ATOM   3786  C CB    . THR B  1 40  ? 113.913 138.909 -122.899 1.00 48.84  ? 40   THR B CB    1 
ATOM   3787  O OG1   . THR B  1 40  ? 113.760 137.519 -123.211 1.00 48.83  ? 40   THR B OG1   1 
ATOM   3788  C CG2   . THR B  1 40  ? 113.461 139.765 -124.063 1.00 47.55  ? 40   THR B CG2   1 
ATOM   3789  N N     . LEU B  1 41  ? 115.182 139.255 -120.177 1.00 44.17  ? 41   LEU B N     1 
ATOM   3790  C CA    . LEU B  1 41  ? 115.355 138.789 -118.815 1.00 43.18  ? 41   LEU B CA    1 
ATOM   3791  C C     . LEU B  1 41  ? 114.125 137.934 -118.521 1.00 41.35  ? 41   LEU B C     1 
ATOM   3792  O O     . LEU B  1 41  ? 113.153 137.973 -119.265 1.00 41.63  ? 41   LEU B O     1 
ATOM   3793  C CB    . LEU B  1 41  ? 115.412 139.984 -117.856 1.00 42.97  ? 41   LEU B CB    1 
ATOM   3794  C CG    . LEU B  1 41  ? 116.472 141.056 -118.160 1.00 43.16  ? 41   LEU B CG    1 
ATOM   3795  C CD1   . LEU B  1 41  ? 116.243 142.271 -117.278 1.00 43.32  ? 41   LEU B CD1   1 
ATOM   3796  C CD2   . LEU B  1 41  ? 117.867 140.487 -117.923 1.00 42.87  ? 41   LEU B CD2   1 
ATOM   3797  N N     . GLY B  1 42  ? 114.163 137.155 -117.450 1.00 39.89  ? 42   GLY B N     1 
ATOM   3798  C CA    . GLY B  1 42  ? 113.000 136.346 -117.134 1.00 39.45  ? 42   GLY B CA    1 
ATOM   3799  C C     . GLY B  1 42  ? 113.257 134.855 -117.204 1.00 38.02  ? 42   GLY B C     1 
ATOM   3800  O O     . GLY B  1 42  ? 112.496 134.077 -116.640 1.00 38.57  ? 42   GLY B O     1 
ATOM   3801  N N     . GLY B  1 43  ? 114.316 134.461 -117.903 1.00 36.43  ? 43   GLY B N     1 
ATOM   3802  C CA    . GLY B  1 43  ? 114.656 133.057 -118.015 1.00 35.67  ? 43   GLY B CA    1 
ATOM   3803  C C     . GLY B  1 43  ? 113.591 132.179 -118.651 1.00 35.98  ? 43   GLY B C     1 
ATOM   3804  O O     . GLY B  1 43  ? 112.763 132.637 -119.433 1.00 34.84  ? 43   GLY B O     1 
ATOM   3805  N N     . THR B  1 44  ? 113.624 130.901 -118.296 1.00 35.91  ? 44   THR B N     1 
ATOM   3806  C CA    . THR B  1 44  ? 112.687 129.913 -118.813 1.00 35.79  ? 44   THR B CA    1 
ATOM   3807  C C     . THR B  1 44  ? 111.243 130.236 -118.469 1.00 36.21  ? 44   THR B C     1 
ATOM   3808  O O     . THR B  1 44  ? 110.364 130.178 -119.332 1.00 35.91  ? 44   THR B O     1 
ATOM   3809  C CB    . THR B  1 44  ? 113.000 128.519 -118.242 1.00 36.32  ? 44   THR B CB    1 
ATOM   3810  O OG1   . THR B  1 44  ? 114.345 128.166 -118.569 1.00 34.22  ? 44   THR B OG1   1 
ATOM   3811  C CG2   . THR B  1 44  ? 112.035 127.468 -118.798 1.00 34.95  ? 44   THR B CG2   1 
ATOM   3812  N N     A CYS B  1 45  ? 110.992 130.575 -117.210 0.51 35.92  ? 45   CYS B N     1 
ATOM   3813  N N     B CYS B  1 45  ? 111.021 130.591 -117.207 0.49 35.80  ? 45   CYS B N     1 
ATOM   3814  C CA    A CYS B  1 45  ? 109.637 130.876 -116.738 0.51 37.22  ? 45   CYS B CA    1 
ATOM   3815  C CA    B CYS B  1 45  ? 109.694 130.928 -116.706 0.49 36.89  ? 45   CYS B CA    1 
ATOM   3816  C C     A CYS B  1 45  ? 108.905 131.969 -117.531 0.51 36.99  ? 45   CYS B C     1 
ATOM   3817  C C     B CYS B  1 45  ? 108.936 131.956 -117.542 0.49 36.85  ? 45   CYS B C     1 
ATOM   3818  O O     A CYS B  1 45  ? 107.775 131.754 -117.982 0.51 37.85  ? 45   CYS B O     1 
ATOM   3819  O O     B CYS B  1 45  ? 107.835 131.688 -118.029 0.49 37.79  ? 45   CYS B O     1 
ATOM   3820  C CB    A CYS B  1 45  ? 109.711 131.236 -115.251 0.51 37.82  ? 45   CYS B CB    1 
ATOM   3821  C CB    B CYS B  1 45  ? 109.798 131.434 -115.259 0.49 37.44  ? 45   CYS B CB    1 
ATOM   3822  S SG    A CYS B  1 45  ? 108.219 131.247 -114.186 0.51 38.35  ? 45   CYS B SG    1 
ATOM   3823  S SG    B CYS B  1 45  ? 108.322 132.315 -114.641 0.49 35.89  ? 45   CYS B SG    1 
ATOM   3824  N N     . LEU B  1 46  ? 109.522 133.135 -117.705 1.00 36.89  ? 46   LEU B N     1 
ATOM   3825  C CA    . LEU B  1 46  ? 108.870 134.207 -118.462 1.00 36.91  ? 46   LEU B CA    1 
ATOM   3826  C C     . LEU B  1 46  ? 108.769 134.036 -119.976 1.00 35.07  ? 46   LEU B C     1 
ATOM   3827  O O     . LEU B  1 46  ? 107.725 134.283 -120.570 1.00 34.10  ? 46   LEU B O     1 
ATOM   3828  C CB    . LEU B  1 46  ? 109.550 135.557 -118.220 1.00 40.18  ? 46   LEU B CB    1 
ATOM   3829  C CG    . LEU B  1 46  ? 109.344 136.322 -116.911 1.00 43.79  ? 46   LEU B CG    1 
ATOM   3830  C CD1   . LEU B  1 46  ? 109.418 137.808 -117.228 1.00 44.33  ? 46   LEU B CD1   1 
ATOM   3831  C CD2   . LEU B  1 46  ? 107.999 136.000 -116.280 1.00 45.63  ? 46   LEU B CD2   1 
ATOM   3832  N N     . ASN B  1 47  ? 109.851 133.611 -120.591 1.00 33.84  ? 47   ASN B N     1 
ATOM   3833  C CA    . ASN B  1 47  ? 109.897 133.516 -122.045 1.00 35.50  ? 47   ASN B CA    1 
ATOM   3834  C C     . ASN B  1 47  ? 109.389 132.249 -122.732 1.00 34.53  ? 47   ASN B C     1 
ATOM   3835  O O     . ASN B  1 47  ? 108.724 132.343 -123.754 1.00 35.60  ? 47   ASN B O     1 
ATOM   3836  C CB    . ASN B  1 47  ? 111.327 133.842 -122.484 1.00 35.84  ? 47   ASN B CB    1 
ATOM   3837  C CG    . ASN B  1 47  ? 111.812 135.176 -121.909 1.00 38.32  ? 47   ASN B CG    1 
ATOM   3838  O OD1   . ASN B  1 47  ? 111.398 136.247 -122.362 1.00 40.64  ? 47   ASN B OD1   1 
ATOM   3839  N ND2   . ASN B  1 47  ? 112.660 135.114 -120.890 1.00 36.50  ? 47   ASN B ND2   1 
ATOM   3840  N N     . VAL B  1 48  ? 109.690 131.078 -122.193 1.00 33.09  ? 48   VAL B N     1 
ATOM   3841  C CA    . VAL B  1 48  ? 109.232 129.838 -122.823 1.00 34.75  ? 48   VAL B CA    1 
ATOM   3842  C C     . VAL B  1 48  ? 108.650 128.874 -121.802 1.00 34.25  ? 48   VAL B C     1 
ATOM   3843  O O     . VAL B  1 48  ? 108.580 127.669 -122.034 1.00 35.62  ? 48   VAL B O     1 
ATOM   3844  C CB    . VAL B  1 48  ? 110.393 129.132 -123.554 1.00 34.47  ? 48   VAL B CB    1 
ATOM   3845  C CG1   . VAL B  1 48  ? 110.927 130.039 -124.696 1.00 33.65  ? 48   VAL B CG1   1 
ATOM   3846  C CG2   . VAL B  1 48  ? 111.518 128.810 -122.554 1.00 32.79  ? 48   VAL B CG2   1 
ATOM   3847  N N     . GLY B  1 49  ? 108.204 129.405 -120.675 1.00 35.12  ? 49   GLY B N     1 
ATOM   3848  C CA    . GLY B  1 49  ? 107.697 128.518 -119.653 1.00 33.57  ? 49   GLY B CA    1 
ATOM   3849  C C     . GLY B  1 49  ? 106.369 128.828 -119.015 1.00 33.58  ? 49   GLY B C     1 
ATOM   3850  O O     . GLY B  1 49  ? 105.331 128.784 -119.666 1.00 33.50  ? 49   GLY B O     1 
ATOM   3851  N N     A CYS B  1 50  ? 106.438 129.176 -117.729 0.51 33.11  ? 50   CYS B N     1 
ATOM   3852  N N     B CYS B  1 50  ? 106.397 129.121 -117.721 0.49 33.20  ? 50   CYS B N     1 
ATOM   3853  C CA    A CYS B  1 50  ? 105.284 129.510 -116.900 0.51 32.76  ? 50   CYS B CA    1 
ATOM   3854  C CA    B CYS B  1 50  ? 105.188 129.407 -116.962 0.49 33.00  ? 50   CYS B CA    1 
ATOM   3855  C C     A CYS B  1 50  ? 104.273 130.439 -117.552 0.51 31.73  ? 50   CYS B C     1 
ATOM   3856  C C     B CYS B  1 50  ? 104.234 130.455 -117.542 0.49 31.82  ? 50   CYS B C     1 
ATOM   3857  O O     A CYS B  1 50  ? 103.097 130.121 -117.699 0.51 30.39  ? 50   CYS B O     1 
ATOM   3858  O O     B CYS B  1 50  ? 103.031 130.223 -117.636 0.49 30.43  ? 50   CYS B O     1 
ATOM   3859  C CB    A CYS B  1 50  ? 105.727 130.223 -115.609 0.51 34.85  ? 50   CYS B CB    1 
ATOM   3860  C CB    B CYS B  1 50  ? 105.582 129.792 -115.536 0.49 34.94  ? 50   CYS B CB    1 
ATOM   3861  S SG    A CYS B  1 50  ? 107.107 129.582 -114.602 0.51 35.67  ? 50   CYS B SG    1 
ATOM   3862  S SG    B CYS B  1 50  ? 104.557 131.099 -114.836 0.49 38.86  ? 50   CYS B SG    1 
ATOM   3863  N N     . ILE B  1 51  ? 104.761 131.618 -117.906 1.00 31.57  ? 51   ILE B N     1 
ATOM   3864  C CA    . ILE B  1 51  ? 103.926 132.656 -118.460 1.00 31.04  ? 51   ILE B CA    1 
ATOM   3865  C C     . ILE B  1 51  ? 103.223 132.282 -119.760 1.00 31.55  ? 51   ILE B C     1 
ATOM   3866  O O     . ILE B  1 51  ? 101.986 132.319 -119.836 1.00 30.69  ? 51   ILE B O     1 
ATOM   3867  C CB    . ILE B  1 51  ? 104.746 133.963 -118.611 1.00 32.23  ? 51   ILE B CB    1 
ATOM   3868  C CG1   . ILE B  1 51  ? 105.361 134.333 -117.245 1.00 32.36  ? 51   ILE B CG1   1 
ATOM   3869  C CG2   . ILE B  1 51  ? 103.843 135.106 -119.138 1.00 29.81  ? 51   ILE B CG2   1 
ATOM   3870  C CD1   . ILE B  1 51  ? 104.325 134.525 -116.097 1.00 33.10  ? 51   ILE B CD1   1 
ATOM   3871  N N     . PRO B  1 52  ? 103.992 131.913 -120.802 1.00 30.94  ? 52   PRO B N     1 
ATOM   3872  C CA    . PRO B  1 52  ? 103.299 131.552 -122.041 1.00 31.41  ? 52   PRO B CA    1 
ATOM   3873  C C     . PRO B  1 52  ? 102.370 130.341 -121.869 1.00 29.68  ? 52   PRO B C     1 
ATOM   3874  O O     . PRO B  1 52  ? 101.279 130.320 -122.408 1.00 28.83  ? 52   PRO B O     1 
ATOM   3875  C CB    . PRO B  1 52  ? 104.449 131.281 -123.011 1.00 29.44  ? 52   PRO B CB    1 
ATOM   3876  C CG    . PRO B  1 52  ? 105.514 130.764 -122.107 1.00 32.34  ? 52   PRO B CG    1 
ATOM   3877  C CD    . PRO B  1 52  ? 105.444 131.756 -120.964 1.00 30.71  ? 52   PRO B CD    1 
ATOM   3878  N N     . SER B  1 53  ? 102.784 129.345 -121.097 1.00 29.53  ? 53   SER B N     1 
ATOM   3879  C CA    . SER B  1 53  ? 101.925 128.178 -120.940 1.00 29.70  ? 53   SER B CA    1 
ATOM   3880  C C     . SER B  1 53  ? 100.605 128.520 -120.218 1.00 29.03  ? 53   SER B C     1 
ATOM   3881  O O     . SER B  1 53  ? 99.517  128.125 -120.663 1.00 28.58  ? 53   SER B O     1 
ATOM   3882  C CB    . SER B  1 53  ? 102.696 127.040 -120.247 1.00 29.38  ? 53   SER B CB    1 
ATOM   3883  O OG    . SER B  1 53  ? 103.150 127.406 -118.959 1.00 34.93  ? 53   SER B OG    1 
ATOM   3884  N N     . LYS B  1 54  ? 100.685 129.293 -119.138 1.00 28.55  ? 54   LYS B N     1 
ATOM   3885  C CA    . LYS B  1 54  ? 99.487  129.659 -118.419 1.00 27.64  ? 54   LYS B CA    1 
ATOM   3886  C C     . LYS B  1 54  ? 98.574  130.507 -119.302 1.00 28.78  ? 54   LYS B C     1 
ATOM   3887  O O     . LYS B  1 54  ? 97.341  130.371 -119.230 1.00 28.36  ? 54   LYS B O     1 
ATOM   3888  C CB    . LYS B  1 54  ? 99.821  130.406 -117.117 1.00 28.73  ? 54   LYS B CB    1 
ATOM   3889  C CG    . LYS B  1 54  ? 99.807  129.529 -115.806 1.00 29.19  ? 54   LYS B CG    1 
ATOM   3890  C CD    . LYS B  1 54  ? 101.075 128.641 -115.621 1.00 29.98  ? 54   LYS B CD    1 
ATOM   3891  C CE    . LYS B  1 54  ? 101.022 127.347 -116.468 1.00 33.16  ? 54   LYS B CE    1 
ATOM   3892  N NZ    . LYS B  1 54  ? 102.308 126.529 -116.520 1.00 29.10  ? 54   LYS B NZ    1 
ATOM   3893  N N     . ALA B  1 55  ? 99.152  131.380 -120.133 1.00 26.84  ? 55   ALA B N     1 
ATOM   3894  C CA    . ALA B  1 55  ? 98.332  132.201 -121.021 1.00 27.22  ? 55   ALA B CA    1 
ATOM   3895  C C     . ALA B  1 55  ? 97.554  131.284 -121.986 1.00 27.22  ? 55   ALA B C     1 
ATOM   3896  O O     . ALA B  1 55  ? 96.332  131.441 -122.170 1.00 25.84  ? 55   ALA B O     1 
ATOM   3897  C CB    . ALA B  1 55  ? 99.193  133.185 -121.810 1.00 27.55  ? 55   ALA B CB    1 
ATOM   3898  N N     . LEU B  1 56  ? 98.248  130.323 -122.585 1.00 26.35  ? 56   LEU B N     1 
ATOM   3899  C CA    . LEU B  1 56  ? 97.561  129.396 -123.487 1.00 29.05  ? 56   LEU B CA    1 
ATOM   3900  C C     . LEU B  1 56  ? 96.566  128.499 -122.718 1.00 29.12  ? 56   LEU B C     1 
ATOM   3901  O O     . LEU B  1 56  ? 95.473  128.178 -123.218 1.00 30.62  ? 56   LEU B O     1 
ATOM   3902  C CB    . LEU B  1 56  ? 98.588  128.545 -124.273 1.00 28.27  ? 56   LEU B CB    1 
ATOM   3903  C CG    . LEU B  1 56  ? 99.465  129.364 -125.240 1.00 30.64  ? 56   LEU B CG    1 
ATOM   3904  C CD1   . LEU B  1 56  ? 100.329 128.433 -126.089 1.00 30.48  ? 56   LEU B CD1   1 
ATOM   3905  C CD2   . LEU B  1 56  ? 98.567  130.247 -126.152 1.00 28.78  ? 56   LEU B CD2   1 
ATOM   3906  N N     . LEU B  1 57  ? 96.930  128.091 -121.503 1.00 28.44  ? 57   LEU B N     1 
ATOM   3907  C CA    . LEU B  1 57  ? 96.032  127.249 -120.727 1.00 26.96  ? 57   LEU B CA    1 
ATOM   3908  C C     . LEU B  1 57  ? 94.754  128.019 -120.503 1.00 28.06  ? 57   LEU B C     1 
ATOM   3909  O O     . LEU B  1 57  ? 93.668  127.480 -120.648 1.00 27.27  ? 57   LEU B O     1 
ATOM   3910  C CB    . LEU B  1 57  ? 96.668  126.856 -119.378 1.00 24.90  ? 57   LEU B CB    1 
ATOM   3911  C CG    . LEU B  1 57  ? 97.601  125.656 -119.512 1.00 22.42  ? 57   LEU B CG    1 
ATOM   3912  C CD1   . LEU B  1 57  ? 98.530  125.491 -118.306 1.00 21.89  ? 57   LEU B CD1   1 
ATOM   3913  C CD2   . LEU B  1 57  ? 96.727  124.450 -119.699 1.00 19.81  ? 57   LEU B CD2   1 
ATOM   3914  N N     . ASN B  1 58  ? 94.909  129.299 -120.177 1.00 28.44  ? 58   ASN B N     1 
ATOM   3915  C CA    . ASN B  1 58  ? 93.800  130.195 -119.896 1.00 29.54  ? 58   ASN B CA    1 
ATOM   3916  C C     . ASN B  1 58  ? 92.881  130.442 -121.117 1.00 29.49  ? 58   ASN B C     1 
ATOM   3917  O O     . ASN B  1 58  ? 91.652  130.295 -121.041 1.00 27.64  ? 58   ASN B O     1 
ATOM   3918  C CB    . ASN B  1 58  ? 94.390  131.517 -119.398 1.00 36.07  ? 58   ASN B CB    1 
ATOM   3919  C CG    . ASN B  1 58  ? 93.428  132.306 -118.568 1.00 42.11  ? 58   ASN B CG    1 
ATOM   3920  O OD1   . ASN B  1 58  ? 93.063  133.436 -118.917 1.00 46.31  ? 58   ASN B OD1   1 
ATOM   3921  N ND2   . ASN B  1 58  ? 93.001  131.724 -117.442 1.00 43.14  ? 58   ASN B ND2   1 
ATOM   3922  N N     . ASN B  1 59  ? 93.486  130.813 -122.238 1.00 26.76  ? 59   ASN B N     1 
ATOM   3923  C CA    . ASN B  1 59  ? 92.730  131.102 -123.451 1.00 28.37  ? 59   ASN B CA    1 
ATOM   3924  C C     . ASN B  1 59  ? 92.044  129.881 -124.051 1.00 28.02  ? 59   ASN B C     1 
ATOM   3925  O O     . ASN B  1 59  ? 90.923  129.980 -124.542 1.00 27.98  ? 59   ASN B O     1 
ATOM   3926  C CB    . ASN B  1 59  ? 93.641  131.761 -124.485 1.00 26.12  ? 59   ASN B CB    1 
ATOM   3927  C CG    . ASN B  1 59  ? 94.224  133.060 -123.985 1.00 27.06  ? 59   ASN B CG    1 
ATOM   3928  O OD1   . ASN B  1 59  ? 93.665  133.714 -123.082 1.00 24.81  ? 59   ASN B OD1   1 
ATOM   3929  N ND2   . ASN B  1 59  ? 95.340  133.463 -124.575 1.00 26.35  ? 59   ASN B ND2   1 
ATOM   3930  N N     . SER B  1 60  ? 92.717  128.735 -123.997 1.00 28.53  ? 60   SER B N     1 
ATOM   3931  C CA    . SER B  1 60  ? 92.151  127.506 -124.530 1.00 28.21  ? 60   SER B CA    1 
ATOM   3932  C C     . SER B  1 60  ? 90.984  127.048 -123.675 1.00 28.55  ? 60   SER B C     1 
ATOM   3933  O O     . SER B  1 60  ? 90.002  126.512 -124.187 1.00 29.21  ? 60   SER B O     1 
ATOM   3934  C CB    . SER B  1 60  ? 93.205  126.400 -124.608 1.00 29.60  ? 60   SER B CB    1 
ATOM   3935  O OG    . SER B  1 60  ? 93.745  126.103 -123.325 1.00 30.13  ? 60   SER B OG    1 
ATOM   3936  N N     . HIS B  1 61  ? 91.075  127.247 -122.368 1.00 28.59  ? 61   HIS B N     1 
ATOM   3937  C CA    . HIS B  1 61  ? 89.968  126.853 -121.523 1.00 28.70  ? 61   HIS B CA    1 
ATOM   3938  C C     . HIS B  1 61  ? 88.745  127.703 -121.841 1.00 29.05  ? 61   HIS B C     1 
ATOM   3939  O O     . HIS B  1 61  ? 87.609  127.190 -121.903 1.00 27.94  ? 61   HIS B O     1 
ATOM   3940  C CB    . HIS B  1 61  ? 90.333  127.013 -120.038 1.00 29.12  ? 61   HIS B CB    1 
ATOM   3941  C CG    . HIS B  1 61  ? 89.161  126.894 -119.121 1.00 28.51  ? 61   HIS B CG    1 
ATOM   3942  N ND1   . HIS B  1 61  ? 88.462  125.747 -118.886 1.00 29.77  ? 61   HIS B ND1   1 
ATOM   3943  C CD2   . HIS B  1 61  ? 88.522  127.877 -118.389 1.00 28.79  ? 61   HIS B CD2   1 
ATOM   3944  C CE1   . HIS B  1 61  ? 87.439  125.996 -118.063 1.00 27.60  ? 61   HIS B CE1   1 
ATOM   3945  N NE2   . HIS B  1 61  ? 87.484  127.291 -117.767 1.00 29.89  ? 61   HIS B NE2   1 
ATOM   3946  N N     . TYR B  1 62  ? 88.974  129.005 -122.026 1.00 29.46  ? 62   TYR B N     1 
ATOM   3947  C CA    . TYR B  1 62  ? 87.886  129.912 -122.355 1.00 31.09  ? 62   TYR B CA    1 
ATOM   3948  C C     . TYR B  1 62  ? 87.287  129.559 -123.718 1.00 31.10  ? 62   TYR B C     1 
ATOM   3949  O O     . TYR B  1 62  ? 86.077  129.646 -123.893 1.00 30.63  ? 62   TYR B O     1 
ATOM   3950  C CB    . TYR B  1 62  ? 88.346  131.374 -122.323 1.00 32.57  ? 62   TYR B CB    1 
ATOM   3951  C CG    . TYR B  1 62  ? 88.584  131.897 -120.925 1.00 36.07  ? 62   TYR B CG    1 
ATOM   3952  C CD1   . TYR B  1 62  ? 87.798  131.463 -119.858 1.00 37.25  ? 62   TYR B CD1   1 
ATOM   3953  C CD2   . TYR B  1 62  ? 89.595  132.827 -120.668 1.00 37.72  ? 62   TYR B CD2   1 
ATOM   3954  C CE1   . TYR B  1 62  ? 88.009  131.932 -118.564 1.00 39.77  ? 62   TYR B CE1   1 
ATOM   3955  C CE2   . TYR B  1 62  ? 89.814  133.313 -119.382 1.00 40.72  ? 62   TYR B CE2   1 
ATOM   3956  C CZ    . TYR B  1 62  ? 89.015  132.863 -118.333 1.00 41.73  ? 62   TYR B CZ    1 
ATOM   3957  O OH    . TYR B  1 62  ? 89.188  133.374 -117.062 1.00 43.95  ? 62   TYR B OH    1 
ATOM   3958  N N     . TYR B  1 63  ? 88.136  129.149 -124.665 1.00 31.49  ? 63   TYR B N     1 
ATOM   3959  C CA    . TYR B  1 63  ? 87.674  128.758 -126.006 1.00 33.00  ? 63   TYR B CA    1 
ATOM   3960  C C     . TYR B  1 63  ? 86.732  127.548 -125.827 1.00 32.60  ? 63   TYR B C     1 
ATOM   3961  O O     . TYR B  1 63  ? 85.640  127.494 -126.388 1.00 30.99  ? 63   TYR B O     1 
ATOM   3962  C CB    . TYR B  1 63  ? 88.875  128.383 -126.897 1.00 34.08  ? 63   TYR B CB    1 
ATOM   3963  C CG    . TYR B  1 63  ? 88.480  127.776 -128.239 1.00 38.36  ? 63   TYR B CG    1 
ATOM   3964  C CD1   . TYR B  1 63  ? 87.888  128.553 -129.244 1.00 39.20  ? 63   TYR B CD1   1 
ATOM   3965  C CD2   . TYR B  1 63  ? 88.624  126.406 -128.474 1.00 39.55  ? 63   TYR B CD2   1 
ATOM   3966  C CE1   . TYR B  1 63  ? 87.435  127.971 -130.456 1.00 39.15  ? 63   TYR B CE1   1 
ATOM   3967  C CE2   . TYR B  1 63  ? 88.178  125.816 -129.670 1.00 39.58  ? 63   TYR B CE2   1 
ATOM   3968  C CZ    . TYR B  1 63  ? 87.581  126.604 -130.656 1.00 41.25  ? 63   TYR B CZ    1 
ATOM   3969  O OH    . TYR B  1 63  ? 87.113  126.010 -131.823 1.00 42.47  ? 63   TYR B OH    1 
ATOM   3970  N N     . HIS B  1 64  ? 87.176  126.597 -125.012 1.00 31.88  ? 64   HIS B N     1 
ATOM   3971  C CA    . HIS B  1 64  ? 86.419  125.394 -124.693 1.00 33.37  ? 64   HIS B CA    1 
ATOM   3972  C C     . HIS B  1 64  ? 85.038  125.710 -124.108 1.00 33.02  ? 64   HIS B C     1 
ATOM   3973  O O     . HIS B  1 64  ? 84.032  125.098 -124.475 1.00 34.42  ? 64   HIS B O     1 
ATOM   3974  C CB    . HIS B  1 64  ? 87.217  124.530 -123.695 1.00 33.91  ? 64   HIS B CB    1 
ATOM   3975  C CG    . HIS B  1 64  ? 86.517  123.280 -123.281 1.00 36.14  ? 64   HIS B CG    1 
ATOM   3976  N ND1   . HIS B  1 64  ? 86.859  122.572 -122.144 1.00 38.12  ? 64   HIS B ND1   1 
ATOM   3977  C CD2   . HIS B  1 64  ? 85.490  122.598 -123.849 1.00 36.65  ? 64   HIS B CD2   1 
ATOM   3978  C CE1   . HIS B  1 64  ? 86.073  121.518 -122.028 1.00 38.17  ? 64   HIS B CE1   1 
ATOM   3979  N NE2   . HIS B  1 64  ? 85.231  121.510 -123.051 1.00 37.26  ? 64   HIS B NE2   1 
ATOM   3980  N N     . MET B  1 65  ? 84.983  126.666 -123.192 1.00 32.72  ? 65   MET B N     1 
ATOM   3981  C CA    . MET B  1 65  ? 83.730  127.040 -122.544 1.00 34.20  ? 65   MET B CA    1 
ATOM   3982  C C     . MET B  1 65  ? 82.756  127.688 -123.532 1.00 33.96  ? 65   MET B C     1 
ATOM   3983  O O     . MET B  1 65  ? 81.557  127.499 -123.445 1.00 33.26  ? 65   MET B O     1 
ATOM   3984  C CB    . MET B  1 65  ? 84.013  128.025 -121.397 1.00 35.41  ? 65   MET B CB    1 
ATOM   3985  C CG    . MET B  1 65  ? 84.981  127.491 -120.344 1.00 38.97  ? 65   MET B CG    1 
ATOM   3986  S SD    . MET B  1 65  ? 84.325  126.065 -119.418 1.00 45.90  ? 65   MET B SD    1 
ATOM   3987  C CE    . MET B  1 65  ? 85.043  124.626 -120.306 1.00 40.81  ? 65   MET B CE    1 
ATOM   3988  N N     . ALA B  1 66  ? 83.290  128.477 -124.453 1.00 35.13  ? 66   ALA B N     1 
ATOM   3989  C CA    . ALA B  1 66  ? 82.461  129.153 -125.440 1.00 36.77  ? 66   ALA B CA    1 
ATOM   3990  C C     . ALA B  1 66  ? 82.049  128.201 -126.554 1.00 37.93  ? 66   ALA B C     1 
ATOM   3991  O O     . ALA B  1 66  ? 80.867  128.070 -126.894 1.00 37.96  ? 66   ALA B O     1 
ATOM   3992  C CB    . ALA B  1 66  ? 83.217  130.327 -126.033 1.00 35.82  ? 66   ALA B CB    1 
ATOM   3993  N N     . HIS B  1 67  ? 83.045  127.527 -127.104 1.00 39.38  ? 67   HIS B N     1 
ATOM   3994  C CA    . HIS B  1 67  ? 82.839  126.618 -128.210 1.00 41.26  ? 67   HIS B CA    1 
ATOM   3995  C C     . HIS B  1 67  ? 82.048  125.383 -127.826 1.00 41.90  ? 67   HIS B C     1 
ATOM   3996  O O     . HIS B  1 67  ? 81.278  124.867 -128.632 1.00 42.48  ? 67   HIS B O     1 
ATOM   3997  C CB    . HIS B  1 67  ? 84.196  126.237 -128.785 1.00 42.31  ? 67   HIS B CB    1 
ATOM   3998  C CG    . HIS B  1 67  ? 84.123  125.362 -129.992 1.00 43.32  ? 67   HIS B CG    1 
ATOM   3999  N ND1   . HIS B  1 67  ? 84.037  123.988 -129.910 1.00 44.26  ? 67   HIS B ND1   1 
ATOM   4000  C CD2   . HIS B  1 67  ? 84.155  125.662 -131.312 1.00 42.97  ? 67   HIS B CD2   1 
ATOM   4001  C CE1   . HIS B  1 67  ? 84.028  123.478 -131.128 1.00 44.62  ? 67   HIS B CE1   1 
ATOM   4002  N NE2   . HIS B  1 67  ? 84.098  124.474 -131.996 1.00 45.37  ? 67   HIS B NE2   1 
ATOM   4003  N N     . GLY B  1 68  ? 82.238  124.923 -126.589 1.00 41.33  ? 68   GLY B N     1 
ATOM   4004  C CA    . GLY B  1 68  ? 81.538  123.751 -126.102 1.00 39.63  ? 68   GLY B CA    1 
ATOM   4005  C C     . GLY B  1 68  ? 80.151  124.032 -125.556 1.00 39.95  ? 68   GLY B C     1 
ATOM   4006  O O     . GLY B  1 68  ? 79.479  124.966 -125.975 1.00 39.50  ? 68   GLY B O     1 
ATOM   4007  N N     . THR B  1 69  ? 79.739  123.230 -124.583 1.00 40.14  ? 69   THR B N     1 
ATOM   4008  C CA    . THR B  1 69  ? 78.418  123.321 -123.978 1.00 40.29  ? 69   THR B CA    1 
ATOM   4009  C C     . THR B  1 69  ? 78.236  124.239 -122.776 1.00 39.71  ? 69   THR B C     1 
ATOM   4010  O O     . THR B  1 69  ? 77.104  124.604 -122.425 1.00 39.30  ? 69   THR B O     1 
ATOM   4011  C CB    . THR B  1 69  ? 77.980  121.935 -123.537 1.00 43.33  ? 69   THR B CB    1 
ATOM   4012  O OG1   . THR B  1 69  ? 77.995  121.058 -124.673 1.00 47.04  ? 69   THR B OG1   1 
ATOM   4013  C CG2   . THR B  1 69  ? 76.591  121.971 -122.919 1.00 45.46  ? 69   THR B CG2   1 
ATOM   4014  N N     . ASP B  1 70  ? 79.330  124.620 -122.135 1.00 38.26  ? 70   ASP B N     1 
ATOM   4015  C CA    . ASP B  1 70  ? 79.191  125.436 -120.941 1.00 36.69  ? 70   ASP B CA    1 
ATOM   4016  C C     . ASP B  1 70  ? 78.443  126.753 -121.057 1.00 34.84  ? 70   ASP B C     1 
ATOM   4017  O O     . ASP B  1 70  ? 77.474  126.980 -120.347 1.00 34.27  ? 70   ASP B O     1 
ATOM   4018  C CB    . ASP B  1 70  ? 80.542  125.730 -120.320 1.00 36.36  ? 70   ASP B CB    1 
ATOM   4019  C CG    . ASP B  1 70  ? 80.402  126.363 -118.961 1.00 36.34  ? 70   ASP B CG    1 
ATOM   4020  O OD1   . ASP B  1 70  ? 80.176  125.613 -117.974 1.00 38.86  ? 70   ASP B OD1   1 
ATOM   4021  O OD2   . ASP B  1 70  ? 80.483  127.600 -118.888 1.00 34.90  ? 70   ASP B OD2   1 
ATOM   4022  N N     . PHE B  1 71  ? 78.905  127.633 -121.932 1.00 34.51  ? 71   PHE B N     1 
ATOM   4023  C CA    . PHE B  1 71  ? 78.268  128.930 -122.070 1.00 34.40  ? 71   PHE B CA    1 
ATOM   4024  C C     . PHE B  1 71  ? 76.807  128.888 -122.440 1.00 33.39  ? 71   PHE B C     1 
ATOM   4025  O O     . PHE B  1 71  ? 76.024  129.650 -121.905 1.00 32.80  ? 71   PHE B O     1 
ATOM   4026  C CB    . PHE B  1 71  ? 79.065  129.782 -123.054 1.00 35.53  ? 71   PHE B CB    1 
ATOM   4027  C CG    . PHE B  1 71  ? 80.157  130.588 -122.390 1.00 35.48  ? 71   PHE B CG    1 
ATOM   4028  C CD1   . PHE B  1 71  ? 80.753  130.136 -121.215 1.00 35.08  ? 71   PHE B CD1   1 
ATOM   4029  C CD2   . PHE B  1 71  ? 80.570  131.805 -122.924 1.00 35.45  ? 71   PHE B CD2   1 
ATOM   4030  C CE1   . PHE B  1 71  ? 81.742  130.885 -120.578 1.00 35.43  ? 71   PHE B CE1   1 
ATOM   4031  C CE2   . PHE B  1 71  ? 81.557  132.555 -122.295 1.00 35.26  ? 71   PHE B CE2   1 
ATOM   4032  C CZ    . PHE B  1 71  ? 82.142  132.094 -121.120 1.00 34.09  ? 71   PHE B CZ    1 
ATOM   4033  N N     . ALA B  1 72  ? 76.431  127.979 -123.330 1.00 34.75  ? 72   ALA B N     1 
ATOM   4034  C CA    . ALA B  1 72  ? 75.032  127.866 -123.729 1.00 35.56  ? 72   ALA B CA    1 
ATOM   4035  C C     . ALA B  1 72  ? 74.161  127.500 -122.539 1.00 35.62  ? 72   ALA B C     1 
ATOM   4036  O O     . ALA B  1 72  ? 73.080  128.056 -122.363 1.00 34.99  ? 72   ALA B O     1 
ATOM   4037  C CB    . ALA B  1 72  ? 74.874  126.812 -124.849 1.00 36.02  ? 72   ALA B CB    1 
ATOM   4038  N N     . SER B  1 73  ? 74.643  126.571 -121.717 1.00 35.32  ? 73   SER B N     1 
ATOM   4039  C CA    . SER B  1 73  ? 73.889  126.127 -120.540 1.00 36.11  ? 73   SER B CA    1 
ATOM   4040  C C     . SER B  1 73  ? 73.651  127.277 -119.576 1.00 35.79  ? 73   SER B C     1 
ATOM   4041  O O     . SER B  1 73  ? 72.796  127.189 -118.687 1.00 37.40  ? 73   SER B O     1 
ATOM   4042  C CB    . SER B  1 73  ? 74.656  125.035 -119.788 1.00 38.33  ? 73   SER B CB    1 
ATOM   4043  O OG    . SER B  1 73  ? 75.695  125.603 -119.001 1.00 37.09  ? 73   SER B OG    1 
ATOM   4044  N N     . ARG B  1 74  ? 74.408  128.347 -119.756 1.00 34.31  ? 74   ARG B N     1 
ATOM   4045  C CA    . ARG B  1 74  ? 74.308  129.520 -118.879 1.00 36.74  ? 74   ARG B CA    1 
ATOM   4046  C C     . ARG B  1 74  ? 73.519  130.663 -119.493 1.00 36.55  ? 74   ARG B C     1 
ATOM   4047  O O     . ARG B  1 74  ? 73.461  131.757 -118.929 1.00 35.89  ? 74   ARG B O     1 
ATOM   4048  C CB    . ARG B  1 74  ? 75.700  130.062 -118.535 1.00 36.56  ? 74   ARG B CB    1 
ATOM   4049  C CG    . ARG B  1 74  ? 76.592  129.100 -117.828 1.00 37.54  ? 74   ARG B CG    1 
ATOM   4050  C CD    . ARG B  1 74  ? 77.969  129.714 -117.598 1.00 38.07  ? 74   ARG B CD    1 
ATOM   4051  N NE    . ARG B  1 74  ? 78.830  128.680 -117.064 1.00 38.29  ? 74   ARG B NE    1 
ATOM   4052  C CZ    . ARG B  1 74  ? 78.775  128.244 -115.814 1.00 38.14  ? 74   ARG B CZ    1 
ATOM   4053  N NH1   . ARG B  1 74  ? 77.905  128.776 -114.956 1.00 36.59  ? 74   ARG B NH1   1 
ATOM   4054  N NH2   . ARG B  1 74  ? 79.562  127.238 -115.446 1.00 37.15  ? 74   ARG B NH2   1 
ATOM   4055  N N     . GLY B  1 75  ? 72.938  130.422 -120.661 1.00 37.31  ? 75   GLY B N     1 
ATOM   4056  C CA    . GLY B  1 75  ? 72.164  131.474 -121.299 1.00 37.02  ? 75   GLY B CA    1 
ATOM   4057  C C     . GLY B  1 75  ? 72.993  132.393 -122.176 1.00 36.59  ? 75   GLY B C     1 
ATOM   4058  O O     . GLY B  1 75  ? 72.525  133.453 -122.571 1.00 37.10  ? 75   GLY B O     1 
ATOM   4059  N N     . ILE B  1 76  ? 74.232  132.009 -122.466 1.00 37.25  ? 76   ILE B N     1 
ATOM   4060  C CA    . ILE B  1 76  ? 75.075  132.824 -123.325 1.00 37.55  ? 76   ILE B CA    1 
ATOM   4061  C C     . ILE B  1 76  ? 75.068  132.065 -124.648 1.00 40.10  ? 76   ILE B C     1 
ATOM   4062  O O     . ILE B  1 76  ? 75.794  131.080 -124.822 1.00 39.00  ? 76   ILE B O     1 
ATOM   4063  C CB    . ILE B  1 76  ? 76.495  132.937 -122.771 1.00 35.84  ? 76   ILE B CB    1 
ATOM   4064  C CG1   . ILE B  1 76  ? 76.446  133.416 -121.314 1.00 35.53  ? 76   ILE B CG1   1 
ATOM   4065  C CG2   . ILE B  1 76  ? 77.294  133.948 -123.575 1.00 34.98  ? 76   ILE B CG2   1 
ATOM   4066  C CD1   . ILE B  1 76  ? 77.778  133.289 -120.598 1.00 33.47  ? 76   ILE B CD1   1 
ATOM   4067  N N     . GLU B  1 77  ? 74.199  132.510 -125.556 1.00 41.99  ? 77   GLU B N     1 
ATOM   4068  C CA    . GLU B  1 77  ? 74.042  131.877 -126.867 1.00 44.77  ? 77   GLU B CA    1 
ATOM   4069  C C     . GLU B  1 77  ? 74.838  132.589 -127.939 1.00 45.31  ? 77   GLU B C     1 
ATOM   4070  O O     . GLU B  1 77  ? 74.796  133.809 -128.059 1.00 44.70  ? 77   GLU B O     1 
ATOM   4071  C CB    . GLU B  1 77  ? 72.575  131.858 -127.271 1.00 46.06  ? 77   GLU B CB    1 
ATOM   4072  C CG    . GLU B  1 77  ? 71.672  131.501 -126.121 1.00 50.62  ? 77   GLU B CG    1 
ATOM   4073  C CD    . GLU B  1 77  ? 70.255  131.226 -126.552 1.00 52.08  ? 77   GLU B CD    1 
ATOM   4074  O OE1   . GLU B  1 77  ? 69.713  132.010 -127.361 1.00 54.66  ? 77   GLU B OE1   1 
ATOM   4075  O OE2   . GLU B  1 77  ? 69.684  130.231 -126.065 1.00 53.38  ? 77   GLU B OE2   1 
ATOM   4076  N N     . MET B  1 78  ? 75.554  131.820 -128.737 1.00 47.10  ? 78   MET B N     1 
ATOM   4077  C CA    . MET B  1 78  ? 76.369  132.404 -129.771 1.00 49.34  ? 78   MET B CA    1 
ATOM   4078  C C     . MET B  1 78  ? 76.252  131.527 -130.986 1.00 51.69  ? 78   MET B C     1 
ATOM   4079  O O     . MET B  1 78  ? 76.460  130.313 -130.901 1.00 51.77  ? 78   MET B O     1 
ATOM   4080  C CB    . MET B  1 78  ? 77.799  132.462 -129.262 1.00 50.42  ? 78   MET B CB    1 
ATOM   4081  C CG    . MET B  1 78  ? 77.803  132.806 -127.778 1.00 50.61  ? 78   MET B CG    1 
ATOM   4082  S SD    . MET B  1 78  ? 79.374  132.848 -127.003 1.00 53.79  ? 78   MET B SD    1 
ATOM   4083  C CE    . MET B  1 78  ? 79.784  131.112 -127.000 1.00 52.10  ? 78   MET B CE    1 
ATOM   4084  N N     . SER B  1 79  ? 75.902  132.145 -132.108 1.00 53.08  ? 79   SER B N     1 
ATOM   4085  C CA    . SER B  1 79  ? 75.736  131.426 -133.357 1.00 55.59  ? 79   SER B CA    1 
ATOM   4086  C C     . SER B  1 79  ? 76.950  130.590 -133.733 1.00 55.33  ? 79   SER B C     1 
ATOM   4087  O O     . SER B  1 79  ? 76.836  129.378 -133.951 1.00 54.77  ? 79   SER B O     1 
ATOM   4088  C CB    . SER B  1 79  ? 75.414  132.408 -134.500 1.00 57.04  ? 79   SER B CB    1 
ATOM   4089  O OG    . SER B  1 79  ? 74.179  133.072 -134.275 1.00 58.52  ? 79   SER B OG    1 
ATOM   4090  N N     . GLU B  1 80  ? 78.114  131.227 -133.812 1.00 55.41  ? 80   GLU B N     1 
ATOM   4091  C CA    . GLU B  1 80  ? 79.309  130.484 -134.179 1.00 55.73  ? 80   GLU B CA    1 
ATOM   4092  C C     . GLU B  1 80  ? 80.490  130.915 -133.344 1.00 54.03  ? 80   GLU B C     1 
ATOM   4093  O O     . GLU B  1 80  ? 80.576  132.061 -132.918 1.00 54.27  ? 80   GLU B O     1 
ATOM   4094  C CB    . GLU B  1 80  ? 79.610  130.639 -135.662 1.00 59.08  ? 80   GLU B CB    1 
ATOM   4095  C CG    . GLU B  1 80  ? 80.628  129.626 -136.183 1.00 63.74  ? 80   GLU B CG    1 
ATOM   4096  C CD    . GLU B  1 80  ? 80.008  128.482 -136.996 1.00 67.15  ? 80   GLU B CD    1 
ATOM   4097  O OE1   . GLU B  1 80  ? 78.760  128.349 -137.043 1.00 69.39  ? 80   GLU B OE1   1 
ATOM   4098  O OE2   . GLU B  1 80  ? 80.792  127.705 -137.592 1.00 68.01  ? 80   GLU B OE2   1 
ATOM   4099  N N     . VAL B  1 81  ? 81.385  129.966 -133.089 1.00 51.67  ? 81   VAL B N     1 
ATOM   4100  C CA    . VAL B  1 81  ? 82.583  130.189 -132.302 1.00 49.20  ? 81   VAL B CA    1 
ATOM   4101  C C     . VAL B  1 81  ? 83.776  129.657 -133.071 1.00 48.34  ? 81   VAL B C     1 
ATOM   4102  O O     . VAL B  1 81  ? 83.886  128.461 -133.290 1.00 48.41  ? 81   VAL B O     1 
ATOM   4103  C CB    . VAL B  1 81  ? 82.497  129.466 -130.941 1.00 48.65  ? 81   VAL B CB    1 
ATOM   4104  C CG1   . VAL B  1 81  ? 83.822  129.613 -130.185 1.00 46.75  ? 81   VAL B CG1   1 
ATOM   4105  C CG2   . VAL B  1 81  ? 81.347  130.046 -130.126 1.00 47.44  ? 81   VAL B CG2   1 
ATOM   4106  N N     . ARG B  1 82  ? 84.674  130.548 -133.469 1.00 47.78  ? 82   ARG B N     1 
ATOM   4107  C CA    . ARG B  1 82  ? 85.844  130.133 -134.228 1.00 48.63  ? 82   ARG B CA    1 
ATOM   4108  C C     . ARG B  1 82  ? 87.149  130.520 -133.539 1.00 46.14  ? 82   ARG B C     1 
ATOM   4109  O O     . ARG B  1 82  ? 87.232  131.565 -132.884 1.00 46.07  ? 82   ARG B O     1 
ATOM   4110  C CB    . ARG B  1 82  ? 85.799  130.752 -135.638 1.00 51.88  ? 82   ARG B CB    1 
ATOM   4111  C CG    . ARG B  1 82  ? 84.485  130.480 -136.372 1.00 57.96  ? 82   ARG B CG    1 
ATOM   4112  C CD    . ARG B  1 82  ? 84.311  131.378 -137.598 1.00 62.81  ? 82   ARG B CD    1 
ATOM   4113  N NE    . ARG B  1 82  ? 82.922  131.426 -138.075 1.00 66.66  ? 82   ARG B NE    1 
ATOM   4114  C CZ    . ARG B  1 82  ? 82.264  130.407 -138.631 1.00 68.64  ? 82   ARG B CZ    1 
ATOM   4115  N NH1   . ARG B  1 82  ? 82.855  129.223 -138.799 1.00 69.50  ? 82   ARG B NH1   1 
ATOM   4116  N NH2   . ARG B  1 82  ? 81.002  130.572 -139.019 1.00 69.18  ? 82   ARG B NH2   1 
ATOM   4117  N N     . LEU B  1 83  ? 88.160  129.674 -133.707 1.00 43.46  ? 83   LEU B N     1 
ATOM   4118  C CA    . LEU B  1 83  ? 89.473  129.906 -133.132 1.00 43.22  ? 83   LEU B CA    1 
ATOM   4119  C C     . LEU B  1 83  ? 90.351  130.772 -134.035 1.00 43.44  ? 83   LEU B C     1 
ATOM   4120  O O     . LEU B  1 83  ? 90.504  130.488 -135.220 1.00 43.44  ? 83   LEU B O     1 
ATOM   4121  C CB    . LEU B  1 83  ? 90.191  128.570 -132.895 1.00 41.72  ? 83   LEU B CB    1 
ATOM   4122  C CG    . LEU B  1 83  ? 91.632  128.658 -132.373 1.00 41.53  ? 83   LEU B CG    1 
ATOM   4123  C CD1   . LEU B  1 83  ? 91.629  129.258 -130.978 1.00 41.21  ? 83   LEU B CD1   1 
ATOM   4124  C CD2   . LEU B  1 83  ? 92.255  127.275 -132.345 1.00 39.68  ? 83   LEU B CD2   1 
ATOM   4125  N N     . ASN B  1 84  ? 90.909  131.843 -133.486 1.00 42.61  ? 84   ASN B N     1 
ATOM   4126  C CA    . ASN B  1 84  ? 91.825  132.678 -134.246 1.00 41.43  ? 84   ASN B CA    1 
ATOM   4127  C C     . ASN B  1 84  ? 93.144  132.445 -133.517 1.00 41.02  ? 84   ASN B C     1 
ATOM   4128  O O     . ASN B  1 84  ? 93.538  133.222 -132.647 1.00 41.08  ? 84   ASN B O     1 
ATOM   4129  C CB    . ASN B  1 84  ? 91.450  134.163 -134.177 1.00 39.93  ? 84   ASN B CB    1 
ATOM   4130  C CG    . ASN B  1 84  ? 92.351  135.017 -135.037 1.00 38.93  ? 84   ASN B CG    1 
ATOM   4131  O OD1   . ASN B  1 84  ? 93.489  134.648 -135.314 1.00 37.44  ? 84   ASN B OD1   1 
ATOM   4132  N ND2   . ASN B  1 84  ? 91.854  136.168 -135.455 1.00 40.36  ? 84   ASN B ND2   1 
ATOM   4133  N N     . LEU B  1 85  ? 93.810  131.354 -133.862 1.00 40.67  ? 85   LEU B N     1 
ATOM   4134  C CA    . LEU B  1 85  ? 95.060  131.008 -133.223 1.00 41.58  ? 85   LEU B CA    1 
ATOM   4135  C C     . LEU B  1 85  ? 96.086  132.136 -133.275 1.00 42.51  ? 85   LEU B C     1 
ATOM   4136  O O     . LEU B  1 85  ? 96.877  132.302 -132.344 1.00 43.45  ? 85   LEU B O     1 
ATOM   4137  C CB    . LEU B  1 85  ? 95.637  129.728 -133.834 1.00 39.93  ? 85   LEU B CB    1 
ATOM   4138  C CG    . LEU B  1 85  ? 96.793  129.107 -133.041 1.00 40.81  ? 85   LEU B CG    1 
ATOM   4139  C CD1   . LEU B  1 85  ? 96.333  128.775 -131.598 1.00 40.69  ? 85   LEU B CD1   1 
ATOM   4140  C CD2   . LEU B  1 85  ? 97.284  127.851 -133.763 1.00 39.34  ? 85   LEU B CD2   1 
ATOM   4141  N N     . ASP B  1 86  ? 96.079  132.915 -134.350 1.00 43.97  ? 86   ASP B N     1 
ATOM   4142  C CA    . ASP B  1 86  ? 97.020  134.029 -134.467 1.00 43.40  ? 86   ASP B CA    1 
ATOM   4143  C C     . ASP B  1 86  ? 96.825  135.052 -133.345 1.00 43.60  ? 86   ASP B C     1 
ATOM   4144  O O     . ASP B  1 86  ? 97.798  135.533 -132.741 1.00 41.43  ? 86   ASP B O     1 
ATOM   4145  C CB    . ASP B  1 86  ? 96.857  134.745 -135.812 1.00 46.03  ? 86   ASP B CB    1 
ATOM   4146  C CG    . ASP B  1 86  ? 97.543  134.016 -136.963 1.00 48.16  ? 86   ASP B CG    1 
ATOM   4147  O OD1   . ASP B  1 86  ? 98.710  133.593 -136.807 1.00 48.53  ? 86   ASP B OD1   1 
ATOM   4148  O OD2   . ASP B  1 86  ? 96.923  133.879 -138.038 1.00 50.49  ? 86   ASP B OD2   1 
ATOM   4149  N N     . LYS B  1 87  ? 95.567  135.391 -133.079 1.00 43.17  ? 87   LYS B N     1 
ATOM   4150  C CA    . LYS B  1 87  ? 95.261  136.364 -132.045 1.00 43.12  ? 87   LYS B CA    1 
ATOM   4151  C C     . LYS B  1 87  ? 95.442  135.781 -130.646 1.00 42.50  ? 87   LYS B C     1 
ATOM   4152  O O     . LYS B  1 87  ? 95.813  136.510 -129.723 1.00 43.41  ? 87   LYS B O     1 
ATOM   4153  C CB    . LYS B  1 87  ? 93.832  136.896 -132.198 1.00 44.12  ? 87   LYS B CB    1 
ATOM   4154  C CG    . LYS B  1 87  ? 93.608  138.183 -131.419 1.00 47.85  ? 87   LYS B CG    1 
ATOM   4155  C CD    . LYS B  1 87  ? 92.135  138.513 -131.297 1.00 53.00  ? 87   LYS B CD    1 
ATOM   4156  C CE    . LYS B  1 87  ? 91.500  138.950 -132.625 1.00 55.55  ? 87   LYS B CE    1 
ATOM   4157  N NZ    . LYS B  1 87  ? 91.859  140.348 -133.019 1.00 57.82  ? 87   LYS B NZ    1 
ATOM   4158  N N     . MET B  1 88  ? 95.177  134.484 -130.485 1.00 40.24  ? 88   MET B N     1 
ATOM   4159  C CA    . MET B  1 88  ? 95.329  133.851 -129.181 1.00 38.85  ? 88   MET B CA    1 
ATOM   4160  C C     . MET B  1 88  ? 96.804  133.840 -128.819 1.00 38.73  ? 88   MET B C     1 
ATOM   4161  O O     . MET B  1 88  ? 97.173  134.106 -127.684 1.00 39.24  ? 88   MET B O     1 
ATOM   4162  C CB    . MET B  1 88  ? 94.791  132.418 -129.205 1.00 37.76  ? 88   MET B CB    1 
ATOM   4163  C CG    . MET B  1 88  ? 94.780  131.720 -127.830 1.00 32.91  ? 88   MET B CG    1 
ATOM   4164  S SD    . MET B  1 88  ? 94.047  130.082 -127.922 1.00 29.43  ? 88   MET B SD    1 
ATOM   4165  C CE    . MET B  1 88  ? 92.281  130.566 -128.080 1.00 25.56  ? 88   MET B CE    1 
ATOM   4166  N N     . MET B  1 89  ? 97.654  133.524 -129.789 1.00 38.87  ? 89   MET B N     1 
ATOM   4167  C CA    . MET B  1 89  ? 99.088  133.520 -129.540 1.00 39.25  ? 89   MET B CA    1 
ATOM   4168  C C     . MET B  1 89  ? 99.557  134.955 -129.285 1.00 41.01  ? 89   MET B C     1 
ATOM   4169  O O     . MET B  1 89  ? 100.516 135.194 -128.547 1.00 40.72  ? 89   MET B O     1 
ATOM   4170  C CB    . MET B  1 89  ? 99.826  132.938 -130.742 1.00 39.20  ? 89   MET B CB    1 
ATOM   4171  C CG    . MET B  1 89  ? 99.708  131.426 -130.873 1.00 37.78  ? 89   MET B CG    1 
ATOM   4172  S SD    . MET B  1 89  ? 100.836 130.604 -129.751 1.00 34.33  ? 89   MET B SD    1 
ATOM   4173  C CE    . MET B  1 89  ? 100.207 128.869 -129.893 1.00 31.88  ? 89   MET B CE    1 
ATOM   4174  N N     . GLU B  1 90  ? 98.865  135.905 -129.903 1.00 42.25  ? 90   GLU B N     1 
ATOM   4175  C CA    . GLU B  1 90  ? 99.186  137.310 -129.751 1.00 44.10  ? 90   GLU B CA    1 
ATOM   4176  C C     . GLU B  1 90  ? 99.005  137.705 -128.286 1.00 43.06  ? 90   GLU B C     1 
ATOM   4177  O O     . GLU B  1 90  ? 99.857  138.374 -127.711 1.00 42.01  ? 90   GLU B O     1 
ATOM   4178  C CB    . GLU B  1 90  ? 98.253  138.143 -130.629 1.00 47.62  ? 90   GLU B CB    1 
ATOM   4179  C CG    . GLU B  1 90  ? 98.622  139.603 -130.738 1.00 52.54  ? 90   GLU B CG    1 
ATOM   4180  C CD    . GLU B  1 90  ? 97.521  140.426 -131.384 1.00 56.25  ? 90   GLU B CD    1 
ATOM   4181  O OE1   . GLU B  1 90  ? 96.642  140.938 -130.649 1.00 56.54  ? 90   GLU B OE1   1 
ATOM   4182  O OE2   . GLU B  1 90  ? 97.525  140.550 -132.632 1.00 58.67  ? 90   GLU B OE2   1 
ATOM   4183  N N     . GLN B  1 91  ? 97.879  137.295 -127.696 1.00 41.34  ? 91   GLN B N     1 
ATOM   4184  C CA    . GLN B  1 91  ? 97.591  137.596 -126.297 1.00 40.04  ? 91   GLN B CA    1 
ATOM   4185  C C     . GLN B  1 91  ? 98.753  137.028 -125.478 1.00 37.68  ? 91   GLN B C     1 
ATOM   4186  O O     . GLN B  1 91  ? 99.328  137.716 -124.631 1.00 35.68  ? 91   GLN B O     1 
ATOM   4187  C CB    . GLN B  1 91  ? 96.242  136.972 -125.899 1.00 40.67  ? 91   GLN B CB    1 
ATOM   4188  C CG    . GLN B  1 91  ? 95.662  137.443 -124.573 1.00 41.84  ? 91   GLN B CG    1 
ATOM   4189  C CD    . GLN B  1 91  ? 96.293  136.737 -123.390 1.00 43.47  ? 91   GLN B CD    1 
ATOM   4190  O OE1   . GLN B  1 91  ? 96.467  135.519 -123.407 1.00 43.50  ? 91   GLN B OE1   1 
ATOM   4191  N NE2   . GLN B  1 91  ? 96.632  137.494 -122.350 1.00 44.29  ? 91   GLN B NE2   1 
ATOM   4192  N N     . LYS B  1 92  ? 99.117  135.781 -125.767 1.00 35.90  ? 92   LYS B N     1 
ATOM   4193  C CA    . LYS B  1 92  ? 100.227 135.128 -125.078 1.00 34.70  ? 92   LYS B CA    1 
ATOM   4194  C C     . LYS B  1 92  ? 101.479 136.012 -125.119 1.00 36.35  ? 92   LYS B C     1 
ATOM   4195  O O     . LYS B  1 92  ? 102.032 136.375 -124.077 1.00 36.67  ? 92   LYS B O     1 
ATOM   4196  C CB    . LYS B  1 92  ? 100.565 133.790 -125.735 1.00 31.03  ? 92   LYS B CB    1 
ATOM   4197  C CG    . LYS B  1 92  ? 101.842 133.139 -125.198 1.00 30.19  ? 92   LYS B CG    1 
ATOM   4198  C CD    . LYS B  1 92  ? 102.401 132.039 -126.119 1.00 29.21  ? 92   LYS B CD    1 
ATOM   4199  C CE    . LYS B  1 92  ? 102.750 132.569 -127.511 1.00 27.52  ? 92   LYS B CE    1 
ATOM   4200  N NZ    . LYS B  1 92  ? 103.746 131.688 -128.205 1.00 26.44  ? 92   LYS B NZ    1 
ATOM   4201  N N     . SER B  1 93  ? 101.922 136.349 -126.326 1.00 36.67  ? 93   SER B N     1 
ATOM   4202  C CA    . SER B  1 93  ? 103.110 137.168 -126.498 1.00 39.44  ? 93   SER B CA    1 
ATOM   4203  C C     . SER B  1 93  ? 103.056 138.498 -125.747 1.00 39.74  ? 93   SER B C     1 
ATOM   4204  O O     . SER B  1 93  ? 104.051 138.928 -125.166 1.00 39.49  ? 93   SER B O     1 
ATOM   4205  C CB    . SER B  1 93  ? 103.351 137.419 -127.985 1.00 41.22  ? 93   SER B CB    1 
ATOM   4206  O OG    . SER B  1 93  ? 103.579 136.192 -128.642 1.00 41.52  ? 93   SER B OG    1 
ATOM   4207  N N     . THR B  1 94  ? 101.895 139.143 -125.758 1.00 40.27  ? 94   THR B N     1 
ATOM   4208  C CA    . THR B  1 94  ? 101.727 140.415 -125.069 1.00 42.52  ? 94   THR B CA    1 
ATOM   4209  C C     . THR B  1 94  ? 102.072 140.274 -123.586 1.00 44.13  ? 94   THR B C     1 
ATOM   4210  O O     . THR B  1 94  ? 102.798 141.106 -123.024 1.00 45.30  ? 94   THR B O     1 
ATOM   4211  C CB    . THR B  1 94  ? 100.288 140.932 -125.219 1.00 43.87  ? 94   THR B CB    1 
ATOM   4212  O OG1   . THR B  1 94  ? 100.025 141.192 -126.608 1.00 46.05  ? 94   THR B OG1   1 
ATOM   4213  C CG2   . THR B  1 94  ? 100.096 142.209 -124.417 1.00 43.42  ? 94   THR B CG2   1 
ATOM   4214  N N     . ALA B  1 95  ? 101.565 139.219 -122.952 1.00 43.50  ? 95   ALA B N     1 
ATOM   4215  C CA    . ALA B  1 95  ? 101.858 138.975 -121.546 1.00 42.74  ? 95   ALA B CA    1 
ATOM   4216  C C     . ALA B  1 95  ? 103.359 138.778 -121.346 1.00 42.32  ? 95   ALA B C     1 
ATOM   4217  O O     . ALA B  1 95  ? 103.948 139.328 -120.411 1.00 41.72  ? 95   ALA B O     1 
ATOM   4218  C CB    . ALA B  1 95  ? 101.105 137.738 -121.053 1.00 43.71  ? 95   ALA B CB    1 
ATOM   4219  N N     . VAL B  1 96  ? 103.973 137.979 -122.215 1.00 41.95  ? 96   VAL B N     1 
ATOM   4220  C CA    . VAL B  1 96  ? 105.398 137.725 -122.111 1.00 43.20  ? 96   VAL B CA    1 
ATOM   4221  C C     . VAL B  1 96  ? 106.216 139.003 -122.325 1.00 45.10  ? 96   VAL B C     1 
ATOM   4222  O O     . VAL B  1 96  ? 107.214 139.229 -121.633 1.00 45.02  ? 96   VAL B O     1 
ATOM   4223  C CB    . VAL B  1 96  ? 105.862 136.662 -123.120 1.00 43.64  ? 96   VAL B CB    1 
ATOM   4224  C CG1   . VAL B  1 96  ? 107.388 136.566 -123.115 1.00 43.17  ? 96   VAL B CG1   1 
ATOM   4225  C CG2   . VAL B  1 96  ? 105.249 135.311 -122.768 1.00 42.80  ? 96   VAL B CG2   1 
ATOM   4226  N N     . LYS B  1 97  ? 105.802 139.840 -123.270 1.00 45.23  ? 97   LYS B N     1 
ATOM   4227  C CA    . LYS B  1 97  ? 106.539 141.075 -123.517 1.00 46.35  ? 97   LYS B CA    1 
ATOM   4228  C C     . LYS B  1 97  ? 106.434 142.018 -122.307 1.00 46.24  ? 97   LYS B C     1 
ATOM   4229  O O     . LYS B  1 97  ? 107.440 142.570 -121.844 1.00 46.70  ? 97   LYS B O     1 
ATOM   4230  C CB    . LYS B  1 97  ? 106.034 141.763 -124.799 1.00 46.05  ? 97   LYS B CB    1 
ATOM   4231  C CG    . LYS B  1 97  ? 106.737 143.097 -125.078 1.00 48.19  ? 97   LYS B CG    1 
ATOM   4232  C CD    . LYS B  1 97  ? 106.788 143.443 -126.568 1.00 50.19  ? 97   LYS B CD    1 
ATOM   4233  C CE    . LYS B  1 97  ? 107.504 144.788 -126.798 1.00 52.71  ? 97   LYS B CE    1 
ATOM   4234  N NZ    . LYS B  1 97  ? 108.902 144.821 -126.236 1.00 53.48  ? 97   LYS B NZ    1 
ATOM   4235  N N     . ALA B  1 98  ? 105.223 142.166 -121.777 1.00 46.32  ? 98   ALA B N     1 
ATOM   4236  C CA    . ALA B  1 98  ? 104.989 143.032 -120.631 1.00 45.97  ? 98   ALA B CA    1 
ATOM   4237  C C     . ALA B  1 98  ? 105.748 142.596 -119.381 1.00 46.11  ? 98   ALA B C     1 
ATOM   4238  O O     . ALA B  1 98  ? 106.324 143.425 -118.678 1.00 46.93  ? 98   ALA B O     1 
ATOM   4239  C CB    . ALA B  1 98  ? 103.504 143.102 -120.330 1.00 45.46  ? 98   ALA B CB    1 
ATOM   4240  N N     . LEU B  1 99  ? 105.761 141.299 -119.100 1.00 45.51  ? 99   LEU B N     1 
ATOM   4241  C CA    . LEU B  1 99  ? 106.439 140.826 -117.907 1.00 44.76  ? 99   LEU B CA    1 
ATOM   4242  C C     . LEU B  1 99  ? 107.956 140.877 -118.005 1.00 45.47  ? 99   LEU B C     1 
ATOM   4243  O O     . LEU B  1 99  ? 108.645 141.097 -117.003 1.00 44.46  ? 99   LEU B O     1 
ATOM   4244  C CB    . LEU B  1 99  ? 105.962 139.416 -117.550 1.00 43.39  ? 99   LEU B CB    1 
ATOM   4245  C CG    . LEU B  1 99  ? 104.520 139.391 -117.030 1.00 43.68  ? 99   LEU B CG    1 
ATOM   4246  C CD1   . LEU B  1 99  ? 104.078 137.956 -116.789 1.00 42.36  ? 99   LEU B CD1   1 
ATOM   4247  C CD2   . LEU B  1 99  ? 104.427 140.211 -115.742 1.00 41.41  ? 99   LEU B CD2   1 
ATOM   4248  N N     . THR B  1 100 ? 108.497 140.672 -119.198 1.00 46.27  ? 100  THR B N     1 
ATOM   4249  C CA    . THR B  1 100 ? 109.944 140.738 -119.314 1.00 46.82  ? 100  THR B CA    1 
ATOM   4250  C C     . THR B  1 100 ? 110.365 142.195 -119.187 1.00 46.44  ? 100  THR B C     1 
ATOM   4251  O O     . THR B  1 100 ? 111.428 142.501 -118.644 1.00 46.34  ? 100  THR B O     1 
ATOM   4252  C CB    . THR B  1 100 ? 110.450 140.145 -120.637 1.00 46.71  ? 100  THR B CB    1 
ATOM   4253  O OG1   . THR B  1 100 ? 109.814 140.798 -121.739 1.00 49.36  ? 100  THR B OG1   1 
ATOM   4254  C CG2   . THR B  1 100 ? 110.161 138.657 -120.668 1.00 48.36  ? 100  THR B CG2   1 
ATOM   4255  N N     . GLY B  1 101 ? 109.515 143.095 -119.670 1.00 46.23  ? 101  GLY B N     1 
ATOM   4256  C CA    . GLY B  1 101 ? 109.830 144.502 -119.560 1.00 46.88  ? 101  GLY B CA    1 
ATOM   4257  C C     . GLY B  1 101 ? 109.833 144.880 -118.095 1.00 47.16  ? 101  GLY B C     1 
ATOM   4258  O O     . GLY B  1 101 ? 110.682 145.650 -117.637 1.00 46.43  ? 101  GLY B O     1 
ATOM   4259  N N     . GLY B  1 102 ? 108.881 144.304 -117.362 1.00 46.79  ? 102  GLY B N     1 
ATOM   4260  C CA    . GLY B  1 102 ? 108.741 144.575 -115.942 1.00 47.13  ? 102  GLY B CA    1 
ATOM   4261  C C     . GLY B  1 102 ? 110.010 144.325 -115.166 1.00 46.96  ? 102  GLY B C     1 
ATOM   4262  O O     . GLY B  1 102 ? 110.334 145.071 -114.242 1.00 47.69  ? 102  GLY B O     1 
ATOM   4263  N N     . ILE B  1 103 ? 110.727 143.269 -115.532 1.00 46.05  ? 103  ILE B N     1 
ATOM   4264  C CA    . ILE B  1 103 ? 111.974 142.956 -114.865 1.00 46.35  ? 103  ILE B CA    1 
ATOM   4265  C C     . ILE B  1 103 ? 113.051 143.986 -115.217 1.00 46.77  ? 103  ILE B C     1 
ATOM   4266  O O     . ILE B  1 103 ? 113.880 144.328 -114.369 1.00 46.71  ? 103  ILE B O     1 
ATOM   4267  C CB    . ILE B  1 103 ? 112.461 141.547 -115.230 1.00 46.36  ? 103  ILE B CB    1 
ATOM   4268  C CG1   . ILE B  1 103 ? 111.457 140.516 -114.693 1.00 46.34  ? 103  ILE B CG1   1 
ATOM   4269  C CG2   . ILE B  1 103 ? 113.857 141.297 -114.650 1.00 42.74  ? 103  ILE B CG2   1 
ATOM   4270  C CD1   . ILE B  1 103 ? 111.831 139.089 -115.018 1.00 48.33  ? 103  ILE B CD1   1 
ATOM   4271  N N     . ALA B  1 104 ? 113.045 144.472 -116.456 1.00 46.75  ? 104  ALA B N     1 
ATOM   4272  C CA    . ALA B  1 104 ? 114.012 145.487 -116.864 1.00 47.34  ? 104  ALA B CA    1 
ATOM   4273  C C     . ALA B  1 104 ? 113.752 146.701 -115.979 1.00 47.51  ? 104  ALA B C     1 
ATOM   4274  O O     . ALA B  1 104 ? 114.674 147.307 -115.443 1.00 47.44  ? 104  ALA B O     1 
ATOM   4275  C CB    . ALA B  1 104 ? 113.819 145.852 -118.332 1.00 46.70  ? 104  ALA B CB    1 
ATOM   4276  N N     . HIS B  1 105 ? 112.477 147.043 -115.819 1.00 48.47  ? 105  HIS B N     1 
ATOM   4277  C CA    . HIS B  1 105 ? 112.096 148.177 -114.990 1.00 49.65  ? 105  HIS B CA    1 
ATOM   4278  C C     . HIS B  1 105 ? 112.430 147.965 -113.500 1.00 49.22  ? 105  HIS B C     1 
ATOM   4279  O O     . HIS B  1 105 ? 112.852 148.900 -112.804 1.00 47.61  ? 105  HIS B O     1 
ATOM   4280  C CB    . HIS B  1 105 ? 110.603 148.458 -115.130 1.00 52.67  ? 105  HIS B CB    1 
ATOM   4281  C CG    . HIS B  1 105 ? 110.115 149.517 -114.196 1.00 57.39  ? 105  HIS B CG    1 
ATOM   4282  N ND1   . HIS B  1 105 ? 110.325 150.859 -114.424 1.00 59.67  ? 105  HIS B ND1   1 
ATOM   4283  C CD2   . HIS B  1 105 ? 109.503 149.429 -112.989 1.00 59.26  ? 105  HIS B CD2   1 
ATOM   4284  C CE1   . HIS B  1 105 ? 109.863 151.555 -113.398 1.00 61.05  ? 105  HIS B CE1   1 
ATOM   4285  N NE2   . HIS B  1 105 ? 109.361 150.710 -112.513 1.00 61.19  ? 105  HIS B NE2   1 
ATOM   4286  N N     . LEU B  1 106 ? 112.225 146.744 -113.009 1.00 47.73  ? 106  LEU B N     1 
ATOM   4287  C CA    . LEU B  1 106 ? 112.523 146.452 -111.613 1.00 47.40  ? 106  LEU B CA    1 
ATOM   4288  C C     . LEU B  1 106 ? 114.036 146.505 -111.345 1.00 47.83  ? 106  LEU B C     1 
ATOM   4289  O O     . LEU B  1 106 ? 114.466 146.963 -110.285 1.00 47.54  ? 106  LEU B O     1 
ATOM   4290  C CB    . LEU B  1 106 ? 111.939 145.088 -111.208 1.00 46.65  ? 106  LEU B CB    1 
ATOM   4291  C CG    . LEU B  1 106 ? 110.400 145.015 -111.144 1.00 46.10  ? 106  LEU B CG    1 
ATOM   4292  C CD1   . LEU B  1 106 ? 109.938 143.587 -110.878 1.00 44.29  ? 106  LEU B CD1   1 
ATOM   4293  C CD2   . LEU B  1 106 ? 109.895 145.960 -110.059 1.00 45.59  ? 106  LEU B CD2   1 
ATOM   4294  N N     . PHE B  1 107 ? 114.846 146.051 -112.298 1.00 47.90  ? 107  PHE B N     1 
ATOM   4295  C CA    . PHE B  1 107 ? 116.297 146.098 -112.119 1.00 49.27  ? 107  PHE B CA    1 
ATOM   4296  C C     . PHE B  1 107 ? 116.720 147.573 -112.025 1.00 50.45  ? 107  PHE B C     1 
ATOM   4297  O O     . PHE B  1 107 ? 117.492 147.966 -111.143 1.00 49.79  ? 107  PHE B O     1 
ATOM   4298  C CB    . PHE B  1 107 ? 117.021 145.410 -113.293 1.00 47.74  ? 107  PHE B CB    1 
ATOM   4299  C CG    . PHE B  1 107 ? 117.254 143.921 -113.097 1.00 48.14  ? 107  PHE B CG    1 
ATOM   4300  C CD1   . PHE B  1 107 ? 116.758 143.256 -111.975 1.00 47.50  ? 107  PHE B CD1   1 
ATOM   4301  C CD2   . PHE B  1 107 ? 117.982 143.189 -114.038 1.00 47.44  ? 107  PHE B CD2   1 
ATOM   4302  C CE1   . PHE B  1 107 ? 116.984 141.893 -111.793 1.00 47.48  ? 107  PHE B CE1   1 
ATOM   4303  C CE2   . PHE B  1 107 ? 118.216 141.829 -113.863 1.00 47.86  ? 107  PHE B CE2   1 
ATOM   4304  C CZ    . PHE B  1 107 ? 117.714 141.178 -112.739 1.00 48.03  ? 107  PHE B CZ    1 
ATOM   4305  N N     . LYS B  1 108 ? 116.178 148.383 -112.928 1.00 51.10  ? 108  LYS B N     1 
ATOM   4306  C CA    . LYS B  1 108 ? 116.471 149.802 -112.966 1.00 52.55  ? 108  LYS B CA    1 
ATOM   4307  C C     . LYS B  1 108 ? 116.070 150.449 -111.641 1.00 52.62  ? 108  LYS B C     1 
ATOM   4308  O O     . LYS B  1 108 ? 116.840 151.197 -111.050 1.00 51.92  ? 108  LYS B O     1 
ATOM   4309  C CB    . LYS B  1 108 ? 115.708 150.437 -114.122 1.00 54.24  ? 108  LYS B CB    1 
ATOM   4310  C CG    . LYS B  1 108 ? 116.263 151.753 -114.594 1.00 57.45  ? 108  LYS B CG    1 
ATOM   4311  C CD    . LYS B  1 108 ? 116.392 151.758 -116.115 1.00 60.23  ? 108  LYS B CD    1 
ATOM   4312  C CE    . LYS B  1 108 ? 117.426 150.732 -116.600 1.00 61.91  ? 108  LYS B CE    1 
ATOM   4313  N NZ    . LYS B  1 108 ? 117.594 150.768 -118.088 1.00 62.97  ? 108  LYS B NZ    1 
ATOM   4314  N N     . GLN B  1 109 ? 114.863 150.147 -111.174 1.00 52.73  ? 109  GLN B N     1 
ATOM   4315  C CA    . GLN B  1 109 ? 114.365 150.700 -109.920 1.00 52.35  ? 109  GLN B CA    1 
ATOM   4316  C C     . GLN B  1 109 ? 115.222 150.334 -108.714 1.00 52.35  ? 109  GLN B C     1 
ATOM   4317  O O     . GLN B  1 109 ? 115.355 151.118 -107.779 1.00 52.51  ? 109  GLN B O     1 
ATOM   4318  C CB    . GLN B  1 109 ? 112.929 150.239 -109.668 1.00 53.44  ? 109  GLN B CB    1 
ATOM   4319  C CG    . GLN B  1 109 ? 112.411 150.585 -108.269 1.00 53.50  ? 109  GLN B CG    1 
ATOM   4320  C CD    . GLN B  1 109 ? 111.022 150.048 -108.016 1.00 54.10  ? 109  GLN B CD    1 
ATOM   4321  O OE1   . GLN B  1 109 ? 110.068 150.432 -108.688 1.00 53.72  ? 109  GLN B OE1   1 
ATOM   4322  N NE2   . GLN B  1 109 ? 110.902 149.146 -107.049 1.00 53.96  ? 109  GLN B NE2   1 
ATOM   4323  N N     . ASN B  1 110 ? 115.794 149.139 -108.716 1.00 52.23  ? 110  ASN B N     1 
ATOM   4324  C CA    . ASN B  1 110 ? 116.628 148.738 -107.592 1.00 52.92  ? 110  ASN B CA    1 
ATOM   4325  C C     . ASN B  1 110 ? 118.117 148.935 -107.907 1.00 53.38  ? 110  ASN B C     1 
ATOM   4326  O O     . ASN B  1 110 ? 118.997 148.456 -107.187 1.00 52.43  ? 110  ASN B O     1 
ATOM   4327  C CB    . ASN B  1 110 ? 116.328 147.282 -107.211 1.00 52.95  ? 110  ASN B CB    1 
ATOM   4328  C CG    . ASN B  1 110 ? 114.941 147.115 -106.598 1.00 53.24  ? 110  ASN B CG    1 
ATOM   4329  O OD1   . ASN B  1 110 ? 114.695 147.508 -105.449 1.00 52.52  ? 110  ASN B OD1   1 
ATOM   4330  N ND2   . ASN B  1 110 ? 114.023 146.547 -107.372 1.00 53.39  ? 110  ASN B ND2   1 
ATOM   4331  N N     . LYS B  1 111 ? 118.380 149.652 -108.992 1.00 53.99  ? 111  LYS B N     1 
ATOM   4332  C CA    . LYS B  1 111 ? 119.742 149.939 -109.419 1.00 55.37  ? 111  LYS B CA    1 
ATOM   4333  C C     . LYS B  1 111 ? 120.614 148.706 -109.593 1.00 55.23  ? 111  LYS B C     1 
ATOM   4334  O O     . LYS B  1 111 ? 121.811 148.717 -109.281 1.00 55.43  ? 111  LYS B O     1 
ATOM   4335  C CB    . LYS B  1 111 ? 120.400 150.921 -108.445 1.00 57.05  ? 111  LYS B CB    1 
ATOM   4336  C CG    . LYS B  1 111 ? 119.704 152.283 -108.404 1.00 58.98  ? 111  LYS B CG    1 
ATOM   4337  C CD    . LYS B  1 111 ? 120.185 153.103 -107.213 1.00 61.58  ? 111  LYS B CD    1 
ATOM   4338  C CE    . LYS B  1 111 ? 119.318 154.332 -106.986 1.00 62.73  ? 111  LYS B CE    1 
ATOM   4339  N NZ    . LYS B  1 111 ? 119.587 154.935 -105.643 1.00 63.14  ? 111  LYS B NZ    1 
ATOM   4340  N N     . VAL B  1 112 ? 120.005 147.628 -110.067 1.00 54.54  ? 112  VAL B N     1 
ATOM   4341  C CA    . VAL B  1 112 ? 120.756 146.416 -110.344 1.00 52.93  ? 112  VAL B CA    1 
ATOM   4342  C C     . VAL B  1 112 ? 121.300 146.728 -111.738 1.00 53.58  ? 112  VAL B C     1 
ATOM   4343  O O     . VAL B  1 112 ? 120.594 147.333 -112.552 1.00 51.78  ? 112  VAL B O     1 
ATOM   4344  C CB    . VAL B  1 112 ? 119.835 145.171 -110.426 1.00 51.43  ? 112  VAL B CB    1 
ATOM   4345  C CG1   . VAL B  1 112 ? 120.631 143.969 -110.922 1.00 49.09  ? 112  VAL B CG1   1 
ATOM   4346  C CG2   . VAL B  1 112 ? 119.217 144.884 -109.058 1.00 50.87  ? 112  VAL B CG2   1 
ATOM   4347  N N     . VAL B  1 113 ? 122.546 146.349 -112.017 1.00 54.01  ? 113  VAL B N     1 
ATOM   4348  C CA    . VAL B  1 113 ? 123.101 146.617 -113.341 1.00 54.66  ? 113  VAL B CA    1 
ATOM   4349  C C     . VAL B  1 113 ? 123.007 145.391 -114.241 1.00 54.59  ? 113  VAL B C     1 
ATOM   4350  O O     . VAL B  1 113 ? 123.474 144.299 -113.888 1.00 54.22  ? 113  VAL B O     1 
ATOM   4351  C CB    . VAL B  1 113 ? 124.565 147.068 -113.269 1.00 55.13  ? 113  VAL B CB    1 
ATOM   4352  C CG1   . VAL B  1 113 ? 125.383 146.029 -112.565 1.00 55.14  ? 113  VAL B CG1   1 
ATOM   4353  C CG2   . VAL B  1 113 ? 125.097 147.303 -114.672 1.00 54.48  ? 113  VAL B CG2   1 
ATOM   4354  N N     . HIS B  1 114 ? 122.410 145.598 -115.411 1.00 54.82  ? 114  HIS B N     1 
ATOM   4355  C CA    . HIS B  1 114 ? 122.197 144.540 -116.397 1.00 55.52  ? 114  HIS B CA    1 
ATOM   4356  C C     . HIS B  1 114 ? 123.314 144.395 -117.438 1.00 56.15  ? 114  HIS B C     1 
ATOM   4357  O O     . HIS B  1 114 ? 123.499 145.252 -118.306 1.00 55.43  ? 114  HIS B O     1 
ATOM   4358  C CB    . HIS B  1 114 ? 120.838 144.770 -117.093 1.00 54.57  ? 114  HIS B CB    1 
ATOM   4359  C CG    . HIS B  1 114 ? 120.519 143.792 -118.185 1.00 53.56  ? 114  HIS B CG    1 
ATOM   4360  N ND1   . HIS B  1 114 ? 121.223 142.622 -118.379 1.00 54.31  ? 114  HIS B ND1   1 
ATOM   4361  C CD2   . HIS B  1 114 ? 119.549 143.806 -119.130 1.00 53.43  ? 114  HIS B CD2   1 
ATOM   4362  C CE1   . HIS B  1 114 ? 120.703 141.960 -119.398 1.00 53.99  ? 114  HIS B CE1   1 
ATOM   4363  N NE2   . HIS B  1 114 ? 119.685 142.656 -119.870 1.00 54.45  ? 114  HIS B NE2   1 
ATOM   4364  N N     . VAL B  1 115 ? 124.051 143.293 -117.330 1.00 57.14  ? 115  VAL B N     1 
ATOM   4365  C CA    . VAL B  1 115 ? 125.131 142.975 -118.251 1.00 58.52  ? 115  VAL B CA    1 
ATOM   4366  C C     . VAL B  1 115 ? 124.615 141.948 -119.257 1.00 59.83  ? 115  VAL B C     1 
ATOM   4367  O O     . VAL B  1 115 ? 124.421 140.781 -118.907 1.00 59.64  ? 115  VAL B O     1 
ATOM   4368  C CB    . VAL B  1 115 ? 126.327 142.353 -117.514 1.00 58.71  ? 115  VAL B CB    1 
ATOM   4369  C CG1   . VAL B  1 115 ? 127.423 142.011 -118.509 1.00 58.34  ? 115  VAL B CG1   1 
ATOM   4370  C CG2   . VAL B  1 115 ? 126.836 143.308 -116.441 1.00 59.47  ? 115  VAL B CG2   1 
ATOM   4371  N N     . ASN B  1 116 ? 124.398 142.382 -120.498 1.00 61.26  ? 116  ASN B N     1 
ATOM   4372  C CA    . ASN B  1 116 ? 123.907 141.505 -121.571 1.00 62.23  ? 116  ASN B CA    1 
ATOM   4373  C C     . ASN B  1 116 ? 125.051 140.698 -122.197 1.00 62.13  ? 116  ASN B C     1 
ATOM   4374  O O     . ASN B  1 116 ? 125.912 141.269 -122.865 1.00 62.67  ? 116  ASN B O     1 
ATOM   4375  C CB    . ASN B  1 116 ? 123.251 142.347 -122.665 1.00 63.62  ? 116  ASN B CB    1 
ATOM   4376  C CG    . ASN B  1 116 ? 122.490 141.507 -123.683 1.00 65.59  ? 116  ASN B CG    1 
ATOM   4377  O OD1   . ASN B  1 116 ? 122.895 140.393 -124.027 1.00 66.75  ? 116  ASN B OD1   1 
ATOM   4378  N ND2   . ASN B  1 116 ? 121.385 142.052 -124.182 1.00 66.19  ? 116  ASN B ND2   1 
ATOM   4379  N N     . GLY B  1 117 ? 125.053 139.382 -121.996 1.00 61.56  ? 117  GLY B N     1 
ATOM   4380  C CA    . GLY B  1 117 ? 126.111 138.546 -122.552 1.00 60.94  ? 117  GLY B CA    1 
ATOM   4381  C C     . GLY B  1 117 ? 126.211 137.172 -121.903 1.00 60.86  ? 117  GLY B C     1 
ATOM   4382  O O     . GLY B  1 117 ? 125.552 136.909 -120.896 1.00 60.30  ? 117  GLY B O     1 
ATOM   4383  N N     . TYR B  1 118 ? 127.034 136.292 -122.475 1.00 60.32  ? 118  TYR B N     1 
ATOM   4384  C CA    . TYR B  1 118 ? 127.215 134.940 -121.946 1.00 59.93  ? 118  TYR B CA    1 
ATOM   4385  C C     . TYR B  1 118 ? 128.304 134.972 -120.888 1.00 60.59  ? 118  TYR B C     1 
ATOM   4386  O O     . TYR B  1 118 ? 129.485 135.150 -121.199 1.00 61.00  ? 118  TYR B O     1 
ATOM   4387  C CB    . TYR B  1 118 ? 127.615 133.985 -123.074 1.00 60.30  ? 118  TYR B CB    1 
ATOM   4388  C CG    . TYR B  1 118 ? 127.355 132.517 -122.792 1.00 60.17  ? 118  TYR B CG    1 
ATOM   4389  C CD1   . TYR B  1 118 ? 128.204 131.777 -121.969 1.00 60.09  ? 118  TYR B CD1   1 
ATOM   4390  C CD2   . TYR B  1 118 ? 126.247 131.871 -123.345 1.00 60.30  ? 118  TYR B CD2   1 
ATOM   4391  C CE1   . TYR B  1 118 ? 127.956 130.422 -121.704 1.00 60.80  ? 118  TYR B CE1   1 
ATOM   4392  C CE2   . TYR B  1 118 ? 125.986 130.518 -123.085 1.00 60.48  ? 118  TYR B CE2   1 
ATOM   4393  C CZ    . TYR B  1 118 ? 126.844 129.803 -122.265 1.00 60.74  ? 118  TYR B CZ    1 
ATOM   4394  O OH    . TYR B  1 118 ? 126.589 128.476 -121.998 1.00 60.60  ? 118  TYR B OH    1 
ATOM   4395  N N     . GLY B  1 119 ? 127.906 134.805 -119.633 1.00 60.61  ? 119  GLY B N     1 
ATOM   4396  C CA    . GLY B  1 119 ? 128.862 134.838 -118.545 1.00 60.79  ? 119  GLY B CA    1 
ATOM   4397  C C     . GLY B  1 119 ? 129.653 133.563 -118.334 1.00 61.22  ? 119  GLY B C     1 
ATOM   4398  O O     . GLY B  1 119 ? 129.183 132.458 -118.611 1.00 61.44  ? 119  GLY B O     1 
ATOM   4399  N N     . LYS B  1 120 ? 130.877 133.726 -117.852 1.00 61.14  ? 120  LYS B N     1 
ATOM   4400  C CA    . LYS B  1 120 ? 131.750 132.604 -117.564 1.00 61.94  ? 120  LYS B CA    1 
ATOM   4401  C C     . LYS B  1 120 ? 132.582 133.010 -116.359 1.00 62.36  ? 120  LYS B C     1 
ATOM   4402  O O     . LYS B  1 120 ? 133.063 134.141 -116.291 1.00 62.55  ? 120  LYS B O     1 
ATOM   4403  C CB    . LYS B  1 120 ? 132.668 132.299 -118.749 1.00 62.40  ? 120  LYS B CB    1 
ATOM   4404  C CG    . LYS B  1 120 ? 133.695 131.223 -118.431 1.00 63.21  ? 120  LYS B CG    1 
ATOM   4405  C CD    . LYS B  1 120 ? 134.538 130.854 -119.629 1.00 64.57  ? 120  LYS B CD    1 
ATOM   4406  C CE    . LYS B  1 120 ? 135.532 129.770 -119.248 1.00 65.27  ? 120  LYS B CE    1 
ATOM   4407  N NZ    . LYS B  1 120 ? 136.422 129.389 -120.379 1.00 66.74  ? 120  LYS B NZ    1 
ATOM   4408  N N     . ILE B  1 121 ? 132.737 132.107 -115.398 1.00 62.97  ? 121  ILE B N     1 
ATOM   4409  C CA    . ILE B  1 121 ? 133.532 132.432 -114.225 1.00 63.62  ? 121  ILE B CA    1 
ATOM   4410  C C     . ILE B  1 121 ? 135.013 132.346 -114.595 1.00 64.14  ? 121  ILE B C     1 
ATOM   4411  O O     . ILE B  1 121 ? 135.574 131.254 -114.742 1.00 64.25  ? 121  ILE B O     1 
ATOM   4412  C CB    . ILE B  1 121 ? 133.220 131.488 -113.038 1.00 63.17  ? 121  ILE B CB    1 
ATOM   4413  C CG1   . ILE B  1 121 ? 131.756 131.660 -112.615 1.00 63.23  ? 121  ILE B CG1   1 
ATOM   4414  C CG2   . ILE B  1 121 ? 134.141 131.803 -111.859 1.00 62.84  ? 121  ILE B CG2   1 
ATOM   4415  C CD1   . ILE B  1 121 ? 131.347 130.786 -111.439 1.00 62.35  ? 121  ILE B CD1   1 
ATOM   4416  N N     . THR B  1 122 ? 135.617 133.519 -114.783 1.00 64.44  ? 122  THR B N     1 
ATOM   4417  C CA    . THR B  1 122 ? 137.035 133.655 -115.129 1.00 63.91  ? 122  THR B CA    1 
ATOM   4418  C C     . THR B  1 122 ? 137.767 134.177 -113.896 1.00 64.29  ? 122  THR B C     1 
ATOM   4419  O O     . THR B  1 122 ? 138.190 135.334 -113.862 1.00 64.74  ? 122  THR B O     1 
ATOM   4420  C CB    . THR B  1 122 ? 137.234 134.673 -116.263 1.00 62.95  ? 122  THR B CB    1 
ATOM   4421  O OG1   . THR B  1 122 ? 136.560 135.894 -115.926 1.00 62.32  ? 122  THR B OG1   1 
ATOM   4422  C CG2   . THR B  1 122 ? 136.694 134.136 -117.570 1.00 61.92  ? 122  THR B CG2   1 
ATOM   4423  N N     . GLY B  1 123 ? 137.896 133.327 -112.880 1.00 64.09  ? 123  GLY B N     1 
ATOM   4424  C CA    . GLY B  1 123 ? 138.558 133.732 -111.651 1.00 63.60  ? 123  GLY B CA    1 
ATOM   4425  C C     . GLY B  1 123 ? 137.631 133.696 -110.447 1.00 63.18  ? 123  GLY B C     1 
ATOM   4426  O O     . GLY B  1 123 ? 136.520 134.219 -110.494 1.00 62.51  ? 123  GLY B O     1 
ATOM   4427  N N     . LYS B  1 124 ? 138.102 133.092 -109.360 1.00 63.35  ? 124  LYS B N     1 
ATOM   4428  C CA    . LYS B  1 124 ? 137.322 132.958 -108.132 1.00 63.62  ? 124  LYS B CA    1 
ATOM   4429  C C     . LYS B  1 124 ? 136.640 134.222 -107.619 1.00 63.17  ? 124  LYS B C     1 
ATOM   4430  O O     . LYS B  1 124 ? 135.911 134.179 -106.632 1.00 62.98  ? 124  LYS B O     1 
ATOM   4431  C CB    . LYS B  1 124 ? 138.190 132.370 -107.020 1.00 64.36  ? 124  LYS B CB    1 
ATOM   4432  C CG    . LYS B  1 124 ? 138.533 130.894 -107.213 1.00 65.88  ? 124  LYS B CG    1 
ATOM   4433  C CD    . LYS B  1 124 ? 139.249 130.315 -105.994 1.00 65.89  ? 124  LYS B CD    1 
ATOM   4434  C CE    . LYS B  1 124 ? 139.529 128.829 -106.173 1.00 66.73  ? 124  LYS B CE    1 
ATOM   4435  N NZ    . LYS B  1 124 ? 140.199 128.230 -104.986 1.00 65.86  ? 124  LYS B NZ    1 
ATOM   4436  N N     . ASN B  1 125 ? 136.872 135.343 -108.283 1.00 63.03  ? 125  ASN B N     1 
ATOM   4437  C CA    . ASN B  1 125 ? 136.257 136.594 -107.873 1.00 62.63  ? 125  ASN B CA    1 
ATOM   4438  C C     . ASN B  1 125 ? 135.993 137.424 -109.103 1.00 62.32  ? 125  ASN B C     1 
ATOM   4439  O O     . ASN B  1 125 ? 135.853 138.648 -109.037 1.00 62.32  ? 125  ASN B O     1 
ATOM   4440  C CB    . ASN B  1 125 ? 137.166 137.347 -106.902 1.00 63.05  ? 125  ASN B CB    1 
ATOM   4441  C CG    . ASN B  1 125 ? 137.014 136.862 -105.474 1.00 63.33  ? 125  ASN B CG    1 
ATOM   4442  O OD1   . ASN B  1 125 ? 135.951 137.004 -104.870 1.00 63.84  ? 125  ASN B OD1   1 
ATOM   4443  N ND2   . ASN B  1 125 ? 138.075 136.282 -104.926 1.00 63.39  ? 125  ASN B ND2   1 
ATOM   4444  N N     . GLN B  1 126 ? 135.927 136.739 -110.234 1.00 62.34  ? 126  GLN B N     1 
ATOM   4445  C CA    . GLN B  1 126 ? 135.666 137.412 -111.484 1.00 62.46  ? 126  GLN B CA    1 
ATOM   4446  C C     . GLN B  1 126 ? 134.786 136.622 -112.441 1.00 61.89  ? 126  GLN B C     1 
ATOM   4447  O O     . GLN B  1 126 ? 134.826 135.390 -112.488 1.00 60.60  ? 126  GLN B O     1 
ATOM   4448  C CB    . GLN B  1 126 ? 136.973 137.750 -112.182 1.00 63.10  ? 126  GLN B CB    1 
ATOM   4449  C CG    . GLN B  1 126 ? 136.746 138.546 -113.437 1.00 64.95  ? 126  GLN B CG    1 
ATOM   4450  C CD    . GLN B  1 126 ? 138.005 138.712 -114.233 1.00 66.52  ? 126  GLN B CD    1 
ATOM   4451  O OE1   . GLN B  1 126 ? 138.675 139.772 -114.116 1.00 68.30  ? 126  GLN B OE1   1 
ATOM   4452  N NE2   . GLN B  1 126 ? 138.359 137.735 -115.013 1.00 66.47  ? 126  GLN B NE2   1 
ATOM   4453  N N     . VAL B  1 127 ? 133.994 137.361 -113.206 1.00 61.82  ? 127  VAL B N     1 
ATOM   4454  C CA    . VAL B  1 127 ? 133.110 136.776 -114.194 1.00 62.40  ? 127  VAL B CA    1 
ATOM   4455  C C     . VAL B  1 127 ? 133.228 137.663 -115.427 1.00 62.24  ? 127  VAL B C     1 
ATOM   4456  O O     . VAL B  1 127 ? 133.112 138.886 -115.342 1.00 61.99  ? 127  VAL B O     1 
ATOM   4457  C CB    . VAL B  1 127 ? 131.627 136.725 -113.690 1.00 62.55  ? 127  VAL B CB    1 
ATOM   4458  C CG1   . VAL B  1 127 ? 130.748 136.021 -114.713 1.00 62.24  ? 127  VAL B CG1   1 
ATOM   4459  C CG2   . VAL B  1 127 ? 131.548 135.989 -112.347 1.00 62.43  ? 127  VAL B CG2   1 
ATOM   4460  N N     . THR B  1 128 ? 133.490 137.028 -116.563 1.00 62.57  ? 128  THR B N     1 
ATOM   4461  C CA    . THR B  1 128 ? 133.644 137.724 -117.834 1.00 62.92  ? 128  THR B CA    1 
ATOM   4462  C C     . THR B  1 128 ? 132.428 137.468 -118.717 1.00 63.24  ? 128  THR B C     1 
ATOM   4463  O O     . THR B  1 128 ? 132.107 136.319 -119.024 1.00 62.50  ? 128  THR B O     1 
ATOM   4464  C CB    . THR B  1 128 ? 134.913 137.227 -118.585 1.00 63.32  ? 128  THR B CB    1 
ATOM   4465  O OG1   . THR B  1 128 ? 136.072 137.427 -117.761 1.00 62.25  ? 128  THR B OG1   1 
ATOM   4466  C CG2   . THR B  1 128 ? 135.079 137.971 -119.918 1.00 63.01  ? 128  THR B CG2   1 
ATOM   4467  N N     . ALA B  1 129 ? 131.761 138.540 -119.132 1.00 63.79  ? 129  ALA B N     1 
ATOM   4468  C CA    . ALA B  1 129 ? 130.579 138.421 -119.981 1.00 65.10  ? 129  ALA B CA    1 
ATOM   4469  C C     . ALA B  1 129 ? 130.899 138.699 -121.453 1.00 66.02  ? 129  ALA B C     1 
ATOM   4470  O O     . ALA B  1 129 ? 131.060 139.856 -121.857 1.00 65.47  ? 129  ALA B O     1 
ATOM   4471  C CB    . ALA B  1 129 ? 129.479 139.377 -119.488 1.00 64.91  ? 129  ALA B CB    1 
ATOM   4472  N N     . THR B  1 130 ? 130.966 137.632 -122.249 1.00 67.28  ? 130  THR B N     1 
ATOM   4473  C CA    . THR B  1 130 ? 131.276 137.738 -123.675 1.00 68.40  ? 130  THR B CA    1 
ATOM   4474  C C     . THR B  1 130 ? 130.039 137.841 -124.568 1.00 69.00  ? 130  THR B C     1 
ATOM   4475  O O     . THR B  1 130 ? 129.331 136.859 -124.779 1.00 68.98  ? 130  THR B O     1 
ATOM   4476  C CB    . THR B  1 130 ? 132.103 136.526 -124.151 1.00 68.10  ? 130  THR B CB    1 
ATOM   4477  O OG1   . THR B  1 130 ? 133.188 136.297 -123.240 1.00 68.10  ? 130  THR B OG1   1 
ATOM   4478  C CG2   . THR B  1 130 ? 132.648 136.779 -125.548 1.00 68.21  ? 130  THR B CG2   1 
ATOM   4479  N N     . LYS B  1 131 ? 129.798 139.034 -125.101 1.00 70.25  ? 131  LYS B N     1 
ATOM   4480  C CA    . LYS B  1 131 ? 128.661 139.269 -125.985 1.00 71.83  ? 131  LYS B CA    1 
ATOM   4481  C C     . LYS B  1 131 ? 128.746 138.435 -127.260 1.00 72.53  ? 131  LYS B C     1 
ATOM   4482  O O     . LYS B  1 131 ? 129.693 137.668 -127.446 1.00 72.70  ? 131  LYS B O     1 
ATOM   4483  C CB    . LYS B  1 131 ? 128.577 140.753 -126.346 1.00 72.94  ? 131  LYS B CB    1 
ATOM   4484  C CG    . LYS B  1 131 ? 127.591 141.543 -125.502 1.00 73.84  ? 131  LYS B CG    1 
ATOM   4485  C CD    . LYS B  1 131 ? 128.002 143.000 -125.377 1.00 74.49  ? 131  LYS B CD    1 
ATOM   4486  C CE    . LYS B  1 131 ? 129.238 143.141 -124.492 1.00 75.26  ? 131  LYS B CE    1 
ATOM   4487  N NZ    . LYS B  1 131 ? 129.607 144.568 -124.257 1.00 75.97  ? 131  LYS B NZ    1 
ATOM   4488  N N     . ALA B  1 132 ? 127.754 138.594 -128.133 1.00 73.21  ? 132  ALA B N     1 
ATOM   4489  C CA    . ALA B  1 132 ? 127.694 137.846 -129.390 1.00 74.35  ? 132  ALA B CA    1 
ATOM   4490  C C     . ALA B  1 132 ? 128.693 138.361 -130.420 1.00 74.86  ? 132  ALA B C     1 
ATOM   4491  O O     . ALA B  1 132 ? 129.183 137.604 -131.261 1.00 74.62  ? 132  ALA B O     1 
ATOM   4492  C CB    . ALA B  1 132 ? 126.285 137.912 -129.962 1.00 74.45  ? 132  ALA B CB    1 
ATOM   4493  N N     . ASP B  1 133 ? 128.980 139.657 -130.352 1.00 75.65  ? 133  ASP B N     1 
ATOM   4494  C CA    . ASP B  1 133 ? 129.917 140.291 -131.272 1.00 75.76  ? 133  ASP B CA    1 
ATOM   4495  C C     . ASP B  1 133 ? 131.354 140.068 -130.799 1.00 75.37  ? 133  ASP B C     1 
ATOM   4496  O O     . ASP B  1 133 ? 132.286 140.675 -131.330 1.00 76.00  ? 133  ASP B O     1 
ATOM   4497  C CB    . ASP B  1 133 ? 129.637 141.795 -131.349 1.00 76.41  ? 133  ASP B CB    1 
ATOM   4498  C CG    . ASP B  1 133 ? 129.934 142.510 -130.039 1.00 77.23  ? 133  ASP B CG    1 
ATOM   4499  O OD1   . ASP B  1 133 ? 129.388 142.084 -128.998 1.00 77.81  ? 133  ASP B OD1   1 
ATOM   4500  O OD2   . ASP B  1 133 ? 130.711 143.492 -130.045 1.00 77.80  ? 133  ASP B OD2   1 
ATOM   4501  N N     . GLY B  1 134 ? 131.528 139.204 -129.801 1.00 74.13  ? 134  GLY B N     1 
ATOM   4502  C CA    . GLY B  1 134 ? 132.858 138.937 -129.283 1.00 73.34  ? 134  GLY B CA    1 
ATOM   4503  C C     . GLY B  1 134 ? 133.295 139.977 -128.268 1.00 73.00  ? 134  GLY B C     1 
ATOM   4504  O O     . GLY B  1 134 ? 134.188 139.723 -127.460 1.00 72.00  ? 134  GLY B O     1 
ATOM   4505  N N     . GLY B  1 135 ? 132.667 141.152 -128.317 1.00 73.08  ? 135  GLY B N     1 
ATOM   4506  C CA    . GLY B  1 135 ? 132.997 142.215 -127.384 1.00 73.28  ? 135  GLY B CA    1 
ATOM   4507  C C     . GLY B  1 135 ? 132.682 141.774 -125.966 1.00 73.61  ? 135  GLY B C     1 
ATOM   4508  O O     . GLY B  1 135 ? 131.539 141.433 -125.657 1.00 73.86  ? 135  GLY B O     1 
ATOM   4509  N N     . THR B  1 136 ? 133.687 141.789 -125.095 1.00 73.23  ? 136  THR B N     1 
ATOM   4510  C CA    . THR B  1 136 ? 133.499 141.353 -123.718 1.00 72.88  ? 136  THR B CA    1 
ATOM   4511  C C     . THR B  1 136 ? 133.238 142.440 -122.675 1.00 72.43  ? 136  THR B C     1 
ATOM   4512  O O     . THR B  1 136 ? 132.997 143.609 -122.993 1.00 72.56  ? 136  THR B O     1 
ATOM   4513  C CB    . THR B  1 136 ? 134.709 140.521 -123.234 1.00 73.46  ? 136  THR B CB    1 
ATOM   4514  O OG1   . THR B  1 136 ? 135.890 141.336 -123.257 1.00 74.50  ? 136  THR B OG1   1 
ATOM   4515  C CG2   . THR B  1 136 ? 134.912 139.297 -124.129 1.00 73.25  ? 136  THR B CG2   1 
ATOM   4516  N N     . GLN B  1 137 ? 133.286 142.008 -121.417 1.00 71.25  ? 137  GLN B N     1 
ATOM   4517  C CA    . GLN B  1 137 ? 133.080 142.854 -120.252 1.00 70.22  ? 137  GLN B CA    1 
ATOM   4518  C C     . GLN B  1 137 ? 133.533 142.058 -119.040 1.00 69.53  ? 137  GLN B C     1 
ATOM   4519  O O     . GLN B  1 137 ? 133.229 140.870 -118.916 1.00 69.91  ? 137  GLN B O     1 
ATOM   4520  C CB    . GLN B  1 137 ? 131.606 143.217 -120.094 1.00 69.99  ? 137  GLN B CB    1 
ATOM   4521  C CG    . GLN B  1 137 ? 131.287 143.857 -118.751 1.00 69.71  ? 137  GLN B CG    1 
ATOM   4522  C CD    . GLN B  1 137 ? 131.959 145.205 -118.559 1.00 69.72  ? 137  GLN B CD    1 
ATOM   4523  O OE1   . GLN B  1 137 ? 131.618 146.183 -119.228 1.00 69.39  ? 137  GLN B OE1   1 
ATOM   4524  N NE2   . GLN B  1 137 ? 132.919 145.262 -117.639 1.00 69.38  ? 137  GLN B NE2   1 
ATOM   4525  N N     . VAL B  1 138 ? 134.257 142.705 -118.142 1.00 68.04  ? 138  VAL B N     1 
ATOM   4526  C CA    . VAL B  1 138 ? 134.740 142.009 -116.970 1.00 67.27  ? 138  VAL B CA    1 
ATOM   4527  C C     . VAL B  1 138 ? 134.087 142.537 -115.706 1.00 67.34  ? 138  VAL B C     1 
ATOM   4528  O O     . VAL B  1 138 ? 133.826 143.734 -115.573 1.00 66.66  ? 138  VAL B O     1 
ATOM   4529  C CB    . VAL B  1 138 ? 136.270 142.133 -116.857 1.00 66.88  ? 138  VAL B CB    1 
ATOM   4530  C CG1   . VAL B  1 138 ? 136.764 141.412 -115.613 1.00 66.22  ? 138  VAL B CG1   1 
ATOM   4531  C CG2   . VAL B  1 138 ? 136.926 141.552 -118.102 1.00 65.98  ? 138  VAL B CG2   1 
ATOM   4532  N N     . ILE B  1 139 ? 133.818 141.626 -114.779 1.00 67.46  ? 139  ILE B N     1 
ATOM   4533  C CA    . ILE B  1 139 ? 133.194 141.997 -113.524 1.00 67.69  ? 139  ILE B CA    1 
ATOM   4534  C C     . ILE B  1 139 ? 133.927 141.341 -112.377 1.00 67.26  ? 139  ILE B C     1 
ATOM   4535  O O     . ILE B  1 139 ? 133.981 140.113 -112.282 1.00 67.35  ? 139  ILE B O     1 
ATOM   4536  C CB    . ILE B  1 139 ? 131.708 141.561 -113.477 1.00 68.27  ? 139  ILE B CB    1 
ATOM   4537  C CG1   . ILE B  1 139 ? 130.951 142.193 -114.649 1.00 68.90  ? 139  ILE B CG1   1 
ATOM   4538  C CG2   . ILE B  1 139 ? 131.082 141.974 -112.149 1.00 67.88  ? 139  ILE B CG2   1 
ATOM   4539  C CD1   . ILE B  1 139 ? 129.537 141.701 -114.815 1.00 70.42  ? 139  ILE B CD1   1 
ATOM   4540  N N     . ASP B  1 140 ? 134.521 142.170 -111.526 1.00 66.51  ? 140  ASP B N     1 
ATOM   4541  C CA    . ASP B  1 140 ? 135.221 141.672 -110.353 1.00 65.87  ? 140  ASP B CA    1 
ATOM   4542  C C     . ASP B  1 140 ? 134.205 141.787 -109.236 1.00 64.64  ? 140  ASP B C     1 
ATOM   4543  O O     . ASP B  1 140 ? 133.595 142.843 -109.022 1.00 63.66  ? 140  ASP B O     1 
ATOM   4544  C CB    . ASP B  1 140 ? 136.469 142.508 -110.058 1.00 67.15  ? 140  ASP B CB    1 
ATOM   4545  C CG    . ASP B  1 140 ? 137.611 142.197 -111.009 1.00 67.79  ? 140  ASP B CG    1 
ATOM   4546  O OD1   . ASP B  1 140 ? 138.130 141.058 -110.969 1.00 68.09  ? 140  ASP B OD1   1 
ATOM   4547  O OD2   . ASP B  1 140 ? 137.979 143.090 -111.801 1.00 68.33  ? 140  ASP B OD2   1 
ATOM   4548  N N     . THR B  1 141 ? 134.018 140.686 -108.530 1.00 63.77  ? 141  THR B N     1 
ATOM   4549  C CA    . THR B  1 141 ? 133.021 140.645 -107.486 1.00 62.85  ? 141  THR B CA    1 
ATOM   4550  C C     . THR B  1 141 ? 133.454 139.814 -106.298 1.00 61.85  ? 141  THR B C     1 
ATOM   4551  O O     . THR B  1 141 ? 134.293 138.915 -106.407 1.00 61.45  ? 141  THR B O     1 
ATOM   4552  C CB    . THR B  1 141 ? 131.700 140.072 -108.057 1.00 63.64  ? 141  THR B CB    1 
ATOM   4553  O OG1   . THR B  1 141 ? 130.741 139.899 -107.007 1.00 63.51  ? 141  THR B OG1   1 
ATOM   4554  C CG2   . THR B  1 141 ? 131.966 138.732 -108.740 1.00 63.79  ? 141  THR B CG2   1 
ATOM   4555  N N     . LYS B  1 142 ? 132.854 140.132 -105.162 1.00 60.75  ? 142  LYS B N     1 
ATOM   4556  C CA    . LYS B  1 142 ? 133.129 139.455 -103.913 1.00 59.87  ? 142  LYS B CA    1 
ATOM   4557  C C     . LYS B  1 142 ? 132.457 138.073 -103.922 1.00 58.63  ? 142  LYS B C     1 
ATOM   4558  O O     . LYS B  1 142 ? 133.060 137.065 -103.533 1.00 57.42  ? 142  LYS B O     1 
ATOM   4559  C CB    . LYS B  1 142 ? 132.604 140.328 -102.769 1.00 61.57  ? 142  LYS B CB    1 
ATOM   4560  C CG    . LYS B  1 142 ? 132.800 141.828 -103.042 1.00 63.74  ? 142  LYS B CG    1 
ATOM   4561  C CD    . LYS B  1 142 ? 132.166 142.731 -101.986 1.00 65.90  ? 142  LYS B CD    1 
ATOM   4562  C CE    . LYS B  1 142 ? 133.068 142.907 -100.774 1.00 67.70  ? 142  LYS B CE    1 
ATOM   4563  N NZ    . LYS B  1 142 ? 133.396 141.616 -100.098 1.00 68.40  ? 142  LYS B NZ    1 
ATOM   4564  N N     . ASN B  1 143 ? 131.210 138.028 -104.388 1.00 57.17  ? 143  ASN B N     1 
ATOM   4565  C CA    . ASN B  1 143 ? 130.469 136.771 -104.442 1.00 55.66  ? 143  ASN B CA    1 
ATOM   4566  C C     . ASN B  1 143 ? 129.872 136.494 -105.821 1.00 54.32  ? 143  ASN B C     1 
ATOM   4567  O O     . ASN B  1 143 ? 129.441 137.406 -106.523 1.00 54.08  ? 143  ASN B O     1 
ATOM   4568  C CB    . ASN B  1 143 ? 129.329 136.779 -103.414 1.00 55.40  ? 143  ASN B CB    1 
ATOM   4569  C CG    . ASN B  1 143 ? 129.807 137.050 -102.000 1.00 53.58  ? 143  ASN B CG    1 
ATOM   4570  O OD1   . ASN B  1 143 ? 130.429 136.203 -101.365 1.00 53.98  ? 143  ASN B OD1   1 
ATOM   4571  N ND2   . ASN B  1 143 ? 129.510 138.242 -101.502 1.00 53.69  ? 143  ASN B ND2   1 
ATOM   4572  N N     . ILE B  1 144 ? 129.856 135.225 -106.204 1.00 54.05  ? 144  ILE B N     1 
ATOM   4573  C CA    . ILE B  1 144 ? 129.263 134.832 -107.475 1.00 52.59  ? 144  ILE B CA    1 
ATOM   4574  C C     . ILE B  1 144 ? 128.051 133.947 -107.166 1.00 51.08  ? 144  ILE B C     1 
ATOM   4575  O O     . ILE B  1 144 ? 128.139 133.010 -106.361 1.00 49.87  ? 144  ILE B O     1 
ATOM   4576  C CB    . ILE B  1 144 ? 130.234 134.006 -108.352 1.00 53.40  ? 144  ILE B CB    1 
ATOM   4577  C CG1   . ILE B  1 144 ? 131.539 134.771 -108.583 1.00 53.60  ? 144  ILE B CG1   1 
ATOM   4578  C CG2   . ILE B  1 144 ? 129.577 133.702 -109.698 1.00 53.04  ? 144  ILE B CG2   1 
ATOM   4579  C CD1   . ILE B  1 144 ? 132.589 133.948 -109.325 1.00 53.12  ? 144  ILE B CD1   1 
ATOM   4580  N N     . LEU B  1 145 ? 126.921 134.266 -107.791 1.00 49.27  ? 145  LEU B N     1 
ATOM   4581  C CA    . LEU B  1 145 ? 125.703 133.484 -107.621 1.00 47.25  ? 145  LEU B CA    1 
ATOM   4582  C C     . LEU B  1 145 ? 125.324 132.868 -108.968 1.00 45.82  ? 145  LEU B C     1 
ATOM   4583  O O     . LEU B  1 145 ? 124.942 133.573 -109.906 1.00 44.73  ? 145  LEU B O     1 
ATOM   4584  C CB    . LEU B  1 145 ? 124.552 134.362 -107.107 1.00 47.64  ? 145  LEU B CB    1 
ATOM   4585  C CG    . LEU B  1 145 ? 123.179 133.664 -106.960 1.00 46.41  ? 145  LEU B CG    1 
ATOM   4586  C CD1   . LEU B  1 145 ? 123.344 132.356 -106.178 1.00 44.23  ? 145  LEU B CD1   1 
ATOM   4587  C CD2   . LEU B  1 145 ? 122.167 134.602 -106.279 1.00 44.43  ? 145  LEU B CD2   1 
ATOM   4588  N N     . ILE B  1 146 ? 125.460 131.553 -109.071 1.00 44.10  ? 146  ILE B N     1 
ATOM   4589  C CA    . ILE B  1 146 ? 125.100 130.875 -110.305 1.00 43.27  ? 146  ILE B CA    1 
ATOM   4590  C C     . ILE B  1 146 ? 123.590 130.578 -110.299 1.00 42.45  ? 146  ILE B C     1 
ATOM   4591  O O     . ILE B  1 146 ? 123.090 129.880 -109.406 1.00 43.19  ? 146  ILE B O     1 
ATOM   4592  C CB    . ILE B  1 146 ? 125.853 129.535 -110.457 1.00 43.55  ? 146  ILE B CB    1 
ATOM   4593  C CG1   . ILE B  1 146 ? 127.359 129.756 -110.315 1.00 42.82  ? 146  ILE B CG1   1 
ATOM   4594  C CG2   . ILE B  1 146 ? 125.526 128.903 -111.816 1.00 42.82  ? 146  ILE B CG2   1 
ATOM   4595  C CD1   . ILE B  1 146 ? 128.167 128.443 -110.265 1.00 41.27  ? 146  ILE B CD1   1 
ATOM   4596  N N     . ALA B  1 147 ? 122.880 131.132 -111.283 1.00 40.85  ? 147  ALA B N     1 
ATOM   4597  C CA    . ALA B  1 147 ? 121.435 130.926 -111.474 1.00 39.33  ? 147  ALA B CA    1 
ATOM   4598  C C     . ALA B  1 147 ? 121.209 130.702 -112.981 1.00 37.86  ? 147  ALA B C     1 
ATOM   4599  O O     . ALA B  1 147 ? 120.335 131.311 -113.600 1.00 37.38  ? 147  ALA B O     1 
ATOM   4600  C CB    . ALA B  1 147 ? 120.656 132.149 -111.002 1.00 37.50  ? 147  ALA B CB    1 
ATOM   4601  N N     . THR B  1 148 ? 122.015 129.813 -113.552 1.00 38.63  ? 148  THR B N     1 
ATOM   4602  C CA    . THR B  1 148 ? 121.974 129.509 -114.977 1.00 38.67  ? 148  THR B CA    1 
ATOM   4603  C C     . THR B  1 148 ? 120.788 128.640 -115.430 1.00 37.85  ? 148  THR B C     1 
ATOM   4604  O O     . THR B  1 148 ? 120.528 128.506 -116.620 1.00 37.57  ? 148  THR B O     1 
ATOM   4605  C CB    . THR B  1 148 ? 123.318 128.884 -115.424 1.00 39.20  ? 148  THR B CB    1 
ATOM   4606  O OG1   . THR B  1 148 ? 123.688 127.821 -114.539 1.00 38.09  ? 148  THR B OG1   1 
ATOM   4607  C CG2   . THR B  1 148 ? 124.404 129.933 -115.407 1.00 39.74  ? 148  THR B CG2   1 
ATOM   4608  N N     . GLY B  1 149 ? 120.081 128.051 -114.473 1.00 38.01  ? 149  GLY B N     1 
ATOM   4609  C CA    . GLY B  1 149 ? 118.898 127.270 -114.787 1.00 36.14  ? 149  GLY B CA    1 
ATOM   4610  C C     . GLY B  1 149 ? 118.969 125.905 -115.442 1.00 35.92  ? 149  GLY B C     1 
ATOM   4611  O O     . GLY B  1 149 ? 119.830 125.070 -115.140 1.00 34.45  ? 149  GLY B O     1 
ATOM   4612  N N     . SER B  1 150 ? 118.042 125.686 -116.368 1.00 34.65  ? 150  SER B N     1 
ATOM   4613  C CA    . SER B  1 150 ? 117.944 124.408 -117.030 1.00 35.24  ? 150  SER B CA    1 
ATOM   4614  C C     . SER B  1 150 ? 117.670 124.514 -118.507 1.00 34.71  ? 150  SER B C     1 
ATOM   4615  O O     . SER B  1 150 ? 117.437 125.594 -119.036 1.00 33.70  ? 150  SER B O     1 
ATOM   4616  C CB    . SER B  1 150 ? 116.800 123.614 -116.401 1.00 36.02  ? 150  SER B CB    1 
ATOM   4617  O OG    . SER B  1 150 ? 115.600 124.368 -116.546 1.00 36.60  ? 150  SER B OG    1 
ATOM   4618  N N     . GLU B  1 151 ? 117.691 123.346 -119.143 1.00 35.97  ? 151  GLU B N     1 
ATOM   4619  C CA    . GLU B  1 151 ? 117.396 123.185 -120.559 1.00 36.16  ? 151  GLU B CA    1 
ATOM   4620  C C     . GLU B  1 151 ? 116.534 121.913 -120.682 1.00 36.96  ? 151  GLU B C     1 
ATOM   4621  O O     . GLU B  1 151 ? 116.472 121.100 -119.743 1.00 36.25  ? 151  GLU B O     1 
ATOM   4622  C CB    . GLU B  1 151 ? 118.687 123.020 -121.375 1.00 34.97  ? 151  GLU B CB    1 
ATOM   4623  C CG    . GLU B  1 151 ? 119.479 121.768 -121.035 1.00 35.86  ? 151  GLU B CG    1 
ATOM   4624  C CD    . GLU B  1 151 ? 120.680 121.517 -121.965 1.00 36.59  ? 151  GLU B CD    1 
ATOM   4625  O OE1   . GLU B  1 151 ? 120.955 122.316 -122.893 1.00 36.98  ? 151  GLU B OE1   1 
ATOM   4626  O OE2   . GLU B  1 151 ? 121.361 120.497 -121.753 1.00 39.64  ? 151  GLU B OE2   1 
ATOM   4627  N N     . VAL B  1 152 ? 115.871 121.753 -121.829 1.00 36.67  ? 152  VAL B N     1 
ATOM   4628  C CA    . VAL B  1 152 ? 115.040 120.581 -122.086 1.00 37.58  ? 152  VAL B CA    1 
ATOM   4629  C C     . VAL B  1 152 ? 115.949 119.372 -122.079 1.00 38.15  ? 152  VAL B C     1 
ATOM   4630  O O     . VAL B  1 152 ? 117.098 119.453 -122.504 1.00 39.63  ? 152  VAL B O     1 
ATOM   4631  C CB    . VAL B  1 152 ? 114.323 120.690 -123.478 1.00 37.97  ? 152  VAL B CB    1 
ATOM   4632  C CG1   . VAL B  1 152 ? 113.707 119.372 -123.865 1.00 38.33  ? 152  VAL B CG1   1 
ATOM   4633  C CG2   . VAL B  1 152 ? 113.254 121.782 -123.436 1.00 37.95  ? 152  VAL B CG2   1 
ATOM   4634  N N     . THR B  1 153 ? 115.453 118.255 -121.565 1.00 39.38  ? 153  THR B N     1 
ATOM   4635  C CA    . THR B  1 153 ? 116.234 117.026 -121.542 1.00 39.76  ? 153  THR B CA    1 
ATOM   4636  C C     . THR B  1 153 ? 115.935 116.325 -122.865 1.00 41.53  ? 153  THR B C     1 
ATOM   4637  O O     . THR B  1 153 ? 114.785 115.957 -123.139 1.00 40.28  ? 153  THR B O     1 
ATOM   4638  C CB    . THR B  1 153 ? 115.799 116.118 -120.404 1.00 40.23  ? 153  THR B CB    1 
ATOM   4639  O OG1   . THR B  1 153 ? 116.042 116.776 -119.156 1.00 41.13  ? 153  THR B OG1   1 
ATOM   4640  C CG2   . THR B  1 153 ? 116.569 114.824 -120.450 1.00 40.87  ? 153  THR B CG2   1 
ATOM   4641  N N     . PRO B  1 154 ? 116.957 116.133 -123.707 1.00 41.68  ? 154  PRO B N     1 
ATOM   4642  C CA    . PRO B  1 154 ? 116.699 115.471 -124.985 1.00 42.63  ? 154  PRO B CA    1 
ATOM   4643  C C     . PRO B  1 154 ? 116.408 113.979 -124.872 1.00 42.15  ? 154  PRO B C     1 
ATOM   4644  O O     . PRO B  1 154 ? 116.809 113.320 -123.911 1.00 40.58  ? 154  PRO B O     1 
ATOM   4645  C CB    . PRO B  1 154 ? 117.968 115.769 -125.790 1.00 44.44  ? 154  PRO B CB    1 
ATOM   4646  C CG    . PRO B  1 154 ? 119.043 115.742 -124.715 1.00 44.99  ? 154  PRO B CG    1 
ATOM   4647  C CD    . PRO B  1 154 ? 118.377 116.496 -123.559 1.00 42.75  ? 154  PRO B CD    1 
ATOM   4648  N N     . PHE B  1 155 ? 115.681 113.467 -125.863 1.00 42.43  ? 155  PHE B N     1 
ATOM   4649  C CA    . PHE B  1 155 ? 115.344 112.048 -125.939 1.00 42.52  ? 155  PHE B CA    1 
ATOM   4650  C C     . PHE B  1 155 ? 116.304 111.507 -127.009 1.00 43.27  ? 155  PHE B C     1 
ATOM   4651  O O     . PHE B  1 155 ? 116.238 111.892 -128.176 1.00 43.06  ? 155  PHE B O     1 
ATOM   4652  C CB    . PHE B  1 155 ? 113.876 111.879 -126.366 1.00 40.94  ? 155  PHE B CB    1 
ATOM   4653  C CG    . PHE B  1 155 ? 113.371 110.457 -126.288 1.00 41.04  ? 155  PHE B CG    1 
ATOM   4654  C CD1   . PHE B  1 155 ? 113.881 109.471 -127.130 1.00 41.41  ? 155  PHE B CD1   1 
ATOM   4655  C CD2   . PHE B  1 155 ? 112.384 110.107 -125.374 1.00 40.18  ? 155  PHE B CD2   1 
ATOM   4656  C CE1   . PHE B  1 155 ? 113.414 108.155 -127.063 1.00 41.31  ? 155  PHE B CE1   1 
ATOM   4657  C CE2   . PHE B  1 155 ? 111.913 108.801 -125.298 1.00 41.52  ? 155  PHE B CE2   1 
ATOM   4658  C CZ    . PHE B  1 155 ? 112.429 107.822 -126.145 1.00 41.69  ? 155  PHE B CZ    1 
ATOM   4659  N N     . PRO B  1 156 ? 117.215 110.608 -126.621 1.00 44.97  ? 156  PRO B N     1 
ATOM   4660  C CA    . PRO B  1 156 ? 118.168 110.060 -127.597 1.00 45.63  ? 156  PRO B CA    1 
ATOM   4661  C C     . PRO B  1 156 ? 117.509 109.373 -128.776 1.00 45.57  ? 156  PRO B C     1 
ATOM   4662  O O     . PRO B  1 156 ? 116.571 108.604 -128.598 1.00 45.58  ? 156  PRO B O     1 
ATOM   4663  C CB    . PRO B  1 156 ? 118.991 109.087 -126.763 1.00 45.88  ? 156  PRO B CB    1 
ATOM   4664  C CG    . PRO B  1 156 ? 117.980 108.566 -125.796 1.00 46.63  ? 156  PRO B CG    1 
ATOM   4665  C CD    . PRO B  1 156 ? 117.256 109.836 -125.366 1.00 45.17  ? 156  PRO B CD    1 
ATOM   4666  N N     . GLY B  1 157 ? 118.014 109.648 -129.974 1.00 46.46  ? 157  GLY B N     1 
ATOM   4667  C CA    . GLY B  1 157 ? 117.466 109.042 -131.174 1.00 46.38  ? 157  GLY B CA    1 
ATOM   4668  C C     . GLY B  1 157 ? 116.452 109.943 -131.847 1.00 46.49  ? 157  GLY B C     1 
ATOM   4669  O O     . GLY B  1 157 ? 116.190 109.834 -133.050 1.00 46.73  ? 157  GLY B O     1 
ATOM   4670  N N     . ILE B  1 158 ? 115.871 110.842 -131.062 1.00 45.35  ? 158  ILE B N     1 
ATOM   4671  C CA    . ILE B  1 158 ? 114.888 111.775 -131.584 1.00 44.42  ? 158  ILE B CA    1 
ATOM   4672  C C     . ILE B  1 158 ? 115.520 113.145 -131.521 1.00 45.06  ? 158  ILE B C     1 
ATOM   4673  O O     . ILE B  1 158 ? 116.009 113.551 -130.470 1.00 46.18  ? 158  ILE B O     1 
ATOM   4674  C CB    . ILE B  1 158 ? 113.607 111.750 -130.730 1.00 43.11  ? 158  ILE B CB    1 
ATOM   4675  C CG1   . ILE B  1 158 ? 112.912 110.392 -130.893 1.00 42.04  ? 158  ILE B CG1   1 
ATOM   4676  C CG2   . ILE B  1 158 ? 112.678 112.863 -131.152 1.00 42.05  ? 158  ILE B CG2   1 
ATOM   4677  C CD1   . ILE B  1 158 ? 111.708 110.181 -129.985 1.00 41.49  ? 158  ILE B CD1   1 
ATOM   4678  N N     . THR B  1 159 ? 115.537 113.851 -132.643 1.00 45.07  ? 159  THR B N     1 
ATOM   4679  C CA    . THR B  1 159 ? 116.128 115.182 -132.659 1.00 45.54  ? 159  THR B CA    1 
ATOM   4680  C C     . THR B  1 159 ? 115.041 116.240 -132.743 1.00 45.53  ? 159  THR B C     1 
ATOM   4681  O O     . THR B  1 159 ? 114.249 116.272 -133.695 1.00 44.27  ? 159  THR B O     1 
ATOM   4682  C CB    . THR B  1 159 ? 117.092 115.376 -133.847 1.00 46.29  ? 159  THR B CB    1 
ATOM   4683  O OG1   . THR B  1 159 ? 118.146 114.412 -133.761 1.00 48.52  ? 159  THR B OG1   1 
ATOM   4684  C CG2   . THR B  1 159 ? 117.690 116.790 -133.827 1.00 46.86  ? 159  THR B CG2   1 
ATOM   4685  N N     . ILE B  1 160 ? 115.003 117.109 -131.743 1.00 44.64  ? 160  ILE B N     1 
ATOM   4686  C CA    . ILE B  1 160 ? 114.003 118.164 -131.720 1.00 44.64  ? 160  ILE B CA    1 
ATOM   4687  C C     . ILE B  1 160 ? 114.352 119.271 -132.710 1.00 45.11  ? 160  ILE B C     1 
ATOM   4688  O O     . ILE B  1 160 ? 115.484 119.742 -132.729 1.00 45.74  ? 160  ILE B O     1 
ATOM   4689  C CB    . ILE B  1 160 ? 113.888 118.754 -130.299 1.00 43.72  ? 160  ILE B CB    1 
ATOM   4690  C CG1   . ILE B  1 160 ? 113.329 117.686 -129.347 1.00 43.44  ? 160  ILE B CG1   1 
ATOM   4691  C CG2   . ILE B  1 160 ? 113.043 120.008 -130.330 1.00 41.11  ? 160  ILE B CG2   1 
ATOM   4692  C CD1   . ILE B  1 160 ? 113.472 118.025 -127.872 1.00 42.43  ? 160  ILE B CD1   1 
ATOM   4693  N N     . ASP B  1 161 ? 113.390 119.675 -133.538 1.00 45.11  ? 161  ASP B N     1 
ATOM   4694  C CA    . ASP B  1 161 ? 113.639 120.746 -134.493 1.00 46.27  ? 161  ASP B CA    1 
ATOM   4695  C C     . ASP B  1 161 ? 112.673 121.919 -134.318 1.00 46.42  ? 161  ASP B C     1 
ATOM   4696  O O     . ASP B  1 161 ? 112.663 122.844 -135.126 1.00 46.89  ? 161  ASP B O     1 
ATOM   4697  C CB    . ASP B  1 161 ? 113.576 120.233 -135.942 1.00 47.40  ? 161  ASP B CB    1 
ATOM   4698  C CG    . ASP B  1 161 ? 112.181 119.780 -136.360 1.00 48.35  ? 161  ASP B CG    1 
ATOM   4699  O OD1   . ASP B  1 161 ? 111.170 120.145 -135.708 1.00 45.96  ? 161  ASP B OD1   1 
ATOM   4700  O OD2   . ASP B  1 161 ? 112.096 119.061 -137.379 1.00 51.51  ? 161  ASP B OD2   1 
ATOM   4701  N N     . GLU B  1 162 ? 111.863 121.871 -133.261 1.00 45.32  ? 162  GLU B N     1 
ATOM   4702  C CA    . GLU B  1 162 ? 110.902 122.925 -132.941 1.00 44.85  ? 162  GLU B CA    1 
ATOM   4703  C C     . GLU B  1 162 ? 109.969 123.303 -134.073 1.00 45.71  ? 162  GLU B C     1 
ATOM   4704  O O     . GLU B  1 162 ? 109.334 124.366 -134.055 1.00 45.82  ? 162  GLU B O     1 
ATOM   4705  C CB    . GLU B  1 162 ? 111.628 124.168 -132.427 1.00 43.71  ? 162  GLU B CB    1 
ATOM   4706  C CG    . GLU B  1 162 ? 112.571 123.881 -131.259 1.00 42.55  ? 162  GLU B CG    1 
ATOM   4707  C CD    . GLU B  1 162 ? 111.861 123.458 -129.957 1.00 42.31  ? 162  GLU B CD    1 
ATOM   4708  O OE1   . GLU B  1 162 ? 110.637 123.161 -129.973 1.00 39.97  ? 162  GLU B OE1   1 
ATOM   4709  O OE2   . GLU B  1 162 ? 112.555 123.412 -128.911 1.00 41.76  ? 162  GLU B OE2   1 
ATOM   4710  N N     . ASP B  1 163 ? 109.885 122.426 -135.061 1.00 46.10  ? 163  ASP B N     1 
ATOM   4711  C CA    . ASP B  1 163 ? 108.981 122.654 -136.163 1.00 46.25  ? 163  ASP B CA    1 
ATOM   4712  C C     . ASP B  1 163 ? 107.898 121.600 -136.076 1.00 45.32  ? 163  ASP B C     1 
ATOM   4713  O O     . ASP B  1 163 ? 106.762 121.899 -135.734 1.00 44.99  ? 163  ASP B O     1 
ATOM   4714  C CB    . ASP B  1 163 ? 109.696 122.540 -137.512 1.00 47.91  ? 163  ASP B CB    1 
ATOM   4715  C CG    . ASP B  1 163 ? 108.725 122.577 -138.693 1.00 48.89  ? 163  ASP B CG    1 
ATOM   4716  O OD1   . ASP B  1 163 ? 107.758 123.364 -138.675 1.00 50.50  ? 163  ASP B OD1   1 
ATOM   4717  O OD2   . ASP B  1 163 ? 108.932 121.821 -139.656 1.00 51.83  ? 163  ASP B OD2   1 
ATOM   4718  N N     . THR B  1 164 ? 108.279 120.361 -136.367 1.00 44.71  ? 164  THR B N     1 
ATOM   4719  C CA    . THR B  1 164 ? 107.364 119.223 -136.369 1.00 44.00  ? 164  THR B CA    1 
ATOM   4720  C C     . THR B  1 164 ? 107.618 118.340 -135.138 1.00 42.09  ? 164  THR B C     1 
ATOM   4721  O O     . THR B  1 164 ? 106.698 117.748 -134.564 1.00 41.27  ? 164  THR B O     1 
ATOM   4722  C CB    . THR B  1 164 ? 107.561 118.435 -137.694 1.00 45.15  ? 164  THR B CB    1 
ATOM   4723  O OG1   . THR B  1 164 ? 106.913 117.168 -137.618 1.00 46.44  ? 164  THR B OG1   1 
ATOM   4724  C CG2   . THR B  1 164 ? 109.051 118.256 -137.985 1.00 47.04  ? 164  THR B CG2   1 
ATOM   4725  N N     . ILE B  1 165 ? 108.880 118.241 -134.753 1.00 40.00  ? 165  ILE B N     1 
ATOM   4726  C CA    . ILE B  1 165 ? 109.261 117.497 -133.563 1.00 38.63  ? 165  ILE B CA    1 
ATOM   4727  C C     . ILE B  1 165 ? 109.716 118.610 -132.623 1.00 38.08  ? 165  ILE B C     1 
ATOM   4728  O O     . ILE B  1 165 ? 110.784 119.196 -132.816 1.00 37.67  ? 165  ILE B O     1 
ATOM   4729  C CB    . ILE B  1 165 ? 110.418 116.532 -133.832 1.00 37.99  ? 165  ILE B CB    1 
ATOM   4730  C CG1   . ILE B  1 165 ? 109.980 115.480 -134.852 1.00 38.17  ? 165  ILE B CG1   1 
ATOM   4731  C CG2   . ILE B  1 165 ? 110.821 115.844 -132.536 1.00 38.97  ? 165  ILE B CG2   1 
ATOM   4732  C CD1   . ILE B  1 165 ? 111.049 114.510 -135.189 1.00 37.66  ? 165  ILE B CD1   1 
ATOM   4733  N N     . VAL B  1 166 ? 108.898 118.899 -131.612 1.00 36.25  ? 166  VAL B N     1 
ATOM   4734  C CA    . VAL B  1 166 ? 109.170 119.998 -130.687 1.00 35.13  ? 166  VAL B CA    1 
ATOM   4735  C C     . VAL B  1 166 ? 109.351 119.691 -129.198 1.00 35.37  ? 166  VAL B C     1 
ATOM   4736  O O     . VAL B  1 166 ? 109.070 118.581 -128.731 1.00 35.57  ? 166  VAL B O     1 
ATOM   4737  C CB    . VAL B  1 166 ? 108.028 121.026 -130.754 1.00 35.25  ? 166  VAL B CB    1 
ATOM   4738  C CG1   . VAL B  1 166 ? 107.843 121.532 -132.202 1.00 35.53  ? 166  VAL B CG1   1 
ATOM   4739  C CG2   . VAL B  1 166 ? 106.731 120.394 -130.221 1.00 33.01  ? 166  VAL B CG2   1 
ATOM   4740  N N     . SER B  1 167 ? 109.827 120.704 -128.465 1.00 34.71  ? 167  SER B N     1 
ATOM   4741  C CA    . SER B  1 167 ? 109.966 120.634 -127.003 1.00 32.30  ? 167  SER B CA    1 
ATOM   4742  C C     . SER B  1 167 ? 108.824 121.548 -126.572 1.00 30.51  ? 167  SER B C     1 
ATOM   4743  O O     . SER B  1 167 ? 108.034 121.975 -127.414 1.00 28.95  ? 167  SER B O     1 
ATOM   4744  C CB    . SER B  1 167 ? 111.312 121.214 -126.523 1.00 30.03  ? 167  SER B CB    1 
ATOM   4745  O OG    . SER B  1 167 ? 111.382 122.618 -126.705 1.00 29.33  ? 167  SER B OG    1 
ATOM   4746  N N     . SER B  1 168 ? 108.714 121.854 -125.281 1.00 29.28  ? 168  SER B N     1 
ATOM   4747  C CA    . SER B  1 168 ? 107.651 122.758 -124.831 1.00 27.09  ? 168  SER B CA    1 
ATOM   4748  C C     . SER B  1 168 ? 107.761 124.141 -125.517 1.00 26.70  ? 168  SER B C     1 
ATOM   4749  O O     . SER B  1 168 ? 106.752 124.832 -125.717 1.00 27.87  ? 168  SER B O     1 
ATOM   4750  C CB    . SER B  1 168 ? 107.706 122.902 -123.295 1.00 27.03  ? 168  SER B CB    1 
ATOM   4751  O OG    . SER B  1 168 ? 109.050 123.002 -122.851 1.00 23.66  ? 168  SER B OG    1 
ATOM   4752  N N     . THR B  1 169 ? 108.975 124.524 -125.889 1.00 27.42  ? 169  THR B N     1 
ATOM   4753  C CA    . THR B  1 169 ? 109.206 125.816 -126.551 1.00 27.76  ? 169  THR B CA    1 
ATOM   4754  C C     . THR B  1 169 ? 108.485 125.854 -127.887 1.00 28.25  ? 169  THR B C     1 
ATOM   4755  O O     . THR B  1 169 ? 107.710 126.783 -128.154 1.00 28.21  ? 169  THR B O     1 
ATOM   4756  C CB    . THR B  1 169 ? 110.717 126.090 -126.771 1.00 29.08  ? 169  THR B CB    1 
ATOM   4757  O OG1   . THR B  1 169 ? 111.348 126.306 -125.498 1.00 28.21  ? 169  THR B OG1   1 
ATOM   4758  C CG2   . THR B  1 169 ? 110.931 127.344 -127.680 1.00 28.01  ? 169  THR B CG2   1 
ATOM   4759  N N     . GLY B  1 170 ? 108.715 124.850 -128.727 1.00 28.20  ? 170  GLY B N     1 
ATOM   4760  C CA    . GLY B  1 170 ? 108.016 124.811 -130.008 1.00 28.21  ? 170  GLY B CA    1 
ATOM   4761  C C     . GLY B  1 170 ? 106.504 124.649 -129.839 1.00 28.57  ? 170  GLY B C     1 
ATOM   4762  O O     . GLY B  1 170 ? 105.705 125.244 -130.576 1.00 27.46  ? 170  GLY B O     1 
ATOM   4763  N N     . ALA B  1 171 ? 106.107 123.850 -128.843 1.00 28.64  ? 171  ALA B N     1 
ATOM   4764  C CA    . ALA B  1 171 ? 104.700 123.586 -128.573 1.00 28.28  ? 171  ALA B CA    1 
ATOM   4765  C C     . ALA B  1 171 ? 103.905 124.821 -128.160 1.00 28.72  ? 171  ALA B C     1 
ATOM   4766  O O     . ALA B  1 171 ? 102.691 124.882 -128.377 1.00 29.68  ? 171  ALA B O     1 
ATOM   4767  C CB    . ALA B  1 171 ? 104.583 122.488 -127.500 1.00 28.78  ? 171  ALA B CB    1 
ATOM   4768  N N     . LEU B  1 172 ? 104.594 125.815 -127.599 1.00 29.25  ? 172  LEU B N     1 
ATOM   4769  C CA    . LEU B  1 172 ? 103.962 127.048 -127.137 1.00 30.06  ? 172  LEU B CA    1 
ATOM   4770  C C     . LEU B  1 172 ? 103.740 128.009 -128.283 1.00 31.32  ? 172  LEU B C     1 
ATOM   4771  O O     . LEU B  1 172 ? 103.007 128.991 -128.159 1.00 30.44  ? 172  LEU B O     1 
ATOM   4772  C CB    . LEU B  1 172 ? 104.836 127.711 -126.057 1.00 30.63  ? 172  LEU B CB    1 
ATOM   4773  C CG    . LEU B  1 172 ? 104.853 126.984 -124.702 1.00 30.34  ? 172  LEU B CG    1 
ATOM   4774  C CD1   . LEU B  1 172 ? 105.945 127.524 -123.807 1.00 33.42  ? 172  LEU B CD1   1 
ATOM   4775  C CD2   . LEU B  1 172 ? 103.488 127.138 -124.046 1.00 28.94  ? 172  LEU B CD2   1 
ATOM   4776  N N     . SER B  1 173 ? 104.363 127.700 -129.413 1.00 33.78  ? 173  SER B N     1 
ATOM   4777  C CA    . SER B  1 173 ? 104.255 128.540 -130.601 1.00 35.12  ? 173  SER B CA    1 
ATOM   4778  C C     . SER B  1 173 ? 103.906 127.789 -131.880 1.00 36.29  ? 173  SER B C     1 
ATOM   4779  O O     . SER B  1 173 ? 104.324 128.186 -132.962 1.00 36.91  ? 173  SER B O     1 
ATOM   4780  C CB    . SER B  1 173 ? 105.559 129.315 -130.790 1.00 33.67  ? 173  SER B CB    1 
ATOM   4781  O OG    . SER B  1 173 ? 105.735 130.235 -129.727 1.00 30.49  ? 173  SER B OG    1 
ATOM   4782  N N     . LEU B  1 174 ? 103.134 126.713 -131.750 1.00 37.90  ? 174  LEU B N     1 
ATOM   4783  C CA    . LEU B  1 174 ? 102.709 125.921 -132.909 1.00 39.23  ? 174  LEU B CA    1 
ATOM   4784  C C     . LEU B  1 174 ? 101.942 126.880 -133.823 1.00 40.16  ? 174  LEU B C     1 
ATOM   4785  O O     . LEU B  1 174 ? 101.091 127.646 -133.360 1.00 40.11  ? 174  LEU B O     1 
ATOM   4786  C CB    . LEU B  1 174 ? 101.803 124.763 -132.459 1.00 39.39  ? 174  LEU B CB    1 
ATOM   4787  C CG    . LEU B  1 174 ? 102.316 123.320 -132.518 1.00 40.24  ? 174  LEU B CG    1 
ATOM   4788  C CD1   . LEU B  1 174 ? 103.720 123.222 -131.998 1.00 40.12  ? 174  LEU B CD1   1 
ATOM   4789  C CD2   . LEU B  1 174 ? 101.381 122.428 -131.735 1.00 38.75  ? 174  LEU B CD2   1 
ATOM   4790  N N     . LYS B  1 175 ? 102.251 126.850 -135.115 1.00 41.28  ? 175  LYS B N     1 
ATOM   4791  C CA    . LYS B  1 175 ? 101.607 127.746 -136.075 1.00 41.84  ? 175  LYS B CA    1 
ATOM   4792  C C     . LYS B  1 175 ? 100.174 127.347 -136.414 1.00 39.86  ? 175  LYS B C     1 
ATOM   4793  O O     . LYS B  1 175 ? 99.360  128.177 -136.799 1.00 40.28  ? 175  LYS B O     1 
ATOM   4794  C CB    . LYS B  1 175 ? 102.442 127.824 -137.365 1.00 45.56  ? 175  LYS B CB    1 
ATOM   4795  C CG    . LYS B  1 175 ? 103.926 128.082 -137.133 1.00 48.43  ? 175  LYS B CG    1 
ATOM   4796  C CD    . LYS B  1 175 ? 104.149 129.378 -136.368 1.00 53.22  ? 175  LYS B CD    1 
ATOM   4797  C CE    . LYS B  1 175 ? 103.715 130.597 -137.168 1.00 55.26  ? 175  LYS B CE    1 
ATOM   4798  N NZ    . LYS B  1 175 ? 103.858 131.850 -136.364 1.00 57.29  ? 175  LYS B NZ    1 
ATOM   4799  N N     . LYS B  1 176 ? 99.863  126.074 -136.259 1.00 37.95  ? 176  LYS B N     1 
ATOM   4800  C CA    . LYS B  1 176 ? 98.531  125.583 -136.570 1.00 37.29  ? 176  LYS B CA    1 
ATOM   4801  C C     . LYS B  1 176 ? 98.137  124.500 -135.560 1.00 34.58  ? 176  LYS B C     1 
ATOM   4802  O O     . LYS B  1 176 ? 98.999  123.812 -135.031 1.00 32.07  ? 176  LYS B O     1 
ATOM   4803  C CB    . LYS B  1 176 ? 98.555  125.002 -137.994 1.00 40.47  ? 176  LYS B CB    1 
ATOM   4804  C CG    . LYS B  1 176 ? 97.240  124.482 -138.526 1.00 46.82  ? 176  LYS B CG    1 
ATOM   4805  C CD    . LYS B  1 176 ? 97.467  123.645 -139.814 1.00 50.76  ? 176  LYS B CD    1 
ATOM   4806  C CE    . LYS B  1 176 ? 96.146  123.231 -140.498 1.00 53.91  ? 176  LYS B CE    1 
ATOM   4807  N NZ    . LYS B  1 176 ? 95.333  124.389 -141.013 1.00 55.18  ? 176  LYS B NZ    1 
ATOM   4808  N N     . VAL B  1 177 ? 96.844  124.360 -135.285 1.00 32.20  ? 177  VAL B N     1 
ATOM   4809  C CA    . VAL B  1 177 ? 96.387  123.310 -134.375 1.00 31.28  ? 177  VAL B CA    1 
ATOM   4810  C C     . VAL B  1 177 ? 96.728  121.960 -135.035 1.00 32.09  ? 177  VAL B C     1 
ATOM   4811  O O     . VAL B  1 177 ? 96.199  121.634 -136.090 1.00 29.57  ? 177  VAL B O     1 
ATOM   4812  C CB    . VAL B  1 177 ? 94.861  123.363 -134.174 1.00 28.77  ? 177  VAL B CB    1 
ATOM   4813  C CG1   . VAL B  1 177 ? 94.422  122.216 -133.299 1.00 29.07  ? 177  VAL B CG1   1 
ATOM   4814  C CG2   . VAL B  1 177 ? 94.454  124.683 -133.557 1.00 30.79  ? 177  VAL B CG2   1 
ATOM   4815  N N     . PRO B  1 178 ? 97.622  121.163 -134.425 1.00 32.98  ? 178  PRO B N     1 
ATOM   4816  C CA    . PRO B  1 178 ? 97.908  119.883 -135.100 1.00 33.54  ? 178  PRO B CA    1 
ATOM   4817  C C     . PRO B  1 178 ? 96.693  118.946 -135.090 1.00 33.93  ? 178  PRO B C     1 
ATOM   4818  O O     . PRO B  1 178 ? 95.940  118.896 -134.119 1.00 33.13  ? 178  PRO B O     1 
ATOM   4819  C CB    . PRO B  1 178 ? 99.083  119.318 -134.300 1.00 34.42  ? 178  PRO B CB    1 
ATOM   4820  C CG    . PRO B  1 178 ? 98.840  119.877 -132.895 1.00 33.90  ? 178  PRO B CG    1 
ATOM   4821  C CD    . PRO B  1 178 ? 98.385  121.306 -133.171 1.00 32.45  ? 178  PRO B CD    1 
ATOM   4822  N N     . GLU B  1 179 ? 96.506  118.205 -136.175 1.00 33.51  ? 179  GLU B N     1 
ATOM   4823  C CA    . GLU B  1 179 ? 95.391  117.286 -136.257 1.00 34.09  ? 179  GLU B CA    1 
ATOM   4824  C C     . GLU B  1 179 ? 95.585  116.150 -135.276 1.00 32.88  ? 179  GLU B C     1 
ATOM   4825  O O     . GLU B  1 179 ? 94.659  115.770 -134.574 1.00 31.51  ? 179  GLU B O     1 
ATOM   4826  C CB    . GLU B  1 179 ? 95.271  116.720 -137.661 1.00 38.65  ? 179  GLU B CB    1 
ATOM   4827  C CG    . GLU B  1 179 ? 93.986  115.977 -137.894 1.00 43.39  ? 179  GLU B CG    1 
ATOM   4828  C CD    . GLU B  1 179 ? 93.784  115.664 -139.364 1.00 47.32  ? 179  GLU B CD    1 
ATOM   4829  O OE1   . GLU B  1 179 ? 93.894  116.602 -140.193 1.00 49.01  ? 179  GLU B OE1   1 
ATOM   4830  O OE2   . GLU B  1 179 ? 93.515  114.489 -139.683 1.00 48.36  ? 179  GLU B OE2   1 
ATOM   4831  N N     . LYS B  1 180 ? 96.783  115.589 -135.257 1.00 32.09  ? 180  LYS B N     1 
ATOM   4832  C CA    . LYS B  1 180 ? 97.093  114.522 -134.326 1.00 34.13  ? 180  LYS B CA    1 
ATOM   4833  C C     . LYS B  1 180 ? 98.444  114.852 -133.678 1.00 34.38  ? 180  LYS B C     1 
ATOM   4834  O O     . LYS B  1 180 ? 99.403  115.211 -134.368 1.00 33.73  ? 180  LYS B O     1 
ATOM   4835  C CB    . LYS B  1 180 ? 97.140  113.165 -135.037 1.00 36.38  ? 180  LYS B CB    1 
ATOM   4836  C CG    . LYS B  1 180 ? 97.552  112.068 -134.109 1.00 41.63  ? 180  LYS B CG    1 
ATOM   4837  C CD    . LYS B  1 180 ? 97.076  110.699 -134.554 1.00 46.07  ? 180  LYS B CD    1 
ATOM   4838  C CE    . LYS B  1 180 ? 97.408  109.665 -133.474 1.00 47.42  ? 180  LYS B CE    1 
ATOM   4839  N NZ    . LYS B  1 180 ? 97.173  108.268 -133.947 1.00 48.85  ? 180  LYS B NZ    1 
ATOM   4840  N N     . MET B  1 181 ? 98.505  114.756 -132.348 1.00 33.39  ? 181  MET B N     1 
ATOM   4841  C CA    . MET B  1 181 ? 99.728  115.059 -131.619 1.00 32.69  ? 181  MET B CA    1 
ATOM   4842  C C     . MET B  1 181 ? 100.065 113.985 -130.617 1.00 31.39  ? 181  MET B C     1 
ATOM   4843  O O     . MET B  1 181 ? 99.203  113.511 -129.874 1.00 30.70  ? 181  MET B O     1 
ATOM   4844  C CB    . MET B  1 181 ? 99.605  116.409 -130.878 1.00 34.32  ? 181  MET B CB    1 
ATOM   4845  C CG    . MET B  1 181 ? 100.850 116.829 -130.072 1.00 35.50  ? 181  MET B CG    1 
ATOM   4846  S SD    . MET B  1 181 ? 100.692 118.478 -129.282 1.00 38.36  ? 181  MET B SD    1 
ATOM   4847  C CE    . MET B  1 181 ? 100.232 117.990 -127.620 1.00 38.24  ? 181  MET B CE    1 
ATOM   4848  N N     . VAL B  1 182 ? 101.328 113.588 -130.611 1.00 31.35  ? 182  VAL B N     1 
ATOM   4849  C CA    . VAL B  1 182 ? 101.799 112.596 -129.653 1.00 29.94  ? 182  VAL B CA    1 
ATOM   4850  C C     . VAL B  1 182 ? 102.756 113.310 -128.677 1.00 29.35  ? 182  VAL B C     1 
ATOM   4851  O O     . VAL B  1 182 ? 103.602 114.117 -129.091 1.00 27.62  ? 182  VAL B O     1 
ATOM   4852  C CB    . VAL B  1 182 ? 102.555 111.433 -130.353 1.00 30.59  ? 182  VAL B CB    1 
ATOM   4853  C CG1   . VAL B  1 182 ? 103.269 110.594 -129.307 1.00 28.33  ? 182  VAL B CG1   1 
ATOM   4854  C CG2   . VAL B  1 182 ? 101.574 110.544 -131.154 1.00 28.49  ? 182  VAL B CG2   1 
ATOM   4855  N N     . VAL B  1 183 ? 102.602 113.021 -127.384 1.00 29.34  ? 183  VAL B N     1 
ATOM   4856  C CA    . VAL B  1 183 ? 103.450 113.614 -126.346 1.00 27.73  ? 183  VAL B CA    1 
ATOM   4857  C C     . VAL B  1 183 ? 104.222 112.516 -125.639 1.00 27.58  ? 183  VAL B C     1 
ATOM   4858  O O     . VAL B  1 183 ? 103.621 111.519 -125.208 1.00 27.16  ? 183  VAL B O     1 
ATOM   4859  C CB    . VAL B  1 183 ? 102.601 114.340 -125.295 1.00 29.78  ? 183  VAL B CB    1 
ATOM   4860  C CG1   . VAL B  1 183 ? 103.495 115.005 -124.245 1.00 27.65  ? 183  VAL B CG1   1 
ATOM   4861  C CG2   . VAL B  1 183 ? 101.718 115.382 -125.979 1.00 27.09  ? 183  VAL B CG2   1 
ATOM   4862  N N     . ILE B  1 184 ? 105.543 112.665 -125.552 1.00 26.06  ? 184  ILE B N     1 
ATOM   4863  C CA    . ILE B  1 184 ? 106.361 111.681 -124.835 1.00 25.79  ? 184  ILE B CA    1 
ATOM   4864  C C     . ILE B  1 184 ? 106.532 112.310 -123.449 1.00 25.98  ? 184  ILE B C     1 
ATOM   4865  O O     . ILE B  1 184 ? 107.050 113.419 -123.335 1.00 26.50  ? 184  ILE B O     1 
ATOM   4866  C CB    . ILE B  1 184 ? 107.779 111.491 -125.460 1.00 25.86  ? 184  ILE B CB    1 
ATOM   4867  C CG1   . ILE B  1 184 ? 107.665 111.065 -126.933 1.00 26.08  ? 184  ILE B CG1   1 
ATOM   4868  C CG2   . ILE B  1 184 ? 108.563 110.438 -124.660 1.00 23.34  ? 184  ILE B CG2   1 
ATOM   4869  C CD1   . ILE B  1 184 ? 109.010 110.833 -127.626 1.00 27.86  ? 184  ILE B CD1   1 
ATOM   4870  N N     . GLY B  1 185 ? 106.099 111.607 -122.410 1.00 27.63  ? 185  GLY B N     1 
ATOM   4871  C CA    . GLY B  1 185 ? 106.187 112.150 -121.055 1.00 27.64  ? 185  GLY B CA    1 
ATOM   4872  C C     . GLY B  1 185 ? 104.836 112.708 -120.579 1.00 26.94  ? 185  GLY B C     1 
ATOM   4873  O O     . GLY B  1 185 ? 104.405 113.773 -121.014 1.00 27.59  ? 185  GLY B O     1 
ATOM   4874  N N     . ALA B  1 186 ? 104.147 111.983 -119.706 1.00 27.30  ? 186  ALA B N     1 
ATOM   4875  C CA    . ALA B  1 186 ? 102.856 112.446 -119.185 1.00 27.62  ? 186  ALA B CA    1 
ATOM   4876  C C     . ALA B  1 186 ? 103.035 113.150 -117.838 1.00 28.85  ? 186  ALA B C     1 
ATOM   4877  O O     . ALA B  1 186 ? 102.279 112.893 -116.870 1.00 27.73  ? 186  ALA B O     1 
ATOM   4878  C CB    . ALA B  1 186 ? 101.888 111.274 -119.033 1.00 26.51  ? 186  ALA B CB    1 
ATOM   4879  N N     . GLY B  1 187 ? 104.054 114.014 -117.803 1.00 29.33  ? 187  GLY B N     1 
ATOM   4880  C CA    . GLY B  1 187 ? 104.396 114.813 -116.631 1.00 28.70  ? 187  GLY B CA    1 
ATOM   4881  C C     . GLY B  1 187 ? 103.571 116.087 -116.591 1.00 29.32  ? 187  GLY B C     1 
ATOM   4882  O O     . GLY B  1 187 ? 102.449 116.145 -117.133 1.00 28.40  ? 187  GLY B O     1 
ATOM   4883  N N     . VAL B  1 188 ? 104.104 117.120 -115.949 1.00 28.16  ? 188  VAL B N     1 
ATOM   4884  C CA    . VAL B  1 188 ? 103.361 118.372 -115.851 1.00 28.26  ? 188  VAL B CA    1 
ATOM   4885  C C     . VAL B  1 188 ? 103.209 119.099 -117.195 1.00 26.63  ? 188  VAL B C     1 
ATOM   4886  O O     . VAL B  1 188 ? 102.103 119.510 -117.552 1.00 23.57  ? 188  VAL B O     1 
ATOM   4887  C CB    . VAL B  1 188 ? 103.996 119.325 -114.801 1.00 27.21  ? 188  VAL B CB    1 
ATOM   4888  C CG1   . VAL B  1 188 ? 103.145 120.556 -114.631 1.00 24.77  ? 188  VAL B CG1   1 
ATOM   4889  C CG2   . VAL B  1 188 ? 104.108 118.595 -113.461 1.00 28.71  ? 188  VAL B CG2   1 
ATOM   4890  N N     . ILE B  1 189 ? 104.312 119.269 -117.929 1.00 28.10  ? 189  ILE B N     1 
ATOM   4891  C CA    . ILE B  1 189 ? 104.259 119.929 -119.242 1.00 30.76  ? 189  ILE B CA    1 
ATOM   4892  C C     . ILE B  1 189 ? 103.363 119.134 -120.196 1.00 29.87  ? 189  ILE B C     1 
ATOM   4893  O O     . ILE B  1 189 ? 102.535 119.695 -120.919 1.00 32.58  ? 189  ILE B O     1 
ATOM   4894  C CB    . ILE B  1 189 ? 105.678 120.019 -119.908 1.00 32.32  ? 189  ILE B CB    1 
ATOM   4895  C CG1   . ILE B  1 189 ? 106.555 121.007 -119.157 1.00 32.26  ? 189  ILE B CG1   1 
ATOM   4896  C CG2   . ILE B  1 189 ? 105.550 120.464 -121.382 1.00 33.16  ? 189  ILE B CG2   1 
ATOM   4897  C CD1   . ILE B  1 189 ? 107.942 121.081 -119.715 1.00 34.33  ? 189  ILE B CD1   1 
ATOM   4898  N N     . GLY B  1 190 ? 103.544 117.819 -120.192 1.00 30.06  ? 190  GLY B N     1 
ATOM   4899  C CA    . GLY B  1 190 ? 102.776 116.964 -121.075 1.00 30.14  ? 190  GLY B CA    1 
ATOM   4900  C C     . GLY B  1 190 ? 101.293 117.142 -120.892 1.00 30.34  ? 190  GLY B C     1 
ATOM   4901  O O     . GLY B  1 190 ? 100.563 117.357 -121.862 1.00 30.03  ? 190  GLY B O     1 
ATOM   4902  N N     . VAL B  1 191 ? 100.834 117.064 -119.643 1.00 28.70  ? 191  VAL B N     1 
ATOM   4903  C CA    . VAL B  1 191 ? 99.425  117.219 -119.392 1.00 28.67  ? 191  VAL B CA    1 
ATOM   4904  C C     . VAL B  1 191 ? 98.983  118.663 -119.652 1.00 27.73  ? 191  VAL B C     1 
ATOM   4905  O O     . VAL B  1 191 ? 97.905  118.900 -120.197 1.00 28.54  ? 191  VAL B O     1 
ATOM   4906  C CB    . VAL B  1 191 ? 99.076  116.746 -117.956 1.00 29.23  ? 191  VAL B CB    1 
ATOM   4907  C CG1   . VAL B  1 191 ? 97.659  117.086 -117.634 1.00 33.07  ? 191  VAL B CG1   1 
ATOM   4908  C CG2   . VAL B  1 191 ? 99.252  115.209 -117.860 1.00 28.84  ? 191  VAL B CG2   1 
ATOM   4909  N N     . GLU B  1 192 ? 99.804  119.638 -119.302 1.00 25.58  ? 192  GLU B N     1 
ATOM   4910  C CA    . GLU B  1 192 ? 99.388  121.011 -119.565 1.00 23.49  ? 192  GLU B CA    1 
ATOM   4911  C C     . GLU B  1 192 ? 99.349  121.352 -121.059 1.00 23.88  ? 192  GLU B C     1 
ATOM   4912  O O     . GLU B  1 192 ? 98.327  121.813 -121.557 1.00 23.14  ? 192  GLU B O     1 
ATOM   4913  C CB    . GLU B  1 192 ? 100.297 122.000 -118.833 1.00 22.03  ? 192  GLU B CB    1 
ATOM   4914  C CG    . GLU B  1 192 ? 100.102 121.977 -117.316 1.00 24.78  ? 192  GLU B CG    1 
ATOM   4915  C CD    . GLU B  1 192 ? 100.914 123.056 -116.594 1.00 27.92  ? 192  GLU B CD    1 
ATOM   4916  O OE1   . GLU B  1 192 ? 101.791 123.678 -117.236 1.00 27.39  ? 192  GLU B OE1   1 
ATOM   4917  O OE2   . GLU B  1 192 ? 100.673 123.273 -115.387 1.00 26.12  ? 192  GLU B OE2   1 
ATOM   4918  N N     . LEU B  1 193 ? 100.457 121.147 -121.756 1.00 24.08  ? 193  LEU B N     1 
ATOM   4919  C CA    . LEU B  1 193 ? 100.499 121.469 -123.191 1.00 27.09  ? 193  LEU B CA    1 
ATOM   4920  C C     . LEU B  1 193 ? 99.590  120.537 -123.999 1.00 27.31  ? 193  LEU B C     1 
ATOM   4921  O O     . LEU B  1 193 ? 98.997  120.945 -125.003 1.00 30.34  ? 193  LEU B O     1 
ATOM   4922  C CB    . LEU B  1 193 ? 101.948 121.434 -123.705 1.00 25.35  ? 193  LEU B CB    1 
ATOM   4923  C CG    . LEU B  1 193 ? 102.767 122.514 -122.972 1.00 28.85  ? 193  LEU B CG    1 
ATOM   4924  C CD1   . LEU B  1 193 ? 104.065 122.751 -123.705 1.00 25.24  ? 193  LEU B CD1   1 
ATOM   4925  C CD2   . LEU B  1 193 ? 101.953 123.829 -122.866 1.00 25.47  ? 193  LEU B CD2   1 
ATOM   4926  N N     . GLY B  1 194 ? 99.480  119.288 -123.557 1.00 25.99  ? 194  GLY B N     1 
ATOM   4927  C CA    . GLY B  1 194 ? 98.603  118.354 -124.236 1.00 25.76  ? 194  GLY B CA    1 
ATOM   4928  C C     . GLY B  1 194 ? 97.173  118.864 -124.126 1.00 25.91  ? 194  GLY B C     1 
ATOM   4929  O O     . GLY B  1 194 ? 96.400  118.856 -125.099 1.00 26.55  ? 194  GLY B O     1 
ATOM   4930  N N     . SER B  1 195 ? 96.813  119.327 -122.937 1.00 24.33  ? 195  SER B N     1 
ATOM   4931  C CA    . SER B  1 195 ? 95.469  119.816 -122.709 1.00 24.25  ? 195  SER B CA    1 
ATOM   4932  C C     . SER B  1 195 ? 95.118  121.048 -123.540 1.00 24.94  ? 195  SER B C     1 
ATOM   4933  O O     . SER B  1 195 ? 94.010  121.184 -124.076 1.00 25.29  ? 195  SER B O     1 
ATOM   4934  C CB    . SER B  1 195 ? 95.291  120.094 -121.227 1.00 25.52  ? 195  SER B CB    1 
ATOM   4935  O OG    . SER B  1 195 ? 93.930  120.003 -120.895 1.00 33.43  ? 195  SER B OG    1 
ATOM   4936  N N     . VAL B  1 196 ? 96.051  121.986 -123.602 1.00 23.77  ? 196  VAL B N     1 
ATOM   4937  C CA    . VAL B  1 196 ? 95.854  123.176 -124.413 1.00 25.26  ? 196  VAL B CA    1 
ATOM   4938  C C     . VAL B  1 196 ? 95.491  122.813 -125.902 1.00 27.42  ? 196  VAL B C     1 
ATOM   4939  O O     . VAL B  1 196 ? 94.475  123.285 -126.453 1.00 27.11  ? 196  VAL B O     1 
ATOM   4940  C CB    . VAL B  1 196 ? 97.139  124.001 -124.415 1.00 25.33  ? 196  VAL B CB    1 
ATOM   4941  C CG1   . VAL B  1 196 ? 97.122  125.019 -125.561 1.00 23.95  ? 196  VAL B CG1   1 
ATOM   4942  C CG2   . VAL B  1 196 ? 97.317  124.688 -123.040 1.00 20.96  ? 196  VAL B CG2   1 
ATOM   4943  N N     . TRP B  1 197 ? 96.323  121.977 -126.528 1.00 26.13  ? 197  TRP B N     1 
ATOM   4944  C CA    . TRP B  1 197 ? 96.121  121.596 -127.930 1.00 27.08  ? 197  TRP B CA    1 
ATOM   4945  C C     . TRP B  1 197 ? 94.950  120.663 -128.118 1.00 27.49  ? 197  TRP B C     1 
ATOM   4946  O O     . TRP B  1 197 ? 94.339  120.667 -129.157 1.00 28.42  ? 197  TRP B O     1 
ATOM   4947  C CB    . TRP B  1 197 ? 97.415  121.014 -128.524 1.00 24.27  ? 197  TRP B CB    1 
ATOM   4948  C CG    . TRP B  1 197 ? 98.433  122.079 -128.670 1.00 25.00  ? 197  TRP B CG    1 
ATOM   4949  C CD1   . TRP B  1 197 ? 99.600  122.203 -127.966 1.00 25.62  ? 197  TRP B CD1   1 
ATOM   4950  C CD2   . TRP B  1 197 ? 98.336  123.259 -129.498 1.00 26.65  ? 197  TRP B CD2   1 
ATOM   4951  N NE1   . TRP B  1 197 ? 100.231 123.391 -128.295 1.00 25.26  ? 197  TRP B NE1   1 
ATOM   4952  C CE2   . TRP B  1 197 ? 99.478  124.054 -129.229 1.00 25.31  ? 197  TRP B CE2   1 
ATOM   4953  C CE3   . TRP B  1 197 ? 97.392  123.720 -130.442 1.00 27.22  ? 197  TRP B CE3   1 
ATOM   4954  C CZ2   . TRP B  1 197 ? 99.705  125.291 -129.869 1.00 27.31  ? 197  TRP B CZ2   1 
ATOM   4955  C CZ3   . TRP B  1 197 ? 97.620  124.953 -131.080 1.00 25.41  ? 197  TRP B CZ3   1 
ATOM   4956  C CH2   . TRP B  1 197 ? 98.773  125.722 -130.785 1.00 27.32  ? 197  TRP B CH2   1 
ATOM   4957  N N     . GLN B  1 198 ? 94.646  119.863 -127.106 1.00 28.38  ? 198  GLN B N     1 
ATOM   4958  C CA    . GLN B  1 198 ? 93.489  119.002 -127.158 1.00 28.40  ? 198  GLN B CA    1 
ATOM   4959  C C     . GLN B  1 198 ? 92.252  119.925 -127.232 1.00 29.25  ? 198  GLN B C     1 
ATOM   4960  O O     . GLN B  1 198 ? 91.360  119.730 -128.079 1.00 28.66  ? 198  GLN B O     1 
ATOM   4961  C CB    . GLN B  1 198 ? 93.458  118.118 -125.905 1.00 30.20  ? 198  GLN B CB    1 
ATOM   4962  C CG    . GLN B  1 198 ? 92.363  117.068 -125.865 1.00 32.13  ? 198  GLN B CG    1 
ATOM   4963  C CD    . GLN B  1 198 ? 90.996  117.642 -125.549 1.00 35.63  ? 198  GLN B CD    1 
ATOM   4964  O OE1   . GLN B  1 198 ? 90.798  118.295 -124.508 1.00 36.03  ? 198  GLN B OE1   1 
ATOM   4965  N NE2   . GLN B  1 198 ? 90.030  117.391 -126.432 1.00 35.62  ? 198  GLN B NE2   1 
ATOM   4966  N N     . ARG B  1 199 ? 92.200  120.940 -126.370 1.00 27.65  ? 199  ARG B N     1 
ATOM   4967  C CA    . ARG B  1 199 ? 91.078  121.885 -126.375 1.00 28.35  ? 199  ARG B CA    1 
ATOM   4968  C C     . ARG B  1 199 ? 90.900  122.648 -127.699 1.00 28.66  ? 199  ARG B C     1 
ATOM   4969  O O     . ARG B  1 199 ? 89.779  122.945 -128.107 1.00 28.03  ? 199  ARG B O     1 
ATOM   4970  C CB    . ARG B  1 199 ? 91.235  122.928 -125.277 1.00 28.82  ? 199  ARG B CB    1 
ATOM   4971  C CG    . ARG B  1 199 ? 91.107  122.411 -123.878 1.00 28.09  ? 199  ARG B CG    1 
ATOM   4972  C CD    . ARG B  1 199 ? 91.820  123.373 -122.954 1.00 29.04  ? 199  ARG B CD    1 
ATOM   4973  N NE    . ARG B  1 199 ? 91.936  122.851 -121.584 1.00 29.80  ? 199  ARG B NE    1 
ATOM   4974  C CZ    . ARG B  1 199 ? 92.491  123.519 -120.577 1.00 28.80  ? 199  ARG B CZ    1 
ATOM   4975  N NH1   . ARG B  1 199 ? 92.977  124.737 -120.787 1.00 25.54  ? 199  ARG B NH1   1 
ATOM   4976  N NH2   . ARG B  1 199 ? 92.571  122.956 -119.370 1.00 28.82  ? 199  ARG B NH2   1 
ATOM   4977  N N     . LEU B  1 200 ? 92.004  122.979 -128.353 1.00 28.36  ? 200  LEU B N     1 
ATOM   4978  C CA    . LEU B  1 200 ? 91.938  123.724 -129.599 1.00 29.70  ? 200  LEU B CA    1 
ATOM   4979  C C     . LEU B  1 200 ? 91.572  122.842 -130.791 1.00 30.81  ? 200  LEU B C     1 
ATOM   4980  O O     . LEU B  1 200 ? 91.343  123.339 -131.890 1.00 29.48  ? 200  LEU B O     1 
ATOM   4981  C CB    . LEU B  1 200 ? 93.268  124.446 -129.818 1.00 28.32  ? 200  LEU B CB    1 
ATOM   4982  C CG    . LEU B  1 200 ? 93.574  125.352 -128.616 1.00 27.31  ? 200  LEU B CG    1 
ATOM   4983  C CD1   . LEU B  1 200 ? 94.864  126.120 -128.826 1.00 29.02  ? 200  LEU B CD1   1 
ATOM   4984  C CD2   . LEU B  1 200 ? 92.462  126.325 -128.445 1.00 28.48  ? 200  LEU B CD2   1 
ATOM   4985  N N     . GLY B  1 201 ? 91.493  121.531 -130.556 1.00 32.09  ? 201  GLY B N     1 
ATOM   4986  C CA    . GLY B  1 201 ? 91.105  120.621 -131.619 1.00 33.57  ? 201  GLY B CA    1 
ATOM   4987  C C     . GLY B  1 201 ? 92.010  119.449 -131.964 1.00 33.41  ? 201  GLY B C     1 
ATOM   4988  O O     . GLY B  1 201 ? 91.631  118.624 -132.801 1.00 31.53  ? 201  GLY B O     1 
ATOM   4989  N N     . ALA B  1 202 ? 93.195  119.364 -131.358 1.00 32.02  ? 202  ALA B N     1 
ATOM   4990  C CA    . ALA B  1 202 ? 94.082  118.243 -131.661 1.00 32.49  ? 202  ALA B CA    1 
ATOM   4991  C C     . ALA B  1 202 ? 93.626  116.937 -131.008 1.00 32.85  ? 202  ALA B C     1 
ATOM   4992  O O     . ALA B  1 202 ? 92.915  116.938 -130.000 1.00 31.35  ? 202  ALA B O     1 
ATOM   4993  C CB    . ALA B  1 202 ? 95.526  118.557 -131.226 1.00 32.48  ? 202  ALA B CB    1 
ATOM   4994  N N     . ASP B  1 203 ? 94.035  115.832 -131.629 1.00 32.96  ? 203  ASP B N     1 
ATOM   4995  C CA    . ASP B  1 203 ? 93.769  114.490 -131.134 1.00 32.88  ? 203  ASP B CA    1 
ATOM   4996  C C     . ASP B  1 203 ? 95.096  114.208 -130.438 1.00 30.68  ? 203  ASP B C     1 
ATOM   4997  O O     . ASP B  1 203 ? 96.133  114.026 -131.086 1.00 29.94  ? 203  ASP B O     1 
ATOM   4998  C CB    . ASP B  1 203 ? 93.575  113.511 -132.297 1.00 37.03  ? 203  ASP B CB    1 
ATOM   4999  C CG    . ASP B  1 203 ? 93.361  112.072 -131.832 1.00 40.42  ? 203  ASP B CG    1 
ATOM   5000  O OD1   . ASP B  1 203 ? 94.068  111.609 -130.920 1.00 44.12  ? 203  ASP B OD1   1 
ATOM   5001  O OD2   . ASP B  1 203 ? 92.485  111.392 -132.396 1.00 45.57  ? 203  ASP B OD2   1 
ATOM   5002  N N     . VAL B  1 204 ? 95.050  114.167 -129.118 1.00 30.01  ? 204  VAL B N     1 
ATOM   5003  C CA    . VAL B  1 204 ? 96.242  113.985 -128.314 1.00 28.40  ? 204  VAL B CA    1 
ATOM   5004  C C     . VAL B  1 204 ? 96.391  112.663 -127.561 1.00 28.21  ? 204  VAL B C     1 
ATOM   5005  O O     . VAL B  1 204 ? 95.460  112.177 -126.934 1.00 26.95  ? 204  VAL B O     1 
ATOM   5006  C CB    . VAL B  1 204 ? 96.334  115.150 -127.282 1.00 30.56  ? 204  VAL B CB    1 
ATOM   5007  C CG1   . VAL B  1 204 ? 97.616  115.035 -126.436 1.00 29.62  ? 204  VAL B CG1   1 
ATOM   5008  C CG2   . VAL B  1 204 ? 96.265  116.492 -128.022 1.00 29.31  ? 204  VAL B CG2   1 
ATOM   5009  N N     . THR B  1 205 ? 97.584  112.086 -127.657 1.00 26.93  ? 205  THR B N     1 
ATOM   5010  C CA    . THR B  1 205 ? 97.913  110.882 -126.932 1.00 28.43  ? 205  THR B CA    1 
ATOM   5011  C C     . THR B  1 205 ? 99.254  111.127 -126.222 1.00 29.06  ? 205  THR B C     1 
ATOM   5012  O O     . THR B  1 205 ? 100.232 111.581 -126.833 1.00 28.16  ? 205  THR B O     1 
ATOM   5013  C CB    . THR B  1 205 ? 98.029  109.641 -127.864 1.00 28.23  ? 205  THR B CB    1 
ATOM   5014  O OG1   . THR B  1 205 ? 96.765  109.389 -128.484 1.00 28.18  ? 205  THR B OG1   1 
ATOM   5015  C CG2   . THR B  1 205 ? 98.400  108.416 -127.059 1.00 27.94  ? 205  THR B CG2   1 
ATOM   5016  N N     . ALA B  1 206 ? 99.284  110.888 -124.912 1.00 29.84  ? 206  ALA B N     1 
ATOM   5017  C CA    . ALA B  1 206 ? 100.529 111.035 -124.165 1.00 28.06  ? 206  ALA B CA    1 
ATOM   5018  C C     . ALA B  1 206 ? 101.073 109.636 -123.920 1.00 27.63  ? 206  ALA B C     1 
ATOM   5019  O O     . ALA B  1 206 ? 100.339 108.773 -123.448 1.00 27.08  ? 206  ALA B O     1 
ATOM   5020  C CB    . ALA B  1 206 ? 100.287 111.737 -122.810 1.00 28.48  ? 206  ALA B CB    1 
ATOM   5021  N N     . VAL B  1 207 ? 102.348 109.416 -124.240 1.00 27.67  ? 207  VAL B N     1 
ATOM   5022  C CA    . VAL B  1 207 ? 102.992 108.127 -124.016 1.00 27.93  ? 207  VAL B CA    1 
ATOM   5023  C C     . VAL B  1 207 ? 103.877 108.295 -122.784 1.00 27.75  ? 207  VAL B C     1 
ATOM   5024  O O     . VAL B  1 207 ? 104.763 109.158 -122.769 1.00 27.43  ? 207  VAL B O     1 
ATOM   5025  C CB    . VAL B  1 207 ? 103.879 107.705 -125.209 1.00 28.18  ? 207  VAL B CB    1 
ATOM   5026  C CG1   . VAL B  1 207 ? 104.575 106.395 -124.878 1.00 31.07  ? 207  VAL B CG1   1 
ATOM   5027  C CG2   . VAL B  1 207 ? 103.035 107.547 -126.465 1.00 28.35  ? 207  VAL B CG2   1 
ATOM   5028  N N     . GLU B  1 208 ? 103.646 107.454 -121.775 1.00 26.97  ? 208  GLU B N     1 
ATOM   5029  C CA    . GLU B  1 208 ? 104.361 107.533 -120.491 1.00 27.88  ? 208  GLU B CA    1 
ATOM   5030  C C     . GLU B  1 208 ? 105.042 106.241 -120.021 1.00 28.12  ? 208  GLU B C     1 
ATOM   5031  O O     . GLU B  1 208 ? 104.402 105.196 -119.904 1.00 29.29  ? 208  GLU B O     1 
ATOM   5032  C CB    . GLU B  1 208 ? 103.372 108.010 -119.408 1.00 26.83  ? 208  GLU B CB    1 
ATOM   5033  C CG    . GLU B  1 208 ? 103.897 107.969 -117.960 1.00 25.03  ? 208  GLU B CG    1 
ATOM   5034  C CD    . GLU B  1 208 ? 105.142 108.827 -117.761 1.00 24.28  ? 208  GLU B CD    1 
ATOM   5035  O OE1   . GLU B  1 208 ? 105.128 110.019 -118.147 1.00 25.15  ? 208  GLU B OE1   1 
ATOM   5036  O OE2   . GLU B  1 208 ? 106.138 108.316 -117.219 1.00 25.29  ? 208  GLU B OE2   1 
ATOM   5037  N N     . PHE B  1 209 ? 106.324 106.329 -119.702 1.00 28.40  ? 209  PHE B N     1 
ATOM   5038  C CA    . PHE B  1 209 ? 107.059 105.164 -119.246 1.00 31.41  ? 209  PHE B CA    1 
ATOM   5039  C C     . PHE B  1 209 ? 106.596 104.607 -117.887 1.00 33.12  ? 209  PHE B C     1 
ATOM   5040  O O     . PHE B  1 209 ? 106.541 103.385 -117.705 1.00 31.43  ? 209  PHE B O     1 
ATOM   5041  C CB    . PHE B  1 209 ? 108.555 105.481 -119.196 1.00 36.63  ? 209  PHE B CB    1 
ATOM   5042  C CG    . PHE B  1 209 ? 109.421 104.278 -118.895 1.00 40.53  ? 209  PHE B CG    1 
ATOM   5043  C CD1   . PHE B  1 209 ? 109.649 103.870 -117.581 1.00 43.43  ? 209  PHE B CD1   1 
ATOM   5044  C CD2   . PHE B  1 209 ? 109.983 103.535 -119.933 1.00 42.81  ? 209  PHE B CD2   1 
ATOM   5045  C CE1   . PHE B  1 209 ? 110.428 102.733 -117.303 1.00 44.00  ? 209  PHE B CE1   1 
ATOM   5046  C CE2   . PHE B  1 209 ? 110.764 102.400 -119.667 1.00 43.68  ? 209  PHE B CE2   1 
ATOM   5047  C CZ    . PHE B  1 209 ? 110.985 102.000 -118.351 1.00 44.74  ? 209  PHE B CZ    1 
ATOM   5048  N N     . LEU B  1 210 ? 106.262 105.495 -116.947 1.00 31.53  ? 210  LEU B N     1 
ATOM   5049  C CA    . LEU B  1 210 ? 105.800 105.081 -115.620 1.00 31.15  ? 210  LEU B CA    1 
ATOM   5050  C C     . LEU B  1 210 ? 104.318 104.761 -115.661 1.00 30.55  ? 210  LEU B C     1 
ATOM   5051  O O     . LEU B  1 210 ? 103.682 104.898 -116.711 1.00 31.42  ? 210  LEU B O     1 
ATOM   5052  C CB    . LEU B  1 210 ? 106.065 106.187 -114.603 1.00 30.19  ? 210  LEU B CB    1 
ATOM   5053  C CG    . LEU B  1 210 ? 107.557 106.459 -114.426 1.00 30.56  ? 210  LEU B CG    1 
ATOM   5054  C CD1   . LEU B  1 210 ? 107.780 107.535 -113.394 1.00 32.85  ? 210  LEU B CD1   1 
ATOM   5055  C CD2   . LEU B  1 210 ? 108.262 105.170 -114.005 1.00 30.75  ? 210  LEU B CD2   1 
ATOM   5056  N N     . GLY B  1 211 ? 103.756 104.364 -114.523 1.00 28.88  ? 211  GLY B N     1 
ATOM   5057  C CA    . GLY B  1 211 ? 102.347 104.018 -114.507 1.00 28.08  ? 211  GLY B CA    1 
ATOM   5058  C C     . GLY B  1 211 ? 101.345 105.046 -114.011 1.00 27.12  ? 211  GLY B C     1 
ATOM   5059  O O     . GLY B  1 211 ? 100.254 104.660 -113.602 1.00 29.37  ? 211  GLY B O     1 
ATOM   5060  N N     . HIS B  1 212 ? 101.672 106.334 -114.040 1.00 25.61  ? 212  HIS B N     1 
ATOM   5061  C CA    . HIS B  1 212 ? 100.728 107.348 -113.578 1.00 25.51  ? 212  HIS B CA    1 
ATOM   5062  C C     . HIS B  1 212 ? 101.075 108.673 -114.253 1.00 24.96  ? 212  HIS B C     1 
ATOM   5063  O O     . HIS B  1 212 ? 102.198 108.879 -114.731 1.00 25.23  ? 212  HIS B O     1 
ATOM   5064  C CB    . HIS B  1 212 ? 100.845 107.541 -112.059 1.00 26.61  ? 212  HIS B CB    1 
ATOM   5065  C CG    . HIS B  1 212 ? 102.145 108.161 -111.646 1.00 27.89  ? 212  HIS B CG    1 
ATOM   5066  N ND1   . HIS B  1 212 ? 103.292 107.421 -111.463 1.00 29.39  ? 212  HIS B ND1   1 
ATOM   5067  C CD2   . HIS B  1 212 ? 102.499 109.458 -111.494 1.00 28.95  ? 212  HIS B CD2   1 
ATOM   5068  C CE1   . HIS B  1 212 ? 104.300 108.241 -111.214 1.00 28.47  ? 212  HIS B CE1   1 
ATOM   5069  N NE2   . HIS B  1 212 ? 103.847 109.479 -111.231 1.00 29.24  ? 212  HIS B NE2   1 
ATOM   5070  N N     . VAL B  1 213 ? 100.129 109.596 -114.275 1.00 24.38  ? 213  VAL B N     1 
ATOM   5071  C CA    . VAL B  1 213 ? 100.405 110.885 -114.895 1.00 24.40  ? 213  VAL B CA    1 
ATOM   5072  C C     . VAL B  1 213 ? 100.666 111.958 -113.820 1.00 24.65  ? 213  VAL B C     1 
ATOM   5073  O O     . VAL B  1 213 ? 100.253 111.785 -112.672 1.00 25.90  ? 213  VAL B O     1 
ATOM   5074  C CB    . VAL B  1 213 ? 99.208  111.312 -115.779 1.00 24.51  ? 213  VAL B CB    1 
ATOM   5075  C CG1   . VAL B  1 213 ? 98.757  110.131 -116.671 1.00 22.65  ? 213  VAL B CG1   1 
ATOM   5076  C CG2   . VAL B  1 213 ? 98.061  111.770 -114.923 1.00 24.87  ? 213  VAL B CG2   1 
ATOM   5077  N N     . GLY B  1 214 ? 101.345 113.045 -114.186 1.00 24.59  ? 214  GLY B N     1 
ATOM   5078  C CA    . GLY B  1 214 ? 101.593 114.118 -113.239 1.00 25.23  ? 214  GLY B CA    1 
ATOM   5079  C C     . GLY B  1 214 ? 102.991 114.311 -112.667 1.00 25.61  ? 214  GLY B C     1 
ATOM   5080  O O     . GLY B  1 214 ? 103.200 115.226 -111.891 1.00 26.50  ? 214  GLY B O     1 
ATOM   5081  N N     . GLY B  1 215 ? 103.942 113.453 -113.012 1.00 26.83  ? 215  GLY B N     1 
ATOM   5082  C CA    . GLY B  1 215 ? 105.297 113.646 -112.526 1.00 27.72  ? 215  GLY B CA    1 
ATOM   5083  C C     . GLY B  1 215 ? 105.565 113.071 -111.156 1.00 30.47  ? 215  GLY B C     1 
ATOM   5084  O O     . GLY B  1 215 ? 104.772 112.286 -110.625 1.00 29.87  ? 215  GLY B O     1 
ATOM   5085  N N     . VAL B  1 216 ? 106.682 113.472 -110.568 1.00 31.37  ? 216  VAL B N     1 
ATOM   5086  C CA    . VAL B  1 216 ? 107.063 112.931 -109.277 1.00 33.03  ? 216  VAL B CA    1 
ATOM   5087  C C     . VAL B  1 216 ? 106.388 113.599 -108.104 1.00 32.00  ? 216  VAL B C     1 
ATOM   5088  O O     . VAL B  1 216 ? 106.101 114.800 -108.126 1.00 32.45  ? 216  VAL B O     1 
ATOM   5089  C CB    . VAL B  1 216 ? 108.618 112.975 -109.086 1.00 35.10  ? 216  VAL B CB    1 
ATOM   5090  C CG1   . VAL B  1 216 ? 109.010 112.573 -107.648 1.00 36.42  ? 216  VAL B CG1   1 
ATOM   5091  C CG2   . VAL B  1 216 ? 109.278 111.970 -110.042 1.00 38.22  ? 216  VAL B CG2   1 
ATOM   5092  N N     . GLY B  1 217 ? 106.091 112.792 -107.100 1.00 31.31  ? 217  GLY B N     1 
ATOM   5093  C CA    . GLY B  1 217 ? 105.509 113.332 -105.891 1.00 28.90  ? 217  GLY B CA    1 
ATOM   5094  C C     . GLY B  1 217 ? 104.017 113.441 -105.837 1.00 27.23  ? 217  GLY B C     1 
ATOM   5095  O O     . GLY B  1 217 ? 103.482 113.687 -104.768 1.00 28.09  ? 217  GLY B O     1 
ATOM   5096  N N     . ILE B  1 218 ? 103.339 113.265 -106.971 1.00 25.23  ? 218  ILE B N     1 
ATOM   5097  C CA    . ILE B  1 218 ? 101.894 113.372 -106.972 1.00 20.88  ? 218  ILE B CA    1 
ATOM   5098  C C     . ILE B  1 218 ? 101.329 112.147 -106.255 1.00 22.34  ? 218  ILE B C     1 
ATOM   5099  O O     . ILE B  1 218 ? 101.875 111.024 -106.325 1.00 20.89  ? 218  ILE B O     1 
ATOM   5100  C CB    . ILE B  1 218 ? 101.324 113.453 -108.428 1.00 22.39  ? 218  ILE B CB    1 
ATOM   5101  C CG1   . ILE B  1 218 ? 99.862  113.931 -108.400 1.00 19.21  ? 218  ILE B CG1   1 
ATOM   5102  C CG2   . ILE B  1 218 ? 101.441 112.063 -109.119 1.00 17.59  ? 218  ILE B CG2   1 
ATOM   5103  C CD1   . ILE B  1 218 ? 99.334  114.356 -109.753 1.00 21.29  ? 218  ILE B CD1   1 
ATOM   5104  N N     . ASP B  1 219 ? 100.223 112.377 -105.558 1.00 23.98  ? 219  ASP B N     1 
ATOM   5105  C CA    . ASP B  1 219 ? 99.543  111.316 -104.825 1.00 24.83  ? 219  ASP B CA    1 
ATOM   5106  C C     . ASP B  1 219 ? 98.880  110.388 -105.870 1.00 24.33  ? 219  ASP B C     1 
ATOM   5107  O O     . ASP B  1 219 ? 98.191  110.862 -106.759 1.00 22.22  ? 219  ASP B O     1 
ATOM   5108  C CB    . ASP B  1 219 ? 98.486  111.922 -103.876 1.00 21.91  ? 219  ASP B CB    1 
ATOM   5109  C CG    . ASP B  1 219 ? 97.658  110.863 -103.191 1.00 22.77  ? 219  ASP B CG    1 
ATOM   5110  O OD1   . ASP B  1 219 ? 98.184  110.202 -102.259 1.00 20.42  ? 219  ASP B OD1   1 
ATOM   5111  O OD2   . ASP B  1 219 ? 96.483  110.678 -103.607 1.00 21.99  ? 219  ASP B OD2   1 
ATOM   5112  N N     . MET B  1 220 ? 99.105  109.075 -105.764 1.00 25.13  ? 220  MET B N     1 
ATOM   5113  C CA    . MET B  1 220 ? 98.546  108.110 -106.722 1.00 25.41  ? 220  MET B CA    1 
ATOM   5114  C C     . MET B  1 220 ? 97.022  108.150 -106.853 1.00 24.63  ? 220  MET B C     1 
ATOM   5115  O O     . MET B  1 220 ? 96.496  108.095 -107.949 1.00 25.26  ? 220  MET B O     1 
ATOM   5116  C CB    . MET B  1 220 ? 99.026  106.693 -106.361 1.00 28.83  ? 220  MET B CB    1 
ATOM   5117  C CG    . MET B  1 220 ? 100.552 106.492 -106.583 1.00 32.10  ? 220  MET B CG    1 
ATOM   5118  S SD    . MET B  1 220 ? 101.068 106.745 -108.356 1.00 35.08  ? 220  MET B SD    1 
ATOM   5119  C CE    . MET B  1 220 ? 99.595  106.038 -109.207 1.00 33.23  ? 220  MET B CE    1 
ATOM   5120  N N     . GLU B  1 221 ? 96.302  108.240 -105.746 1.00 24.34  ? 221  GLU B N     1 
ATOM   5121  C CA    . GLU B  1 221 ? 94.855  108.344 -105.849 1.00 22.27  ? 221  GLU B CA    1 
ATOM   5122  C C     . GLU B  1 221 ? 94.475  109.614 -106.623 1.00 23.32  ? 221  GLU B C     1 
ATOM   5123  O O     . GLU B  1 221 ? 93.588  109.584 -107.502 1.00 21.80  ? 221  GLU B O     1 
ATOM   5124  C CB    . GLU B  1 221 ? 94.201  108.358 -104.463 1.00 23.31  ? 221  GLU B CB    1 
ATOM   5125  C CG    . GLU B  1 221 ? 92.719  108.761 -104.516 1.00 25.97  ? 221  GLU B CG    1 
ATOM   5126  C CD    . GLU B  1 221 ? 92.002  108.653 -103.167 1.00 26.53  ? 221  GLU B CD    1 
ATOM   5127  O OE1   . GLU B  1 221 ? 92.649  108.889 -102.136 1.00 27.84  ? 221  GLU B OE1   1 
ATOM   5128  O OE2   . GLU B  1 221 ? 90.785  108.355 -103.139 1.00 26.43  ? 221  GLU B OE2   1 
ATOM   5129  N N     . ILE B  1 222 ? 95.129  110.731 -106.307 1.00 21.40  ? 222  ILE B N     1 
ATOM   5130  C CA    . ILE B  1 222 ? 94.843  111.973 -107.019 1.00 22.90  ? 222  ILE B CA    1 
ATOM   5131  C C     . ILE B  1 222 ? 95.225  111.816 -108.518 1.00 23.70  ? 222  ILE B C     1 
ATOM   5132  O O     . ILE B  1 222 ? 94.475  112.225 -109.399 1.00 23.19  ? 222  ILE B O     1 
ATOM   5133  C CB    . ILE B  1 222 ? 95.646  113.168 -106.419 1.00 21.32  ? 222  ILE B CB    1 
ATOM   5134  C CG1   . ILE B  1 222 ? 95.093  113.538 -105.029 1.00 21.03  ? 222  ILE B CG1   1 
ATOM   5135  C CG2   . ILE B  1 222 ? 95.596  114.366 -107.367 1.00 21.82  ? 222  ILE B CG2   1 
ATOM   5136  C CD1   . ILE B  1 222 ? 93.758  114.279 -105.068 1.00 21.02  ? 222  ILE B CD1   1 
ATOM   5137  N N     . SER B  1 223 ? 96.402  111.241 -108.778 1.00 26.18  ? 223  SER B N     1 
ATOM   5138  C CA    . SER B  1 223 ? 96.910  111.043 -110.143 1.00 26.31  ? 223  SER B CA    1 
ATOM   5139  C C     . SER B  1 223 ? 95.947  110.226 -110.985 1.00 26.23  ? 223  SER B C     1 
ATOM   5140  O O     . SER B  1 223 ? 95.693  110.550 -112.154 1.00 26.19  ? 223  SER B O     1 
ATOM   5141  C CB    . SER B  1 223 ? 98.253  110.325 -110.122 1.00 24.95  ? 223  SER B CB    1 
ATOM   5142  O OG    . SER B  1 223 ? 98.701  110.086 -111.440 1.00 28.11  ? 223  SER B OG    1 
ATOM   5143  N N     . LYS B  1 224 ? 95.424  109.160 -110.376 1.00 26.66  ? 224  LYS B N     1 
ATOM   5144  C CA    . LYS B  1 224 ? 94.462  108.269 -111.025 1.00 26.60  ? 224  LYS B CA    1 
ATOM   5145  C C     . LYS B  1 224 ? 93.162  108.991 -111.357 1.00 25.31  ? 224  LYS B C     1 
ATOM   5146  O O     . LYS B  1 224 ? 92.700  108.901 -112.486 1.00 24.45  ? 224  LYS B O     1 
ATOM   5147  C CB    . LYS B  1 224 ? 94.172  107.061 -110.130 1.00 29.89  ? 224  LYS B CB    1 
ATOM   5148  C CG    . LYS B  1 224 ? 95.316  106.054 -110.050 1.00 34.65  ? 224  LYS B CG    1 
ATOM   5149  C CD    . LYS B  1 224 ? 95.422  105.199 -111.321 1.00 41.62  ? 224  LYS B CD    1 
ATOM   5150  C CE    . LYS B  1 224 ? 96.385  105.791 -112.367 1.00 43.74  ? 224  LYS B CE    1 
ATOM   5151  N NZ    . LYS B  1 224 ? 96.332  105.052 -113.675 1.00 44.28  ? 224  LYS B NZ    1 
ATOM   5152  N N     . ASN B  1 225 ? 92.565  109.690 -110.386 1.00 22.70  ? 225  ASN B N     1 
ATOM   5153  C CA    . ASN B  1 225 ? 91.326  110.447 -110.631 1.00 24.61  ? 225  ASN B CA    1 
ATOM   5154  C C     . ASN B  1 225 ? 91.515  111.544 -111.700 1.00 24.94  ? 225  ASN B C     1 
ATOM   5155  O O     . ASN B  1 225 ? 90.601  111.836 -112.470 1.00 25.41  ? 225  ASN B O     1 
ATOM   5156  C CB    . ASN B  1 225 ? 90.803  111.115 -109.347 1.00 24.45  ? 225  ASN B CB    1 
ATOM   5157  C CG    . ASN B  1 225 ? 90.196  110.116 -108.347 1.00 32.61  ? 225  ASN B CG    1 
ATOM   5158  O OD1   . ASN B  1 225 ? 90.095  108.913 -108.623 1.00 33.04  ? 225  ASN B OD1   1 
ATOM   5159  N ND2   . ASN B  1 225 ? 89.786  110.622 -107.180 1.00 32.45  ? 225  ASN B ND2   1 
ATOM   5160  N N     . PHE B  1 226 ? 92.695  112.168 -111.698 1.00 24.82  ? 226  PHE B N     1 
ATOM   5161  C CA    . PHE B  1 226 ? 93.067  113.236 -112.647 1.00 25.35  ? 226  PHE B CA    1 
ATOM   5162  C C     . PHE B  1 226 ? 93.091  112.645 -114.084 1.00 25.00  ? 226  PHE B C     1 
ATOM   5163  O O     . PHE B  1 226 ? 92.462  113.191 -114.998 1.00 24.85  ? 226  PHE B O     1 
ATOM   5164  C CB    . PHE B  1 226 ? 94.454  113.772 -112.237 1.00 22.52  ? 226  PHE B CB    1 
ATOM   5165  C CG    . PHE B  1 226 ? 95.023  114.852 -113.141 1.00 24.80  ? 226  PHE B CG    1 
ATOM   5166  C CD1   . PHE B  1 226 ? 94.235  115.906 -113.611 1.00 22.72  ? 226  PHE B CD1   1 
ATOM   5167  C CD2   . PHE B  1 226 ? 96.393  114.875 -113.428 1.00 23.55  ? 226  PHE B CD2   1 
ATOM   5168  C CE1   . PHE B  1 226 ? 94.815  116.957 -114.343 1.00 22.18  ? 226  PHE B CE1   1 
ATOM   5169  C CE2   . PHE B  1 226 ? 96.972  115.919 -114.151 1.00 22.58  ? 226  PHE B CE2   1 
ATOM   5170  C CZ    . PHE B  1 226 ? 96.178  116.957 -114.605 1.00 22.95  ? 226  PHE B CZ    1 
ATOM   5171  N N     . GLN B  1 227 ? 93.823  111.545 -114.260 1.00 24.52  ? 227  GLN B N     1 
ATOM   5172  C CA    . GLN B  1 227 ? 93.900  110.856 -115.533 1.00 27.08  ? 227  GLN B CA    1 
ATOM   5173  C C     . GLN B  1 227 ? 92.493  110.550 -116.100 1.00 28.26  ? 227  GLN B C     1 
ATOM   5174  O O     . GLN B  1 227 ? 92.235  110.753 -117.313 1.00 28.83  ? 227  GLN B O     1 
ATOM   5175  C CB    . GLN B  1 227 ? 94.638  109.521 -115.356 1.00 26.14  ? 227  GLN B CB    1 
ATOM   5176  C CG    . GLN B  1 227 ? 94.903  108.802 -116.694 1.00 27.44  ? 227  GLN B CG    1 
ATOM   5177  C CD    . GLN B  1 227 ? 95.412  107.396 -116.512 1.00 31.35  ? 227  GLN B CD    1 
ATOM   5178  O OE1   . GLN B  1 227 ? 95.990  107.064 -115.464 1.00 31.16  ? 227  GLN B OE1   1 
ATOM   5179  N NE2   . GLN B  1 227 ? 95.219  106.547 -117.536 1.00 29.43  ? 227  GLN B NE2   1 
ATOM   5180  N N     . ARG B  1 228 ? 91.609  110.069 -115.257 1.00 29.33  ? 228  ARG B N     1 
ATOM   5181  C CA    . ARG B  1 228 ? 90.270  109.670 -115.654 1.00 31.04  ? 228  ARG B CA    1 
ATOM   5182  C C     . ARG B  1 228 ? 89.473  110.880 -116.139 1.00 31.52  ? 228  ARG B C     1 
ATOM   5183  O O     . ARG B  1 228 ? 88.711  110.793 -117.108 1.00 33.36  ? 228  ARG B O     1 
ATOM   5184  C CB    . ARG B  1 228 ? 89.490  109.075 -114.448 1.00 34.33  ? 228  ARG B CB    1 
ATOM   5185  C CG    . ARG B  1 228 ? 89.268  107.593 -114.545 1.00 40.15  ? 228  ARG B CG    1 
ATOM   5186  C CD    . ARG B  1 228 ? 90.617  106.944 -114.341 1.00 46.44  ? 228  ARG B CD    1 
ATOM   5187  N NE    . ARG B  1 228 ? 90.604  106.087 -113.176 1.00 50.73  ? 228  ARG B NE    1 
ATOM   5188  C CZ    . ARG B  1 228 ? 90.031  106.419 -112.024 1.00 52.48  ? 228  ARG B CZ    1 
ATOM   5189  N NH1   . ARG B  1 228 ? 90.041  105.574 -110.992 1.00 52.46  ? 228  ARG B NH1   1 
ATOM   5190  N NH2   . ARG B  1 228 ? 89.442  107.605 -111.881 1.00 53.84  ? 228  ARG B NH2   1 
ATOM   5191  N N     . ILE B  1 229 ? 89.669  112.019 -115.482 1.00 29.41  ? 229  ILE B N     1 
ATOM   5192  C CA    . ILE B  1 229 ? 88.958  113.193 -115.883 1.00 28.95  ? 229  ILE B CA    1 
ATOM   5193  C C     . ILE B  1 229 ? 89.498  113.711 -117.221 1.00 28.30  ? 229  ILE B C     1 
ATOM   5194  O O     . ILE B  1 229 ? 88.719  114.133 -118.064 1.00 28.19  ? 229  ILE B O     1 
ATOM   5195  C CB    . ILE B  1 229 ? 89.060  114.292 -114.787 1.00 28.62  ? 229  ILE B CB    1 
ATOM   5196  C CG1   . ILE B  1 229 ? 88.272  113.844 -113.547 1.00 29.42  ? 229  ILE B CG1   1 
ATOM   5197  C CG2   . ILE B  1 229 ? 88.500  115.631 -115.292 1.00 27.43  ? 229  ILE B CG2   1 
ATOM   5198  C CD1   . ILE B  1 229 ? 88.653  114.624 -112.289 1.00 28.85  ? 229  ILE B CD1   1 
ATOM   5199  N N     . LEU B  1 230 ? 90.820  113.718 -117.375 1.00 27.59  ? 230  LEU B N     1 
ATOM   5200  C CA    . LEU B  1 230 ? 91.448  114.173 -118.605 1.00 27.09  ? 230  LEU B CA    1 
ATOM   5201  C C     . LEU B  1 230 ? 91.027  113.217 -119.736 1.00 29.51  ? 230  LEU B C     1 
ATOM   5202  O O     . LEU B  1 230 ? 90.781  113.650 -120.856 1.00 28.04  ? 230  LEU B O     1 
ATOM   5203  C CB    . LEU B  1 230 ? 92.979  114.158 -118.477 1.00 26.47  ? 230  LEU B CB    1 
ATOM   5204  C CG    . LEU B  1 230 ? 93.648  115.182 -117.545 1.00 24.02  ? 230  LEU B CG    1 
ATOM   5205  C CD1   . LEU B  1 230 ? 95.165  114.980 -117.542 1.00 21.93  ? 230  LEU B CD1   1 
ATOM   5206  C CD2   . LEU B  1 230 ? 93.296  116.597 -118.035 1.00 22.10  ? 230  LEU B CD2   1 
ATOM   5207  N N     . GLN B  1 231 ? 90.976  111.917 -119.439 1.00 28.91  ? 231  GLN B N     1 
ATOM   5208  C CA    . GLN B  1 231 ? 90.575  110.954 -120.440 1.00 29.99  ? 231  GLN B CA    1 
ATOM   5209  C C     . GLN B  1 231 ? 89.155  111.234 -120.918 1.00 31.15  ? 231  GLN B C     1 
ATOM   5210  O O     . GLN B  1 231 ? 88.885  111.148 -122.120 1.00 30.75  ? 231  GLN B O     1 
ATOM   5211  C CB    . GLN B  1 231 ? 90.714  109.526 -119.899 1.00 31.87  ? 231  GLN B CB    1 
ATOM   5212  C CG    . GLN B  1 231 ? 92.110  108.959 -120.130 1.00 30.84  ? 231  GLN B CG    1 
ATOM   5213  C CD    . GLN B  1 231 ? 92.354  107.645 -119.417 1.00 32.06  ? 231  GLN B CD    1 
ATOM   5214  O OE1   . GLN B  1 231 ? 93.348  106.973 -119.670 1.00 34.44  ? 231  GLN B OE1   1 
ATOM   5215  N NE2   . GLN B  1 231 ? 91.464  107.280 -118.504 1.00 33.12  ? 231  GLN B NE2   1 
ATOM   5216  N N     . LYS B  1 232 ? 88.254  111.590 -120.000 1.00 31.85  ? 232  LYS B N     1 
ATOM   5217  C CA    . LYS B  1 232 ? 86.889  111.903 -120.402 1.00 35.06  ? 232  LYS B CA    1 
ATOM   5218  C C     . LYS B  1 232 ? 86.857  113.194 -121.242 1.00 35.94  ? 232  LYS B C     1 
ATOM   5219  O O     . LYS B  1 232 ? 85.892  113.442 -121.971 1.00 37.00  ? 232  LYS B O     1 
ATOM   5220  C CB    . LYS B  1 232 ? 85.962  112.038 -119.187 1.00 36.76  ? 232  LYS B CB    1 
ATOM   5221  C CG    . LYS B  1 232 ? 85.876  110.764 -118.331 1.00 40.35  ? 232  LYS B CG    1 
ATOM   5222  C CD    . LYS B  1 232 ? 84.824  110.844 -117.193 1.00 42.11  ? 232  LYS B CD    1 
ATOM   5223  C CE    . LYS B  1 232 ? 85.072  109.725 -116.125 1.00 42.96  ? 232  LYS B CE    1 
ATOM   5224  N NZ    . LYS B  1 232 ? 83.844  109.155 -115.436 1.00 42.47  ? 232  LYS B NZ    1 
ATOM   5225  N N     . GLN B  1 233 ? 87.907  114.010 -121.141 1.00 34.76  ? 233  GLN B N     1 
ATOM   5226  C CA    . GLN B  1 233 ? 87.990  115.241 -121.926 1.00 34.43  ? 233  GLN B CA    1 
ATOM   5227  C C     . GLN B  1 233 ? 88.480  114.983 -123.354 1.00 33.50  ? 233  GLN B C     1 
ATOM   5228  O O     . GLN B  1 233 ? 88.373  115.843 -124.226 1.00 31.94  ? 233  GLN B O     1 
ATOM   5229  C CB    . GLN B  1 233 ? 88.920  116.249 -121.257 1.00 33.83  ? 233  GLN B CB    1 
ATOM   5230  C CG    . GLN B  1 233 ? 88.357  116.814 -119.975 1.00 33.57  ? 233  GLN B CG    1 
ATOM   5231  C CD    . GLN B  1 233 ? 89.327  117.740 -119.268 1.00 32.16  ? 233  GLN B CD    1 
ATOM   5232  O OE1   . GLN B  1 233 ? 90.431  118.013 -119.762 1.00 29.65  ? 233  GLN B OE1   1 
ATOM   5233  N NE2   . GLN B  1 233 ? 88.916  118.232 -118.103 1.00 31.55  ? 233  GLN B NE2   1 
ATOM   5234  N N     . GLY B  1 234 ? 89.023  113.798 -123.590 1.00 33.76  ? 234  GLY B N     1 
ATOM   5235  C CA    . GLY B  1 234 ? 89.495  113.479 -124.929 1.00 33.98  ? 234  GLY B CA    1 
ATOM   5236  C C     . GLY B  1 234 ? 90.960  113.125 -124.926 1.00 33.94  ? 234  GLY B C     1 
ATOM   5237  O O     . GLY B  1 234 ? 91.486  112.580 -125.902 1.00 34.44  ? 234  GLY B O     1 
ATOM   5238  N N     . PHE B  1 235 ? 91.613  113.410 -123.805 1.00 32.70  ? 235  PHE B N     1 
ATOM   5239  C CA    . PHE B  1 235 ? 93.040  113.151 -123.633 1.00 33.36  ? 235  PHE B CA    1 
ATOM   5240  C C     . PHE B  1 235 ? 93.320  111.648 -123.473 1.00 33.93  ? 235  PHE B C     1 
ATOM   5241  O O     . PHE B  1 235 ? 92.855  111.036 -122.529 1.00 35.69  ? 235  PHE B O     1 
ATOM   5242  C CB    . PHE B  1 235 ? 93.507  113.921 -122.399 1.00 34.61  ? 235  PHE B CB    1 
ATOM   5243  C CG    . PHE B  1 235 ? 94.938  114.364 -122.450 1.00 31.74  ? 235  PHE B CG    1 
ATOM   5244  C CD1   . PHE B  1 235 ? 95.935  113.507 -122.902 1.00 32.87  ? 235  PHE B CD1   1 
ATOM   5245  C CD2   . PHE B  1 235 ? 95.290  115.616 -121.971 1.00 31.43  ? 235  PHE B CD2   1 
ATOM   5246  C CE1   . PHE B  1 235 ? 97.273  113.894 -122.869 1.00 33.43  ? 235  PHE B CE1   1 
ATOM   5247  C CE2   . PHE B  1 235 ? 96.613  116.019 -121.929 1.00 30.49  ? 235  PHE B CE2   1 
ATOM   5248  C CZ    . PHE B  1 235 ? 97.606  115.168 -122.373 1.00 32.60  ? 235  PHE B CZ    1 
ATOM   5249  N N     . LYS B  1 236 ? 94.087  111.050 -124.382 1.00 33.79  ? 236  LYS B N     1 
ATOM   5250  C CA    . LYS B  1 236 ? 94.367  109.617 -124.299 1.00 33.31  ? 236  LYS B CA    1 
ATOM   5251  C C     . LYS B  1 236 ? 95.748  109.348 -123.732 1.00 32.14  ? 236  LYS B C     1 
ATOM   5252  O O     . LYS B  1 236 ? 96.681  110.139 -123.951 1.00 33.43  ? 236  LYS B O     1 
ATOM   5253  C CB    . LYS B  1 236 ? 94.253  108.970 -125.700 1.00 34.29  ? 236  LYS B CB    1 
ATOM   5254  C CG    . LYS B  1 236 ? 92.855  109.086 -126.326 1.00 37.31  ? 236  LYS B CG    1 
ATOM   5255  C CD    . LYS B  1 236 ? 92.812  108.541 -127.746 1.00 40.46  ? 236  LYS B CD    1 
ATOM   5256  C CE    . LYS B  1 236 ? 93.499  109.490 -128.723 1.00 45.17  ? 236  LYS B CE    1 
ATOM   5257  N NZ    . LYS B  1 236 ? 92.806  110.821 -128.768 1.00 46.05  ? 236  LYS B NZ    1 
ATOM   5258  N N     . PHE B  1 237 ? 95.897  108.226 -123.035 1.00 28.77  ? 237  PHE B N     1 
ATOM   5259  C CA    . PHE B  1 237 ? 97.190  107.878 -122.442 1.00 27.53  ? 237  PHE B CA    1 
ATOM   5260  C C     . PHE B  1 237 ? 97.647  106.454 -122.698 1.00 27.52  ? 237  PHE B C     1 
ATOM   5261  O O     . PHE B  1 237 ? 96.856  105.521 -122.702 1.00 29.34  ? 237  PHE B O     1 
ATOM   5262  C CB    . PHE B  1 237 ? 97.151  108.057 -120.911 1.00 26.58  ? 237  PHE B CB    1 
ATOM   5263  C CG    . PHE B  1 237 ? 96.971  109.473 -120.471 1.00 26.38  ? 237  PHE B CG    1 
ATOM   5264  C CD1   . PHE B  1 237 ? 98.064  110.341 -120.421 1.00 24.77  ? 237  PHE B CD1   1 
ATOM   5265  C CD2   . PHE B  1 237 ? 95.698  109.957 -120.142 1.00 24.37  ? 237  PHE B CD2   1 
ATOM   5266  C CE1   . PHE B  1 237 ? 97.898  111.680 -120.058 1.00 25.36  ? 237  PHE B CE1   1 
ATOM   5267  C CE2   . PHE B  1 237 ? 95.512  111.271 -119.782 1.00 22.59  ? 237  PHE B CE2   1 
ATOM   5268  C CZ    . PHE B  1 237 ? 96.622  112.151 -119.743 1.00 23.79  ? 237  PHE B CZ    1 
ATOM   5269  N N     . LYS B  1 238 ? 98.947  106.296 -122.876 1.00 28.60  ? 238  LYS B N     1 
ATOM   5270  C CA    . LYS B  1 238 ? 99.559  104.990 -123.045 1.00 29.01  ? 238  LYS B CA    1 
ATOM   5271  C C     . LYS B  1 238 ? 100.580 104.949 -121.908 1.00 29.17  ? 238  LYS B C     1 
ATOM   5272  O O     . LYS B  1 238 ? 101.713 105.396 -122.081 1.00 27.33  ? 238  LYS B O     1 
ATOM   5273  C CB    . LYS B  1 238 ? 100.274 104.891 -124.408 1.00 32.74  ? 238  LYS B CB    1 
ATOM   5274  C CG    . LYS B  1 238 ? 99.342  104.744 -125.595 1.00 36.81  ? 238  LYS B CG    1 
ATOM   5275  C CD    . LYS B  1 238 ? 98.656  103.383 -125.555 1.00 42.95  ? 238  LYS B CD    1 
ATOM   5276  C CE    . LYS B  1 238 ? 97.699  103.174 -126.735 1.00 47.85  ? 238  LYS B CE    1 
ATOM   5277  N NZ    . LYS B  1 238 ? 98.393  103.116 -128.063 1.00 50.21  ? 238  LYS B NZ    1 
ATOM   5278  N N     . LEU B  1 239 ? 100.170 104.447 -120.742 1.00 29.02  ? 239  LEU B N     1 
ATOM   5279  C CA    . LEU B  1 239 ? 101.058 104.373 -119.580 1.00 30.79  ? 239  LEU B CA    1 
ATOM   5280  C C     . LEU B  1 239 ? 101.894 103.106 -119.613 1.00 31.42  ? 239  LEU B C     1 
ATOM   5281  O O     . LEU B  1 239 ? 101.578 102.185 -120.350 1.00 32.01  ? 239  LEU B O     1 
ATOM   5282  C CB    . LEU B  1 239 ? 100.243 104.399 -118.281 1.00 31.20  ? 239  LEU B CB    1 
ATOM   5283  C CG    . LEU B  1 239 ? 99.215  105.517 -118.103 1.00 30.43  ? 239  LEU B CG    1 
ATOM   5284  C CD1   . LEU B  1 239 ? 98.620  105.402 -116.714 1.00 30.43  ? 239  LEU B CD1   1 
ATOM   5285  C CD2   . LEU B  1 239 ? 99.860  106.875 -118.319 1.00 30.03  ? 239  LEU B CD2   1 
ATOM   5286  N N     . ASN B  1 240 ? 102.954 103.067 -118.818 1.00 31.48  ? 240  ASN B N     1 
ATOM   5287  C CA    . ASN B  1 240 ? 103.829 101.897 -118.777 1.00 33.50  ? 240  ASN B CA    1 
ATOM   5288  C C     . ASN B  1 240 ? 104.289 101.518 -120.189 1.00 33.60  ? 240  ASN B C     1 
ATOM   5289  O O     . ASN B  1 240 ? 104.408 100.335 -120.512 1.00 34.24  ? 240  ASN B O     1 
ATOM   5290  C CB    . ASN B  1 240 ? 103.079 100.722 -118.157 1.00 33.97  ? 240  ASN B CB    1 
ATOM   5291  C CG    . ASN B  1 240 ? 102.654 101.003 -116.731 1.00 34.25  ? 240  ASN B CG    1 
ATOM   5292  O OD1   . ASN B  1 240 ? 103.491 101.158 -115.865 1.00 33.10  ? 240  ASN B OD1   1 
ATOM   5293  N ND2   . ASN B  1 240 ? 101.355 101.096 -116.495 1.00 33.08  ? 240  ASN B ND2   1 
ATOM   5294  N N     . THR B  1 241 ? 104.547 102.527 -121.011 1.00 34.00  ? 241  THR B N     1 
ATOM   5295  C CA    . THR B  1 241 ? 104.971 102.328 -122.394 1.00 35.15  ? 241  THR B CA    1 
ATOM   5296  C C     . THR B  1 241 ? 106.245 103.099 -122.712 1.00 36.01  ? 241  THR B C     1 
ATOM   5297  O O     . THR B  1 241 ? 106.397 104.274 -122.361 1.00 36.33  ? 241  THR B O     1 
ATOM   5298  C CB    . THR B  1 241 ? 103.865 102.790 -123.375 1.00 35.39  ? 241  THR B CB    1 
ATOM   5299  O OG1   . THR B  1 241 ? 102.696 101.986 -123.185 1.00 34.40  ? 241  THR B OG1   1 
ATOM   5300  C CG2   . THR B  1 241 ? 104.343 102.691 -124.829 1.00 34.87  ? 241  THR B CG2   1 
ATOM   5301  N N     . LYS B  1 242 ? 107.158 102.425 -123.394 1.00 37.05  ? 242  LYS B N     1 
ATOM   5302  C CA    . LYS B  1 242 ? 108.425 103.013 -123.799 1.00 39.44  ? 242  LYS B CA    1 
ATOM   5303  C C     . LYS B  1 242 ? 108.383 103.457 -125.281 1.00 39.65  ? 242  LYS B C     1 
ATOM   5304  O O     . LYS B  1 242 ? 107.700 102.853 -126.104 1.00 38.69  ? 242  LYS B O     1 
ATOM   5305  C CB    . LYS B  1 242 ? 109.518 101.966 -123.567 1.00 41.63  ? 242  LYS B CB    1 
ATOM   5306  C CG    . LYS B  1 242 ? 110.891 102.290 -124.102 1.00 45.09  ? 242  LYS B CG    1 
ATOM   5307  C CD    . LYS B  1 242 ? 111.834 101.126 -123.808 1.00 47.93  ? 242  LYS B CD    1 
ATOM   5308  C CE    . LYS B  1 242 ? 111.241 99.800  -124.275 1.00 50.17  ? 242  LYS B CE    1 
ATOM   5309  N NZ    . LYS B  1 242 ? 111.909 98.601  -123.664 1.00 52.46  ? 242  LYS B NZ    1 
ATOM   5310  N N     . VAL B  1 243 ? 109.077 104.535 -125.610 1.00 40.05  ? 243  VAL B N     1 
ATOM   5311  C CA    . VAL B  1 243 ? 109.123 104.989 -126.993 1.00 40.54  ? 243  VAL B CA    1 
ATOM   5312  C C     . VAL B  1 243 ? 110.402 104.400 -127.593 1.00 42.31  ? 243  VAL B C     1 
ATOM   5313  O O     . VAL B  1 243 ? 111.509 104.687 -127.141 1.00 42.67  ? 243  VAL B O     1 
ATOM   5314  C CB    . VAL B  1 243 ? 109.135 106.536 -127.083 1.00 39.85  ? 243  VAL B CB    1 
ATOM   5315  C CG1   . VAL B  1 243 ? 109.342 106.998 -128.528 1.00 39.10  ? 243  VAL B CG1   1 
ATOM   5316  C CG2   . VAL B  1 243 ? 107.830 107.084 -126.560 1.00 37.69  ? 243  VAL B CG2   1 
ATOM   5317  N N     . THR B  1 244 ? 110.228 103.545 -128.596 1.00 44.11  ? 244  THR B N     1 
ATOM   5318  C CA    . THR B  1 244 ? 111.323 102.871 -129.291 1.00 45.91  ? 244  THR B CA    1 
ATOM   5319  C C     . THR B  1 244 ? 112.078 103.846 -130.197 1.00 46.23  ? 244  THR B C     1 
ATOM   5320  O O     . THR B  1 244 ? 113.307 103.796 -130.299 1.00 46.75  ? 244  THR B O     1 
ATOM   5321  C CB    . THR B  1 244 ? 110.750 101.704 -130.136 1.00 47.37  ? 244  THR B CB    1 
ATOM   5322  O OG1   . THR B  1 244 ? 110.254 100.687 -129.254 1.00 50.22  ? 244  THR B OG1   1 
ATOM   5323  C CG2   . THR B  1 244 ? 111.800 101.122 -131.069 1.00 49.97  ? 244  THR B CG2   1 
ATOM   5324  N N     . GLY B  1 245 ? 111.333 104.736 -130.848 1.00 45.77  ? 245  GLY B N     1 
ATOM   5325  C CA    . GLY B  1 245 ? 111.944 105.701 -131.735 1.00 44.37  ? 245  GLY B CA    1 
ATOM   5326  C C     . GLY B  1 245 ? 110.900 106.502 -132.481 1.00 43.97  ? 245  GLY B C     1 
ATOM   5327  O O     . GLY B  1 245 ? 109.695 106.292 -132.314 1.00 43.21  ? 245  GLY B O     1 
ATOM   5328  N N     . ALA B  1 246 ? 111.359 107.438 -133.301 1.00 43.13  ? 246  ALA B N     1 
ATOM   5329  C CA    . ALA B  1 246 ? 110.443 108.250 -134.082 1.00 44.13  ? 246  ALA B CA    1 
ATOM   5330  C C     . ALA B  1 246 ? 111.116 108.672 -135.389 1.00 44.15  ? 246  ALA B C     1 
ATOM   5331  O O     . ALA B  1 246 ? 112.284 109.080 -135.402 1.00 44.33  ? 246  ALA B O     1 
ATOM   5332  C CB    . ALA B  1 246 ? 109.992 109.477 -133.278 1.00 42.53  ? 246  ALA B CB    1 
ATOM   5333  N N     . THR B  1 247 ? 110.366 108.577 -136.481 1.00 43.18  ? 247  THR B N     1 
ATOM   5334  C CA    . THR B  1 247 ? 110.893 108.932 -137.796 1.00 43.27  ? 247  THR B CA    1 
ATOM   5335  C C     . THR B  1 247 ? 109.970 109.900 -138.525 1.00 41.82  ? 247  THR B C     1 
ATOM   5336  O O     . THR B  1 247 ? 108.761 109.705 -138.563 1.00 41.23  ? 247  THR B O     1 
ATOM   5337  C CB    . THR B  1 247 ? 111.087 107.655 -138.662 1.00 43.84  ? 247  THR B CB    1 
ATOM   5338  O OG1   . THR B  1 247 ? 109.829 106.990 -138.827 1.00 44.48  ? 247  THR B OG1   1 
ATOM   5339  C CG2   . THR B  1 247 ? 112.056 106.690 -137.982 1.00 44.76  ? 247  THR B CG2   1 
ATOM   5340  N N     . LYS B  1 248 ? 110.541 110.953 -139.093 1.00 42.30  ? 248  LYS B N     1 
ATOM   5341  C CA    . LYS B  1 248 ? 109.742 111.919 -139.833 1.00 43.83  ? 248  LYS B CA    1 
ATOM   5342  C C     . LYS B  1 248 ? 109.637 111.370 -141.257 1.00 42.68  ? 248  LYS B C     1 
ATOM   5343  O O     . LYS B  1 248 ? 110.655 111.039 -141.861 1.00 42.02  ? 248  LYS B O     1 
ATOM   5344  C CB    . LYS B  1 248 ? 110.411 113.296 -139.845 1.00 46.15  ? 248  LYS B CB    1 
ATOM   5345  C CG    . LYS B  1 248 ? 109.477 114.388 -140.388 1.00 50.32  ? 248  LYS B CG    1 
ATOM   5346  C CD    . LYS B  1 248 ? 110.133 115.764 -140.498 1.00 52.48  ? 248  LYS B CD    1 
ATOM   5347  C CE    . LYS B  1 248 ? 109.151 116.776 -141.101 1.00 53.65  ? 248  LYS B CE    1 
ATOM   5348  N NZ    . LYS B  1 248 ? 107.836 116.772 -140.374 1.00 54.52  ? 248  LYS B NZ    1 
ATOM   5349  N N     . LYS B  1 249 ? 108.419 111.285 -141.789 1.00 41.57  ? 249  LYS B N     1 
ATOM   5350  C CA    . LYS B  1 249 ? 108.198 110.722 -143.125 1.00 40.15  ? 249  LYS B CA    1 
ATOM   5351  C C     . LYS B  1 249 ? 108.078 111.750 -144.234 1.00 39.58  ? 249  LYS B C     1 
ATOM   5352  O O     . LYS B  1 249 ? 107.691 112.887 -143.992 1.00 38.54  ? 249  LYS B O     1 
ATOM   5353  C CB    . LYS B  1 249 ? 106.956 109.818 -143.099 1.00 39.98  ? 249  LYS B CB    1 
ATOM   5354  C CG    . LYS B  1 249 ? 107.071 108.702 -142.047 1.00 38.42  ? 249  LYS B CG    1 
ATOM   5355  C CD    . LYS B  1 249 ? 105.998 107.630 -142.146 1.00 36.09  ? 249  LYS B CD    1 
ATOM   5356  C CE    . LYS B  1 249 ? 104.654 108.134 -141.739 1.00 33.84  ? 249  LYS B CE    1 
ATOM   5357  N NZ    . LYS B  1 249 ? 103.675 107.032 -141.633 1.00 31.02  ? 249  LYS B NZ    1 
ATOM   5358  N N     . SER B  1 250 ? 108.399 111.342 -145.460 1.00 39.16  ? 250  SER B N     1 
ATOM   5359  C CA    . SER B  1 250 ? 108.332 112.258 -146.606 1.00 38.83  ? 250  SER B CA    1 
ATOM   5360  C C     . SER B  1 250 ? 106.983 112.934 -146.790 1.00 37.33  ? 250  SER B C     1 
ATOM   5361  O O     . SER B  1 250 ? 106.911 113.984 -147.412 1.00 37.54  ? 250  SER B O     1 
ATOM   5362  C CB    . SER B  1 250 ? 108.729 111.542 -147.906 1.00 39.12  ? 250  SER B CB    1 
ATOM   5363  O OG    . SER B  1 250 ? 108.022 110.332 -148.055 1.00 41.07  ? 250  SER B OG    1 
ATOM   5364  N N     . ASP B  1 251 ? 105.913 112.347 -146.259 1.00 37.46  ? 251  ASP B N     1 
ATOM   5365  C CA    . ASP B  1 251 ? 104.592 112.962 -146.386 1.00 38.64  ? 251  ASP B CA    1 
ATOM   5366  C C     . ASP B  1 251 ? 104.395 113.999 -145.271 1.00 39.36  ? 251  ASP B C     1 
ATOM   5367  O O     . ASP B  1 251 ? 103.343 114.633 -145.171 1.00 39.50  ? 251  ASP B O     1 
ATOM   5368  C CB    . ASP B  1 251 ? 103.484 111.890 -146.324 1.00 40.62  ? 251  ASP B CB    1 
ATOM   5369  C CG    . ASP B  1 251 ? 103.453 111.132 -144.995 1.00 43.05  ? 251  ASP B CG    1 
ATOM   5370  O OD1   . ASP B  1 251 ? 104.488 111.088 -144.292 1.00 44.44  ? 251  ASP B OD1   1 
ATOM   5371  O OD2   . ASP B  1 251 ? 102.388 110.557 -144.661 1.00 45.17  ? 251  ASP B OD2   1 
ATOM   5372  N N     . GLY B  1 252 ? 105.419 114.165 -144.442 1.00 39.68  ? 252  GLY B N     1 
ATOM   5373  C CA    . GLY B  1 252 ? 105.339 115.115 -143.343 1.00 41.91  ? 252  GLY B CA    1 
ATOM   5374  C C     . GLY B  1 252 ? 104.877 114.516 -142.019 1.00 41.12  ? 252  GLY B C     1 
ATOM   5375  O O     . GLY B  1 252 ? 105.121 115.081 -140.948 1.00 42.63  ? 252  GLY B O     1 
ATOM   5376  N N     . LYS B  1 253 ? 104.195 113.379 -142.083 1.00 39.87  ? 253  LYS B N     1 
ATOM   5377  C CA    . LYS B  1 253 ? 103.718 112.734 -140.876 1.00 38.53  ? 253  LYS B CA    1 
ATOM   5378  C C     . LYS B  1 253 ? 104.896 112.170 -140.043 1.00 37.79  ? 253  LYS B C     1 
ATOM   5379  O O     . LYS B  1 253 ? 106.026 112.056 -140.520 1.00 36.70  ? 253  LYS B O     1 
ATOM   5380  C CB    . LYS B  1 253 ? 102.725 111.647 -141.271 1.00 40.38  ? 253  LYS B CB    1 
ATOM   5381  C CG    . LYS B  1 253 ? 101.433 112.171 -141.933 1.00 40.37  ? 253  LYS B CG    1 
ATOM   5382  C CD    . LYS B  1 253 ? 100.311 112.301 -140.901 1.00 42.74  ? 253  LYS B CD    1 
ATOM   5383  C CE    . LYS B  1 253 ? 98.980  112.783 -141.480 1.00 41.60  ? 253  LYS B CE    1 
ATOM   5384  N NZ    . LYS B  1 253 ? 98.984  114.220 -141.831 1.00 45.58  ? 253  LYS B NZ    1 
ATOM   5385  N N     . ILE B  1 254 ? 104.633 111.845 -138.782 1.00 36.57  ? 254  ILE B N     1 
ATOM   5386  C CA    . ILE B  1 254 ? 105.668 111.316 -137.903 1.00 35.74  ? 254  ILE B CA    1 
ATOM   5387  C C     . ILE B  1 254 ? 105.223 109.975 -137.332 1.00 34.33  ? 254  ILE B C     1 
ATOM   5388  O O     . ILE B  1 254 ? 104.132 109.868 -136.787 1.00 31.92  ? 254  ILE B O     1 
ATOM   5389  C CB    . ILE B  1 254 ? 105.944 112.269 -136.698 1.00 37.10  ? 254  ILE B CB    1 
ATOM   5390  C CG1   . ILE B  1 254 ? 106.402 113.643 -137.187 1.00 37.67  ? 254  ILE B CG1   1 
ATOM   5391  C CG2   . ILE B  1 254 ? 106.989 111.647 -135.775 1.00 36.60  ? 254  ILE B CG2   1 
ATOM   5392  C CD1   . ILE B  1 254 ? 106.481 114.681 -136.068 1.00 38.84  ? 254  ILE B CD1   1 
ATOM   5393  N N     . ASP B  1 255 ? 106.066 108.958 -137.473 1.00 33.62  ? 255  ASP B N     1 
ATOM   5394  C CA    . ASP B  1 255 ? 105.756 107.637 -136.931 1.00 34.91  ? 255  ASP B CA    1 
ATOM   5395  C C     . ASP B  1 255 ? 106.492 107.473 -135.600 1.00 34.53  ? 255  ASP B C     1 
ATOM   5396  O O     . ASP B  1 255 ? 107.721 107.629 -135.536 1.00 35.00  ? 255  ASP B O     1 
ATOM   5397  C CB    . ASP B  1 255 ? 106.200 106.519 -137.888 1.00 33.71  ? 255  ASP B CB    1 
ATOM   5398  C CG    . ASP B  1 255 ? 105.129 106.140 -138.913 1.00 35.55  ? 255  ASP B CG    1 
ATOM   5399  O OD1   . ASP B  1 255 ? 104.034 106.758 -138.929 1.00 34.43  ? 255  ASP B OD1   1 
ATOM   5400  O OD2   . ASP B  1 255 ? 105.396 105.210 -139.710 1.00 35.25  ? 255  ASP B OD2   1 
ATOM   5401  N N     . VAL B  1 256 ? 105.733 107.168 -134.549 1.00 33.78  ? 256  VAL B N     1 
ATOM   5402  C CA    . VAL B  1 256 ? 106.295 106.979 -133.210 1.00 32.93  ? 256  VAL B CA    1 
ATOM   5403  C C     . VAL B  1 256 ? 106.196 105.512 -132.796 1.00 31.72  ? 256  VAL B C     1 
ATOM   5404  O O     . VAL B  1 256 ? 105.108 105.004 -132.569 1.00 32.28  ? 256  VAL B O     1 
ATOM   5405  C CB    . VAL B  1 256 ? 105.537 107.812 -132.143 1.00 33.52  ? 256  VAL B CB    1 
ATOM   5406  C CG1   . VAL B  1 256 ? 106.227 107.648 -130.790 1.00 32.90  ? 256  VAL B CG1   1 
ATOM   5407  C CG2   . VAL B  1 256 ? 105.484 109.266 -132.540 1.00 30.08  ? 256  VAL B CG2   1 
ATOM   5408  N N     . SER B  1 257 ? 107.326 104.829 -132.689 1.00 30.86  ? 257  SER B N     1 
ATOM   5409  C CA    . SER B  1 257 ? 107.301 103.427 -132.310 1.00 32.05  ? 257  SER B CA    1 
ATOM   5410  C C     . SER B  1 257 ? 107.280 103.263 -130.801 1.00 32.24  ? 257  SER B C     1 
ATOM   5411  O O     . SER B  1 257 ? 108.038 103.928 -130.094 1.00 31.99  ? 257  SER B O     1 
ATOM   5412  C CB    . SER B  1 257 ? 108.520 102.726 -132.893 1.00 31.35  ? 257  SER B CB    1 
ATOM   5413  O OG    . SER B  1 257 ? 108.441 102.758 -134.296 1.00 35.28  ? 257  SER B OG    1 
ATOM   5414  N N     . ILE B  1 258 ? 106.406 102.391 -130.316 1.00 32.91  ? 258  ILE B N     1 
ATOM   5415  C CA    . ILE B  1 258 ? 106.299 102.146 -128.882 1.00 33.97  ? 258  ILE B CA    1 
ATOM   5416  C C     . ILE B  1 258 ? 106.206 100.668 -128.550 1.00 35.10  ? 258  ILE B C     1 
ATOM   5417  O O     . ILE B  1 258 ? 105.981 99.837  -129.425 1.00 34.59  ? 258  ILE B O     1 
ATOM   5418  C CB    . ILE B  1 258 ? 105.078 102.855 -128.259 1.00 32.54  ? 258  ILE B CB    1 
ATOM   5419  C CG1   . ILE B  1 258 ? 103.787 102.353 -128.904 1.00 31.46  ? 258  ILE B CG1   1 
ATOM   5420  C CG2   . ILE B  1 258 ? 105.230 104.371 -128.400 1.00 31.16  ? 258  ILE B CG2   1 
ATOM   5421  C CD1   . ILE B  1 258 ? 102.521 102.742 -128.113 1.00 29.71  ? 258  ILE B CD1   1 
ATOM   5422  N N     . GLU B  1 259 ? 106.404 100.361 -127.270 1.00 35.26  ? 259  GLU B N     1 
ATOM   5423  C CA    . GLU B  1 259 ? 106.358 98.999  -126.732 1.00 36.60  ? 259  GLU B CA    1 
ATOM   5424  C C     . GLU B  1 259 ? 106.000 99.113  -125.270 1.00 35.28  ? 259  GLU B C     1 
ATOM   5425  O O     . GLU B  1 259 ? 106.175 100.170 -124.670 1.00 33.53  ? 259  GLU B O     1 
ATOM   5426  C CB    . GLU B  1 259 ? 107.739 98.329  -126.754 1.00 39.89  ? 259  GLU B CB    1 
ATOM   5427  C CG    . GLU B  1 259 ? 108.180 97.708  -128.055 1.00 45.28  ? 259  GLU B CG    1 
ATOM   5428  C CD    . GLU B  1 259 ? 109.604 97.201  -127.970 1.00 47.54  ? 259  GLU B CD    1 
ATOM   5429  O OE1   . GLU B  1 259 ? 109.873 96.241  -127.209 1.00 49.57  ? 259  GLU B OE1   1 
ATOM   5430  O OE2   . GLU B  1 259 ? 110.462 97.780  -128.668 1.00 51.09  ? 259  GLU B OE2   1 
ATOM   5431  N N     . ALA B  1 260 ? 105.542 98.016  -124.692 1.00 34.85  ? 260  ALA B N     1 
ATOM   5432  C CA    . ALA B  1 260 ? 105.243 98.002  -123.268 1.00 36.77  ? 260  ALA B CA    1 
ATOM   5433  C C     . ALA B  1 260 ? 106.603 98.241  -122.610 1.00 37.79  ? 260  ALA B C     1 
ATOM   5434  O O     . ALA B  1 260 ? 107.624 97.766  -123.112 1.00 38.57  ? 260  ALA B O     1 
ATOM   5435  C CB    . ALA B  1 260 ? 104.675 96.637  -122.855 1.00 36.21  ? 260  ALA B CB    1 
ATOM   5436  N N     . ALA B  1 261 ? 106.632 98.990  -121.513 1.00 40.01  ? 261  ALA B N     1 
ATOM   5437  C CA    . ALA B  1 261 ? 107.890 99.277  -120.827 1.00 41.29  ? 261  ALA B CA    1 
ATOM   5438  C C     . ALA B  1 261 ? 108.620 97.977  -120.460 1.00 42.93  ? 261  ALA B C     1 
ATOM   5439  O O     . ALA B  1 261 ? 109.851 97.900  -120.502 1.00 44.41  ? 261  ALA B O     1 
ATOM   5440  C CB    . ALA B  1 261 ? 107.624 100.118 -119.566 1.00 41.20  ? 261  ALA B CB    1 
ATOM   5441  N N     . SER B  1 262 ? 107.857 96.951  -120.112 1.00 44.11  ? 262  SER B N     1 
ATOM   5442  C CA    . SER B  1 262 ? 108.447 95.674  -119.741 1.00 46.91  ? 262  SER B CA    1 
ATOM   5443  C C     . SER B  1 262 ? 108.690 94.798  -120.970 1.00 48.64  ? 262  SER B C     1 
ATOM   5444  O O     . SER B  1 262 ? 108.671 93.570  -120.868 1.00 49.07  ? 262  SER B O     1 
ATOM   5445  C CB    . SER B  1 262 ? 107.524 94.934  -118.779 1.00 45.95  ? 262  SER B CB    1 
ATOM   5446  O OG    . SER B  1 262 ? 106.270 94.696  -119.394 1.00 46.11  ? 262  SER B OG    1 
ATOM   5447  N N     . GLY B  1 263 ? 108.896 95.434  -122.124 1.00 49.37  ? 263  GLY B N     1 
ATOM   5448  C CA    . GLY B  1 263 ? 109.151 94.697  -123.352 1.00 48.70  ? 263  GLY B CA    1 
ATOM   5449  C C     . GLY B  1 263 ? 107.941 94.114  -124.070 1.00 48.19  ? 263  GLY B C     1 
ATOM   5450  O O     . GLY B  1 263 ? 106.948 93.724  -123.446 1.00 47.16  ? 263  GLY B O     1 
ATOM   5451  N N     . GLY B  1 264 ? 108.033 94.057  -125.400 1.00 48.20  ? 264  GLY B N     1 
ATOM   5452  C CA    . GLY B  1 264 ? 106.953 93.509  -126.193 1.00 47.07  ? 264  GLY B CA    1 
ATOM   5453  C C     . GLY B  1 264 ? 105.883 94.511  -126.558 1.00 46.37  ? 264  GLY B C     1 
ATOM   5454  O O     . GLY B  1 264 ? 106.033 95.709  -126.326 1.00 47.37  ? 264  GLY B O     1 
ATOM   5455  N N     . LYS B  1 265 ? 104.793 94.000  -127.118 1.00 45.45  ? 265  LYS B N     1 
ATOM   5456  C CA    . LYS B  1 265 ? 103.658 94.805  -127.567 1.00 45.04  ? 265  LYS B CA    1 
ATOM   5457  C C     . LYS B  1 265 ? 104.055 95.991  -128.455 1.00 43.79  ? 265  LYS B C     1 
ATOM   5458  O O     . LYS B  1 265 ? 103.604 97.121  -128.243 1.00 42.61  ? 265  LYS B O     1 
ATOM   5459  C CB    . LYS B  1 265 ? 102.845 95.296  -126.365 1.00 46.89  ? 265  LYS B CB    1 
ATOM   5460  C CG    . LYS B  1 265 ? 101.516 95.961  -126.743 1.00 50.40  ? 265  LYS B CG    1 
ATOM   5461  C CD    . LYS B  1 265 ? 100.531 95.978  -125.570 1.00 51.51  ? 265  LYS B CD    1 
ATOM   5462  C CE    . LYS B  1 265 ? 99.389  96.990  -125.751 1.00 52.39  ? 265  LYS B CE    1 
ATOM   5463  N NZ    . LYS B  1 265 ? 98.500  96.707  -126.908 1.00 54.36  ? 265  LYS B NZ    1 
ATOM   5464  N N     . ALA B  1 266 ? 104.893 95.725  -129.456 1.00 41.56  ? 266  ALA B N     1 
ATOM   5465  C CA    . ALA B  1 266 ? 105.341 96.766  -130.387 1.00 40.40  ? 266  ALA B CA    1 
ATOM   5466  C C     . ALA B  1 266 ? 104.134 97.433  -131.033 1.00 39.93  ? 266  ALA B C     1 
ATOM   5467  O O     . ALA B  1 266 ? 103.141 96.784  -131.349 1.00 40.03  ? 266  ALA B O     1 
ATOM   5468  C CB    . ALA B  1 266 ? 106.244 96.163  -131.469 1.00 39.96  ? 266  ALA B CB    1 
ATOM   5469  N N     . GLU B  1 267 ? 104.202 98.741  -131.211 1.00 37.60  ? 267  GLU B N     1 
ATOM   5470  C CA    . GLU B  1 267 ? 103.105 99.445  -131.836 1.00 36.21  ? 267  GLU B CA    1 
ATOM   5471  C C     . GLU B  1 267 ? 103.717 100.679 -132.464 1.00 34.76  ? 267  GLU B C     1 
ATOM   5472  O O     . GLU B  1 267 ? 104.859 101.014 -132.169 1.00 31.22  ? 267  GLU B O     1 
ATOM   5473  C CB    . GLU B  1 267 ? 102.065 99.864  -130.809 1.00 37.93  ? 267  GLU B CB    1 
ATOM   5474  C CG    . GLU B  1 267 ? 101.176 98.769  -130.260 1.00 42.59  ? 267  GLU B CG    1 
ATOM   5475  C CD    . GLU B  1 267 ? 100.101 99.344  -129.340 1.00 44.83  ? 267  GLU B CD    1 
ATOM   5476  O OE1   . GLU B  1 267 ? 100.420 99.795  -128.224 1.00 46.17  ? 267  GLU B OE1   1 
ATOM   5477  O OE2   . GLU B  1 267 ? 98.924  99.368  -129.738 1.00 48.70  ? 267  GLU B OE2   1 
ATOM   5478  N N     . VAL B  1 268 ? 102.955 101.328 -133.340 1.00 35.12  ? 268  VAL B N     1 
ATOM   5479  C CA    . VAL B  1 268 ? 103.386 102.544 -134.018 1.00 35.46  ? 268  VAL B CA    1 
ATOM   5480  C C     . VAL B  1 268 ? 102.226 103.530 -134.019 1.00 35.22  ? 268  VAL B C     1 
ATOM   5481  O O     . VAL B  1 268 ? 101.103 103.172 -134.372 1.00 35.41  ? 268  VAL B O     1 
ATOM   5482  C CB    . VAL B  1 268 ? 103.809 102.290 -135.505 1.00 35.17  ? 268  VAL B CB    1 
ATOM   5483  C CG1   . VAL B  1 268 ? 104.190 103.620 -136.165 1.00 34.92  ? 268  VAL B CG1   1 
ATOM   5484  C CG2   . VAL B  1 268 ? 104.994 101.309 -135.579 1.00 35.44  ? 268  VAL B CG2   1 
ATOM   5485  N N     . ILE B  1 269 ? 102.506 104.764 -133.605 1.00 35.72  ? 269  ILE B N     1 
ATOM   5486  C CA    . ILE B  1 269 ? 101.504 105.833 -133.577 1.00 36.11  ? 269  ILE B CA    1 
ATOM   5487  C C     . ILE B  1 269 ? 101.945 106.902 -134.580 1.00 35.45  ? 269  ILE B C     1 
ATOM   5488  O O     . ILE B  1 269 ? 103.085 107.355 -134.550 1.00 36.57  ? 269  ILE B O     1 
ATOM   5489  C CB    . ILE B  1 269 ? 101.386 106.530 -132.182 1.00 37.01  ? 269  ILE B CB    1 
ATOM   5490  C CG1   . ILE B  1 269 ? 101.076 105.515 -131.075 1.00 38.46  ? 269  ILE B CG1   1 
ATOM   5491  C CG2   . ILE B  1 269 ? 100.276 107.602 -132.242 1.00 37.11  ? 269  ILE B CG2   1 
ATOM   5492  C CD1   . ILE B  1 269 ? 99.766  104.804 -131.243 1.00 39.18  ? 269  ILE B CD1   1 
ATOM   5493  N N     . THR B  1 270 ? 101.043 107.305 -135.469 1.00 36.48  ? 270  THR B N     1 
ATOM   5494  C CA    . THR B  1 270 ? 101.371 108.320 -136.472 1.00 35.65  ? 270  THR B CA    1 
ATOM   5495  C C     . THR B  1 270 ? 100.747 109.671 -136.104 1.00 35.40  ? 270  THR B C     1 
ATOM   5496  O O     . THR B  1 270 ? 99.561  109.748 -135.798 1.00 36.41  ? 270  THR B O     1 
ATOM   5497  C CB    . THR B  1 270 ? 100.878 107.878 -137.871 1.00 35.31  ? 270  THR B CB    1 
ATOM   5498  O OG1   . THR B  1 270 ? 101.377 106.561 -138.152 1.00 34.96  ? 270  THR B OG1   1 
ATOM   5499  C CG2   . THR B  1 270 ? 101.365 108.848 -138.939 1.00 32.39  ? 270  THR B CG2   1 
ATOM   5500  N N     . CYS B  1 271 ? 101.545 110.735 -136.135 1.00 34.00  ? 271  CYS B N     1 
ATOM   5501  C CA    . CYS B  1 271 ? 101.045 112.060 -135.769 1.00 34.33  ? 271  CYS B CA    1 
ATOM   5502  C C     . CYS B  1 271 ? 101.581 113.184 -136.661 1.00 33.62  ? 271  CYS B C     1 
ATOM   5503  O O     . CYS B  1 271 ? 102.450 112.990 -137.501 1.00 32.25  ? 271  CYS B O     1 
ATOM   5504  C CB    . CYS B  1 271 ? 101.419 112.375 -134.314 1.00 32.88  ? 271  CYS B CB    1 
ATOM   5505  S SG    . CYS B  1 271 ? 103.223 112.323 -133.998 1.00 36.72  ? 271  CYS B SG    1 
ATOM   5506  N N     . ASP B  1 272 ? 101.054 114.376 -136.444 1.00 34.90  ? 272  ASP B N     1 
ATOM   5507  C CA    . ASP B  1 272 ? 101.474 115.540 -137.208 1.00 35.89  ? 272  ASP B CA    1 
ATOM   5508  C C     . ASP B  1 272 ? 102.526 116.314 -136.430 1.00 35.70  ? 272  ASP B C     1 
ATOM   5509  O O     . ASP B  1 272 ? 103.383 116.988 -137.011 1.00 37.66  ? 272  ASP B O     1 
ATOM   5510  C CB    . ASP B  1 272 ? 100.259 116.414 -137.499 1.00 36.17  ? 272  ASP B CB    1 
ATOM   5511  C CG    . ASP B  1 272 ? 99.187  115.658 -138.243 1.00 37.46  ? 272  ASP B CG    1 
ATOM   5512  O OD1   . ASP B  1 272 ? 99.426  115.294 -139.418 1.00 38.72  ? 272  ASP B OD1   1 
ATOM   5513  O OD2   . ASP B  1 272 ? 98.117  115.409 -137.656 1.00 38.29  ? 272  ASP B OD2   1 
ATOM   5514  N N     . VAL B  1 273 ? 102.460 116.218 -135.106 1.00 33.96  ? 273  VAL B N     1 
ATOM   5515  C CA    . VAL B  1 273 ? 103.423 116.901 -134.255 1.00 32.28  ? 273  VAL B CA    1 
ATOM   5516  C C     . VAL B  1 273 ? 103.770 116.010 -133.087 1.00 31.51  ? 273  VAL B C     1 
ATOM   5517  O O     . VAL B  1 273 ? 102.893 115.364 -132.492 1.00 30.24  ? 273  VAL B O     1 
ATOM   5518  C CB    . VAL B  1 273 ? 102.870 118.237 -133.692 1.00 33.21  ? 273  VAL B CB    1 
ATOM   5519  C CG1   . VAL B  1 273 ? 103.866 118.839 -132.716 1.00 32.68  ? 273  VAL B CG1   1 
ATOM   5520  C CG2   . VAL B  1 273 ? 102.606 119.212 -134.812 1.00 31.74  ? 273  VAL B CG2   1 
ATOM   5521  N N     . LEU B  1 274 ? 105.061 115.947 -132.799 1.00 30.41  ? 274  LEU B N     1 
ATOM   5522  C CA    . LEU B  1 274 ? 105.560 115.182 -131.673 1.00 30.09  ? 274  LEU B CA    1 
ATOM   5523  C C     . LEU B  1 274 ? 106.141 116.163 -130.657 1.00 29.36  ? 274  LEU B C     1 
ATOM   5524  O O     . LEU B  1 274 ? 106.957 117.008 -131.002 1.00 28.80  ? 274  LEU B O     1 
ATOM   5525  C CB    . LEU B  1 274 ? 106.647 114.198 -132.107 1.00 29.01  ? 274  LEU B CB    1 
ATOM   5526  C CG    . LEU B  1 274 ? 107.233 113.344 -130.982 1.00 29.34  ? 274  LEU B CG    1 
ATOM   5527  C CD1   . LEU B  1 274 ? 106.166 112.397 -130.391 1.00 25.19  ? 274  LEU B CD1   1 
ATOM   5528  C CD2   . LEU B  1 274 ? 108.414 112.578 -131.544 1.00 28.95  ? 274  LEU B CD2   1 
ATOM   5529  N N     . LEU B  1 275 ? 105.673 116.059 -129.418 1.00 31.41  ? 275  LEU B N     1 
ATOM   5530  C CA    . LEU B  1 275 ? 106.145 116.889 -128.305 1.00 28.50  ? 275  LEU B CA    1 
ATOM   5531  C C     . LEU B  1 275 ? 106.916 115.985 -127.353 1.00 29.49  ? 275  LEU B C     1 
ATOM   5532  O O     . LEU B  1 275 ? 106.370 115.039 -126.781 1.00 29.76  ? 275  LEU B O     1 
ATOM   5533  C CB    . LEU B  1 275 ? 104.968 117.523 -127.563 1.00 28.42  ? 275  LEU B CB    1 
ATOM   5534  C CG    . LEU B  1 275 ? 105.264 118.115 -126.174 1.00 28.39  ? 275  LEU B CG    1 
ATOM   5535  C CD1   . LEU B  1 275 ? 106.498 119.016 -126.198 1.00 23.77  ? 275  LEU B CD1   1 
ATOM   5536  C CD2   . LEU B  1 275 ? 104.057 118.884 -125.724 1.00 26.93  ? 275  LEU B CD2   1 
ATOM   5537  N N     . VAL B  1 276 ? 108.201 116.276 -127.214 1.00 29.48  ? 276  VAL B N     1 
ATOM   5538  C CA    . VAL B  1 276 ? 109.088 115.549 -126.331 1.00 29.82  ? 276  VAL B CA    1 
ATOM   5539  C C     . VAL B  1 276 ? 109.163 116.339 -125.007 1.00 30.32  ? 276  VAL B C     1 
ATOM   5540  O O     . VAL B  1 276 ? 109.581 117.501 -124.993 1.00 30.18  ? 276  VAL B O     1 
ATOM   5541  C CB    . VAL B  1 276 ? 110.514 115.453 -126.965 1.00 29.74  ? 276  VAL B CB    1 
ATOM   5542  C CG1   . VAL B  1 276 ? 111.429 114.620 -126.089 1.00 29.98  ? 276  VAL B CG1   1 
ATOM   5543  C CG2   . VAL B  1 276 ? 110.418 114.835 -128.376 1.00 29.29  ? 276  VAL B CG2   1 
ATOM   5544  N N     . CYS B  1 277 ? 108.704 115.738 -123.915 1.00 29.42  ? 277  CYS B N     1 
ATOM   5545  C CA    . CYS B  1 277 ? 108.804 116.399 -122.632 1.00 30.39  ? 277  CYS B CA    1 
ATOM   5546  C C     . CYS B  1 277 ? 109.024 115.373 -121.529 1.00 31.30  ? 277  CYS B C     1 
ATOM   5547  O O     . CYS B  1 277 ? 108.142 115.056 -120.730 1.00 30.24  ? 277  CYS B O     1 
ATOM   5548  C CB    . CYS B  1 277 ? 107.582 117.301 -122.359 1.00 31.78  ? 277  CYS B CB    1 
ATOM   5549  S SG    . CYS B  1 277 ? 105.939 116.622 -122.712 1.00 34.03  ? 277  CYS B SG    1 
ATOM   5550  N N     . ILE B  1 278 ? 110.232 114.834 -121.493 1.00 32.13  ? 278  ILE B N     1 
ATOM   5551  C CA    . ILE B  1 278 ? 110.553 113.844 -120.489 1.00 33.74  ? 278  ILE B CA    1 
ATOM   5552  C C     . ILE B  1 278 ? 111.389 114.459 -119.363 1.00 34.16  ? 278  ILE B C     1 
ATOM   5553  O O     . ILE B  1 278 ? 112.189 113.778 -118.731 1.00 35.66  ? 278  ILE B O     1 
ATOM   5554  C CB    . ILE B  1 278 ? 111.302 112.675 -121.117 1.00 33.87  ? 278  ILE B CB    1 
ATOM   5555  C CG1   . ILE B  1 278 ? 112.638 113.164 -121.680 1.00 35.22  ? 278  ILE B CG1   1 
ATOM   5556  C CG2   . ILE B  1 278 ? 110.426 112.044 -122.217 1.00 31.99  ? 278  ILE B CG2   1 
ATOM   5557  C CD1   . ILE B  1 278 ? 113.626 112.043 -122.026 1.00 34.33  ? 278  ILE B CD1   1 
ATOM   5558  N N     . GLY B  1 279 ? 111.187 115.752 -119.119 1.00 34.59  ? 279  GLY B N     1 
ATOM   5559  C CA    . GLY B  1 279 ? 111.933 116.445 -118.078 1.00 34.94  ? 279  GLY B CA    1 
ATOM   5560  C C     . GLY B  1 279 ? 112.904 117.512 -118.562 1.00 35.12  ? 279  GLY B C     1 
ATOM   5561  O O     . GLY B  1 279 ? 113.049 117.762 -119.771 1.00 34.41  ? 279  GLY B O     1 
ATOM   5562  N N     . ARG B  1 280 ? 113.558 118.157 -117.600 1.00 35.04  ? 280  ARG B N     1 
ATOM   5563  C CA    . ARG B  1 280 ? 114.536 119.198 -117.875 1.00 34.82  ? 280  ARG B CA    1 
ATOM   5564  C C     . ARG B  1 280 ? 115.746 118.893 -117.011 1.00 36.69  ? 280  ARG B C     1 
ATOM   5565  O O     . ARG B  1 280 ? 115.660 118.098 -116.057 1.00 35.25  ? 280  ARG B O     1 
ATOM   5566  C CB    . ARG B  1 280 ? 113.971 120.585 -117.551 1.00 34.04  ? 280  ARG B CB    1 
ATOM   5567  C CG    . ARG B  1 280 ? 112.922 121.078 -118.546 1.00 33.64  ? 280  ARG B CG    1 
ATOM   5568  C CD    . ARG B  1 280 ? 112.327 122.429 -118.143 1.00 34.05  ? 280  ARG B CD    1 
ATOM   5569  N NE    . ARG B  1 280 ? 113.276 123.524 -118.347 1.00 36.57  ? 280  ARG B NE    1 
ATOM   5570  C CZ    . ARG B  1 280 ? 113.610 124.023 -119.537 1.00 36.37  ? 280  ARG B CZ    1 
ATOM   5571  N NH1   . ARG B  1 280 ? 113.061 123.531 -120.636 1.00 36.64  ? 280  ARG B NH1   1 
ATOM   5572  N NH2   . ARG B  1 280 ? 114.512 124.993 -119.637 1.00 34.96  ? 280  ARG B NH2   1 
ATOM   5573  N N     . ARG B  1 281 ? 116.882 119.495 -117.371 1.00 36.70  ? 281  ARG B N     1 
ATOM   5574  C CA    . ARG B  1 281 ? 118.130 119.291 -116.638 1.00 37.03  ? 281  ARG B CA    1 
ATOM   5575  C C     . ARG B  1 281 ? 118.903 120.598 -116.419 1.00 36.74  ? 281  ARG B C     1 
ATOM   5576  O O     . ARG B  1 281 ? 118.755 121.566 -117.168 1.00 36.46  ? 281  ARG B O     1 
ATOM   5577  C CB    . ARG B  1 281 ? 119.020 118.279 -117.374 1.00 37.23  ? 281  ARG B CB    1 
ATOM   5578  C CG    . ARG B  1 281 ? 119.324 118.656 -118.823 1.00 37.57  ? 281  ARG B CG    1 
ATOM   5579  C CD    . ARG B  1 281 ? 120.061 117.521 -119.529 1.00 37.75  ? 281  ARG B CD    1 
ATOM   5580  N NE    . ARG B  1 281 ? 120.549 117.914 -120.853 1.00 39.58  ? 281  ARG B NE    1 
ATOM   5581  C CZ    . ARG B  1 281 ? 121.260 117.125 -121.660 1.00 39.47  ? 281  ARG B CZ    1 
ATOM   5582  N NH1   . ARG B  1 281 ? 121.579 115.886 -121.293 1.00 37.87  ? 281  ARG B NH1   1 
ATOM   5583  N NH2   . ARG B  1 281 ? 121.660 117.580 -122.840 1.00 39.47  ? 281  ARG B NH2   1 
ATOM   5584  N N     . PRO B  1 282 ? 119.734 120.637 -115.376 1.00 37.32  ? 282  PRO B N     1 
ATOM   5585  C CA    . PRO B  1 282 ? 120.511 121.849 -115.091 1.00 38.83  ? 282  PRO B CA    1 
ATOM   5586  C C     . PRO B  1 282 ? 121.408 122.275 -116.251 1.00 39.57  ? 282  PRO B C     1 
ATOM   5587  O O     . PRO B  1 282 ? 122.059 121.452 -116.886 1.00 40.13  ? 282  PRO B O     1 
ATOM   5588  C CB    . PRO B  1 282 ? 121.290 121.470 -113.827 1.00 38.56  ? 282  PRO B CB    1 
ATOM   5589  C CG    . PRO B  1 282 ? 121.379 119.960 -113.909 1.00 39.33  ? 282  PRO B CG    1 
ATOM   5590  C CD    . PRO B  1 282 ? 120.009 119.579 -114.391 1.00 37.31  ? 282  PRO B CD    1 
ATOM   5591  N N     . PHE B  1 283 ? 121.410 123.564 -116.544 1.00 40.56  ? 283  PHE B N     1 
ATOM   5592  C CA    . PHE B  1 283 ? 122.239 124.082 -117.619 1.00 43.24  ? 283  PHE B CA    1 
ATOM   5593  C C     . PHE B  1 283 ? 123.457 124.798 -117.034 1.00 44.57  ? 283  PHE B C     1 
ATOM   5594  O O     . PHE B  1 283 ? 123.314 125.811 -116.351 1.00 44.00  ? 283  PHE B O     1 
ATOM   5595  C CB    . PHE B  1 283 ? 121.436 125.047 -118.488 1.00 43.98  ? 283  PHE B CB    1 
ATOM   5596  C CG    . PHE B  1 283 ? 122.196 125.567 -119.681 1.00 45.76  ? 283  PHE B CG    1 
ATOM   5597  C CD1   . PHE B  1 283 ? 123.018 126.680 -119.570 1.00 45.85  ? 283  PHE B CD1   1 
ATOM   5598  C CD2   . PHE B  1 283 ? 122.065 124.949 -120.929 1.00 46.27  ? 283  PHE B CD2   1 
ATOM   5599  C CE1   . PHE B  1 283 ? 123.698 127.178 -120.692 1.00 48.66  ? 283  PHE B CE1   1 
ATOM   5600  C CE2   . PHE B  1 283 ? 122.735 125.432 -122.052 1.00 46.95  ? 283  PHE B CE2   1 
ATOM   5601  C CZ    . PHE B  1 283 ? 123.554 126.548 -121.940 1.00 47.37  ? 283  PHE B CZ    1 
ATOM   5602  N N     . THR B  1 284 ? 124.648 124.259 -117.310 1.00 47.02  ? 284  THR B N     1 
ATOM   5603  C CA    . THR B  1 284 ? 125.907 124.813 -116.814 1.00 48.89  ? 284  THR B CA    1 
ATOM   5604  C C     . THR B  1 284 ? 127.052 124.833 -117.833 1.00 52.21  ? 284  THR B C     1 
ATOM   5605  O O     . THR B  1 284 ? 128.206 125.023 -117.438 1.00 51.98  ? 284  THR B O     1 
ATOM   5606  C CB    . THR B  1 284 ? 126.441 123.996 -115.619 1.00 47.74  ? 284  THR B CB    1 
ATOM   5607  O OG1   . THR B  1 284 ? 126.537 122.618 -115.995 1.00 47.46  ? 284  THR B OG1   1 
ATOM   5608  C CG2   . THR B  1 284 ? 125.541 124.132 -114.410 1.00 46.82  ? 284  THR B CG2   1 
ATOM   5609  N N     . LYS B  1 285 ? 126.779 124.658 -119.126 1.00 54.85  ? 285  LYS B N     1 
ATOM   5610  C CA    . LYS B  1 285 ? 127.901 124.611 -120.065 1.00 57.82  ? 285  LYS B CA    1 
ATOM   5611  C C     . LYS B  1 285 ? 128.619 125.937 -120.345 1.00 59.15  ? 285  LYS B C     1 
ATOM   5612  O O     . LYS B  1 285 ? 128.005 127.010 -120.402 1.00 59.00  ? 285  LYS B O     1 
ATOM   5613  C CB    . LYS B  1 285 ? 127.499 123.909 -121.382 1.00 58.36  ? 285  LYS B CB    1 
ATOM   5614  C CG    . LYS B  1 285 ? 126.854 124.770 -122.448 1.00 59.56  ? 285  LYS B CG    1 
ATOM   5615  C CD    . LYS B  1 285 ? 127.102 124.163 -123.838 1.00 61.22  ? 285  LYS B CD    1 
ATOM   5616  C CE    . LYS B  1 285 ? 126.482 125.015 -124.953 1.00 62.42  ? 285  LYS B CE    1 
ATOM   5617  N NZ    . LYS B  1 285 ? 126.837 126.469 -124.826 1.00 62.71  ? 285  LYS B NZ    1 
ATOM   5618  N N     . ASN B  1 286 ? 129.938 125.833 -120.505 1.00 61.18  ? 286  ASN B N     1 
ATOM   5619  C CA    . ASN B  1 286 ? 130.817 126.975 -120.763 1.00 63.10  ? 286  ASN B CA    1 
ATOM   5620  C C     . ASN B  1 286 ? 130.693 128.059 -119.694 1.00 64.29  ? 286  ASN B C     1 
ATOM   5621  O O     . ASN B  1 286 ? 130.817 129.256 -119.982 1.00 65.01  ? 286  ASN B O     1 
ATOM   5622  C CB    . ASN B  1 286 ? 130.545 127.573 -122.149 1.00 63.65  ? 286  ASN B CB    1 
ATOM   5623  C CG    . ASN B  1 286 ? 130.870 126.606 -123.277 1.00 63.73  ? 286  ASN B CG    1 
ATOM   5624  O OD1   . ASN B  1 286 ? 131.634 125.650 -123.096 1.00 63.29  ? 286  ASN B OD1   1 
ATOM   5625  N ND2   . ASN B  1 286 ? 130.305 126.860 -124.451 1.00 63.99  ? 286  ASN B ND2   1 
ATOM   5626  N N     . LEU B  1 287 ? 130.453 127.626 -118.461 1.00 65.02  ? 287  LEU B N     1 
ATOM   5627  C CA    . LEU B  1 287 ? 130.327 128.532 -117.325 1.00 65.63  ? 287  LEU B CA    1 
ATOM   5628  C C     . LEU B  1 287 ? 131.676 128.646 -116.614 1.00 65.91  ? 287  LEU B C     1 
ATOM   5629  O O     . LEU B  1 287 ? 131.957 129.632 -115.925 1.00 65.72  ? 287  LEU B O     1 
ATOM   5630  C CB    . LEU B  1 287 ? 129.256 128.015 -116.351 1.00 65.63  ? 287  LEU B CB    1 
ATOM   5631  C CG    . LEU B  1 287 ? 128.925 128.879 -115.130 1.00 65.28  ? 287  LEU B CG    1 
ATOM   5632  C CD1   . LEU B  1 287 ? 128.336 130.220 -115.577 1.00 64.66  ? 287  LEU B CD1   1 
ATOM   5633  C CD2   . LEU B  1 287 ? 127.930 128.142 -114.233 1.00 65.32  ? 287  LEU B CD2   1 
ATOM   5634  N N     . GLY B  1 288 ? 132.511 127.621 -116.800 1.00 66.47  ? 288  GLY B N     1 
ATOM   5635  C CA    . GLY B  1 288 ? 133.836 127.601 -116.200 1.00 66.72  ? 288  GLY B CA    1 
ATOM   5636  C C     . GLY B  1 288 ? 133.992 126.758 -114.947 1.00 66.94  ? 288  GLY B C     1 
ATOM   5637  O O     . GLY B  1 288 ? 134.990 126.872 -114.239 1.00 67.05  ? 288  GLY B O     1 
ATOM   5638  N N     . LEU B  1 289 ? 133.019 125.899 -114.675 1.00 67.01  ? 289  LEU B N     1 
ATOM   5639  C CA    . LEU B  1 289 ? 133.066 125.062 -113.485 1.00 67.62  ? 289  LEU B CA    1 
ATOM   5640  C C     . LEU B  1 289 ? 134.141 123.977 -113.496 1.00 68.55  ? 289  LEU B C     1 
ATOM   5641  O O     . LEU B  1 289 ? 134.758 123.716 -112.464 1.00 67.96  ? 289  LEU B O     1 
ATOM   5642  C CB    . LEU B  1 289 ? 131.696 124.417 -113.245 1.00 67.29  ? 289  LEU B CB    1 
ATOM   5643  C CG    . LEU B  1 289 ? 130.514 125.371 -113.041 1.00 67.23  ? 289  LEU B CG    1 
ATOM   5644  C CD1   . LEU B  1 289 ? 129.254 124.554 -112.822 1.00 67.26  ? 289  LEU B CD1   1 
ATOM   5645  C CD2   . LEU B  1 289 ? 130.762 126.284 -111.854 1.00 66.36  ? 289  LEU B CD2   1 
ATOM   5646  N N     . GLU B  1 290 ? 134.356 123.331 -114.642 1.00 70.08  ? 290  GLU B N     1 
ATOM   5647  C CA    . GLU B  1 290 ? 135.366 122.278 -114.712 1.00 72.09  ? 290  GLU B CA    1 
ATOM   5648  C C     . GLU B  1 290 ? 136.682 122.943 -114.354 1.00 72.85  ? 290  GLU B C     1 
ATOM   5649  O O     . GLU B  1 290 ? 137.459 122.444 -113.531 1.00 72.62  ? 290  GLU B O     1 
ATOM   5650  C CB    . GLU B  1 290 ? 135.464 121.686 -116.121 1.00 73.51  ? 290  GLU B CB    1 
ATOM   5651  C CG    . GLU B  1 290 ? 136.520 120.578 -116.232 1.00 76.04  ? 290  GLU B CG    1 
ATOM   5652  C CD    . GLU B  1 290 ? 136.736 120.073 -117.660 1.00 77.45  ? 290  GLU B CD    1 
ATOM   5653  O OE1   . GLU B  1 290 ? 135.800 119.487 -118.247 1.00 78.53  ? 290  GLU B OE1   1 
ATOM   5654  O OE2   . GLU B  1 290 ? 137.852 120.260 -118.196 1.00 78.19  ? 290  GLU B OE2   1 
ATOM   5655  N N     . GLU B  1 291 ? 136.906 124.090 -114.981 1.00 73.18  ? 291  GLU B N     1 
ATOM   5656  C CA    . GLU B  1 291 ? 138.101 124.878 -114.751 1.00 73.65  ? 291  GLU B CA    1 
ATOM   5657  C C     . GLU B  1 291 ? 138.252 125.190 -113.263 1.00 73.05  ? 291  GLU B C     1 
ATOM   5658  O O     . GLU B  1 291 ? 139.201 124.757 -112.604 1.00 73.50  ? 291  GLU B O     1 
ATOM   5659  C CB    . GLU B  1 291 ? 138.006 126.183 -115.543 1.00 75.54  ? 291  GLU B CB    1 
ATOM   5660  C CG    . GLU B  1 291 ? 139.225 127.072 -115.439 1.00 78.56  ? 291  GLU B CG    1 
ATOM   5661  C CD    . GLU B  1 291 ? 140.471 126.412 -115.998 1.00 81.01  ? 291  GLU B CD    1 
ATOM   5662  O OE1   . GLU B  1 291 ? 140.341 125.375 -116.690 1.00 81.82  ? 291  GLU B OE1   1 
ATOM   5663  O OE2   . GLU B  1 291 ? 141.580 126.942 -115.754 1.00 81.98  ? 291  GLU B OE2   1 
ATOM   5664  N N     . LEU B  1 292 ? 137.277 125.935 -112.750 1.00 71.92  ? 292  LEU B N     1 
ATOM   5665  C CA    . LEU B  1 292 ? 137.216 126.383 -111.362 1.00 69.74  ? 292  LEU B CA    1 
ATOM   5666  C C     . LEU B  1 292 ? 137.315 125.297 -110.284 1.00 68.09  ? 292  LEU B C     1 
ATOM   5667  O O     . LEU B  1 292 ? 137.654 125.594 -109.142 1.00 67.53  ? 292  LEU B O     1 
ATOM   5668  C CB    . LEU B  1 292 ? 135.926 127.183 -111.187 1.00 70.60  ? 292  LEU B CB    1 
ATOM   5669  C CG    . LEU B  1 292 ? 135.562 127.846 -109.864 1.00 71.27  ? 292  LEU B CG    1 
ATOM   5670  C CD1   . LEU B  1 292 ? 136.647 128.830 -109.450 1.00 71.44  ? 292  LEU B CD1   1 
ATOM   5671  C CD2   . LEU B  1 292 ? 134.216 128.553 -110.035 1.00 71.31  ? 292  LEU B CD2   1 
ATOM   5672  N N     . GLY B  1 293 ? 137.020 124.051 -110.638 1.00 66.54  ? 293  GLY B N     1 
ATOM   5673  C CA    . GLY B  1 293 ? 137.080 122.978 -109.656 1.00 65.26  ? 293  GLY B CA    1 
ATOM   5674  C C     . GLY B  1 293 ? 135.723 122.512 -109.133 1.00 64.37  ? 293  GLY B C     1 
ATOM   5675  O O     . GLY B  1 293 ? 135.642 121.588 -108.314 1.00 63.79  ? 293  GLY B O     1 
ATOM   5676  N N     . ILE B  1 294 ? 134.654 123.152 -109.600 1.00 63.25  ? 294  ILE B N     1 
ATOM   5677  C CA    . ILE B  1 294 ? 133.304 122.790 -109.180 1.00 62.44  ? 294  ILE B CA    1 
ATOM   5678  C C     . ILE B  1 294 ? 132.859 121.525 -109.916 1.00 61.74  ? 294  ILE B C     1 
ATOM   5679  O O     . ILE B  1 294 ? 132.627 121.542 -111.127 1.00 60.72  ? 294  ILE B O     1 
ATOM   5680  C CB    . ILE B  1 294 ? 132.287 123.911 -109.505 1.00 62.49  ? 294  ILE B CB    1 
ATOM   5681  C CG1   . ILE B  1 294 ? 132.823 125.269 -109.049 1.00 62.57  ? 294  ILE B CG1   1 
ATOM   5682  C CG2   . ILE B  1 294 ? 130.965 123.626 -108.810 1.00 62.41  ? 294  ILE B CG2   1 
ATOM   5683  C CD1   . ILE B  1 294 ? 132.966 125.398 -107.565 1.00 62.17  ? 294  ILE B CD1   1 
ATOM   5684  N N     . GLU B  1 295 ? 132.747 120.430 -109.175 1.00 61.45  ? 295  GLU B N     1 
ATOM   5685  C CA    . GLU B  1 295 ? 132.313 119.156 -109.744 1.00 61.99  ? 295  GLU B CA    1 
ATOM   5686  C C     . GLU B  1 295 ? 130.797 119.005 -109.661 1.00 60.62  ? 295  GLU B C     1 
ATOM   5687  O O     . GLU B  1 295 ? 130.219 119.186 -108.593 1.00 60.74  ? 295  GLU B O     1 
ATOM   5688  C CB    . GLU B  1 295 ? 132.932 117.989 -108.982 1.00 63.83  ? 295  GLU B CB    1 
ATOM   5689  C CG    . GLU B  1 295 ? 134.249 117.493 -109.506 1.00 66.87  ? 295  GLU B CG    1 
ATOM   5690  C CD    . GLU B  1 295 ? 134.785 116.366 -108.646 1.00 69.08  ? 295  GLU B CD    1 
ATOM   5691  O OE1   . GLU B  1 295 ? 135.197 116.643 -107.496 1.00 70.60  ? 295  GLU B OE1   1 
ATOM   5692  O OE2   . GLU B  1 295 ? 134.779 115.203 -109.109 1.00 70.33  ? 295  GLU B OE2   1 
ATOM   5693  N N     . LEU B  1 296 ? 130.161 118.653 -110.776 1.00 58.52  ? 296  LEU B N     1 
ATOM   5694  C CA    . LEU B  1 296 ? 128.716 118.462 -110.799 1.00 55.89  ? 296  LEU B CA    1 
ATOM   5695  C C     . LEU B  1 296 ? 128.406 117.071 -110.262 1.00 55.36  ? 296  LEU B C     1 
ATOM   5696  O O     . LEU B  1 296 ? 129.295 116.222 -110.218 1.00 55.62  ? 296  LEU B O     1 
ATOM   5697  C CB    . LEU B  1 296 ? 128.203 118.579 -112.226 1.00 54.34  ? 296  LEU B CB    1 
ATOM   5698  C CG    . LEU B  1 296 ? 128.483 119.913 -112.908 1.00 54.37  ? 296  LEU B CG    1 
ATOM   5699  C CD1   . LEU B  1 296 ? 127.949 119.854 -114.328 1.00 53.17  ? 296  LEU B CD1   1 
ATOM   5700  C CD2   . LEU B  1 296 ? 127.841 121.062 -112.128 1.00 53.65  ? 296  LEU B CD2   1 
ATOM   5701  N N     . ASP B  1 297 ? 127.166 116.835 -109.836 1.00 54.27  ? 297  ASP B N     1 
ATOM   5702  C CA    . ASP B  1 297 ? 126.795 115.508 -109.348 1.00 52.63  ? 297  ASP B CA    1 
ATOM   5703  C C     . ASP B  1 297 ? 126.468 114.692 -110.592 1.00 51.79  ? 297  ASP B C     1 
ATOM   5704  O O     . ASP B  1 297 ? 126.401 115.241 -111.683 1.00 49.99  ? 297  ASP B O     1 
ATOM   5705  C CB    . ASP B  1 297 ? 125.591 115.572 -108.383 1.00 52.96  ? 297  ASP B CB    1 
ATOM   5706  C CG    . ASP B  1 297 ? 124.262 115.916 -109.074 1.00 53.67  ? 297  ASP B CG    1 
ATOM   5707  O OD1   . ASP B  1 297 ? 124.220 116.209 -110.287 1.00 53.26  ? 297  ASP B OD1   1 
ATOM   5708  O OD2   . ASP B  1 297 ? 123.233 115.899 -108.374 1.00 53.52  ? 297  ASP B OD2   1 
ATOM   5709  N N     . PRO B  1 298 ? 126.260 113.374 -110.455 1.00 52.84  ? 298  PRO B N     1 
ATOM   5710  C CA    . PRO B  1 298 ? 125.952 112.597 -111.667 1.00 53.01  ? 298  PRO B CA    1 
ATOM   5711  C C     . PRO B  1 298 ? 124.822 113.143 -112.555 1.00 52.11  ? 298  PRO B C     1 
ATOM   5712  O O     . PRO B  1 298 ? 124.850 112.968 -113.771 1.00 52.71  ? 298  PRO B O     1 
ATOM   5713  C CB    . PRO B  1 298 ? 125.662 111.193 -111.119 1.00 53.59  ? 298  PRO B CB    1 
ATOM   5714  C CG    . PRO B  1 298 ? 125.222 111.448 -109.707 1.00 54.44  ? 298  PRO B CG    1 
ATOM   5715  C CD    . PRO B  1 298 ? 126.168 112.531 -109.250 1.00 53.18  ? 298  PRO B CD    1 
ATOM   5716  N N     . ARG B  1 299 ? 123.846 113.818 -111.953 1.00 51.08  ? 299  ARG B N     1 
ATOM   5717  C CA    . ARG B  1 299 ? 122.726 114.379 -112.703 1.00 49.67  ? 299  ARG B CA    1 
ATOM   5718  C C     . ARG B  1 299 ? 122.976 115.781 -113.265 1.00 48.14  ? 299  ARG B C     1 
ATOM   5719  O O     . ARG B  1 299 ? 122.080 116.396 -113.819 1.00 48.02  ? 299  ARG B O     1 
ATOM   5720  C CB    . ARG B  1 299 ? 121.479 114.373 -111.824 1.00 50.92  ? 299  ARG B CB    1 
ATOM   5721  C CG    . ARG B  1 299 ? 121.012 112.956 -111.489 1.00 53.30  ? 299  ARG B CG    1 
ATOM   5722  C CD    . ARG B  1 299 ? 120.046 112.910 -110.308 1.00 54.28  ? 299  ARG B CD    1 
ATOM   5723  N NE    . ARG B  1 299 ? 118.843 113.700 -110.555 1.00 54.05  ? 299  ARG B NE    1 
ATOM   5724  C CZ    . ARG B  1 299 ? 117.873 113.873 -109.663 1.00 54.35  ? 299  ARG B CZ    1 
ATOM   5725  N NH1   . ARG B  1 299 ? 117.968 113.306 -108.462 1.00 52.97  ? 299  ARG B NH1   1 
ATOM   5726  N NH2   . ARG B  1 299 ? 116.818 114.623 -109.968 1.00 53.86  ? 299  ARG B NH2   1 
ATOM   5727  N N     . GLY B  1 300 ? 124.198 116.279 -113.125 1.00 46.62  ? 300  GLY B N     1 
ATOM   5728  C CA    . GLY B  1 300 ? 124.527 117.590 -113.656 1.00 44.26  ? 300  GLY B CA    1 
ATOM   5729  C C     . GLY B  1 300 ? 124.282 118.792 -112.763 1.00 43.61  ? 300  GLY B C     1 
ATOM   5730  O O     . GLY B  1 300 ? 124.520 119.927 -113.178 1.00 42.78  ? 300  GLY B O     1 
ATOM   5731  N N     . ARG B  1 301 ? 123.813 118.572 -111.542 1.00 43.05  ? 301  ARG B N     1 
ATOM   5732  C CA    . ARG B  1 301 ? 123.558 119.700 -110.650 1.00 42.57  ? 301  ARG B CA    1 
ATOM   5733  C C     . ARG B  1 301 ? 124.816 120.161 -109.916 1.00 42.45  ? 301  ARG B C     1 
ATOM   5734  O O     . ARG B  1 301 ? 125.745 119.386 -109.709 1.00 41.77  ? 301  ARG B O     1 
ATOM   5735  C CB    . ARG B  1 301 ? 122.493 119.340 -109.613 1.00 42.86  ? 301  ARG B CB    1 
ATOM   5736  C CG    . ARG B  1 301 ? 121.115 119.100 -110.176 1.00 43.77  ? 301  ARG B CG    1 
ATOM   5737  C CD    . ARG B  1 301 ? 120.948 117.657 -110.562 1.00 44.77  ? 301  ARG B CD    1 
ATOM   5738  N NE    . ARG B  1 301 ? 120.962 116.766 -109.401 1.00 45.72  ? 301  ARG B NE    1 
ATOM   5739  C CZ    . ARG B  1 301 ? 119.978 116.662 -108.501 1.00 46.44  ? 301  ARG B CZ    1 
ATOM   5740  N NH1   . ARG B  1 301 ? 118.882 117.393 -108.608 1.00 45.73  ? 301  ARG B NH1   1 
ATOM   5741  N NH2   . ARG B  1 301 ? 120.082 115.808 -107.488 1.00 46.79  ? 301  ARG B NH2   1 
ATOM   5742  N N     . ILE B  1 302 ? 124.835 121.433 -109.534 1.00 43.11  ? 302  ILE B N     1 
ATOM   5743  C CA    . ILE B  1 302 ? 125.949 121.997 -108.779 1.00 43.45  ? 302  ILE B CA    1 
ATOM   5744  C C     . ILE B  1 302 ? 125.674 121.740 -107.307 1.00 44.75  ? 302  ILE B C     1 
ATOM   5745  O O     . ILE B  1 302 ? 124.712 122.268 -106.742 1.00 44.94  ? 302  ILE B O     1 
ATOM   5746  C CB    . ILE B  1 302 ? 126.050 123.498 -108.968 1.00 42.27  ? 302  ILE B CB    1 
ATOM   5747  C CG1   . ILE B  1 302 ? 126.314 123.815 -110.437 1.00 40.85  ? 302  ILE B CG1   1 
ATOM   5748  C CG2   . ILE B  1 302 ? 127.132 124.046 -108.057 1.00 43.59  ? 302  ILE B CG2   1 
ATOM   5749  C CD1   . ILE B  1 302 ? 126.246 125.279 -110.755 1.00 40.72  ? 302  ILE B CD1   1 
ATOM   5750  N N     . PRO B  1 303 ? 126.521 120.934 -106.657 1.00 45.67  ? 303  PRO B N     1 
ATOM   5751  C CA    . PRO B  1 303 ? 126.310 120.639 -105.235 1.00 45.73  ? 303  PRO B CA    1 
ATOM   5752  C C     . PRO B  1 303 ? 126.496 121.906 -104.408 1.00 46.35  ? 303  PRO B C     1 
ATOM   5753  O O     . PRO B  1 303 ? 127.347 122.746 -104.722 1.00 44.95  ? 303  PRO B O     1 
ATOM   5754  C CB    . PRO B  1 303 ? 127.377 119.581 -104.923 1.00 46.92  ? 303  PRO B CB    1 
ATOM   5755  C CG    . PRO B  1 303 ? 127.801 119.048 -106.307 1.00 46.57  ? 303  PRO B CG    1 
ATOM   5756  C CD    . PRO B  1 303 ? 127.745 120.293 -107.162 1.00 45.03  ? 303  PRO B CD    1 
ATOM   5757  N N     . VAL B  1 304 ? 125.677 122.051 -103.370 1.00 46.83  ? 304  VAL B N     1 
ATOM   5758  C CA    . VAL B  1 304 ? 125.738 123.216 -102.489 1.00 46.72  ? 304  VAL B CA    1 
ATOM   5759  C C     . VAL B  1 304 ? 125.320 122.804 -101.086 1.00 47.28  ? 304  VAL B C     1 
ATOM   5760  O O     . VAL B  1 304 ? 124.634 121.793 -100.909 1.00 45.72  ? 304  VAL B O     1 
ATOM   5761  C CB    . VAL B  1 304 ? 124.788 124.366 -102.957 1.00 47.16  ? 304  VAL B CB    1 
ATOM   5762  C CG1   . VAL B  1 304 ? 125.145 124.802 -104.374 1.00 46.62  ? 304  VAL B CG1   1 
ATOM   5763  C CG2   . VAL B  1 304 ? 123.328 123.919 -102.863 1.00 47.32  ? 304  VAL B CG2   1 
ATOM   5764  N N     . ASN B  1 305 ? 125.745 123.579 -100.090 1.00 47.67  ? 305  ASN B N     1 
ATOM   5765  C CA    . ASN B  1 305 ? 125.383 123.289 -98.710  1.00 48.05  ? 305  ASN B CA    1 
ATOM   5766  C C     . ASN B  1 305 ? 124.115 124.068 -98.356  1.00 47.80  ? 305  ASN B C     1 
ATOM   5767  O O     . ASN B  1 305 ? 123.514 124.711 -99.220  1.00 48.74  ? 305  ASN B O     1 
ATOM   5768  C CB    . ASN B  1 305 ? 126.520 123.669 -97.755  1.00 48.66  ? 305  ASN B CB    1 
ATOM   5769  C CG    . ASN B  1 305 ? 126.869 125.150 -97.810  1.00 48.41  ? 305  ASN B CG    1 
ATOM   5770  O OD1   . ASN B  1 305 ? 126.041 125.994 -98.151  1.00 47.73  ? 305  ASN B OD1   1 
ATOM   5771  N ND2   . ASN B  1 305 ? 128.099 125.468 -97.452  1.00 49.14  ? 305  ASN B ND2   1 
ATOM   5772  N N     . THR B  1 306 ? 123.723 124.032 -97.085  1.00 47.76  ? 306  THR B N     1 
ATOM   5773  C CA    . THR B  1 306 ? 122.510 124.716 -96.634  1.00 47.80  ? 306  THR B CA    1 
ATOM   5774  C C     . THR B  1 306 ? 122.435 126.217 -96.889  1.00 46.95  ? 306  THR B C     1 
ATOM   5775  O O     . THR B  1 306 ? 121.359 126.800 -96.786  1.00 46.47  ? 306  THR B O     1 
ATOM   5776  C CB    . THR B  1 306 ? 122.274 124.489 -95.144  1.00 48.39  ? 306  THR B CB    1 
ATOM   5777  O OG1   . THR B  1 306 ? 123.380 125.019 -94.404  1.00 50.29  ? 306  THR B OG1   1 
ATOM   5778  C CG2   . THR B  1 306 ? 122.126 123.005 -94.856  1.00 48.08  ? 306  THR B CG2   1 
ATOM   5779  N N     . ARG B  1 307 ? 123.564 126.844 -97.214  1.00 47.18  ? 307  ARG B N     1 
ATOM   5780  C CA    . ARG B  1 307 ? 123.586 128.279 -97.495  1.00 46.39  ? 307  ARG B CA    1 
ATOM   5781  C C     . ARG B  1 307 ? 123.712 128.531 -99.005  1.00 45.82  ? 307  ARG B C     1 
ATOM   5782  O O     . ARG B  1 307 ? 123.879 129.669 -99.465  1.00 42.85  ? 307  ARG B O     1 
ATOM   5783  C CB    . ARG B  1 307 ? 124.733 128.943 -96.723  1.00 47.51  ? 307  ARG B CB    1 
ATOM   5784  C CG    . ARG B  1 307 ? 124.599 128.787 -95.205  1.00 48.60  ? 307  ARG B CG    1 
ATOM   5785  C CD    . ARG B  1 307 ? 125.633 129.621 -94.447  1.00 50.41  ? 307  ARG B CD    1 
ATOM   5786  N NE    . ARG B  1 307 ? 125.365 131.065 -94.505  1.00 50.95  ? 307  ARG B NE    1 
ATOM   5787  C CZ    . ARG B  1 307 ? 124.540 131.725 -93.681  1.00 51.82  ? 307  ARG B CZ    1 
ATOM   5788  N NH1   . ARG B  1 307 ? 123.890 131.085 -92.715  1.00 50.66  ? 307  ARG B NH1   1 
ATOM   5789  N NH2   . ARG B  1 307 ? 124.364 133.031 -93.836  1.00 52.05  ? 307  ARG B NH2   1 
ATOM   5790  N N     . PHE B  1 308 ? 123.618 127.445 -99.767  1.00 46.25  ? 308  PHE B N     1 
ATOM   5791  C CA    . PHE B  1 308 ? 123.690 127.487 -101.222 1.00 48.03  ? 308  PHE B CA    1 
ATOM   5792  C C     . PHE B  1 308 ? 125.041 127.867 -101.817 1.00 48.95  ? 308  PHE B C     1 
ATOM   5793  O O     . PHE B  1 308 ? 125.120 128.367 -102.939 1.00 48.76  ? 308  PHE B O     1 
ATOM   5794  C CB    . PHE B  1 308 ? 122.583 128.394 -101.762 1.00 47.13  ? 308  PHE B CB    1 
ATOM   5795  C CG    . PHE B  1 308 ? 121.210 127.860 -101.496 1.00 47.33  ? 308  PHE B CG    1 
ATOM   5796  C CD1   . PHE B  1 308 ? 120.700 126.803 -102.256 1.00 46.02  ? 308  PHE B CD1   1 
ATOM   5797  C CD2   . PHE B  1 308 ? 120.450 128.355 -100.438 1.00 47.12  ? 308  PHE B CD2   1 
ATOM   5798  C CE1   . PHE B  1 308 ? 119.465 126.243 -101.964 1.00 44.31  ? 308  PHE B CE1   1 
ATOM   5799  C CE2   . PHE B  1 308 ? 119.206 127.797 -100.137 1.00 46.47  ? 308  PHE B CE2   1 
ATOM   5800  C CZ    . PHE B  1 308 ? 118.716 126.738 -100.906 1.00 45.72  ? 308  PHE B CZ    1 
ATOM   5801  N N     . GLN B  1 309 ? 126.107 127.613 -101.069 1.00 50.94  ? 309  GLN B N     1 
ATOM   5802  C CA    . GLN B  1 309 ? 127.439 127.899 -101.574 1.00 53.81  ? 309  GLN B CA    1 
ATOM   5803  C C     . GLN B  1 309 ? 128.122 126.615 -102.043 1.00 53.23  ? 309  GLN B C     1 
ATOM   5804  O O     . GLN B  1 309 ? 127.974 125.549 -101.445 1.00 51.95  ? 309  GLN B O     1 
ATOM   5805  C CB    . GLN B  1 309 ? 128.287 128.609 -100.509 1.00 54.69  ? 309  GLN B CB    1 
ATOM   5806  C CG    . GLN B  1 309 ? 128.325 127.907 -99.178  1.00 57.22  ? 309  GLN B CG    1 
ATOM   5807  C CD    . GLN B  1 309 ? 128.897 128.786 -98.068  1.00 58.42  ? 309  GLN B CD    1 
ATOM   5808  O OE1   . GLN B  1 309 ? 128.825 128.438 -96.890  1.00 58.39  ? 309  GLN B OE1   1 
ATOM   5809  N NE2   . GLN B  1 309 ? 129.469 129.923 -98.443  1.00 59.24  ? 309  GLN B NE2   1 
ATOM   5810  N N     . THR B  1 310 ? 128.861 126.745 -103.134 1.00 54.91  ? 310  THR B N     1 
ATOM   5811  C CA    . THR B  1 310 ? 129.595 125.640 -103.735 1.00 57.29  ? 310  THR B CA    1 
ATOM   5812  C C     . THR B  1 310 ? 130.847 125.283 -102.933 1.00 58.75  ? 310  THR B C     1 
ATOM   5813  O O     . THR B  1 310 ? 130.940 125.569 -101.735 1.00 58.63  ? 310  THR B O     1 
ATOM   5814  C CB    . THR B  1 310 ? 130.037 126.019 -105.147 1.00 57.32  ? 310  THR B CB    1 
ATOM   5815  O OG1   . THR B  1 310 ? 130.993 127.088 -105.071 1.00 57.49  ? 310  THR B OG1   1 
ATOM   5816  C CG2   . THR B  1 310 ? 128.833 126.481 -105.969 1.00 57.24  ? 310  THR B CG2   1 
ATOM   5817  N N     . LYS B  1 311 ? 131.798 124.644 -103.614 1.00 60.09  ? 311  LYS B N     1 
ATOM   5818  C CA    . LYS B  1 311 ? 133.077 124.259 -103.019 1.00 61.13  ? 311  LYS B CA    1 
ATOM   5819  C C     . LYS B  1 311 ? 133.753 125.557 -102.629 1.00 60.25  ? 311  LYS B C     1 
ATOM   5820  O O     . LYS B  1 311 ? 134.304 125.678 -101.540 1.00 60.69  ? 311  LYS B O     1 
ATOM   5821  C CB    . LYS B  1 311 ? 133.949 123.532 -104.048 1.00 62.88  ? 311  LYS B CB    1 
ATOM   5822  C CG    . LYS B  1 311 ? 133.460 122.148 -104.424 1.00 66.14  ? 311  LYS B CG    1 
ATOM   5823  C CD    . LYS B  1 311 ? 133.887 121.096 -103.405 1.00 67.81  ? 311  LYS B CD    1 
ATOM   5824  C CE    . LYS B  1 311 ? 135.346 120.677 -103.616 1.00 69.05  ? 311  LYS B CE    1 
ATOM   5825  N NZ    . LYS B  1 311 ? 136.319 121.784 -103.371 1.00 69.42  ? 311  LYS B NZ    1 
ATOM   5826  N N     . ILE B  1 312 ? 133.706 126.512 -103.555 1.00 59.77  ? 312  ILE B N     1 
ATOM   5827  C CA    . ILE B  1 312 ? 134.271 127.840 -103.367 1.00 59.57  ? 312  ILE B CA    1 
ATOM   5828  C C     . ILE B  1 312 ? 133.280 128.619 -102.501 1.00 58.72  ? 312  ILE B C     1 
ATOM   5829  O O     . ILE B  1 312 ? 132.197 128.985 -102.963 1.00 58.59  ? 312  ILE B O     1 
ATOM   5830  C CB    . ILE B  1 312 ? 134.453 128.564 -104.728 1.00 60.31  ? 312  ILE B CB    1 
ATOM   5831  C CG1   . ILE B  1 312 ? 135.663 128.000 -105.481 1.00 61.28  ? 312  ILE B CG1   1 
ATOM   5832  C CG2   . ILE B  1 312 ? 134.657 130.046 -104.506 1.00 61.41  ? 312  ILE B CG2   1 
ATOM   5833  C CD1   . ILE B  1 312 ? 135.574 126.535 -105.813 1.00 60.29  ? 312  ILE B CD1   1 
ATOM   5834  N N     . PRO B  1 313 ? 133.657 128.915 -101.245 1.00 57.50  ? 313  PRO B N     1 
ATOM   5835  C CA    . PRO B  1 313 ? 132.818 129.642 -100.285 1.00 56.38  ? 313  PRO B CA    1 
ATOM   5836  C C     . PRO B  1 313 ? 132.133 130.933 -100.733 1.00 54.91  ? 313  PRO B C     1 
ATOM   5837  O O     . PRO B  1 313 ? 131.135 131.326 -100.130 1.00 54.95  ? 313  PRO B O     1 
ATOM   5838  C CB    . PRO B  1 313 ? 133.761 129.861 -99.100  1.00 57.12  ? 313  PRO B CB    1 
ATOM   5839  C CG    . PRO B  1 313 ? 135.099 130.000 -99.772  1.00 57.64  ? 313  PRO B CG    1 
ATOM   5840  C CD    . PRO B  1 313 ? 135.054 128.870 -100.773 1.00 57.96  ? 313  PRO B CD    1 
ATOM   5841  N N     . ASN B  1 314 ? 132.641 131.603 -101.766 1.00 53.24  ? 314  ASN B N     1 
ATOM   5842  C CA    . ASN B  1 314 ? 132.002 132.849 -102.209 1.00 51.75  ? 314  ASN B CA    1 
ATOM   5843  C C     . ASN B  1 314 ? 131.235 132.661 -103.518 1.00 50.43  ? 314  ASN B C     1 
ATOM   5844  O O     . ASN B  1 314 ? 130.762 133.630 -104.114 1.00 48.83  ? 314  ASN B O     1 
ATOM   5845  C CB    . ASN B  1 314 ? 133.038 133.962 -102.392 1.00 52.16  ? 314  ASN B CB    1 
ATOM   5846  C CG    . ASN B  1 314 ? 133.924 133.731 -103.595 1.00 52.21  ? 314  ASN B CG    1 
ATOM   5847  O OD1   . ASN B  1 314 ? 134.582 132.690 -103.702 1.00 51.52  ? 314  ASN B OD1   1 
ATOM   5848  N ND2   . ASN B  1 314 ? 133.944 134.695 -104.514 1.00 51.24  ? 314  ASN B ND2   1 
ATOM   5849  N N     . ILE B  1 315 ? 131.131 131.415 -103.969 1.00 50.02  ? 315  ILE B N     1 
ATOM   5850  C CA    . ILE B  1 315 ? 130.399 131.119 -105.198 1.00 49.24  ? 315  ILE B CA    1 
ATOM   5851  C C     . ILE B  1 315 ? 129.198 130.259 -104.825 1.00 47.77  ? 315  ILE B C     1 
ATOM   5852  O O     . ILE B  1 315 ? 129.336 129.179 -104.240 1.00 46.02  ? 315  ILE B O     1 
ATOM   5853  C CB    . ILE B  1 315 ? 131.294 130.399 -106.244 1.00 49.68  ? 315  ILE B CB    1 
ATOM   5854  C CG1   . ILE B  1 315 ? 132.442 131.330 -106.663 1.00 50.76  ? 315  ILE B CG1   1 
ATOM   5855  C CG2   . ILE B  1 315 ? 130.480 130.045 -107.478 1.00 49.89  ? 315  ILE B CG2   1 
ATOM   5856  C CD1   . ILE B  1 315 ? 133.311 130.789 -107.782 1.00 49.98  ? 315  ILE B CD1   1 
ATOM   5857  N N     . TYR B  1 316 ? 128.012 130.768 -105.148 1.00 47.68  ? 316  TYR B N     1 
ATOM   5858  C CA    . TYR B  1 316 ? 126.768 130.077 -104.826 1.00 47.30  ? 316  TYR B CA    1 
ATOM   5859  C C     . TYR B  1 316 ? 126.008 129.661 -106.082 1.00 46.04  ? 316  TYR B C     1 
ATOM   5860  O O     . TYR B  1 316 ? 126.286 130.140 -107.188 1.00 44.64  ? 316  TYR B O     1 
ATOM   5861  C CB    . TYR B  1 316 ? 125.851 130.976 -103.984 1.00 47.57  ? 316  TYR B CB    1 
ATOM   5862  C CG    . TYR B  1 316 ? 126.476 131.592 -102.754 1.00 48.78  ? 316  TYR B CG    1 
ATOM   5863  C CD1   . TYR B  1 316 ? 127.452 132.599 -102.866 1.00 49.03  ? 316  TYR B CD1   1 
ATOM   5864  C CD2   . TYR B  1 316 ? 126.044 131.227 -101.479 1.00 48.05  ? 316  TYR B CD2   1 
ATOM   5865  C CE1   . TYR B  1 316 ? 127.974 133.236 -101.732 1.00 50.39  ? 316  TYR B CE1   1 
ATOM   5866  C CE2   . TYR B  1 316 ? 126.559 131.853 -100.340 1.00 50.25  ? 316  TYR B CE2   1 
ATOM   5867  C CZ    . TYR B  1 316 ? 127.521 132.862 -100.475 1.00 49.95  ? 316  TYR B CZ    1 
ATOM   5868  O OH    . TYR B  1 316 ? 128.005 133.523 -99.369  1.00 50.42  ? 316  TYR B OH    1 
ATOM   5869  N N     . ALA B  1 317 ? 125.039 128.775 -105.881 1.00 44.75  ? 317  ALA B N     1 
ATOM   5870  C CA    . ALA B  1 317 ? 124.197 128.262 -106.950 1.00 43.58  ? 317  ALA B CA    1 
ATOM   5871  C C     . ALA B  1 317 ? 122.813 128.026 -106.373 1.00 42.82  ? 317  ALA B C     1 
ATOM   5872  O O     . ALA B  1 317 ? 122.676 127.472 -105.277 1.00 42.77  ? 317  ALA B O     1 
ATOM   5873  C CB    . ALA B  1 317 ? 124.764 126.968 -107.489 1.00 42.99  ? 317  ALA B CB    1 
ATOM   5874  N N     . ILE B  1 318 ? 121.799 128.455 -107.118 1.00 41.84  ? 318  ILE B N     1 
ATOM   5875  C CA    . ILE B  1 318 ? 120.404 128.318 -106.711 1.00 40.50  ? 318  ILE B CA    1 
ATOM   5876  C C     . ILE B  1 318 ? 119.537 127.942 -107.919 1.00 39.52  ? 318  ILE B C     1 
ATOM   5877  O O     . ILE B  1 318 ? 119.986 127.998 -109.073 1.00 40.02  ? 318  ILE B O     1 
ATOM   5878  C CB    . ILE B  1 318 ? 119.832 129.660 -106.167 1.00 39.81  ? 318  ILE B CB    1 
ATOM   5879  C CG1   . ILE B  1 318 ? 120.005 130.746 -107.240 1.00 39.18  ? 318  ILE B CG1   1 
ATOM   5880  C CG2   . ILE B  1 318 ? 120.490 130.027 -104.844 1.00 39.71  ? 318  ILE B CG2   1 
ATOM   5881  C CD1   . ILE B  1 318 ? 119.131 131.973 -107.070 1.00 40.36  ? 318  ILE B CD1   1 
ATOM   5882  N N     . GLY B  1 319 ? 118.293 127.562 -107.635 1.00 37.13  ? 319  GLY B N     1 
ATOM   5883  C CA    . GLY B  1 319 ? 117.339 127.243 -108.687 1.00 36.08  ? 319  GLY B CA    1 
ATOM   5884  C C     . GLY B  1 319 ? 117.424 125.917 -109.406 1.00 34.14  ? 319  GLY B C     1 
ATOM   5885  O O     . GLY B  1 319 ? 117.837 124.908 -108.829 1.00 33.03  ? 319  GLY B O     1 
ATOM   5886  N N     . ASP B  1 320 ? 117.016 125.926 -110.679 1.00 33.73  ? 320  ASP B N     1 
ATOM   5887  C CA    . ASP B  1 320 ? 117.032 124.714 -111.492 1.00 34.63  ? 320  ASP B CA    1 
ATOM   5888  C C     . ASP B  1 320 ? 118.425 124.101 -111.618 1.00 36.36  ? 320  ASP B C     1 
ATOM   5889  O O     . ASP B  1 320 ? 118.560 122.907 -111.904 1.00 34.93  ? 320  ASP B O     1 
ATOM   5890  C CB    . ASP B  1 320 ? 116.465 124.994 -112.885 1.00 32.94  ? 320  ASP B CB    1 
ATOM   5891  C CG    . ASP B  1 320 ? 114.937 124.961 -112.919 1.00 32.72  ? 320  ASP B CG    1 
ATOM   5892  O OD1   . ASP B  1 320 ? 114.293 124.902 -111.845 1.00 28.16  ? 320  ASP B OD1   1 
ATOM   5893  O OD2   . ASP B  1 320 ? 114.380 125.012 -114.034 1.00 31.53  ? 320  ASP B OD2   1 
ATOM   5894  N N     . VAL B  1 321 ? 119.464 124.900 -111.386 1.00 37.99  ? 321  VAL B N     1 
ATOM   5895  C CA    . VAL B  1 321 ? 120.824 124.366 -111.500 1.00 40.71  ? 321  VAL B CA    1 
ATOM   5896  C C     . VAL B  1 321 ? 121.238 123.526 -110.290 1.00 40.06  ? 321  VAL B C     1 
ATOM   5897  O O     . VAL B  1 321 ? 122.265 122.850 -110.311 1.00 40.99  ? 321  VAL B O     1 
ATOM   5898  C CB    . VAL B  1 321 ? 121.850 125.502 -111.730 1.00 42.39  ? 321  VAL B CB    1 
ATOM   5899  C CG1   . VAL B  1 321 ? 122.268 126.124 -110.411 1.00 43.40  ? 321  VAL B CG1   1 
ATOM   5900  C CG2   . VAL B  1 321 ? 123.037 124.969 -112.500 1.00 44.05  ? 321  VAL B CG2   1 
ATOM   5901  N N     . VAL B  1 322 ? 120.425 123.554 -109.239 1.00 40.38  ? 322  VAL B N     1 
ATOM   5902  C CA    . VAL B  1 322 ? 120.721 122.784 -108.038 1.00 40.07  ? 322  VAL B CA    1 
ATOM   5903  C C     . VAL B  1 322 ? 119.604 121.772 -107.703 1.00 39.84  ? 322  VAL B C     1 
ATOM   5904  O O     . VAL B  1 322 ? 118.538 121.776 -108.327 1.00 38.70  ? 322  VAL B O     1 
ATOM   5905  C CB    . VAL B  1 322 ? 120.964 123.737 -106.851 1.00 41.16  ? 322  VAL B CB    1 
ATOM   5906  C CG1   . VAL B  1 322 ? 121.359 122.949 -105.620 1.00 42.92  ? 322  VAL B CG1   1 
ATOM   5907  C CG2   . VAL B  1 322 ? 122.095 124.711 -107.199 1.00 41.28  ? 322  VAL B CG2   1 
ATOM   5908  N N     . ALA B  1 323 ? 119.863 120.907 -106.722 1.00 38.69  ? 323  ALA B N     1 
ATOM   5909  C CA    . ALA B  1 323 ? 118.909 119.881 -106.301 1.00 38.73  ? 323  ALA B CA    1 
ATOM   5910  C C     . ALA B  1 323 ? 117.585 120.464 -105.801 1.00 37.58  ? 323  ALA B C     1 
ATOM   5911  O O     . ALA B  1 323 ? 117.492 121.654 -105.499 1.00 36.63  ? 323  ALA B O     1 
ATOM   5912  C CB    . ALA B  1 323 ? 119.536 118.970 -105.212 1.00 37.38  ? 323  ALA B CB    1 
ATOM   5913  N N     . GLY B  1 324 ? 116.572 119.600 -105.724 1.00 37.02  ? 324  GLY B N     1 
ATOM   5914  C CA    . GLY B  1 324 ? 115.249 120.007 -105.264 1.00 37.07  ? 324  GLY B CA    1 
ATOM   5915  C C     . GLY B  1 324 ? 114.243 120.143 -106.400 1.00 35.63  ? 324  GLY B C     1 
ATOM   5916  O O     . GLY B  1 324 ? 114.616 120.026 -107.559 1.00 34.79  ? 324  GLY B O     1 
ATOM   5917  N N     . PRO B  1 325 ? 112.963 120.403 -106.107 1.00 34.71  ? 325  PRO B N     1 
ATOM   5918  C CA    . PRO B  1 325 ? 112.007 120.534 -107.208 1.00 34.12  ? 325  PRO B CA    1 
ATOM   5919  C C     . PRO B  1 325 ? 112.398 121.648 -108.163 1.00 33.90  ? 325  PRO B C     1 
ATOM   5920  O O     . PRO B  1 325 ? 112.736 122.749 -107.724 1.00 33.96  ? 325  PRO B O     1 
ATOM   5921  C CB    . PRO B  1 325 ? 110.699 120.838 -106.493 1.00 34.82  ? 325  PRO B CB    1 
ATOM   5922  C CG    . PRO B  1 325 ? 111.180 121.628 -105.289 1.00 35.85  ? 325  PRO B CG    1 
ATOM   5923  C CD    . PRO B  1 325 ? 112.337 120.767 -104.825 1.00 35.09  ? 325  PRO B CD    1 
ATOM   5924  N N     . MET B  1 326 ? 112.349 121.361 -109.467 1.00 32.09  ? 326  MET B N     1 
ATOM   5925  C CA    . MET B  1 326 ? 112.682 122.348 -110.493 1.00 31.35  ? 326  MET B CA    1 
ATOM   5926  C C     . MET B  1 326 ? 111.450 123.162 -110.794 1.00 31.34  ? 326  MET B C     1 
ATOM   5927  O O     . MET B  1 326 ? 110.783 122.964 -111.797 1.00 33.68  ? 326  MET B O     1 
ATOM   5928  C CB    . MET B  1 326 ? 113.179 121.659 -111.762 1.00 32.57  ? 326  MET B CB    1 
ATOM   5929  C CG    . MET B  1 326 ? 114.520 120.947 -111.565 1.00 32.63  ? 326  MET B CG    1 
ATOM   5930  S SD    . MET B  1 326 ? 115.045 120.013 -113.040 1.00 36.37  ? 326  MET B SD    1 
ATOM   5931  C CE    . MET B  1 326 ? 115.773 121.372 -113.997 1.00 33.98  ? 326  MET B CE    1 
ATOM   5932  N N     . LEU B  1 327 ? 111.168 124.099 -109.901 1.00 31.94  ? 327  LEU B N     1 
ATOM   5933  C CA    . LEU B  1 327 ? 110.008 124.966 -109.980 1.00 30.60  ? 327  LEU B CA    1 
ATOM   5934  C C     . LEU B  1 327 ? 110.443 126.414 -109.832 1.00 30.87  ? 327  LEU B C     1 
ATOM   5935  O O     . LEU B  1 327 ? 111.466 126.702 -109.205 1.00 32.22  ? 327  LEU B O     1 
ATOM   5936  C CB    . LEU B  1 327 ? 109.040 124.599 -108.858 1.00 28.63  ? 327  LEU B CB    1 
ATOM   5937  C CG    . LEU B  1 327 ? 108.387 123.236 -108.980 1.00 30.43  ? 327  LEU B CG    1 
ATOM   5938  C CD1   . LEU B  1 327 ? 107.489 122.980 -107.743 1.00 28.57  ? 327  LEU B CD1   1 
ATOM   5939  C CD2   . LEU B  1 327 ? 107.582 123.191 -110.297 1.00 28.71  ? 327  LEU B CD2   1 
ATOM   5940  N N     . ALA B  1 328 ? 109.660 127.324 -110.391 1.00 31.33  ? 328  ALA B N     1 
ATOM   5941  C CA    . ALA B  1 328 ? 109.997 128.739 -110.311 1.00 31.68  ? 328  ALA B CA    1 
ATOM   5942  C C     . ALA B  1 328 ? 109.922 129.343 -108.879 1.00 32.02  ? 328  ALA B C     1 
ATOM   5943  O O     . ALA B  1 328 ? 110.837 130.063 -108.458 1.00 30.33  ? 328  ALA B O     1 
ATOM   5944  C CB    . ALA B  1 328 ? 109.119 129.536 -111.282 1.00 29.81  ? 328  ALA B CB    1 
ATOM   5945  N N     . HIS B  1 329 ? 108.851 129.060 -108.130 1.00 31.36  ? 329  HIS B N     1 
ATOM   5946  C CA    . HIS B  1 329 ? 108.755 129.607 -106.778 1.00 31.85  ? 329  HIS B CA    1 
ATOM   5947  C C     . HIS B  1 329 ? 109.844 129.046 -105.869 1.00 31.22  ? 329  HIS B C     1 
ATOM   5948  O O     . HIS B  1 329 ? 110.263 129.707 -104.914 1.00 32.75  ? 329  HIS B O     1 
ATOM   5949  C CB    . HIS B  1 329 ? 107.348 129.401 -106.169 1.00 32.37  ? 329  HIS B CB    1 
ATOM   5950  C CG    . HIS B  1 329 ? 106.768 128.036 -106.398 1.00 33.82  ? 329  HIS B CG    1 
ATOM   5951  N ND1   . HIS B  1 329 ? 106.291 127.625 -107.626 1.00 33.81  ? 329  HIS B ND1   1 
ATOM   5952  C CD2   . HIS B  1 329 ? 106.570 127.000 -105.550 1.00 33.26  ? 329  HIS B CD2   1 
ATOM   5953  C CE1   . HIS B  1 329 ? 105.820 126.395 -107.524 1.00 35.43  ? 329  HIS B CE1   1 
ATOM   5954  N NE2   . HIS B  1 329 ? 105.979 125.992 -106.273 1.00 35.25  ? 329  HIS B NE2   1 
ATOM   5955  N N     . LYS B  1 330 ? 110.319 127.842 -106.170 1.00 29.86  ? 330  LYS B N     1 
ATOM   5956  C CA    . LYS B  1 330 ? 111.398 127.229 -105.392 1.00 30.89  ? 330  LYS B CA    1 
ATOM   5957  C C     . LYS B  1 330 ? 112.722 127.968 -105.675 1.00 31.56  ? 330  LYS B C     1 
ATOM   5958  O O     . LYS B  1 330 ? 113.524 128.213 -104.768 1.00 30.68  ? 330  LYS B O     1 
ATOM   5959  C CB    . LYS B  1 330 ? 111.527 125.734 -105.754 1.00 31.31  ? 330  LYS B CB    1 
ATOM   5960  C CG    . LYS B  1 330 ? 112.713 124.971 -105.129 1.00 31.80  ? 330  LYS B CG    1 
ATOM   5961  C CD    . LYS B  1 330 ? 114.023 125.137 -105.905 1.00 31.15  ? 330  LYS B CD    1 
ATOM   5962  C CE    . LYS B  1 330 ? 114.916 123.922 -105.665 1.00 32.74  ? 330  LYS B CE    1 
ATOM   5963  N NZ    . LYS B  1 330 ? 116.207 123.998 -106.387 1.00 31.69  ? 330  LYS B NZ    1 
ATOM   5964  N N     . ALA B  1 331 ? 112.932 128.326 -106.940 1.00 31.99  ? 331  ALA B N     1 
ATOM   5965  C CA    . ALA B  1 331 ? 114.135 129.040 -107.360 1.00 32.62  ? 331  ALA B CA    1 
ATOM   5966  C C     . ALA B  1 331 ? 114.172 130.446 -106.757 1.00 33.74  ? 331  ALA B C     1 
ATOM   5967  O O     . ALA B  1 331 ? 115.218 130.888 -106.296 1.00 32.63  ? 331  ALA B O     1 
ATOM   5968  C CB    . ALA B  1 331 ? 114.186 129.129 -108.884 1.00 33.14  ? 331  ALA B CB    1 
ATOM   5969  N N     . GLU B  1 332 ? 113.035 131.140 -106.759 1.00 34.40  ? 332  GLU B N     1 
ATOM   5970  C CA    . GLU B  1 332 ? 112.981 132.486 -106.201 1.00 38.32  ? 332  GLU B CA    1 
ATOM   5971  C C     . GLU B  1 332 ? 113.272 132.483 -104.701 1.00 38.85  ? 332  GLU B C     1 
ATOM   5972  O O     . GLU B  1 332 ? 114.076 133.274 -104.213 1.00 38.90  ? 332  GLU B O     1 
ATOM   5973  C CB    . GLU B  1 332 ? 111.616 133.115 -106.439 1.00 39.17  ? 332  GLU B CB    1 
ATOM   5974  C CG    . GLU B  1 332 ? 111.181 133.049 -107.874 1.00 44.30  ? 332  GLU B CG    1 
ATOM   5975  C CD    . GLU B  1 332 ? 109.977 133.918 -108.141 1.00 45.86  ? 332  GLU B CD    1 
ATOM   5976  O OE1   . GLU B  1 332 ? 109.210 134.188 -107.186 1.00 46.57  ? 332  GLU B OE1   1 
ATOM   5977  O OE2   . GLU B  1 332 ? 109.799 134.319 -109.312 1.00 47.20  ? 332  GLU B OE2   1 
ATOM   5978  N N     . ASP B  1 333 ? 112.609 131.595 -103.978 1.00 38.12  ? 333  ASP B N     1 
ATOM   5979  C CA    . ASP B  1 333 ? 112.827 131.505 -102.556 1.00 39.12  ? 333  ASP B CA    1 
ATOM   5980  C C     . ASP B  1 333 ? 114.296 131.236 -102.241 1.00 39.07  ? 333  ASP B C     1 
ATOM   5981  O O     . ASP B  1 333 ? 114.847 131.810 -101.298 1.00 37.92  ? 333  ASP B O     1 
ATOM   5982  C CB    . ASP B  1 333 ? 111.940 130.416 -101.959 1.00 40.57  ? 333  ASP B CB    1 
ATOM   5983  C CG    . ASP B  1 333 ? 110.534 130.914 -101.664 1.00 42.91  ? 333  ASP B CG    1 
ATOM   5984  O OD1   . ASP B  1 333 ? 109.911 131.561 -102.547 1.00 45.36  ? 333  ASP B OD1   1 
ATOM   5985  O OD2   . ASP B  1 333 ? 110.052 130.657 -100.547 1.00 43.28  ? 333  ASP B OD2   1 
ATOM   5986  N N     . GLU B  1 334 ? 114.935 130.373 -103.024 1.00 37.92  ? 334  GLU B N     1 
ATOM   5987  C CA    . GLU B  1 334 ? 116.339 130.078 -102.782 1.00 38.41  ? 334  GLU B CA    1 
ATOM   5988  C C     . GLU B  1 334 ? 117.203 131.306 -103.064 1.00 38.87  ? 334  GLU B C     1 
ATOM   5989  O O     . GLU B  1 334 ? 118.191 131.539 -102.377 1.00 37.08  ? 334  GLU B O     1 
ATOM   5990  C CB    . GLU B  1 334 ? 116.800 128.895 -103.632 1.00 37.11  ? 334  GLU B CB    1 
ATOM   5991  C CG    . GLU B  1 334 ? 116.095 127.609 -103.269 1.00 35.18  ? 334  GLU B CG    1 
ATOM   5992  C CD    . GLU B  1 334 ? 116.539 126.444 -104.120 1.00 35.49  ? 334  GLU B CD    1 
ATOM   5993  O OE1   . GLU B  1 334 ? 116.888 126.645 -105.306 1.00 36.23  ? 334  GLU B OE1   1 
ATOM   5994  O OE2   . GLU B  1 334 ? 116.525 125.311 -103.616 1.00 35.34  ? 334  GLU B OE2   1 
ATOM   5995  N N     . GLY B  1 335 ? 116.818 132.080 -104.074 1.00 39.17  ? 335  GLY B N     1 
ATOM   5996  C CA    . GLY B  1 335 ? 117.561 133.271 -104.409 1.00 40.00  ? 335  GLY B CA    1 
ATOM   5997  C C     . GLY B  1 335 ? 117.519 134.228 -103.230 1.00 41.55  ? 335  GLY B C     1 
ATOM   5998  O O     . GLY B  1 335 ? 118.567 134.702 -102.766 1.00 40.85  ? 335  GLY B O     1 
ATOM   5999  N N     . ILE B  1 336 ? 116.308 134.500 -102.743 1.00 40.66  ? 336  ILE B N     1 
ATOM   6000  C CA    . ILE B  1 336 ? 116.120 135.403 -101.627 1.00 40.87  ? 336  ILE B CA    1 
ATOM   6001  C C     . ILE B  1 336 ? 116.903 135.006 -100.388 1.00 40.36  ? 336  ILE B C     1 
ATOM   6002  O O     . ILE B  1 336 ? 117.655 135.817 -99.848  1.00 39.98  ? 336  ILE B O     1 
ATOM   6003  C CB    . ILE B  1 336 ? 114.636 135.522 -101.251 1.00 42.13  ? 336  ILE B CB    1 
ATOM   6004  C CG1   . ILE B  1 336 ? 113.941 136.411 -102.270 1.00 41.71  ? 336  ILE B CG1   1 
ATOM   6005  C CG2   . ILE B  1 336 ? 114.479 136.115 -99.840  1.00 41.94  ? 336  ILE B CG2   1 
ATOM   6006  C CD1   . ILE B  1 336 ? 112.481 136.537 -102.034 1.00 44.27  ? 336  ILE B CD1   1 
ATOM   6007  N N     . ILE B  1 337 ? 116.750 133.764 -99.946  1.00 39.53  ? 337  ILE B N     1 
ATOM   6008  C CA    . ILE B  1 337 ? 117.439 133.329 -98.746  1.00 39.57  ? 337  ILE B CA    1 
ATOM   6009  C C     . ILE B  1 337 ? 118.940 133.200 -98.941  1.00 40.14  ? 337  ILE B C     1 
ATOM   6010  O O     . ILE B  1 337 ? 119.706 133.422 -98.007  1.00 40.10  ? 337  ILE B O     1 
ATOM   6011  C CB    . ILE B  1 337 ? 116.852 132.015 -98.196  1.00 39.21  ? 337  ILE B CB    1 
ATOM   6012  C CG1   . ILE B  1 337 ? 117.119 130.856 -99.142  1.00 39.35  ? 337  ILE B CG1   1 
ATOM   6013  C CG2   . ILE B  1 337 ? 115.354 132.162 -98.022  1.00 39.33  ? 337  ILE B CG2   1 
ATOM   6014  C CD1   . ILE B  1 337 ? 116.572 129.540 -98.610  1.00 38.62  ? 337  ILE B CD1   1 
ATOM   6015  N N     . CYS B  1 338 ? 119.370 132.856 -100.148 1.00 40.17  ? 338  CYS B N     1 
ATOM   6016  C CA    . CYS B  1 338 ? 120.797 132.753 -100.404 1.00 40.71  ? 338  CYS B CA    1 
ATOM   6017  C C     . CYS B  1 338 ? 121.458 134.125 -100.200 1.00 40.51  ? 338  CYS B C     1 
ATOM   6018  O O     . CYS B  1 338 ? 122.442 134.217 -99.482  1.00 39.68  ? 338  CYS B O     1 
ATOM   6019  C CB    . CYS B  1 338 ? 121.079 132.255 -101.823 1.00 41.00  ? 338  CYS B CB    1 
ATOM   6020  S SG    . CYS B  1 338 ? 122.839 132.363 -102.301 1.00 41.75  ? 338  CYS B SG    1 
ATOM   6021  N N     . VAL B  1 339 ? 120.928 135.181 -100.808 1.00 40.67  ? 339  VAL B N     1 
ATOM   6022  C CA    . VAL B  1 339 ? 121.554 136.484 -100.618 1.00 42.75  ? 339  VAL B CA    1 
ATOM   6023  C C     . VAL B  1 339 ? 121.320 137.064 -99.222  1.00 44.38  ? 339  VAL B C     1 
ATOM   6024  O O     . VAL B  1 339 ? 122.072 137.938 -98.783  1.00 46.07  ? 339  VAL B O     1 
ATOM   6025  C CB    . VAL B  1 339 ? 121.138 137.523 -101.696 1.00 40.94  ? 339  VAL B CB    1 
ATOM   6026  C CG1   . VAL B  1 339 ? 121.348 136.932 -103.050 1.00 41.19  ? 339  VAL B CG1   1 
ATOM   6027  C CG2   . VAL B  1 339 ? 119.716 137.983 -101.501 1.00 41.66  ? 339  VAL B CG2   1 
ATOM   6028  N N     . GLU B  1 340 ? 120.282 136.592 -98.526  1.00 45.48  ? 340  GLU B N     1 
ATOM   6029  C CA    . GLU B  1 340 ? 120.033 137.047 -97.156  1.00 44.76  ? 340  GLU B CA    1 
ATOM   6030  C C     . GLU B  1 340 ? 121.144 136.409 -96.342  1.00 45.05  ? 340  GLU B C     1 
ATOM   6031  O O     . GLU B  1 340 ? 121.678 137.016 -95.409  1.00 45.56  ? 340  GLU B O     1 
ATOM   6032  C CB    . GLU B  1 340 ? 118.669 136.578 -96.628  1.00 43.81  ? 340  GLU B CB    1 
ATOM   6033  C CG    . GLU B  1 340 ? 117.498 137.423 -97.120  1.00 43.28  ? 340  GLU B CG    1 
ATOM   6034  C CD    . GLU B  1 340 ? 116.134 136.949 -96.592  1.00 42.90  ? 340  GLU B CD    1 
ATOM   6035  O OE1   . GLU B  1 340 ? 116.025 135.781 -96.146  1.00 41.24  ? 340  GLU B OE1   1 
ATOM   6036  O OE2   . GLU B  1 340 ? 115.176 137.746 -96.645  1.00 42.85  ? 340  GLU B OE2   1 
ATOM   6037  N N     . GLY B  1 341 ? 121.488 135.177 -96.710  1.00 44.80  ? 341  GLY B N     1 
ATOM   6038  C CA    . GLY B  1 341 ? 122.563 134.466 -96.043  1.00 44.90  ? 341  GLY B CA    1 
ATOM   6039  C C     . GLY B  1 341 ? 123.871 135.188 -96.312  1.00 45.73  ? 341  GLY B C     1 
ATOM   6040  O O     . GLY B  1 341 ? 124.746 135.241 -95.447  1.00 45.90  ? 341  GLY B O     1 
ATOM   6041  N N     . MET B  1 342 ? 124.003 135.749 -97.511  1.00 45.37  ? 342  MET B N     1 
ATOM   6042  C CA    . MET B  1 342 ? 125.199 136.494 -97.875  1.00 46.79  ? 342  MET B CA    1 
ATOM   6043  C C     . MET B  1 342 ? 125.323 137.710 -96.949  1.00 47.95  ? 342  MET B C     1 
ATOM   6044  O O     . MET B  1 342 ? 126.424 138.140 -96.611  1.00 48.62  ? 342  MET B O     1 
ATOM   6045  C CB    . MET B  1 342 ? 125.119 136.967 -99.334  1.00 46.56  ? 342  MET B CB    1 
ATOM   6046  C CG    . MET B  1 342 ? 125.557 135.952 -100.394 1.00 44.41  ? 342  MET B CG    1 
ATOM   6047  S SD    . MET B  1 342 ? 125.384 136.685 -102.036 1.00 44.98  ? 342  MET B SD    1 
ATOM   6048  C CE    . MET B  1 342 ? 124.823 135.282 -103.062 1.00 42.95  ? 342  MET B CE    1 
ATOM   6049  N N     . ALA B  1 343 ? 124.186 138.261 -96.541  1.00 48.63  ? 343  ALA B N     1 
ATOM   6050  C CA    . ALA B  1 343 ? 124.180 139.422 -95.660  1.00 48.96  ? 343  ALA B CA    1 
ATOM   6051  C C     . ALA B  1 343 ? 124.259 139.051 -94.169  1.00 49.12  ? 343  ALA B C     1 
ATOM   6052  O O     . ALA B  1 343 ? 124.181 139.915 -93.302  1.00 49.67  ? 343  ALA B O     1 
ATOM   6053  C CB    . ALA B  1 343 ? 122.943 140.257 -95.932  1.00 47.82  ? 343  ALA B CB    1 
ATOM   6054  N N     . GLY B  1 344 ? 124.404 137.769 -93.869  1.00 49.69  ? 344  GLY B N     1 
ATOM   6055  C CA    . GLY B  1 344 ? 124.503 137.360 -92.479  1.00 50.17  ? 344  GLY B CA    1 
ATOM   6056  C C     . GLY B  1 344 ? 123.311 136.627 -91.873  1.00 50.99  ? 344  GLY B C     1 
ATOM   6057  O O     . GLY B  1 344 ? 123.455 135.960 -90.841  1.00 49.96  ? 344  GLY B O     1 
ATOM   6058  N N     . GLY B  1 345 ? 122.140 136.733 -92.497  1.00 51.15  ? 345  GLY B N     1 
ATOM   6059  C CA    . GLY B  1 345 ? 120.966 136.068 -91.951  1.00 51.23  ? 345  GLY B CA    1 
ATOM   6060  C C     . GLY B  1 345 ? 121.070 134.556 -91.977  1.00 51.59  ? 345  GLY B C     1 
ATOM   6061  O O     . GLY B  1 345 ? 122.001 134.008 -92.571  1.00 51.22  ? 345  GLY B O     1 
ATOM   6062  N N     . ALA B  1 346 ? 120.135 133.877 -91.315  1.00 52.15  ? 346  ALA B N     1 
ATOM   6063  C CA    . ALA B  1 346 ? 120.111 132.408 -91.318  1.00 52.27  ? 346  ALA B CA    1 
ATOM   6064  C C     . ALA B  1 346 ? 119.561 131.974 -92.693  1.00 52.07  ? 346  ALA B C     1 
ATOM   6065  O O     . ALA B  1 346 ? 118.869 132.740 -93.375  1.00 51.43  ? 346  ALA B O     1 
ATOM   6066  C CB    . ALA B  1 346 ? 119.206 131.892 -90.199  1.00 52.02  ? 346  ALA B CB    1 
ATOM   6067  N N     . VAL B  1 347 ? 119.868 130.759 -93.114  1.00 50.96  ? 347  VAL B N     1 
ATOM   6068  C CA    . VAL B  1 347 ? 119.379 130.314 -94.408  1.00 50.67  ? 347  VAL B CA    1 
ATOM   6069  C C     . VAL B  1 347 ? 118.699 128.980 -94.246  1.00 50.60  ? 347  VAL B C     1 
ATOM   6070  O O     . VAL B  1 347 ? 119.350 127.987 -93.930  1.00 51.74  ? 347  VAL B O     1 
ATOM   6071  C CB    . VAL B  1 347 ? 120.530 130.179 -95.432  1.00 49.59  ? 347  VAL B CB    1 
ATOM   6072  C CG1   . VAL B  1 347 ? 119.997 129.632 -96.748  1.00 50.59  ? 347  VAL B CG1   1 
ATOM   6073  C CG2   . VAL B  1 347 ? 121.176 131.533 -95.660  1.00 48.34  ? 347  VAL B CG2   1 
ATOM   6074  N N     . HIS B  1 348 ? 117.391 128.948 -94.457  1.00 49.75  ? 348  HIS B N     1 
ATOM   6075  C CA    . HIS B  1 348 ? 116.681 127.697 -94.314  1.00 49.90  ? 348  HIS B CA    1 
ATOM   6076  C C     . HIS B  1 348 ? 115.458 127.530 -95.196  1.00 48.71  ? 348  HIS B C     1 
ATOM   6077  O O     . HIS B  1 348 ? 114.575 128.387 -95.244  1.00 47.30  ? 348  HIS B O     1 
ATOM   6078  C CB    . HIS B  1 348 ? 116.270 127.484 -92.856  1.00 52.90  ? 348  HIS B CB    1 
ATOM   6079  C CG    . HIS B  1 348 ? 115.575 126.179 -92.618  1.00 56.47  ? 348  HIS B CG    1 
ATOM   6080  N ND1   . HIS B  1 348 ? 114.236 126.093 -92.291  1.00 58.59  ? 348  HIS B ND1   1 
ATOM   6081  C CD2   . HIS B  1 348 ? 116.017 124.902 -92.726  1.00 57.84  ? 348  HIS B CD2   1 
ATOM   6082  C CE1   . HIS B  1 348 ? 113.885 124.822 -92.213  1.00 58.93  ? 348  HIS B CE1   1 
ATOM   6083  N NE2   . HIS B  1 348 ? 114.947 124.078 -92.473  1.00 58.57  ? 348  HIS B NE2   1 
ATOM   6084  N N     . ILE B  1 349 ? 115.424 126.410 -95.905  1.00 48.34  ? 349  ILE B N     1 
ATOM   6085  C CA    . ILE B  1 349 ? 114.293 126.081 -96.751  1.00 47.17  ? 349  ILE B CA    1 
ATOM   6086  C C     . ILE B  1 349 ? 113.955 124.616 -96.509  1.00 47.26  ? 349  ILE B C     1 
ATOM   6087  O O     . ILE B  1 349 ? 114.837 123.773 -96.320  1.00 46.90  ? 349  ILE B O     1 
ATOM   6088  C CB    . ILE B  1 349 ? 114.571 126.302 -98.260  1.00 45.55  ? 349  ILE B CB    1 
ATOM   6089  C CG1   . ILE B  1 349 ? 113.306 125.956 -99.055  1.00 46.28  ? 349  ILE B CG1   1 
ATOM   6090  C CG2   . ILE B  1 349 ? 115.733 125.442 -98.728  1.00 45.22  ? 349  ILE B CG2   1 
ATOM   6091  C CD1   . ILE B  1 349 ? 113.353 126.359 -100.499 1.00 46.23  ? 349  ILE B CD1   1 
ATOM   6092  N N     . ASP B  1 350 ? 112.660 124.338 -96.492  1.00 47.51  ? 350  ASP B N     1 
ATOM   6093  C CA    . ASP B  1 350 ? 112.139 122.995 -96.283  1.00 47.71  ? 350  ASP B CA    1 
ATOM   6094  C C     . ASP B  1 350 ? 111.338 122.626 -97.548  1.00 45.82  ? 350  ASP B C     1 
ATOM   6095  O O     . ASP B  1 350 ? 110.226 123.109 -97.755  1.00 43.70  ? 350  ASP B O     1 
ATOM   6096  C CB    . ASP B  1 350 ? 111.259 123.017 -95.026  1.00 50.33  ? 350  ASP B CB    1 
ATOM   6097  C CG    . ASP B  1 350 ? 110.555 121.697 -94.762  1.00 53.12  ? 350  ASP B CG    1 
ATOM   6098  O OD1   . ASP B  1 350 ? 111.033 120.632 -95.242  1.00 53.16  ? 350  ASP B OD1   1 
ATOM   6099  O OD2   . ASP B  1 350 ? 109.521 121.748 -94.048  1.00 53.79  ? 350  ASP B OD2   1 
ATOM   6100  N N     . TYR B  1 351 ? 111.922 121.789 -98.403  1.00 43.91  ? 351  TYR B N     1 
ATOM   6101  C CA    . TYR B  1 351 ? 111.262 121.405 -99.636  1.00 43.44  ? 351  TYR B CA    1 
ATOM   6102  C C     . TYR B  1 351 ? 109.943 120.658 -99.444  1.00 42.04  ? 351  TYR B C     1 
ATOM   6103  O O     . TYR B  1 351 ? 109.163 120.542 -100.383 1.00 39.49  ? 351  TYR B O     1 
ATOM   6104  C CB    . TYR B  1 351 ? 112.227 120.606 -100.531 1.00 46.11  ? 351  TYR B CB    1 
ATOM   6105  C CG    . TYR B  1 351 ? 113.437 121.422 -100.954 1.00 48.53  ? 351  TYR B CG    1 
ATOM   6106  C CD1   . TYR B  1 351 ? 113.282 122.638 -101.614 1.00 48.11  ? 351  TYR B CD1   1 
ATOM   6107  C CD2   . TYR B  1 351 ? 114.724 121.031 -100.596 1.00 51.25  ? 351  TYR B CD2   1 
ATOM   6108  C CE1   . TYR B  1 351 ? 114.368 123.455 -101.895 1.00 50.76  ? 351  TYR B CE1   1 
ATOM   6109  C CE2   . TYR B  1 351 ? 115.830 121.848 -100.870 1.00 53.32  ? 351  TYR B CE2   1 
ATOM   6110  C CZ    . TYR B  1 351 ? 115.638 123.062 -101.517 1.00 52.84  ? 351  TYR B CZ    1 
ATOM   6111  O OH    . TYR B  1 351 ? 116.709 123.900 -101.744 1.00 53.87  ? 351  TYR B OH    1 
ATOM   6112  N N     . ASN B  1 352 ? 109.681 120.174 -98.233  1.00 40.52  ? 352  ASN B N     1 
ATOM   6113  C CA    . ASN B  1 352 ? 108.428 119.470 -97.968  1.00 39.21  ? 352  ASN B CA    1 
ATOM   6114  C C     . ASN B  1 352 ? 107.294 120.495 -97.967  1.00 37.86  ? 352  ASN B C     1 
ATOM   6115  O O     . ASN B  1 352 ? 106.124 120.138 -98.119  1.00 37.46  ? 352  ASN B O     1 
ATOM   6116  C CB    . ASN B  1 352 ? 108.478 118.761 -96.602  1.00 39.58  ? 352  ASN B CB    1 
ATOM   6117  C CG    . ASN B  1 352 ? 107.197 117.969 -96.289  1.00 40.85  ? 352  ASN B CG    1 
ATOM   6118  O OD1   . ASN B  1 352 ? 106.769 117.111 -97.077  1.00 40.64  ? 352  ASN B OD1   1 
ATOM   6119  N ND2   . ASN B  1 352 ? 106.587 118.246 -95.130  1.00 38.25  ? 352  ASN B ND2   1 
ATOM   6120  N N     . CYS B  1 353 ? 107.648 121.769 -97.818  1.00 34.96  ? 353  CYS B N     1 
ATOM   6121  C CA    . CYS B  1 353 ? 106.653 122.828 -97.756  1.00 33.74  ? 353  CYS B CA    1 
ATOM   6122  C C     . CYS B  1 353 ? 106.493 123.639 -99.064  1.00 32.64  ? 353  CYS B C     1 
ATOM   6123  O O     . CYS B  1 353 ? 105.784 124.643 -99.110  1.00 32.89  ? 353  CYS B O     1 
ATOM   6124  C CB    . CYS B  1 353 ? 106.979 123.742 -96.566  1.00 35.96  ? 353  CYS B CB    1 
ATOM   6125  S SG    . CYS B  1 353 ? 106.788 122.968 -94.888  1.00 41.90  ? 353  CYS B SG    1 
ATOM   6126  N N     . VAL B  1 354 ? 107.143 123.172 -100.126 1.00 30.13  ? 354  VAL B N     1 
ATOM   6127  C CA    . VAL B  1 354 ? 107.101 123.816 -101.442 1.00 27.78  ? 354  VAL B CA    1 
ATOM   6128  C C     . VAL B  1 354 ? 105.943 123.205 -102.203 1.00 25.50  ? 354  VAL B C     1 
ATOM   6129  O O     . VAL B  1 354 ? 105.956 122.016 -102.470 1.00 25.01  ? 354  VAL B O     1 
ATOM   6130  C CB    . VAL B  1 354 ? 108.393 123.536 -102.233 1.00 27.79  ? 354  VAL B CB    1 
ATOM   6131  C CG1   . VAL B  1 354 ? 108.239 124.030 -103.656 1.00 27.57  ? 354  VAL B CG1   1 
ATOM   6132  C CG2   . VAL B  1 354 ? 109.587 124.208 -101.547 1.00 29.01  ? 354  VAL B CG2   1 
ATOM   6133  N N     . PRO B  1 355 ? 104.929 124.004 -102.569 1.00 25.40  ? 355  PRO B N     1 
ATOM   6134  C CA    . PRO B  1 355 ? 103.842 123.323 -103.286 1.00 26.50  ? 355  PRO B CA    1 
ATOM   6135  C C     . PRO B  1 355 ? 104.073 123.060 -104.770 1.00 26.35  ? 355  PRO B C     1 
ATOM   6136  O O     . PRO B  1 355 ? 105.006 123.591 -105.363 1.00 27.84  ? 355  PRO B O     1 
ATOM   6137  C CB    . PRO B  1 355 ? 102.630 124.225 -103.028 1.00 22.71  ? 355  PRO B CB    1 
ATOM   6138  C CG    . PRO B  1 355 ? 103.199 125.580 -102.991 1.00 23.67  ? 355  PRO B CG    1 
ATOM   6139  C CD    . PRO B  1 355 ? 104.576 125.406 -102.275 1.00 24.57  ? 355  PRO B CD    1 
ATOM   6140  N N     . SER B  1 356 ? 103.227 122.200 -105.337 1.00 25.42  ? 356  SER B N     1 
ATOM   6141  C CA    . SER B  1 356 ? 103.260 121.848 -106.758 1.00 22.82  ? 356  SER B CA    1 
ATOM   6142  C C     . SER B  1 356 ? 101.869 122.156 -107.309 1.00 23.43  ? 356  SER B C     1 
ATOM   6143  O O     . SER B  1 356 ? 100.864 121.936 -106.614 1.00 21.62  ? 356  SER B O     1 
ATOM   6144  C CB    . SER B  1 356 ? 103.538 120.352 -106.942 1.00 23.93  ? 356  SER B CB    1 
ATOM   6145  O OG    . SER B  1 356 ? 104.914 120.053 -106.767 1.00 25.08  ? 356  SER B OG    1 
ATOM   6146  N N     . VAL B  1 357 ? 101.783 122.695 -108.528 1.00 22.20  ? 357  VAL B N     1 
ATOM   6147  C CA    . VAL B  1 357 ? 100.457 122.986 -109.104 1.00 21.48  ? 357  VAL B CA    1 
ATOM   6148  C C     . VAL B  1 357 ? 100.498 122.548 -110.568 1.00 22.92  ? 357  VAL B C     1 
ATOM   6149  O O     . VAL B  1 357 ? 101.554 122.639 -111.223 1.00 21.45  ? 357  VAL B O     1 
ATOM   6150  C CB    . VAL B  1 357 ? 100.072 124.519 -109.055 1.00 22.88  ? 357  VAL B CB    1 
ATOM   6151  C CG1   . VAL B  1 357 ? 98.650  124.719 -109.605 1.00 22.97  ? 357  VAL B CG1   1 
ATOM   6152  C CG2   . VAL B  1 357 ? 100.100 125.055 -107.636 1.00 22.19  ? 357  VAL B CG2   1 
ATOM   6153  N N     . ILE B  1 358 ? 99.363  122.045 -111.054 1.00 22.36  ? 358  ILE B N     1 
ATOM   6154  C CA    . ILE B  1 358 ? 99.219  121.640 -112.453 1.00 22.53  ? 358  ILE B CA    1 
ATOM   6155  C C     . ILE B  1 358 ? 98.063  122.516 -112.886 1.00 22.24  ? 358  ILE B C     1 
ATOM   6156  O O     . ILE B  1 358 ? 96.985  122.474 -112.296 1.00 23.47  ? 358  ILE B O     1 
ATOM   6157  C CB    . ILE B  1 358 ? 98.903  120.126 -112.627 1.00 21.22  ? 358  ILE B CB    1 
ATOM   6158  C CG1   . ILE B  1 358 ? 100.098 119.309 -112.117 1.00 21.64  ? 358  ILE B CG1   1 
ATOM   6159  C CG2   . ILE B  1 358 ? 98.616  119.834 -114.157 1.00 20.13  ? 358  ILE B CG2   1 
ATOM   6160  C CD1   . ILE B  1 358 ? 99.999  117.785 -112.224 1.00 21.33  ? 358  ILE B CD1   1 
ATOM   6161  N N     . TYR B  1 359 ? 98.314  123.357 -113.884 1.00 22.77  ? 359  TYR B N     1 
ATOM   6162  C CA    . TYR B  1 359 ? 97.307  124.317 -114.306 1.00 23.31  ? 359  TYR B CA    1 
ATOM   6163  C C     . TYR B  1 359 ? 96.328  123.890 -115.375 1.00 24.58  ? 359  TYR B C     1 
ATOM   6164  O O     . TYR B  1 359 ? 95.809  124.708 -116.142 1.00 25.19  ? 359  TYR B O     1 
ATOM   6165  C CB    . TYR B  1 359 ? 97.969  125.658 -114.674 1.00 22.44  ? 359  TYR B CB    1 
ATOM   6166  C CG    . TYR B  1 359 ? 98.683  126.320 -113.519 1.00 21.68  ? 359  TYR B CG    1 
ATOM   6167  C CD1   . TYR B  1 359 ? 99.991  125.951 -113.176 1.00 23.31  ? 359  TYR B CD1   1 
ATOM   6168  C CD2   . TYR B  1 359 ? 98.046  127.301 -112.752 1.00 23.41  ? 359  TYR B CD2   1 
ATOM   6169  C CE1   . TYR B  1 359 ? 100.661 126.552 -112.089 1.00 23.05  ? 359  TYR B CE1   1 
ATOM   6170  C CE2   . TYR B  1 359 ? 98.692  127.905 -111.673 1.00 25.20  ? 359  TYR B CE2   1 
ATOM   6171  C CZ    . TYR B  1 359 ? 100.001 127.527 -111.345 1.00 27.04  ? 359  TYR B CZ    1 
ATOM   6172  O OH    . TYR B  1 359 ? 100.637 128.149 -110.278 1.00 30.08  ? 359  TYR B OH    1 
ATOM   6173  N N     . THR B  1 360 ? 96.047  122.597 -115.398 1.00 24.03  ? 360  THR B N     1 
ATOM   6174  C CA    . THR B  1 360 ? 95.051  122.088 -116.311 1.00 24.90  ? 360  THR B CA    1 
ATOM   6175  C C     . THR B  1 360 ? 93.704  122.507 -115.738 1.00 24.55  ? 360  THR B C     1 
ATOM   6176  O O     . THR B  1 360 ? 93.621  123.329 -114.801 1.00 24.00  ? 360  THR B O     1 
ATOM   6177  C CB    . THR B  1 360 ? 95.078  120.558 -116.338 1.00 25.56  ? 360  THR B CB    1 
ATOM   6178  O OG1   . THR B  1 360 ? 95.283  120.079 -114.995 1.00 25.36  ? 360  THR B OG1   1 
ATOM   6179  C CG2   . THR B  1 360 ? 96.208  120.053 -117.253 1.00 25.26  ? 360  THR B CG2   1 
ATOM   6180  N N     . HIS B  1 361 ? 92.654  121.924 -116.306 1.00 23.74  ? 361  HIS B N     1 
ATOM   6181  C CA    . HIS B  1 361 ? 91.298  122.139 -115.843 1.00 24.86  ? 361  HIS B CA    1 
ATOM   6182  C C     . HIS B  1 361 ? 90.611  120.782 -115.858 1.00 25.22  ? 361  HIS B C     1 
ATOM   6183  O O     . HIS B  1 361 ? 90.298  120.254 -116.907 1.00 25.28  ? 361  HIS B O     1 
ATOM   6184  C CB    . HIS B  1 361 ? 90.519  123.070 -116.738 1.00 27.28  ? 361  HIS B CB    1 
ATOM   6185  C CG    . HIS B  1 361 ? 89.241  123.514 -116.115 1.00 29.99  ? 361  HIS B CG    1 
ATOM   6186  N ND1   . HIS B  1 361 ? 89.172  124.597 -115.264 1.00 29.21  ? 361  HIS B ND1   1 
ATOM   6187  C CD2   . HIS B  1 361 ? 88.021  122.933 -116.089 1.00 31.37  ? 361  HIS B CD2   1 
ATOM   6188  C CE1   . HIS B  1 361 ? 87.962  124.659 -114.737 1.00 31.33  ? 361  HIS B CE1   1 
ATOM   6189  N NE2   . HIS B  1 361 ? 87.244  123.660 -115.219 1.00 33.50  ? 361  HIS B NE2   1 
ATOM   6190  N N     . PRO B  1 362 ? 90.341  120.209 -114.684 1.00 26.42  ? 362  PRO B N     1 
ATOM   6191  C CA    . PRO B  1 362 ? 90.629  120.748 -113.351 1.00 24.74  ? 362  PRO B CA    1 
ATOM   6192  C C     . PRO B  1 362 ? 92.108  120.922 -113.044 1.00 23.48  ? 362  PRO B C     1 
ATOM   6193  O O     . PRO B  1 362 ? 92.946  120.241 -113.621 1.00 23.67  ? 362  PRO B O     1 
ATOM   6194  C CB    . PRO B  1 362 ? 89.992  119.710 -112.428 1.00 23.67  ? 362  PRO B CB    1 
ATOM   6195  C CG    . PRO B  1 362 ? 90.311  118.432 -113.130 1.00 25.08  ? 362  PRO B CG    1 
ATOM   6196  C CD    . PRO B  1 362 ? 89.969  118.781 -114.602 1.00 23.24  ? 362  PRO B CD    1 
ATOM   6197  N N     . GLU B  1 363 ? 92.413  121.837 -112.125 1.00 23.30  ? 363  GLU B N     1 
ATOM   6198  C CA    . GLU B  1 363 ? 93.785  122.059 -111.691 1.00 24.38  ? 363  GLU B CA    1 
ATOM   6199  C C     . GLU B  1 363 ? 94.092  120.976 -110.677 1.00 22.34  ? 363  GLU B C     1 
ATOM   6200  O O     . GLU B  1 363 ? 93.204  120.316 -110.169 1.00 24.22  ? 363  GLU B O     1 
ATOM   6201  C CB    . GLU B  1 363 ? 93.950  123.426 -111.004 1.00 25.79  ? 363  GLU B CB    1 
ATOM   6202  C CG    . GLU B  1 363 ? 93.682  124.606 -111.910 1.00 28.77  ? 363  GLU B CG    1 
ATOM   6203  C CD    . GLU B  1 363 ? 93.822  125.933 -111.211 1.00 28.82  ? 363  GLU B CD    1 
ATOM   6204  O OE1   . GLU B  1 363 ? 93.829  125.944 -109.964 1.00 30.54  ? 363  GLU B OE1   1 
ATOM   6205  O OE2   . GLU B  1 363 ? 93.917  126.971 -111.910 1.00 30.28  ? 363  GLU B OE2   1 
ATOM   6206  N N     . VAL B  1 364 ? 95.363  120.790 -110.402 1.00 22.27  ? 364  VAL B N     1 
ATOM   6207  C CA    . VAL B  1 364 ? 95.785  119.809 -109.408 1.00 23.00  ? 364  VAL B CA    1 
ATOM   6208  C C     . VAL B  1 364 ? 96.835  120.559 -108.582 1.00 23.15  ? 364  VAL B C     1 
ATOM   6209  O O     . VAL B  1 364 ? 97.599  121.334 -109.141 1.00 23.47  ? 364  VAL B O     1 
ATOM   6210  C CB    . VAL B  1 364 ? 96.458  118.567 -110.054 1.00 22.63  ? 364  VAL B CB    1 
ATOM   6211  C CG1   . VAL B  1 364 ? 96.676  117.485 -108.994 1.00 19.87  ? 364  VAL B CG1   1 
ATOM   6212  C CG2   . VAL B  1 364 ? 95.587  118.036 -111.211 1.00 21.67  ? 364  VAL B CG2   1 
ATOM   6213  N N     . ALA B  1 365 ? 96.865  120.348 -107.267 1.00 21.14  ? 365  ALA B N     1 
ATOM   6214  C CA    . ALA B  1 365 ? 97.852  121.027 -106.448 1.00 19.40  ? 365  ALA B CA    1 
ATOM   6215  C C     . ALA B  1 365 ? 98.085  120.261 -105.163 1.00 21.03  ? 365  ALA B C     1 
ATOM   6216  O O     . ALA B  1 365 ? 97.170  119.640 -104.635 1.00 19.12  ? 365  ALA B O     1 
ATOM   6217  C CB    . ALA B  1 365 ? 97.386  122.456 -106.139 1.00 15.05  ? 365  ALA B CB    1 
ATOM   6218  N N     . TRP B  1 366 ? 99.323  120.286 -104.670 1.00 22.28  ? 366  TRP B N     1 
ATOM   6219  C CA    . TRP B  1 366 ? 99.623  119.589 -103.436 1.00 21.32  ? 366  TRP B CA    1 
ATOM   6220  C C     . TRP B  1 366 ? 100.870 120.119 -102.739 1.00 21.02  ? 366  TRP B C     1 
ATOM   6221  O O     . TRP B  1 366 ? 101.737 120.770 -103.329 1.00 19.38  ? 366  TRP B O     1 
ATOM   6222  C CB    . TRP B  1 366 ? 99.762  118.074 -103.681 1.00 19.00  ? 366  TRP B CB    1 
ATOM   6223  C CG    . TRP B  1 366 ? 100.980 117.678 -104.489 1.00 20.67  ? 366  TRP B CG    1 
ATOM   6224  C CD1   . TRP B  1 366 ? 102.207 117.327 -104.007 1.00 19.08  ? 366  TRP B CD1   1 
ATOM   6225  C CD2   . TRP B  1 366 ? 101.062 117.569 -105.918 1.00 18.68  ? 366  TRP B CD2   1 
ATOM   6226  N NE1   . TRP B  1 366 ? 103.051 116.995 -105.048 1.00 19.45  ? 366  TRP B NE1   1 
ATOM   6227  C CE2   . TRP B  1 366 ? 102.373 117.132 -106.231 1.00 20.08  ? 366  TRP B CE2   1 
ATOM   6228  C CE3   . TRP B  1 366 ? 100.157 117.785 -106.952 1.00 20.21  ? 366  TRP B CE3   1 
ATOM   6229  C CZ2   . TRP B  1 366 ? 102.803 116.912 -107.552 1.00 21.40  ? 366  TRP B CZ2   1 
ATOM   6230  C CZ3   . TRP B  1 366 ? 100.577 117.567 -108.277 1.00 21.65  ? 366  TRP B CZ3   1 
ATOM   6231  C CH2   . TRP B  1 366 ? 101.890 117.132 -108.557 1.00 18.70  ? 366  TRP B CH2   1 
ATOM   6232  N N     . VAL B  1 367 ? 100.940 119.811 -101.449 1.00 21.32  ? 367  VAL B N     1 
ATOM   6233  C CA    . VAL B  1 367 ? 102.069 120.203 -100.647 1.00 19.76  ? 367  VAL B CA    1 
ATOM   6234  C C     . VAL B  1 367 ? 102.128 119.171 -99.520  1.00 20.81  ? 367  VAL B C     1 
ATOM   6235  O O     . VAL B  1 367 ? 101.092 118.638 -99.080  1.00 19.62  ? 367  VAL B O     1 
ATOM   6236  C CB    . VAL B  1 367 ? 101.883 121.656 -100.125 1.00 21.40  ? 367  VAL B CB    1 
ATOM   6237  C CG1   . VAL B  1 367 ? 100.767 121.689 -99.089  1.00 18.35  ? 367  VAL B CG1   1 
ATOM   6238  C CG2   . VAL B  1 367 ? 103.212 122.218 -99.570  1.00 18.30  ? 367  VAL B CG2   1 
ATOM   6239  N N     . GLY B  1 368 ? 103.343 118.859 -99.088  1.00 19.70  ? 368  GLY B N     1 
ATOM   6240  C CA    . GLY B  1 368 ? 103.507 117.885 -98.035  1.00 22.24  ? 368  GLY B CA    1 
ATOM   6241  C C     . GLY B  1 368 ? 103.636 116.483 -98.631  1.00 23.61  ? 368  GLY B C     1 
ATOM   6242  O O     . GLY B  1 368 ? 104.054 116.316 -99.778  1.00 24.07  ? 368  GLY B O     1 
ATOM   6243  N N     . LYS B  1 369 ? 103.220 115.477 -97.871  1.00 23.22  ? 369  LYS B N     1 
ATOM   6244  C CA    . LYS B  1 369 ? 103.361 114.089 -98.307  1.00 23.03  ? 369  LYS B CA    1 
ATOM   6245  C C     . LYS B  1 369 ? 102.164 113.453 -98.953  1.00 21.73  ? 369  LYS B C     1 
ATOM   6246  O O     . LYS B  1 369 ? 101.020 113.781 -98.647  1.00 21.72  ? 369  LYS B O     1 
ATOM   6247  C CB    . LYS B  1 369 ? 103.766 113.201 -97.114  1.00 22.06  ? 369  LYS B CB    1 
ATOM   6248  C CG    . LYS B  1 369 ? 104.953 113.708 -96.289  1.00 24.82  ? 369  LYS B CG    1 
ATOM   6249  C CD    . LYS B  1 369 ? 106.275 113.380 -96.940  1.00 27.07  ? 369  LYS B CD    1 
ATOM   6250  C CE    . LYS B  1 369 ? 107.483 113.912 -96.107  1.00 29.26  ? 369  LYS B CE    1 
ATOM   6251  N NZ    . LYS B  1 369 ? 107.514 113.345 -94.715  1.00 30.03  ? 369  LYS B NZ    1 
ATOM   6252  N N     . SER B  1 370 ? 102.450 112.504 -99.835  1.00 20.25  ? 370  SER B N     1 
ATOM   6253  C CA    . SER B  1 370 ? 101.407 111.727 -100.493 1.00 19.74  ? 370  SER B CA    1 
ATOM   6254  C C     . SER B  1 370 ? 101.191 110.498 -99.598  1.00 19.96  ? 370  SER B C     1 
ATOM   6255  O O     . SER B  1 370 ? 101.990 110.247 -98.693  1.00 20.24  ? 370  SER B O     1 
ATOM   6256  C CB    . SER B  1 370 ? 101.896 111.239 -101.861 1.00 20.79  ? 370  SER B CB    1 
ATOM   6257  O OG    . SER B  1 370 ? 102.976 110.335 -101.695 1.00 18.23  ? 370  SER B OG    1 
ATOM   6258  N N     . GLU B  1 371 ? 100.132 109.733 -99.838  1.00 19.43  ? 371  GLU B N     1 
ATOM   6259  C CA    . GLU B  1 371 ? 99.926  108.526 -99.047  1.00 21.18  ? 371  GLU B CA    1 
ATOM   6260  C C     . GLU B  1 371 ? 101.051 107.502 -99.259  1.00 21.35  ? 371  GLU B C     1 
ATOM   6261  O O     . GLU B  1 371 ? 101.408 106.775 -98.325  1.00 21.30  ? 371  GLU B O     1 
ATOM   6262  C CB    . GLU B  1 371 ? 98.618  107.834 -99.401  1.00 22.75  ? 371  GLU B CB    1 
ATOM   6263  C CG    . GLU B  1 371 ? 97.443  108.403 -98.734  1.00 26.48  ? 371  GLU B CG    1 
ATOM   6264  C CD    . GLU B  1 371 ? 96.260  107.444 -98.733  1.00 24.45  ? 371  GLU B CD    1 
ATOM   6265  O OE1   . GLU B  1 371 ? 96.307  106.381 -98.086  1.00 24.74  ? 371  GLU B OE1   1 
ATOM   6266  O OE2   . GLU B  1 371 ? 95.276  107.770 -99.397  1.00 26.24  ? 371  GLU B OE2   1 
ATOM   6267  N N     . GLU B  1 372 ? 101.598 107.432 -100.474 1.00 20.34  ? 372  GLU B N     1 
ATOM   6268  C CA    . GLU B  1 372 ? 102.664 106.470 -100.736 1.00 22.26  ? 372  GLU B CA    1 
ATOM   6269  C C     . GLU B  1 372 ? 103.849 106.807 -99.843  1.00 23.81  ? 372  GLU B C     1 
ATOM   6270  O O     . GLU B  1 372 ? 104.466 105.919 -99.258  1.00 22.32  ? 372  GLU B O     1 
ATOM   6271  C CB    . GLU B  1 372 ? 103.090 106.470 -102.228 1.00 22.99  ? 372  GLU B CB    1 
ATOM   6272  C CG    . GLU B  1 372 ? 101.988 105.896 -103.175 1.00 24.79  ? 372  GLU B CG    1 
ATOM   6273  C CD    . GLU B  1 372 ? 100.657 106.710 -103.189 1.00 23.97  ? 372  GLU B CD    1 
ATOM   6274  O OE1   . GLU B  1 372 ? 100.694 107.952 -103.393 1.00 23.66  ? 372  GLU B OE1   1 
ATOM   6275  O OE2   . GLU B  1 372 ? 99.567  106.107 -103.017 1.00 23.30  ? 372  GLU B OE2   1 
ATOM   6276  N N     . GLN B  1 373 ? 104.150 108.100 -99.724  1.00 23.02  ? 373  GLN B N     1 
ATOM   6277  C CA    . GLN B  1 373 ? 105.255 108.535 -98.890  1.00 22.68  ? 373  GLN B CA    1 
ATOM   6278  C C     . GLN B  1 373 ? 105.038 108.173 -97.429  1.00 23.45  ? 373  GLN B C     1 
ATOM   6279  O O     . GLN B  1 373 ? 105.951 107.674 -96.770  1.00 22.50  ? 373  GLN B O     1 
ATOM   6280  C CB    . GLN B  1 373 ? 105.456 110.052 -99.001  1.00 24.76  ? 373  GLN B CB    1 
ATOM   6281  C CG    . GLN B  1 373 ? 106.096 110.478 -100.293 1.00 25.85  ? 373  GLN B CG    1 
ATOM   6282  C CD    . GLN B  1 373 ? 106.239 111.989 -100.396 1.00 26.23  ? 373  GLN B CD    1 
ATOM   6283  O OE1   . GLN B  1 373 ? 105.269 112.698 -100.648 1.00 25.01  ? 373  GLN B OE1   1 
ATOM   6284  N NE2   . GLN B  1 373 ? 107.465 112.486 -100.185 1.00 27.37  ? 373  GLN B NE2   1 
ATOM   6285  N N     . LEU B  1 374 ? 103.837 108.412 -96.920  1.00 22.64  ? 374  LEU B N     1 
ATOM   6286  C CA    . LEU B  1 374 ? 103.574 108.091 -95.515  1.00 23.07  ? 374  LEU B CA    1 
ATOM   6287  C C     . LEU B  1 374 ? 103.625 106.576 -95.285  1.00 23.16  ? 374  LEU B C     1 
ATOM   6288  O O     . LEU B  1 374 ? 104.180 106.118 -94.286  1.00 23.02  ? 374  LEU B O     1 
ATOM   6289  C CB    . LEU B  1 374 ? 102.212 108.651 -95.089  1.00 18.31  ? 374  LEU B CB    1 
ATOM   6290  C CG    . LEU B  1 374 ? 102.086 110.181 -95.171  1.00 19.72  ? 374  LEU B CG    1 
ATOM   6291  C CD1   . LEU B  1 374 ? 100.626 110.585 -94.850  1.00 19.11  ? 374  LEU B CD1   1 
ATOM   6292  C CD2   . LEU B  1 374 ? 103.077 110.859 -94.171  1.00 19.21  ? 374  LEU B CD2   1 
ATOM   6293  N N     . LYS B  1 375 ? 103.029 105.790 -96.184  1.00 22.87  ? 375  LYS B N     1 
ATOM   6294  C CA    . LYS B  1 375 ? 103.100 104.328 -95.998  1.00 24.07  ? 375  LYS B CA    1 
ATOM   6295  C C     . LYS B  1 375 ? 104.560 103.848 -96.052  1.00 24.49  ? 375  LYS B C     1 
ATOM   6296  O O     . LYS B  1 375 ? 104.987 102.965 -95.278  1.00 24.26  ? 375  LYS B O     1 
ATOM   6297  C CB    . LYS B  1 375 ? 102.312 103.601 -97.071  1.00 21.41  ? 375  LYS B CB    1 
ATOM   6298  C CG    . LYS B  1 375 ? 100.823 103.671 -96.875  1.00 24.89  ? 375  LYS B CG    1 
ATOM   6299  C CD    . LYS B  1 375 ? 100.123 103.005 -98.063  1.00 28.35  ? 375  LYS B CD    1 
ATOM   6300  C CE    . LYS B  1 375 ? 98.635  102.897 -97.837  1.00 31.94  ? 375  LYS B CE    1 
ATOM   6301  N NZ    . LYS B  1 375 ? 98.024  102.074 -98.916  1.00 33.61  ? 375  LYS B NZ    1 
ATOM   6302  N N     . GLU B  1 376 ? 105.319 104.422 -96.974  1.00 23.75  ? 376  GLU B N     1 
ATOM   6303  C CA    . GLU B  1 376 ? 106.720 104.042 -97.098  1.00 27.24  ? 376  GLU B CA    1 
ATOM   6304  C C     . GLU B  1 376 ? 107.505 104.411 -95.826  1.00 26.46  ? 376  GLU B C     1 
ATOM   6305  O O     . GLU B  1 376 ? 108.483 103.755 -95.470  1.00 26.88  ? 376  GLU B O     1 
ATOM   6306  C CB    . GLU B  1 376 ? 107.328 104.723 -98.349  1.00 29.96  ? 376  GLU B CB    1 
ATOM   6307  C CG    . GLU B  1 376 ? 108.853 104.557 -98.545  1.00 38.66  ? 376  GLU B CG    1 
ATOM   6308  C CD    . GLU B  1 376 ? 109.349 103.083 -98.601  1.00 45.18  ? 376  GLU B CD    1 
ATOM   6309  O OE1   . GLU B  1 376 ? 108.625 102.198 -99.144  1.00 47.44  ? 376  GLU B OE1   1 
ATOM   6310  O OE2   . GLU B  1 376 ? 110.483 102.816 -98.106  1.00 45.58  ? 376  GLU B OE2   1 
ATOM   6311  N N     . GLU B  1 377 ? 107.057 105.447 -95.130  1.00 26.43  ? 377  GLU B N     1 
ATOM   6312  C CA    . GLU B  1 377 ? 107.739 105.912 -93.936  1.00 27.08  ? 377  GLU B CA    1 
ATOM   6313  C C     . GLU B  1 377 ? 107.194 105.286 -92.650  1.00 25.14  ? 377  GLU B C     1 
ATOM   6314  O O     . GLU B  1 377 ? 107.710 105.573 -91.578  1.00 23.87  ? 377  GLU B O     1 
ATOM   6315  C CB    . GLU B  1 377 ? 107.651 107.452 -93.855  1.00 29.37  ? 377  GLU B CB    1 
ATOM   6316  C CG    . GLU B  1 377 ? 108.428 108.177 -94.956  1.00 34.72  ? 377  GLU B CG    1 
ATOM   6317  C CD    . GLU B  1 377 ? 108.059 109.671 -95.090  1.00 38.80  ? 377  GLU B CD    1 
ATOM   6318  O OE1   . GLU B  1 377 ? 107.503 110.246 -94.134  1.00 40.56  ? 377  GLU B OE1   1 
ATOM   6319  O OE2   . GLU B  1 377 ? 108.340 110.272 -96.157  1.00 41.98  ? 377  GLU B OE2   1 
ATOM   6320  N N     . GLY B  1 378 ? 106.160 104.449 -92.770  1.00 23.95  ? 378  GLY B N     1 
ATOM   6321  C CA    . GLY B  1 378 ? 105.568 103.798 -91.610  1.00 21.64  ? 378  GLY B CA    1 
ATOM   6322  C C     . GLY B  1 378 ? 104.801 104.758 -90.716  1.00 22.46  ? 378  GLY B C     1 
ATOM   6323  O O     . GLY B  1 378 ? 104.637 104.514 -89.518  1.00 23.53  ? 378  GLY B O     1 
ATOM   6324  N N     . ILE B  1 379 ? 104.308 105.851 -91.287  1.00 22.58  ? 379  ILE B N     1 
ATOM   6325  C CA    . ILE B  1 379 ? 103.549 106.843 -90.517  1.00 22.92  ? 379  ILE B CA    1 
ATOM   6326  C C     . ILE B  1 379 ? 102.098 106.394 -90.298  1.00 24.59  ? 379  ILE B C     1 
ATOM   6327  O O     . ILE B  1 379 ? 101.424 105.924 -91.231  1.00 24.14  ? 379  ILE B O     1 
ATOM   6328  C CB    . ILE B  1 379 ? 103.467 108.189 -91.253  1.00 23.59  ? 379  ILE B CB    1 
ATOM   6329  C CG1   . ILE B  1 379 ? 104.863 108.696 -91.620  1.00 24.34  ? 379  ILE B CG1   1 
ATOM   6330  C CG2   . ILE B  1 379 ? 102.717 109.188 -90.400  1.00 23.14  ? 379  ILE B CG2   1 
ATOM   6331  C CD1   . ILE B  1 379 ? 105.751 109.002 -90.442  1.00 26.30  ? 379  ILE B CD1   1 
ATOM   6332  N N     . GLU B  1 380 ? 101.611 106.524 -89.075  1.00 24.20  ? 380  GLU B N     1 
ATOM   6333  C CA    . GLU B  1 380 ? 100.223 106.174 -88.810  1.00 26.41  ? 380  GLU B CA    1 
ATOM   6334  C C     . GLU B  1 380 ? 99.430  107.483 -89.081  1.00 25.52  ? 380  GLU B C     1 
ATOM   6335  O O     . GLU B  1 380 ? 99.593  108.489 -88.382  1.00 22.25  ? 380  GLU B O     1 
ATOM   6336  C CB    . GLU B  1 380 ? 100.082 105.692 -87.356  1.00 31.48  ? 380  GLU B CB    1 
ATOM   6337  C CG    . GLU B  1 380 ? 98.640  105.536 -86.861  1.00 39.78  ? 380  GLU B CG    1 
ATOM   6338  C CD    . GLU B  1 380 ? 98.105  104.105 -86.925  1.00 45.06  ? 380  GLU B CD    1 
ATOM   6339  O OE1   . GLU B  1 380 ? 97.816  103.594 -88.032  1.00 47.88  ? 380  GLU B OE1   1 
ATOM   6340  O OE2   . GLU B  1 380 ? 97.975  103.483 -85.845  1.00 50.07  ? 380  GLU B OE2   1 
ATOM   6341  N N     . TYR B  1 381 ? 98.591  107.474 -90.114  1.00 24.44  ? 381  TYR B N     1 
ATOM   6342  C CA    . TYR B  1 381 ? 97.852  108.675 -90.480  1.00 24.82  ? 381  TYR B CA    1 
ATOM   6343  C C     . TYR B  1 381 ? 96.374  108.449 -90.671  1.00 23.77  ? 381  TYR B C     1 
ATOM   6344  O O     . TYR B  1 381 ? 95.911  107.309 -90.711  1.00 22.91  ? 381  TYR B O     1 
ATOM   6345  C CB    . TYR B  1 381 ? 98.417  109.274 -91.782  1.00 24.54  ? 381  TYR B CB    1 
ATOM   6346  C CG    . TYR B  1 381 ? 98.288  108.332 -92.974  1.00 25.42  ? 381  TYR B CG    1 
ATOM   6347  C CD1   . TYR B  1 381 ? 99.214  107.296 -93.169  1.00 26.06  ? 381  TYR B CD1   1 
ATOM   6348  C CD2   . TYR B  1 381 ? 97.227  108.458 -93.878  1.00 24.21  ? 381  TYR B CD2   1 
ATOM   6349  C CE1   . TYR B  1 381 ? 99.088  106.391 -94.237  1.00 27.69  ? 381  TYR B CE1   1 
ATOM   6350  C CE2   . TYR B  1 381 ? 97.085  107.563 -94.959  1.00 27.75  ? 381  TYR B CE2   1 
ATOM   6351  C CZ    . TYR B  1 381 ? 98.019  106.529 -95.125  1.00 29.65  ? 381  TYR B CZ    1 
ATOM   6352  O OH    . TYR B  1 381 ? 97.855  105.612 -96.142  1.00 30.46  ? 381  TYR B OH    1 
ATOM   6353  N N     . LYS B  1 382 ? 95.668  109.572 -90.821  1.00 22.87  ? 382  LYS B N     1 
ATOM   6354  C CA    . LYS B  1 382 ? 94.222  109.650 -91.019  1.00 22.15  ? 382  LYS B CA    1 
ATOM   6355  C C     . LYS B  1 382 ? 93.954  110.316 -92.370  1.00 20.88  ? 382  LYS B C     1 
ATOM   6356  O O     . LYS B  1 382 ? 94.738  111.148 -92.823  1.00 19.77  ? 382  LYS B O     1 
ATOM   6357  C CB    . LYS B  1 382 ? 93.587  110.542 -89.952  1.00 25.07  ? 382  LYS B CB    1 
ATOM   6358  C CG    . LYS B  1 382 ? 93.897  110.152 -88.549  1.00 26.85  ? 382  LYS B CG    1 
ATOM   6359  C CD    . LYS B  1 382 ? 93.101  111.028 -87.586  1.00 28.98  ? 382  LYS B CD    1 
ATOM   6360  C CE    . LYS B  1 382 ? 93.573  112.487 -87.577  1.00 28.88  ? 382  LYS B CE    1 
ATOM   6361  N NZ    . LYS B  1 382 ? 92.785  113.276 -86.557  1.00 28.61  ? 382  LYS B NZ    1 
ATOM   6362  N N     . VAL B  1 383 ? 92.842  109.970 -93.006  1.00 21.17  ? 383  VAL B N     1 
ATOM   6363  C CA    . VAL B  1 383 ? 92.518  110.554 -94.298  1.00 19.94  ? 383  VAL B CA    1 
ATOM   6364  C C     . VAL B  1 383 ? 91.170  111.257 -94.251  1.00 19.89  ? 383  VAL B C     1 
ATOM   6365  O O     . VAL B  1 383 ? 90.212  110.733 -93.701  1.00 20.12  ? 383  VAL B O     1 
ATOM   6366  C CB    . VAL B  1 383 ? 92.419  109.488 -95.402  1.00 22.48  ? 383  VAL B CB    1 
ATOM   6367  C CG1   . VAL B  1 383 ? 92.175  110.170 -96.718  1.00 21.99  ? 383  VAL B CG1   1 
ATOM   6368  C CG2   . VAL B  1 383 ? 93.699  108.626 -95.464  1.00 20.70  ? 383  VAL B CG2   1 
ATOM   6369  N N     . GLY B  1 384 ? 91.095  112.445 -94.837  1.00 20.91  ? 384  GLY B N     1 
ATOM   6370  C CA    . GLY B  1 384 ? 89.844  113.192 -94.891  1.00 18.52  ? 384  GLY B CA    1 
ATOM   6371  C C     . GLY B  1 384 ? 89.645  113.537 -96.364  1.00 20.46  ? 384  GLY B C     1 
ATOM   6372  O O     . GLY B  1 384 ? 90.564  114.065 -97.011  1.00 17.83  ? 384  GLY B O     1 
ATOM   6373  N N     . LYS B  1 385 ? 88.471  113.224 -96.919  1.00 20.17  ? 385  LYS B N     1 
ATOM   6374  C CA    . LYS B  1 385 ? 88.221  113.549 -98.322  1.00 20.95  ? 385  LYS B CA    1 
ATOM   6375  C C     . LYS B  1 385 ? 86.928  114.316 -98.429  1.00 21.44  ? 385  LYS B C     1 
ATOM   6376  O O     . LYS B  1 385 ? 86.011  114.078 -97.663  1.00 23.35  ? 385  LYS B O     1 
ATOM   6377  C CB    . LYS B  1 385 ? 88.117  112.288 -99.161  1.00 21.78  ? 385  LYS B CB    1 
ATOM   6378  C CG    . LYS B  1 385 ? 89.370  111.415 -99.143  1.00 24.38  ? 385  LYS B CG    1 
ATOM   6379  C CD    . LYS B  1 385 ? 89.087  110.120 -99.903  1.00 25.62  ? 385  LYS B CD    1 
ATOM   6380  C CE    . LYS B  1 385 ? 90.217  109.116 -99.710  1.00 28.38  ? 385  LYS B CE    1 
ATOM   6381  N NZ    . LYS B  1 385 ? 90.090  107.948 -100.637 1.00 28.73  ? 385  LYS B NZ    1 
ATOM   6382  N N     . PHE B  1 386 ? 86.857  115.253 -99.372  1.00 20.03  ? 386  PHE B N     1 
ATOM   6383  C CA    . PHE B  1 386 ? 85.647  116.031 -99.567  1.00 19.50  ? 386  PHE B CA    1 
ATOM   6384  C C     . PHE B  1 386 ? 85.510  116.334 -101.046 1.00 19.57  ? 386  PHE B C     1 
ATOM   6385  O O     . PHE B  1 386 ? 86.353  117.014 -101.618 1.00 20.79  ? 386  PHE B O     1 
ATOM   6386  C CB    . PHE B  1 386 ? 85.684  117.338 -98.760  1.00 18.89  ? 386  PHE B CB    1 
ATOM   6387  C CG    . PHE B  1 386 ? 84.365  118.054 -98.747  1.00 17.04  ? 386  PHE B CG    1 
ATOM   6388  C CD1   . PHE B  1 386 ? 83.368  117.692 -97.843  1.00 19.31  ? 386  PHE B CD1   1 
ATOM   6389  C CD2   . PHE B  1 386 ? 84.083  119.028 -99.703  1.00 19.30  ? 386  PHE B CD2   1 
ATOM   6390  C CE1   . PHE B  1 386 ? 82.103  118.282 -97.884  1.00 18.90  ? 386  PHE B CE1   1 
ATOM   6391  C CE2   . PHE B  1 386 ? 82.829  119.628 -99.762  1.00 20.77  ? 386  PHE B CE2   1 
ATOM   6392  C CZ    . PHE B  1 386 ? 81.829  119.256 -98.846  1.00 20.24  ? 386  PHE B CZ    1 
ATOM   6393  N N     . PRO B  1 387 ? 84.416  115.866 -101.684 1.00 20.75  ? 387  PRO B N     1 
ATOM   6394  C CA    . PRO B  1 387 ? 84.210  116.095 -103.125 1.00 18.66  ? 387  PRO B CA    1 
ATOM   6395  C C     . PRO B  1 387 ? 83.737  117.517 -103.451 1.00 19.36  ? 387  PRO B C     1 
ATOM   6396  O O     . PRO B  1 387 ? 82.977  118.110 -102.698 1.00 18.36  ? 387  PRO B O     1 
ATOM   6397  C CB    . PRO B  1 387 ? 83.194  115.016 -103.491 1.00 19.53  ? 387  PRO B CB    1 
ATOM   6398  C CG    . PRO B  1 387 ? 82.266  115.038 -102.247 1.00 24.23  ? 387  PRO B CG    1 
ATOM   6399  C CD    . PRO B  1 387 ? 83.254  115.195 -101.057 1.00 20.28  ? 387  PRO B CD    1 
ATOM   6400  N N     . PHE B  1 388 ? 84.215  118.082 -104.559 1.00 20.76  ? 388  PHE B N     1 
ATOM   6401  C CA    . PHE B  1 388 ? 83.795  119.427 -104.898 1.00 21.80  ? 388  PHE B CA    1 
ATOM   6402  C C     . PHE B  1 388 ? 82.330  119.366 -105.323 1.00 23.28  ? 388  PHE B C     1 
ATOM   6403  O O     . PHE B  1 388 ? 81.668  120.386 -105.388 1.00 22.85  ? 388  PHE B O     1 
ATOM   6404  C CB    . PHE B  1 388 ? 84.659  120.010 -106.016 1.00 22.64  ? 388  PHE B CB    1 
ATOM   6405  C CG    . PHE B  1 388 ? 85.899  120.717 -105.517 1.00 23.95  ? 388  PHE B CG    1 
ATOM   6406  C CD1   . PHE B  1 388 ? 85.794  121.946 -104.858 1.00 23.59  ? 388  PHE B CD1   1 
ATOM   6407  C CD2   . PHE B  1 388 ? 87.158  120.147 -105.684 1.00 21.51  ? 388  PHE B CD2   1 
ATOM   6408  C CE1   . PHE B  1 388 ? 86.916  122.584 -104.377 1.00 25.26  ? 388  PHE B CE1   1 
ATOM   6409  C CE2   . PHE B  1 388 ? 88.284  120.778 -105.208 1.00 23.24  ? 388  PHE B CE2   1 
ATOM   6410  C CZ    . PHE B  1 388 ? 88.172  122.003 -104.551 1.00 24.05  ? 388  PHE B CZ    1 
ATOM   6411  N N     . ALA B  1 389 ? 81.826  118.163 -105.595 1.00 22.98  ? 389  ALA B N     1 
ATOM   6412  C CA    . ALA B  1 389 ? 80.422  118.021 -105.969 1.00 25.01  ? 389  ALA B CA    1 
ATOM   6413  C C     . ALA B  1 389 ? 79.519  118.447 -104.797 1.00 26.74  ? 389  ALA B C     1 
ATOM   6414  O O     . ALA B  1 389 ? 78.346  118.777 -104.997 1.00 26.06  ? 389  ALA B O     1 
ATOM   6415  C CB    . ALA B  1 389 ? 80.110  116.567 -106.381 1.00 26.92  ? 389  ALA B CB    1 
ATOM   6416  N N     . ALA B  1 390 ? 80.073  118.447 -103.579 1.00 26.24  ? 390  ALA B N     1 
ATOM   6417  C CA    . ALA B  1 390 ? 79.310  118.861 -102.401 1.00 23.65  ? 390  ALA B CA    1 
ATOM   6418  C C     . ALA B  1 390 ? 79.683  120.249 -101.933 1.00 24.35  ? 390  ALA B C     1 
ATOM   6419  O O     . ALA B  1 390 ? 79.249  120.681 -100.851 1.00 23.66  ? 390  ALA B O     1 
ATOM   6420  C CB    . ALA B  1 390 ? 79.506  117.879 -101.245 1.00 23.66  ? 390  ALA B CB    1 
ATOM   6421  N N     . ASN B  1 391 ? 80.518  120.934 -102.707 1.00 24.58  ? 391  ASN B N     1 
ATOM   6422  C CA    . ASN B  1 391 ? 80.903  122.293 -102.355 1.00 24.06  ? 391  ASN B CA    1 
ATOM   6423  C C     . ASN B  1 391 ? 79.948  123.320 -102.991 1.00 26.63  ? 391  ASN B C     1 
ATOM   6424  O O     . ASN B  1 391 ? 79.710  123.301 -104.201 1.00 25.69  ? 391  ASN B O     1 
ATOM   6425  C CB    . ASN B  1 391 ? 82.329  122.590 -102.803 1.00 23.24  ? 391  ASN B CB    1 
ATOM   6426  C CG    . ASN B  1 391 ? 82.717  124.058 -102.564 1.00 22.31  ? 391  ASN B CG    1 
ATOM   6427  O OD1   . ASN B  1 391 ? 82.682  124.857 -103.479 1.00 23.96  ? 391  ASN B OD1   1 
ATOM   6428  N ND2   . ASN B  1 391 ? 83.066  124.407 -101.323 1.00 21.83  ? 391  ASN B ND2   1 
ATOM   6429  N N     . SER B  1 392 ? 79.434  124.226 -102.165 1.00 27.16  ? 392  SER B N     1 
ATOM   6430  C CA    . SER B  1 392 ? 78.506  125.245 -102.610 1.00 29.41  ? 392  SER B CA    1 
ATOM   6431  C C     . SER B  1 392 ? 78.947  126.091 -103.781 1.00 29.23  ? 392  SER B C     1 
ATOM   6432  O O     . SER B  1 392 ? 78.174  126.279 -104.720 1.00 30.20  ? 392  SER B O     1 
ATOM   6433  C CB    . SER B  1 392 ? 78.139  126.167 -101.454 1.00 31.14  ? 392  SER B CB    1 
ATOM   6434  O OG    . SER B  1 392 ? 77.146  125.540 -100.675 1.00 37.02  ? 392  SER B OG    1 
ATOM   6435  N N     . ARG B  1 393 ? 80.174  126.592 -103.753 1.00 28.79  ? 393  ARG B N     1 
ATOM   6436  C CA    . ARG B  1 393 ? 80.607  127.446 -104.853 1.00 28.82  ? 393  ARG B CA    1 
ATOM   6437  C C     . ARG B  1 393 ? 80.843  126.688 -106.144 1.00 27.72  ? 393  ARG B C     1 
ATOM   6438  O O     . ARG B  1 393 ? 80.519  127.180 -107.225 1.00 26.50  ? 393  ARG B O     1 
ATOM   6439  C CB    . ARG B  1 393 ? 81.853  128.255 -104.486 1.00 28.01  ? 393  ARG B CB    1 
ATOM   6440  C CG    . ARG B  1 393 ? 82.005  129.451 -105.416 1.00 31.79  ? 393  ARG B CG    1 
ATOM   6441  C CD    . ARG B  1 393 ? 83.062  130.441 -104.955 1.00 34.78  ? 393  ARG B CD    1 
ATOM   6442  N NE    . ARG B  1 393 ? 83.134  131.596 -105.841 1.00 35.55  ? 393  ARG B NE    1 
ATOM   6443  C CZ    . ARG B  1 393 ? 84.052  132.555 -105.755 1.00 38.54  ? 393  ARG B CZ    1 
ATOM   6444  N NH1   . ARG B  1 393 ? 84.986  132.522 -104.810 1.00 38.03  ? 393  ARG B NH1   1 
ATOM   6445  N NH2   . ARG B  1 393 ? 84.068  133.530 -106.649 1.00 37.05  ? 393  ARG B NH2   1 
ATOM   6446  N N     . ALA B  1 394 ? 81.377  125.475 -106.023 1.00 26.74  ? 394  ALA B N     1 
ATOM   6447  C CA    . ALA B  1 394 ? 81.642  124.638 -107.178 1.00 25.30  ? 394  ALA B CA    1 
ATOM   6448  C C     . ALA B  1 394 ? 80.299  124.253 -107.824 1.00 26.25  ? 394  ALA B C     1 
ATOM   6449  O O     . ALA B  1 394 ? 80.111  124.324 -109.057 1.00 25.77  ? 394  ALA B O     1 
ATOM   6450  C CB    . ALA B  1 394 ? 82.418  123.373 -106.738 1.00 22.47  ? 394  ALA B CB    1 
ATOM   6451  N N     . LYS B  1 395 ? 79.351  123.859 -106.989 1.00 27.38  ? 395  LYS B N     1 
ATOM   6452  C CA    . LYS B  1 395 ? 78.051  123.468 -107.519 1.00 29.78  ? 395  LYS B CA    1 
ATOM   6453  C C     . LYS B  1 395 ? 77.346  124.679 -108.165 1.00 30.92  ? 395  LYS B C     1 
ATOM   6454  O O     . LYS B  1 395 ? 76.730  124.563 -109.217 1.00 30.94  ? 395  LYS B O     1 
ATOM   6455  C CB    . LYS B  1 395 ? 77.177  122.881 -106.410 1.00 29.57  ? 395  LYS B CB    1 
ATOM   6456  C CG    . LYS B  1 395 ? 75.933  122.143 -106.912 1.00 33.17  ? 395  LYS B CG    1 
ATOM   6457  C CD    . LYS B  1 395 ? 76.324  120.968 -107.801 1.00 34.02  ? 395  LYS B CD    1 
ATOM   6458  C CE    . LYS B  1 395 ? 75.111  120.186 -108.265 1.00 37.29  ? 395  LYS B CE    1 
ATOM   6459  N NZ    . LYS B  1 395 ? 75.428  119.205 -109.337 1.00 38.06  ? 395  LYS B NZ    1 
ATOM   6460  N N     . THR B  1 396 ? 77.446  125.838 -107.531 1.00 32.15  ? 396  THR B N     1 
ATOM   6461  C CA    . THR B  1 396 ? 76.814  127.017 -108.074 1.00 36.10  ? 396  THR B CA    1 
ATOM   6462  C C     . THR B  1 396 ? 77.413  127.382 -109.431 1.00 36.17  ? 396  THR B C     1 
ATOM   6463  O O     . THR B  1 396 ? 76.689  127.781 -110.345 1.00 36.99  ? 396  THR B O     1 
ATOM   6464  C CB    . THR B  1 396 ? 76.956  128.210 -107.133 1.00 36.73  ? 396  THR B CB    1 
ATOM   6465  O OG1   . THR B  1 396 ? 76.433  127.864 -105.846 1.00 38.61  ? 396  THR B OG1   1 
ATOM   6466  C CG2   . THR B  1 396 ? 76.169  129.393 -107.678 1.00 38.95  ? 396  THR B CG2   1 
ATOM   6467  N N     . ASN B  1 397 ? 78.733  127.243 -109.548 1.00 36.36  ? 397  ASN B N     1 
ATOM   6468  C CA    . ASN B  1 397 ? 79.461  127.552 -110.780 1.00 36.21  ? 397  ASN B CA    1 
ATOM   6469  C C     . ASN B  1 397 ? 79.285  126.432 -111.798 1.00 33.96  ? 397  ASN B C     1 
ATOM   6470  O O     . ASN B  1 397 ? 79.756  126.537 -112.921 1.00 33.11  ? 397  ASN B O     1 
ATOM   6471  C CB    . ASN B  1 397 ? 80.980  127.718 -110.504 1.00 38.01  ? 397  ASN B CB    1 
ATOM   6472  C CG    . ASN B  1 397 ? 81.332  129.011 -109.735 1.00 42.23  ? 397  ASN B CG    1 
ATOM   6473  O OD1   . ASN B  1 397 ? 80.600  130.010 -109.796 1.00 44.13  ? 397  ASN B OD1   1 
ATOM   6474  N ND2   . ASN B  1 397 ? 82.480  129.001 -109.038 1.00 43.73  ? 397  ASN B ND2   1 
ATOM   6475  N N     . ALA B  1 398 ? 78.623  125.354 -111.391 1.00 34.00  ? 398  ALA B N     1 
ATOM   6476  C CA    . ALA B  1 398 ? 78.438  124.180 -112.246 1.00 34.50  ? 398  ALA B CA    1 
ATOM   6477  C C     . ALA B  1 398 ? 79.784  123.690 -112.767 1.00 34.67  ? 398  ALA B C     1 
ATOM   6478  O O     . ALA B  1 398 ? 79.959  123.463 -113.971 1.00 35.45  ? 398  ALA B O     1 
ATOM   6479  C CB    . ALA B  1 398 ? 77.508  124.510 -113.430 1.00 34.13  ? 398  ALA B CB    1 
ATOM   6480  N N     . ASP B  1 399 ? 80.733  123.528 -111.851 1.00 35.10  ? 399  ASP B N     1 
ATOM   6481  C CA    . ASP B  1 399 ? 82.101  123.070 -112.171 1.00 35.87  ? 399  ASP B CA    1 
ATOM   6482  C C     . ASP B  1 399 ? 82.477  122.299 -110.921 1.00 35.69  ? 399  ASP B C     1 
ATOM   6483  O O     . ASP B  1 399 ? 83.066  122.854 -109.993 1.00 35.13  ? 399  ASP B O     1 
ATOM   6484  C CB    . ASP B  1 399 ? 83.014  124.287 -112.357 1.00 38.16  ? 399  ASP B CB    1 
ATOM   6485  C CG    . ASP B  1 399 ? 84.484  123.920 -112.627 1.00 40.39  ? 399  ASP B CG    1 
ATOM   6486  O OD1   . ASP B  1 399 ? 84.817  122.733 -112.866 1.00 41.38  ? 399  ASP B OD1   1 
ATOM   6487  O OD2   . ASP B  1 399 ? 85.312  124.862 -112.600 1.00 42.64  ? 399  ASP B OD2   1 
ATOM   6488  N N     . THR B  1 400 ? 82.139  121.012 -110.924 1.00 35.17  ? 400  THR B N     1 
ATOM   6489  C CA    . THR B  1 400 ? 82.314  120.159 -109.765 1.00 34.37  ? 400  THR B CA    1 
ATOM   6490  C C     . THR B  1 400 ? 83.265  118.954 -109.788 1.00 33.90  ? 400  THR B C     1 
ATOM   6491  O O     . THR B  1 400 ? 83.169  118.112 -108.912 1.00 32.91  ? 400  THR B O     1 
ATOM   6492  C CB    . THR B  1 400 ? 80.928  119.626 -109.349 1.00 35.46  ? 400  THR B CB    1 
ATOM   6493  O OG1   . THR B  1 400 ? 80.375  118.883 -110.447 1.00 36.24  ? 400  THR B OG1   1 
ATOM   6494  C CG2   . THR B  1 400 ? 79.966  120.780 -108.994 1.00 32.84  ? 400  THR B CG2   1 
ATOM   6495  N N     . ASP B  1 401 ? 84.160  118.841 -110.761 1.00 33.78  ? 401  ASP B N     1 
ATOM   6496  C CA    . ASP B  1 401 ? 85.065  117.689 -110.774 1.00 33.84  ? 401  ASP B CA    1 
ATOM   6497  C C     . ASP B  1 401 ? 86.005  117.671 -109.560 1.00 31.65  ? 401  ASP B C     1 
ATOM   6498  O O     . ASP B  1 401 ? 86.419  118.720 -109.076 1.00 30.05  ? 401  ASP B O     1 
ATOM   6499  C CB    . ASP B  1 401 ? 86.028  117.709 -111.964 1.00 38.45  ? 401  ASP B CB    1 
ATOM   6500  C CG    . ASP B  1 401 ? 85.345  117.705 -113.295 1.00 42.14  ? 401  ASP B CG    1 
ATOM   6501  O OD1   . ASP B  1 401 ? 84.305  117.030 -113.433 1.00 44.43  ? 401  ASP B OD1   1 
ATOM   6502  O OD2   . ASP B  1 401 ? 85.896  118.375 -114.205 1.00 44.11  ? 401  ASP B OD2   1 
ATOM   6503  N N     . GLY B  1 402 ? 86.345  116.477 -109.103 1.00 28.11  ? 402  GLY B N     1 
ATOM   6504  C CA    . GLY B  1 402 ? 87.347  116.338 -108.063 1.00 27.06  ? 402  GLY B CA    1 
ATOM   6505  C C     . GLY B  1 402 ? 87.068  116.397 -106.586 1.00 25.16  ? 402  GLY B C     1 
ATOM   6506  O O     . GLY B  1 402 ? 85.934  116.398 -106.139 1.00 23.24  ? 402  GLY B O     1 
ATOM   6507  N N     . MET B  1 403 ? 88.148  116.501 -105.820 1.00 24.72  ? 403  MET B N     1 
ATOM   6508  C CA    . MET B  1 403 ? 88.030  116.526 -104.371 1.00 24.00  ? 403  MET B CA    1 
ATOM   6509  C C     . MET B  1 403 ? 89.259  117.105 -103.705 1.00 22.72  ? 403  MET B C     1 
ATOM   6510  O O     . MET B  1 403 ? 90.301  117.334 -104.342 1.00 21.22  ? 403  MET B O     1 
ATOM   6511  C CB    . MET B  1 403 ? 87.899  115.079 -103.857 1.00 26.13  ? 403  MET B CB    1 
ATOM   6512  C CG    . MET B  1 403 ? 89.114  114.220 -104.240 1.00 29.28  ? 403  MET B CG    1 
ATOM   6513  S SD    . MET B  1 403 ? 89.310  112.676 -103.307 1.00 33.36  ? 403  MET B SD    1 
ATOM   6514  C CE    . MET B  1 403 ? 90.697  111.957 -104.104 1.00 33.35  ? 403  MET B CE    1 
ATOM   6515  N N     . VAL B  1 404 ? 89.132  117.290 -102.395 1.00 19.98  ? 404  VAL B N     1 
ATOM   6516  C CA    . VAL B  1 404 ? 90.248  117.710 -101.577 1.00 18.70  ? 404  VAL B CA    1 
ATOM   6517  C C     . VAL B  1 404 ? 90.524  116.489 -100.675 1.00 19.93  ? 404  VAL B C     1 
ATOM   6518  O O     . VAL B  1 404 ? 89.614  115.919 -100.088 1.00 19.02  ? 404  VAL B O     1 
ATOM   6519  C CB    . VAL B  1 404 ? 89.912  118.908 -100.684 1.00 17.25  ? 404  VAL B CB    1 
ATOM   6520  C CG1   . VAL B  1 404 ? 91.014  119.094 -99.666  1.00 19.25  ? 404  VAL B CG1   1 
ATOM   6521  C CG2   . VAL B  1 404 ? 89.795  120.156 -101.499 1.00 17.57  ? 404  VAL B CG2   1 
ATOM   6522  N N     . LYS B  1 405 ? 91.798  116.081 -100.582 1.00 21.74  ? 405  LYS B N     1 
ATOM   6523  C CA    . LYS B  1 405 ? 92.207  114.970 -99.733  1.00 20.33  ? 405  LYS B CA    1 
ATOM   6524  C C     . LYS B  1 405 ? 93.271  115.459 -98.736  1.00 20.80  ? 405  LYS B C     1 
ATOM   6525  O O     . LYS B  1 405 ? 94.302  115.995 -99.129  1.00 19.86  ? 405  LYS B O     1 
ATOM   6526  C CB    . LYS B  1 405 ? 92.780  113.818 -100.574 1.00 20.25  ? 405  LYS B CB    1 
ATOM   6527  C CG    . LYS B  1 405 ? 93.424  112.709 -99.731  1.00 22.69  ? 405  LYS B CG    1 
ATOM   6528  C CD    . LYS B  1 405 ? 93.568  111.396 -100.515 1.00 24.25  ? 405  LYS B CD    1 
ATOM   6529  C CE    . LYS B  1 405 ? 94.975  111.035 -100.766 1.00 25.42  ? 405  LYS B CE    1 
ATOM   6530  N NZ    . LYS B  1 405 ? 95.019  109.618 -101.261 1.00 26.06  ? 405  LYS B NZ    1 
ATOM   6531  N N     . ILE B  1 406 ? 93.007  115.269 -97.446  1.00 20.36  ? 406  ILE B N     1 
ATOM   6532  C CA    . ILE B  1 406 ? 93.915  115.681 -96.370  1.00 18.27  ? 406  ILE B CA    1 
ATOM   6533  C C     . ILE B  1 406 ? 94.429  114.435 -95.642  1.00 18.99  ? 406  ILE B C     1 
ATOM   6534  O O     . ILE B  1 406 ? 93.651  113.512 -95.333  1.00 18.98  ? 406  ILE B O     1 
ATOM   6535  C CB    . ILE B  1 406 ? 93.155  116.536 -95.357  1.00 16.58  ? 406  ILE B CB    1 
ATOM   6536  C CG1   . ILE B  1 406 ? 92.603  117.782 -96.061  1.00 14.16  ? 406  ILE B CG1   1 
ATOM   6537  C CG2   . ILE B  1 406 ? 94.017  116.812 -94.135  1.00 15.51  ? 406  ILE B CG2   1 
ATOM   6538  C CD1   . ILE B  1 406 ? 93.677  118.779 -96.553  1.00 15.29  ? 406  ILE B CD1   1 
ATOM   6539  N N     . LEU B  1 407 ? 95.746  114.420 -95.412  1.00 17.10  ? 407  LEU B N     1 
ATOM   6540  C CA    . LEU B  1 407 ? 96.448  113.359 -94.681  1.00 16.55  ? 407  LEU B CA    1 
ATOM   6541  C C     . LEU B  1 407 ? 96.885  113.999 -93.338  1.00 17.56  ? 407  LEU B C     1 
ATOM   6542  O O     . LEU B  1 407 ? 97.555  115.030 -93.307  1.00 18.17  ? 407  LEU B O     1 
ATOM   6543  C CB    . LEU B  1 407 ? 97.667  112.865 -95.503  1.00 14.33  ? 407  LEU B CB    1 
ATOM   6544  C CG    . LEU B  1 407 ? 97.279  112.445 -96.949  1.00 17.40  ? 407  LEU B CG    1 
ATOM   6545  C CD1   . LEU B  1 407 ? 98.431  111.950 -97.773  1.00 16.19  ? 407  LEU B CD1   1 
ATOM   6546  C CD2   . LEU B  1 407 ? 96.275  111.334 -96.828  1.00 15.30  ? 407  LEU B CD2   1 
ATOM   6547  N N     . GLY B  1 408 ? 96.449  113.416 -92.231  1.00 18.36  ? 408  GLY B N     1 
ATOM   6548  C CA    . GLY B  1 408 ? 96.802  113.946 -90.924  1.00 20.80  ? 408  GLY B CA    1 
ATOM   6549  C C     . GLY B  1 408 ? 97.469  112.893 -90.042  1.00 22.31  ? 408  GLY B C     1 
ATOM   6550  O O     . GLY B  1 408 ? 97.174  111.682 -90.153  1.00 21.66  ? 408  GLY B O     1 
ATOM   6551  N N     . GLN B  1 409 ? 98.375  113.339 -89.182  1.00 22.10  ? 409  GLN B N     1 
ATOM   6552  C CA    . GLN B  1 409 ? 99.050  112.412 -88.287  1.00 22.74  ? 409  GLN B CA    1 
ATOM   6553  C C     . GLN B  1 409 ? 98.046  111.931 -87.253  1.00 22.16  ? 409  GLN B C     1 
ATOM   6554  O O     . GLN B  1 409 ? 97.357  112.722 -86.627  1.00 22.07  ? 409  GLN B O     1 
ATOM   6555  C CB    . GLN B  1 409 ? 100.210 113.088 -87.601  1.00 24.24  ? 409  GLN B CB    1 
ATOM   6556  C CG    . GLN B  1 409 ? 101.148 112.132 -86.908  1.00 28.27  ? 409  GLN B CG    1 
ATOM   6557  C CD    . GLN B  1 409 ? 102.574 112.651 -86.982  1.00 34.50  ? 409  GLN B CD    1 
ATOM   6558  O OE1   . GLN B  1 409 ? 102.814 113.858 -86.836  1.00 35.50  ? 409  GLN B OE1   1 
ATOM   6559  N NE2   . GLN B  1 409 ? 103.527 111.754 -87.212  1.00 38.72  ? 409  GLN B NE2   1 
ATOM   6560  N N     . LYS B  1 410 ? 97.959  110.621 -87.087  1.00 22.06  ? 410  LYS B N     1 
ATOM   6561  C CA    . LYS B  1 410 ? 96.996  110.050 -86.154  1.00 25.93  ? 410  LYS B CA    1 
ATOM   6562  C C     . LYS B  1 410 ? 97.175  110.582 -84.720  1.00 25.58  ? 410  LYS B C     1 
ATOM   6563  O O     . LYS B  1 410 ? 96.214  110.995 -84.083  1.00 23.87  ? 410  LYS B O     1 
ATOM   6564  C CB    . LYS B  1 410 ? 97.111  108.512 -86.165  1.00 28.35  ? 410  LYS B CB    1 
ATOM   6565  C CG    . LYS B  1 410 ? 96.162  107.775 -85.246  1.00 32.94  ? 410  LYS B CG    1 
ATOM   6566  C CD    . LYS B  1 410 ? 94.891  107.433 -85.983  1.00 40.63  ? 410  LYS B CD    1 
ATOM   6567  C CE    . LYS B  1 410 ? 95.154  106.502 -87.198  1.00 42.23  ? 410  LYS B CE    1 
ATOM   6568  N NZ    . LYS B  1 410 ? 93.916  106.282 -88.033  1.00 44.49  ? 410  LYS B NZ    1 
ATOM   6569  N N     . SER B  1 411 ? 98.410  110.580 -84.240  1.00 27.00  ? 411  SER B N     1 
ATOM   6570  C CA    . SER B  1 411 ? 98.731  111.005 -82.879  1.00 29.34  ? 411  SER B CA    1 
ATOM   6571  C C     . SER B  1 411 ? 98.536  112.463 -82.506  1.00 29.09  ? 411  SER B C     1 
ATOM   6572  O O     . SER B  1 411 ? 98.063  112.768 -81.412  1.00 32.25  ? 411  SER B O     1 
ATOM   6573  C CB    . SER B  1 411 ? 100.182 110.638 -82.556  1.00 30.91  ? 411  SER B CB    1 
ATOM   6574  O OG    . SER B  1 411 ? 101.060 111.258 -83.485  1.00 31.58  ? 411  SER B OG    1 
ATOM   6575  N N     . THR B  1 412 ? 98.889  113.365 -83.403  1.00 27.90  ? 412  THR B N     1 
ATOM   6576  C CA    . THR B  1 412 ? 98.810  114.794 -83.099  1.00 25.79  ? 412  THR B CA    1 
ATOM   6577  C C     . THR B  1 412 ? 97.825  115.605 -83.964  1.00 24.67  ? 412  THR B C     1 
ATOM   6578  O O     . THR B  1 412 ? 97.649  116.811 -83.739  1.00 23.21  ? 412  THR B O     1 
ATOM   6579  C CB    . THR B  1 412 ? 100.180 115.398 -83.309  1.00 27.88  ? 412  THR B CB    1 
ATOM   6580  O OG1   . THR B  1 412 ? 100.581 115.144 -84.667  1.00 24.37  ? 412  THR B OG1   1 
ATOM   6581  C CG2   . THR B  1 412 ? 101.214 114.769 -82.344  1.00 27.91  ? 412  THR B CG2   1 
ATOM   6582  N N     . ASP B  1 413 ? 97.218  114.942 -84.951  1.00 21.02  ? 413  ASP B N     1 
ATOM   6583  C CA    . ASP B  1 413 ? 96.282  115.568 -85.894  1.00 20.79  ? 413  ASP B CA    1 
ATOM   6584  C C     . ASP B  1 413 ? 96.988  116.599 -86.799  1.00 18.83  ? 413  ASP B C     1 
ATOM   6585  O O     . ASP B  1 413 ? 96.355  117.340 -87.533  1.00 17.94  ? 413  ASP B O     1 
ATOM   6586  C CB    . ASP B  1 413 ? 95.103  116.213 -85.140  1.00 20.59  ? 413  ASP B CB    1 
ATOM   6587  C CG    . ASP B  1 413 ? 93.935  116.563 -86.070  1.00 24.15  ? 413  ASP B CG    1 
ATOM   6588  O OD1   . ASP B  1 413 ? 93.628  115.760 -86.979  1.00 20.94  ? 413  ASP B OD1   1 
ATOM   6589  O OD2   . ASP B  1 413 ? 93.302  117.635 -85.889  1.00 23.73  ? 413  ASP B OD2   1 
ATOM   6590  N N     . ARG B  1 414 ? 98.308  116.653 -86.736  1.00 19.13  ? 414  ARG B N     1 
ATOM   6591  C CA    . ARG B  1 414 ? 99.042  117.560 -87.598  1.00 18.90  ? 414  ARG B CA    1 
ATOM   6592  C C     . ARG B  1 414 ? 98.812  117.260 -89.107  1.00 18.61  ? 414  ARG B C     1 
ATOM   6593  O O     . ARG B  1 414 ? 98.837  116.102 -89.551  1.00 19.91  ? 414  ARG B O     1 
ATOM   6594  C CB    . ARG B  1 414 ? 100.518 117.439 -87.303  1.00 22.81  ? 414  ARG B CB    1 
ATOM   6595  C CG    . ARG B  1 414 ? 101.400 118.321 -88.153  1.00 26.18  ? 414  ARG B CG    1 
ATOM   6596  C CD    . ARG B  1 414 ? 102.726 118.414 -87.426  1.00 31.15  ? 414  ARG B CD    1 
ATOM   6597  N NE    . ARG B  1 414 ? 103.670 119.278 -88.108  1.00 33.21  ? 414  ARG B NE    1 
ATOM   6598  C CZ    . ARG B  1 414 ? 104.850 119.621 -87.618  1.00 33.74  ? 414  ARG B CZ    1 
ATOM   6599  N NH1   . ARG B  1 414 ? 105.226 119.157 -86.430  1.00 35.52  ? 414  ARG B NH1   1 
ATOM   6600  N NH2   . ARG B  1 414 ? 105.645 120.442 -88.306  1.00 32.78  ? 414  ARG B NH2   1 
ATOM   6601  N N     . VAL B  1 415 ? 98.582  118.297 -89.889  1.00 16.86  ? 415  VAL B N     1 
ATOM   6602  C CA    . VAL B  1 415 ? 98.408  118.105 -91.323  1.00 17.19  ? 415  VAL B CA    1 
ATOM   6603  C C     . VAL B  1 415 ? 99.728  117.666 -91.922  1.00 19.36  ? 415  VAL B C     1 
ATOM   6604  O O     . VAL B  1 415 ? 100.718 118.388 -91.836  1.00 18.13  ? 415  VAL B O     1 
ATOM   6605  C CB    . VAL B  1 415 ? 98.012  119.394 -91.998  1.00 18.21  ? 415  VAL B CB    1 
ATOM   6606  C CG1   . VAL B  1 415 ? 97.908  119.157 -93.515  1.00 16.16  ? 415  VAL B CG1   1 
ATOM   6607  C CG2   . VAL B  1 415 ? 96.702  119.917 -91.373  1.00 14.22  ? 415  VAL B CG2   1 
ATOM   6608  N N     . LEU B  1 416 ? 99.753  116.481 -92.533  1.00 18.69  ? 416  LEU B N     1 
ATOM   6609  C CA    . LEU B  1 416 ? 100.986 115.999 -93.145  1.00 18.22  ? 416  LEU B CA    1 
ATOM   6610  C C     . LEU B  1 416 ? 100.988 116.177 -94.679  1.00 19.66  ? 416  LEU B C     1 
ATOM   6611  O O     . LEU B  1 416 ? 102.058 116.242 -95.306  1.00 19.55  ? 416  LEU B O     1 
ATOM   6612  C CB    . LEU B  1 416 ? 101.193 114.519 -92.800  1.00 19.38  ? 416  LEU B CB    1 
ATOM   6613  C CG    . LEU B  1 416 ? 101.276 114.117 -91.307  1.00 19.86  ? 416  LEU B CG    1 
ATOM   6614  C CD1   . LEU B  1 416 ? 101.374 112.558 -91.165  1.00 17.38  ? 416  LEU B CD1   1 
ATOM   6615  C CD2   . LEU B  1 416 ? 102.486 114.783 -90.647  1.00 19.78  ? 416  LEU B CD2   1 
ATOM   6616  N N     . GLY B  1 417 ? 99.803  116.270 -95.278  1.00 19.58  ? 417  GLY B N     1 
ATOM   6617  C CA    . GLY B  1 417 ? 99.747  116.398 -96.722  1.00 17.02  ? 417  GLY B CA    1 
ATOM   6618  C C     . GLY B  1 417 ? 98.416  116.930 -97.130  1.00 16.99  ? 417  GLY B C     1 
ATOM   6619  O O     . GLY B  1 417 ? 97.397  116.554 -96.555  1.00 17.67  ? 417  GLY B O     1 
ATOM   6620  N N     . ALA B  1 418 ? 98.430  117.833 -98.110  1.00 17.62  ? 418  ALA B N     1 
ATOM   6621  C CA    . ALA B  1 418 ? 97.208  118.390 -98.661  1.00 18.56  ? 418  ALA B CA    1 
ATOM   6622  C C     . ALA B  1 418 ? 97.224  118.164 -100.181 1.00 20.69  ? 418  ALA B C     1 
ATOM   6623  O O     . ALA B  1 418 ? 98.191  118.512 -100.850 1.00 19.98  ? 418  ALA B O     1 
ATOM   6624  C CB    . ALA B  1 418 ? 97.068  119.893 -98.310  1.00 18.60  ? 418  ALA B CB    1 
ATOM   6625  N N     . HIS B  1 419 ? 96.143  117.577 -100.715 1.00 21.49  ? 419  HIS B N     1 
ATOM   6626  C CA    . HIS B  1 419 ? 96.060  117.246 -102.146 1.00 19.60  ? 419  HIS B CA    1 
ATOM   6627  C C     . HIS B  1 419 ? 94.718  117.666 -102.704 1.00 20.84  ? 419  HIS B C     1 
ATOM   6628  O O     . HIS B  1 419 ? 93.669  117.229 -102.218 1.00 19.77  ? 419  HIS B O     1 
ATOM   6629  C CB    . HIS B  1 419 ? 96.234  115.735 -102.339 1.00 18.38  ? 419  HIS B CB    1 
ATOM   6630  C CG    . HIS B  1 419 ? 97.493  115.216 -101.748 1.00 16.70  ? 419  HIS B CG    1 
ATOM   6631  N ND1   . HIS B  1 419 ? 98.697  115.238 -102.424 1.00 18.36  ? 419  HIS B ND1   1 
ATOM   6632  C CD2   . HIS B  1 419 ? 97.762  114.754 -100.506 1.00 14.92  ? 419  HIS B CD2   1 
ATOM   6633  C CE1   . HIS B  1 419 ? 99.657  114.820 -101.619 1.00 19.07  ? 419  HIS B CE1   1 
ATOM   6634  N NE2   . HIS B  1 419 ? 99.116  114.521 -100.447 1.00 19.66  ? 419  HIS B NE2   1 
ATOM   6635  N N     . ILE B  1 420 ? 94.765  118.485 -103.756 1.00 20.47  ? 420  ILE B N     1 
ATOM   6636  C CA    . ILE B  1 420 ? 93.561  119.020 -104.370 1.00 21.41  ? 420  ILE B CA    1 
ATOM   6637  C C     . ILE B  1 420 ? 93.453  118.746 -105.874 1.00 21.70  ? 420  ILE B C     1 
ATOM   6638  O O     . ILE B  1 420 ? 94.380  119.000 -106.639 1.00 22.63  ? 420  ILE B O     1 
ATOM   6639  C CB    . ILE B  1 420 ? 93.476  120.565 -104.157 1.00 22.32  ? 420  ILE B CB    1 
ATOM   6640  C CG1   . ILE B  1 420 ? 93.587  120.906 -102.665 1.00 23.94  ? 420  ILE B CG1   1 
ATOM   6641  C CG2   . ILE B  1 420 ? 92.144  121.107 -104.663 1.00 23.88  ? 420  ILE B CG2   1 
ATOM   6642  C CD1   . ILE B  1 420 ? 94.614  122.021 -102.390 1.00 21.76  ? 420  ILE B CD1   1 
ATOM   6643  N N     . LEU B  1 421 ? 92.308  118.208 -106.274 1.00 22.90  ? 421  LEU B N     1 
ATOM   6644  C CA    . LEU B  1 421 ? 92.014  117.930 -107.668 1.00 21.09  ? 421  LEU B CA    1 
ATOM   6645  C C     . LEU B  1 421 ? 90.710  118.669 -107.878 1.00 21.20  ? 421  LEU B C     1 
ATOM   6646  O O     . LEU B  1 421 ? 89.702  118.298 -107.306 1.00 21.92  ? 421  LEU B O     1 
ATOM   6647  C CB    . LEU B  1 421 ? 91.781  116.434 -107.908 1.00 21.47  ? 421  LEU B CB    1 
ATOM   6648  C CG    . LEU B  1 421 ? 91.245  116.088 -109.318 1.00 20.90  ? 421  LEU B CG    1 
ATOM   6649  C CD1   . LEU B  1 421 ? 92.269  116.538 -110.359 1.00 18.18  ? 421  LEU B CD1   1 
ATOM   6650  C CD2   . LEU B  1 421 ? 91.004  114.591 -109.465 1.00 17.99  ? 421  LEU B CD2   1 
ATOM   6651  N N     . GLY B  1 422 ? 90.725  119.729 -108.673 1.00 22.65  ? 422  GLY B N     1 
ATOM   6652  C CA    . GLY B  1 422 ? 89.494  120.454 -108.895 1.00 24.37  ? 422  GLY B CA    1 
ATOM   6653  C C     . GLY B  1 422 ? 89.667  121.938 -109.117 1.00 25.50  ? 422  GLY B C     1 
ATOM   6654  O O     . GLY B  1 422 ? 90.796  122.450 -109.285 1.00 25.84  ? 422  GLY B O     1 
ATOM   6655  N N     . PRO B  1 423 ? 88.545  122.670 -109.123 1.00 25.04  ? 423  PRO B N     1 
ATOM   6656  C CA    . PRO B  1 423 ? 88.609  124.115 -109.335 1.00 25.35  ? 423  PRO B CA    1 
ATOM   6657  C C     . PRO B  1 423 ? 89.360  124.849 -108.241 1.00 26.35  ? 423  PRO B C     1 
ATOM   6658  O O     . PRO B  1 423 ? 89.263  124.491 -107.067 1.00 27.22  ? 423  PRO B O     1 
ATOM   6659  C CB    . PRO B  1 423 ? 87.141  124.537 -109.396 1.00 23.18  ? 423  PRO B CB    1 
ATOM   6660  C CG    . PRO B  1 423 ? 86.479  123.552 -108.514 1.00 24.23  ? 423  PRO B CG    1 
ATOM   6661  C CD    . PRO B  1 423 ? 87.153  122.232 -108.894 1.00 25.35  ? 423  PRO B CD    1 
ATOM   6662  N N     . GLY B  1 424 ? 90.106  125.872 -108.648 1.00 27.07  ? 424  GLY B N     1 
ATOM   6663  C CA    . GLY B  1 424 ? 90.858  126.696 -107.715 1.00 27.18  ? 424  GLY B CA    1 
ATOM   6664  C C     . GLY B  1 424 ? 91.960  126.043 -106.882 1.00 25.71  ? 424  GLY B C     1 
ATOM   6665  O O     . GLY B  1 424 ? 92.420  126.620 -105.896 1.00 25.65  ? 424  GLY B O     1 
ATOM   6666  N N     . ALA B  1 425 ? 92.410  124.861 -107.286 1.00 25.12  ? 425  ALA B N     1 
ATOM   6667  C CA    . ALA B  1 425 ? 93.459  124.148 -106.554 1.00 24.34  ? 425  ALA B CA    1 
ATOM   6668  C C     . ALA B  1 425 ? 94.768  124.944 -106.388 1.00 23.74  ? 425  ALA B C     1 
ATOM   6669  O O     . ALA B  1 425 ? 95.388  124.936 -105.314 1.00 21.79  ? 425  ALA B O     1 
ATOM   6670  C CB    . ALA B  1 425 ? 93.753  122.809 -107.249 1.00 22.83  ? 425  ALA B CB    1 
ATOM   6671  N N     . GLY B  1 426 ? 95.186  125.619 -107.461 1.00 23.35  ? 426  GLY B N     1 
ATOM   6672  C CA    . GLY B  1 426 ? 96.421  126.380 -107.436 1.00 24.47  ? 426  GLY B CA    1 
ATOM   6673  C C     . GLY B  1 426 ? 96.485  127.481 -106.392 1.00 25.40  ? 426  GLY B C     1 
ATOM   6674  O O     . GLY B  1 426 ? 97.545  127.733 -105.815 1.00 25.37  ? 426  GLY B O     1 
ATOM   6675  N N     . GLU B  1 427 ? 95.355  128.137 -106.155 1.00 23.92  ? 427  GLU B N     1 
ATOM   6676  C CA    . GLU B  1 427 ? 95.317  129.193 -105.166 1.00 24.90  ? 427  GLU B CA    1 
ATOM   6677  C C     . GLU B  1 427 ? 95.119  128.567 -103.804 1.00 24.62  ? 427  GLU B C     1 
ATOM   6678  O O     . GLU B  1 427 ? 95.741  128.977 -102.829 1.00 26.35  ? 427  GLU B O     1 
ATOM   6679  C CB    . GLU B  1 427 ? 94.161  130.162 -105.441 1.00 23.29  ? 427  GLU B CB    1 
ATOM   6680  C CG    . GLU B  1 427 ? 94.268  130.957 -106.776 1.00 24.33  ? 427  GLU B CG    1 
ATOM   6681  C CD    . GLU B  1 427 ? 95.554  131.798 -106.873 1.00 24.40  ? 427  GLU B CD    1 
ATOM   6682  O OE1   . GLU B  1 427 ? 96.143  132.148 -105.827 1.00 24.29  ? 427  GLU B OE1   1 
ATOM   6683  O OE2   . GLU B  1 427 ? 95.980  132.143 -108.007 1.00 24.99  ? 427  GLU B OE2   1 
ATOM   6684  N N     . MET B  1 428 ? 94.271  127.554 -103.754 1.00 22.08  ? 428  MET B N     1 
ATOM   6685  C CA    . MET B  1 428 ? 93.941  126.900 -102.496 1.00 22.21  ? 428  MET B CA    1 
ATOM   6686  C C     . MET B  1 428 ? 95.140  126.250 -101.795 1.00 19.40  ? 428  MET B C     1 
ATOM   6687  O O     . MET B  1 428 ? 95.197  126.257 -100.578 1.00 20.24  ? 428  MET B O     1 
ATOM   6688  C CB    . MET B  1 428 ? 92.832  125.866 -102.744 1.00 23.00  ? 428  MET B CB    1 
ATOM   6689  C CG    . MET B  1 428 ? 92.205  125.263 -101.497 1.00 22.14  ? 428  MET B CG    1 
ATOM   6690  S SD    . MET B  1 428 ? 91.002  123.960 -101.970 1.00 22.96  ? 428  MET B SD    1 
ATOM   6691  C CE    . MET B  1 428 ? 89.978  124.867 -103.121 1.00 19.95  ? 428  MET B CE    1 
ATOM   6692  N N     . VAL B  1 429 ? 96.098  125.720 -102.554 1.00 18.38  ? 429  VAL B N     1 
ATOM   6693  C CA    . VAL B  1 429 ? 97.264  125.048 -101.964 1.00 18.87  ? 429  VAL B CA    1 
ATOM   6694  C C     . VAL B  1 429 ? 98.158  125.991 -101.109 1.00 19.83  ? 429  VAL B C     1 
ATOM   6695  O O     . VAL B  1 429 ? 98.960  125.530 -100.288 1.00 16.82  ? 429  VAL B O     1 
ATOM   6696  C CB    . VAL B  1 429 ? 98.124  124.312 -103.075 1.00 18.74  ? 429  VAL B CB    1 
ATOM   6697  C CG1   . VAL B  1 429 ? 98.951  125.292 -103.902 1.00 18.57  ? 429  VAL B CG1   1 
ATOM   6698  C CG2   . VAL B  1 429 ? 99.034  123.303 -102.440 1.00 18.11  ? 429  VAL B CG2   1 
ATOM   6699  N N     . ASN B  1 430 ? 97.994  127.302 -101.295 1.00 19.71  ? 430  ASN B N     1 
ATOM   6700  C CA    . ASN B  1 430 ? 98.779  128.256 -100.527 1.00 21.00  ? 430  ASN B CA    1 
ATOM   6701  C C     . ASN B  1 430 ? 98.250  128.380 -99.107  1.00 22.03  ? 430  ASN B C     1 
ATOM   6702  O O     . ASN B  1 430 ? 99.015  128.667 -98.198  1.00 23.04  ? 430  ASN B O     1 
ATOM   6703  C CB    . ASN B  1 430 ? 98.835  129.587 -101.258 1.00 21.77  ? 430  ASN B CB    1 
ATOM   6704  C CG    . ASN B  1 430 ? 99.446  129.428 -102.611 1.00 22.56  ? 430  ASN B CG    1 
ATOM   6705  O OD1   . ASN B  1 430 ? 100.628 129.104 -102.737 1.00 25.18  ? 430  ASN B OD1   1 
ATOM   6706  N ND2   . ASN B  1 430 ? 98.626  129.568 -103.646 1.00 26.98  ? 430  ASN B ND2   1 
ATOM   6707  N N     . GLU B  1 431 ? 96.954  128.151 -98.903  1.00 22.76  ? 431  GLU B N     1 
ATOM   6708  C CA    . GLU B  1 431 ? 96.434  128.160 -97.541  1.00 22.11  ? 431  GLU B CA    1 
ATOM   6709  C C     . GLU B  1 431 ? 97.063  126.929 -96.872  1.00 21.98  ? 431  GLU B C     1 
ATOM   6710  O O     . GLU B  1 431 ? 97.401  126.944 -95.682  1.00 22.50  ? 431  GLU B O     1 
ATOM   6711  C CB    . GLU B  1 431 ? 94.912  128.004 -97.512  1.00 21.95  ? 431  GLU B CB    1 
ATOM   6712  C CG    . GLU B  1 431 ? 94.326  127.938 -96.104  1.00 20.03  ? 431  GLU B CG    1 
ATOM   6713  C CD    . GLU B  1 431 ? 92.791  127.778 -96.060  1.00 22.79  ? 431  GLU B CD    1 
ATOM   6714  O OE1   . GLU B  1 431 ? 92.100  128.169 -97.026  1.00 20.97  ? 431  GLU B OE1   1 
ATOM   6715  O OE2   . GLU B  1 431 ? 92.270  127.276 -95.038  1.00 21.46  ? 431  GLU B OE2   1 
ATOM   6716  N N     . ALA B  1 432 ? 97.206  125.852 -97.653  1.00 21.12  ? 432  ALA B N     1 
ATOM   6717  C CA    . ALA B  1 432 ? 97.790  124.600 -97.159  1.00 18.98  ? 432  ALA B CA    1 
ATOM   6718  C C     . ALA B  1 432 ? 99.284  124.738 -96.824  1.00 20.53  ? 432  ALA B C     1 
ATOM   6719  O O     . ALA B  1 432 ? 99.756  124.205 -95.795  1.00 19.46  ? 432  ALA B O     1 
ATOM   6720  C CB    . ALA B  1 432 ? 97.584  123.474 -98.207  1.00 18.85  ? 432  ALA B CB    1 
ATOM   6721  N N     . ALA B  1 433 ? 100.032 125.431 -97.693  1.00 19.02  ? 433  ALA B N     1 
ATOM   6722  C CA    . ALA B  1 433 ? 101.471 125.648 -97.457  1.00 20.75  ? 433  ALA B CA    1 
ATOM   6723  C C     . ALA B  1 433 ? 101.663 126.435 -96.138  1.00 18.80  ? 433  ALA B C     1 
ATOM   6724  O O     . ALA B  1 433 ? 102.559 126.132 -95.342  1.00 20.64  ? 433  ALA B O     1 
ATOM   6725  C CB    . ALA B  1 433 ? 102.113 126.424 -98.625  1.00 19.82  ? 433  ALA B CB    1 
ATOM   6726  N N     . LEU B  1 434 ? 100.809 127.422 -95.919  1.00 19.45  ? 434  LEU B N     1 
ATOM   6727  C CA    . LEU B  1 434 ? 100.852 128.237 -94.693  1.00 20.71  ? 434  LEU B CA    1 
ATOM   6728  C C     . LEU B  1 434 ? 100.595 127.357 -93.486  1.00 20.90  ? 434  LEU B C     1 
ATOM   6729  O O     . LEU B  1 434 ? 101.328 127.432 -92.505  1.00 22.61  ? 434  LEU B O     1 
ATOM   6730  C CB    . LEU B  1 434 ? 99.815  129.375 -94.732  1.00 20.78  ? 434  LEU B CB    1 
ATOM   6731  C CG    . LEU B  1 434 ? 99.697  130.283 -93.479  1.00 23.54  ? 434  LEU B CG    1 
ATOM   6732  C CD1   . LEU B  1 434 ? 101.065 130.883 -93.155  1.00 23.60  ? 434  LEU B CD1   1 
ATOM   6733  C CD2   . LEU B  1 434 ? 98.675  131.417 -93.697  1.00 22.80  ? 434  LEU B CD2   1 
ATOM   6734  N N     . ALA B  1 435 ? 99.558  126.526 -93.555  1.00 20.39  ? 435  ALA B N     1 
ATOM   6735  C CA    . ALA B  1 435 ? 99.248  125.606 -92.459  1.00 19.68  ? 435  ALA B CA    1 
ATOM   6736  C C     . ALA B  1 435 ? 100.480 124.726 -92.098  1.00 19.51  ? 435  ALA B C     1 
ATOM   6737  O O     . ALA B  1 435 ? 100.895 124.632 -90.932  1.00 20.17  ? 435  ALA B O     1 
ATOM   6738  C CB    . ALA B  1 435 ? 98.058  124.720 -92.852  1.00 16.45  ? 435  ALA B CB    1 
ATOM   6739  N N     . LEU B  1 436 ? 101.060 124.082 -93.098  1.00 20.32  ? 436  LEU B N     1 
ATOM   6740  C CA    . LEU B  1 436 ? 102.233 123.240 -92.870  1.00 23.30  ? 436  LEU B CA    1 
ATOM   6741  C C     . LEU B  1 436 ? 103.418 123.993 -92.279  1.00 24.52  ? 436  LEU B C     1 
ATOM   6742  O O     . LEU B  1 436 ? 104.213 123.415 -91.536  1.00 22.83  ? 436  LEU B O     1 
ATOM   6743  C CB    . LEU B  1 436 ? 102.703 122.574 -94.166  1.00 25.31  ? 436  LEU B CB    1 
ATOM   6744  C CG    . LEU B  1 436 ? 101.993 121.307 -94.636  1.00 27.15  ? 436  LEU B CG    1 
ATOM   6745  C CD1   . LEU B  1 436 ? 102.755 120.757 -95.842  1.00 27.21  ? 436  LEU B CD1   1 
ATOM   6746  C CD2   . LEU B  1 436 ? 102.029 120.263 -93.563  1.00 29.97  ? 436  LEU B CD2   1 
ATOM   6747  N N     . GLU B  1 437 ? 103.551 125.270 -92.621  1.00 25.12  ? 437  GLU B N     1 
ATOM   6748  C CA    . GLU B  1 437 ? 104.663 126.063 -92.105  1.00 27.53  ? 437  GLU B CA    1 
ATOM   6749  C C     . GLU B  1 437 ? 104.571 126.208 -90.586  1.00 25.83  ? 437  GLU B C     1 
ATOM   6750  O O     . GLU B  1 437 ? 105.582 126.243 -89.895  1.00 25.11  ? 437  GLU B O     1 
ATOM   6751  C CB    . GLU B  1 437 ? 104.673 127.451 -92.757  1.00 32.51  ? 437  GLU B CB    1 
ATOM   6752  C CG    . GLU B  1 437 ? 106.096 127.985 -93.026  1.00 40.62  ? 437  GLU B CG    1 
ATOM   6753  C CD    . GLU B  1 437 ? 106.852 127.184 -94.083  1.00 41.83  ? 437  GLU B CD    1 
ATOM   6754  O OE1   . GLU B  1 437 ? 106.376 127.102 -95.234  1.00 46.27  ? 437  GLU B OE1   1 
ATOM   6755  O OE2   . GLU B  1 437 ? 107.925 126.648 -93.756  1.00 42.62  ? 437  GLU B OE2   1 
ATOM   6756  N N     . TYR B  1 438 ? 103.354 126.304 -90.075  1.00 24.74  ? 438  TYR B N     1 
ATOM   6757  C CA    . TYR B  1 438 ? 103.138 126.402 -88.637  1.00 25.78  ? 438  TYR B CA    1 
ATOM   6758  C C     . TYR B  1 438 ? 102.986 125.034 -87.989  1.00 24.74  ? 438  TYR B C     1 
ATOM   6759  O O     . TYR B  1 438 ? 102.936 124.930 -86.763  1.00 26.01  ? 438  TYR B O     1 
ATOM   6760  C CB    . TYR B  1 438 ? 101.868 127.206 -88.337  1.00 29.12  ? 438  TYR B CB    1 
ATOM   6761  C CG    . TYR B  1 438 ? 102.013 128.686 -88.585  1.00 32.32  ? 438  TYR B CG    1 
ATOM   6762  C CD1   . TYR B  1 438 ? 102.827 129.472 -87.769  1.00 31.98  ? 438  TYR B CD1   1 
ATOM   6763  C CD2   . TYR B  1 438 ? 101.355 129.305 -89.651  1.00 32.86  ? 438  TYR B CD2   1 
ATOM   6764  C CE1   . TYR B  1 438 ? 102.975 130.831 -88.009  1.00 32.75  ? 438  TYR B CE1   1 
ATOM   6765  C CE2   . TYR B  1 438 ? 101.504 130.665 -89.895  1.00 31.87  ? 438  TYR B CE2   1 
ATOM   6766  C CZ    . TYR B  1 438 ? 102.309 131.419 -89.072  1.00 34.06  ? 438  TYR B CZ    1 
ATOM   6767  O OH    . TYR B  1 438 ? 102.438 132.779 -89.310  1.00 36.92  ? 438  TYR B OH    1 
ATOM   6768  N N     . GLY B  1 439 ? 102.904 123.977 -88.791  1.00 23.27  ? 439  GLY B N     1 
ATOM   6769  C CA    . GLY B  1 439 ? 102.688 122.667 -88.200  1.00 20.16  ? 439  GLY B CA    1 
ATOM   6770  C C     . GLY B  1 439 ? 101.252 122.598 -87.684  1.00 18.36  ? 439  GLY B C     1 
ATOM   6771  O O     . GLY B  1 439 ? 100.945 121.915 -86.689  1.00 17.13  ? 439  GLY B O     1 
ATOM   6772  N N     . ALA B  1 440 ? 100.357 123.313 -88.362  1.00 18.74  ? 440  ALA B N     1 
ATOM   6773  C CA    . ALA B  1 440 ? 98.945  123.350 -87.959  1.00 17.93  ? 440  ALA B CA    1 
ATOM   6774  C C     . ALA B  1 440 ? 98.293  121.979 -88.059  1.00 17.63  ? 440  ALA B C     1 
ATOM   6775  O O     . ALA B  1 440 ? 98.704  121.157 -88.863  1.00 19.35  ? 440  ALA B O     1 
ATOM   6776  C CB    . ALA B  1 440 ? 98.172  124.334 -88.821  1.00 17.99  ? 440  ALA B CB    1 
ATOM   6777  N N     . SER B  1 441 ? 97.258  121.771 -87.263  1.00 17.32  ? 441  SER B N     1 
ATOM   6778  C CA    . SER B  1 441 ? 96.513  120.524 -87.237  1.00 17.76  ? 441  SER B CA    1 
ATOM   6779  C C     . SER B  1 441 ? 95.286  120.577 -88.193  1.00 18.22  ? 441  SER B C     1 
ATOM   6780  O O     . SER B  1 441 ? 94.887  121.640 -88.686  1.00 18.18  ? 441  SER B O     1 
ATOM   6781  C CB    . SER B  1 441 ? 96.010  120.276 -85.814  1.00 14.73  ? 441  SER B CB    1 
ATOM   6782  O OG    . SER B  1 441 ? 94.951  121.189 -85.516  1.00 17.80  ? 441  SER B OG    1 
ATOM   6783  N N     . CYS B  1 442 ? 94.694  119.413 -88.440  1.00 18.28  ? 442  CYS B N     1 
ATOM   6784  C CA    . CYS B  1 442 ? 93.501  119.350 -89.274  1.00 19.14  ? 442  CYS B CA    1 
ATOM   6785  C C     . CYS B  1 442 ? 92.388  120.101 -88.553  1.00 17.33  ? 442  CYS B C     1 
ATOM   6786  O O     . CYS B  1 442 ? 91.583  120.798 -89.163  1.00 17.67  ? 442  CYS B O     1 
ATOM   6787  C CB    . CYS B  1 442 ? 93.054  117.902 -89.516  1.00 17.31  ? 442  CYS B CB    1 
ATOM   6788  S SG    . CYS B  1 442 ? 94.262  116.951 -90.398  1.00 18.97  ? 442  CYS B SG    1 
ATOM   6789  N N     . GLU B  1 443 ? 92.332  119.947 -87.240  1.00 19.08  ? 443  GLU B N     1 
ATOM   6790  C CA    . GLU B  1 443 ? 91.310  120.650 -86.470  1.00 18.74  ? 443  GLU B CA    1 
ATOM   6791  C C     . GLU B  1 443 ? 91.499  122.181 -86.564  1.00 17.89  ? 443  GLU B C     1 
ATOM   6792  O O     . GLU B  1 443 ? 90.517  122.912 -86.674  1.00 17.71  ? 443  GLU B O     1 
ATOM   6793  C CB    . GLU B  1 443 ? 91.362  120.220 -85.018  1.00 18.02  ? 443  GLU B CB    1 
ATOM   6794  C CG    . GLU B  1 443 ? 90.272  120.874 -84.180  1.00 20.95  ? 443  GLU B CG    1 
ATOM   6795  C CD    . GLU B  1 443 ? 90.333  120.465 -82.707  1.00 21.15  ? 443  GLU B CD    1 
ATOM   6796  O OE1   . GLU B  1 443 ? 91.126  119.579 -82.331  1.00 21.68  ? 443  GLU B OE1   1 
ATOM   6797  O OE2   . GLU B  1 443 ? 89.565  121.041 -81.923  1.00 23.28  ? 443  GLU B OE2   1 
ATOM   6798  N N     . ASP B  1 444 ? 92.752  122.648 -86.493  1.00 16.99  ? 444  ASP B N     1 
ATOM   6799  C CA    . ASP B  1 444 ? 93.053  124.078 -86.579  1.00 17.60  ? 444  ASP B CA    1 
ATOM   6800  C C     . ASP B  1 444 ? 92.340  124.630 -87.795  1.00 18.79  ? 444  ASP B C     1 
ATOM   6801  O O     . ASP B  1 444 ? 91.536  125.570 -87.719  1.00 20.15  ? 444  ASP B O     1 
ATOM   6802  C CB    . ASP B  1 444 ? 94.554  124.340 -86.775  1.00 19.18  ? 444  ASP B CB    1 
ATOM   6803  C CG    . ASP B  1 444 ? 95.375  124.228 -85.486  1.00 19.51  ? 444  ASP B CG    1 
ATOM   6804  O OD1   . ASP B  1 444 ? 94.799  124.343 -84.384  1.00 20.39  ? 444  ASP B OD1   1 
ATOM   6805  O OD2   . ASP B  1 444 ? 96.612  124.039 -85.592  1.00 20.03  ? 444  ASP B OD2   1 
ATOM   6806  N N     . ILE B  1 445 ? 92.620  124.009 -88.932  1.00 18.54  ? 445  ILE B N     1 
ATOM   6807  C CA    . ILE B  1 445 ? 92.045  124.466 -90.182  1.00 19.32  ? 445  ILE B CA    1 
ATOM   6808  C C     . ILE B  1 445 ? 90.528  124.413 -90.189  1.00 19.09  ? 445  ILE B C     1 
ATOM   6809  O O     . ILE B  1 445 ? 89.885  125.358 -90.632  1.00 18.77  ? 445  ILE B O     1 
ATOM   6810  C CB    . ILE B  1 445 ? 92.614  123.661 -91.366  1.00 18.28  ? 445  ILE B CB    1 
ATOM   6811  C CG1   . ILE B  1 445 ? 94.130  123.937 -91.475  1.00 19.85  ? 445  ILE B CG1   1 
ATOM   6812  C CG2   . ILE B  1 445 ? 91.894  124.086 -92.643  1.00 19.05  ? 445  ILE B CG2   1 
ATOM   6813  C CD1   . ILE B  1 445 ? 94.875  123.022 -92.424  1.00 22.32  ? 445  ILE B CD1   1 
ATOM   6814  N N     . ALA B  1 446 ? 89.970  123.324 -89.659  1.00 17.95  ? 446  ALA B N     1 
ATOM   6815  C CA    . ALA B  1 446 ? 88.522  123.135 -89.622  1.00 18.84  ? 446  ALA B CA    1 
ATOM   6816  C C     . ALA B  1 446 ? 87.808  124.202 -88.808  1.00 19.89  ? 446  ALA B C     1 
ATOM   6817  O O     . ALA B  1 446 ? 86.651  124.545 -89.098  1.00 20.27  ? 446  ALA B O     1 
ATOM   6818  C CB    . ALA B  1 446 ? 88.181  121.738 -89.051  1.00 19.00  ? 446  ALA B CB    1 
ATOM   6819  N N     . ARG B  1 447 ? 88.479  124.706 -87.777  1.00 18.99  ? 447  ARG B N     1 
ATOM   6820  C CA    . ARG B  1 447 ? 87.879  125.724 -86.926  1.00 18.99  ? 447  ARG B CA    1 
ATOM   6821  C C     . ARG B  1 447 ? 88.123  127.124 -87.438  1.00 20.31  ? 447  ARG B C     1 
ATOM   6822  O O     . ARG B  1 447 ? 87.597  128.068 -86.865  1.00 20.33  ? 447  ARG B O     1 
ATOM   6823  C CB    . ARG B  1 447 ? 88.379  125.606 -85.481  1.00 18.57  ? 447  ARG B CB    1 
ATOM   6824  C CG    . ARG B  1 447 ? 87.883  124.334 -84.802  1.00 18.32  ? 447  ARG B CG    1 
ATOM   6825  C CD    . ARG B  1 447 ? 88.213  124.242 -83.309  1.00 18.09  ? 447  ARG B CD    1 
ATOM   6826  N NE    . ARG B  1 447 ? 87.685  122.988 -82.777  1.00 19.47  ? 447  ARG B NE    1 
ATOM   6827  C CZ    . ARG B  1 447 ? 86.410  122.747 -82.495  1.00 20.01  ? 447  ARG B CZ    1 
ATOM   6828  N NH1   . ARG B  1 447 ? 85.476  123.702 -82.667  1.00 21.19  ? 447  ARG B NH1   1 
ATOM   6829  N NH2   . ARG B  1 447 ? 86.056  121.529 -82.089  1.00 17.75  ? 447  ARG B NH2   1 
ATOM   6830  N N     . VAL B  1 448 ? 88.908  127.284 -88.507  1.00 20.20  ? 448  VAL B N     1 
ATOM   6831  C CA    . VAL B  1 448 ? 89.115  128.642 -89.021  1.00 20.95  ? 448  VAL B CA    1 
ATOM   6832  C C     . VAL B  1 448 ? 87.849  128.958 -89.824  1.00 20.13  ? 448  VAL B C     1 
ATOM   6833  O O     . VAL B  1 448 ? 87.374  128.121 -90.595  1.00 17.40  ? 448  VAL B O     1 
ATOM   6834  C CB    . VAL B  1 448 ? 90.350  128.749 -89.951  1.00 22.18  ? 448  VAL B CB    1 
ATOM   6835  C CG1   . VAL B  1 448 ? 90.278  130.070 -90.754  1.00 21.02  ? 448  VAL B CG1   1 
ATOM   6836  C CG2   . VAL B  1 448 ? 91.630  128.697 -89.128  1.00 23.54  ? 448  VAL B CG2   1 
ATOM   6837  N N     . CYS B  1 449 ? 87.295  130.151 -89.645  1.00 21.14  ? 449  CYS B N     1 
ATOM   6838  C CA    . CYS B  1 449 ? 86.070  130.516 -90.356  1.00 22.27  ? 449  CYS B CA    1 
ATOM   6839  C C     . CYS B  1 449 ? 86.380  130.893 -91.807  1.00 22.00  ? 449  CYS B C     1 
ATOM   6840  O O     . CYS B  1 449 ? 86.993  131.932 -92.067  1.00 22.97  ? 449  CYS B O     1 
ATOM   6841  C CB    . CYS B  1 449 ? 85.361  131.682 -89.632  1.00 25.66  ? 449  CYS B CB    1 
ATOM   6842  S SG    . CYS B  1 449 ? 83.710  132.149 -90.266  1.00 29.18  ? 449  CYS B SG    1 
ATOM   6843  N N     . HIS B  1 450 ? 86.000  130.023 -92.747  1.00 22.09  ? 450  HIS B N     1 
ATOM   6844  C CA    . HIS B  1 450 ? 86.214  130.255 -94.175  1.00 19.56  ? 450  HIS B CA    1 
ATOM   6845  C C     . HIS B  1 450 ? 84.991  130.942 -94.761  1.00 21.31  ? 450  HIS B C     1 
ATOM   6846  O O     . HIS B  1 450 ? 83.886  130.640 -94.359  1.00 22.34  ? 450  HIS B O     1 
ATOM   6847  C CB    . HIS B  1 450 ? 86.395  128.931 -94.891  1.00 20.41  ? 450  HIS B CB    1 
ATOM   6848  C CG    . HIS B  1 450 ? 87.711  128.283 -94.634  1.00 19.24  ? 450  HIS B CG    1 
ATOM   6849  N ND1   . HIS B  1 450 ? 88.114  127.903 -93.374  1.00 20.07  ? 450  HIS B ND1   1 
ATOM   6850  C CD2   . HIS B  1 450 ? 88.716  127.948 -95.473  1.00 18.29  ? 450  HIS B CD2   1 
ATOM   6851  C CE1   . HIS B  1 450 ? 89.312  127.360 -93.451  1.00 21.56  ? 450  HIS B CE1   1 
ATOM   6852  N NE2   . HIS B  1 450 ? 89.701  127.375 -94.711  1.00 19.47  ? 450  HIS B NE2   1 
ATOM   6853  N N     . ALA B  1 451 ? 85.175  131.842 -95.727  1.00 21.47  ? 451  ALA B N     1 
ATOM   6854  C CA    . ALA B  1 451 ? 84.050  132.555 -96.337  1.00 22.28  ? 451  ALA B CA    1 
ATOM   6855  C C     . ALA B  1 451 ? 83.090  131.619 -97.083  1.00 23.21  ? 451  ALA B C     1 
ATOM   6856  O O     . ALA B  1 451 ? 83.520  130.652 -97.730  1.00 24.18  ? 451  ALA B O     1 
ATOM   6857  C CB    . ALA B  1 451 ? 84.574  133.628 -97.293  1.00 20.63  ? 451  ALA B CB    1 
ATOM   6858  N N     . HIS B  1 452 ? 81.789  131.890 -96.959  1.00 23.67  ? 452  HIS B N     1 
ATOM   6859  C CA    . HIS B  1 452 ? 80.760  131.106 -97.646  1.00 24.12  ? 452  HIS B CA    1 
ATOM   6860  C C     . HIS B  1 452 ? 80.086  132.005 -98.684  1.00 23.71  ? 452  HIS B C     1 
ATOM   6861  O O     . HIS B  1 452 ? 79.648  133.110 -98.374  1.00 23.02  ? 452  HIS B O     1 
ATOM   6862  C CB    . HIS B  1 452 ? 79.700  130.585 -96.664  1.00 25.98  ? 452  HIS B CB    1 
ATOM   6863  C CG    . HIS B  1 452 ? 78.709  129.650 -97.297  1.00 27.85  ? 452  HIS B CG    1 
ATOM   6864  N ND1   . HIS B  1 452 ? 78.935  128.296 -97.429  1.00 29.59  ? 452  HIS B ND1   1 
ATOM   6865  C CD2   . HIS B  1 452 ? 77.518  129.890 -97.897  1.00 27.53  ? 452  HIS B CD2   1 
ATOM   6866  C CE1   . HIS B  1 452 ? 77.929  127.745 -98.086  1.00 27.15  ? 452  HIS B CE1   1 
ATOM   6867  N NE2   . HIS B  1 452 ? 77.057  128.692 -98.381  1.00 28.19  ? 452  HIS B NE2   1 
ATOM   6868  N N     . PRO B  1 453 ? 79.982  131.542 -99.928  1.00 23.46  ? 453  PRO B N     1 
ATOM   6869  C CA    . PRO B  1 453 ? 80.445  130.249 -100.447 1.00 23.88  ? 453  PRO B CA    1 
ATOM   6870  C C     . PRO B  1 453 ? 81.740  130.382 -101.230 1.00 24.32  ? 453  PRO B C     1 
ATOM   6871  O O     . PRO B  1 453 ? 81.842  131.199 -102.136 1.00 25.07  ? 453  PRO B O     1 
ATOM   6872  C CB    . PRO B  1 453 ? 79.301  129.819 -101.352 1.00 23.00  ? 453  PRO B CB    1 
ATOM   6873  C CG    . PRO B  1 453 ? 78.942  131.183 -102.016 1.00 24.90  ? 453  PRO B CG    1 
ATOM   6874  C CD    . PRO B  1 453 ? 78.967  132.146 -100.820 1.00 22.82  ? 453  PRO B CD    1 
ATOM   6875  N N     . THR B  1 454 ? 82.733  129.572 -100.880 1.00 23.14  ? 454  THR B N     1 
ATOM   6876  C CA    . THR B  1 454 ? 84.004  129.604 -101.588 1.00 23.50  ? 454  THR B CA    1 
ATOM   6877  C C     . THR B  1 454 ? 84.491  128.175 -101.779 1.00 22.26  ? 454  THR B C     1 
ATOM   6878  O O     . THR B  1 454 ? 84.038  127.264 -101.079 1.00 22.65  ? 454  THR B O     1 
ATOM   6879  C CB    . THR B  1 454 ? 85.114  130.385 -100.795 1.00 23.67  ? 454  THR B CB    1 
ATOM   6880  O OG1   . THR B  1 454 ? 85.401  129.708 -99.557  1.00 20.50  ? 454  THR B OG1   1 
ATOM   6881  C CG2   . THR B  1 454 ? 84.656  131.830 -100.495 1.00 21.90  ? 454  THR B CG2   1 
ATOM   6882  N N     . LEU B  1 455 ? 85.417  127.991 -102.718 1.00 20.79  ? 455  LEU B N     1 
ATOM   6883  C CA    . LEU B  1 455 ? 86.019  126.679 -102.954 1.00 22.02  ? 455  LEU B CA    1 
ATOM   6884  C C     . LEU B  1 455 ? 86.877  126.257 -101.730 1.00 21.48  ? 455  LEU B C     1 
ATOM   6885  O O     . LEU B  1 455 ? 87.027  125.063 -101.441 1.00 21.08  ? 455  LEU B O     1 
ATOM   6886  C CB    . LEU B  1 455 ? 86.903  126.716 -104.213 1.00 21.42  ? 455  LEU B CB    1 
ATOM   6887  C CG    . LEU B  1 455 ? 86.183  127.128 -105.514 1.00 24.10  ? 455  LEU B CG    1 
ATOM   6888  C CD1   . LEU B  1 455 ? 87.198  127.298 -106.677 1.00 22.69  ? 455  LEU B CD1   1 
ATOM   6889  C CD2   . LEU B  1 455 ? 85.103  126.076 -105.844 1.00 23.02  ? 455  LEU B CD2   1 
ATOM   6890  N N     . SER B  1 456 ? 87.428  127.250 -101.023 1.00 22.09  ? 456  SER B N     1 
ATOM   6891  C CA    . SER B  1 456 ? 88.269  126.985 -99.842  1.00 22.33  ? 456  SER B CA    1 
ATOM   6892  C C     . SER B  1 456 ? 87.496  126.124 -98.827  1.00 21.66  ? 456  SER B C     1 
ATOM   6893  O O     . SER B  1 456 ? 88.099  125.403 -98.036  1.00 23.39  ? 456  SER B O     1 
ATOM   6894  C CB    . SER B  1 456 ? 88.714  128.287 -99.159  1.00 20.88  ? 456  SER B CB    1 
ATOM   6895  O OG    . SER B  1 456 ? 87.706  128.762 -98.291  1.00 21.04  ? 456  SER B OG    1 
ATOM   6896  N N     . GLU B  1 457 ? 86.166  126.185 -98.863  1.00 20.90  ? 457  GLU B N     1 
ATOM   6897  C CA    . GLU B  1 457 ? 85.364  125.391 -97.940  1.00 21.43  ? 457  GLU B CA    1 
ATOM   6898  C C     . GLU B  1 457 ? 85.505  123.878 -98.128  1.00 20.49  ? 457  GLU B C     1 
ATOM   6899  O O     . GLU B  1 457 ? 85.262  123.125 -97.196  1.00 17.14  ? 457  GLU B O     1 
ATOM   6900  C CB    . GLU B  1 457 ? 83.898  125.788 -98.035  1.00 23.55  ? 457  GLU B CB    1 
ATOM   6901  C CG    . GLU B  1 457 ? 83.634  127.168 -97.484  1.00 23.35  ? 457  GLU B CG    1 
ATOM   6902  C CD    . GLU B  1 457 ? 82.172  127.565 -97.622  1.00 25.63  ? 457  GLU B CD    1 
ATOM   6903  O OE1   . GLU B  1 457 ? 81.752  127.916 -98.750  1.00 24.39  ? 457  GLU B OE1   1 
ATOM   6904  O OE2   . GLU B  1 457 ? 81.455  127.527 -96.612  1.00 28.41  ? 457  GLU B OE2   1 
ATOM   6905  N N     . ALA B  1 458 ? 85.885  123.439 -99.332  1.00 19.68  ? 458  ALA B N     1 
ATOM   6906  C CA    . ALA B  1 458 ? 86.106  122.002 -99.589  1.00 19.66  ? 458  ALA B CA    1 
ATOM   6907  C C     . ALA B  1 458 ? 87.336  121.619 -98.776  1.00 20.94  ? 458  ALA B C     1 
ATOM   6908  O O     . ALA B  1 458 ? 87.409  120.522 -98.212  1.00 22.67  ? 458  ALA B O     1 
ATOM   6909  C CB    . ALA B  1 458 ? 86.380  121.741 -101.118 1.00 18.55  ? 458  ALA B CB    1 
ATOM   6910  N N     . PHE B  1 459 ? 88.303  122.550 -98.740  1.00 21.49  ? 459  PHE B N     1 
ATOM   6911  C CA    . PHE B  1 459 ? 89.561  122.385 -98.009  1.00 20.62  ? 459  PHE B CA    1 
ATOM   6912  C C     . PHE B  1 459 ? 89.241  122.298 -96.529  1.00 20.19  ? 459  PHE B C     1 
ATOM   6913  O O     . PHE B  1 459 ? 89.682  121.398 -95.831  1.00 20.92  ? 459  PHE B O     1 
ATOM   6914  C CB    . PHE B  1 459 ? 90.496  123.581 -98.261  1.00 19.82  ? 459  PHE B CB    1 
ATOM   6915  C CG    . PHE B  1 459 ? 91.859  123.449 -97.615  1.00 18.33  ? 459  PHE B CG    1 
ATOM   6916  C CD1   . PHE B  1 459 ? 92.740  122.456 -98.038  1.00 19.31  ? 459  PHE B CD1   1 
ATOM   6917  C CD2   . PHE B  1 459 ? 92.224  124.267 -96.539  1.00 17.31  ? 459  PHE B CD2   1 
ATOM   6918  C CE1   . PHE B  1 459 ? 93.982  122.257 -97.392  1.00 19.79  ? 459  PHE B CE1   1 
ATOM   6919  C CE2   . PHE B  1 459 ? 93.449  124.089 -95.885  1.00 18.53  ? 459  PHE B CE2   1 
ATOM   6920  C CZ    . PHE B  1 459 ? 94.329  123.085 -96.308  1.00 20.84  ? 459  PHE B CZ    1 
ATOM   6921  N N     . ARG B  1 460 ? 88.464  123.251 -96.050  1.00 21.03  ? 460  ARG B N     1 
ATOM   6922  C CA    . ARG B  1 460 ? 88.106  123.233 -94.656  1.00 21.12  ? 460  ARG B CA    1 
ATOM   6923  C C     . ARG B  1 460 ? 87.379  121.933 -94.245  1.00 20.37  ? 460  ARG B C     1 
ATOM   6924  O O     . ARG B  1 460 ? 87.692  121.339 -93.211  1.00 18.63  ? 460  ARG B O     1 
ATOM   6925  C CB    . ARG B  1 460 ? 87.244  124.445 -94.346  1.00 21.69  ? 460  ARG B CB    1 
ATOM   6926  C CG    . ARG B  1 460 ? 86.861  124.535 -92.879  1.00 21.93  ? 460  ARG B CG    1 
ATOM   6927  C CD    . ARG B  1 460 ? 85.668  125.480 -92.649  1.00 21.94  ? 460  ARG B CD    1 
ATOM   6928  N NE    . ARG B  1 460 ? 85.529  125.765 -91.225  1.00 25.40  ? 460  ARG B NE    1 
ATOM   6929  C CZ    . ARG B  1 460 ? 84.763  126.721 -90.701  1.00 26.45  ? 460  ARG B CZ    1 
ATOM   6930  N NH1   . ARG B  1 460 ? 84.039  127.513 -91.495  1.00 25.88  ? 460  ARG B NH1   1 
ATOM   6931  N NH2   . ARG B  1 460 ? 84.734  126.886 -89.377  1.00 27.58  ? 460  ARG B NH2   1 
ATOM   6932  N N     . GLU B  1 461 ? 86.422  121.494 -95.055  1.00 21.92  ? 461  GLU B N     1 
ATOM   6933  C CA    . GLU B  1 461 ? 85.659  120.283 -94.747  1.00 21.44  ? 461  GLU B CA    1 
ATOM   6934  C C     . GLU B  1 461 ? 86.463  119.006 -94.806  1.00 20.07  ? 461  GLU B C     1 
ATOM   6935  O O     . GLU B  1 461 ? 86.163  118.075 -94.051  1.00 20.80  ? 461  GLU B O     1 
ATOM   6936  C CB    . GLU B  1 461 ? 84.452  120.167 -95.667  1.00 23.61  ? 461  GLU B CB    1 
ATOM   6937  C CG    . GLU B  1 461 ? 83.323  121.114 -95.297  1.00 26.99  ? 461  GLU B CG    1 
ATOM   6938  C CD    . GLU B  1 461 ? 82.155  120.398 -94.651  1.00 31.77  ? 461  GLU B CD    1 
ATOM   6939  O OE1   . GLU B  1 461 ? 82.328  119.844 -93.540  1.00 36.81  ? 461  GLU B OE1   1 
ATOM   6940  O OE2   . GLU B  1 461 ? 81.069  120.380 -95.252  1.00 31.88  ? 461  GLU B OE2   1 
ATOM   6941  N N     . ALA B  1 462 ? 87.476  118.958 -95.678  1.00 16.70  ? 462  ALA B N     1 
ATOM   6942  C CA    . ALA B  1 462 ? 88.323  117.767 -95.796  1.00 16.99  ? 462  ALA B CA    1 
ATOM   6943  C C     . ALA B  1 462 ? 89.142  117.679 -94.485  1.00 18.01  ? 462  ALA B C     1 
ATOM   6944  O O     . ALA B  1 462 ? 89.367  116.591 -93.956  1.00 18.92  ? 462  ALA B O     1 
ATOM   6945  C CB    . ALA B  1 462 ? 89.268  117.871 -97.051  1.00 16.22  ? 462  ALA B CB    1 
ATOM   6946  N N     . ASN B  1 463 ? 89.584  118.825 -93.971  1.00 16.98  ? 463  ASN B N     1 
ATOM   6947  C CA    . ASN B  1 463 ? 90.326  118.834 -92.703  1.00 17.86  ? 463  ASN B CA    1 
ATOM   6948  C C     . ASN B  1 463 ? 89.413  118.391 -91.555  1.00 16.57  ? 463  ASN B C     1 
ATOM   6949  O O     . ASN B  1 463 ? 89.818  117.631 -90.685  1.00 16.75  ? 463  ASN B O     1 
ATOM   6950  C CB    . ASN B  1 463 ? 90.911  120.234 -92.446  1.00 16.51  ? 463  ASN B CB    1 
ATOM   6951  C CG    . ASN B  1 463 ? 92.209  120.402 -93.127  1.00 18.25  ? 463  ASN B CG    1 
ATOM   6952  O OD1   . ASN B  1 463 ? 93.236  119.951 -92.627  1.00 21.09  ? 463  ASN B OD1   1 
ATOM   6953  N ND2   . ASN B  1 463 ? 92.191  121.008 -94.307  1.00 21.00  ? 463  ASN B ND2   1 
ATOM   6954  N N     . LEU B  1 464 ? 88.169  118.859 -91.575  1.00 17.37  ? 464  LEU B N     1 
ATOM   6955  C CA    . LEU B  1 464 ? 87.201  118.478 -90.550  1.00 18.75  ? 464  LEU B CA    1 
ATOM   6956  C C     . LEU B  1 464 ? 87.013  116.954 -90.574  1.00 19.88  ? 464  LEU B C     1 
ATOM   6957  O O     . LEU B  1 464 ? 87.025  116.289 -89.515  1.00 20.34  ? 464  LEU B O     1 
ATOM   6958  C CB    . LEU B  1 464 ? 85.845  119.195 -90.771  1.00 16.46  ? 464  LEU B CB    1 
ATOM   6959  C CG    . LEU B  1 464 ? 84.708  118.804 -89.801  1.00 17.85  ? 464  LEU B CG    1 
ATOM   6960  C CD1   . LEU B  1 464 ? 85.157  118.927 -88.348  1.00 17.66  ? 464  LEU B CD1   1 
ATOM   6961  C CD2   . LEU B  1 464 ? 83.480  119.705 -90.043  1.00 17.45  ? 464  LEU B CD2   1 
ATOM   6962  N N     . ALA B  1 465 ? 86.844  116.406 -91.780  1.00 19.32  ? 465  ALA B N     1 
ATOM   6963  C CA    . ALA B  1 465 ? 86.681  114.963 -91.947  1.00 20.91  ? 465  ALA B CA    1 
ATOM   6964  C C     . ALA B  1 465 ? 87.912  114.232 -91.414  1.00 21.64  ? 465  ALA B C     1 
ATOM   6965  O O     . ALA B  1 465 ? 87.795  113.245 -90.695  1.00 23.34  ? 465  ALA B O     1 
ATOM   6966  C CB    . ALA B  1 465 ? 86.465  114.609 -93.431  1.00 18.95  ? 465  ALA B CB    1 
ATOM   6967  N N     . ALA B  1 466 ? 89.096  114.711 -91.774  1.00 21.73  ? 466  ALA B N     1 
ATOM   6968  C CA    . ALA B  1 466 ? 90.330  114.089 -91.312  1.00 22.56  ? 466  ALA B CA    1 
ATOM   6969  C C     . ALA B  1 466 ? 90.409  114.179 -89.777  1.00 22.04  ? 466  ALA B C     1 
ATOM   6970  O O     . ALA B  1 466 ? 90.773  113.225 -89.082  1.00 21.12  ? 466  ALA B O     1 
ATOM   6971  C CB    . ALA B  1 466 ? 91.562  114.796 -91.954  1.00 18.43  ? 466  ALA B CB    1 
ATOM   6972  N N     . SER B  1 467 ? 90.032  115.327 -89.243  1.00 22.59  ? 467  SER B N     1 
ATOM   6973  C CA    . SER B  1 467 ? 90.136  115.506 -87.812  1.00 23.13  ? 467  SER B CA    1 
ATOM   6974  C C     . SER B  1 467 ? 89.113  114.781 -86.941  1.00 25.05  ? 467  SER B C     1 
ATOM   6975  O O     . SER B  1 467 ? 89.466  114.046 -86.029  1.00 25.94  ? 467  SER B O     1 
ATOM   6976  C CB    . SER B  1 467 ? 90.088  116.997 -87.477  1.00 22.79  ? 467  SER B CB    1 
ATOM   6977  O OG    . SER B  1 467 ? 90.289  117.160 -86.079  1.00 26.03  ? 467  SER B OG    1 
ATOM   6978  N N     . PHE B  1 468 ? 87.840  115.017 -87.230  1.00 26.53  ? 468  PHE B N     1 
ATOM   6979  C CA    . PHE B  1 468 ? 86.715  114.508 -86.461  1.00 25.83  ? 468  PHE B CA    1 
ATOM   6980  C C     . PHE B  1 468 ? 86.145  113.206 -87.013  1.00 27.03  ? 468  PHE B C     1 
ATOM   6981  O O     . PHE B  1 468 ? 85.487  112.466 -86.284  1.00 26.98  ? 468  PHE B O     1 
ATOM   6982  C CB    . PHE B  1 468 ? 85.667  115.640 -86.439  1.00 29.29  ? 468  PHE B CB    1 
ATOM   6983  C CG    . PHE B  1 468 ? 84.358  115.308 -85.749  1.00 32.15  ? 468  PHE B CG    1 
ATOM   6984  C CD1   . PHE B  1 468 ? 84.232  115.411 -84.357  1.00 32.91  ? 468  PHE B CD1   1 
ATOM   6985  C CD2   . PHE B  1 468 ? 83.225  114.967 -86.509  1.00 32.49  ? 468  PHE B CD2   1 
ATOM   6986  C CE1   . PHE B  1 468 ? 83.001  115.191 -83.729  1.00 33.80  ? 468  PHE B CE1   1 
ATOM   6987  C CE2   . PHE B  1 468 ? 81.983  114.742 -85.900  1.00 31.57  ? 468  PHE B CE2   1 
ATOM   6988  C CZ    . PHE B  1 468 ? 81.866  114.852 -84.509  1.00 34.93  ? 468  PHE B CZ    1 
ATOM   6989  N N     . GLY B  1 469 ? 86.418  112.903 -88.284  1.00 25.20  ? 469  GLY B N     1 
ATOM   6990  C CA    . GLY B  1 469 ? 85.880  111.683 -88.858  1.00 25.81  ? 469  GLY B CA    1 
ATOM   6991  C C     . GLY B  1 469 ? 84.776  111.941 -89.886  1.00 24.74  ? 469  GLY B C     1 
ATOM   6992  O O     . GLY B  1 469 ? 84.596  111.151 -90.785  1.00 25.17  ? 469  GLY B O     1 
ATOM   6993  N N     . LYS B  1 470 ? 84.067  113.057 -89.765  1.00 23.88  ? 470  LYS B N     1 
ATOM   6994  C CA    . LYS B  1 470 ? 82.994  113.389 -90.688  1.00 23.20  ? 470  LYS B CA    1 
ATOM   6995  C C     . LYS B  1 470 ? 83.018  114.865 -90.982  1.00 21.73  ? 470  LYS B C     1 
ATOM   6996  O O     . LYS B  1 470 ? 83.286  115.646 -90.091  1.00 21.29  ? 470  LYS B O     1 
ATOM   6997  C CB    . LYS B  1 470 ? 81.624  113.117 -90.046  1.00 25.27  ? 470  LYS B CB    1 
ATOM   6998  C CG    . LYS B  1 470 ? 81.298  111.682 -89.734  1.00 28.75  ? 470  LYS B CG    1 
ATOM   6999  C CD    . LYS B  1 470 ? 79.951  111.584 -89.053  1.00 31.04  ? 470  LYS B CD    1 
ATOM   7000  C CE    . LYS B  1 470 ? 79.689  110.165 -88.525  1.00 33.61  ? 470  LYS B CE    1 
ATOM   7001  N NZ    . LYS B  1 470 ? 78.401  110.115 -87.752  1.00 36.06  ? 470  LYS B NZ    1 
ATOM   7002  N N     . SER B  1 471 ? 82.737  115.255 -92.219  1.00 20.82  ? 471  SER B N     1 
ATOM   7003  C CA    . SER B  1 471 ? 82.615  116.687 -92.550  1.00 21.96  ? 471  SER B CA    1 
ATOM   7004  C C     . SER B  1 471 ? 81.082  116.946 -92.343  1.00 19.70  ? 471  SER B C     1 
ATOM   7005  O O     . SER B  1 471 ? 80.343  116.025 -92.023  1.00 20.55  ? 471  SER B O     1 
ATOM   7006  C CB    . SER B  1 471 ? 82.981  116.924 -94.021  1.00 21.39  ? 471  SER B CB    1 
ATOM   7007  O OG    . SER B  1 471 ? 82.002  116.304 -94.834  1.00 25.46  ? 471  SER B OG    1 
ATOM   7008  N N     . ILE B  1 472 ? 80.615  118.172 -92.497  1.00 19.94  ? 472  ILE B N     1 
ATOM   7009  C CA    . ILE B  1 472 ? 79.182  118.462 -92.364  1.00 19.77  ? 472  ILE B CA    1 
ATOM   7010  C C     . ILE B  1 472 ? 78.351  118.154 -93.654  1.00 21.21  ? 472  ILE B C     1 
ATOM   7011  O O     . ILE B  1 472 ? 77.286  117.520 -93.593  1.00 22.74  ? 472  ILE B O     1 
ATOM   7012  C CB    . ILE B  1 472 ? 78.930  119.958 -92.047  1.00 19.57  ? 472  ILE B CB    1 
ATOM   7013  C CG1   . ILE B  1 472 ? 79.479  120.313 -90.658  1.00 20.68  ? 472  ILE B CG1   1 
ATOM   7014  C CG2   . ILE B  1 472 ? 77.399  120.266 -92.166  1.00 17.55  ? 472  ILE B CG2   1 
ATOM   7015  C CD1   . ILE B  1 472 ? 78.788  119.550 -89.538  1.00 19.78  ? 472  ILE B CD1   1 
ATOM   7016  N N     . ASN B  1 473 ? 78.846  118.625 -94.800  1.00 21.63  ? 473  ASN B N     1 
ATOM   7017  C CA    . ASN B  1 473 ? 78.155  118.500 -96.083  1.00 22.58  ? 473  ASN B CA    1 
ATOM   7018  C C     . ASN B  1 473 ? 78.332  117.272 -96.958  1.00 22.35  ? 473  ASN B C     1 
ATOM   7019  O O     . ASN B  1 473 ? 78.001  117.296 -98.137  1.00 21.32  ? 473  ASN B O     1 
ATOM   7020  C CB    . ASN B  1 473 ? 78.420  119.755 -96.911  1.00 23.44  ? 473  ASN B CB    1 
ATOM   7021  C CG    . ASN B  1 473 ? 77.768  120.982 -96.306  1.00 26.34  ? 473  ASN B CG    1 
ATOM   7022  O OD1   . ASN B  1 473 ? 76.543  121.138 -96.335  1.00 26.46  ? 473  ASN B OD1   1 
ATOM   7023  N ND2   . ASN B  1 473 ? 78.589  121.856 -95.734  1.00 27.28  ? 473  ASN B ND2   1 
ATOM   7024  N N     . PHE B  1 474 ? 78.878  116.209 -96.395  1.00 22.66  ? 474  PHE B N     1 
ATOM   7025  C CA    . PHE B  1 474 ? 79.023  114.990 -97.138  1.00 26.69  ? 474  PHE B CA    1 
ATOM   7026  C C     . PHE B  1 474 ? 79.135  113.879 -96.112  1.00 27.79  ? 474  PHE B C     1 
ATOM   7027  O O     . PHE B  1 474 ? 78.765  112.734 -96.433  1.00 25.28  ? 474  PHE B O     1 
ATOM   7028  C CB    . PHE B  1 474 ? 80.265  115.028 -98.035  1.00 28.33  ? 474  PHE B CB    1 
ATOM   7029  C CG    . PHE B  1 474 ? 80.379  113.847 -98.954  1.00 30.63  ? 474  PHE B CG    1 
ATOM   7030  C CD1   . PHE B  1 474 ? 79.516  113.718 -100.048 1.00 31.80  ? 474  PHE B CD1   1 
ATOM   7031  C CD2   . PHE B  1 474 ? 81.315  112.838 -98.701  1.00 30.62  ? 474  PHE B CD2   1 
ATOM   7032  C CE1   . PHE B  1 474 ? 79.581  112.602 -100.879 1.00 31.30  ? 474  PHE B CE1   1 
ATOM   7033  C CE2   . PHE B  1 474 ? 81.390  111.713 -99.522  1.00 32.38  ? 474  PHE B CE2   1 
ATOM   7034  C CZ    . PHE B  1 474 ? 80.518  111.596 -100.616 1.00 33.16  ? 474  PHE B CZ    1 
ATOM   7035  O OXT   . PHE B  1 474 ? 79.605  114.181 -95.000  1.00 31.71  ? 474  PHE B OXT   1 
ATOM   7036  N N     . PRO C  1 4   ? 223.767 147.436 -120.701 1.00 71.99  ? 4    PRO C N     1 
ATOM   7037  C CA    . PRO C  1 4   ? 223.900 146.632 -119.454 1.00 72.34  ? 4    PRO C CA    1 
ATOM   7038  C C     . PRO C  1 4   ? 222.937 147.127 -118.372 1.00 72.42  ? 4    PRO C C     1 
ATOM   7039  O O     . PRO C  1 4   ? 223.009 148.281 -117.954 1.00 72.79  ? 4    PRO C O     1 
ATOM   7040  C CB    . PRO C  1 4   ? 225.346 146.756 -119.009 1.00 71.91  ? 4    PRO C CB    1 
ATOM   7041  C CG    . PRO C  1 4   ? 226.034 146.936 -120.362 1.00 72.10  ? 4    PRO C CG    1 
ATOM   7042  C CD    . PRO C  1 4   ? 225.096 147.866 -121.163 1.00 71.74  ? 4    PRO C CD    1 
ATOM   7043  N N     . ILE C  1 5   ? 222.042 146.246 -117.920 1.00 72.33  ? 5    ILE C N     1 
ATOM   7044  C CA    . ILE C  1 5   ? 221.035 146.600 -116.917 1.00 71.67  ? 5    ILE C CA    1 
ATOM   7045  C C     . ILE C  1 5   ? 221.252 145.976 -115.543 1.00 71.18  ? 5    ILE C C     1 
ATOM   7046  O O     . ILE C  1 5   ? 221.712 144.838 -115.423 1.00 71.06  ? 5    ILE C O     1 
ATOM   7047  C CB    . ILE C  1 5   ? 219.607 146.200 -117.397 1.00 72.27  ? 5    ILE C CB    1 
ATOM   7048  C CG1   . ILE C  1 5   ? 219.330 146.783 -118.787 1.00 72.31  ? 5    ILE C CG1   1 
ATOM   7049  C CG2   . ILE C  1 5   ? 218.560 146.688 -116.401 1.00 72.22  ? 5    ILE C CG2   1 
ATOM   7050  C CD1   . ILE C  1 5   ? 219.441 148.295 -118.873 1.00 71.43  ? 5    ILE C CD1   1 
ATOM   7051  N N     . ASP C  1 6   ? 220.902 146.739 -114.509 1.00 70.55  ? 6    ASP C N     1 
ATOM   7052  C CA    . ASP C  1 6   ? 221.020 146.290 -113.123 1.00 69.89  ? 6    ASP C CA    1 
ATOM   7053  C C     . ASP C  1 6   ? 219.678 145.785 -112.600 1.00 68.24  ? 6    ASP C C     1 
ATOM   7054  O O     . ASP C  1 6   ? 218.621 146.316 -112.955 1.00 67.73  ? 6    ASP C O     1 
ATOM   7055  C CB    . ASP C  1 6   ? 221.519 147.434 -112.232 1.00 71.48  ? 6    ASP C CB    1 
ATOM   7056  C CG    . ASP C  1 6   ? 223.033 147.517 -112.185 1.00 73.51  ? 6    ASP C CG    1 
ATOM   7057  O OD1   . ASP C  1 6   ? 223.666 147.621 -113.263 1.00 74.36  ? 6    ASP C OD1   1 
ATOM   7058  O OD2   . ASP C  1 6   ? 223.585 147.472 -111.063 1.00 74.61  ? 6    ASP C OD2   1 
ATOM   7059  N N     . ALA C  1 7   ? 219.724 144.763 -111.747 1.00 66.17  ? 7    ALA C N     1 
ATOM   7060  C CA    . ALA C  1 7   ? 218.502 144.199 -111.203 1.00 63.67  ? 7    ALA C CA    1 
ATOM   7061  C C     . ALA C  1 7   ? 218.651 143.404 -109.912 1.00 61.97  ? 7    ALA C C     1 
ATOM   7062  O O     . ALA C  1 7   ? 219.689 142.791 -109.646 1.00 60.81  ? 7    ALA C O     1 
ATOM   7063  C CB    . ALA C  1 7   ? 217.840 143.323 -112.256 1.00 64.10  ? 7    ALA C CB    1 
ATOM   7064  N N     . ASP C  1 8   ? 217.588 143.441 -109.110 1.00 60.72  ? 8    ASP C N     1 
ATOM   7065  C CA    . ASP C  1 8   ? 217.505 142.685 -107.859 1.00 58.87  ? 8    ASP C CA    1 
ATOM   7066  C C     . ASP C  1 8   ? 216.891 141.331 -108.246 1.00 57.23  ? 8    ASP C C     1 
ATOM   7067  O O     . ASP C  1 8   ? 217.337 140.267 -107.797 1.00 56.09  ? 8    ASP C O     1 
ATOM   7068  C CB    . ASP C  1 8   ? 216.575 143.384 -106.856 1.00 59.31  ? 8    ASP C CB    1 
ATOM   7069  C CG    . ASP C  1 8   ? 217.237 144.555 -106.150 1.00 60.43  ? 8    ASP C CG    1 
ATOM   7070  O OD1   . ASP C  1 8   ? 218.332 144.368 -105.574 1.00 61.25  ? 8    ASP C OD1   1 
ATOM   7071  O OD2   . ASP C  1 8   ? 216.656 145.659 -106.159 1.00 59.51  ? 8    ASP C OD2   1 
ATOM   7072  N N     . VAL C  1 9   ? 215.867 141.398 -109.099 1.00 55.44  ? 9    VAL C N     1 
ATOM   7073  C CA    . VAL C  1 9   ? 215.154 140.216 -109.571 1.00 53.20  ? 9    VAL C CA    1 
ATOM   7074  C C     . VAL C  1 9   ? 214.930 140.215 -111.084 1.00 50.93  ? 9    VAL C C     1 
ATOM   7075  O O     . VAL C  1 9   ? 214.341 141.141 -111.640 1.00 48.95  ? 9    VAL C O     1 
ATOM   7076  C CB    . VAL C  1 9   ? 213.763 140.097 -108.904 1.00 53.66  ? 9    VAL C CB    1 
ATOM   7077  C CG1   . VAL C  1 9   ? 213.128 138.751 -109.261 1.00 53.58  ? 9    VAL C CG1   1 
ATOM   7078  C CG2   . VAL C  1 9   ? 213.881 140.275 -107.397 1.00 53.61  ? 9    VAL C CG2   1 
ATOM   7079  N N     . THR C  1 10  ? 215.402 139.169 -111.745 1.00 49.72  ? 10   THR C N     1 
ATOM   7080  C CA    . THR C  1 10  ? 215.193 139.057 -113.178 1.00 49.65  ? 10   THR C CA    1 
ATOM   7081  C C     . THR C  1 10  ? 214.351 137.805 -113.453 1.00 48.93  ? 10   THR C C     1 
ATOM   7082  O O     . THR C  1 10  ? 214.799 136.671 -113.261 1.00 48.45  ? 10   THR C O     1 
ATOM   7083  C CB    . THR C  1 10  ? 216.536 139.003 -113.947 1.00 49.53  ? 10   THR C CB    1 
ATOM   7084  O OG1   . THR C  1 10  ? 217.229 140.243 -113.749 1.00 50.55  ? 10   THR C OG1   1 
ATOM   7085  C CG2   . THR C  1 10  ? 216.299 138.813 -115.451 1.00 48.89  ? 10   THR C CG2   1 
ATOM   7086  N N     . VAL C  1 11  ? 213.115 138.039 -113.887 1.00 48.09  ? 11   VAL C N     1 
ATOM   7087  C CA    . VAL C  1 11  ? 212.169 136.971 -114.185 1.00 46.19  ? 11   VAL C CA    1 
ATOM   7088  C C     . VAL C  1 11  ? 212.182 136.597 -115.674 1.00 45.38  ? 11   VAL C C     1 
ATOM   7089  O O     . VAL C  1 11  ? 211.889 137.426 -116.536 1.00 43.67  ? 11   VAL C O     1 
ATOM   7090  C CB    . VAL C  1 11  ? 210.736 137.394 -113.761 1.00 46.16  ? 11   VAL C CB    1 
ATOM   7091  C CG1   . VAL C  1 11  ? 209.734 136.289 -114.095 1.00 44.65  ? 11   VAL C CG1   1 
ATOM   7092  C CG2   . VAL C  1 11  ? 210.710 137.704 -112.251 1.00 45.59  ? 11   VAL C CG2   1 
ATOM   7093  N N     . ILE C  1 12  ? 212.537 135.347 -115.970 1.00 44.77  ? 12   ILE C N     1 
ATOM   7094  C CA    . ILE C  1 12  ? 212.560 134.896 -117.357 1.00 43.61  ? 12   ILE C CA    1 
ATOM   7095  C C     . ILE C  1 12  ? 211.244 134.209 -117.707 1.00 43.05  ? 12   ILE C C     1 
ATOM   7096  O O     . ILE C  1 12  ? 211.051 133.017 -117.451 1.00 42.34  ? 12   ILE C O     1 
ATOM   7097  C CB    . ILE C  1 12  ? 213.707 133.920 -117.617 1.00 43.58  ? 12   ILE C CB    1 
ATOM   7098  C CG1   . ILE C  1 12  ? 215.034 134.539 -117.159 1.00 42.91  ? 12   ILE C CG1   1 
ATOM   7099  C CG2   . ILE C  1 12  ? 213.763 133.604 -119.104 1.00 43.53  ? 12   ILE C CG2   1 
ATOM   7100  C CD1   . ILE C  1 12  ? 216.115 133.513 -116.848 1.00 43.64  ? 12   ILE C CD1   1 
ATOM   7101  N N     . GLY C  1 13  ? 210.333 134.978 -118.293 1.00 42.27  ? 13   GLY C N     1 
ATOM   7102  C CA    . GLY C  1 13  ? 209.043 134.437 -118.662 1.00 41.32  ? 13   GLY C CA    1 
ATOM   7103  C C     . GLY C  1 13  ? 207.919 135.322 -118.166 1.00 40.52  ? 13   GLY C C     1 
ATOM   7104  O O     . GLY C  1 13  ? 207.894 135.731 -116.998 1.00 39.88  ? 13   GLY C O     1 
ATOM   7105  N N     . SER C  1 14  ? 206.979 135.624 -119.053 1.00 40.28  ? 14   SER C N     1 
ATOM   7106  C CA    . SER C  1 14  ? 205.851 136.464 -118.675 1.00 40.87  ? 14   SER C CA    1 
ATOM   7107  C C     . SER C  1 14  ? 204.508 135.718 -118.595 1.00 38.97  ? 14   SER C C     1 
ATOM   7108  O O     . SER C  1 14  ? 203.451 136.321 -118.789 1.00 39.67  ? 14   SER C O     1 
ATOM   7109  C CB    . SER C  1 14  ? 205.732 137.653 -119.635 1.00 40.21  ? 14   SER C CB    1 
ATOM   7110  O OG    . SER C  1 14  ? 205.593 137.219 -120.973 1.00 42.38  ? 14   SER C OG    1 
ATOM   7111  N N     . GLY C  1 15  ? 204.549 134.413 -118.321 1.00 38.51  ? 15   GLY C N     1 
ATOM   7112  C CA    . GLY C  1 15  ? 203.309 133.656 -118.179 1.00 36.55  ? 15   GLY C CA    1 
ATOM   7113  C C     . GLY C  1 15  ? 202.719 133.944 -116.801 1.00 36.04  ? 15   GLY C C     1 
ATOM   7114  O O     . GLY C  1 15  ? 203.295 134.733 -116.038 1.00 34.71  ? 15   GLY C O     1 
ATOM   7115  N N     . PRO C  1 16  ? 201.578 133.339 -116.434 1.00 35.98  ? 16   PRO C N     1 
ATOM   7116  C CA    . PRO C  1 16  ? 201.035 133.635 -115.100 1.00 35.37  ? 16   PRO C CA    1 
ATOM   7117  C C     . PRO C  1 16  ? 202.036 133.566 -113.943 1.00 35.25  ? 16   PRO C C     1 
ATOM   7118  O O     . PRO C  1 16  ? 201.937 134.338 -112.989 1.00 34.45  ? 16   PRO C O     1 
ATOM   7119  C CB    . PRO C  1 16  ? 199.884 132.628 -114.948 1.00 35.29  ? 16   PRO C CB    1 
ATOM   7120  C CG    . PRO C  1 16  ? 200.143 131.586 -116.002 1.00 36.25  ? 16   PRO C CG    1 
ATOM   7121  C CD    . PRO C  1 16  ? 200.716 132.387 -117.148 1.00 35.80  ? 16   PRO C CD    1 
ATOM   7122  N N     . GLY C  1 17  ? 202.985 132.635 -114.019 1.00 35.71  ? 17   GLY C N     1 
ATOM   7123  C CA    . GLY C  1 17  ? 203.971 132.528 -112.963 1.00 36.76  ? 17   GLY C CA    1 
ATOM   7124  C C     . GLY C  1 17  ? 204.939 133.716 -112.957 1.00 37.98  ? 17   GLY C C     1 
ATOM   7125  O O     . GLY C  1 17  ? 205.118 134.412 -111.942 1.00 36.83  ? 17   GLY C O     1 
ATOM   7126  N N     . GLY C  1 18  ? 205.555 133.955 -114.111 1.00 37.69  ? 18   GLY C N     1 
ATOM   7127  C CA    . GLY C  1 18  ? 206.517 135.039 -114.240 1.00 36.49  ? 18   GLY C CA    1 
ATOM   7128  C C     . GLY C  1 18  ? 206.008 136.452 -114.085 1.00 35.44  ? 18   GLY C C     1 
ATOM   7129  O O     . GLY C  1 18  ? 206.520 137.217 -113.262 1.00 36.64  ? 18   GLY C O     1 
ATOM   7130  N N     . TYR C  1 19  ? 204.990 136.814 -114.852 1.00 35.04  ? 19   TYR C N     1 
ATOM   7131  C CA    . TYR C  1 19  ? 204.478 138.178 -114.791 1.00 35.34  ? 19   TYR C CA    1 
ATOM   7132  C C     . TYR C  1 19  ? 203.853 138.552 -113.442 1.00 34.93  ? 19   TYR C C     1 
ATOM   7133  O O     . TYR C  1 19  ? 203.900 139.714 -113.036 1.00 32.92  ? 19   TYR C O     1 
ATOM   7134  C CB    . TYR C  1 19  ? 203.508 138.419 -115.954 1.00 35.85  ? 19   TYR C CB    1 
ATOM   7135  C CG    . TYR C  1 19  ? 202.058 138.356 -115.589 1.00 37.56  ? 19   TYR C CG    1 
ATOM   7136  C CD1   . TYR C  1 19  ? 201.407 139.472 -115.063 1.00 38.51  ? 19   TYR C CD1   1 
ATOM   7137  C CD2   . TYR C  1 19  ? 201.327 137.187 -115.779 1.00 36.91  ? 19   TYR C CD2   1 
ATOM   7138  C CE1   . TYR C  1 19  ? 200.060 139.429 -114.737 1.00 38.50  ? 19   TYR C CE1   1 
ATOM   7139  C CE2   . TYR C  1 19  ? 199.977 137.128 -115.462 1.00 39.89  ? 19   TYR C CE2   1 
ATOM   7140  C CZ    . TYR C  1 19  ? 199.342 138.251 -114.941 1.00 39.80  ? 19   TYR C CZ    1 
ATOM   7141  O OH    . TYR C  1 19  ? 197.990 138.213 -114.653 1.00 39.78  ? 19   TYR C OH    1 
ATOM   7142  N N     . VAL C  1 20  ? 203.264 137.580 -112.754 1.00 35.42  ? 20   VAL C N     1 
ATOM   7143  C CA    . VAL C  1 20  ? 202.700 137.867 -111.436 1.00 36.23  ? 20   VAL C CA    1 
ATOM   7144  C C     . VAL C  1 20  ? 203.858 137.980 -110.441 1.00 36.31  ? 20   VAL C C     1 
ATOM   7145  O O     . VAL C  1 20  ? 203.809 138.794 -109.525 1.00 36.61  ? 20   VAL C O     1 
ATOM   7146  C CB    . VAL C  1 20  ? 201.688 136.766 -110.963 1.00 36.76  ? 20   VAL C CB    1 
ATOM   7147  C CG1   . VAL C  1 20  ? 201.408 136.897 -109.465 1.00 35.41  ? 20   VAL C CG1   1 
ATOM   7148  C CG2   . VAL C  1 20  ? 200.370 136.914 -111.730 1.00 36.15  ? 20   VAL C CG2   1 
ATOM   7149  N N     . ALA C  1 21  ? 204.893 137.159 -110.631 1.00 37.31  ? 21   ALA C N     1 
ATOM   7150  C CA    . ALA C  1 21  ? 206.089 137.184 -109.787 1.00 38.46  ? 21   ALA C CA    1 
ATOM   7151  C C     . ALA C  1 21  ? 206.797 138.553 -109.941 1.00 39.26  ? 21   ALA C C     1 
ATOM   7152  O O     . ALA C  1 21  ? 207.225 139.168 -108.953 1.00 38.67  ? 21   ALA C O     1 
ATOM   7153  C CB    . ALA C  1 21  ? 207.035 136.052 -110.197 1.00 36.69  ? 21   ALA C CB    1 
ATOM   7154  N N     . ALA C  1 22  ? 206.897 139.011 -111.190 1.00 39.46  ? 22   ALA C N     1 
ATOM   7155  C CA    . ALA C  1 22  ? 207.526 140.284 -111.528 1.00 40.54  ? 22   ALA C CA    1 
ATOM   7156  C C     . ALA C  1 22  ? 206.816 141.443 -110.826 1.00 40.42  ? 22   ALA C C     1 
ATOM   7157  O O     . ALA C  1 22  ? 207.447 142.247 -110.127 1.00 41.37  ? 22   ALA C O     1 
ATOM   7158  C CB    . ALA C  1 22  ? 207.502 140.493 -113.053 1.00 39.97  ? 22   ALA C CB    1 
ATOM   7159  N N     . ILE C  1 23  ? 205.502 141.516 -111.006 1.00 39.57  ? 23   ILE C N     1 
ATOM   7160  C CA    . ILE C  1 23  ? 204.696 142.565 -110.396 1.00 38.19  ? 23   ILE C CA    1 
ATOM   7161  C C     . ILE C  1 23  ? 204.829 142.592 -108.871 1.00 37.91  ? 23   ILE C C     1 
ATOM   7162  O O     . ILE C  1 23  ? 205.082 143.645 -108.290 1.00 35.74  ? 23   ILE C O     1 
ATOM   7163  C CB    . ILE C  1 23  ? 203.207 142.398 -110.773 1.00 38.47  ? 23   ILE C CB    1 
ATOM   7164  C CG1   . ILE C  1 23  ? 203.027 142.634 -112.277 1.00 39.88  ? 23   ILE C CG1   1 
ATOM   7165  C CG2   . ILE C  1 23  ? 202.332 143.357 -109.953 1.00 37.89  ? 23   ILE C CG2   1 
ATOM   7166  C CD1   . ILE C  1 23  ? 201.573 142.535 -112.763 1.00 37.13  ? 23   ILE C CD1   1 
ATOM   7167  N N     . LYS C  1 24  ? 204.654 141.431 -108.239 1.00 37.51  ? 24   LYS C N     1 
ATOM   7168  C CA    . LYS C  1 24  ? 204.748 141.298 -106.785 1.00 38.49  ? 24   LYS C CA    1 
ATOM   7169  C C     . LYS C  1 24  ? 206.145 141.680 -106.266 1.00 39.20  ? 24   LYS C C     1 
ATOM   7170  O O     . LYS C  1 24  ? 206.265 142.258 -105.181 1.00 38.37  ? 24   LYS C O     1 
ATOM   7171  C CB    . LYS C  1 24  ? 204.415 139.858 -106.356 1.00 36.49  ? 24   LYS C CB    1 
ATOM   7172  C CG    . LYS C  1 24  ? 204.260 139.677 -104.852 1.00 36.21  ? 24   LYS C CG    1 
ATOM   7173  C CD    . LYS C  1 24  ? 203.111 140.507 -104.308 1.00 37.01  ? 24   LYS C CD    1 
ATOM   7174  C CE    . LYS C  1 24  ? 202.988 140.332 -102.793 1.00 38.17  ? 24   LYS C CE    1 
ATOM   7175  N NZ    . LYS C  1 24  ? 201.826 141.067 -102.235 1.00 35.72  ? 24   LYS C NZ    1 
ATOM   7176  N N     . ALA C  1 25  ? 207.182 141.332 -107.034 1.00 38.87  ? 25   ALA C N     1 
ATOM   7177  C CA    . ALA C  1 25  ? 208.563 141.648 -106.684 1.00 40.32  ? 25   ALA C CA    1 
ATOM   7178  C C     . ALA C  1 25  ? 208.734 143.170 -106.701 1.00 41.96  ? 25   ALA C C     1 
ATOM   7179  O O     . ALA C  1 25  ? 209.343 143.752 -105.789 1.00 40.97  ? 25   ALA C O     1 
ATOM   7180  C CB    . ALA C  1 25  ? 209.527 141.002 -107.686 1.00 40.17  ? 25   ALA C CB    1 
ATOM   7181  N N     . ALA C  1 26  ? 208.182 143.807 -107.731 1.00 41.85  ? 26   ALA C N     1 
ATOM   7182  C CA    . ALA C  1 26  ? 208.251 145.255 -107.854 1.00 42.77  ? 26   ALA C CA    1 
ATOM   7183  C C     . ALA C  1 26  ? 207.599 145.892 -106.636 1.00 43.51  ? 26   ALA C C     1 
ATOM   7184  O O     . ALA C  1 26  ? 208.179 146.773 -105.989 1.00 44.11  ? 26   ALA C O     1 
ATOM   7185  C CB    . ALA C  1 26  ? 207.543 145.708 -109.115 1.00 41.47  ? 26   ALA C CB    1 
ATOM   7186  N N     . GLN C  1 27  ? 206.381 145.446 -106.336 1.00 43.74  ? 27   GLN C N     1 
ATOM   7187  C CA    . GLN C  1 27  ? 205.617 145.955 -105.199 1.00 44.25  ? 27   GLN C CA    1 
ATOM   7188  C C     . GLN C  1 27  ? 206.286 145.710 -103.834 1.00 44.51  ? 27   GLN C C     1 
ATOM   7189  O O     . GLN C  1 27  ? 205.940 146.370 -102.848 1.00 44.50  ? 27   GLN C O     1 
ATOM   7190  C CB    . GLN C  1 27  ? 204.212 145.332 -105.199 1.00 43.87  ? 27   GLN C CB    1 
ATOM   7191  C CG    . GLN C  1 27  ? 203.412 145.569 -106.464 1.00 42.77  ? 27   GLN C CG    1 
ATOM   7192  C CD    . GLN C  1 27  ? 201.996 145.020 -106.356 1.00 43.23  ? 27   GLN C CD    1 
ATOM   7193  O OE1   . GLN C  1 27  ? 201.736 144.111 -105.564 1.00 42.23  ? 27   GLN C OE1   1 
ATOM   7194  N NE2   . GLN C  1 27  ? 201.078 145.563 -107.165 1.00 41.36  ? 27   GLN C NE2   1 
ATOM   7195  N N     . LEU C  1 28  ? 207.221 144.760 -103.781 1.00 45.08  ? 28   LEU C N     1 
ATOM   7196  C CA    . LEU C  1 28  ? 207.937 144.433 -102.551 1.00 46.20  ? 28   LEU C CA    1 
ATOM   7197  C C     . LEU C  1 28  ? 209.241 145.239 -102.400 1.00 47.58  ? 28   LEU C C     1 
ATOM   7198  O O     . LEU C  1 28  ? 210.009 145.004 -101.470 1.00 47.99  ? 28   LEU C O     1 
ATOM   7199  C CB    . LEU C  1 28  ? 208.255 142.927 -102.497 1.00 44.86  ? 28   LEU C CB    1 
ATOM   7200  C CG    . LEU C  1 28  ? 207.088 141.961 -102.292 1.00 45.76  ? 28   LEU C CG    1 
ATOM   7201  C CD1   . LEU C  1 28  ? 207.602 140.535 -102.214 1.00 44.25  ? 28   LEU C CD1   1 
ATOM   7202  C CD2   . LEU C  1 28  ? 206.344 142.325 -101.001 1.00 46.53  ? 28   LEU C CD2   1 
ATOM   7203  N N     . GLY C  1 29  ? 209.487 146.180 -103.310 1.00 48.46  ? 29   GLY C N     1 
ATOM   7204  C CA    . GLY C  1 29  ? 210.697 146.984 -103.230 1.00 49.29  ? 29   GLY C CA    1 
ATOM   7205  C C     . GLY C  1 29  ? 211.890 146.377 -103.953 1.00 50.45  ? 29   GLY C C     1 
ATOM   7206  O O     . GLY C  1 29  ? 213.033 146.525 -103.512 1.00 51.59  ? 29   GLY C O     1 
ATOM   7207  N N     . PHE C  1 30  ? 211.625 145.686 -105.061 1.00 50.12  ? 30   PHE C N     1 
ATOM   7208  C CA    . PHE C  1 30  ? 212.676 145.065 -105.857 1.00 49.56  ? 30   PHE C CA    1 
ATOM   7209  C C     . PHE C  1 30  ? 212.784 145.725 -107.228 1.00 50.28  ? 30   PHE C C     1 
ATOM   7210  O O     . PHE C  1 30  ? 211.766 146.061 -107.858 1.00 50.69  ? 30   PHE C O     1 
ATOM   7211  C CB    . PHE C  1 30  ? 212.402 143.572 -106.079 1.00 48.04  ? 30   PHE C CB    1 
ATOM   7212  C CG    . PHE C  1 30  ? 212.745 142.692 -104.910 1.00 47.54  ? 30   PHE C CG    1 
ATOM   7213  C CD1   . PHE C  1 30  ? 214.058 142.585 -104.463 1.00 46.35  ? 30   PHE C CD1   1 
ATOM   7214  C CD2   . PHE C  1 30  ? 211.752 141.916 -104.289 1.00 47.32  ? 30   PHE C CD2   1 
ATOM   7215  C CE1   . PHE C  1 30  ? 214.391 141.717 -103.426 1.00 45.74  ? 30   PHE C CE1   1 
ATOM   7216  C CE2   . PHE C  1 30  ? 212.067 141.042 -103.248 1.00 45.75  ? 30   PHE C CE2   1 
ATOM   7217  C CZ    . PHE C  1 30  ? 213.394 140.941 -102.815 1.00 46.80  ? 30   PHE C CZ    1 
ATOM   7218  N N     . LYS C  1 31  ? 214.021 145.924 -107.672 1.00 50.41  ? 31   LYS C N     1 
ATOM   7219  C CA    . LYS C  1 31  ? 214.300 146.483 -108.996 1.00 51.13  ? 31   LYS C CA    1 
ATOM   7220  C C     . LYS C  1 31  ? 214.031 145.249 -109.851 1.00 49.02  ? 31   LYS C C     1 
ATOM   7221  O O     . LYS C  1 31  ? 214.783 144.271 -109.788 1.00 48.88  ? 31   LYS C O     1 
ATOM   7222  C CB    . LYS C  1 31  ? 215.774 146.910 -109.089 1.00 52.66  ? 31   LYS C CB    1 
ATOM   7223  C CG    . LYS C  1 31  ? 216.325 147.012 -110.508 1.00 56.80  ? 31   LYS C CG    1 
ATOM   7224  C CD    . LYS C  1 31  ? 215.925 148.308 -111.199 1.00 61.07  ? 31   LYS C CD    1 
ATOM   7225  C CE    . LYS C  1 31  ? 216.773 149.500 -110.723 1.00 63.01  ? 31   LYS C CE    1 
ATOM   7226  N NZ    . LYS C  1 31  ? 216.600 149.782 -109.264 1.00 65.18  ? 31   LYS C NZ    1 
ATOM   7227  N N     . THR C  1 32  ? 212.970 145.283 -110.649 1.00 48.08  ? 32   THR C N     1 
ATOM   7228  C CA    . THR C  1 32  ? 212.603 144.085 -111.411 1.00 46.74  ? 32   THR C CA    1 
ATOM   7229  C C     . THR C  1 32  ? 212.594 144.114 -112.939 1.00 46.02  ? 32   THR C C     1 
ATOM   7230  O O     . THR C  1 32  ? 212.072 145.035 -113.571 1.00 45.09  ? 32   THR C O     1 
ATOM   7231  C CB    . THR C  1 32  ? 211.215 143.560 -110.915 1.00 46.06  ? 32   THR C CB    1 
ATOM   7232  O OG1   . THR C  1 32  ? 211.223 143.488 -109.483 1.00 43.53  ? 32   THR C OG1   1 
ATOM   7233  C CG2   . THR C  1 32  ? 210.924 142.157 -111.471 1.00 44.34  ? 32   THR C CG2   1 
ATOM   7234  N N     . VAL C  1 33  ? 213.159 143.059 -113.516 1.00 46.13  ? 33   VAL C N     1 
ATOM   7235  C CA    . VAL C  1 33  ? 213.217 142.902 -114.957 1.00 46.46  ? 33   VAL C CA    1 
ATOM   7236  C C     . VAL C  1 33  ? 212.487 141.618 -115.365 1.00 46.36  ? 33   VAL C C     1 
ATOM   7237  O O     . VAL C  1 33  ? 212.602 140.590 -114.697 1.00 45.72  ? 33   VAL C O     1 
ATOM   7238  C CB    . VAL C  1 33  ? 214.673 142.819 -115.442 1.00 46.42  ? 33   VAL C CB    1 
ATOM   7239  C CG1   . VAL C  1 33  ? 214.705 142.557 -116.935 1.00 46.91  ? 33   VAL C CG1   1 
ATOM   7240  C CG2   . VAL C  1 33  ? 215.395 144.118 -115.117 1.00 47.27  ? 33   VAL C CG2   1 
ATOM   7241  N N     . CYS C  1 34  ? 211.728 141.686 -116.457 1.00 46.22  ? 34   CYS C N     1 
ATOM   7242  C CA    . CYS C  1 34  ? 211.007 140.521 -116.954 1.00 46.03  ? 34   CYS C CA    1 
ATOM   7243  C C     . CYS C  1 34  ? 211.346 140.301 -118.423 1.00 45.57  ? 34   CYS C C     1 
ATOM   7244  O O     . CYS C  1 34  ? 211.104 141.158 -119.263 1.00 44.25  ? 34   CYS C O     1 
ATOM   7245  C CB    . CYS C  1 34  ? 209.486 140.689 -116.785 1.00 46.33  ? 34   CYS C CB    1 
ATOM   7246  S SG    . CYS C  1 34  ? 208.536 139.227 -117.355 1.00 44.77  ? 34   CYS C SG    1 
ATOM   7247  N N     . ILE C  1 35  ? 211.907 139.134 -118.709 1.00 46.56  ? 35   ILE C N     1 
ATOM   7248  C CA    . ILE C  1 35  ? 212.300 138.759 -120.062 1.00 48.04  ? 35   ILE C CA    1 
ATOM   7249  C C     . ILE C  1 35  ? 211.267 137.825 -120.729 1.00 48.55  ? 35   ILE C C     1 
ATOM   7250  O O     . ILE C  1 35  ? 210.908 136.777 -120.172 1.00 49.42  ? 35   ILE C O     1 
ATOM   7251  C CB    . ILE C  1 35  ? 213.686 138.053 -120.033 1.00 48.60  ? 35   ILE C CB    1 
ATOM   7252  C CG1   . ILE C  1 35  ? 214.701 138.946 -119.307 1.00 48.56  ? 35   ILE C CG1   1 
ATOM   7253  C CG2   . ILE C  1 35  ? 214.157 137.741 -121.447 1.00 48.46  ? 35   ILE C CG2   1 
ATOM   7254  C CD1   . ILE C  1 35  ? 216.027 138.279 -119.024 1.00 48.75  ? 35   ILE C CD1   1 
ATOM   7255  N N     . GLU C  1 36  ? 210.798 138.212 -121.917 1.00 48.00  ? 36   GLU C N     1 
ATOM   7256  C CA    . GLU C  1 36  ? 209.834 137.421 -122.692 1.00 46.96  ? 36   GLU C CA    1 
ATOM   7257  C C     . GLU C  1 36  ? 210.266 137.275 -124.159 1.00 47.92  ? 36   GLU C C     1 
ATOM   7258  O O     . GLU C  1 36  ? 210.360 138.273 -124.885 1.00 47.77  ? 36   GLU C O     1 
ATOM   7259  C CB    . GLU C  1 36  ? 208.447 138.071 -122.656 1.00 45.66  ? 36   GLU C CB    1 
ATOM   7260  C CG    . GLU C  1 36  ? 207.394 137.308 -123.470 1.00 44.83  ? 36   GLU C CG    1 
ATOM   7261  C CD    . GLU C  1 36  ? 207.312 135.819 -123.080 1.00 43.56  ? 36   GLU C CD    1 
ATOM   7262  O OE1   . GLU C  1 36  ? 206.926 135.525 -121.926 1.00 42.19  ? 36   GLU C OE1   1 
ATOM   7263  O OE2   . GLU C  1 36  ? 207.638 134.942 -123.917 1.00 41.63  ? 36   GLU C OE2   1 
ATOM   7264  N N     . LYS C  1 37  ? 210.497 136.032 -124.594 1.00 48.07  ? 37   LYS C N     1 
ATOM   7265  C CA    . LYS C  1 37  ? 210.922 135.740 -125.966 1.00 48.68  ? 37   LYS C CA    1 
ATOM   7266  C C     . LYS C  1 37  ? 209.832 135.895 -127.035 1.00 49.98  ? 37   LYS C C     1 
ATOM   7267  O O     . LYS C  1 37  ? 210.141 136.068 -128.215 1.00 51.20  ? 37   LYS C O     1 
ATOM   7268  C CB    . LYS C  1 37  ? 211.494 134.316 -126.046 1.00 47.68  ? 37   LYS C CB    1 
ATOM   7269  C CG    . LYS C  1 37  ? 210.462 133.221 -125.737 1.00 43.68  ? 37   LYS C CG    1 
ATOM   7270  C CD    . LYS C  1 37  ? 211.044 131.830 -125.903 1.00 41.86  ? 37   LYS C CD    1 
ATOM   7271  C CE    . LYS C  1 37  ? 209.991 130.752 -125.677 1.00 39.29  ? 37   LYS C CE    1 
ATOM   7272  N NZ    . LYS C  1 37  ? 208.829 130.945 -126.582 1.00 36.46  ? 37   LYS C NZ    1 
ATOM   7273  N N     . ASN C  1 38  ? 208.562 135.833 -126.641 1.00 50.82  ? 38   ASN C N     1 
ATOM   7274  C CA    . ASN C  1 38  ? 207.470 135.957 -127.605 1.00 51.65  ? 38   ASN C CA    1 
ATOM   7275  C C     . ASN C  1 38  ? 207.064 137.396 -127.854 1.00 51.99  ? 38   ASN C C     1 
ATOM   7276  O O     . ASN C  1 38  ? 207.516 138.304 -127.161 1.00 51.51  ? 38   ASN C O     1 
ATOM   7277  C CB    . ASN C  1 38  ? 206.251 135.153 -127.147 1.00 52.12  ? 38   ASN C CB    1 
ATOM   7278  C CG    . ASN C  1 38  ? 206.546 133.672 -127.038 1.00 53.62  ? 38   ASN C CG    1 
ATOM   7279  O OD1   . ASN C  1 38  ? 207.550 133.188 -127.559 1.00 53.38  ? 38   ASN C OD1   1 
ATOM   7280  N ND2   . ASN C  1 38  ? 205.662 132.938 -126.367 1.00 54.69  ? 38   ASN C ND2   1 
ATOM   7281  N N     . GLU C  1 39  ? 206.201 137.612 -128.840 1.00 52.68  ? 39   GLU C N     1 
ATOM   7282  C CA    . GLU C  1 39  ? 205.795 138.972 -129.145 1.00 53.75  ? 39   GLU C CA    1 
ATOM   7283  C C     . GLU C  1 39  ? 204.740 139.589 -128.229 1.00 52.87  ? 39   GLU C C     1 
ATOM   7284  O O     . GLU C  1 39  ? 204.392 140.762 -128.378 1.00 53.62  ? 39   GLU C O     1 
ATOM   7285  C CB    . GLU C  1 39  ? 205.374 139.089 -130.609 1.00 56.88  ? 39   GLU C CB    1 
ATOM   7286  C CG    . GLU C  1 39  ? 204.385 138.057 -131.087 1.00 61.82  ? 39   GLU C CG    1 
ATOM   7287  C CD    . GLU C  1 39  ? 204.108 138.204 -132.577 1.00 64.51  ? 39   GLU C CD    1 
ATOM   7288  O OE1   . GLU C  1 39  ? 204.758 139.066 -133.214 1.00 65.86  ? 39   GLU C OE1   1 
ATOM   7289  O OE2   . GLU C  1 39  ? 203.249 137.462 -133.109 1.00 66.43  ? 39   GLU C OE2   1 
ATOM   7290  N N     . THR C  1 40  ? 204.218 138.816 -127.283 1.00 50.41  ? 40   THR C N     1 
ATOM   7291  C CA    . THR C  1 40  ? 203.267 139.374 -126.334 1.00 47.52  ? 40   THR C CA    1 
ATOM   7292  C C     . THR C  1 40  ? 203.573 138.753 -124.986 1.00 46.09  ? 40   THR C C     1 
ATOM   7293  O O     . THR C  1 40  ? 204.264 137.743 -124.911 1.00 46.62  ? 40   THR C O     1 
ATOM   7294  C CB    . THR C  1 40  ? 201.802 139.088 -126.713 1.00 47.91  ? 40   THR C CB    1 
ATOM   7295  O OG1   . THR C  1 40  ? 201.597 137.673 -126.787 1.00 46.49  ? 40   THR C OG1   1 
ATOM   7296  C CG2   . THR C  1 40  ? 201.452 139.751 -128.037 1.00 46.42  ? 40   THR C CG2   1 
ATOM   7297  N N     . LEU C  1 41  ? 203.090 139.385 -123.923 1.00 44.34  ? 41   LEU C N     1 
ATOM   7298  C CA    . LEU C  1 41  ? 203.292 138.886 -122.569 1.00 43.23  ? 41   LEU C CA    1 
ATOM   7299  C C     . LEU C  1 41  ? 202.106 137.976 -122.251 1.00 42.28  ? 41   LEU C C     1 
ATOM   7300  O O     . LEU C  1 41  ? 201.122 137.955 -123.000 1.00 42.59  ? 41   LEU C O     1 
ATOM   7301  C CB    . LEU C  1 41  ? 203.313 140.051 -121.579 1.00 41.78  ? 41   LEU C CB    1 
ATOM   7302  C CG    . LEU C  1 41  ? 204.401 141.103 -121.811 1.00 41.38  ? 41   LEU C CG    1 
ATOM   7303  C CD1   . LEU C  1 41  ? 204.105 142.368 -121.021 1.00 39.19  ? 41   LEU C CD1   1 
ATOM   7304  C CD2   . LEU C  1 41  ? 205.736 140.503 -121.423 1.00 40.19  ? 41   LEU C CD2   1 
ATOM   7305  N N     . GLY C  1 42  ? 202.195 137.220 -121.160 1.00 40.87  ? 42   GLY C N     1 
ATOM   7306  C CA    . GLY C  1 42  ? 201.076 136.366 -120.789 1.00 40.59  ? 42   GLY C CA    1 
ATOM   7307  C C     . GLY C  1 42  ? 201.252 134.865 -120.947 1.00 39.86  ? 42   GLY C C     1 
ATOM   7308  O O     . GLY C  1 42  ? 200.406 134.087 -120.479 1.00 39.91  ? 42   GLY C O     1 
ATOM   7309  N N     . GLY C  1 43  ? 202.323 134.461 -121.626 1.00 37.75  ? 43   GLY C N     1 
ATOM   7310  C CA    . GLY C  1 43  ? 202.613 133.051 -121.804 1.00 36.92  ? 43   GLY C CA    1 
ATOM   7311  C C     . GLY C  1 43  ? 201.554 132.168 -122.446 1.00 36.05  ? 43   GLY C C     1 
ATOM   7312  O O     . GLY C  1 43  ? 200.712 132.629 -123.216 1.00 35.26  ? 43   GLY C O     1 
ATOM   7313  N N     . THR C  1 44  ? 201.619 130.879 -122.128 1.00 35.53  ? 44   THR C N     1 
ATOM   7314  C CA    . THR C  1 44  ? 200.675 129.894 -122.648 1.00 34.48  ? 44   THR C CA    1 
ATOM   7315  C C     . THR C  1 44  ? 199.242 130.269 -122.300 1.00 34.37  ? 44   THR C C     1 
ATOM   7316  O O     . THR C  1 44  ? 198.383 130.344 -123.171 1.00 35.11  ? 44   THR C O     1 
ATOM   7317  C CB    . THR C  1 44  ? 200.971 128.518 -122.044 1.00 34.38  ? 44   THR C CB    1 
ATOM   7318  O OG1   . THR C  1 44  ? 202.330 128.184 -122.317 1.00 32.91  ? 44   THR C OG1   1 
ATOM   7319  C CG2   . THR C  1 44  ? 200.042 127.435 -122.618 1.00 33.19  ? 44   THR C CG2   1 
ATOM   7320  N N     A CYS C  1 45  ? 198.990 130.515 -121.018 0.51 34.60  ? 45   CYS C N     1 
ATOM   7321  N N     B CYS C  1 45  ? 199.022 130.529 -121.016 0.49 34.62  ? 45   CYS C N     1 
ATOM   7322  C CA    A CYS C  1 45  ? 197.649 130.848 -120.518 0.51 35.42  ? 45   CYS C CA    1 
ATOM   7323  C CA    B CYS C  1 45  ? 197.711 130.892 -120.489 0.49 35.40  ? 45   CYS C CA    1 
ATOM   7324  C C     A CYS C  1 45  ? 196.919 131.948 -121.304 0.51 35.66  ? 45   CYS C C     1 
ATOM   7325  C C     B CYS C  1 45  ? 196.948 131.937 -121.304 0.49 35.70  ? 45   CYS C C     1 
ATOM   7326  O O     A CYS C  1 45  ? 195.796 131.736 -121.778 0.51 35.22  ? 45   CYS C O     1 
ATOM   7327  O O     B CYS C  1 45  ? 195.839 131.682 -121.791 0.49 35.40  ? 45   CYS C O     1 
ATOM   7328  C CB    A CYS C  1 45  ? 197.759 131.218 -119.030 0.51 35.21  ? 45   CYS C CB    1 
ATOM   7329  C CB    B CYS C  1 45  ? 197.860 131.380 -119.041 0.49 35.31  ? 45   CYS C CB    1 
ATOM   7330  S SG    A CYS C  1 45  ? 196.303 131.196 -117.914 0.51 36.27  ? 45   CYS C SG    1 
ATOM   7331  S SG    B CYS C  1 45  ? 196.414 132.264 -118.376 0.49 35.88  ? 45   CYS C SG    1 
ATOM   7332  N N     . LEU C  1 46  ? 197.547 133.112 -121.451 1.00 35.74  ? 46   LEU C N     1 
ATOM   7333  C CA    . LEU C  1 46  ? 196.919 134.201 -122.180 1.00 36.07  ? 46   LEU C CA    1 
ATOM   7334  C C     . LEU C  1 46  ? 196.795 134.034 -123.685 1.00 35.28  ? 46   LEU C C     1 
ATOM   7335  O O     . LEU C  1 46  ? 195.726 134.271 -124.262 1.00 33.60  ? 46   LEU C O     1 
ATOM   7336  C CB    . LEU C  1 46  ? 197.642 135.528 -121.911 1.00 38.98  ? 46   LEU C CB    1 
ATOM   7337  C CG    . LEU C  1 46  ? 197.031 136.368 -120.785 1.00 41.87  ? 46   LEU C CG    1 
ATOM   7338  C CD1   . LEU C  1 46  ? 197.404 135.757 -119.411 1.00 42.18  ? 46   LEU C CD1   1 
ATOM   7339  C CD2   . LEU C  1 46  ? 197.516 137.812 -120.901 1.00 41.67  ? 46   LEU C CD2   1 
ATOM   7340  N N     . ASN C  1 47  ? 197.875 133.610 -124.313 1.00 33.74  ? 47   ASN C N     1 
ATOM   7341  C CA    . ASN C  1 47  ? 197.908 133.508 -125.760 1.00 34.91  ? 47   ASN C CA    1 
ATOM   7342  C C     . ASN C  1 47  ? 197.392 132.250 -126.450 1.00 34.81  ? 47   ASN C C     1 
ATOM   7343  O O     . ASN C  1 47  ? 196.683 132.362 -127.444 1.00 34.55  ? 47   ASN C O     1 
ATOM   7344  C CB    . ASN C  1 47  ? 199.337 133.850 -126.197 1.00 34.45  ? 47   ASN C CB    1 
ATOM   7345  C CG    . ASN C  1 47  ? 199.784 135.211 -125.644 1.00 35.11  ? 47   ASN C CG    1 
ATOM   7346  O OD1   . ASN C  1 47  ? 199.389 136.265 -126.162 1.00 35.62  ? 47   ASN C OD1   1 
ATOM   7347  N ND2   . ASN C  1 47  ? 200.566 135.190 -124.571 1.00 33.12  ? 47   ASN C ND2   1 
ATOM   7348  N N     . VAL C  1 48  ? 197.713 131.068 -125.931 1.00 34.62  ? 48   VAL C N     1 
ATOM   7349  C CA    . VAL C  1 48  ? 197.259 129.829 -126.563 1.00 34.69  ? 48   VAL C CA    1 
ATOM   7350  C C     . VAL C  1 48  ? 196.670 128.866 -125.550 1.00 34.34  ? 48   VAL C C     1 
ATOM   7351  O O     . VAL C  1 48  ? 196.589 127.666 -125.803 1.00 35.94  ? 48   VAL C O     1 
ATOM   7352  C CB    . VAL C  1 48  ? 198.429 129.120 -127.261 1.00 34.88  ? 48   VAL C CB    1 
ATOM   7353  C CG1   . VAL C  1 48  ? 198.944 129.980 -128.435 1.00 35.51  ? 48   VAL C CG1   1 
ATOM   7354  C CG2   . VAL C  1 48  ? 199.557 128.891 -126.253 1.00 34.52  ? 48   VAL C CG2   1 
ATOM   7355  N N     . GLY C  1 49  ? 196.245 129.390 -124.412 1.00 33.86  ? 49   GLY C N     1 
ATOM   7356  C CA    . GLY C  1 49  ? 195.718 128.516 -123.398 1.00 32.38  ? 49   GLY C CA    1 
ATOM   7357  C C     . GLY C  1 49  ? 194.390 128.854 -122.779 1.00 32.78  ? 49   GLY C C     1 
ATOM   7358  O O     . GLY C  1 49  ? 193.353 128.779 -123.440 1.00 32.75  ? 49   GLY C O     1 
ATOM   7359  N N     A CYS C  1 50  ? 194.454 129.262 -121.510 0.51 32.66  ? 50   CYS C N     1 
ATOM   7360  N N     B CYS C  1 50  ? 194.411 129.216 -121.500 0.49 32.56  ? 50   CYS C N     1 
ATOM   7361  C CA    A CYS C  1 50  ? 193.305 129.614 -120.683 0.51 32.73  ? 50   CYS C CA    1 
ATOM   7362  C CA    B CYS C  1 50  ? 193.203 129.518 -120.742 0.49 32.64  ? 50   CYS C CA    1 
ATOM   7363  C C     A CYS C  1 50  ? 192.267 130.538 -121.319 0.51 32.30  ? 50   CYS C C     1 
ATOM   7364  C C     B CYS C  1 50  ? 192.226 130.554 -121.316 0.49 32.16  ? 50   CYS C C     1 
ATOM   7365  O O     A CYS C  1 50  ? 191.077 130.210 -121.410 0.51 31.42  ? 50   CYS C O     1 
ATOM   7366  O O     B CYS C  1 50  ? 191.015 130.307 -121.370 0.49 31.23  ? 50   CYS C O     1 
ATOM   7367  C CB    A CYS C  1 50  ? 193.764 130.297 -119.377 0.51 33.87  ? 50   CYS C CB    1 
ATOM   7368  C CB    B CYS C  1 50  ? 193.599 129.885 -119.306 0.49 33.07  ? 50   CYS C CB    1 
ATOM   7369  S SG    A CYS C  1 50  ? 195.128 129.585 -118.388 0.51 34.77  ? 50   CYS C SG    1 
ATOM   7370  S SG    B CYS C  1 50  ? 192.622 131.223 -118.584 0.49 36.23  ? 50   CYS C SG    1 
ATOM   7371  N N     . ILE C  1 51  ? 192.731 131.709 -121.735 1.00 31.75  ? 51   ILE C N     1 
ATOM   7372  C CA    . ILE C  1 51  ? 191.862 132.725 -122.288 1.00 30.78  ? 51   ILE C CA    1 
ATOM   7373  C C     . ILE C  1 51  ? 191.164 132.341 -123.586 1.00 30.05  ? 51   ILE C C     1 
ATOM   7374  O O     . ILE C  1 51  ? 189.938 132.379 -123.667 1.00 29.92  ? 51   ILE C O     1 
ATOM   7375  C CB    . ILE C  1 51  ? 192.632 134.063 -122.465 1.00 31.49  ? 51   ILE C CB    1 
ATOM   7376  C CG1   . ILE C  1 51  ? 193.358 134.420 -121.155 1.00 32.66  ? 51   ILE C CG1   1 
ATOM   7377  C CG2   . ILE C  1 51  ? 191.664 135.179 -122.883 1.00 32.23  ? 51   ILE C CG2   1 
ATOM   7378  C CD1   . ILE C  1 51  ? 192.462 134.573 -119.931 1.00 32.64  ? 51   ILE C CD1   1 
ATOM   7379  N N     . PRO C  1 52  ? 191.922 131.963 -124.622 1.00 28.61  ? 52   PRO C N     1 
ATOM   7380  C CA    . PRO C  1 52  ? 191.218 131.601 -125.853 1.00 29.13  ? 52   PRO C CA    1 
ATOM   7381  C C     . PRO C  1 52  ? 190.285 130.394 -125.668 1.00 28.23  ? 52   PRO C C     1 
ATOM   7382  O O     . PRO C  1 52  ? 189.147 130.395 -126.148 1.00 25.96  ? 52   PRO C O     1 
ATOM   7383  C CB    . PRO C  1 52  ? 192.352 131.340 -126.835 1.00 28.50  ? 52   PRO C CB    1 
ATOM   7384  C CG    . PRO C  1 52  ? 193.444 130.821 -125.946 1.00 30.59  ? 52   PRO C CG    1 
ATOM   7385  C CD    . PRO C  1 52  ? 193.375 131.802 -124.782 1.00 29.59  ? 52   PRO C CD    1 
ATOM   7386  N N     . SER C  1 53  ? 190.734 129.389 -124.920 1.00 27.21  ? 53   SER C N     1 
ATOM   7387  C CA    . SER C  1 53  ? 189.874 128.240 -124.755 1.00 27.97  ? 53   SER C CA    1 
ATOM   7388  C C     . SER C  1 53  ? 188.573 128.593 -123.991 1.00 27.33  ? 53   SER C C     1 
ATOM   7389  O O     . SER C  1 53  ? 187.477 128.211 -124.426 1.00 27.29  ? 53   SER C O     1 
ATOM   7390  C CB    . SER C  1 53  ? 190.663 127.067 -124.138 1.00 26.69  ? 53   SER C CB    1 
ATOM   7391  O OG    . SER C  1 53  ? 191.163 127.363 -122.860 1.00 31.26  ? 53   SER C OG    1 
ATOM   7392  N N     . LYS C  1 54  ? 188.658 129.365 -122.909 1.00 26.90  ? 54   LYS C N     1 
ATOM   7393  C CA    . LYS C  1 54  ? 187.444 129.713 -122.186 1.00 26.63  ? 54   LYS C CA    1 
ATOM   7394  C C     . LYS C  1 54  ? 186.516 130.558 -123.063 1.00 27.36  ? 54   LYS C C     1 
ATOM   7395  O O     . LYS C  1 54  ? 185.296 130.391 -122.986 1.00 26.70  ? 54   LYS C O     1 
ATOM   7396  C CB    . LYS C  1 54  ? 187.757 130.434 -120.865 1.00 28.78  ? 54   LYS C CB    1 
ATOM   7397  C CG    . LYS C  1 54  ? 187.756 129.528 -119.586 1.00 31.17  ? 54   LYS C CG    1 
ATOM   7398  C CD    . LYS C  1 54  ? 189.067 128.698 -119.385 1.00 31.15  ? 54   LYS C CD    1 
ATOM   7399  C CE    . LYS C  1 54  ? 189.086 127.425 -120.269 1.00 32.88  ? 54   LYS C CE    1 
ATOM   7400  N NZ    . LYS C  1 54  ? 190.356 126.607 -120.260 1.00 29.43  ? 54   LYS C NZ    1 
ATOM   7401  N N     . ALA C  1 55  ? 187.071 131.454 -123.889 1.00 26.02  ? 55   ALA C N     1 
ATOM   7402  C CA    . ALA C  1 55  ? 186.236 132.267 -124.800 1.00 27.20  ? 55   ALA C CA    1 
ATOM   7403  C C     . ALA C  1 55  ? 185.465 131.337 -125.768 1.00 27.34  ? 55   ALA C C     1 
ATOM   7404  O O     . ALA C  1 55  ? 184.245 131.496 -125.961 1.00 27.64  ? 55   ALA C O     1 
ATOM   7405  C CB    . ALA C  1 55  ? 187.099 133.261 -125.610 1.00 25.23  ? 55   ALA C CB    1 
ATOM   7406  N N     . LEU C  1 56  ? 186.162 130.374 -126.364 1.00 26.47  ? 56   LEU C N     1 
ATOM   7407  C CA    . LEU C  1 56  ? 185.489 129.426 -127.267 1.00 28.12  ? 56   LEU C CA    1 
ATOM   7408  C C     . LEU C  1 56  ? 184.476 128.546 -126.514 1.00 27.90  ? 56   LEU C C     1 
ATOM   7409  O O     . LEU C  1 56  ? 183.401 128.236 -127.031 1.00 30.49  ? 56   LEU C O     1 
ATOM   7410  C CB    . LEU C  1 56  ? 186.525 128.544 -128.006 1.00 26.87  ? 56   LEU C CB    1 
ATOM   7411  C CG    . LEU C  1 56  ? 187.464 129.316 -128.951 1.00 28.31  ? 56   LEU C CG    1 
ATOM   7412  C CD1   . LEU C  1 56  ? 188.346 128.358 -129.786 1.00 27.70  ? 56   LEU C CD1   1 
ATOM   7413  C CD2   . LEU C  1 56  ? 186.609 130.211 -129.867 1.00 27.33  ? 56   LEU C CD2   1 
ATOM   7414  N N     . LEU C  1 57  ? 184.803 128.135 -125.294 1.00 27.62  ? 57   LEU C N     1 
ATOM   7415  C CA    . LEU C  1 57  ? 183.877 127.314 -124.526 1.00 26.07  ? 57   LEU C CA    1 
ATOM   7416  C C     . LEU C  1 57  ? 182.603 128.119 -124.305 1.00 27.05  ? 57   LEU C C     1 
ATOM   7417  O O     . LEU C  1 57  ? 181.500 127.606 -124.462 1.00 27.45  ? 57   LEU C O     1 
ATOM   7418  C CB    . LEU C  1 57  ? 184.510 126.896 -123.186 1.00 24.01  ? 57   LEU C CB    1 
ATOM   7419  C CG    . LEU C  1 57  ? 185.516 125.755 -123.378 1.00 22.85  ? 57   LEU C CG    1 
ATOM   7420  C CD1   . LEU C  1 57  ? 186.578 125.746 -122.280 1.00 21.06  ? 57   LEU C CD1   1 
ATOM   7421  C CD2   . LEU C  1 57  ? 184.774 124.440 -123.422 1.00 18.23  ? 57   LEU C CD2   1 
ATOM   7422  N N     . ASN C  1 58  ? 182.762 129.393 -123.970 1.00 27.36  ? 58   ASN C N     1 
ATOM   7423  C CA    . ASN C  1 58  ? 181.629 130.260 -123.741 1.00 28.14  ? 58   ASN C CA    1 
ATOM   7424  C C     . ASN C  1 58  ? 180.775 130.525 -124.964 1.00 27.52  ? 58   ASN C C     1 
ATOM   7425  O O     . ASN C  1 58  ? 179.553 130.436 -124.900 1.00 27.14  ? 58   ASN C O     1 
ATOM   7426  C CB    . ASN C  1 58  ? 182.104 131.593 -123.217 1.00 33.98  ? 58   ASN C CB    1 
ATOM   7427  C CG    . ASN C  1 58  ? 181.838 131.736 -121.765 1.00 40.67  ? 58   ASN C CG    1 
ATOM   7428  O OD1   . ASN C  1 58  ? 180.696 131.973 -121.350 1.00 43.16  ? 58   ASN C OD1   1 
ATOM   7429  N ND2   . ASN C  1 58  ? 182.874 131.556 -120.961 1.00 42.82  ? 58   ASN C ND2   1 
ATOM   7430  N N     . ASN C  1 59  ? 181.410 130.869 -126.073 1.00 26.32  ? 59   ASN C N     1 
ATOM   7431  C CA    . ASN C  1 59  ? 180.648 131.172 -127.279 1.00 28.58  ? 59   ASN C CA    1 
ATOM   7432  C C     . ASN C  1 59  ? 179.969 129.946 -127.867 1.00 27.76  ? 59   ASN C C     1 
ATOM   7433  O O     . ASN C  1 59  ? 178.834 130.023 -128.335 1.00 28.25  ? 59   ASN C O     1 
ATOM   7434  C CB    . ASN C  1 59  ? 181.550 131.844 -128.311 1.00 28.29  ? 59   ASN C CB    1 
ATOM   7435  C CG    . ASN C  1 59  ? 182.149 133.126 -127.784 1.00 29.63  ? 59   ASN C CG    1 
ATOM   7436  O OD1   . ASN C  1 59  ? 181.612 133.742 -126.850 1.00 28.21  ? 59   ASN C OD1   1 
ATOM   7437  N ND2   . ASN C  1 59  ? 183.257 133.547 -128.382 1.00 29.97  ? 59   ASN C ND2   1 
ATOM   7438  N N     . SER C  1 60  ? 180.654 128.815 -127.813 1.00 27.50  ? 60   SER C N     1 
ATOM   7439  C CA    . SER C  1 60  ? 180.083 127.583 -128.332 1.00 27.52  ? 60   SER C CA    1 
ATOM   7440  C C     . SER C  1 60  ? 178.934 127.131 -127.442 1.00 27.89  ? 60   SER C C     1 
ATOM   7441  O O     . SER C  1 60  ? 177.953 126.559 -127.923 1.00 27.72  ? 60   SER C O     1 
ATOM   7442  C CB    . SER C  1 60  ? 181.147 126.484 -128.416 1.00 27.41  ? 60   SER C CB    1 
ATOM   7443  O OG    . SER C  1 60  ? 181.664 126.117 -127.140 1.00 26.58  ? 60   SER C OG    1 
ATOM   7444  N N     . HIS C  1 61  ? 179.040 127.382 -126.140 1.00 27.56  ? 61   HIS C N     1 
ATOM   7445  C CA    . HIS C  1 61  ? 177.951 126.977 -125.254 1.00 27.70  ? 61   HIS C CA    1 
ATOM   7446  C C     . HIS C  1 61  ? 176.702 127.753 -125.621 1.00 28.20  ? 61   HIS C C     1 
ATOM   7447  O O     . HIS C  1 61  ? 175.610 127.170 -125.744 1.00 28.40  ? 61   HIS C O     1 
ATOM   7448  C CB    . HIS C  1 61  ? 178.295 127.233 -123.772 1.00 26.52  ? 61   HIS C CB    1 
ATOM   7449  C CG    . HIS C  1 61  ? 177.115 127.120 -122.854 1.00 27.75  ? 61   HIS C CG    1 
ATOM   7450  N ND1   . HIS C  1 61  ? 176.413 125.946 -122.686 1.00 26.55  ? 61   HIS C ND1   1 
ATOM   7451  C CD2   . HIS C  1 61  ? 176.477 128.049 -122.099 1.00 28.31  ? 61   HIS C CD2   1 
ATOM   7452  C CE1   . HIS C  1 61  ? 175.392 126.154 -121.873 1.00 25.86  ? 61   HIS C CE1   1 
ATOM   7453  N NE2   . HIS C  1 61  ? 175.405 127.420 -121.503 1.00 29.58  ? 61   HIS C NE2   1 
ATOM   7454  N N     . TYR C  1 62  ? 176.873 129.072 -125.786 1.00 28.49  ? 62   TYR C N     1 
ATOM   7455  C CA    . TYR C  1 62  ? 175.778 129.964 -126.141 1.00 30.03  ? 62   TYR C CA    1 
ATOM   7456  C C     . TYR C  1 62  ? 175.194 129.637 -127.518 1.00 30.34  ? 62   TYR C C     1 
ATOM   7457  O O     . TYR C  1 62  ? 173.991 129.754 -127.718 1.00 29.68  ? 62   TYR C O     1 
ATOM   7458  C CB    . TYR C  1 62  ? 176.231 131.429 -126.085 1.00 32.06  ? 62   TYR C CB    1 
ATOM   7459  C CG    . TYR C  1 62  ? 176.443 131.921 -124.674 1.00 36.36  ? 62   TYR C CG    1 
ATOM   7460  C CD1   . TYR C  1 62  ? 175.568 131.547 -123.657 1.00 38.32  ? 62   TYR C CD1   1 
ATOM   7461  C CD2   . TYR C  1 62  ? 177.496 132.780 -124.356 1.00 37.74  ? 62   TYR C CD2   1 
ATOM   7462  C CE1   . TYR C  1 62  ? 175.727 132.009 -122.360 1.00 40.20  ? 62   TYR C CE1   1 
ATOM   7463  C CE2   . TYR C  1 62  ? 177.661 133.254 -123.063 1.00 41.41  ? 62   TYR C CE2   1 
ATOM   7464  C CZ    . TYR C  1 62  ? 176.767 132.864 -122.071 1.00 41.98  ? 62   TYR C CZ    1 
ATOM   7465  O OH    . TYR C  1 62  ? 176.888 133.368 -120.800 1.00 44.54  ? 62   TYR C OH    1 
ATOM   7466  N N     . TYR C  1 63  ? 176.048 129.242 -128.458 1.00 29.87  ? 63   TYR C N     1 
ATOM   7467  C CA    . TYR C  1 63  ? 175.582 128.872 -129.792 1.00 30.65  ? 63   TYR C CA    1 
ATOM   7468  C C     . TYR C  1 63  ? 174.642 127.650 -129.614 1.00 30.59  ? 63   TYR C C     1 
ATOM   7469  O O     . TYR C  1 63  ? 173.563 127.610 -130.179 1.00 26.44  ? 63   TYR C O     1 
ATOM   7470  C CB    . TYR C  1 63  ? 176.773 128.514 -130.692 1.00 30.73  ? 63   TYR C CB    1 
ATOM   7471  C CG    . TYR C  1 63  ? 176.360 127.879 -132.006 1.00 33.61  ? 63   TYR C CG    1 
ATOM   7472  C CD1   . TYR C  1 63  ? 175.765 128.641 -133.034 1.00 35.44  ? 63   TYR C CD1   1 
ATOM   7473  C CD2   . TYR C  1 63  ? 176.516 126.504 -132.209 1.00 34.77  ? 63   TYR C CD2   1 
ATOM   7474  C CE1   . TYR C  1 63  ? 175.336 128.037 -134.238 1.00 35.64  ? 63   TYR C CE1   1 
ATOM   7475  C CE2   . TYR C  1 63  ? 176.095 125.890 -133.393 1.00 36.22  ? 63   TYR C CE2   1 
ATOM   7476  C CZ    . TYR C  1 63  ? 175.506 126.663 -134.402 1.00 38.09  ? 63   TYR C CZ    1 
ATOM   7477  O OH    . TYR C  1 63  ? 175.094 126.037 -135.558 1.00 40.57  ? 63   TYR C OH    1 
ATOM   7478  N N     . HIS C  1 64  ? 175.071 126.682 -128.794 1.00 30.82  ? 64   HIS C N     1 
ATOM   7479  C CA    . HIS C  1 64  ? 174.303 125.475 -128.490 1.00 31.51  ? 64   HIS C CA    1 
ATOM   7480  C C     . HIS C  1 64  ? 172.929 125.768 -127.889 1.00 32.57  ? 64   HIS C C     1 
ATOM   7481  O O     . HIS C  1 64  ? 171.922 125.136 -128.231 1.00 32.89  ? 64   HIS C O     1 
ATOM   7482  C CB    . HIS C  1 64  ? 175.096 124.599 -127.512 1.00 33.07  ? 64   HIS C CB    1 
ATOM   7483  C CG    . HIS C  1 64  ? 174.391 123.342 -127.112 1.00 34.53  ? 64   HIS C CG    1 
ATOM   7484  N ND1   . HIS C  1 64  ? 174.730 122.625 -125.984 1.00 36.62  ? 64   HIS C ND1   1 
ATOM   7485  C CD2   . HIS C  1 64  ? 173.384 122.655 -127.708 1.00 35.09  ? 64   HIS C CD2   1 
ATOM   7486  C CE1   . HIS C  1 64  ? 173.961 121.550 -125.899 1.00 36.12  ? 64   HIS C CE1   1 
ATOM   7487  N NE2   . HIS C  1 64  ? 173.137 121.546 -126.934 1.00 34.98  ? 64   HIS C NE2   1 
ATOM   7488  N N     . MET C  1 65  ? 172.894 126.703 -126.952 1.00 32.90  ? 65   MET C N     1 
ATOM   7489  C CA    . MET C  1 65  ? 171.648 127.102 -126.300 1.00 34.57  ? 65   MET C CA    1 
ATOM   7490  C C     . MET C  1 65  ? 170.701 127.780 -127.297 1.00 33.68  ? 65   MET C C     1 
ATOM   7491  O O     . MET C  1 65  ? 169.493 127.620 -127.235 1.00 33.39  ? 65   MET C O     1 
ATOM   7492  C CB    . MET C  1 65  ? 171.966 128.087 -125.170 1.00 36.01  ? 65   MET C CB    1 
ATOM   7493  C CG    . MET C  1 65  ? 172.966 127.546 -124.175 1.00 40.76  ? 65   MET C CG    1 
ATOM   7494  S SD    . MET C  1 65  ? 172.213 126.253 -123.179 1.00 46.72  ? 65   MET C SD    1 
ATOM   7495  C CE    . MET C  1 65  ? 171.462 127.390 -121.852 1.00 48.54  ? 65   MET C CE    1 
ATOM   7496  N N     . ALA C  1 66  ? 171.269 128.559 -128.203 1.00 34.44  ? 66   ALA C N     1 
ATOM   7497  C CA    . ALA C  1 66  ? 170.481 129.268 -129.195 1.00 35.51  ? 66   ALA C CA    1 
ATOM   7498  C C     . ALA C  1 66  ? 170.060 128.347 -130.345 1.00 36.68  ? 66   ALA C C     1 
ATOM   7499  O O     . ALA C  1 66  ? 168.931 128.401 -130.831 1.00 35.64  ? 66   ALA C O     1 
ATOM   7500  C CB    . ALA C  1 66  ? 171.295 130.429 -129.740 1.00 34.59  ? 66   ALA C CB    1 
ATOM   7501  N N     . HIS C  1 67  ? 170.993 127.503 -130.758 1.00 37.12  ? 67   HIS C N     1 
ATOM   7502  C CA    . HIS C  1 67  ? 170.804 126.599 -131.870 1.00 39.38  ? 67   HIS C CA    1 
ATOM   7503  C C     . HIS C  1 67  ? 169.999 125.349 -131.517 1.00 40.88  ? 67   HIS C C     1 
ATOM   7504  O O     . HIS C  1 67  ? 169.291 124.802 -132.371 1.00 41.38  ? 67   HIS C O     1 
ATOM   7505  C CB    . HIS C  1 67  ? 172.174 126.208 -132.420 1.00 40.96  ? 67   HIS C CB    1 
ATOM   7506  C CG    . HIS C  1 67  ? 172.133 125.350 -133.639 1.00 41.90  ? 67   HIS C CG    1 
ATOM   7507  N ND1   . HIS C  1 67  ? 172.232 123.986 -133.645 1.00 42.04  ? 67   HIS C ND1   1 
ATOM   7508  C CD2   . HIS C  1 67  ? 172.032 125.728 -134.964 1.00 41.69  ? 67   HIS C CD2   1 
ATOM   7509  C CE1   . HIS C  1 67  ? 172.204 123.539 -134.906 1.00 42.35  ? 67   HIS C CE1   1 
ATOM   7510  N NE2   . HIS C  1 67  ? 172.084 124.604 -135.697 1.00 43.16  ? 67   HIS C NE2   1 
ATOM   7511  N N     . GLY C  1 68  ? 170.096 124.914 -130.259 1.00 40.33  ? 68   GLY C N     1 
ATOM   7512  C CA    . GLY C  1 68  ? 169.387 123.730 -129.809 1.00 39.28  ? 68   GLY C CA    1 
ATOM   7513  C C     . GLY C  1 68  ? 167.994 124.022 -129.285 1.00 39.72  ? 68   GLY C C     1 
ATOM   7514  O O     . GLY C  1 68  ? 167.344 124.971 -129.701 1.00 39.39  ? 68   GLY C O     1 
ATOM   7515  N N     . THR C  1 69  ? 167.543 123.226 -128.328 1.00 39.99  ? 69   THR C N     1 
ATOM   7516  C CA    . THR C  1 69  ? 166.197 123.381 -127.796 1.00 40.44  ? 69   THR C CA    1 
ATOM   7517  C C     . THR C  1 69  ? 166.085 124.308 -126.599 1.00 38.67  ? 69   THR C C     1 
ATOM   7518  O O     . THR C  1 69  ? 164.977 124.704 -126.213 1.00 38.12  ? 69   THR C O     1 
ATOM   7519  C CB    . THR C  1 69  ? 165.638 122.013 -127.356 1.00 44.14  ? 69   THR C CB    1 
ATOM   7520  O OG1   . THR C  1 69  ? 165.976 121.023 -128.340 1.00 47.50  ? 69   THR C OG1   1 
ATOM   7521  C CG2   . THR C  1 69  ? 164.099 122.070 -127.204 1.00 47.17  ? 69   THR C CG2   1 
ATOM   7522  N N     . ASP C  1 70  ? 167.218 124.671 -126.015 1.00 36.48  ? 70   ASP C N     1 
ATOM   7523  C CA    . ASP C  1 70  ? 167.147 125.478 -124.811 1.00 34.83  ? 70   ASP C CA    1 
ATOM   7524  C C     . ASP C  1 70  ? 166.430 126.814 -124.922 1.00 32.82  ? 70   ASP C C     1 
ATOM   7525  O O     . ASP C  1 70  ? 165.484 127.061 -124.192 1.00 30.96  ? 70   ASP C O     1 
ATOM   7526  C CB    . ASP C  1 70  ? 168.533 125.709 -124.210 1.00 35.07  ? 70   ASP C CB    1 
ATOM   7527  C CG    . ASP C  1 70  ? 168.447 126.354 -122.847 1.00 36.27  ? 70   ASP C CG    1 
ATOM   7528  O OD1   . ASP C  1 70  ? 168.152 125.624 -121.869 1.00 38.35  ? 70   ASP C OD1   1 
ATOM   7529  O OD2   . ASP C  1 70  ? 168.631 127.588 -122.758 1.00 33.10  ? 70   ASP C OD2   1 
ATOM   7530  N N     . PHE C  1 71  ? 166.882 127.682 -125.814 1.00 32.30  ? 71   PHE C N     1 
ATOM   7531  C CA    . PHE C  1 71  ? 166.242 128.981 -125.938 1.00 33.12  ? 71   PHE C CA    1 
ATOM   7532  C C     . PHE C  1 71  ? 164.765 128.911 -126.314 1.00 32.09  ? 71   PHE C C     1 
ATOM   7533  O O     . PHE C  1 71  ? 163.965 129.687 -125.805 1.00 29.89  ? 71   PHE C O     1 
ATOM   7534  C CB    . PHE C  1 71  ? 167.023 129.860 -126.922 1.00 34.97  ? 71   PHE C CB    1 
ATOM   7535  C CG    . PHE C  1 71  ? 168.103 130.683 -126.267 1.00 35.81  ? 71   PHE C CG    1 
ATOM   7536  C CD1   . PHE C  1 71  ? 168.746 130.226 -125.112 1.00 36.93  ? 71   PHE C CD1   1 
ATOM   7537  C CD2   . PHE C  1 71  ? 168.451 131.926 -126.779 1.00 36.88  ? 71   PHE C CD2   1 
ATOM   7538  C CE1   . PHE C  1 71  ? 169.718 131.001 -124.468 1.00 36.47  ? 71   PHE C CE1   1 
ATOM   7539  C CE2   . PHE C  1 71  ? 169.419 132.713 -126.154 1.00 36.55  ? 71   PHE C CE2   1 
ATOM   7540  C CZ    . PHE C  1 71  ? 170.056 132.252 -124.992 1.00 36.59  ? 71   PHE C CZ    1 
ATOM   7541  N N     . ALA C  1 72  ? 164.392 127.968 -127.176 1.00 33.00  ? 72   ALA C N     1 
ATOM   7542  C CA    . ALA C  1 72  ? 162.988 127.861 -127.561 1.00 34.80  ? 72   ALA C CA    1 
ATOM   7543  C C     . ALA C  1 72  ? 162.137 127.495 -126.354 1.00 35.38  ? 72   ALA C C     1 
ATOM   7544  O O     . ALA C  1 72  ? 161.009 127.980 -126.205 1.00 35.74  ? 72   ALA C O     1 
ATOM   7545  C CB    . ALA C  1 72  ? 162.804 126.810 -128.678 1.00 35.17  ? 72   ALA C CB    1 
ATOM   7546  N N     . SER C  1 73  ? 162.675 126.643 -125.481 1.00 34.75  ? 73   SER C N     1 
ATOM   7547  C CA    . SER C  1 73  ? 161.917 126.238 -124.301 1.00 34.68  ? 73   SER C CA    1 
ATOM   7548  C C     . SER C  1 73  ? 161.669 127.410 -123.371 1.00 33.94  ? 73   SER C C     1 
ATOM   7549  O O     . SER C  1 73  ? 160.792 127.344 -122.511 1.00 35.59  ? 73   SER C O     1 
ATOM   7550  C CB    . SER C  1 73  ? 162.652 125.138 -123.523 1.00 35.99  ? 73   SER C CB    1 
ATOM   7551  O OG    . SER C  1 73  ? 163.836 125.642 -122.925 1.00 34.37  ? 73   SER C OG    1 
ATOM   7552  N N     . ARG C  1 74  ? 162.440 128.480 -123.533 1.00 33.48  ? 74   ARG C N     1 
ATOM   7553  C CA    . ARG C  1 74  ? 162.293 129.673 -122.679 1.00 34.15  ? 74   ARG C CA    1 
ATOM   7554  C C     . ARG C  1 74  ? 161.489 130.817 -123.303 1.00 34.05  ? 74   ARG C C     1 
ATOM   7555  O O     . ARG C  1 74  ? 161.422 131.918 -122.746 1.00 31.40  ? 74   ARG C O     1 
ATOM   7556  C CB    . ARG C  1 74  ? 163.659 130.232 -122.304 1.00 33.55  ? 74   ARG C CB    1 
ATOM   7557  C CG    . ARG C  1 74  ? 164.491 129.290 -121.521 1.00 34.37  ? 74   ARG C CG    1 
ATOM   7558  C CD    . ARG C  1 74  ? 165.899 129.838 -121.357 1.00 33.68  ? 74   ARG C CD    1 
ATOM   7559  N NE    . ARG C  1 74  ? 166.726 128.801 -120.760 1.00 33.13  ? 74   ARG C NE    1 
ATOM   7560  C CZ    . ARG C  1 74  ? 166.607 128.385 -119.506 1.00 34.72  ? 74   ARG C CZ    1 
ATOM   7561  N NH1   . ARG C  1 74  ? 165.712 128.933 -118.687 1.00 34.28  ? 74   ARG C NH1   1 
ATOM   7562  N NH2   . ARG C  1 74  ? 167.335 127.358 -119.094 1.00 36.91  ? 74   ARG C NH2   1 
ATOM   7563  N N     . GLY C  1 75  ? 160.890 130.554 -124.462 1.00 34.27  ? 75   GLY C N     1 
ATOM   7564  C CA    . GLY C  1 75  ? 160.110 131.590 -125.117 1.00 34.88  ? 75   GLY C CA    1 
ATOM   7565  C C     . GLY C  1 75  ? 160.963 132.499 -125.976 1.00 35.04  ? 75   GLY C C     1 
ATOM   7566  O O     . GLY C  1 75  ? 160.529 133.572 -126.364 1.00 36.80  ? 75   GLY C O     1 
ATOM   7567  N N     . ILE C  1 76  ? 162.194 132.088 -126.246 1.00 35.89  ? 76   ILE C N     1 
ATOM   7568  C CA    . ILE C  1 76  ? 163.077 132.880 -127.081 1.00 37.14  ? 76   ILE C CA    1 
ATOM   7569  C C     . ILE C  1 76  ? 163.118 132.127 -128.404 1.00 39.24  ? 76   ILE C C     1 
ATOM   7570  O O     . ILE C  1 76  ? 163.776 131.093 -128.534 1.00 37.29  ? 76   ILE C O     1 
ATOM   7571  C CB    . ILE C  1 76  ? 164.466 132.978 -126.474 1.00 35.57  ? 76   ILE C CB    1 
ATOM   7572  C CG1   . ILE C  1 76  ? 164.356 133.422 -125.014 1.00 35.58  ? 76   ILE C CG1   1 
ATOM   7573  C CG2   . ILE C  1 76  ? 165.286 133.993 -127.242 1.00 35.16  ? 76   ILE C CG2   1 
ATOM   7574  C CD1   . ILE C  1 76  ? 165.617 133.168 -124.207 1.00 36.52  ? 76   ILE C CD1   1 
ATOM   7575  N N     . GLU C  1 77  ? 162.378 132.651 -129.376 1.00 42.06  ? 77   GLU C N     1 
ATOM   7576  C CA    . GLU C  1 77  ? 162.281 132.018 -130.682 1.00 45.85  ? 77   GLU C CA    1 
ATOM   7577  C C     . GLU C  1 77  ? 163.016 132.702 -131.792 1.00 46.98  ? 77   GLU C C     1 
ATOM   7578  O O     . GLU C  1 77  ? 162.839 133.895 -132.021 1.00 46.53  ? 77   GLU C O     1 
ATOM   7579  C CB    . GLU C  1 77  ? 160.831 131.904 -131.085 1.00 48.03  ? 77   GLU C CB    1 
ATOM   7580  C CG    . GLU C  1 77  ? 159.950 131.613 -129.906 1.00 52.03  ? 77   GLU C CG    1 
ATOM   7581  C CD    . GLU C  1 77  ? 158.559 131.215 -130.320 1.00 54.31  ? 77   GLU C CD    1 
ATOM   7582  O OE1   . GLU C  1 77  ? 157.995 131.865 -131.228 1.00 56.04  ? 77   GLU C OE1   1 
ATOM   7583  O OE2   . GLU C  1 77  ? 158.027 130.252 -129.728 1.00 55.43  ? 77   GLU C OE2   1 
ATOM   7584  N N     . MET C  1 78  ? 163.833 131.923 -132.492 1.00 49.07  ? 78   MET C N     1 
ATOM   7585  C CA    . MET C  1 78  ? 164.596 132.421 -133.616 1.00 51.82  ? 78   MET C CA    1 
ATOM   7586  C C     . MET C  1 78  ? 164.197 131.647 -134.836 1.00 54.15  ? 78   MET C C     1 
ATOM   7587  O O     . MET C  1 78  ? 163.904 130.455 -134.748 1.00 54.97  ? 78   MET C O     1 
ATOM   7588  C CB    . MET C  1 78  ? 166.091 132.226 -133.416 1.00 51.56  ? 78   MET C CB    1 
ATOM   7589  C CG    . MET C  1 78  ? 166.714 133.203 -132.475 1.00 53.35  ? 78   MET C CG    1 
ATOM   7590  S SD    . MET C  1 78  ? 166.582 132.686 -130.769 1.00 51.81  ? 78   MET C SD    1 
ATOM   7591  C CE    . MET C  1 78  ? 167.853 131.436 -130.701 1.00 50.42  ? 78   MET C CE    1 
ATOM   7592  N N     . SER C  1 79  ? 164.192 132.333 -135.972 1.00 55.92  ? 79   SER C N     1 
ATOM   7593  C CA    . SER C  1 79  ? 163.864 131.714 -137.246 1.00 57.84  ? 79   SER C CA    1 
ATOM   7594  C C     . SER C  1 79  ? 164.968 130.687 -137.527 1.00 57.23  ? 79   SER C C     1 
ATOM   7595  O O     . SER C  1 79  ? 164.723 129.481 -137.615 1.00 57.01  ? 79   SER C O     1 
ATOM   7596  C CB    . SER C  1 79  ? 163.860 132.783 -138.337 1.00 59.14  ? 79   SER C CB    1 
ATOM   7597  O OG    . SER C  1 79  ? 165.118 133.445 -138.372 1.00 61.08  ? 79   SER C OG    1 
ATOM   7598  N N     . GLU C  1 80  ? 166.189 131.182 -137.667 1.00 56.29  ? 80   GLU C N     1 
ATOM   7599  C CA    . GLU C  1 80  ? 167.317 130.309 -137.910 1.00 55.86  ? 80   GLU C CA    1 
ATOM   7600  C C     . GLU C  1 80  ? 168.529 130.858 -137.186 1.00 53.46  ? 80   GLU C C     1 
ATOM   7601  O O     . GLU C  1 80  ? 168.710 132.067 -137.088 1.00 53.26  ? 80   GLU C O     1 
ATOM   7602  C CB    . GLU C  1 80  ? 167.613 130.193 -139.408 1.00 58.85  ? 80   GLU C CB    1 
ATOM   7603  C CG    . GLU C  1 80  ? 168.781 129.253 -139.708 1.00 63.49  ? 80   GLU C CG    1 
ATOM   7604  C CD    . GLU C  1 80  ? 169.219 129.257 -141.175 1.00 66.68  ? 80   GLU C CD    1 
ATOM   7605  O OE1   . GLU C  1 80  ? 169.181 130.340 -141.813 1.00 68.58  ? 80   GLU C OE1   1 
ATOM   7606  O OE2   . GLU C  1 80  ? 169.628 128.180 -141.676 1.00 66.53  ? 80   GLU C OE2   1 
ATOM   7607  N N     . VAL C  1 81  ? 169.344 129.952 -136.664 1.00 50.58  ? 81   VAL C N     1 
ATOM   7608  C CA    . VAL C  1 81  ? 170.550 130.312 -135.949 1.00 48.56  ? 81   VAL C CA    1 
ATOM   7609  C C     . VAL C  1 81  ? 171.704 129.755 -136.758 1.00 47.46  ? 81   VAL C C     1 
ATOM   7610  O O     . VAL C  1 81  ? 171.788 128.554 -136.991 1.00 47.25  ? 81   VAL C O     1 
ATOM   7611  C CB    . VAL C  1 81  ? 170.567 129.681 -134.534 1.00 48.11  ? 81   VAL C CB    1 
ATOM   7612  C CG1   . VAL C  1 81  ? 171.874 130.016 -133.825 1.00 45.54  ? 81   VAL C CG1   1 
ATOM   7613  C CG2   . VAL C  1 81  ? 169.370 130.178 -133.741 1.00 48.23  ? 81   VAL C CG2   1 
ATOM   7614  N N     . ARG C  1 82  ? 172.597 130.632 -137.183 1.00 46.18  ? 82   ARG C N     1 
ATOM   7615  C CA    . ARG C  1 82  ? 173.734 130.205 -137.971 1.00 46.06  ? 82   ARG C CA    1 
ATOM   7616  C C     . ARG C  1 82  ? 175.043 130.605 -137.324 1.00 43.23  ? 82   ARG C C     1 
ATOM   7617  O O     . ARG C  1 82  ? 175.124 131.618 -136.630 1.00 43.47  ? 82   ARG C O     1 
ATOM   7618  C CB    . ARG C  1 82  ? 173.658 130.800 -139.379 1.00 49.94  ? 82   ARG C CB    1 
ATOM   7619  C CG    . ARG C  1 82  ? 173.020 129.898 -140.429 1.00 54.71  ? 82   ARG C CG    1 
ATOM   7620  C CD    . ARG C  1 82  ? 172.771 130.702 -141.696 1.00 59.37  ? 82   ARG C CD    1 
ATOM   7621  N NE    . ARG C  1 82  ? 173.747 131.787 -141.834 1.00 63.79  ? 82   ARG C NE    1 
ATOM   7622  C CZ    . ARG C  1 82  ? 175.032 131.630 -142.160 1.00 65.63  ? 82   ARG C CZ    1 
ATOM   7623  N NH1   . ARG C  1 82  ? 175.527 130.418 -142.401 1.00 66.32  ? 82   ARG C NH1   1 
ATOM   7624  N NH2   . ARG C  1 82  ? 175.829 132.696 -142.229 1.00 66.12  ? 82   ARG C NH2   1 
ATOM   7625  N N     . LEU C  1 83  ? 176.064 129.801 -137.576 1.00 40.13  ? 83   LEU C N     1 
ATOM   7626  C CA    . LEU C  1 83  ? 177.389 130.016 -137.034 1.00 38.90  ? 83   LEU C CA    1 
ATOM   7627  C C     . LEU C  1 83  ? 178.256 130.888 -137.924 1.00 38.69  ? 83   LEU C C     1 
ATOM   7628  O O     . LEU C  1 83  ? 178.313 130.681 -139.135 1.00 37.02  ? 83   LEU C O     1 
ATOM   7629  C CB    . LEU C  1 83  ? 178.098 128.672 -136.849 1.00 37.45  ? 83   LEU C CB    1 
ATOM   7630  C CG    . LEU C  1 83  ? 179.478 128.751 -136.203 1.00 39.34  ? 83   LEU C CG    1 
ATOM   7631  C CD1   . LEU C  1 83  ? 179.312 129.202 -134.737 1.00 38.57  ? 83   LEU C CD1   1 
ATOM   7632  C CD2   . LEU C  1 83  ? 180.161 127.382 -136.275 1.00 37.41  ? 83   LEU C CD2   1 
ATOM   7633  N N     . ASN C  1 84  ? 178.922 131.861 -137.318 1.00 37.62  ? 84   ASN C N     1 
ATOM   7634  C CA    . ASN C  1 84  ? 179.835 132.720 -138.043 1.00 38.26  ? 84   ASN C CA    1 
ATOM   7635  C C     . ASN C  1 84  ? 181.167 132.507 -137.343 1.00 38.13  ? 84   ASN C C     1 
ATOM   7636  O O     . ASN C  1 84  ? 181.574 133.314 -136.510 1.00 39.02  ? 84   ASN C O     1 
ATOM   7637  C CB    . ASN C  1 84  ? 179.431 134.188 -137.923 1.00 37.70  ? 84   ASN C CB    1 
ATOM   7638  C CG    . ASN C  1 84  ? 180.310 135.092 -138.748 1.00 39.25  ? 84   ASN C CG    1 
ATOM   7639  O OD1   . ASN C  1 84  ? 181.491 134.796 -138.995 1.00 37.87  ? 84   ASN C OD1   1 
ATOM   7640  N ND2   . ASN C  1 84  ? 179.745 136.214 -139.177 1.00 40.45  ? 84   ASN C ND2   1 
ATOM   7641  N N     . LEU C  1 85  ? 181.834 131.416 -137.679 1.00 38.36  ? 85   LEU C N     1 
ATOM   7642  C CA    . LEU C  1 85  ? 183.099 131.056 -137.062 1.00 39.22  ? 85   LEU C CA    1 
ATOM   7643  C C     . LEU C  1 85  ? 184.102 132.202 -137.025 1.00 39.65  ? 85   LEU C C     1 
ATOM   7644  O O     . LEU C  1 85  ? 184.717 132.446 -135.993 1.00 40.26  ? 85   LEU C O     1 
ATOM   7645  C CB    . LEU C  1 85  ? 183.697 129.818 -137.753 1.00 38.34  ? 85   LEU C CB    1 
ATOM   7646  C CG    . LEU C  1 85  ? 184.972 129.233 -137.138 1.00 39.42  ? 85   LEU C CG    1 
ATOM   7647  C CD1   . LEU C  1 85  ? 184.753 128.977 -135.666 1.00 40.40  ? 85   LEU C CD1   1 
ATOM   7648  C CD2   . LEU C  1 85  ? 185.344 127.928 -137.823 1.00 40.22  ? 85   LEU C CD2   1 
ATOM   7649  N N     . ASP C  1 86  ? 184.264 132.919 -138.129 1.00 40.86  ? 86   ASP C N     1 
ATOM   7650  C CA    . ASP C  1 86  ? 185.206 134.042 -138.154 1.00 41.17  ? 86   ASP C CA    1 
ATOM   7651  C C     . ASP C  1 86  ? 184.931 135.088 -137.067 1.00 40.09  ? 86   ASP C C     1 
ATOM   7652  O O     . ASP C  1 86  ? 185.856 135.651 -136.474 1.00 37.02  ? 86   ASP C O     1 
ATOM   7653  C CB    . ASP C  1 86  ? 185.182 134.766 -139.507 1.00 45.06  ? 86   ASP C CB    1 
ATOM   7654  C CG    . ASP C  1 86  ? 185.737 133.926 -140.649 1.00 48.62  ? 86   ASP C CG    1 
ATOM   7655  O OD1   . ASP C  1 86  ? 186.660 133.100 -140.409 1.00 50.37  ? 86   ASP C OD1   1 
ATOM   7656  O OD2   . ASP C  1 86  ? 185.252 134.109 -141.794 1.00 49.87  ? 86   ASP C OD2   1 
ATOM   7657  N N     . LYS C  1 87  ? 183.657 135.364 -136.823 1.00 39.41  ? 87   LYS C N     1 
ATOM   7658  C CA    . LYS C  1 87  ? 183.296 136.339 -135.816 1.00 40.09  ? 87   LYS C CA    1 
ATOM   7659  C C     . LYS C  1 87  ? 183.412 135.785 -134.399 1.00 39.41  ? 87   LYS C C     1 
ATOM   7660  O O     . LYS C  1 87  ? 183.667 136.540 -133.457 1.00 39.76  ? 87   LYS C O     1 
ATOM   7661  C CB    . LYS C  1 87  ? 181.872 136.822 -136.028 1.00 42.73  ? 87   LYS C CB    1 
ATOM   7662  C CG    . LYS C  1 87  ? 181.504 137.940 -135.083 1.00 46.60  ? 87   LYS C CG    1 
ATOM   7663  C CD    . LYS C  1 87  ? 180.032 138.240 -135.161 1.00 52.15  ? 87   LYS C CD    1 
ATOM   7664  C CE    . LYS C  1 87  ? 179.615 138.502 -136.595 1.00 55.50  ? 87   LYS C CE    1 
ATOM   7665  N NZ    . LYS C  1 87  ? 180.537 139.491 -137.230 1.00 59.03  ? 87   LYS C NZ    1 
ATOM   7666  N N     . MET C  1 88  ? 183.196 134.482 -134.239 1.00 36.75  ? 88   MET C N     1 
ATOM   7667  C CA    . MET C  1 88  ? 183.299 133.882 -132.918 1.00 36.05  ? 88   MET C CA    1 
ATOM   7668  C C     . MET C  1 88  ? 184.776 133.888 -132.560 1.00 35.82  ? 88   MET C C     1 
ATOM   7669  O O     . MET C  1 88  ? 185.142 134.129 -131.411 1.00 35.49  ? 88   MET C O     1 
ATOM   7670  C CB    . MET C  1 88  ? 182.760 132.452 -132.937 1.00 34.52  ? 88   MET C CB    1 
ATOM   7671  C CG    . MET C  1 88  ? 182.714 131.780 -131.575 1.00 31.00  ? 88   MET C CG    1 
ATOM   7672  S SD    . MET C  1 88  ? 181.995 130.132 -131.661 1.00 29.36  ? 88   MET C SD    1 
ATOM   7673  C CE    . MET C  1 88  ? 180.188 130.519 -131.604 1.00 25.63  ? 88   MET C CE    1 
ATOM   7674  N N     . MET C  1 89  ? 185.616 133.644 -133.560 1.00 35.60  ? 89   MET C N     1 
ATOM   7675  C CA    . MET C  1 89  ? 187.065 133.633 -133.365 1.00 38.13  ? 89   MET C CA    1 
ATOM   7676  C C     . MET C  1 89  ? 187.559 135.048 -133.084 1.00 39.59  ? 89   MET C C     1 
ATOM   7677  O O     . MET C  1 89  ? 188.537 135.254 -132.364 1.00 39.68  ? 89   MET C O     1 
ATOM   7678  C CB    . MET C  1 89  ? 187.772 133.081 -134.611 1.00 38.44  ? 89   MET C CB    1 
ATOM   7679  C CG    . MET C  1 89  ? 187.687 131.570 -134.789 1.00 37.30  ? 89   MET C CG    1 
ATOM   7680  S SD    . MET C  1 89  ? 188.645 130.683 -133.541 1.00 36.46  ? 89   MET C SD    1 
ATOM   7681  C CE    . MET C  1 89  ? 188.214 128.975 -133.908 1.00 33.71  ? 89   MET C CE    1 
ATOM   7682  N N     . GLU C  1 90  ? 186.876 136.024 -133.664 1.00 40.51  ? 90   GLU C N     1 
ATOM   7683  C CA    . GLU C  1 90  ? 187.246 137.412 -133.458 1.00 43.43  ? 90   GLU C CA    1 
ATOM   7684  C C     . GLU C  1 90  ? 186.984 137.815 -132.003 1.00 42.28  ? 90   GLU C C     1 
ATOM   7685  O O     . GLU C  1 90  ? 187.784 138.518 -131.391 1.00 41.81  ? 90   GLU C O     1 
ATOM   7686  C CB    . GLU C  1 90  ? 186.434 138.289 -134.397 1.00 46.54  ? 90   GLU C CB    1 
ATOM   7687  C CG    . GLU C  1 90  ? 186.655 139.768 -134.222 1.00 51.39  ? 90   GLU C CG    1 
ATOM   7688  C CD    . GLU C  1 90  ? 185.631 140.569 -135.004 1.00 54.72  ? 90   GLU C CD    1 
ATOM   7689  O OE1   . GLU C  1 90  ? 185.633 140.467 -136.255 1.00 57.45  ? 90   GLU C OE1   1 
ATOM   7690  O OE2   . GLU C  1 90  ? 184.819 141.282 -134.368 1.00 55.22  ? 90   GLU C OE2   1 
ATOM   7691  N N     . GLN C  1 91  ? 185.845 137.381 -131.462 1.00 41.61  ? 91   GLN C N     1 
ATOM   7692  C CA    . GLN C  1 91  ? 185.501 137.692 -130.074 1.00 41.18  ? 91   GLN C CA    1 
ATOM   7693  C C     . GLN C  1 91  ? 186.650 137.119 -129.242 1.00 39.67  ? 91   GLN C C     1 
ATOM   7694  O O     . GLN C  1 91  ? 187.197 137.779 -128.360 1.00 40.10  ? 91   GLN C O     1 
ATOM   7695  C CB    . GLN C  1 91  ? 184.154 137.049 -129.701 1.00 41.43  ? 91   GLN C CB    1 
ATOM   7696  C CG    . GLN C  1 91  ? 183.562 137.472 -128.344 1.00 42.05  ? 91   GLN C CG    1 
ATOM   7697  C CD    . GLN C  1 91  ? 184.197 136.756 -127.156 1.00 42.01  ? 91   GLN C CD    1 
ATOM   7698  O OE1   . GLN C  1 91  ? 184.423 135.554 -127.198 1.00 41.99  ? 91   GLN C OE1   1 
ATOM   7699  N NE2   . GLN C  1 91  ? 184.463 137.492 -126.088 1.00 42.87  ? 91   GLN C NE2   1 
ATOM   7700  N N     . LYS C  1 92  ? 187.042 135.897 -129.573 1.00 38.76  ? 92   LYS C N     1 
ATOM   7701  C CA    . LYS C  1 92  ? 188.138 135.225 -128.890 1.00 36.96  ? 92   LYS C CA    1 
ATOM   7702  C C     . LYS C  1 92  ? 189.409 136.066 -128.869 1.00 37.95  ? 92   LYS C C     1 
ATOM   7703  O O     . LYS C  1 92  ? 189.989 136.320 -127.803 1.00 37.67  ? 92   LYS C O     1 
ATOM   7704  C CB    . LYS C  1 92  ? 188.452 133.900 -129.569 1.00 34.65  ? 92   LYS C CB    1 
ATOM   7705  C CG    . LYS C  1 92  ? 189.604 133.156 -128.934 1.00 34.30  ? 92   LYS C CG    1 
ATOM   7706  C CD    . LYS C  1 92  ? 190.191 132.096 -129.866 1.00 33.96  ? 92   LYS C CD    1 
ATOM   7707  C CE    . LYS C  1 92  ? 190.774 132.703 -131.162 1.00 34.24  ? 92   LYS C CE    1 
ATOM   7708  N NZ    . LYS C  1 92  ? 191.659 131.739 -131.896 1.00 31.52  ? 92   LYS C NZ    1 
ATOM   7709  N N     . SER C  1 93  ? 189.856 136.482 -130.050 1.00 38.70  ? 93   SER C N     1 
ATOM   7710  C CA    . SER C  1 93  ? 191.071 137.278 -130.164 1.00 40.17  ? 93   SER C CA    1 
ATOM   7711  C C     . SER C  1 93  ? 190.995 138.597 -129.396 1.00 40.32  ? 93   SER C C     1 
ATOM   7712  O O     . SER C  1 93  ? 191.946 138.992 -128.730 1.00 40.52  ? 93   SER C O     1 
ATOM   7713  C CB    . SER C  1 93  ? 191.364 137.556 -131.636 1.00 41.64  ? 93   SER C CB    1 
ATOM   7714  O OG    . SER C  1 93  ? 191.562 136.339 -132.331 1.00 40.86  ? 93   SER C OG    1 
ATOM   7715  N N     . THR C  1 94  ? 189.858 139.266 -129.488 1.00 40.55  ? 94   THR C N     1 
ATOM   7716  C CA    . THR C  1 94  ? 189.669 140.533 -128.804 1.00 42.01  ? 94   THR C CA    1 
ATOM   7717  C C     . THR C  1 94  ? 189.953 140.394 -127.312 1.00 42.49  ? 94   THR C C     1 
ATOM   7718  O O     . THR C  1 94  ? 190.530 141.292 -126.697 1.00 44.07  ? 94   THR C O     1 
ATOM   7719  C CB    . THR C  1 94  ? 188.238 141.062 -129.026 1.00 43.34  ? 94   THR C CB    1 
ATOM   7720  O OG1   . THR C  1 94  ? 188.088 141.459 -130.404 1.00 43.79  ? 94   THR C OG1   1 
ATOM   7721  C CG2   . THR C  1 94  ? 187.949 142.239 -128.099 1.00 43.41  ? 94   THR C CG2   1 
ATOM   7722  N N     . ALA C  1 95  ? 189.561 139.269 -126.732 1.00 41.19  ? 95   ALA C N     1 
ATOM   7723  C CA    . ALA C  1 95  ? 189.816 139.040 -125.321 1.00 40.29  ? 95   ALA C CA    1 
ATOM   7724  C C     . ALA C  1 95  ? 191.309 138.802 -125.082 1.00 40.06  ? 95   ALA C C     1 
ATOM   7725  O O     . ALA C  1 95  ? 191.870 139.265 -124.085 1.00 39.01  ? 95   ALA C O     1 
ATOM   7726  C CB    . ALA C  1 95  ? 188.998 137.850 -124.824 1.00 40.91  ? 95   ALA C CB    1 
ATOM   7727  N N     . VAL C  1 96  ? 191.961 138.093 -125.999 1.00 39.85  ? 96   VAL C N     1 
ATOM   7728  C CA    . VAL C  1 96  ? 193.386 137.830 -125.847 1.00 41.00  ? 96   VAL C CA    1 
ATOM   7729  C C     . VAL C  1 96  ? 194.201 139.121 -126.004 1.00 42.57  ? 96   VAL C C     1 
ATOM   7730  O O     . VAL C  1 96  ? 195.110 139.391 -125.217 1.00 42.65  ? 96   VAL C O     1 
ATOM   7731  C CB    . VAL C  1 96  ? 193.866 136.772 -126.858 1.00 40.47  ? 96   VAL C CB    1 
ATOM   7732  C CG1   . VAL C  1 96  ? 195.392 136.681 -126.850 1.00 40.68  ? 96   VAL C CG1   1 
ATOM   7733  C CG2   . VAL C  1 96  ? 193.265 135.424 -126.495 1.00 39.52  ? 96   VAL C CG2   1 
ATOM   7734  N N     . LYS C  1 97  ? 193.856 139.920 -127.008 1.00 42.93  ? 97   LYS C N     1 
ATOM   7735  C CA    . LYS C  1 97  ? 194.542 141.184 -127.264 1.00 44.10  ? 97   LYS C CA    1 
ATOM   7736  C C     . LYS C  1 97  ? 194.436 142.095 -126.033 1.00 43.50  ? 97   LYS C C     1 
ATOM   7737  O O     . LYS C  1 97  ? 195.442 142.588 -125.512 1.00 42.08  ? 97   LYS C O     1 
ATOM   7738  C CB    . LYS C  1 97  ? 193.903 141.871 -128.476 1.00 45.43  ? 97   LYS C CB    1 
ATOM   7739  C CG    . LYS C  1 97  ? 194.538 143.194 -128.879 1.00 48.72  ? 97   LYS C CG    1 
ATOM   7740  C CD    . LYS C  1 97  ? 195.728 142.963 -129.794 1.00 52.35  ? 97   LYS C CD    1 
ATOM   7741  C CE    . LYS C  1 97  ? 196.065 144.223 -130.603 1.00 54.34  ? 97   LYS C CE    1 
ATOM   7742  N NZ    . LYS C  1 97  ? 196.312 145.420 -129.727 1.00 54.37  ? 97   LYS C NZ    1 
ATOM   7743  N N     . ALA C  1 98  ? 193.204 142.285 -125.566 1.00 43.33  ? 98   ALA C N     1 
ATOM   7744  C CA    . ALA C  1 98  ? 192.920 143.125 -124.413 1.00 44.23  ? 98   ALA C CA    1 
ATOM   7745  C C     . ALA C  1 98  ? 193.645 142.688 -123.139 1.00 44.73  ? 98   ALA C C     1 
ATOM   7746  O O     . ALA C  1 98  ? 194.126 143.529 -122.378 1.00 45.01  ? 98   ALA C O     1 
ATOM   7747  C CB    . ALA C  1 98  ? 191.414 143.173 -124.166 1.00 43.50  ? 98   ALA C CB    1 
ATOM   7748  N N     . LEU C  1 99  ? 193.739 141.383 -122.900 1.00 44.62  ? 99   LEU C N     1 
ATOM   7749  C CA    . LEU C  1 99  ? 194.395 140.914 -121.687 1.00 44.59  ? 99   LEU C CA    1 
ATOM   7750  C C     . LEU C  1 99  ? 195.921 140.959 -121.792 1.00 45.75  ? 99   LEU C C     1 
ATOM   7751  O O     . LEU C  1 99  ? 196.620 141.116 -120.786 1.00 44.94  ? 99   LEU C O     1 
ATOM   7752  C CB    . LEU C  1 99  ? 193.917 139.495 -121.338 1.00 44.27  ? 99   LEU C CB    1 
ATOM   7753  C CG    . LEU C  1 99  ? 192.430 139.356 -120.988 1.00 43.74  ? 99   LEU C CG    1 
ATOM   7754  C CD1   . LEU C  1 99  ? 192.055 137.899 -120.824 1.00 43.44  ? 99   LEU C CD1   1 
ATOM   7755  C CD2   . LEU C  1 99  ? 192.142 140.111 -119.696 1.00 43.61  ? 99   LEU C CD2   1 
ATOM   7756  N N     . THR C  1 100 ? 196.462 140.826 -122.993 1.00 46.67  ? 100  THR C N     1 
ATOM   7757  C CA    . THR C  1 100 ? 197.914 140.886 -123.094 1.00 47.46  ? 100  THR C CA    1 
ATOM   7758  C C     . THR C  1 100 ? 198.368 142.333 -122.935 1.00 47.56  ? 100  THR C C     1 
ATOM   7759  O O     . THR C  1 100 ? 199.429 142.603 -122.357 1.00 48.62  ? 100  THR C O     1 
ATOM   7760  C CB    . THR C  1 100 ? 198.431 140.303 -124.426 1.00 47.48  ? 100  THR C CB    1 
ATOM   7761  O OG1   . THR C  1 100 ? 197.668 140.828 -125.518 1.00 48.79  ? 100  THR C OG1   1 
ATOM   7762  C CG2   . THR C  1 100 ? 198.319 138.784 -124.406 1.00 47.92  ? 100  THR C CG2   1 
ATOM   7763  N N     . GLY C  1 101 ? 197.559 143.261 -123.438 1.00 47.34  ? 101  GLY C N     1 
ATOM   7764  C CA    . GLY C  1 101 ? 197.891 144.668 -123.315 1.00 47.47  ? 101  GLY C CA    1 
ATOM   7765  C C     . GLY C  1 101 ? 197.863 145.028 -121.842 1.00 47.20  ? 101  GLY C C     1 
ATOM   7766  O O     . GLY C  1 101 ? 198.645 145.859 -121.369 1.00 47.02  ? 101  GLY C O     1 
ATOM   7767  N N     . GLY C  1 102 ? 196.957 144.373 -121.117 1.00 46.57  ? 102  GLY C N     1 
ATOM   7768  C CA    . GLY C  1 102 ? 196.815 144.601 -119.690 1.00 45.38  ? 102  GLY C CA    1 
ATOM   7769  C C     . GLY C  1 102 ? 198.092 144.318 -118.932 1.00 44.99  ? 102  GLY C C     1 
ATOM   7770  O O     . GLY C  1 102 ? 198.474 145.080 -118.045 1.00 45.26  ? 102  GLY C O     1 
ATOM   7771  N N     . ILE C  1 103 ? 198.758 143.222 -119.272 1.00 43.87  ? 103  ILE C N     1 
ATOM   7772  C CA    . ILE C  1 103 ? 200.001 142.894 -118.601 1.00 43.83  ? 103  ILE C CA    1 
ATOM   7773  C C     . ILE C  1 103 ? 201.028 143.980 -118.941 1.00 43.98  ? 103  ILE C C     1 
ATOM   7774  O O     . ILE C  1 103 ? 201.797 144.395 -118.081 1.00 43.70  ? 103  ILE C O     1 
ATOM   7775  C CB    . ILE C  1 103 ? 200.507 141.499 -119.019 1.00 43.90  ? 103  ILE C CB    1 
ATOM   7776  C CG1   . ILE C  1 103 ? 199.474 140.446 -118.592 1.00 43.64  ? 103  ILE C CG1   1 
ATOM   7777  C CG2   . ILE C  1 103 ? 201.860 141.204 -118.377 1.00 41.17  ? 103  ILE C CG2   1 
ATOM   7778  C CD1   . ILE C  1 103 ? 199.944 139.022 -118.792 1.00 45.89  ? 103  ILE C CD1   1 
ATOM   7779  N N     . ALA C  1 104 ? 201.025 144.443 -120.188 1.00 44.13  ? 104  ALA C N     1 
ATOM   7780  C CA    . ALA C  1 104 ? 201.935 145.508 -120.596 1.00 44.41  ? 104  ALA C CA    1 
ATOM   7781  C C     . ALA C  1 104 ? 201.693 146.715 -119.686 1.00 45.08  ? 104  ALA C C     1 
ATOM   7782  O O     . ALA C  1 104 ? 202.621 147.270 -119.101 1.00 44.70  ? 104  ALA C O     1 
ATOM   7783  C CB    . ALA C  1 104 ? 201.681 145.891 -122.041 1.00 44.12  ? 104  ALA C CB    1 
ATOM   7784  N N     . HIS C  1 105 ? 200.432 147.104 -119.553 1.00 45.65  ? 105  HIS C N     1 
ATOM   7785  C CA    . HIS C  1 105 ? 200.079 148.235 -118.712 1.00 46.72  ? 105  HIS C CA    1 
ATOM   7786  C C     . HIS C  1 105 ? 200.428 148.024 -117.227 1.00 45.70  ? 105  HIS C C     1 
ATOM   7787  O O     . HIS C  1 105 ? 200.910 148.943 -116.561 1.00 45.15  ? 105  HIS C O     1 
ATOM   7788  C CB    . HIS C  1 105 ? 198.586 148.536 -118.858 1.00 49.80  ? 105  HIS C CB    1 
ATOM   7789  C CG    . HIS C  1 105 ? 198.064 149.503 -117.840 1.00 53.93  ? 105  HIS C CG    1 
ATOM   7790  N ND1   . HIS C  1 105 ? 198.430 150.832 -117.817 1.00 56.49  ? 105  HIS C ND1   1 
ATOM   7791  C CD2   . HIS C  1 105 ? 197.213 149.329 -116.800 1.00 55.67  ? 105  HIS C CD2   1 
ATOM   7792  C CE1   . HIS C  1 105 ? 197.826 151.437 -116.807 1.00 56.96  ? 105  HIS C CE1   1 
ATOM   7793  N NE2   . HIS C  1 105 ? 197.081 150.547 -116.174 1.00 56.75  ? 105  HIS C NE2   1 
ATOM   7794  N N     . LEU C  1 106 ? 200.181 146.823 -116.709 1.00 43.85  ? 106  LEU C N     1 
ATOM   7795  C CA    . LEU C  1 106 ? 200.473 146.536 -115.307 1.00 43.21  ? 106  LEU C CA    1 
ATOM   7796  C C     . LEU C  1 106 ? 201.982 146.603 -115.020 1.00 43.47  ? 106  LEU C C     1 
ATOM   7797  O O     . LEU C  1 106 ? 202.402 147.029 -113.942 1.00 42.66  ? 106  LEU C O     1 
ATOM   7798  C CB    . LEU C  1 106 ? 199.896 145.166 -114.898 1.00 40.77  ? 106  LEU C CB    1 
ATOM   7799  C CG    . LEU C  1 106 ? 198.361 145.060 -114.857 1.00 40.73  ? 106  LEU C CG    1 
ATOM   7800  C CD1   . LEU C  1 106 ? 197.926 143.611 -114.593 1.00 39.97  ? 106  LEU C CD1   1 
ATOM   7801  C CD2   . LEU C  1 106 ? 197.812 145.987 -113.785 1.00 38.89  ? 106  LEU C CD2   1 
ATOM   7802  N N     . PHE C  1 107 ? 202.794 146.171 -115.980 1.00 44.19  ? 107  PHE C N     1 
ATOM   7803  C CA    . PHE C  1 107 ? 204.244 146.236 -115.821 1.00 46.28  ? 107  PHE C CA    1 
ATOM   7804  C C     . PHE C  1 107 ? 204.666 147.715 -115.738 1.00 47.46  ? 107  PHE C C     1 
ATOM   7805  O O     . PHE C  1 107 ? 205.473 148.102 -114.887 1.00 47.61  ? 107  PHE C O     1 
ATOM   7806  C CB    . PHE C  1 107 ? 204.941 145.536 -116.997 1.00 45.11  ? 107  PHE C CB    1 
ATOM   7807  C CG    . PHE C  1 107 ? 205.141 144.048 -116.795 1.00 46.91  ? 107  PHE C CG    1 
ATOM   7808  C CD1   . PHE C  1 107 ? 204.583 143.387 -115.698 1.00 46.83  ? 107  PHE C CD1   1 
ATOM   7809  C CD2   . PHE C  1 107 ? 205.907 143.306 -117.699 1.00 46.12  ? 107  PHE C CD2   1 
ATOM   7810  C CE1   . PHE C  1 107 ? 204.792 142.011 -115.504 1.00 46.70  ? 107  PHE C CE1   1 
ATOM   7811  C CE2   . PHE C  1 107 ? 206.119 141.940 -117.512 1.00 46.22  ? 107  PHE C CE2   1 
ATOM   7812  C CZ    . PHE C  1 107 ? 205.561 141.292 -116.415 1.00 45.49  ? 107  PHE C CZ    1 
ATOM   7813  N N     . LYS C  1 108 ? 204.093 148.541 -116.611 1.00 48.12  ? 108  LYS C N     1 
ATOM   7814  C CA    . LYS C  1 108 ? 204.402 149.960 -116.610 1.00 49.49  ? 108  LYS C CA    1 
ATOM   7815  C C     . LYS C  1 108 ? 204.044 150.539 -115.244 1.00 49.28  ? 108  LYS C C     1 
ATOM   7816  O O     . LYS C  1 108 ? 204.878 151.168 -114.599 1.00 48.46  ? 108  LYS C O     1 
ATOM   7817  C CB    . LYS C  1 108 ? 203.610 150.669 -117.711 1.00 51.55  ? 108  LYS C CB    1 
ATOM   7818  C CG    . LYS C  1 108 ? 203.920 152.160 -117.856 1.00 55.43  ? 108  LYS C CG    1 
ATOM   7819  C CD    . LYS C  1 108 ? 203.181 152.786 -119.053 1.00 57.99  ? 108  LYS C CD    1 
ATOM   7820  C CE    . LYS C  1 108 ? 203.583 152.106 -120.370 1.00 59.89  ? 108  LYS C CE    1 
ATOM   7821  N NZ    . LYS C  1 108 ? 203.032 152.793 -121.580 1.00 61.26  ? 108  LYS C NZ    1 
ATOM   7822  N N     . GLN C  1 109 ? 202.808 150.300 -114.804 1.00 49.66  ? 109  GLN C N     1 
ATOM   7823  C CA    . GLN C  1 109 ? 202.313 150.797 -113.518 1.00 49.36  ? 109  GLN C CA    1 
ATOM   7824  C C     . GLN C  1 109 ? 203.207 150.444 -112.332 1.00 49.61  ? 109  GLN C C     1 
ATOM   7825  O O     . GLN C  1 109 ? 203.450 151.270 -111.454 1.00 49.44  ? 109  GLN C O     1 
ATOM   7826  C CB    . GLN C  1 109 ? 200.895 150.266 -113.267 1.00 49.58  ? 109  GLN C CB    1 
ATOM   7827  C CG    . GLN C  1 109 ? 200.285 150.667 -111.925 1.00 49.81  ? 109  GLN C CG    1 
ATOM   7828  C CD    . GLN C  1 109 ? 198.887 150.083 -111.718 1.00 50.79  ? 109  GLN C CD    1 
ATOM   7829  O OE1   . GLN C  1 109 ? 197.965 150.362 -112.485 1.00 49.40  ? 109  GLN C OE1   1 
ATOM   7830  N NE2   . GLN C  1 109 ? 198.731 149.261 -110.681 1.00 49.95  ? 109  GLN C NE2   1 
ATOM   7831  N N     . ASN C  1 110 ? 203.697 149.212 -112.305 1.00 49.84  ? 110  ASN C N     1 
ATOM   7832  C CA    . ASN C  1 110 ? 204.547 148.766 -111.212 1.00 50.30  ? 110  ASN C CA    1 
ATOM   7833  C C     . ASN C  1 110 ? 206.026 148.981 -111.516 1.00 51.02  ? 110  ASN C C     1 
ATOM   7834  O O     . ASN C  1 110 ? 206.903 148.545 -110.765 1.00 49.31  ? 110  ASN C O     1 
ATOM   7835  C CB    . ASN C  1 110 ? 204.260 147.292 -110.929 1.00 48.99  ? 110  ASN C CB    1 
ATOM   7836  C CG    . ASN C  1 110 ? 202.871 147.081 -110.362 1.00 48.19  ? 110  ASN C CG    1 
ATOM   7837  O OD1   . ASN C  1 110 ? 202.634 147.314 -109.171 1.00 46.45  ? 110  ASN C OD1   1 
ATOM   7838  N ND2   . ASN C  1 110 ? 201.933 146.670 -111.222 1.00 46.23  ? 110  ASN C ND2   1 
ATOM   7839  N N     . LYS C  1 111 ? 206.286 149.664 -112.622 1.00 52.73  ? 111  LYS C N     1 
ATOM   7840  C CA    . LYS C  1 111 ? 207.646 149.955 -113.051 1.00 55.21  ? 111  LYS C CA    1 
ATOM   7841  C C     . LYS C  1 111 ? 208.521 148.716 -113.234 1.00 55.26  ? 111  LYS C C     1 
ATOM   7842  O O     . LYS C  1 111 ? 209.683 148.693 -112.821 1.00 55.43  ? 111  LYS C O     1 
ATOM   7843  C CB    . LYS C  1 111 ? 208.324 150.928 -112.070 1.00 56.88  ? 111  LYS C CB    1 
ATOM   7844  C CG    . LYS C  1 111 ? 207.633 152.301 -111.955 1.00 59.24  ? 111  LYS C CG    1 
ATOM   7845  C CD    . LYS C  1 111 ? 208.523 153.315 -111.218 1.00 61.19  ? 111  LYS C CD    1 
ATOM   7846  C CE    . LYS C  1 111 ? 207.798 154.628 -110.905 1.00 61.80  ? 111  LYS C CE    1 
ATOM   7847  N NZ    . LYS C  1 111 ? 206.761 154.472 -109.837 1.00 62.72  ? 111  LYS C NZ    1 
ATOM   7848  N N     . VAL C  1 112 ? 207.959 147.676 -113.837 1.00 55.61  ? 112  VAL C N     1 
ATOM   7849  C CA    . VAL C  1 112 ? 208.732 146.470 -114.106 1.00 55.30  ? 112  VAL C CA    1 
ATOM   7850  C C     . VAL C  1 112 ? 209.352 146.745 -115.469 1.00 55.07  ? 112  VAL C C     1 
ATOM   7851  O O     . VAL C  1 112 ? 208.704 147.334 -116.335 1.00 53.83  ? 112  VAL C O     1 
ATOM   7852  C CB    . VAL C  1 112 ? 207.831 145.191 -114.190 1.00 55.00  ? 112  VAL C CB    1 
ATOM   7853  C CG1   . VAL C  1 112 ? 208.626 144.021 -114.764 1.00 53.34  ? 112  VAL C CG1   1 
ATOM   7854  C CG2   . VAL C  1 112 ? 207.298 144.827 -112.801 1.00 54.86  ? 112  VAL C CG2   1 
ATOM   7855  N N     . VAL C  1 113 ? 210.604 146.336 -115.657 1.00 55.32  ? 113  VAL C N     1 
ATOM   7856  C CA    . VAL C  1 113 ? 211.264 146.561 -116.936 1.00 56.03  ? 113  VAL C CA    1 
ATOM   7857  C C     . VAL C  1 113 ? 211.101 145.357 -117.845 1.00 55.80  ? 113  VAL C C     1 
ATOM   7858  O O     . VAL C  1 113 ? 211.567 144.264 -117.528 1.00 56.00  ? 113  VAL C O     1 
ATOM   7859  C CB    . VAL C  1 113 ? 212.765 146.848 -116.760 1.00 56.34  ? 113  VAL C CB    1 
ATOM   7860  C CG1   . VAL C  1 113 ? 213.390 147.095 -118.120 1.00 55.99  ? 113  VAL C CG1   1 
ATOM   7861  C CG2   . VAL C  1 113 ? 212.967 148.070 -115.854 1.00 56.53  ? 113  VAL C CG2   1 
ATOM   7862  N N     . HIS C  1 114 ? 210.449 145.577 -118.982 1.00 55.74  ? 114  HIS C N     1 
ATOM   7863  C CA    . HIS C  1 114 ? 210.191 144.523 -119.959 1.00 56.32  ? 114  HIS C CA    1 
ATOM   7864  C C     . HIS C  1 114 ? 211.271 144.401 -121.046 1.00 56.92  ? 114  HIS C C     1 
ATOM   7865  O O     . HIS C  1 114 ? 211.452 145.294 -121.876 1.00 56.49  ? 114  HIS C O     1 
ATOM   7866  C CB    . HIS C  1 114 ? 208.802 144.754 -120.585 1.00 55.67  ? 114  HIS C CB    1 
ATOM   7867  C CG    . HIS C  1 114 ? 208.491 143.870 -121.756 1.00 54.58  ? 114  HIS C CG    1 
ATOM   7868  N ND1   . HIS C  1 114 ? 209.059 142.624 -121.930 1.00 54.54  ? 114  HIS C ND1   1 
ATOM   7869  C CD2   . HIS C  1 114 ? 207.638 144.041 -122.794 1.00 53.87  ? 114  HIS C CD2   1 
ATOM   7870  C CE1   . HIS C  1 114 ? 208.570 142.070 -123.025 1.00 54.26  ? 114  HIS C CE1   1 
ATOM   7871  N NE2   . HIS C  1 114 ? 207.705 142.908 -123.568 1.00 54.33  ? 114  HIS C NE2   1 
ATOM   7872  N N     . VAL C  1 115 ? 211.979 143.277 -121.019 1.00 57.56  ? 115  VAL C N     1 
ATOM   7873  C CA    . VAL C  1 115 ? 213.037 142.985 -121.977 1.00 59.10  ? 115  VAL C CA    1 
ATOM   7874  C C     . VAL C  1 115 ? 212.529 141.968 -122.999 1.00 60.32  ? 115  VAL C C     1 
ATOM   7875  O O     . VAL C  1 115 ? 212.253 140.819 -122.644 1.00 60.93  ? 115  VAL C O     1 
ATOM   7876  C CB    . VAL C  1 115 ? 214.272 142.390 -121.260 1.00 59.22  ? 115  VAL C CB    1 
ATOM   7877  C CG1   . VAL C  1 115 ? 215.368 142.088 -122.262 1.00 58.59  ? 115  VAL C CG1   1 
ATOM   7878  C CG2   . VAL C  1 115 ? 214.769 143.354 -120.190 1.00 59.41  ? 115  VAL C CG2   1 
ATOM   7879  N N     . ASN C  1 116 ? 212.415 142.381 -124.262 1.00 60.99  ? 116  ASN C N     1 
ATOM   7880  C CA    . ASN C  1 116 ? 211.929 141.495 -125.323 1.00 61.55  ? 116  ASN C CA    1 
ATOM   7881  C C     . ASN C  1 116 ? 213.018 140.664 -126.002 1.00 61.53  ? 116  ASN C C     1 
ATOM   7882  O O     . ASN C  1 116 ? 213.647 141.126 -126.950 1.00 62.42  ? 116  ASN C O     1 
ATOM   7883  C CB    . ASN C  1 116 ? 211.201 142.310 -126.393 1.00 61.91  ? 116  ASN C CB    1 
ATOM   7884  C CG    . ASN C  1 116 ? 210.736 141.452 -127.567 1.00 63.57  ? 116  ASN C CG    1 
ATOM   7885  O OD1   . ASN C  1 116 ? 209.764 140.699 -127.463 1.00 62.43  ? 116  ASN C OD1   1 
ATOM   7886  N ND2   . ASN C  1 116 ? 211.442 141.555 -128.689 1.00 64.19  ? 116  ASN C ND2   1 
ATOM   7887  N N     . GLY C  1 117 ? 213.217 139.432 -125.539 1.00 61.19  ? 117  GLY C N     1 
ATOM   7888  C CA    . GLY C  1 117 ? 214.231 138.572 -126.130 1.00 60.99  ? 117  GLY C CA    1 
ATOM   7889  C C     . GLY C  1 117 ? 214.346 137.195 -125.491 1.00 60.62  ? 117  GLY C C     1 
ATOM   7890  O O     . GLY C  1 117 ? 213.738 136.929 -124.454 1.00 60.30  ? 117  GLY C O     1 
ATOM   7891  N N     . TYR C  1 118 ? 215.129 136.314 -126.109 1.00 59.97  ? 118  TYR C N     1 
ATOM   7892  C CA    . TYR C  1 118 ? 215.321 134.965 -125.590 1.00 59.56  ? 118  TYR C CA    1 
ATOM   7893  C C     . TYR C  1 118 ? 216.411 134.991 -124.523 1.00 60.17  ? 118  TYR C C     1 
ATOM   7894  O O     . TYR C  1 118 ? 217.598 135.103 -124.835 1.00 60.22  ? 118  TYR C O     1 
ATOM   7895  C CB    . TYR C  1 118 ? 215.724 134.019 -126.725 1.00 59.47  ? 118  TYR C CB    1 
ATOM   7896  C CG    . TYR C  1 118 ? 215.416 132.552 -126.469 1.00 59.84  ? 118  TYR C CG    1 
ATOM   7897  C CD1   . TYR C  1 118 ? 216.195 131.786 -125.600 1.00 60.17  ? 118  TYR C CD1   1 
ATOM   7898  C CD2   . TYR C  1 118 ? 214.331 131.936 -127.093 1.00 59.77  ? 118  TYR C CD2   1 
ATOM   7899  C CE1   . TYR C  1 118 ? 215.898 130.437 -125.364 1.00 60.35  ? 118  TYR C CE1   1 
ATOM   7900  C CE2   . TYR C  1 118 ? 214.022 130.594 -126.862 1.00 59.97  ? 118  TYR C CE2   1 
ATOM   7901  C CZ    . TYR C  1 118 ? 214.805 129.851 -126.001 1.00 59.94  ? 118  TYR C CZ    1 
ATOM   7902  O OH    . TYR C  1 118 ? 214.492 128.530 -125.785 1.00 59.51  ? 118  TYR C OH    1 
ATOM   7903  N N     . GLY C  1 119 ? 216.003 134.888 -123.264 1.00 59.94  ? 119  GLY C N     1 
ATOM   7904  C CA    . GLY C  1 119 ? 216.961 134.912 -122.182 1.00 59.87  ? 119  GLY C CA    1 
ATOM   7905  C C     . GLY C  1 119 ? 217.734 133.618 -121.995 1.00 60.40  ? 119  GLY C C     1 
ATOM   7906  O O     . GLY C  1 119 ? 217.258 132.526 -122.315 1.00 60.10  ? 119  GLY C O     1 
ATOM   7907  N N     . LYS C  1 120 ? 218.956 133.755 -121.496 1.00 60.81  ? 120  LYS C N     1 
ATOM   7908  C CA    . LYS C  1 120 ? 219.817 132.621 -121.203 1.00 61.88  ? 120  LYS C CA    1 
ATOM   7909  C C     . LYS C  1 120 ? 220.682 133.020 -120.020 1.00 62.15  ? 120  LYS C C     1 
ATOM   7910  O O     . LYS C  1 120 ? 221.292 134.095 -120.017 1.00 62.79  ? 120  LYS C O     1 
ATOM   7911  C CB    . LYS C  1 120 ? 220.716 132.253 -122.392 1.00 61.96  ? 120  LYS C CB    1 
ATOM   7912  C CG    . LYS C  1 120 ? 221.726 131.152 -122.047 1.00 62.45  ? 120  LYS C CG    1 
ATOM   7913  C CD    . LYS C  1 120 ? 222.460 130.617 -123.269 1.00 63.69  ? 120  LYS C CD    1 
ATOM   7914  C CE    . LYS C  1 120 ? 223.470 129.541 -122.872 1.00 64.52  ? 120  LYS C CE    1 
ATOM   7915  N NZ    . LYS C  1 120 ? 224.122 128.902 -124.057 1.00 64.95  ? 120  LYS C NZ    1 
ATOM   7916  N N     . ILE C  1 121 ? 220.713 132.173 -118.998 1.00 62.59  ? 121  ILE C N     1 
ATOM   7917  C CA    . ILE C  1 121 ? 221.532 132.464 -117.836 1.00 62.60  ? 121  ILE C CA    1 
ATOM   7918  C C     . ILE C  1 121 ? 222.972 132.386 -118.323 1.00 62.99  ? 121  ILE C C     1 
ATOM   7919  O O     . ILE C  1 121 ? 223.460 131.316 -118.710 1.00 62.51  ? 121  ILE C O     1 
ATOM   7920  C CB    . ILE C  1 121 ? 221.276 131.457 -116.689 1.00 62.37  ? 121  ILE C CB    1 
ATOM   7921  C CG1   . ILE C  1 121 ? 219.859 131.670 -116.135 1.00 62.72  ? 121  ILE C CG1   1 
ATOM   7922  C CG2   . ILE C  1 121 ? 222.316 131.630 -115.584 1.00 61.87  ? 121  ILE C CG2   1 
ATOM   7923  C CD1   . ILE C  1 121 ? 219.488 130.760 -114.964 1.00 62.80  ? 121  ILE C CD1   1 
ATOM   7924  N N     . THR C  1 122 ? 223.627 133.544 -118.338 1.00 63.26  ? 122  THR C N     1 
ATOM   7925  C CA    . THR C  1 122 ? 225.014 133.657 -118.785 1.00 63.27  ? 122  THR C CA    1 
ATOM   7926  C C     . THR C  1 122 ? 225.971 133.897 -117.612 1.00 63.63  ? 122  THR C C     1 
ATOM   7927  O O     . THR C  1 122 ? 227.075 134.405 -117.795 1.00 64.46  ? 122  THR C O     1 
ATOM   7928  C CB    . THR C  1 122 ? 225.171 134.805 -119.818 1.00 62.38  ? 122  THR C CB    1 
ATOM   7929  O OG1   . THR C  1 122 ? 224.541 135.991 -119.321 1.00 61.20  ? 122  THR C OG1   1 
ATOM   7930  C CG2   . THR C  1 122 ? 224.545 134.421 -121.149 1.00 61.07  ? 122  THR C CG2   1 
ATOM   7931  N N     . GLY C  1 123 ? 225.536 133.518 -116.411 1.00 63.46  ? 123  GLY C N     1 
ATOM   7932  C CA    . GLY C  1 123 ? 226.348 133.691 -115.220 1.00 62.48  ? 123  GLY C CA    1 
ATOM   7933  C C     . GLY C  1 123 ? 225.486 133.624 -113.975 1.00 62.02  ? 123  GLY C C     1 
ATOM   7934  O O     . GLY C  1 123 ? 224.349 134.073 -113.993 1.00 61.56  ? 123  GLY C O     1 
ATOM   7935  N N     . LYS C  1 124 ? 226.027 133.065 -112.895 1.00 61.73  ? 124  LYS C N     1 
ATOM   7936  C CA    . LYS C  1 124 ? 225.298 132.944 -111.642 1.00 61.91  ? 124  LYS C CA    1 
ATOM   7937  C C     . LYS C  1 124 ? 224.600 134.238 -111.240 1.00 61.59  ? 124  LYS C C     1 
ATOM   7938  O O     . LYS C  1 124 ? 223.673 134.228 -110.432 1.00 61.87  ? 124  LYS C O     1 
ATOM   7939  C CB    . LYS C  1 124 ? 226.238 132.486 -110.525 1.00 63.15  ? 124  LYS C CB    1 
ATOM   7940  C CG    . LYS C  1 124 ? 226.685 131.030 -110.675 1.00 65.31  ? 124  LYS C CG    1 
ATOM   7941  C CD    . LYS C  1 124 ? 227.680 130.575 -109.593 1.00 66.94  ? 124  LYS C CD    1 
ATOM   7942  C CE    . LYS C  1 124 ? 229.152 130.849 -109.968 1.00 68.05  ? 124  LYS C CE    1 
ATOM   7943  N NZ    . LYS C  1 124 ? 229.607 132.261 -109.768 1.00 68.72  ? 124  LYS C NZ    1 
ATOM   7944  N N     . ASN C  1 125 ? 225.033 135.355 -111.806 1.00 60.54  ? 125  ASN C N     1 
ATOM   7945  C CA    . ASN C  1 125 ? 224.408 136.624 -111.482 1.00 59.64  ? 125  ASN C CA    1 
ATOM   7946  C C     . ASN C  1 125 ? 224.132 137.420 -112.739 1.00 58.95  ? 125  ASN C C     1 
ATOM   7947  O O     . ASN C  1 125 ? 223.987 138.641 -112.711 1.00 58.48  ? 125  ASN C O     1 
ATOM   7948  C CB    . ASN C  1 125 ? 225.287 137.398 -110.499 1.00 59.60  ? 125  ASN C CB    1 
ATOM   7949  C CG    . ASN C  1 125 ? 225.298 136.758 -109.117 1.00 59.64  ? 125  ASN C CG    1 
ATOM   7950  O OD1   . ASN C  1 125 ? 224.394 136.982 -108.307 1.00 59.56  ? 125  ASN C OD1   1 
ATOM   7951  N ND2   . ASN C  1 125 ? 226.305 135.931 -108.856 1.00 59.72  ? 125  ASN C ND2   1 
ATOM   7952  N N     . GLN C  1 126 ? 224.027 136.704 -113.850 1.00 59.08  ? 126  GLN C N     1 
ATOM   7953  C CA    . GLN C  1 126 ? 223.749 137.347 -115.119 1.00 59.28  ? 126  GLN C CA    1 
ATOM   7954  C C     . GLN C  1 126 ? 222.840 136.553 -116.060 1.00 58.52  ? 126  GLN C C     1 
ATOM   7955  O O     . GLN C  1 126 ? 222.821 135.325 -116.054 1.00 57.74  ? 126  GLN C O     1 
ATOM   7956  C CB    . GLN C  1 126 ? 225.053 137.657 -115.838 1.00 60.07  ? 126  GLN C CB    1 
ATOM   7957  C CG    . GLN C  1 126 ? 224.849 138.477 -117.091 1.00 61.72  ? 126  GLN C CG    1 
ATOM   7958  C CD    . GLN C  1 126 ? 226.114 138.593 -117.905 1.00 63.33  ? 126  GLN C CD    1 
ATOM   7959  O OE1   . GLN C  1 126 ? 226.486 137.672 -118.641 1.00 63.35  ? 126  GLN C OE1   1 
ATOM   7960  N NE2   . GLN C  1 126 ? 226.800 139.722 -117.764 1.00 64.46  ? 126  GLN C NE2   1 
ATOM   7961  N N     . VAL C  1 127 ? 222.098 137.286 -116.882 1.00 58.45  ? 127  VAL C N     1 
ATOM   7962  C CA    . VAL C  1 127 ? 221.181 136.699 -117.852 1.00 58.83  ? 127  VAL C CA    1 
ATOM   7963  C C     . VAL C  1 127 ? 221.336 137.547 -119.112 1.00 59.40  ? 127  VAL C C     1 
ATOM   7964  O O     . VAL C  1 127 ? 221.501 138.763 -119.024 1.00 59.47  ? 127  VAL C O     1 
ATOM   7965  C CB    . VAL C  1 127 ? 219.698 136.769 -117.346 1.00 58.07  ? 127  VAL C CB    1 
ATOM   7966  C CG1   . VAL C  1 127 ? 218.760 136.149 -118.367 1.00 57.23  ? 127  VAL C CG1   1 
ATOM   7967  C CG2   . VAL C  1 127 ? 219.562 136.060 -115.990 1.00 57.27  ? 127  VAL C CG2   1 
ATOM   7968  N N     . THR C  1 128 ? 221.297 136.915 -120.279 1.00 59.93  ? 128  THR C N     1 
ATOM   7969  C CA    . THR C  1 128 ? 221.435 137.658 -121.528 1.00 60.75  ? 128  THR C CA    1 
ATOM   7970  C C     . THR C  1 128 ? 220.267 137.420 -122.475 1.00 61.49  ? 128  THR C C     1 
ATOM   7971  O O     . THR C  1 128 ? 220.024 136.290 -122.899 1.00 61.31  ? 128  THR C O     1 
ATOM   7972  C CB    . THR C  1 128 ? 222.729 137.281 -122.276 1.00 60.81  ? 128  THR C CB    1 
ATOM   7973  O OG1   . THR C  1 128 ? 223.859 137.461 -121.414 1.00 59.94  ? 128  THR C OG1   1 
ATOM   7974  C CG2   . THR C  1 128 ? 222.892 138.157 -123.510 1.00 60.45  ? 128  THR C CG2   1 
ATOM   7975  N N     . ALA C  1 129 ? 219.559 138.493 -122.816 1.00 62.33  ? 129  ALA C N     1 
ATOM   7976  C CA    . ALA C  1 129 ? 218.418 138.401 -123.719 1.00 63.38  ? 129  ALA C CA    1 
ATOM   7977  C C     . ALA C  1 129 ? 218.800 138.760 -125.156 1.00 64.08  ? 129  ALA C C     1 
ATOM   7978  O O     . ALA C  1 129 ? 219.090 139.914 -125.475 1.00 63.57  ? 129  ALA C O     1 
ATOM   7979  C CB    . ALA C  1 129 ? 217.280 139.308 -123.228 1.00 63.35  ? 129  ALA C CB    1 
ATOM   7980  N N     . THR C  1 130 ? 218.789 137.750 -126.016 1.00 65.25  ? 130  THR C N     1 
ATOM   7981  C CA    . THR C  1 130 ? 219.120 137.920 -127.422 1.00 66.58  ? 130  THR C CA    1 
ATOM   7982  C C     . THR C  1 130 ? 217.843 138.123 -128.227 1.00 67.64  ? 130  THR C C     1 
ATOM   7983  O O     . THR C  1 130 ? 216.975 137.246 -128.257 1.00 67.32  ? 130  THR C O     1 
ATOM   7984  C CB    . THR C  1 130 ? 219.836 136.676 -127.978 1.00 66.12  ? 130  THR C CB    1 
ATOM   7985  O OG1   . THR C  1 130 ? 221.057 136.459 -127.258 1.00 66.42  ? 130  THR C OG1   1 
ATOM   7986  C CG2   . THR C  1 130 ? 220.132 136.852 -129.460 1.00 66.16  ? 130  THR C CG2   1 
ATOM   7987  N N     . LYS C  1 131 ? 217.735 139.275 -128.880 1.00 69.06  ? 131  LYS C N     1 
ATOM   7988  C CA    . LYS C  1 131 ? 216.567 139.579 -129.693 1.00 70.84  ? 131  LYS C CA    1 
ATOM   7989  C C     . LYS C  1 131 ? 216.570 138.753 -130.972 1.00 71.68  ? 131  LYS C C     1 
ATOM   7990  O O     . LYS C  1 131 ? 217.502 137.988 -131.234 1.00 71.47  ? 131  LYS C O     1 
ATOM   7991  C CB    . LYS C  1 131 ? 216.530 141.066 -130.040 1.00 71.68  ? 131  LYS C CB    1 
ATOM   7992  C CG    . LYS C  1 131 ? 216.406 141.965 -128.831 1.00 72.96  ? 131  LYS C CG    1 
ATOM   7993  C CD    . LYS C  1 131 ? 216.511 143.431 -129.216 1.00 74.23  ? 131  LYS C CD    1 
ATOM   7994  C CE    . LYS C  1 131 ? 216.337 144.325 -127.997 1.00 75.13  ? 131  LYS C CE    1 
ATOM   7995  N NZ    . LYS C  1 131 ? 217.309 143.969 -126.919 1.00 75.91  ? 131  LYS C NZ    1 
ATOM   7996  N N     . ALA C  1 132 ? 215.517 138.916 -131.766 1.00 72.81  ? 132  ALA C N     1 
ATOM   7997  C CA    . ALA C  1 132 ? 215.373 138.176 -133.014 1.00 74.28  ? 132  ALA C CA    1 
ATOM   7998  C C     . ALA C  1 132 ? 216.384 138.614 -134.066 1.00 74.57  ? 132  ALA C C     1 
ATOM   7999  O O     . ALA C  1 132 ? 216.719 137.853 -134.977 1.00 74.61  ? 132  ALA C O     1 
ATOM   8000  C CB    . ALA C  1 132 ? 213.952 138.345 -133.554 1.00 74.63  ? 132  ALA C CB    1 
ATOM   8001  N N     . ASP C  1 133 ? 216.870 139.844 -133.932 1.00 75.03  ? 133  ASP C N     1 
ATOM   8002  C CA    . ASP C  1 133 ? 217.836 140.389 -134.877 1.00 75.05  ? 133  ASP C CA    1 
ATOM   8003  C C     . ASP C  1 133 ? 219.273 140.296 -134.380 1.00 74.87  ? 133  ASP C C     1 
ATOM   8004  O O     . ASP C  1 133 ? 220.138 141.025 -134.859 1.00 75.12  ? 133  ASP C O     1 
ATOM   8005  C CB    . ASP C  1 133 ? 217.501 141.849 -135.180 1.00 74.99  ? 133  ASP C CB    1 
ATOM   8006  C CG    . ASP C  1 133 ? 217.370 142.684 -133.924 1.00 75.33  ? 133  ASP C CG    1 
ATOM   8007  O OD1   . ASP C  1 133 ? 218.325 142.705 -133.116 1.00 75.17  ? 133  ASP C OD1   1 
ATOM   8008  O OD2   . ASP C  1 133 ? 216.310 143.319 -133.744 1.00 76.02  ? 133  ASP C OD2   1 
ATOM   8009  N N     . GLY C  1 134 ? 219.524 139.400 -133.425 1.00 74.48  ? 134  GLY C N     1 
ATOM   8010  C CA    . GLY C  1 134 ? 220.866 139.239 -132.889 1.00 73.72  ? 134  GLY C CA    1 
ATOM   8011  C C     . GLY C  1 134 ? 221.181 140.247 -131.800 1.00 73.50  ? 134  GLY C C     1 
ATOM   8012  O O     . GLY C  1 134 ? 222.110 140.055 -131.014 1.00 72.81  ? 134  GLY C O     1 
ATOM   8013  N N     . GLY C  1 135 ? 220.399 141.323 -131.756 1.00 73.70  ? 135  GLY C N     1 
ATOM   8014  C CA    . GLY C  1 135 ? 220.599 142.356 -130.754 1.00 74.05  ? 135  GLY C CA    1 
ATOM   8015  C C     . GLY C  1 135 ? 220.536 141.795 -129.346 1.00 74.21  ? 135  GLY C C     1 
ATOM   8016  O O     . GLY C  1 135 ? 219.482 141.345 -128.894 1.00 74.32  ? 135  GLY C O     1 
ATOM   8017  N N     . THR C  1 136 ? 221.668 141.833 -128.649 1.00 73.76  ? 136  THR C N     1 
ATOM   8018  C CA    . THR C  1 136 ? 221.759 141.311 -127.296 1.00 73.02  ? 136  THR C CA    1 
ATOM   8019  C C     . THR C  1 136 ? 221.474 142.348 -126.202 1.00 72.62  ? 136  THR C C     1 
ATOM   8020  O O     . THR C  1 136 ? 221.505 143.558 -126.441 1.00 72.96  ? 136  THR C O     1 
ATOM   8021  C CB    . THR C  1 136 ? 223.152 140.694 -127.053 1.00 73.17  ? 136  THR C CB    1 
ATOM   8022  O OG1   . THR C  1 136 ? 223.206 140.145 -125.733 1.00 73.37  ? 136  THR C OG1   1 
ATOM   8023  C CG2   . THR C  1 136 ? 224.245 141.753 -127.202 1.00 73.50  ? 136  THR C CG2   1 
ATOM   8024  N N     . GLN C  1 137 ? 221.190 141.853 -125.001 1.00 71.53  ? 137  GLN C N     1 
ATOM   8025  C CA    . GLN C  1 137 ? 220.908 142.699 -123.846 1.00 70.32  ? 137  GLN C CA    1 
ATOM   8026  C C     . GLN C  1 137 ? 221.347 142.005 -122.557 1.00 69.59  ? 137  GLN C C     1 
ATOM   8027  O O     . GLN C  1 137 ? 220.926 140.883 -122.268 1.00 69.49  ? 137  GLN C O     1 
ATOM   8028  C CB    . GLN C  1 137 ? 219.418 143.018 -123.773 1.00 70.62  ? 137  GLN C CB    1 
ATOM   8029  C CG    . GLN C  1 137 ? 219.026 143.730 -122.487 1.00 70.33  ? 137  GLN C CG    1 
ATOM   8030  C CD    . GLN C  1 137 ? 219.693 145.084 -122.342 1.00 70.27  ? 137  GLN C CD    1 
ATOM   8031  O OE1   . GLN C  1 137 ? 219.354 146.032 -123.054 1.00 70.48  ? 137  GLN C OE1   1 
ATOM   8032  N NE2   . GLN C  1 137 ? 220.650 145.183 -121.422 1.00 69.92  ? 137  GLN C NE2   1 
ATOM   8033  N N     . VAL C  1 138 ? 222.186 142.676 -121.778 1.00 68.26  ? 138  VAL C N     1 
ATOM   8034  C CA    . VAL C  1 138 ? 222.677 142.086 -120.543 1.00 67.24  ? 138  VAL C CA    1 
ATOM   8035  C C     . VAL C  1 138 ? 222.007 142.639 -119.291 1.00 66.48  ? 138  VAL C C     1 
ATOM   8036  O O     . VAL C  1 138 ? 221.761 143.843 -119.170 1.00 66.05  ? 138  VAL C O     1 
ATOM   8037  C CB    . VAL C  1 138 ? 224.206 142.253 -120.419 1.00 67.33  ? 138  VAL C CB    1 
ATOM   8038  C CG1   . VAL C  1 138 ? 224.707 141.612 -119.129 1.00 66.26  ? 138  VAL C CG1   1 
ATOM   8039  C CG2   . VAL C  1 138 ? 224.882 141.615 -121.626 1.00 67.26  ? 138  VAL C CG2   1 
ATOM   8040  N N     . ILE C  1 139 ? 221.717 141.730 -118.366 1.00 65.09  ? 139  ILE C N     1 
ATOM   8041  C CA    . ILE C  1 139 ? 221.069 142.066 -117.111 1.00 63.44  ? 139  ILE C CA    1 
ATOM   8042  C C     . ILE C  1 139 ? 221.885 141.444 -115.997 1.00 62.40  ? 139  ILE C C     1 
ATOM   8043  O O     . ILE C  1 139 ? 222.020 140.222 -115.939 1.00 62.31  ? 139  ILE C O     1 
ATOM   8044  C CB    . ILE C  1 139 ? 219.649 141.457 -117.013 1.00 63.85  ? 139  ILE C CB    1 
ATOM   8045  C CG1   . ILE C  1 139 ? 218.861 141.695 -118.307 1.00 63.92  ? 139  ILE C CG1   1 
ATOM   8046  C CG2   . ILE C  1 139 ? 218.925 142.048 -115.816 1.00 63.58  ? 139  ILE C CG2   1 
ATOM   8047  C CD1   . ILE C  1 139 ? 218.528 143.146 -118.578 1.00 65.17  ? 139  ILE C CD1   1 
ATOM   8048  N N     . ASP C  1 140 ? 222.451 142.269 -115.131 1.00 61.06  ? 140  ASP C N     1 
ATOM   8049  C CA    . ASP C  1 140 ? 223.206 141.733 -114.012 1.00 60.32  ? 140  ASP C CA    1 
ATOM   8050  C C     . ASP C  1 140 ? 222.209 141.788 -112.884 1.00 59.35  ? 140  ASP C C     1 
ATOM   8051  O O     . ASP C  1 140 ? 221.600 142.828 -112.620 1.00 58.98  ? 140  ASP C O     1 
ATOM   8052  C CB    . ASP C  1 140 ? 224.451 142.571 -113.723 1.00 61.48  ? 140  ASP C CB    1 
ATOM   8053  C CG    . ASP C  1 140 ? 225.563 142.310 -114.728 1.00 61.77  ? 140  ASP C CG    1 
ATOM   8054  O OD1   . ASP C  1 140 ? 226.115 141.186 -114.734 1.00 62.08  ? 140  ASP C OD1   1 
ATOM   8055  O OD2   . ASP C  1 140 ? 225.872 143.224 -115.522 1.00 63.63  ? 140  ASP C OD2   1 
ATOM   8056  N N     . THR C  1 141 ? 222.033 140.655 -112.225 1.00 58.52  ? 141  THR C N     1 
ATOM   8057  C CA    . THR C  1 141 ? 221.034 140.564 -111.188 1.00 57.71  ? 141  THR C CA    1 
ATOM   8058  C C     . THR C  1 141 ? 221.449 139.709 -110.014 1.00 57.32  ? 141  THR C C     1 
ATOM   8059  O O     . THR C  1 141 ? 222.216 138.751 -110.157 1.00 57.01  ? 141  THR C O     1 
ATOM   8060  C CB    . THR C  1 141 ? 219.754 139.965 -111.786 1.00 58.26  ? 141  THR C CB    1 
ATOM   8061  O OG1   . THR C  1 141 ? 218.712 139.955 -110.805 1.00 58.66  ? 141  THR C OG1   1 
ATOM   8062  C CG2   . THR C  1 141 ? 220.029 138.533 -112.268 1.00 57.53  ? 141  THR C CG2   1 
ATOM   8063  N N     . LYS C  1 142 ? 220.920 140.058 -108.848 1.00 57.20  ? 142  LYS C N     1 
ATOM   8064  C CA    . LYS C  1 142 ? 221.196 139.307 -107.639 1.00 57.29  ? 142  LYS C CA    1 
ATOM   8065  C C     . LYS C  1 142 ? 220.489 137.945 -107.700 1.00 56.49  ? 142  LYS C C     1 
ATOM   8066  O O     . LYS C  1 142 ? 221.096 136.900 -107.438 1.00 55.96  ? 142  LYS C O     1 
ATOM   8067  C CB    . LYS C  1 142 ? 220.714 140.086 -106.409 1.00 58.72  ? 142  LYS C CB    1 
ATOM   8068  C CG    . LYS C  1 142 ? 221.380 141.440 -106.231 1.00 61.01  ? 142  LYS C CG    1 
ATOM   8069  C CD    . LYS C  1 142 ? 221.186 141.959 -104.816 1.00 62.26  ? 142  LYS C CD    1 
ATOM   8070  C CE    . LYS C  1 142 ? 221.631 143.403 -104.716 1.00 63.76  ? 142  LYS C CE    1 
ATOM   8071  N NZ    . LYS C  1 142 ? 220.921 144.238 -105.730 1.00 64.50  ? 142  LYS C NZ    1 
ATOM   8072  N N     . ASN C  1 143 ? 219.207 137.965 -108.062 1.00 55.75  ? 143  ASN C N     1 
ATOM   8073  C CA    . ASN C  1 143 ? 218.402 136.743 -108.149 1.00 54.69  ? 143  ASN C CA    1 
ATOM   8074  C C     . ASN C  1 143 ? 217.842 136.491 -109.549 1.00 53.08  ? 143  ASN C C     1 
ATOM   8075  O O     . ASN C  1 143 ? 217.430 137.419 -110.253 1.00 52.60  ? 143  ASN C O     1 
ATOM   8076  C CB    . ASN C  1 143 ? 217.204 136.814 -107.185 1.00 55.15  ? 143  ASN C CB    1 
ATOM   8077  C CG    . ASN C  1 143 ? 217.608 137.049 -105.741 1.00 54.61  ? 143  ASN C CG    1 
ATOM   8078  O OD1   . ASN C  1 143 ? 218.209 136.191 -105.100 1.00 53.97  ? 143  ASN C OD1   1 
ATOM   8079  N ND2   . ASN C  1 143 ? 217.263 138.221 -105.220 1.00 54.91  ? 143  ASN C ND2   1 
ATOM   8080  N N     . ILE C  1 144 ? 217.813 135.219 -109.931 1.00 52.08  ? 144  ILE C N     1 
ATOM   8081  C CA    . ILE C  1 144 ? 217.248 134.811 -111.213 1.00 49.85  ? 144  ILE C CA    1 
ATOM   8082  C C     . ILE C  1 144 ? 216.012 133.942 -110.915 1.00 48.55  ? 144  ILE C C     1 
ATOM   8083  O O     . ILE C  1 144 ? 216.076 133.021 -110.091 1.00 47.68  ? 144  ILE C O     1 
ATOM   8084  C CB    . ILE C  1 144 ? 218.245 133.965 -112.041 1.00 49.83  ? 144  ILE C CB    1 
ATOM   8085  C CG1   . ILE C  1 144 ? 219.608 134.661 -112.101 1.00 49.68  ? 144  ILE C CG1   1 
ATOM   8086  C CG2   . ILE C  1 144 ? 217.713 133.762 -113.453 1.00 49.34  ? 144  ILE C CG2   1 
ATOM   8087  C CD1   . ILE C  1 144 ? 220.659 133.839 -112.798 1.00 49.28  ? 144  ILE C CD1   1 
ATOM   8088  N N     . LEU C  1 145 ? 214.889 134.253 -111.561 1.00 47.38  ? 145  LEU C N     1 
ATOM   8089  C CA    . LEU C  1 145 ? 213.664 133.474 -111.386 1.00 45.16  ? 145  LEU C CA    1 
ATOM   8090  C C     . LEU C  1 145 ? 213.262 132.916 -112.744 1.00 43.96  ? 145  LEU C C     1 
ATOM   8091  O O     . LEU C  1 145 ? 212.924 133.660 -113.672 1.00 44.35  ? 145  LEU C O     1 
ATOM   8092  C CB    . LEU C  1 145 ? 212.533 134.334 -110.800 1.00 44.64  ? 145  LEU C CB    1 
ATOM   8093  C CG    . LEU C  1 145 ? 211.138 133.672 -110.722 1.00 43.81  ? 145  LEU C CG    1 
ATOM   8094  C CD1   . LEU C  1 145 ? 211.216 132.332 -109.990 1.00 40.64  ? 145  LEU C CD1   1 
ATOM   8095  C CD2   . LEU C  1 145 ? 210.145 134.620 -110.042 1.00 42.27  ? 145  LEU C CD2   1 
ATOM   8096  N N     . ILE C  1 146 ? 213.343 131.597 -112.857 1.00 43.00  ? 146  ILE C N     1 
ATOM   8097  C CA    . ILE C  1 146 ? 212.998 130.897 -114.084 1.00 41.99  ? 146  ILE C CA    1 
ATOM   8098  C C     . ILE C  1 146 ? 211.505 130.573 -114.050 1.00 41.29  ? 146  ILE C C     1 
ATOM   8099  O O     . ILE C  1 146 ? 211.024 129.864 -113.150 1.00 40.70  ? 146  ILE C O     1 
ATOM   8100  C CB    . ILE C  1 146 ? 213.790 129.572 -114.209 1.00 42.05  ? 146  ILE C CB    1 
ATOM   8101  C CG1   . ILE C  1 146 ? 215.295 129.854 -114.128 1.00 42.59  ? 146  ILE C CG1   1 
ATOM   8102  C CG2   . ILE C  1 146 ? 213.448 128.874 -115.527 1.00 41.39  ? 146  ILE C CG2   1 
ATOM   8103  C CD1   . ILE C  1 146 ? 216.173 128.605 -113.960 1.00 40.64  ? 146  ILE C CD1   1 
ATOM   8104  N N     . ALA C  1 147 ? 210.786 131.129 -115.015 1.00 39.65  ? 147  ALA C N     1 
ATOM   8105  C CA    . ALA C  1 147 ? 209.350 130.923 -115.174 1.00 38.33  ? 147  ALA C CA    1 
ATOM   8106  C C     . ALA C  1 147 ? 209.162 130.714 -116.671 1.00 37.12  ? 147  ALA C C     1 
ATOM   8107  O O     . ALA C  1 147 ? 208.333 131.362 -117.295 1.00 36.73  ? 147  ALA C O     1 
ATOM   8108  C CB    . ALA C  1 147 ? 208.592 132.144 -114.722 1.00 36.39  ? 147  ALA C CB    1 
ATOM   8109  N N     . THR C  1 148 ? 209.948 129.800 -117.235 1.00 37.59  ? 148  THR C N     1 
ATOM   8110  C CA    . THR C  1 148 ? 209.910 129.516 -118.671 1.00 38.67  ? 148  THR C CA    1 
ATOM   8111  C C     . THR C  1 148 ? 208.774 128.608 -119.140 1.00 38.05  ? 148  THR C C     1 
ATOM   8112  O O     . THR C  1 148 ? 208.592 128.404 -120.339 1.00 38.29  ? 148  THR C O     1 
ATOM   8113  C CB    . THR C  1 148 ? 211.255 128.939 -119.158 1.00 39.05  ? 148  THR C CB    1 
ATOM   8114  O OG1   . THR C  1 148 ? 211.653 127.853 -118.320 1.00 41.04  ? 148  THR C OG1   1 
ATOM   8115  C CG2   . THR C  1 148 ? 212.320 130.010 -119.133 1.00 39.50  ? 148  THR C CG2   1 
ATOM   8116  N N     . GLY C  1 149 ? 208.026 128.059 -118.189 1.00 37.50  ? 149  GLY C N     1 
ATOM   8117  C CA    . GLY C  1 149 ? 206.881 127.237 -118.524 1.00 35.80  ? 149  GLY C CA    1 
ATOM   8118  C C     . GLY C  1 149 ? 206.983 125.887 -119.210 1.00 35.30  ? 149  GLY C C     1 
ATOM   8119  O O     . GLY C  1 149 ? 207.878 125.068 -118.961 1.00 33.23  ? 149  GLY C O     1 
ATOM   8120  N N     . SER C  1 150 ? 206.025 125.662 -120.101 1.00 35.19  ? 150  SER C N     1 
ATOM   8121  C CA    . SER C  1 150 ? 205.915 124.383 -120.795 1.00 36.46  ? 150  SER C CA    1 
ATOM   8122  C C     . SER C  1 150 ? 205.660 124.499 -122.278 1.00 35.80  ? 150  SER C C     1 
ATOM   8123  O O     . SER C  1 150 ? 205.493 125.591 -122.816 1.00 35.86  ? 150  SER C O     1 
ATOM   8124  C CB    . SER C  1 150 ? 204.756 123.580 -120.188 1.00 36.20  ? 150  SER C CB    1 
ATOM   8125  O OG    . SER C  1 150 ? 203.546 124.327 -120.318 1.00 32.84  ? 150  SER C OG    1 
ATOM   8126  N N     . GLU C  1 151 ? 205.621 123.333 -122.916 1.00 36.59  ? 151  GLU C N     1 
ATOM   8127  C CA    . GLU C  1 151 ? 205.344 123.210 -124.339 1.00 36.10  ? 151  GLU C CA    1 
ATOM   8128  C C     . GLU C  1 151 ? 204.504 121.935 -124.476 1.00 35.75  ? 151  GLU C C     1 
ATOM   8129  O O     . GLU C  1 151 ? 204.473 121.104 -123.554 1.00 33.81  ? 151  GLU C O     1 
ATOM   8130  C CB    . GLU C  1 151 ? 206.647 123.058 -125.135 1.00 36.69  ? 151  GLU C CB    1 
ATOM   8131  C CG    . GLU C  1 151 ? 207.427 121.781 -124.784 1.00 38.48  ? 151  GLU C CG    1 
ATOM   8132  C CD    . GLU C  1 151 ? 208.713 121.591 -125.614 1.00 40.02  ? 151  GLU C CD    1 
ATOM   8133  O OE1   . GLU C  1 151 ? 209.010 122.434 -126.490 1.00 40.20  ? 151  GLU C OE1   1 
ATOM   8134  O OE2   . GLU C  1 151 ? 209.425 120.587 -125.387 1.00 41.67  ? 151  GLU C OE2   1 
ATOM   8135  N N     . VAL C  1 152 ? 203.823 121.791 -125.614 1.00 35.10  ? 152  VAL C N     1 
ATOM   8136  C CA    . VAL C  1 152 ? 203.012 120.609 -125.885 1.00 35.58  ? 152  VAL C CA    1 
ATOM   8137  C C     . VAL C  1 152 ? 203.932 119.394 -125.876 1.00 36.32  ? 152  VAL C C     1 
ATOM   8138  O O     . VAL C  1 152 ? 205.090 119.487 -126.259 1.00 36.95  ? 152  VAL C O     1 
ATOM   8139  C CB    . VAL C  1 152 ? 202.311 120.722 -127.274 1.00 35.97  ? 152  VAL C CB    1 
ATOM   8140  C CG1   . VAL C  1 152 ? 201.530 119.455 -127.588 1.00 35.99  ? 152  VAL C CG1   1 
ATOM   8141  C CG2   . VAL C  1 152 ? 201.370 121.932 -127.277 1.00 36.04  ? 152  VAL C CG2   1 
ATOM   8142  N N     . THR C  1 153 ? 203.427 118.263 -125.405 1.00 37.19  ? 153  THR C N     1 
ATOM   8143  C CA    . THR C  1 153 ? 204.209 117.035 -125.372 1.00 37.72  ? 153  THR C CA    1 
ATOM   8144  C C     . THR C  1 153 ? 203.855 116.361 -126.692 1.00 38.48  ? 153  THR C C     1 
ATOM   8145  O O     . THR C  1 153 ? 202.695 116.044 -126.950 1.00 37.61  ? 153  THR C O     1 
ATOM   8146  C CB    . THR C  1 153 ? 203.785 116.158 -124.184 1.00 38.61  ? 153  THR C CB    1 
ATOM   8147  O OG1   . THR C  1 153 ? 204.035 116.876 -122.967 1.00 39.47  ? 153  THR C OG1   1 
ATOM   8148  C CG2   . THR C  1 153 ? 204.561 114.852 -124.172 1.00 38.00  ? 153  THR C CG2   1 
ATOM   8149  N N     . PRO C  1 154 ? 204.847 116.162 -127.562 1.00 39.04  ? 154  PRO C N     1 
ATOM   8150  C CA    . PRO C  1 154 ? 204.492 115.525 -128.829 1.00 39.80  ? 154  PRO C CA    1 
ATOM   8151  C C     . PRO C  1 154 ? 204.211 114.035 -128.725 1.00 40.08  ? 154  PRO C C     1 
ATOM   8152  O O     . PRO C  1 154 ? 204.640 113.369 -127.786 1.00 39.60  ? 154  PRO C O     1 
ATOM   8153  C CB    . PRO C  1 154 ? 205.686 115.851 -129.726 1.00 40.50  ? 154  PRO C CB    1 
ATOM   8154  C CG    . PRO C  1 154 ? 206.830 115.834 -128.766 1.00 41.70  ? 154  PRO C CG    1 
ATOM   8155  C CD    . PRO C  1 154 ? 206.273 116.529 -127.517 1.00 40.00  ? 154  PRO C CD    1 
ATOM   8156  N N     . PHE C  1 155 ? 203.444 113.528 -129.682 1.00 41.12  ? 155  PHE C N     1 
ATOM   8157  C CA    . PHE C  1 155 ? 203.134 112.109 -129.738 1.00 41.88  ? 155  PHE C CA    1 
ATOM   8158  C C     . PHE C  1 155 ? 204.146 111.555 -130.745 1.00 42.92  ? 155  PHE C C     1 
ATOM   8159  O O     . PHE C  1 155 ? 204.140 111.920 -131.917 1.00 41.38  ? 155  PHE C O     1 
ATOM   8160  C CB    . PHE C  1 155 ? 201.704 111.905 -130.231 1.00 42.08  ? 155  PHE C CB    1 
ATOM   8161  C CG    . PHE C  1 155 ? 201.228 110.480 -130.150 1.00 43.00  ? 155  PHE C CG    1 
ATOM   8162  C CD1   . PHE C  1 155 ? 201.717 109.518 -131.022 1.00 43.55  ? 155  PHE C CD1   1 
ATOM   8163  C CD2   . PHE C  1 155 ? 200.276 110.105 -129.209 1.00 43.27  ? 155  PHE C CD2   1 
ATOM   8164  C CE1   . PHE C  1 155 ? 201.260 108.191 -130.961 1.00 44.25  ? 155  PHE C CE1   1 
ATOM   8165  C CE2   . PHE C  1 155 ? 199.809 108.784 -129.138 1.00 44.53  ? 155  PHE C CE2   1 
ATOM   8166  C CZ    . PHE C  1 155 ? 200.302 107.826 -130.016 1.00 44.57  ? 155  PHE C CZ    1 
ATOM   8167  N N     . PRO C  1 156 ? 205.035 110.663 -130.293 1.00 44.78  ? 156  PRO C N     1 
ATOM   8168  C CA    . PRO C  1 156 ? 206.043 110.095 -131.199 1.00 45.34  ? 156  PRO C CA    1 
ATOM   8169  C C     . PRO C  1 156 ? 205.459 109.410 -132.421 1.00 45.74  ? 156  PRO C C     1 
ATOM   8170  O O     . PRO C  1 156 ? 204.604 108.529 -132.299 1.00 45.46  ? 156  PRO C O     1 
ATOM   8171  C CB    . PRO C  1 156 ? 206.790 109.107 -130.311 1.00 46.12  ? 156  PRO C CB    1 
ATOM   8172  C CG    . PRO C  1 156 ? 205.712 108.615 -129.391 1.00 46.63  ? 156  PRO C CG    1 
ATOM   8173  C CD    . PRO C  1 156 ? 204.968 109.897 -129.031 1.00 45.42  ? 156  PRO C CD    1 
ATOM   8174  N N     . GLY C  1 157 ? 205.928 109.816 -133.596 1.00 45.56  ? 157  GLY C N     1 
ATOM   8175  C CA    . GLY C  1 157 ? 205.449 109.214 -134.825 1.00 44.39  ? 157  GLY C CA    1 
ATOM   8176  C C     . GLY C  1 157 ? 204.369 110.026 -135.504 1.00 44.27  ? 157  GLY C C     1 
ATOM   8177  O O     . GLY C  1 157 ? 204.012 109.771 -136.658 1.00 43.93  ? 157  GLY C O     1 
ATOM   8178  N N     . ILE C  1 158 ? 203.818 110.997 -134.787 1.00 42.88  ? 158  ILE C N     1 
ATOM   8179  C CA    . ILE C  1 158 ? 202.786 111.836 -135.366 1.00 41.54  ? 158  ILE C CA    1 
ATOM   8180  C C     . ILE C  1 158 ? 203.325 113.236 -135.316 1.00 42.76  ? 158  ILE C C     1 
ATOM   8181  O O     . ILE C  1 158 ? 203.696 113.725 -134.254 1.00 43.73  ? 158  ILE C O     1 
ATOM   8182  C CB    . ILE C  1 158 ? 201.466 111.772 -134.577 1.00 40.18  ? 158  ILE C CB    1 
ATOM   8183  C CG1   . ILE C  1 158 ? 200.877 110.357 -134.659 1.00 38.57  ? 158  ILE C CG1   1 
ATOM   8184  C CG2   . ILE C  1 158 ? 200.490 112.803 -135.134 1.00 38.77  ? 158  ILE C CG2   1 
ATOM   8185  C CD1   . ILE C  1 158 ? 199.568 110.144 -133.892 1.00 36.68  ? 158  ILE C CD1   1 
ATOM   8186  N N     . THR C  1 159 ? 203.386 113.885 -136.468 1.00 43.68  ? 159  THR C N     1 
ATOM   8187  C CA    . THR C  1 159 ? 203.913 115.239 -136.522 1.00 44.31  ? 159  THR C CA    1 
ATOM   8188  C C     . THR C  1 159 ? 202.792 116.264 -136.562 1.00 44.16  ? 159  THR C C     1 
ATOM   8189  O O     . THR C  1 159 ? 201.914 116.210 -137.424 1.00 43.14  ? 159  THR C O     1 
ATOM   8190  C CB    . THR C  1 159 ? 204.828 115.430 -137.753 1.00 45.23  ? 159  THR C CB    1 
ATOM   8191  O OG1   . THR C  1 159 ? 205.933 114.521 -137.658 1.00 46.21  ? 159  THR C OG1   1 
ATOM   8192  C CG2   . THR C  1 159 ? 205.355 116.868 -137.818 1.00 45.46  ? 159  THR C CG2   1 
ATOM   8193  N N     . ILE C  1 160 ? 202.824 117.192 -135.613 1.00 43.86  ? 160  ILE C N     1 
ATOM   8194  C CA    . ILE C  1 160 ? 201.814 118.238 -135.539 1.00 43.63  ? 160  ILE C CA    1 
ATOM   8195  C C     . ILE C  1 160 ? 202.227 119.326 -136.517 1.00 43.93  ? 160  ILE C C     1 
ATOM   8196  O O     . ILE C  1 160 ? 203.391 119.722 -136.535 1.00 44.45  ? 160  ILE C O     1 
ATOM   8197  C CB    . ILE C  1 160 ? 201.744 118.810 -134.105 1.00 43.22  ? 160  ILE C CB    1 
ATOM   8198  C CG1   . ILE C  1 160 ? 201.365 117.681 -133.140 1.00 42.54  ? 160  ILE C CG1   1 
ATOM   8199  C CG2   . ILE C  1 160 ? 200.760 119.970 -134.039 1.00 42.57  ? 160  ILE C CG2   1 
ATOM   8200  C CD1   . ILE C  1 160 ? 201.610 117.995 -131.700 1.00 43.68  ? 160  ILE C CD1   1 
ATOM   8201  N N     . ASP C  1 161 ? 201.297 119.783 -137.350 1.00 42.95  ? 161  ASP C N     1 
ATOM   8202  C CA    . ASP C  1 161 ? 201.614 120.839 -138.300 1.00 43.28  ? 161  ASP C CA    1 
ATOM   8203  C C     . ASP C  1 161 ? 200.641 121.999 -138.136 1.00 42.87  ? 161  ASP C C     1 
ATOM   8204  O O     . ASP C  1 161 ? 200.618 122.919 -138.946 1.00 42.43  ? 161  ASP C O     1 
ATOM   8205  C CB    . ASP C  1 161 ? 201.553 120.312 -139.737 1.00 45.09  ? 161  ASP C CB    1 
ATOM   8206  C CG    . ASP C  1 161 ? 200.248 119.603 -140.046 1.00 46.38  ? 161  ASP C CG    1 
ATOM   8207  O OD1   . ASP C  1 161 ? 199.173 120.086 -139.621 1.00 44.72  ? 161  ASP C OD1   1 
ATOM   8208  O OD2   . ASP C  1 161 ? 200.298 118.561 -140.730 1.00 48.37  ? 161  ASP C OD2   1 
ATOM   8209  N N     . GLU C  1 162 ? 199.848 121.953 -137.070 1.00 42.30  ? 162  GLU C N     1 
ATOM   8210  C CA    . GLU C  1 162 ? 198.847 122.979 -136.786 1.00 41.30  ? 162  GLU C CA    1 
ATOM   8211  C C     . GLU C  1 162 ? 197.961 123.310 -137.977 1.00 41.71  ? 162  GLU C C     1 
ATOM   8212  O O     . GLU C  1 162 ? 197.391 124.396 -138.047 1.00 41.89  ? 162  GLU C O     1 
ATOM   8213  C CB    . GLU C  1 162 ? 199.496 124.261 -136.255 1.00 39.96  ? 162  GLU C CB    1 
ATOM   8214  C CG    . GLU C  1 162 ? 200.408 124.037 -135.062 1.00 39.23  ? 162  GLU C CG    1 
ATOM   8215  C CD    . GLU C  1 162 ? 199.699 123.489 -133.811 1.00 38.92  ? 162  GLU C CD    1 
ATOM   8216  O OE1   . GLU C  1 162 ? 198.469 123.199 -133.838 1.00 37.49  ? 162  GLU C OE1   1 
ATOM   8217  O OE2   . GLU C  1 162 ? 200.409 123.350 -132.788 1.00 39.65  ? 162  GLU C OE2   1 
ATOM   8218  N N     . ASP C  1 163 ? 197.858 122.378 -138.921 1.00 42.25  ? 163  ASP C N     1 
ATOM   8219  C CA    . ASP C  1 163 ? 196.986 122.557 -140.076 1.00 42.16  ? 163  ASP C CA    1 
ATOM   8220  C C     . ASP C  1 163 ? 195.845 121.561 -139.861 1.00 41.52  ? 163  ASP C C     1 
ATOM   8221  O O     . ASP C  1 163 ? 194.766 121.946 -139.412 1.00 40.10  ? 163  ASP C O     1 
ATOM   8222  C CB    . ASP C  1 163 ? 197.730 122.247 -141.382 1.00 43.22  ? 163  ASP C CB    1 
ATOM   8223  C CG    . ASP C  1 163 ? 196.869 122.489 -142.617 1.00 44.13  ? 163  ASP C CG    1 
ATOM   8224  O OD1   . ASP C  1 163 ? 195.708 122.932 -142.479 1.00 42.97  ? 163  ASP C OD1   1 
ATOM   8225  O OD2   . ASP C  1 163 ? 197.356 122.235 -143.740 1.00 47.96  ? 163  ASP C OD2   1 
ATOM   8226  N N     . THR C  1 164 ? 196.090 120.281 -140.172 1.00 40.67  ? 164  THR C N     1 
ATOM   8227  C CA    . THR C  1 164 ? 195.080 119.233 -139.974 1.00 40.09  ? 164  THR C CA    1 
ATOM   8228  C C     . THR C  1 164 ? 195.464 118.369 -138.771 1.00 37.88  ? 164  THR C C     1 
ATOM   8229  O O     . THR C  1 164 ? 194.608 117.759 -138.149 1.00 38.22  ? 164  THR C O     1 
ATOM   8230  C CB    . THR C  1 164 ? 194.929 118.306 -141.201 1.00 40.60  ? 164  THR C CB    1 
ATOM   8231  O OG1   . THR C  1 164 ? 196.191 117.690 -141.493 1.00 41.91  ? 164  THR C OG1   1 
ATOM   8232  C CG2   . THR C  1 164 ? 194.438 119.083 -142.401 1.00 42.88  ? 164  THR C CG2   1 
ATOM   8233  N N     . ILE C  1 165 ? 196.759 118.287 -138.484 1.00 37.11  ? 165  ILE C N     1 
ATOM   8234  C CA    . ILE C  1 165 ? 197.246 117.561 -137.313 1.00 36.76  ? 165  ILE C CA    1 
ATOM   8235  C C     . ILE C  1 165 ? 197.693 118.683 -136.359 1.00 37.14  ? 165  ILE C C     1 
ATOM   8236  O O     . ILE C  1 165 ? 198.787 119.256 -136.518 1.00 36.58  ? 165  ILE C O     1 
ATOM   8237  C CB    . ILE C  1 165 ? 198.435 116.641 -137.650 1.00 36.30  ? 165  ILE C CB    1 
ATOM   8238  C CG1   . ILE C  1 165 ? 197.982 115.540 -138.609 1.00 36.91  ? 165  ILE C CG1   1 
ATOM   8239  C CG2   . ILE C  1 165 ? 198.956 115.980 -136.380 1.00 36.20  ? 165  ILE C CG2   1 
ATOM   8240  C CD1   . ILE C  1 165 ? 199.109 114.652 -139.062 1.00 37.05  ? 165  ILE C CD1   1 
ATOM   8241  N N     . VAL C  1 166 ? 196.839 118.979 -135.367 1.00 35.44  ? 166  VAL C N     1 
ATOM   8242  C CA    . VAL C  1 166 ? 197.067 120.081 -134.432 1.00 33.94  ? 166  VAL C CA    1 
ATOM   8243  C C     . VAL C  1 166 ? 197.237 119.774 -132.948 1.00 34.12  ? 166  VAL C C     1 
ATOM   8244  O O     . VAL C  1 166 ? 196.856 118.702 -132.462 1.00 33.29  ? 166  VAL C O     1 
ATOM   8245  C CB    . VAL C  1 166 ? 195.900 121.101 -134.503 1.00 33.83  ? 166  VAL C CB    1 
ATOM   8246  C CG1   . VAL C  1 166 ? 195.668 121.568 -135.947 1.00 32.81  ? 166  VAL C CG1   1 
ATOM   8247  C CG2   . VAL C  1 166 ? 194.620 120.466 -133.939 1.00 31.74  ? 166  VAL C CG2   1 
ATOM   8248  N N     . SER C  1 167 ? 197.816 120.748 -132.241 1.00 33.89  ? 167  SER C N     1 
ATOM   8249  C CA    . SER C  1 167 ? 197.976 120.671 -130.790 1.00 31.68  ? 167  SER C CA    1 
ATOM   8250  C C     . SER C  1 167 ? 196.842 121.579 -130.344 1.00 31.16  ? 167  SER C C     1 
ATOM   8251  O O     . SER C  1 167 ? 196.030 121.996 -131.173 1.00 30.94  ? 167  SER C O     1 
ATOM   8252  C CB    . SER C  1 167 ? 199.320 121.254 -130.320 1.00 30.67  ? 167  SER C CB    1 
ATOM   8253  O OG    . SER C  1 167 ? 199.363 122.660 -130.469 1.00 27.64  ? 167  SER C OG    1 
ATOM   8254  N N     . SER C  1 168 ? 196.770 121.886 -129.050 1.00 30.30  ? 168  SER C N     1 
ATOM   8255  C CA    . SER C  1 168 ? 195.720 122.776 -128.554 1.00 28.50  ? 168  SER C CA    1 
ATOM   8256  C C     . SER C  1 168 ? 195.758 124.144 -129.264 1.00 27.70  ? 168  SER C C     1 
ATOM   8257  O O     . SER C  1 168 ? 194.722 124.787 -129.457 1.00 29.15  ? 168  SER C O     1 
ATOM   8258  C CB    . SER C  1 168 ? 195.877 122.962 -127.031 1.00 26.57  ? 168  SER C CB    1 
ATOM   8259  O OG    . SER C  1 168 ? 197.241 123.118 -126.665 1.00 25.79  ? 168  SER C OG    1 
ATOM   8260  N N     . THR C  1 169 ? 196.948 124.574 -129.659 1.00 27.93  ? 169  THR C N     1 
ATOM   8261  C CA    . THR C  1 169 ? 197.119 125.864 -130.327 1.00 27.28  ? 169  THR C CA    1 
ATOM   8262  C C     . THR C  1 169 ? 196.413 125.910 -131.676 1.00 27.35  ? 169  THR C C     1 
ATOM   8263  O O     . THR C  1 169 ? 195.684 126.860 -131.955 1.00 26.46  ? 169  THR C O     1 
ATOM   8264  C CB    . THR C  1 169 ? 198.602 126.185 -130.540 1.00 29.09  ? 169  THR C CB    1 
ATOM   8265  O OG1   . THR C  1 169 ? 199.251 126.326 -129.263 1.00 28.28  ? 169  THR C OG1   1 
ATOM   8266  C CG2   . THR C  1 169 ? 198.746 127.482 -131.361 1.00 28.96  ? 169  THR C CG2   1 
ATOM   8267  N N     . GLY C  1 170 ? 196.629 124.892 -132.509 1.00 27.56  ? 170  GLY C N     1 
ATOM   8268  C CA    . GLY C  1 170 ? 195.962 124.850 -133.801 1.00 26.62  ? 170  GLY C CA    1 
ATOM   8269  C C     . GLY C  1 170 ? 194.459 124.685 -133.620 1.00 27.70  ? 170  GLY C C     1 
ATOM   8270  O O     . GLY C  1 170 ? 193.659 125.299 -134.336 1.00 25.00  ? 170  GLY C O     1 
ATOM   8271  N N     . ALA C  1 171 ? 194.066 123.879 -132.626 1.00 27.21  ? 171  ALA C N     1 
ATOM   8272  C CA    . ALA C  1 171 ? 192.657 123.627 -132.362 1.00 26.59  ? 171  ALA C CA    1 
ATOM   8273  C C     . ALA C  1 171 ? 191.897 124.887 -131.945 1.00 27.91  ? 171  ALA C C     1 
ATOM   8274  O O     . ALA C  1 171 ? 190.691 124.997 -132.176 1.00 27.67  ? 171  ALA C O     1 
ATOM   8275  C CB    . ALA C  1 171 ? 192.520 122.527 -131.281 1.00 26.72  ? 171  ALA C CB    1 
ATOM   8276  N N     . LEU C  1 172 ? 192.599 125.839 -131.342 1.00 28.37  ? 172  LEU C N     1 
ATOM   8277  C CA    . LEU C  1 172 ? 191.961 127.079 -130.900 1.00 29.18  ? 172  LEU C CA    1 
ATOM   8278  C C     . LEU C  1 172 ? 191.723 128.048 -132.043 1.00 29.62  ? 172  LEU C C     1 
ATOM   8279  O O     . LEU C  1 172 ? 190.988 129.018 -131.892 1.00 29.30  ? 172  LEU C O     1 
ATOM   8280  C CB    . LEU C  1 172 ? 192.808 127.762 -129.817 1.00 26.23  ? 172  LEU C CB    1 
ATOM   8281  C CG    . LEU C  1 172 ? 192.829 127.090 -128.436 1.00 26.65  ? 172  LEU C CG    1 
ATOM   8282  C CD1   . LEU C  1 172 ? 193.949 127.695 -127.572 1.00 28.23  ? 172  LEU C CD1   1 
ATOM   8283  C CD2   . LEU C  1 172 ? 191.489 127.267 -127.756 1.00 23.63  ? 172  LEU C CD2   1 
ATOM   8284  N N     . SER C  1 173 ? 192.322 127.766 -133.193 1.00 32.27  ? 173  SER C N     1 
ATOM   8285  C CA    . SER C  1 173 ? 192.171 128.645 -134.345 1.00 34.35  ? 173  SER C CA    1 
ATOM   8286  C C     . SER C  1 173 ? 191.761 127.954 -135.645 1.00 36.04  ? 173  SER C C     1 
ATOM   8287  O O     . SER C  1 173 ? 192.083 128.443 -136.723 1.00 36.32  ? 173  SER C O     1 
ATOM   8288  C CB    . SER C  1 173 ? 193.474 129.420 -134.566 1.00 34.71  ? 173  SER C CB    1 
ATOM   8289  O OG    . SER C  1 173 ? 193.808 130.167 -133.414 1.00 33.08  ? 173  SER C OG    1 
ATOM   8290  N N     . LEU C  1 174 ? 191.043 126.832 -135.549 1.00 37.20  ? 174  LEU C N     1 
ATOM   8291  C CA    . LEU C  1 174 ? 190.600 126.123 -136.751 1.00 37.89  ? 174  LEU C CA    1 
ATOM   8292  C C     . LEU C  1 174 ? 189.794 127.061 -137.634 1.00 37.94  ? 174  LEU C C     1 
ATOM   8293  O O     . LEU C  1 174 ? 188.958 127.816 -137.143 1.00 38.96  ? 174  LEU C O     1 
ATOM   8294  C CB    . LEU C  1 174 ? 189.751 124.894 -136.387 1.00 37.97  ? 174  LEU C CB    1 
ATOM   8295  C CG    . LEU C  1 174 ? 190.528 123.689 -135.847 1.00 37.44  ? 174  LEU C CG    1 
ATOM   8296  C CD1   . LEU C  1 174 ? 189.588 122.541 -135.570 1.00 36.30  ? 174  LEU C CD1   1 
ATOM   8297  C CD2   . LEU C  1 174 ? 191.573 123.256 -136.857 1.00 38.19  ? 174  LEU C CD2   1 
ATOM   8298  N N     . LYS C  1 175 ? 190.045 127.006 -138.939 1.00 38.98  ? 175  LYS C N     1 
ATOM   8299  C CA    . LYS C  1 175 ? 189.361 127.862 -139.903 1.00 38.58  ? 175  LYS C CA    1 
ATOM   8300  C C     . LYS C  1 175 ? 187.936 127.445 -140.211 1.00 36.87  ? 175  LYS C C     1 
ATOM   8301  O O     . LYS C  1 175 ? 187.104 128.266 -140.568 1.00 36.27  ? 175  LYS C O     1 
ATOM   8302  C CB    . LYS C  1 175 ? 190.169 127.913 -141.198 1.00 42.25  ? 175  LYS C CB    1 
ATOM   8303  C CG    . LYS C  1 175 ? 191.461 128.694 -141.057 1.00 45.30  ? 175  LYS C CG    1 
ATOM   8304  C CD    . LYS C  1 175 ? 191.160 130.183 -140.878 1.00 48.31  ? 175  LYS C CD    1 
ATOM   8305  C CE    . LYS C  1 175 ? 192.392 130.965 -140.428 1.00 51.30  ? 175  LYS C CE    1 
ATOM   8306  N NZ    . LYS C  1 175 ? 192.801 130.651 -139.013 1.00 51.41  ? 175  LYS C NZ    1 
ATOM   8307  N N     . LYS C  1 176 ? 187.664 126.161 -140.103 1.00 35.71  ? 176  LYS C N     1 
ATOM   8308  C CA    . LYS C  1 176 ? 186.324 125.645 -140.352 1.00 36.47  ? 176  LYS C CA    1 
ATOM   8309  C C     . LYS C  1 176 ? 186.030 124.576 -139.313 1.00 34.08  ? 176  LYS C C     1 
ATOM   8310  O O     . LYS C  1 176 ? 186.936 123.967 -138.746 1.00 31.96  ? 176  LYS C O     1 
ATOM   8311  C CB    . LYS C  1 176 ? 186.212 125.005 -141.757 1.00 39.94  ? 176  LYS C CB    1 
ATOM   8312  C CG    . LYS C  1 176 ? 186.098 125.972 -142.935 1.00 46.20  ? 176  LYS C CG    1 
ATOM   8313  C CD    . LYS C  1 176 ? 184.661 126.508 -143.126 1.00 50.74  ? 176  LYS C CD    1 
ATOM   8314  C CE    . LYS C  1 176 ? 184.472 127.189 -144.507 1.00 52.47  ? 176  LYS C CE    1 
ATOM   8315  N NZ    . LYS C  1 176 ? 183.081 127.753 -144.734 1.00 54.85  ? 176  LYS C NZ    1 
ATOM   8316  N N     . VAL C  1 177 ? 184.754 124.360 -139.066 1.00 33.22  ? 177  VAL C N     1 
ATOM   8317  C CA    . VAL C  1 177 ? 184.335 123.330 -138.140 1.00 33.16  ? 177  VAL C CA    1 
ATOM   8318  C C     . VAL C  1 177 ? 184.699 122.004 -138.840 1.00 34.89  ? 177  VAL C C     1 
ATOM   8319  O O     . VAL C  1 177 ? 184.231 121.732 -139.950 1.00 33.64  ? 177  VAL C O     1 
ATOM   8320  C CB    . VAL C  1 177 ? 182.822 123.410 -137.930 1.00 30.44  ? 177  VAL C CB    1 
ATOM   8321  C CG1   . VAL C  1 177 ? 182.347 122.232 -137.116 1.00 28.54  ? 177  VAL C CG1   1 
ATOM   8322  C CG2   . VAL C  1 177 ? 182.467 124.737 -137.270 1.00 30.27  ? 177  VAL C CG2   1 
ATOM   8323  N N     . PRO C  1 178 ? 185.553 121.173 -138.218 1.00 35.09  ? 178  PRO C N     1 
ATOM   8324  C CA    . PRO C  1 178 ? 185.858 119.926 -138.933 1.00 35.87  ? 178  PRO C CA    1 
ATOM   8325  C C     . PRO C  1 178 ? 184.664 118.976 -138.905 1.00 35.85  ? 178  PRO C C     1 
ATOM   8326  O O     . PRO C  1 178 ? 183.918 118.925 -137.929 1.00 34.37  ? 178  PRO C O     1 
ATOM   8327  C CB    . PRO C  1 178 ? 187.070 119.372 -138.180 1.00 37.07  ? 178  PRO C CB    1 
ATOM   8328  C CG    . PRO C  1 178 ? 186.831 119.873 -136.754 1.00 36.68  ? 178  PRO C CG    1 
ATOM   8329  C CD    . PRO C  1 178 ? 186.339 121.299 -136.980 1.00 35.80  ? 178  PRO C CD    1 
ATOM   8330  N N     . GLU C  1 179 ? 184.470 118.240 -139.996 1.00 36.49  ? 179  GLU C N     1 
ATOM   8331  C CA    . GLU C  1 179 ? 183.368 117.296 -140.069 1.00 36.77  ? 179  GLU C CA    1 
ATOM   8332  C C     . GLU C  1 179 ? 183.600 116.181 -139.050 1.00 34.99  ? 179  GLU C C     1 
ATOM   8333  O O     . GLU C  1 179 ? 182.677 115.788 -138.342 1.00 32.92  ? 179  GLU C O     1 
ATOM   8334  C CB    . GLU C  1 179 ? 183.272 116.699 -141.472 1.00 40.86  ? 179  GLU C CB    1 
ATOM   8335  C CG    . GLU C  1 179 ? 182.048 115.835 -141.684 1.00 47.12  ? 179  GLU C CG    1 
ATOM   8336  C CD    . GLU C  1 179 ? 181.966 115.278 -143.107 1.00 51.66  ? 179  GLU C CD    1 
ATOM   8337  O OE1   . GLU C  1 179 ? 182.709 115.769 -143.998 1.00 54.29  ? 179  GLU C OE1   1 
ATOM   8338  O OE2   . GLU C  1 179 ? 181.146 114.357 -143.328 1.00 53.05  ? 179  GLU C OE2   1 
ATOM   8339  N N     . LYS C  1 180 ? 184.828 115.664 -139.007 1.00 34.84  ? 180  LYS C N     1 
ATOM   8340  C CA    . LYS C  1 180 ? 185.204 114.619 -138.055 1.00 36.37  ? 180  LYS C CA    1 
ATOM   8341  C C     . LYS C  1 180 ? 186.514 115.001 -137.419 1.00 35.48  ? 180  LYS C C     1 
ATOM   8342  O O     . LYS C  1 180 ? 187.450 115.391 -138.111 1.00 35.01  ? 180  LYS C O     1 
ATOM   8343  C CB    . LYS C  1 180 ? 185.396 113.248 -138.706 1.00 38.43  ? 180  LYS C CB    1 
ATOM   8344  C CG    . LYS C  1 180 ? 184.112 112.481 -138.916 1.00 44.07  ? 180  LYS C CG    1 
ATOM   8345  C CD    . LYS C  1 180 ? 184.340 110.950 -138.907 1.00 46.88  ? 180  LYS C CD    1 
ATOM   8346  C CE    . LYS C  1 180 ? 184.759 110.415 -137.518 1.00 49.07  ? 180  LYS C CE    1 
ATOM   8347  N NZ    . LYS C  1 180 ? 184.869 108.911 -137.475 1.00 49.61  ? 180  LYS C NZ    1 
ATOM   8348  N N     . MET C  1 181 ? 186.579 114.875 -136.100 1.00 34.21  ? 181  MET C N     1 
ATOM   8349  C CA    . MET C  1 181 ? 187.779 115.204 -135.381 1.00 32.97  ? 181  MET C CA    1 
ATOM   8350  C C     . MET C  1 181 ? 188.088 114.099 -134.402 1.00 31.99  ? 181  MET C C     1 
ATOM   8351  O O     . MET C  1 181 ? 187.200 113.608 -133.701 1.00 30.55  ? 181  MET C O     1 
ATOM   8352  C CB    . MET C  1 181 ? 187.612 116.525 -134.617 1.00 34.90  ? 181  MET C CB    1 
ATOM   8353  C CG    . MET C  1 181 ? 188.802 116.881 -133.727 1.00 38.53  ? 181  MET C CG    1 
ATOM   8354  S SD    . MET C  1 181 ? 188.786 118.621 -133.149 1.00 40.95  ? 181  MET C SD    1 
ATOM   8355  C CE    . MET C  1 181 ? 187.459 118.517 -131.930 1.00 42.42  ? 181  MET C CE    1 
ATOM   8356  N N     . VAL C  1 182 ? 189.351 113.693 -134.368 1.00 31.05  ? 182  VAL C N     1 
ATOM   8357  C CA    . VAL C  1 182 ? 189.777 112.673 -133.427 1.00 29.33  ? 182  VAL C CA    1 
ATOM   8358  C C     . VAL C  1 182 ? 190.682 113.403 -132.474 1.00 29.00  ? 182  VAL C C     1 
ATOM   8359  O O     . VAL C  1 182 ? 191.489 114.236 -132.894 1.00 28.50  ? 182  VAL C O     1 
ATOM   8360  C CB    . VAL C  1 182 ? 190.557 111.525 -134.114 1.00 29.59  ? 182  VAL C CB    1 
ATOM   8361  C CG1   . VAL C  1 182 ? 191.310 110.699 -133.071 1.00 26.78  ? 182  VAL C CG1   1 
ATOM   8362  C CG2   . VAL C  1 182 ? 189.581 110.636 -134.884 1.00 26.28  ? 182  VAL C CG2   1 
ATOM   8363  N N     . VAL C  1 183 ? 190.512 113.118 -131.186 1.00 28.74  ? 183  VAL C N     1 
ATOM   8364  C CA    . VAL C  1 183 ? 191.333 113.736 -130.152 1.00 27.05  ? 183  VAL C CA    1 
ATOM   8365  C C     . VAL C  1 183 ? 192.099 112.641 -129.444 1.00 25.84  ? 183  VAL C C     1 
ATOM   8366  O O     . VAL C  1 183 ? 191.507 111.632 -129.038 1.00 24.98  ? 183  VAL C O     1 
ATOM   8367  C CB    . VAL C  1 183 ? 190.460 114.489 -129.126 1.00 27.04  ? 183  VAL C CB    1 
ATOM   8368  C CG1   . VAL C  1 183 ? 191.319 115.024 -127.984 1.00 27.13  ? 183  VAL C CG1   1 
ATOM   8369  C CG2   . VAL C  1 183 ? 189.739 115.622 -129.822 1.00 25.22  ? 183  VAL C CG2   1 
ATOM   8370  N N     . ILE C  1 184 ? 193.419 112.804 -129.352 1.00 26.36  ? 184  ILE C N     1 
ATOM   8371  C CA    . ILE C  1 184 ? 194.247 111.827 -128.633 1.00 26.50  ? 184  ILE C CA    1 
ATOM   8372  C C     . ILE C  1 184 ? 194.441 112.448 -127.241 1.00 25.41  ? 184  ILE C C     1 
ATOM   8373  O O     . ILE C  1 184 ? 195.000 113.521 -127.114 1.00 25.34  ? 184  ILE C O     1 
ATOM   8374  C CB    . ILE C  1 184 ? 195.659 111.598 -129.301 1.00 27.57  ? 184  ILE C CB    1 
ATOM   8375  C CG1   . ILE C  1 184 ? 195.499 111.099 -130.754 1.00 27.76  ? 184  ILE C CG1   1 
ATOM   8376  C CG2   . ILE C  1 184 ? 196.456 110.538 -128.506 1.00 26.33  ? 184  ILE C CG2   1 
ATOM   8377  C CD1   . ILE C  1 184 ? 196.828 110.990 -131.531 1.00 28.20  ? 184  ILE C CD1   1 
ATOM   8378  N N     . GLY C  1 185 ? 193.967 111.757 -126.213 1.00 26.20  ? 185  GLY C N     1 
ATOM   8379  C CA    . GLY C  1 185 ? 194.057 112.257 -124.851 1.00 26.97  ? 185  GLY C CA    1 
ATOM   8380  C C     . GLY C  1 185 ? 192.714 112.817 -124.401 1.00 26.93  ? 185  GLY C C     1 
ATOM   8381  O O     . GLY C  1 185 ? 192.293 113.880 -124.876 1.00 29.61  ? 185  GLY C O     1 
ATOM   8382  N N     . ALA C  1 186 ? 192.018 112.100 -123.516 1.00 26.99  ? 186  ALA C N     1 
ATOM   8383  C CA    . ALA C  1 186 ? 190.739 112.584 -123.001 1.00 26.43  ? 186  ALA C CA    1 
ATOM   8384  C C     . ALA C  1 186 ? 191.008 113.251 -121.666 1.00 27.61  ? 186  ALA C C     1 
ATOM   8385  O O     . ALA C  1 186 ? 190.329 112.996 -120.661 1.00 27.21  ? 186  ALA C O     1 
ATOM   8386  C CB    . ALA C  1 186 ? 189.740 111.439 -122.838 1.00 27.17  ? 186  ALA C CB    1 
ATOM   8387  N N     . GLY C  1 187 ? 192.031 114.100 -121.681 1.00 28.11  ? 187  GLY C N     1 
ATOM   8388  C CA    . GLY C  1 187 ? 192.435 114.852 -120.506 1.00 27.20  ? 187  GLY C CA    1 
ATOM   8389  C C     . GLY C  1 187 ? 191.610 116.117 -120.447 1.00 27.08  ? 187  GLY C C     1 
ATOM   8390  O O     . GLY C  1 187 ? 190.528 116.173 -121.035 1.00 26.93  ? 187  GLY C O     1 
ATOM   8391  N N     . VAL C  1 188 ? 192.107 117.149 -119.771 1.00 26.56  ? 188  VAL C N     1 
ATOM   8392  C CA    . VAL C  1 188 ? 191.317 118.371 -119.652 1.00 26.16  ? 188  VAL C CA    1 
ATOM   8393  C C     . VAL C  1 188 ? 191.183 119.132 -120.962 1.00 24.55  ? 188  VAL C C     1 
ATOM   8394  O O     . VAL C  1 188 ? 190.090 119.560 -121.317 1.00 22.80  ? 188  VAL C O     1 
ATOM   8395  C CB    . VAL C  1 188 ? 191.857 119.308 -118.541 1.00 26.04  ? 188  VAL C CB    1 
ATOM   8396  C CG1   . VAL C  1 188 ? 190.979 120.570 -118.441 1.00 24.39  ? 188  VAL C CG1   1 
ATOM   8397  C CG2   . VAL C  1 188 ? 191.854 118.555 -117.200 1.00 25.60  ? 188  VAL C CG2   1 
ATOM   8398  N N     . ILE C  1 189 ? 192.289 119.279 -121.682 1.00 26.82  ? 189  ILE C N     1 
ATOM   8399  C CA    . ILE C  1 189 ? 192.258 119.973 -122.965 1.00 28.50  ? 189  ILE C CA    1 
ATOM   8400  C C     . ILE C  1 189 ? 191.358 119.216 -123.930 1.00 27.89  ? 189  ILE C C     1 
ATOM   8401  O O     . ILE C  1 189 ? 190.524 119.812 -124.623 1.00 29.88  ? 189  ILE C O     1 
ATOM   8402  C CB    . ILE C  1 189 ? 193.678 120.078 -123.604 1.00 29.93  ? 189  ILE C CB    1 
ATOM   8403  C CG1   . ILE C  1 189 ? 194.467 121.217 -122.954 1.00 32.04  ? 189  ILE C CG1   1 
ATOM   8404  C CG2   . ILE C  1 189 ? 193.572 120.331 -125.123 1.00 31.87  ? 189  ILE C CG2   1 
ATOM   8405  C CD1   . ILE C  1 189 ? 195.915 121.325 -123.461 1.00 30.30  ? 189  ILE C CD1   1 
ATOM   8406  N N     . GLY C  1 190 ? 191.531 117.893 -123.959 1.00 28.32  ? 190  GLY C N     1 
ATOM   8407  C CA    . GLY C  1 190 ? 190.768 117.052 -124.866 1.00 28.74  ? 190  GLY C CA    1 
ATOM   8408  C C     . GLY C  1 190 ? 189.285 117.234 -124.707 1.00 28.94  ? 190  GLY C C     1 
ATOM   8409  O O     . GLY C  1 190 ? 188.560 117.485 -125.666 1.00 28.35  ? 190  GLY C O     1 
ATOM   8410  N N     . VAL C  1 191 ? 188.826 117.115 -123.469 1.00 28.19  ? 191  VAL C N     1 
ATOM   8411  C CA    . VAL C  1 191 ? 187.417 117.277 -123.206 1.00 28.66  ? 191  VAL C CA    1 
ATOM   8412  C C     . VAL C  1 191 ? 186.944 118.715 -123.442 1.00 26.36  ? 191  VAL C C     1 
ATOM   8413  O O     . VAL C  1 191 ? 185.844 118.934 -123.933 1.00 27.41  ? 191  VAL C O     1 
ATOM   8414  C CB    . VAL C  1 191 ? 187.088 116.801 -121.772 1.00 31.22  ? 191  VAL C CB    1 
ATOM   8415  C CG1   . VAL C  1 191 ? 185.670 117.114 -121.450 1.00 34.40  ? 191  VAL C CG1   1 
ATOM   8416  C CG2   . VAL C  1 191 ? 187.299 115.266 -121.676 1.00 30.65  ? 191  VAL C CG2   1 
ATOM   8417  N N     . GLU C  1 192 ? 187.747 119.710 -123.105 1.00 24.99  ? 192  GLU C N     1 
ATOM   8418  C CA    . GLU C  1 192 ? 187.286 121.077 -123.361 1.00 23.92  ? 192  GLU C CA    1 
ATOM   8419  C C     . GLU C  1 192 ? 187.234 121.431 -124.859 1.00 22.95  ? 192  GLU C C     1 
ATOM   8420  O O     . GLU C  1 192 ? 186.199 121.872 -125.338 1.00 21.82  ? 192  GLU C O     1 
ATOM   8421  C CB    . GLU C  1 192 ? 188.156 122.098 -122.627 1.00 24.42  ? 192  GLU C CB    1 
ATOM   8422  C CG    . GLU C  1 192 ? 187.980 122.089 -121.098 1.00 26.31  ? 192  GLU C CG    1 
ATOM   8423  C CD    . GLU C  1 192 ? 188.859 123.136 -120.386 1.00 28.84  ? 192  GLU C CD    1 
ATOM   8424  O OE1   . GLU C  1 192 ? 189.801 123.696 -121.006 1.00 27.74  ? 192  GLU C OE1   1 
ATOM   8425  O OE2   . GLU C  1 192 ? 188.601 123.394 -119.186 1.00 26.74  ? 192  GLU C OE2   1 
ATOM   8426  N N     . LEU C  1 193 ? 188.329 121.221 -125.587 1.00 22.64  ? 193  LEU C N     1 
ATOM   8427  C CA    . LEU C  1 193 ? 188.342 121.575 -127.021 1.00 25.20  ? 193  LEU C CA    1 
ATOM   8428  C C     . LEU C  1 193 ? 187.414 120.639 -127.813 1.00 25.32  ? 193  LEU C C     1 
ATOM   8429  O O     . LEU C  1 193 ? 186.761 121.052 -128.782 1.00 27.07  ? 193  LEU C O     1 
ATOM   8430  C CB    . LEU C  1 193 ? 189.785 121.569 -127.569 1.00 23.08  ? 193  LEU C CB    1 
ATOM   8431  C CG    . LEU C  1 193 ? 190.699 122.570 -126.806 1.00 26.83  ? 193  LEU C CG    1 
ATOM   8432  C CD1   . LEU C  1 193 ? 192.006 122.736 -127.536 1.00 24.47  ? 193  LEU C CD1   1 
ATOM   8433  C CD2   . LEU C  1 193 ? 190.036 123.934 -126.654 1.00 24.71  ? 193  LEU C CD2   1 
ATOM   8434  N N     . GLY C  1 194 ? 187.334 119.385 -127.377 1.00 23.75  ? 194  GLY C N     1 
ATOM   8435  C CA    . GLY C  1 194 ? 186.437 118.457 -128.024 1.00 24.01  ? 194  GLY C CA    1 
ATOM   8436  C C     . GLY C  1 194 ? 185.010 118.974 -127.877 1.00 25.74  ? 194  GLY C C     1 
ATOM   8437  O O     . GLY C  1 194 ? 184.239 118.936 -128.861 1.00 26.24  ? 194  GLY C O     1 
ATOM   8438  N N     . SER C  1 195 ? 184.638 119.444 -126.669 1.00 22.89  ? 195  SER C N     1 
ATOM   8439  C CA    . SER C  1 195 ? 183.275 119.969 -126.471 1.00 24.50  ? 195  SER C CA    1 
ATOM   8440  C C     . SER C  1 195 ? 183.011 121.165 -127.355 1.00 22.52  ? 195  SER C C     1 
ATOM   8441  O O     . SER C  1 195 ? 181.917 121.307 -127.882 1.00 24.13  ? 195  SER C O     1 
ATOM   8442  C CB    . SER C  1 195 ? 182.984 120.447 -125.042 1.00 21.59  ? 195  SER C CB    1 
ATOM   8443  O OG    . SER C  1 195 ? 182.768 119.376 -124.180 1.00 28.36  ? 195  SER C OG    1 
ATOM   8444  N N     . VAL C  1 196 ? 183.993 122.052 -127.442 1.00 22.73  ? 196  VAL C N     1 
ATOM   8445  C CA    . VAL C  1 196 ? 183.877 123.257 -128.261 1.00 23.38  ? 196  VAL C CA    1 
ATOM   8446  C C     . VAL C  1 196 ? 183.496 122.916 -129.733 1.00 25.74  ? 196  VAL C C     1 
ATOM   8447  O O     . VAL C  1 196 ? 182.476 123.390 -130.266 1.00 24.47  ? 196  VAL C O     1 
ATOM   8448  C CB    . VAL C  1 196 ? 185.209 124.025 -128.270 1.00 22.36  ? 196  VAL C CB    1 
ATOM   8449  C CG1   . VAL C  1 196 ? 185.197 125.045 -129.405 1.00 21.67  ? 196  VAL C CG1   1 
ATOM   8450  C CG2   . VAL C  1 196 ? 185.452 124.712 -126.881 1.00 18.82  ? 196  VAL C CG2   1 
ATOM   8451  N N     . TRP C  1 197 ? 184.313 122.078 -130.364 1.00 24.39  ? 197  TRP C N     1 
ATOM   8452  C CA    . TRP C  1 197 ? 184.069 121.724 -131.747 1.00 26.35  ? 197  TRP C CA    1 
ATOM   8453  C C     . TRP C  1 197 ? 182.893 120.800 -131.906 1.00 28.48  ? 197  TRP C C     1 
ATOM   8454  O O     . TRP C  1 197 ? 182.221 120.842 -132.908 1.00 31.06  ? 197  TRP C O     1 
ATOM   8455  C CB    . TRP C  1 197 ? 185.339 121.166 -132.358 1.00 25.29  ? 197  TRP C CB    1 
ATOM   8456  C CG    . TRP C  1 197 ? 186.372 122.263 -132.480 1.00 27.94  ? 197  TRP C CG    1 
ATOM   8457  C CD1   . TRP C  1 197 ? 187.536 122.366 -131.786 1.00 26.18  ? 197  TRP C CD1   1 
ATOM   8458  C CD2   . TRP C  1 197 ? 186.294 123.442 -133.308 1.00 27.04  ? 197  TRP C CD2   1 
ATOM   8459  N NE1   . TRP C  1 197 ? 188.187 123.530 -132.121 1.00 26.53  ? 197  TRP C NE1   1 
ATOM   8460  C CE2   . TRP C  1 197 ? 187.447 124.208 -133.050 1.00 27.05  ? 197  TRP C CE2   1 
ATOM   8461  C CE3   . TRP C  1 197 ? 185.362 123.918 -134.243 1.00 28.25  ? 197  TRP C CE3   1 
ATOM   8462  C CZ2   . TRP C  1 197 ? 187.703 125.426 -133.689 1.00 27.43  ? 197  TRP C CZ2   1 
ATOM   8463  C CZ3   . TRP C  1 197 ? 185.616 125.131 -134.881 1.00 26.76  ? 197  TRP C CZ3   1 
ATOM   8464  C CH2   . TRP C  1 197 ? 186.782 125.870 -134.596 1.00 26.85  ? 197  TRP C CH2   1 
ATOM   8465  N N     . GLN C  1 198 ? 182.616 119.979 -130.902 1.00 29.76  ? 198  GLN C N     1 
ATOM   8466  C CA    . GLN C  1 198 ? 181.458 119.109 -130.959 1.00 29.73  ? 198  GLN C CA    1 
ATOM   8467  C C     . GLN C  1 198 ? 180.204 119.995 -131.025 1.00 30.95  ? 198  GLN C C     1 
ATOM   8468  O O     . GLN C  1 198 ? 179.294 119.756 -131.827 1.00 30.58  ? 198  GLN C O     1 
ATOM   8469  C CB    . GLN C  1 198 ? 181.431 118.235 -129.704 1.00 31.15  ? 198  GLN C CB    1 
ATOM   8470  C CG    . GLN C  1 198 ? 180.332 117.188 -129.660 1.00 33.17  ? 198  GLN C CG    1 
ATOM   8471  C CD    . GLN C  1 198 ? 179.003 117.757 -129.251 1.00 36.22  ? 198  GLN C CD    1 
ATOM   8472  O OE1   . GLN C  1 198 ? 178.897 118.439 -128.233 1.00 35.77  ? 198  GLN C OE1   1 
ATOM   8473  N NE2   . GLN C  1 198 ? 177.967 117.466 -130.035 1.00 37.67  ? 198  GLN C NE2   1 
ATOM   8474  N N     . ARG C  1 199 ? 180.160 121.029 -130.182 1.00 29.37  ? 199  ARG C N     1 
ATOM   8475  C CA    . ARG C  1 199 ? 179.024 121.958 -130.151 1.00 29.53  ? 199  ARG C CA    1 
ATOM   8476  C C     . ARG C  1 199 ? 178.826 122.735 -131.461 1.00 30.20  ? 199  ARG C C     1 
ATOM   8477  O O     . ARG C  1 199 ? 177.703 123.037 -131.857 1.00 30.06  ? 199  ARG C O     1 
ATOM   8478  C CB    . ARG C  1 199 ? 179.201 123.005 -129.050 1.00 28.31  ? 199  ARG C CB    1 
ATOM   8479  C CG    . ARG C  1 199 ? 179.183 122.464 -127.660 1.00 26.51  ? 199  ARG C CG    1 
ATOM   8480  C CD    . ARG C  1 199 ? 179.689 123.511 -126.722 1.00 25.94  ? 199  ARG C CD    1 
ATOM   8481  N NE    . ARG C  1 199 ? 179.784 122.984 -125.361 1.00 26.35  ? 199  ARG C NE    1 
ATOM   8482  C CZ    . ARG C  1 199 ? 180.374 123.632 -124.365 1.00 26.12  ? 199  ARG C CZ    1 
ATOM   8483  N NH1   . ARG C  1 199 ? 180.922 124.829 -124.594 1.00 21.41  ? 199  ARG C NH1   1 
ATOM   8484  N NH2   . ARG C  1 199 ? 180.413 123.077 -123.153 1.00 25.95  ? 199  ARG C NH2   1 
ATOM   8485  N N     . LEU C  1 200 ? 179.929 123.086 -132.103 1.00 30.84  ? 200  LEU C N     1 
ATOM   8486  C CA    . LEU C  1 200 ? 179.882 123.842 -133.345 1.00 32.32  ? 200  LEU C CA    1 
ATOM   8487  C C     . LEU C  1 200 ? 179.504 122.951 -134.528 1.00 33.42  ? 200  LEU C C     1 
ATOM   8488  O O     . LEU C  1 200 ? 179.232 123.446 -135.620 1.00 31.53  ? 200  LEU C O     1 
ATOM   8489  C CB    . LEU C  1 200 ? 181.232 124.536 -133.579 1.00 31.85  ? 200  LEU C CB    1 
ATOM   8490  C CG    . LEU C  1 200 ? 181.592 125.458 -132.402 1.00 30.78  ? 200  LEU C CG    1 
ATOM   8491  C CD1   . LEU C  1 200 ? 182.819 126.275 -132.707 1.00 30.63  ? 200  LEU C CD1   1 
ATOM   8492  C CD2   . LEU C  1 200 ? 180.407 126.382 -132.129 1.00 30.09  ? 200  LEU C CD2   1 
ATOM   8493  N N     . GLY C  1 201 ? 179.486 121.635 -134.299 1.00 33.61  ? 201  GLY C N     1 
ATOM   8494  C CA    . GLY C  1 201 ? 179.081 120.719 -135.349 1.00 32.36  ? 201  GLY C CA    1 
ATOM   8495  C C     . GLY C  1 201 ? 179.986 119.560 -135.720 1.00 32.53  ? 201  GLY C C     1 
ATOM   8496  O O     . GLY C  1 201 ? 179.619 118.764 -136.583 1.00 30.11  ? 201  GLY C O     1 
ATOM   8497  N N     . ALA C  1 202 ? 181.164 119.457 -135.113 1.00 30.34  ? 202  ALA C N     1 
ATOM   8498  C CA    . ALA C  1 202 ? 182.041 118.335 -135.436 1.00 32.08  ? 202  ALA C CA    1 
ATOM   8499  C C     . ALA C  1 202 ? 181.572 117.007 -134.816 1.00 32.41  ? 202  ALA C C     1 
ATOM   8500  O O     . ALA C  1 202 ? 180.855 116.971 -133.808 1.00 30.88  ? 202  ALA C O     1 
ATOM   8501  C CB    . ALA C  1 202 ? 183.482 118.626 -134.988 1.00 31.39  ? 202  ALA C CB    1 
ATOM   8502  N N     . ASP C  1 203 ? 181.977 115.920 -135.459 1.00 33.52  ? 203  ASP C N     1 
ATOM   8503  C CA    . ASP C  1 203 ? 181.689 114.577 -134.984 1.00 34.48  ? 203  ASP C CA    1 
ATOM   8504  C C     . ASP C  1 203 ? 183.004 114.279 -134.269 1.00 32.94  ? 203  ASP C C     1 
ATOM   8505  O O     . ASP C  1 203 ? 184.050 114.053 -134.901 1.00 32.09  ? 203  ASP C O     1 
ATOM   8506  C CB    . ASP C  1 203 ? 181.491 113.622 -136.159 1.00 38.33  ? 203  ASP C CB    1 
ATOM   8507  C CG    . ASP C  1 203 ? 181.310 112.181 -135.715 1.00 41.24  ? 203  ASP C CG    1 
ATOM   8508  O OD1   . ASP C  1 203 ? 182.076 111.721 -134.840 1.00 44.78  ? 203  ASP C OD1   1 
ATOM   8509  O OD2   . ASP C  1 203 ? 180.408 111.503 -136.242 1.00 44.78  ? 203  ASP C OD2   1 
ATOM   8510  N N     . VAL C  1 204 ? 182.938 114.270 -132.945 1.00 31.56  ? 204  VAL C N     1 
ATOM   8511  C CA    . VAL C  1 204 ? 184.119 114.090 -132.122 1.00 28.70  ? 204  VAL C CA    1 
ATOM   8512  C C     . VAL C  1 204 ? 184.287 112.772 -131.368 1.00 28.74  ? 204  VAL C C     1 
ATOM   8513  O O     . VAL C  1 204 ? 183.361 112.275 -130.748 1.00 28.52  ? 204  VAL C O     1 
ATOM   8514  C CB    . VAL C  1 204 ? 184.193 115.241 -131.087 1.00 29.68  ? 204  VAL C CB    1 
ATOM   8515  C CG1   . VAL C  1 204 ? 185.483 115.140 -130.273 1.00 29.16  ? 204  VAL C CG1   1 
ATOM   8516  C CG2   . VAL C  1 204 ? 184.051 116.591 -131.790 1.00 26.95  ? 204  VAL C CG2   1 
ATOM   8517  N N     . THR C  1 205 ? 185.502 112.231 -131.425 1.00 27.83  ? 205  THR C N     1 
ATOM   8518  C CA    . THR C  1 205 ? 185.853 111.018 -130.714 1.00 29.02  ? 205  THR C CA    1 
ATOM   8519  C C     . THR C  1 205 ? 187.225 111.242 -130.068 1.00 30.05  ? 205  THR C C     1 
ATOM   8520  O O     . THR C  1 205 ? 188.196 111.633 -130.727 1.00 30.38  ? 205  THR C O     1 
ATOM   8521  C CB    . THR C  1 205 ? 185.952 109.783 -131.650 1.00 28.92  ? 205  THR C CB    1 
ATOM   8522  O OG1   . THR C  1 205 ? 184.716 109.618 -132.362 1.00 28.15  ? 205  THR C OG1   1 
ATOM   8523  C CG2   . THR C  1 205 ? 186.207 108.521 -130.829 1.00 28.07  ? 205  THR C CG2   1 
ATOM   8524  N N     . ALA C  1 206 ? 187.301 111.026 -128.761 1.00 30.45  ? 206  ALA C N     1 
ATOM   8525  C CA    . ALA C  1 206 ? 188.574 111.158 -128.056 1.00 28.72  ? 206  ALA C CA    1 
ATOM   8526  C C     . ALA C  1 206 ? 189.052 109.740 -127.765 1.00 27.61  ? 206  ALA C C     1 
ATOM   8527  O O     . ALA C  1 206 ? 188.272 108.883 -127.339 1.00 28.07  ? 206  ALA C O     1 
ATOM   8528  C CB    . ALA C  1 206 ? 188.393 111.951 -126.724 1.00 30.30  ? 206  ALA C CB    1 
ATOM   8529  N N     . VAL C  1 207 ? 190.333 109.494 -128.004 1.00 27.55  ? 207  VAL C N     1 
ATOM   8530  C CA    . VAL C  1 207 ? 190.919 108.192 -127.761 1.00 26.75  ? 207  VAL C CA    1 
ATOM   8531  C C     . VAL C  1 207 ? 191.819 108.342 -126.560 1.00 27.04  ? 207  VAL C C     1 
ATOM   8532  O O     . VAL C  1 207 ? 192.697 109.211 -126.543 1.00 25.08  ? 207  VAL C O     1 
ATOM   8533  C CB    . VAL C  1 207 ? 191.722 107.700 -128.989 1.00 27.59  ? 207  VAL C CB    1 
ATOM   8534  C CG1   . VAL C  1 207 ? 192.508 106.427 -128.637 1.00 28.81  ? 207  VAL C CG1   1 
ATOM   8535  C CG2   . VAL C  1 207 ? 190.735 107.415 -130.158 1.00 26.94  ? 207  VAL C CG2   1 
ATOM   8536  N N     . GLU C  1 208 ? 191.587 107.491 -125.558 1.00 26.75  ? 208  GLU C N     1 
ATOM   8537  C CA    . GLU C  1 208 ? 192.326 107.546 -124.285 1.00 28.08  ? 208  GLU C CA    1 
ATOM   8538  C C     . GLU C  1 208 ? 192.990 106.241 -123.842 1.00 27.37  ? 208  GLU C C     1 
ATOM   8539  O O     . GLU C  1 208 ? 192.347 105.195 -123.771 1.00 27.25  ? 208  GLU C O     1 
ATOM   8540  C CB    . GLU C  1 208 ? 191.368 108.027 -123.173 1.00 27.03  ? 208  GLU C CB    1 
ATOM   8541  C CG    . GLU C  1 208 ? 191.924 107.990 -121.725 1.00 25.22  ? 208  GLU C CG    1 
ATOM   8542  C CD    . GLU C  1 208 ? 193.176 108.845 -121.529 1.00 23.69  ? 208  GLU C CD    1 
ATOM   8543  O OE1   . GLU C  1 208 ? 193.166 110.044 -121.900 1.00 24.64  ? 208  GLU C OE1   1 
ATOM   8544  O OE2   . GLU C  1 208 ? 194.180 108.330 -120.997 1.00 25.00  ? 208  GLU C OE2   1 
ATOM   8545  N N     . PHE C  1 209 ? 194.270 106.318 -123.511 1.00 27.83  ? 209  PHE C N     1 
ATOM   8546  C CA    . PHE C  1 209 ? 195.009 105.151 -123.058 1.00 31.24  ? 209  PHE C CA    1 
ATOM   8547  C C     . PHE C  1 209 ? 194.521 104.570 -121.720 1.00 31.63  ? 209  PHE C C     1 
ATOM   8548  O O     . PHE C  1 209 ? 194.475 103.348 -121.560 1.00 31.29  ? 209  PHE C O     1 
ATOM   8549  C CB    . PHE C  1 209 ? 196.491 105.498 -122.940 1.00 35.45  ? 209  PHE C CB    1 
ATOM   8550  C CG    . PHE C  1 209 ? 197.376 104.302 -122.708 1.00 39.61  ? 209  PHE C CG    1 
ATOM   8551  C CD1   . PHE C  1 209 ? 197.566 103.793 -121.422 1.00 41.90  ? 209  PHE C CD1   1 
ATOM   8552  C CD2   . PHE C  1 209 ? 198.019 103.681 -123.781 1.00 42.04  ? 209  PHE C CD2   1 
ATOM   8553  C CE1   . PHE C  1 209 ? 198.387 102.681 -121.201 1.00 42.64  ? 209  PHE C CE1   1 
ATOM   8554  C CE2   . PHE C  1 209 ? 198.846 102.562 -123.576 1.00 43.66  ? 209  PHE C CE2   1 
ATOM   8555  C CZ    . PHE C  1 209 ? 199.028 102.065 -122.283 1.00 43.83  ? 209  PHE C CZ    1 
ATOM   8556  N N     . LEU C  1 210 ? 194.167 105.452 -120.782 1.00 30.03  ? 210  LEU C N     1 
ATOM   8557  C CA    . LEU C  1 210 ? 193.700 105.058 -119.451 1.00 29.76  ? 210  LEU C CA    1 
ATOM   8558  C C     . LEU C  1 210 ? 192.217 104.770 -119.482 1.00 28.95  ? 210  LEU C C     1 
ATOM   8559  O O     . LEU C  1 210 ? 191.570 104.940 -120.529 1.00 29.47  ? 210  LEU C O     1 
ATOM   8560  C CB    . LEU C  1 210 ? 194.002 106.160 -118.426 1.00 30.85  ? 210  LEU C CB    1 
ATOM   8561  C CG    . LEU C  1 210 ? 195.508 106.408 -118.251 1.00 31.76  ? 210  LEU C CG    1 
ATOM   8562  C CD1   . LEU C  1 210 ? 195.737 107.577 -117.299 1.00 32.93  ? 210  LEU C CD1   1 
ATOM   8563  C CD2   . LEU C  1 210 ? 196.196 105.137 -117.717 1.00 32.65  ? 210  LEU C CD2   1 
ATOM   8564  N N     . GLY C  1 211 ? 191.668 104.359 -118.340 1.00 27.01  ? 211  GLY C N     1 
ATOM   8565  C CA    . GLY C  1 211 ? 190.259 104.023 -118.296 1.00 25.82  ? 211  GLY C CA    1 
ATOM   8566  C C     . GLY C  1 211 ? 189.255 105.068 -117.861 1.00 25.35  ? 211  GLY C C     1 
ATOM   8567  O O     . GLY C  1 211 ? 188.122 104.717 -117.539 1.00 27.14  ? 211  GLY C O     1 
ATOM   8568  N N     . HIS C  1 212 ? 189.632 106.341 -117.863 1.00 25.18  ? 212  HIS C N     1 
ATOM   8569  C CA    . HIS C  1 212 ? 188.711 107.396 -117.440 1.00 25.08  ? 212  HIS C CA    1 
ATOM   8570  C C     . HIS C  1 212 ? 189.082 108.726 -118.115 1.00 25.11  ? 212  HIS C C     1 
ATOM   8571  O O     . HIS C  1 212 ? 190.217 108.904 -118.572 1.00 26.82  ? 212  HIS C O     1 
ATOM   8572  C CB    . HIS C  1 212 ? 188.797 107.587 -115.923 1.00 25.67  ? 212  HIS C CB    1 
ATOM   8573  C CG    . HIS C  1 212 ? 190.105 108.179 -115.472 1.00 26.12  ? 212  HIS C CG    1 
ATOM   8574  N ND1   . HIS C  1 212 ? 191.244 107.426 -115.307 1.00 25.99  ? 212  HIS C ND1   1 
ATOM   8575  C CD2   . HIS C  1 212 ? 190.460 109.462 -115.218 1.00 26.00  ? 212  HIS C CD2   1 
ATOM   8576  C CE1   . HIS C  1 212 ? 192.247 108.216 -114.966 1.00 25.40  ? 212  HIS C CE1   1 
ATOM   8577  N NE2   . HIS C  1 212 ? 191.802 109.456 -114.909 1.00 27.86  ? 212  HIS C NE2   1 
ATOM   8578  N N     . VAL C  1 213 ? 188.143 109.664 -118.151 1.00 24.71  ? 213  VAL C N     1 
ATOM   8579  C CA    . VAL C  1 213 ? 188.408 110.969 -118.754 1.00 24.42  ? 213  VAL C CA    1 
ATOM   8580  C C     . VAL C  1 213 ? 188.625 112.012 -117.651 1.00 26.29  ? 213  VAL C C     1 
ATOM   8581  O O     . VAL C  1 213 ? 188.181 111.803 -116.512 1.00 26.25  ? 213  VAL C O     1 
ATOM   8582  C CB    . VAL C  1 213 ? 187.227 111.424 -119.660 1.00 25.83  ? 213  VAL C CB    1 
ATOM   8583  C CG1   . VAL C  1 213 ? 186.712 110.246 -120.501 1.00 23.94  ? 213  VAL C CG1   1 
ATOM   8584  C CG2   . VAL C  1 213 ? 186.112 112.000 -118.834 1.00 26.36  ? 213  VAL C CG2   1 
ATOM   8585  N N     . GLY C  1 214 ? 189.316 113.111 -117.975 1.00 25.93  ? 214  GLY C N     1 
ATOM   8586  C CA    . GLY C  1 214 ? 189.542 114.176 -117.007 1.00 25.28  ? 214  GLY C CA    1 
ATOM   8587  C C     . GLY C  1 214 ? 190.946 114.356 -116.446 1.00 25.79  ? 214  GLY C C     1 
ATOM   8588  O O     . GLY C  1 214 ? 191.175 115.269 -115.664 1.00 25.74  ? 214  GLY C O     1 
ATOM   8589  N N     . GLY C  1 215 ? 191.881 113.480 -116.813 1.00 26.67  ? 215  GLY C N     1 
ATOM   8590  C CA    . GLY C  1 215 ? 193.246 113.615 -116.335 1.00 27.10  ? 215  GLY C CA    1 
ATOM   8591  C C     . GLY C  1 215 ? 193.506 113.065 -114.948 1.00 29.04  ? 215  GLY C C     1 
ATOM   8592  O O     . GLY C  1 215 ? 192.682 112.332 -114.392 1.00 29.29  ? 215  GLY C O     1 
ATOM   8593  N N     . VAL C  1 216 ? 194.657 113.424 -114.387 1.00 31.12  ? 216  VAL C N     1 
ATOM   8594  C CA    . VAL C  1 216 ? 195.064 112.950 -113.069 1.00 33.16  ? 216  VAL C CA    1 
ATOM   8595  C C     . VAL C  1 216 ? 194.401 113.684 -111.904 1.00 32.29  ? 216  VAL C C     1 
ATOM   8596  O O     . VAL C  1 216 ? 194.139 114.881 -111.982 1.00 34.19  ? 216  VAL C O     1 
ATOM   8597  C CB    . VAL C  1 216 ? 196.610 113.003 -112.958 1.00 35.59  ? 216  VAL C CB    1 
ATOM   8598  C CG1   . VAL C  1 216 ? 197.067 112.872 -111.504 1.00 35.63  ? 216  VAL C CG1   1 
ATOM   8599  C CG2   . VAL C  1 216 ? 197.199 111.824 -113.764 1.00 36.61  ? 216  VAL C CG2   1 
ATOM   8600  N N     . GLY C  1 217 ? 194.079 112.927 -110.854 1.00 32.34  ? 217  GLY C N     1 
ATOM   8601  C CA    . GLY C  1 217 ? 193.462 113.486 -109.656 1.00 28.32  ? 217  GLY C CA    1 
ATOM   8602  C C     . GLY C  1 217 ? 191.949 113.535 -109.603 1.00 27.52  ? 217  GLY C C     1 
ATOM   8603  O O     . GLY C  1 217 ? 191.372 113.713 -108.535 1.00 28.02  ? 217  GLY C O     1 
ATOM   8604  N N     . ILE C  1 218 ? 191.284 113.388 -110.748 1.00 26.81  ? 218  ILE C N     1 
ATOM   8605  C CA    . ILE C  1 218 ? 189.822 113.454 -110.765 1.00 22.52  ? 218  ILE C CA    1 
ATOM   8606  C C     . ILE C  1 218 ? 189.237 112.235 -110.031 1.00 21.65  ? 218  ILE C C     1 
ATOM   8607  O O     . ILE C  1 218 ? 189.779 111.151 -110.080 1.00 22.42  ? 218  ILE C O     1 
ATOM   8608  C CB    . ILE C  1 218 ? 189.290 113.532 -112.237 1.00 21.69  ? 218  ILE C CB    1 
ATOM   8609  C CG1   . ILE C  1 218 ? 187.792 113.856 -112.235 1.00 20.56  ? 218  ILE C CG1   1 
ATOM   8610  C CG2   . ILE C  1 218 ? 189.588 112.209 -112.966 1.00 20.06  ? 218  ILE C CG2   1 
ATOM   8611  C CD1   . ILE C  1 218 ? 187.230 114.226 -113.567 1.00 21.34  ? 218  ILE C CD1   1 
ATOM   8612  N N     . ASP C  1 219 ? 188.139 112.426 -109.324 1.00 23.18  ? 219  ASP C N     1 
ATOM   8613  C CA    . ASP C  1 219 ? 187.514 111.326 -108.602 1.00 24.00  ? 219  ASP C CA    1 
ATOM   8614  C C     . ASP C  1 219 ? 186.845 110.407 -109.653 1.00 23.83  ? 219  ASP C C     1 
ATOM   8615  O O     . ASP C  1 219 ? 186.215 110.882 -110.594 1.00 20.97  ? 219  ASP C O     1 
ATOM   8616  C CB    . ASP C  1 219 ? 186.491 111.898 -107.597 1.00 21.06  ? 219  ASP C CB    1 
ATOM   8617  C CG    . ASP C  1 219 ? 185.673 110.833 -106.924 1.00 18.63  ? 219  ASP C CG    1 
ATOM   8618  O OD1   . ASP C  1 219 ? 186.189 110.195 -105.984 1.00 16.59  ? 219  ASP C OD1   1 
ATOM   8619  O OD2   . ASP C  1 219 ? 184.503 110.640 -107.354 1.00 20.51  ? 219  ASP C OD2   1 
ATOM   8620  N N     . MET C  1 220 ? 187.017 109.098 -109.489 1.00 24.99  ? 220  MET C N     1 
ATOM   8621  C CA    . MET C  1 220 ? 186.468 108.128 -110.434 1.00 25.23  ? 220  MET C CA    1 
ATOM   8622  C C     . MET C  1 220 ? 184.957 108.167 -110.607 1.00 23.70  ? 220  MET C C     1 
ATOM   8623  O O     . MET C  1 220 ? 184.477 108.065 -111.731 1.00 24.42  ? 220  MET C O     1 
ATOM   8624  C CB    . MET C  1 220 ? 186.928 106.698 -110.079 1.00 27.71  ? 220  MET C CB    1 
ATOM   8625  C CG    . MET C  1 220 ? 188.437 106.453 -110.329 1.00 32.49  ? 220  MET C CG    1 
ATOM   8626  S SD    . MET C  1 220 ? 188.901 106.646 -112.139 1.00 35.67  ? 220  MET C SD    1 
ATOM   8627  C CE    . MET C  1 220 ? 187.479 105.867 -112.946 1.00 35.71  ? 220  MET C CE    1 
ATOM   8628  N N     . GLU C  1 221 ? 184.193 108.310 -109.528 1.00 22.08  ? 221  GLU C N     1 
ATOM   8629  C CA    . GLU C  1 221 ? 182.740 108.381 -109.685 1.00 22.16  ? 221  GLU C CA    1 
ATOM   8630  C C     . GLU C  1 221 ? 182.369 109.639 -110.470 1.00 23.16  ? 221  GLU C C     1 
ATOM   8631  O O     . GLU C  1 221 ? 181.530 109.595 -111.379 1.00 24.53  ? 221  GLU C O     1 
ATOM   8632  C CB    . GLU C  1 221 ? 182.017 108.355 -108.330 1.00 21.22  ? 221  GLU C CB    1 
ATOM   8633  C CG    . GLU C  1 221 ? 180.542 108.713 -108.399 1.00 22.21  ? 221  GLU C CG    1 
ATOM   8634  C CD    . GLU C  1 221 ? 179.862 108.635 -107.027 1.00 24.71  ? 221  GLU C CD    1 
ATOM   8635  O OE1   . GLU C  1 221 ? 180.538 108.918 -106.027 1.00 23.10  ? 221  GLU C OE1   1 
ATOM   8636  O OE2   . GLU C  1 221 ? 178.655 108.302 -106.929 1.00 24.71  ? 221  GLU C OE2   1 
ATOM   8637  N N     . ILE C  1 222 ? 182.996 110.764 -110.125 1.00 21.28  ? 222  ILE C N     1 
ATOM   8638  C CA    . ILE C  1 222 ? 182.752 112.018 -110.837 1.00 21.20  ? 222  ILE C CA    1 
ATOM   8639  C C     . ILE C  1 222 ? 183.142 111.865 -112.346 1.00 21.73  ? 222  ILE C C     1 
ATOM   8640  O O     . ILE C  1 222 ? 182.396 112.270 -113.238 1.00 20.04  ? 222  ILE C O     1 
ATOM   8641  C CB    . ILE C  1 222 ? 183.589 113.191 -110.218 1.00 19.34  ? 222  ILE C CB    1 
ATOM   8642  C CG1   . ILE C  1 222 ? 183.058 113.556 -108.815 1.00 17.58  ? 222  ILE C CG1   1 
ATOM   8643  C CG2   . ILE C  1 222 ? 183.504 114.415 -111.138 1.00 19.47  ? 222  ILE C CG2   1 
ATOM   8644  C CD1   . ILE C  1 222 ? 181.691 114.188 -108.838 1.00 18.58  ? 222  ILE C CD1   1 
ATOM   8645  N N     . SER C  1 223 ? 184.317 111.291 -112.608 1.00 23.24  ? 223  SER C N     1 
ATOM   8646  C CA    . SER C  1 223 ? 184.810 111.090 -113.985 1.00 25.17  ? 223  SER C CA    1 
ATOM   8647  C C     . SER C  1 223 ? 183.806 110.266 -114.800 1.00 26.15  ? 223  SER C C     1 
ATOM   8648  O O     . SER C  1 223 ? 183.487 110.569 -115.951 1.00 25.65  ? 223  SER C O     1 
ATOM   8649  C CB    . SER C  1 223 ? 186.158 110.348 -113.956 1.00 25.79  ? 223  SER C CB    1 
ATOM   8650  O OG    . SER C  1 223 ? 186.655 110.133 -115.260 1.00 26.50  ? 223  SER C OG    1 
ATOM   8651  N N     . LYS C  1 224 ? 183.315 109.211 -114.172 1.00 26.56  ? 224  LYS C N     1 
ATOM   8652  C CA    . LYS C  1 224 ? 182.344 108.341 -114.795 1.00 27.20  ? 224  LYS C CA    1 
ATOM   8653  C C     . LYS C  1 224 ? 181.053 109.064 -115.139 1.00 25.31  ? 224  LYS C C     1 
ATOM   8654  O O     . LYS C  1 224 ? 180.541 108.939 -116.256 1.00 24.73  ? 224  LYS C O     1 
ATOM   8655  C CB    . LYS C  1 224 ? 182.047 107.167 -113.867 1.00 31.42  ? 224  LYS C CB    1 
ATOM   8656  C CG    . LYS C  1 224 ? 182.649 105.877 -114.339 1.00 37.69  ? 224  LYS C CG    1 
ATOM   8657  C CD    . LYS C  1 224 ? 184.172 105.898 -114.259 1.00 42.78  ? 224  LYS C CD    1 
ATOM   8658  C CE    . LYS C  1 224 ? 184.822 104.862 -115.215 1.00 44.90  ? 224  LYS C CE    1 
ATOM   8659  N NZ    . LYS C  1 224 ? 184.810 105.271 -116.676 1.00 46.16  ? 224  LYS C NZ    1 
ATOM   8660  N N     . ASN C  1 225 ? 180.513 109.822 -114.186 1.00 21.91  ? 225  ASN C N     1 
ATOM   8661  C CA    . ASN C  1 225 ? 179.271 110.564 -114.429 1.00 23.88  ? 225  ASN C CA    1 
ATOM   8662  C C     . ASN C  1 225 ? 179.463 111.611 -115.523 1.00 23.45  ? 225  ASN C C     1 
ATOM   8663  O O     . ASN C  1 225 ? 178.585 111.825 -116.330 1.00 23.32  ? 225  ASN C O     1 
ATOM   8664  C CB    . ASN C  1 225 ? 178.781 111.215 -113.143 1.00 25.42  ? 225  ASN C CB    1 
ATOM   8665  C CG    . ASN C  1 225 ? 178.306 110.195 -112.099 1.00 32.39  ? 225  ASN C CG    1 
ATOM   8666  O OD1   . ASN C  1 225 ? 178.111 110.545 -110.920 1.00 33.79  ? 225  ASN C OD1   1 
ATOM   8667  N ND2   . ASN C  1 225 ? 178.112 108.960 -112.510 1.00 31.33  ? 225  ASN C ND2   1 
ATOM   8668  N N     . PHE C  1 226 ? 180.619 112.270 -115.511 1.00 24.09  ? 226  PHE C N     1 
ATOM   8669  C CA    . PHE C  1 226 ? 180.995 113.316 -116.481 1.00 24.17  ? 226  PHE C CA    1 
ATOM   8670  C C     . PHE C  1 226 ? 181.028 112.719 -117.924 1.00 24.92  ? 226  PHE C C     1 
ATOM   8671  O O     . PHE C  1 226 ? 180.402 113.244 -118.853 1.00 24.53  ? 226  PHE C O     1 
ATOM   8672  C CB    . PHE C  1 226 ? 182.372 113.847 -116.044 1.00 22.43  ? 226  PHE C CB    1 
ATOM   8673  C CG    . PHE C  1 226 ? 182.968 114.921 -116.940 1.00 22.73  ? 226  PHE C CG    1 
ATOM   8674  C CD1   . PHE C  1 226 ? 182.193 115.957 -117.446 1.00 19.82  ? 226  PHE C CD1   1 
ATOM   8675  C CD2   . PHE C  1 226 ? 184.333 114.928 -117.201 1.00 19.00  ? 226  PHE C CD2   1 
ATOM   8676  C CE1   . PHE C  1 226 ? 182.787 116.971 -118.190 1.00 19.30  ? 226  PHE C CE1   1 
ATOM   8677  C CE2   . PHE C  1 226 ? 184.915 115.936 -117.938 1.00 18.71  ? 226  PHE C CE2   1 
ATOM   8678  C CZ    . PHE C  1 226 ? 184.139 116.951 -118.429 1.00 19.73  ? 226  PHE C CZ    1 
ATOM   8679  N N     . GLN C  1 227 ? 181.731 111.601 -118.075 1.00 24.81  ? 227  GLN C N     1 
ATOM   8680  C CA    . GLN C  1 227 ? 181.863 110.929 -119.355 1.00 27.90  ? 227  GLN C CA    1 
ATOM   8681  C C     . GLN C  1 227 ? 180.482 110.607 -119.920 1.00 29.15  ? 227  GLN C C     1 
ATOM   8682  O O     . GLN C  1 227 ? 180.193 110.836 -121.092 1.00 31.03  ? 227  GLN C O     1 
ATOM   8683  C CB    . GLN C  1 227 ? 182.659 109.624 -119.167 1.00 28.79  ? 227  GLN C CB    1 
ATOM   8684  C CG    . GLN C  1 227 ? 182.861 108.846 -120.467 1.00 30.12  ? 227  GLN C CG    1 
ATOM   8685  C CD    . GLN C  1 227 ? 183.401 107.456 -120.254 1.00 33.03  ? 227  GLN C CD    1 
ATOM   8686  O OE1   . GLN C  1 227 ? 183.993 107.148 -119.208 1.00 34.91  ? 227  GLN C OE1   1 
ATOM   8687  N NE2   . GLN C  1 227 ? 183.215 106.595 -121.258 1.00 32.54  ? 227  GLN C NE2   1 
ATOM   8688  N N     . ARG C  1 228 ? 179.632 110.062 -119.065 1.00 29.84  ? 228  ARG C N     1 
ATOM   8689  C CA    . ARG C  1 228 ? 178.281 109.684 -119.443 1.00 30.35  ? 228  ARG C CA    1 
ATOM   8690  C C     . ARG C  1 228 ? 177.505 110.887 -119.966 1.00 29.60  ? 228  ARG C C     1 
ATOM   8691  O O     . ARG C  1 228 ? 176.809 110.794 -120.970 1.00 30.12  ? 228  ARG C O     1 
ATOM   8692  C CB    . ARG C  1 228 ? 177.561 109.123 -118.225 1.00 33.93  ? 228  ARG C CB    1 
ATOM   8693  C CG    . ARG C  1 228 ? 176.782 107.891 -118.468 1.00 38.80  ? 228  ARG C CG    1 
ATOM   8694  C CD    . ARG C  1 228 ? 177.424 106.736 -117.745 1.00 42.55  ? 228  ARG C CD    1 
ATOM   8695  N NE    . ARG C  1 228 ? 177.382 106.913 -116.300 1.00 46.53  ? 228  ARG C NE    1 
ATOM   8696  C CZ    . ARG C  1 228 ? 177.883 106.045 -115.427 1.00 48.33  ? 228  ARG C CZ    1 
ATOM   8697  N NH1   . ARG C  1 228 ? 178.471 104.924 -115.845 1.00 49.84  ? 228  ARG C NH1   1 
ATOM   8698  N NH2   . ARG C  1 228 ? 177.806 106.301 -114.125 1.00 50.51  ? 228  ARG C NH2   1 
ATOM   8699  N N     . ILE C  1 229 ? 177.606 112.011 -119.267 1.00 27.60  ? 229  ILE C N     1 
ATOM   8700  C CA    . ILE C  1 229 ? 176.899 113.203 -119.688 1.00 26.36  ? 229  ILE C CA    1 
ATOM   8701  C C     . ILE C  1 229 ? 177.437 113.764 -120.995 1.00 26.14  ? 229  ILE C C     1 
ATOM   8702  O O     . ILE C  1 229 ? 176.673 114.267 -121.808 1.00 26.73  ? 229  ILE C O     1 
ATOM   8703  C CB    . ILE C  1 229 ? 176.948 114.301 -118.599 1.00 25.44  ? 229  ILE C CB    1 
ATOM   8704  C CG1   . ILE C  1 229 ? 176.055 113.892 -117.424 1.00 26.26  ? 229  ILE C CG1   1 
ATOM   8705  C CG2   . ILE C  1 229 ? 176.466 115.638 -119.162 1.00 23.87  ? 229  ILE C CG2   1 
ATOM   8706  C CD1   . ILE C  1 229 ? 176.330 114.710 -116.171 1.00 27.97  ? 229  ILE C CD1   1 
ATOM   8707  N N     . LEU C  1 230 ? 178.754 113.710 -121.175 1.00 26.50  ? 230  LEU C N     1 
ATOM   8708  C CA    . LEU C  1 230 ? 179.381 114.216 -122.392 1.00 25.93  ? 230  LEU C CA    1 
ATOM   8709  C C     . LEU C  1 230 ? 178.972 113.303 -123.554 1.00 28.96  ? 230  LEU C C     1 
ATOM   8710  O O     . LEU C  1 230 ? 178.762 113.769 -124.676 1.00 27.41  ? 230  LEU C O     1 
ATOM   8711  C CB    . LEU C  1 230 ? 180.907 114.217 -122.253 1.00 24.92  ? 230  LEU C CB    1 
ATOM   8712  C CG    . LEU C  1 230 ? 181.574 115.281 -121.358 1.00 23.09  ? 230  LEU C CG    1 
ATOM   8713  C CD1   . LEU C  1 230 ? 183.042 115.075 -121.372 1.00 18.29  ? 230  LEU C CD1   1 
ATOM   8714  C CD2   . LEU C  1 230 ? 181.255 116.711 -121.862 1.00 22.49  ? 230  LEU C CD2   1 
ATOM   8715  N N     . GLN C  1 231 ? 178.876 112.000 -123.266 1.00 29.43  ? 231  GLN C N     1 
ATOM   8716  C CA    . GLN C  1 231 ? 178.487 111.018 -124.270 1.00 30.49  ? 231  GLN C CA    1 
ATOM   8717  C C     . GLN C  1 231 ? 177.080 111.289 -124.760 1.00 31.07  ? 231  GLN C C     1 
ATOM   8718  O O     . GLN C  1 231 ? 176.810 111.152 -125.950 1.00 31.20  ? 231  GLN C O     1 
ATOM   8719  C CB    . GLN C  1 231 ? 178.618 109.598 -123.729 1.00 31.41  ? 231  GLN C CB    1 
ATOM   8720  C CG    . GLN C  1 231 ? 180.049 109.078 -123.880 1.00 32.39  ? 231  GLN C CG    1 
ATOM   8721  C CD    . GLN C  1 231 ? 180.265 107.726 -123.228 1.00 32.34  ? 231  GLN C CD    1 
ATOM   8722  O OE1   . GLN C  1 231 ? 181.243 107.032 -123.543 1.00 33.71  ? 231  GLN C OE1   1 
ATOM   8723  N NE2   . GLN C  1 231 ? 179.416 107.357 -122.320 1.00 33.63  ? 231  GLN C NE2   1 
ATOM   8724  N N     . LYS C  1 232 ? 176.187 111.688 -123.863 1.00 32.88  ? 232  LYS C N     1 
ATOM   8725  C CA    . LYS C  1 232 ? 174.829 111.992 -124.283 1.00 35.79  ? 232  LYS C CA    1 
ATOM   8726  C C     . LYS C  1 232 ? 174.831 113.296 -125.108 1.00 36.14  ? 232  LYS C C     1 
ATOM   8727  O O     . LYS C  1 232 ? 173.897 113.565 -125.866 1.00 36.67  ? 232  LYS C O     1 
ATOM   8728  C CB    . LYS C  1 232 ? 173.890 112.109 -123.079 1.00 37.04  ? 232  LYS C CB    1 
ATOM   8729  C CG    . LYS C  1 232 ? 173.833 110.828 -122.225 1.00 41.94  ? 232  LYS C CG    1 
ATOM   8730  C CD    . LYS C  1 232 ? 172.798 110.887 -121.078 1.00 44.08  ? 232  LYS C CD    1 
ATOM   8731  C CE    . LYS C  1 232 ? 172.962 109.682 -120.096 1.00 46.16  ? 232  LYS C CE    1 
ATOM   8732  N NZ    . LYS C  1 232 ? 171.745 109.362 -119.247 1.00 46.86  ? 232  LYS C NZ    1 
ATOM   8733  N N     . GLN C  1 233 ? 175.879 114.103 -124.958 1.00 35.05  ? 233  GLN C N     1 
ATOM   8734  C CA    . GLN C  1 233 ? 175.996 115.339 -125.728 1.00 34.00  ? 233  GLN C CA    1 
ATOM   8735  C C     . GLN C  1 233 ? 176.458 115.032 -127.156 1.00 32.76  ? 233  GLN C C     1 
ATOM   8736  O O     . GLN C  1 233 ? 176.362 115.870 -128.044 1.00 31.30  ? 233  GLN C O     1 
ATOM   8737  C CB    . GLN C  1 233 ? 176.981 116.296 -125.061 1.00 34.01  ? 233  GLN C CB    1 
ATOM   8738  C CG    . GLN C  1 233 ? 176.383 117.032 -123.877 1.00 33.91  ? 233  GLN C CG    1 
ATOM   8739  C CD    . GLN C  1 233 ? 177.424 117.818 -123.086 1.00 31.52  ? 233  GLN C CD    1 
ATOM   8740  O OE1   . GLN C  1 233 ? 178.524 118.089 -123.568 1.00 31.39  ? 233  GLN C OE1   1 
ATOM   8741  N NE2   . GLN C  1 233 ? 177.067 118.193 -121.868 1.00 32.78  ? 233  GLN C NE2   1 
ATOM   8742  N N     . GLY C  1 234 ? 176.951 113.816 -127.363 1.00 33.54  ? 234  GLY C N     1 
ATOM   8743  C CA    . GLY C  1 234 ? 177.396 113.412 -128.686 1.00 33.78  ? 234  GLY C CA    1 
ATOM   8744  C C     . GLY C  1 234 ? 178.874 113.112 -128.718 1.00 33.76  ? 234  GLY C C     1 
ATOM   8745  O O     . GLY C  1 234 ? 179.366 112.516 -129.672 1.00 33.45  ? 234  GLY C O     1 
ATOM   8746  N N     . PHE C  1 235 ? 179.577 113.504 -127.657 1.00 32.28  ? 235  PHE C N     1 
ATOM   8747  C CA    . PHE C  1 235 ? 181.026 113.300 -127.545 1.00 32.32  ? 235  PHE C CA    1 
ATOM   8748  C C     . PHE C  1 235 ? 181.298 111.803 -127.329 1.00 32.02  ? 235  PHE C C     1 
ATOM   8749  O O     . PHE C  1 235 ? 180.859 111.228 -126.347 1.00 32.99  ? 235  PHE C O     1 
ATOM   8750  C CB    . PHE C  1 235 ? 181.543 114.139 -126.355 1.00 33.66  ? 235  PHE C CB    1 
ATOM   8751  C CG    . PHE C  1 235 ? 183.012 114.428 -126.379 1.00 30.31  ? 235  PHE C CG    1 
ATOM   8752  C CD1   . PHE C  1 235 ? 183.912 113.494 -126.843 1.00 30.20  ? 235  PHE C CD1   1 
ATOM   8753  C CD2   . PHE C  1 235 ? 183.487 115.641 -125.879 1.00 30.84  ? 235  PHE C CD2   1 
ATOM   8754  C CE1   . PHE C  1 235 ? 185.271 113.742 -126.815 1.00 30.55  ? 235  PHE C CE1   1 
ATOM   8755  C CE2   . PHE C  1 235 ? 184.848 115.917 -125.839 1.00 29.38  ? 235  PHE C CE2   1 
ATOM   8756  C CZ    . PHE C  1 235 ? 185.745 114.963 -126.310 1.00 31.79  ? 235  PHE C CZ    1 
ATOM   8757  N N     . LYS C  1 236 ? 182.020 111.169 -128.246 1.00 32.11  ? 236  LYS C N     1 
ATOM   8758  C CA    . LYS C  1 236 ? 182.310 109.740 -128.125 1.00 32.44  ? 236  LYS C CA    1 
ATOM   8759  C C     . LYS C  1 236 ? 183.702 109.491 -127.547 1.00 31.73  ? 236  LYS C C     1 
ATOM   8760  O O     . LYS C  1 236 ? 184.605 110.325 -127.704 1.00 32.54  ? 236  LYS C O     1 
ATOM   8761  C CB    . LYS C  1 236 ? 182.201 109.057 -129.504 1.00 33.50  ? 236  LYS C CB    1 
ATOM   8762  C CG    . LYS C  1 236 ? 180.812 109.141 -130.138 1.00 36.05  ? 236  LYS C CG    1 
ATOM   8763  C CD    . LYS C  1 236 ? 180.840 108.784 -131.625 1.00 39.52  ? 236  LYS C CD    1 
ATOM   8764  C CE    . LYS C  1 236 ? 181.528 109.872 -132.439 1.00 41.33  ? 236  LYS C CE    1 
ATOM   8765  N NZ    . LYS C  1 236 ? 180.831 111.184 -132.293 1.00 42.55  ? 236  LYS C NZ    1 
ATOM   8766  N N     . PHE C  1 237 ? 183.874 108.336 -126.911 1.00 29.50  ? 237  PHE C N     1 
ATOM   8767  C CA    . PHE C  1 237 ? 185.145 107.966 -126.294 1.00 28.40  ? 237  PHE C CA    1 
ATOM   8768  C C     . PHE C  1 237 ? 185.610 106.532 -126.544 1.00 28.40  ? 237  PHE C C     1 
ATOM   8769  O O     . PHE C  1 237 ? 184.817 105.593 -126.570 1.00 29.13  ? 237  PHE C O     1 
ATOM   8770  C CB    . PHE C  1 237 ? 185.063 108.144 -124.762 1.00 26.52  ? 237  PHE C CB    1 
ATOM   8771  C CG    . PHE C  1 237 ? 184.921 109.566 -124.318 1.00 24.51  ? 237  PHE C CG    1 
ATOM   8772  C CD1   . PHE C  1 237 ? 186.041 110.389 -124.201 1.00 22.50  ? 237  PHE C CD1   1 
ATOM   8773  C CD2   . PHE C  1 237 ? 183.660 110.101 -124.037 1.00 22.73  ? 237  PHE C CD2   1 
ATOM   8774  C CE1   . PHE C  1 237 ? 185.908 111.726 -123.818 1.00 19.21  ? 237  PHE C CE1   1 
ATOM   8775  C CE2   . PHE C  1 237 ? 183.520 111.446 -123.653 1.00 20.50  ? 237  PHE C CE2   1 
ATOM   8776  C CZ    . PHE C  1 237 ? 184.658 112.251 -123.548 1.00 19.61  ? 237  PHE C CZ    1 
ATOM   8777  N N     . LYS C  1 238 ? 186.915 106.378 -126.682 1.00 29.83  ? 238  LYS C N     1 
ATOM   8778  C CA    . LYS C  1 238 ? 187.537 105.070 -126.840 1.00 30.81  ? 238  LYS C CA    1 
ATOM   8779  C C     . LYS C  1 238 ? 188.553 104.997 -125.697 1.00 31.44  ? 238  LYS C C     1 
ATOM   8780  O O     . LYS C  1 238 ? 189.707 105.392 -125.884 1.00 30.05  ? 238  LYS C O     1 
ATOM   8781  C CB    . LYS C  1 238 ? 188.267 104.972 -128.191 1.00 34.59  ? 238  LYS C CB    1 
ATOM   8782  C CG    . LYS C  1 238 ? 187.351 104.887 -129.394 1.00 37.94  ? 238  LYS C CG    1 
ATOM   8783  C CD    . LYS C  1 238 ? 186.778 103.493 -129.497 1.00 42.65  ? 238  LYS C CD    1 
ATOM   8784  C CE    . LYS C  1 238 ? 186.280 103.172 -130.901 1.00 45.07  ? 238  LYS C CE    1 
ATOM   8785  N NZ    . LYS C  1 238 ? 186.177 101.678 -131.054 1.00 46.29  ? 238  LYS C NZ    1 
ATOM   8786  N N     . LEU C  1 239 ? 188.123 104.521 -124.516 1.00 31.05  ? 239  LEU C N     1 
ATOM   8787  C CA    . LEU C  1 239 ? 189.010 104.414 -123.350 1.00 30.51  ? 239  LEU C CA    1 
ATOM   8788  C C     . LEU C  1 239 ? 189.857 103.139 -123.402 1.00 29.82  ? 239  LEU C C     1 
ATOM   8789  O O     . LEU C  1 239 ? 189.556 102.228 -124.151 1.00 30.06  ? 239  LEU C O     1 
ATOM   8790  C CB    . LEU C  1 239 ? 188.199 104.420 -122.041 1.00 29.83  ? 239  LEU C CB    1 
ATOM   8791  C CG    . LEU C  1 239 ? 187.099 105.462 -121.856 1.00 27.39  ? 239  LEU C CG    1 
ATOM   8792  C CD1   . LEU C  1 239 ? 186.637 105.404 -120.422 1.00 28.97  ? 239  LEU C CD1   1 
ATOM   8793  C CD2   . LEU C  1 239 ? 187.603 106.858 -122.192 1.00 29.45  ? 239  LEU C CD2   1 
ATOM   8794  N N     . ASN C  1 240 ? 190.912 103.080 -122.606 1.00 29.88  ? 240  ASN C N     1 
ATOM   8795  C CA    . ASN C  1 240 ? 191.777 101.913 -122.598 1.00 31.76  ? 240  ASN C CA    1 
ATOM   8796  C C     . ASN C  1 240 ? 192.185 101.538 -124.017 1.00 32.49  ? 240  ASN C C     1 
ATOM   8797  O O     . ASN C  1 240 ? 192.253 100.356 -124.360 1.00 34.42  ? 240  ASN C O     1 
ATOM   8798  C CB    . ASN C  1 240 ? 191.051 100.738 -121.941 1.00 31.63  ? 240  ASN C CB    1 
ATOM   8799  C CG    . ASN C  1 240 ? 190.704 101.025 -120.491 1.00 31.39  ? 240  ASN C CG    1 
ATOM   8800  O OD1   . ASN C  1 240 ? 191.590 101.273 -119.682 1.00 29.72  ? 240  ASN C OD1   1 
ATOM   8801  N ND2   . ASN C  1 240 ? 189.419 101.016 -120.172 1.00 29.69  ? 240  ASN C ND2   1 
ATOM   8802  N N     . THR C  1 241 ? 192.453 102.558 -124.821 1.00 31.98  ? 241  THR C N     1 
ATOM   8803  C CA    . THR C  1 241 ? 192.856 102.397 -126.203 1.00 33.31  ? 241  THR C CA    1 
ATOM   8804  C C     . THR C  1 241 ? 194.169 103.140 -126.461 1.00 34.13  ? 241  THR C C     1 
ATOM   8805  O O     . THR C  1 241 ? 194.409 104.244 -125.965 1.00 34.59  ? 241  THR C O     1 
ATOM   8806  C CB    . THR C  1 241 ? 191.773 102.940 -127.156 1.00 33.36  ? 241  THR C CB    1 
ATOM   8807  O OG1   . THR C  1 241 ? 190.559 102.199 -126.977 1.00 33.62  ? 241  THR C OG1   1 
ATOM   8808  C CG2   . THR C  1 241 ? 192.223 102.823 -128.603 1.00 34.49  ? 241  THR C CG2   1 
ATOM   8809  N N     . LYS C  1 242 ? 195.013 102.523 -127.264 1.00 34.35  ? 242  LYS C N     1 
ATOM   8810  C CA    . LYS C  1 242 ? 196.308 103.067 -127.612 1.00 36.22  ? 242  LYS C CA    1 
ATOM   8811  C C     . LYS C  1 242 ? 196.304 103.479 -129.099 1.00 36.49  ? 242  LYS C C     1 
ATOM   8812  O O     . LYS C  1 242 ? 195.774 102.762 -129.942 1.00 33.87  ? 242  LYS C O     1 
ATOM   8813  C CB    . LYS C  1 242 ? 197.326 101.954 -127.341 1.00 38.51  ? 242  LYS C CB    1 
ATOM   8814  C CG    . LYS C  1 242 ? 198.746 102.185 -127.759 1.00 42.55  ? 242  LYS C CG    1 
ATOM   8815  C CD    . LYS C  1 242 ? 199.418 100.829 -127.947 1.00 45.00  ? 242  LYS C CD    1 
ATOM   8816  C CE    . LYS C  1 242 ? 200.791 100.992 -128.607 1.00 50.19  ? 242  LYS C CE    1 
ATOM   8817  N NZ    . LYS C  1 242 ? 201.310 99.730  -129.267 1.00 51.40  ? 242  LYS C NZ    1 
ATOM   8818  N N     . VAL C  1 243 ? 196.857 104.646 -129.415 1.00 37.98  ? 243  VAL C N     1 
ATOM   8819  C CA    . VAL C  1 243 ? 196.962 105.075 -130.814 1.00 38.75  ? 243  VAL C CA    1 
ATOM   8820  C C     . VAL C  1 243 ? 198.285 104.524 -131.368 1.00 40.55  ? 243  VAL C C     1 
ATOM   8821  O O     . VAL C  1 243 ? 199.372 104.899 -130.920 1.00 40.45  ? 243  VAL C O     1 
ATOM   8822  C CB    . VAL C  1 243 ? 196.953 106.604 -130.951 1.00 37.35  ? 243  VAL C CB    1 
ATOM   8823  C CG1   . VAL C  1 243 ? 197.296 107.001 -132.389 1.00 37.98  ? 243  VAL C CG1   1 
ATOM   8824  C CG2   . VAL C  1 243 ? 195.578 107.147 -130.569 1.00 36.13  ? 243  VAL C CG2   1 
ATOM   8825  N N     . THR C  1 244 ? 198.189 103.618 -132.341 1.00 42.55  ? 244  THR C N     1 
ATOM   8826  C CA    . THR C  1 244 ? 199.383 103.014 -132.926 1.00 43.52  ? 244  THR C CA    1 
ATOM   8827  C C     . THR C  1 244 ? 199.995 103.869 -134.035 1.00 44.16  ? 244  THR C C     1 
ATOM   8828  O O     . THR C  1 244 ? 201.134 103.636 -134.447 1.00 44.84  ? 244  THR C O     1 
ATOM   8829  C CB    . THR C  1 244 ? 199.093 101.570 -133.459 1.00 44.46  ? 244  THR C CB    1 
ATOM   8830  O OG1   . THR C  1 244 ? 198.076 101.599 -134.469 1.00 45.37  ? 244  THR C OG1   1 
ATOM   8831  C CG2   . THR C  1 244 ? 198.613 100.674 -132.320 1.00 45.25  ? 244  THR C CG2   1 
ATOM   8832  N N     . GLY C  1 245 ? 199.261 104.880 -134.496 1.00 43.81  ? 245  GLY C N     1 
ATOM   8833  C CA    . GLY C  1 245 ? 199.788 105.732 -135.547 1.00 42.55  ? 245  GLY C CA    1 
ATOM   8834  C C     . GLY C  1 245 ? 198.748 106.572 -136.254 1.00 41.33  ? 245  GLY C C     1 
ATOM   8835  O O     . GLY C  1 245 ? 197.550 106.378 -136.069 1.00 41.04  ? 245  GLY C O     1 
ATOM   8836  N N     . ALA C  1 246 ? 199.213 107.520 -137.056 1.00 40.71  ? 246  ALA C N     1 
ATOM   8837  C CA    . ALA C  1 246 ? 198.320 108.378 -137.821 1.00 41.62  ? 246  ALA C CA    1 
ATOM   8838  C C     . ALA C  1 246 ? 198.982 108.723 -139.158 1.00 41.96  ? 246  ALA C C     1 
ATOM   8839  O O     . ALA C  1 246 ? 200.192 108.963 -139.228 1.00 42.17  ? 246  ALA C O     1 
ATOM   8840  C CB    . ALA C  1 246 ? 197.990 109.652 -137.039 1.00 41.48  ? 246  ALA C CB    1 
ATOM   8841  N N     . THR C  1 247 ? 198.183 108.754 -140.217 1.00 41.46  ? 247  THR C N     1 
ATOM   8842  C CA    . THR C  1 247 ? 198.708 109.058 -141.544 1.00 41.93  ? 247  THR C CA    1 
ATOM   8843  C C     . THR C  1 247 ? 197.792 110.001 -142.308 1.00 40.77  ? 247  THR C C     1 
ATOM   8844  O O     . THR C  1 247 ? 196.590 109.777 -142.393 1.00 40.27  ? 247  THR C O     1 
ATOM   8845  C CB    . THR C  1 247 ? 198.900 107.756 -142.375 1.00 42.65  ? 247  THR C CB    1 
ATOM   8846  O OG1   . THR C  1 247 ? 197.649 107.071 -142.472 1.00 43.99  ? 247  THR C OG1   1 
ATOM   8847  C CG2   . THR C  1 247 ? 199.909 106.819 -141.709 1.00 42.82  ? 247  THR C CG2   1 
ATOM   8848  N N     . LYS C  1 248 ? 198.364 111.077 -142.834 1.00 41.59  ? 248  LYS C N     1 
ATOM   8849  C CA    . LYS C  1 248 ? 197.596 112.032 -143.627 1.00 43.18  ? 248  LYS C CA    1 
ATOM   8850  C C     . LYS C  1 248 ? 197.446 111.387 -144.997 1.00 41.81  ? 248  LYS C C     1 
ATOM   8851  O O     . LYS C  1 248 ? 198.398 110.803 -145.489 1.00 42.51  ? 248  LYS C O     1 
ATOM   8852  C CB    . LYS C  1 248 ? 198.357 113.346 -143.802 1.00 45.74  ? 248  LYS C CB    1 
ATOM   8853  C CG    . LYS C  1 248 ? 198.201 114.338 -142.666 1.00 50.64  ? 248  LYS C CG    1 
ATOM   8854  C CD    . LYS C  1 248 ? 198.469 115.774 -143.148 1.00 53.84  ? 248  LYS C CD    1 
ATOM   8855  C CE    . LYS C  1 248 ? 197.471 116.221 -144.254 1.00 54.88  ? 248  LYS C CE    1 
ATOM   8856  N NZ    . LYS C  1 248 ? 196.029 116.329 -143.827 1.00 54.49  ? 248  LYS C NZ    1 
ATOM   8857  N N     . LYS C  1 249 ? 196.280 111.495 -145.620 1.00 40.01  ? 249  LYS C N     1 
ATOM   8858  C CA    . LYS C  1 249 ? 196.089 110.886 -146.934 1.00 38.17  ? 249  LYS C CA    1 
ATOM   8859  C C     . LYS C  1 249 ? 196.006 111.901 -148.061 1.00 37.67  ? 249  LYS C C     1 
ATOM   8860  O O     . LYS C  1 249 ? 195.739 113.080 -147.829 1.00 36.53  ? 249  LYS C O     1 
ATOM   8861  C CB    . LYS C  1 249 ? 194.839 110.021 -146.920 1.00 37.79  ? 249  LYS C CB    1 
ATOM   8862  C CG    . LYS C  1 249 ? 194.942 108.885 -145.925 1.00 36.72  ? 249  LYS C CG    1 
ATOM   8863  C CD    . LYS C  1 249 ? 193.843 107.851 -146.092 1.00 34.90  ? 249  LYS C CD    1 
ATOM   8864  C CE    . LYS C  1 249 ? 192.522 108.323 -145.564 1.00 33.35  ? 249  LYS C CE    1 
ATOM   8865  N NZ    . LYS C  1 249 ? 191.668 107.140 -145.267 1.00 30.62  ? 249  LYS C NZ    1 
ATOM   8866  N N     . SER C  1 250 ? 196.221 111.426 -149.285 1.00 36.84  ? 250  SER C N     1 
ATOM   8867  C CA    . SER C  1 250 ? 196.182 112.276 -150.485 1.00 35.80  ? 250  SER C CA    1 
ATOM   8868  C C     . SER C  1 250 ? 194.857 113.013 -150.661 1.00 34.72  ? 250  SER C C     1 
ATOM   8869  O O     . SER C  1 250 ? 194.800 114.055 -151.315 1.00 35.47  ? 250  SER C O     1 
ATOM   8870  C CB    . SER C  1 250 ? 196.461 111.429 -151.741 1.00 36.53  ? 250  SER C CB    1 
ATOM   8871  O OG    . SER C  1 250 ? 195.410 110.498 -151.969 1.00 37.36  ? 250  SER C OG    1 
ATOM   8872  N N     . ASP C  1 251 ? 193.783 112.466 -150.094 1.00 33.97  ? 251  ASP C N     1 
ATOM   8873  C CA    . ASP C  1 251 ? 192.471 113.093 -150.192 1.00 34.15  ? 251  ASP C CA    1 
ATOM   8874  C C     . ASP C  1 251 ? 192.335 114.114 -149.066 1.00 35.87  ? 251  ASP C C     1 
ATOM   8875  O O     . ASP C  1 251 ? 191.318 114.790 -148.944 1.00 35.38  ? 251  ASP C O     1 
ATOM   8876  C CB    . ASP C  1 251 ? 191.362 112.031 -150.087 1.00 36.94  ? 251  ASP C CB    1 
ATOM   8877  C CG    . ASP C  1 251 ? 191.345 111.303 -148.730 1.00 38.69  ? 251  ASP C CG    1 
ATOM   8878  O OD1   . ASP C  1 251 ? 192.317 111.407 -147.952 1.00 39.91  ? 251  ASP C OD1   1 
ATOM   8879  O OD2   . ASP C  1 251 ? 190.352 110.602 -148.443 1.00 40.16  ? 251  ASP C OD2   1 
ATOM   8880  N N     . GLY C  1 252 ? 193.371 114.221 -148.243 1.00 36.66  ? 252  GLY C N     1 
ATOM   8881  C CA    . GLY C  1 252 ? 193.328 115.160 -147.130 1.00 39.85  ? 252  GLY C CA    1 
ATOM   8882  C C     . GLY C  1 252 ? 192.848 114.559 -145.811 1.00 39.54  ? 252  GLY C C     1 
ATOM   8883  O O     . GLY C  1 252 ? 193.020 115.169 -144.760 1.00 40.58  ? 252  GLY C O     1 
ATOM   8884  N N     . LYS C  1 253 ? 192.232 113.381 -145.855 1.00 39.62  ? 253  LYS C N     1 
ATOM   8885  C CA    . LYS C  1 253 ? 191.756 112.735 -144.634 1.00 38.98  ? 253  LYS C CA    1 
ATOM   8886  C C     . LYS C  1 253 ? 192.937 112.226 -143.791 1.00 37.77  ? 253  LYS C C     1 
ATOM   8887  O O     . LYS C  1 253 ? 194.075 112.141 -144.267 1.00 36.05  ? 253  LYS C O     1 
ATOM   8888  C CB    . LYS C  1 253 ? 190.850 111.553 -144.975 1.00 41.46  ? 253  LYS C CB    1 
ATOM   8889  C CG    . LYS C  1 253 ? 189.599 111.889 -145.761 1.00 41.91  ? 253  LYS C CG    1 
ATOM   8890  C CD    . LYS C  1 253 ? 188.644 112.763 -144.980 1.00 44.00  ? 253  LYS C CD    1 
ATOM   8891  C CE    . LYS C  1 253 ? 187.265 112.751 -145.624 1.00 44.57  ? 253  LYS C CE    1 
ATOM   8892  N NZ    . LYS C  1 253 ? 186.344 113.766 -145.058 1.00 45.51  ? 253  LYS C NZ    1 
ATOM   8893  N N     . ILE C  1 254 ? 192.654 111.895 -142.532 1.00 35.91  ? 254  ILE C N     1 
ATOM   8894  C CA    . ILE C  1 254 ? 193.671 111.376 -141.637 1.00 34.21  ? 254  ILE C CA    1 
ATOM   8895  C C     . ILE C  1 254 ? 193.163 110.067 -141.085 1.00 33.23  ? 254  ILE C C     1 
ATOM   8896  O O     . ILE C  1 254 ? 192.026 109.988 -140.616 1.00 31.32  ? 254  ILE C O     1 
ATOM   8897  C CB    . ILE C  1 254 ? 193.933 112.323 -140.459 1.00 36.03  ? 254  ILE C CB    1 
ATOM   8898  C CG1   . ILE C  1 254 ? 194.245 113.718 -140.990 1.00 37.20  ? 254  ILE C CG1   1 
ATOM   8899  C CG2   . ILE C  1 254 ? 195.096 111.791 -139.623 1.00 33.86  ? 254  ILE C CG2   1 
ATOM   8900  C CD1   . ILE C  1 254 ? 194.313 114.765 -139.924 1.00 38.30  ? 254  ILE C CD1   1 
ATOM   8901  N N     . ASP C  1 255 ? 193.996 109.038 -141.169 1.00 31.94  ? 255  ASP C N     1 
ATOM   8902  C CA    . ASP C  1 255 ? 193.632 107.723 -140.654 1.00 33.32  ? 255  ASP C CA    1 
ATOM   8903  C C     . ASP C  1 255 ? 194.387 107.540 -139.351 1.00 33.13  ? 255  ASP C C     1 
ATOM   8904  O O     . ASP C  1 255 ? 195.622 107.636 -139.331 1.00 34.91  ? 255  ASP C O     1 
ATOM   8905  C CB    . ASP C  1 255 ? 194.039 106.599 -141.623 1.00 31.91  ? 255  ASP C CB    1 
ATOM   8906  C CG    . ASP C  1 255 ? 192.940 106.237 -142.625 1.00 32.97  ? 255  ASP C CG    1 
ATOM   8907  O OD1   . ASP C  1 255 ? 191.859 106.873 -142.633 1.00 31.04  ? 255  ASP C OD1   1 
ATOM   8908  O OD2   . ASP C  1 255 ? 193.181 105.293 -143.414 1.00 34.00  ? 255  ASP C OD2   1 
ATOM   8909  N N     . VAL C  1 256 ? 193.642 107.310 -138.273 1.00 32.42  ? 256  VAL C N     1 
ATOM   8910  C CA    . VAL C  1 256 ? 194.226 107.100 -136.951 1.00 31.85  ? 256  VAL C CA    1 
ATOM   8911  C C     . VAL C  1 256 ? 194.125 105.616 -136.584 1.00 31.13  ? 256  VAL C C     1 
ATOM   8912  O O     . VAL C  1 256 ? 193.034 105.086 -136.407 1.00 32.18  ? 256  VAL C O     1 
ATOM   8913  C CB    . VAL C  1 256 ? 193.484 107.941 -135.871 1.00 31.93  ? 256  VAL C CB    1 
ATOM   8914  C CG1   . VAL C  1 256 ? 194.117 107.720 -134.493 1.00 32.07  ? 256  VAL C CG1   1 
ATOM   8915  C CG2   . VAL C  1 256 ? 193.545 109.393 -136.229 1.00 29.15  ? 256  VAL C CG2   1 
ATOM   8916  N N     . SER C  1 257 ? 195.260 104.942 -136.471 1.00 30.83  ? 257  SER C N     1 
ATOM   8917  C CA    . SER C  1 257 ? 195.244 103.533 -136.133 1.00 32.53  ? 257  SER C CA    1 
ATOM   8918  C C     . SER C  1 257 ? 195.276 103.371 -134.619 1.00 32.65  ? 257  SER C C     1 
ATOM   8919  O O     . SER C  1 257 ? 196.063 104.027 -133.933 1.00 32.09  ? 257  SER C O     1 
ATOM   8920  C CB    . SER C  1 257 ? 196.447 102.836 -136.771 1.00 33.00  ? 257  SER C CB    1 
ATOM   8921  O OG    . SER C  1 257 ? 196.344 102.896 -138.187 1.00 36.49  ? 257  SER C OG    1 
ATOM   8922  N N     . ILE C  1 258 ? 194.405 102.509 -134.109 1.00 32.82  ? 258  ILE C N     1 
ATOM   8923  C CA    . ILE C  1 258 ? 194.311 102.269 -132.669 1.00 33.38  ? 258  ILE C CA    1 
ATOM   8924  C C     . ILE C  1 258 ? 194.172 100.795 -132.353 1.00 34.41  ? 258  ILE C C     1 
ATOM   8925  O O     . ILE C  1 258 ? 193.838 99.995  -133.226 1.00 33.05  ? 258  ILE C O     1 
ATOM   8926  C CB    . ILE C  1 258 ? 193.096 102.999 -132.033 1.00 32.64  ? 258  ILE C CB    1 
ATOM   8927  C CG1   . ILE C  1 258 ? 191.799 102.449 -132.634 1.00 32.98  ? 258  ILE C CG1   1 
ATOM   8928  C CG2   . ILE C  1 258 ? 193.230 104.500 -132.241 1.00 30.37  ? 258  ILE C CG2   1 
ATOM   8929  C CD1   . ILE C  1 258 ? 190.548 102.825 -131.873 1.00 32.40  ? 258  ILE C CD1   1 
ATOM   8930  N N     . GLU C  1 259 ? 194.432 100.462 -131.086 1.00 35.12  ? 259  GLU C N     1 
ATOM   8931  C CA    . GLU C  1 259 ? 194.378 99.097  -130.546 1.00 38.22  ? 259  GLU C CA    1 
ATOM   8932  C C     . GLU C  1 259 ? 193.920 99.195  -129.099 1.00 37.65  ? 259  GLU C C     1 
ATOM   8933  O O     . GLU C  1 259 ? 193.962 100.272 -128.502 1.00 36.58  ? 259  GLU C O     1 
ATOM   8934  C CB    . GLU C  1 259 ? 195.778 98.451  -130.516 1.00 40.66  ? 259  GLU C CB    1 
ATOM   8935  C CG    . GLU C  1 259 ? 196.251 97.786  -131.802 1.00 47.76  ? 259  GLU C CG    1 
ATOM   8936  C CD    . GLU C  1 259 ? 197.602 97.082  -131.643 1.00 49.90  ? 259  GLU C CD    1 
ATOM   8937  O OE1   . GLU C  1 259 ? 197.744 96.216  -130.748 1.00 51.82  ? 259  GLU C OE1   1 
ATOM   8938  O OE2   . GLU C  1 259 ? 198.530 97.384  -132.424 1.00 53.70  ? 259  GLU C OE2   1 
ATOM   8939  N N     . ALA C  1 260 ? 193.486 98.075  -128.538 1.00 37.72  ? 260  ALA C N     1 
ATOM   8940  C CA    . ALA C  1 260 ? 193.099 98.061  -127.133 1.00 38.26  ? 260  ALA C CA    1 
ATOM   8941  C C     . ALA C  1 260 ? 194.440 98.319  -126.455 1.00 38.70  ? 260  ALA C C     1 
ATOM   8942  O O     . ALA C  1 260 ? 195.472 97.856  -126.943 1.00 39.20  ? 260  ALA C O     1 
ATOM   8943  C CB    . ALA C  1 260 ? 192.557 96.688  -126.740 1.00 37.81  ? 260  ALA C CB    1 
ATOM   8944  N N     . ALA C  1 261 ? 194.446 99.079  -125.365 1.00 40.49  ? 261  ALA C N     1 
ATOM   8945  C CA    . ALA C  1 261 ? 195.695 99.376  -124.668 1.00 41.49  ? 261  ALA C CA    1 
ATOM   8946  C C     . ALA C  1 261 ? 196.470 98.092  -124.333 1.00 43.10  ? 261  ALA C C     1 
ATOM   8947  O O     . ALA C  1 261 ? 197.702 98.066  -124.386 1.00 43.40  ? 261  ALA C O     1 
ATOM   8948  C CB    . ALA C  1 261 ? 195.409 100.177 -123.387 1.00 42.19  ? 261  ALA C CB    1 
ATOM   8949  N N     . SER C  1 262 ? 195.743 97.027  -124.009 1.00 43.96  ? 262  SER C N     1 
ATOM   8950  C CA    . SER C  1 262 ? 196.362 95.744  -123.677 1.00 47.72  ? 262  SER C CA    1 
ATOM   8951  C C     . SER C  1 262 ? 196.532 94.839  -124.910 1.00 49.48  ? 262  SER C C     1 
ATOM   8952  O O     . SER C  1 262 ? 196.425 93.617  -124.798 1.00 50.32  ? 262  SER C O     1 
ATOM   8953  C CB    . SER C  1 262 ? 195.514 94.995  -122.643 1.00 46.45  ? 262  SER C CB    1 
ATOM   8954  O OG    . SER C  1 262 ? 194.279 94.595  -123.208 1.00 45.95  ? 262  SER C OG    1 
ATOM   8955  N N     . GLY C  1 263 ? 196.768 95.442  -126.077 1.00 50.51  ? 263  GLY C N     1 
ATOM   8956  C CA    . GLY C  1 263 ? 196.956 94.668  -127.298 1.00 49.41  ? 263  GLY C CA    1 
ATOM   8957  C C     . GLY C  1 263 ? 195.709 94.129  -127.988 1.00 48.57  ? 263  GLY C C     1 
ATOM   8958  O O     . GLY C  1 263 ? 194.736 93.749  -127.336 1.00 47.79  ? 263  GLY C O     1 
ATOM   8959  N N     . GLY C  1 264 ? 195.747 94.090  -129.321 1.00 48.63  ? 264  GLY C N     1 
ATOM   8960  C CA    . GLY C  1 264 ? 194.615 93.584  -130.080 1.00 46.94  ? 264  GLY C CA    1 
ATOM   8961  C C     . GLY C  1 264 ? 193.586 94.648  -130.395 1.00 46.62  ? 264  GLY C C     1 
ATOM   8962  O O     . GLY C  1 264 ? 193.830 95.838  -130.183 1.00 46.96  ? 264  GLY C O     1 
ATOM   8963  N N     . LYS C  1 265 ? 192.438 94.214  -130.908 1.00 45.66  ? 265  LYS C N     1 
ATOM   8964  C CA    . LYS C  1 265 ? 191.342 95.110  -131.269 1.00 45.34  ? 265  LYS C CA    1 
ATOM   8965  C C     . LYS C  1 265 ? 191.815 96.187  -132.250 1.00 43.93  ? 265  LYS C C     1 
ATOM   8966  O O     . LYS C  1 265 ? 191.448 97.355  -132.126 1.00 43.26  ? 265  LYS C O     1 
ATOM   8967  C CB    . LYS C  1 265 ? 190.775 95.761  -130.001 1.00 47.64  ? 265  LYS C CB    1 
ATOM   8968  C CG    . LYS C  1 265 ? 189.447 96.522  -130.156 1.00 50.55  ? 265  LYS C CG    1 
ATOM   8969  C CD    . LYS C  1 265 ? 188.241 95.586  -130.233 1.00 52.42  ? 265  LYS C CD    1 
ATOM   8970  C CE    . LYS C  1 265 ? 186.909 96.341  -130.387 1.00 53.89  ? 265  LYS C CE    1 
ATOM   8971  N NZ    . LYS C  1 265 ? 186.514 97.160  -129.195 1.00 53.82  ? 265  LYS C NZ    1 
ATOM   8972  N N     . ALA C  1 266 ? 192.622 95.796  -133.228 1.00 41.98  ? 266  ALA C N     1 
ATOM   8973  C CA    . ALA C  1 266 ? 193.120 96.759  -134.202 1.00 41.26  ? 266  ALA C CA    1 
ATOM   8974  C C     . ALA C  1 266 ? 191.975 97.436  -134.936 1.00 41.29  ? 266  ALA C C     1 
ATOM   8975  O O     . ALA C  1 266 ? 191.088 96.784  -135.496 1.00 41.43  ? 266  ALA C O     1 
ATOM   8976  C CB    . ALA C  1 266 ? 194.043 96.083  -135.201 1.00 40.42  ? 266  ALA C CB    1 
ATOM   8977  N N     . GLU C  1 267 ? 191.989 98.760  -134.920 1.00 39.42  ? 267  GLU C N     1 
ATOM   8978  C CA    . GLU C  1 267 ? 190.973 99.525  -135.610 1.00 37.32  ? 267  GLU C CA    1 
ATOM   8979  C C     . GLU C  1 267 ? 191.643 100.754 -136.246 1.00 35.39  ? 267  GLU C C     1 
ATOM   8980  O O     . GLU C  1 267 ? 192.800 101.061 -135.958 1.00 31.68  ? 267  GLU C O     1 
ATOM   8981  C CB    . GLU C  1 267 ? 189.879 99.972  -134.638 1.00 38.81  ? 267  GLU C CB    1 
ATOM   8982  C CG    . GLU C  1 267 ? 189.039 98.858  -134.042 1.00 43.11  ? 267  GLU C CG    1 
ATOM   8983  C CD    . GLU C  1 267 ? 188.016 99.384  -133.031 1.00 44.99  ? 267  GLU C CD    1 
ATOM   8984  O OE1   . GLU C  1 267 ? 188.401 99.739  -131.894 1.00 45.79  ? 267  GLU C OE1   1 
ATOM   8985  O OE2   . GLU C  1 267 ? 186.819 99.455  -133.370 1.00 46.60  ? 267  GLU C OE2   1 
ATOM   8986  N N     . VAL C  1 268 ? 190.908 101.427 -137.131 1.00 34.72  ? 268  VAL C N     1 
ATOM   8987  C CA    . VAL C  1 268 ? 191.374 102.637 -137.798 1.00 34.81  ? 268  VAL C CA    1 
ATOM   8988  C C     . VAL C  1 268 ? 190.206 103.617 -137.792 1.00 34.43  ? 268  VAL C C     1 
ATOM   8989  O O     . VAL C  1 268 ? 189.073 103.248 -138.090 1.00 34.65  ? 268  VAL C O     1 
ATOM   8990  C CB    . VAL C  1 268 ? 191.785 102.397 -139.291 1.00 34.69  ? 268  VAL C CB    1 
ATOM   8991  C CG1   . VAL C  1 268 ? 192.268 103.712 -139.908 1.00 34.01  ? 268  VAL C CG1   1 
ATOM   8992  C CG2   . VAL C  1 268 ? 192.885 101.343 -139.388 1.00 34.19  ? 268  VAL C CG2   1 
ATOM   8993  N N     . ILE C  1 269 ? 190.488 104.858 -137.430 1.00 34.77  ? 269  ILE C N     1 
ATOM   8994  C CA    . ILE C  1 269 ? 189.474 105.897 -137.400 1.00 34.52  ? 269  ILE C CA    1 
ATOM   8995  C C     . ILE C  1 269 ? 189.941 106.949 -138.392 1.00 34.68  ? 269  ILE C C     1 
ATOM   8996  O O     . ILE C  1 269 ? 191.111 107.328 -138.390 1.00 35.24  ? 269  ILE C O     1 
ATOM   8997  C CB    . ILE C  1 269 ? 189.352 106.576 -136.006 1.00 34.80  ? 269  ILE C CB    1 
ATOM   8998  C CG1   . ILE C  1 269 ? 188.924 105.559 -134.946 1.00 35.45  ? 269  ILE C CG1   1 
ATOM   8999  C CG2   . ILE C  1 269 ? 188.317 107.708 -136.067 1.00 35.26  ? 269  ILE C CG2   1 
ATOM   9000  C CD1   . ILE C  1 269 ? 188.749 106.175 -133.557 1.00 33.69  ? 269  ILE C CD1   1 
ATOM   9001  N N     . THR C  1 270 ? 189.030 107.403 -139.240 1.00 35.28  ? 270  THR C N     1 
ATOM   9002  C CA    . THR C  1 270 ? 189.348 108.409 -140.240 1.00 34.96  ? 270  THR C CA    1 
ATOM   9003  C C     . THR C  1 270 ? 188.689 109.730 -139.866 1.00 34.26  ? 270  THR C C     1 
ATOM   9004  O O     . THR C  1 270 ? 187.506 109.765 -139.533 1.00 35.03  ? 270  THR C O     1 
ATOM   9005  C CB    . THR C  1 270 ? 188.851 107.961 -141.628 1.00 35.80  ? 270  THR C CB    1 
ATOM   9006  O OG1   . THR C  1 270 ? 189.383 106.657 -141.921 1.00 37.45  ? 270  THR C OG1   1 
ATOM   9007  C CG2   . THR C  1 270 ? 189.294 108.946 -142.693 1.00 34.07  ? 270  THR C CG2   1 
ATOM   9008  N N     . CYS C  1 271 ? 189.457 110.811 -139.937 1.00 33.21  ? 271  CYS C N     1 
ATOM   9009  C CA    . CYS C  1 271 ? 188.962 112.142 -139.568 1.00 33.64  ? 271  CYS C CA    1 
ATOM   9010  C C     . CYS C  1 271 ? 189.525 113.266 -140.459 1.00 33.10  ? 271  CYS C C     1 
ATOM   9011  O O     . CYS C  1 271 ? 190.390 113.042 -141.311 1.00 33.21  ? 271  CYS C O     1 
ATOM   9012  C CB    . CYS C  1 271 ? 189.336 112.429 -138.104 1.00 32.34  ? 271  CYS C CB    1 
ATOM   9013  S SG    . CYS C  1 271 ? 191.135 112.397 -137.805 1.00 34.13  ? 271  CYS C SG    1 
ATOM   9014  N N     . ASP C  1 272 ? 189.035 114.479 -140.243 1.00 33.45  ? 272  ASP C N     1 
ATOM   9015  C CA    . ASP C  1 272 ? 189.481 115.632 -141.011 1.00 34.68  ? 272  ASP C CA    1 
ATOM   9016  C C     . ASP C  1 272 ? 190.503 116.407 -140.215 1.00 34.82  ? 272  ASP C C     1 
ATOM   9017  O O     . ASP C  1 272 ? 191.369 117.093 -140.768 1.00 35.76  ? 272  ASP C O     1 
ATOM   9018  C CB    . ASP C  1 272 ? 188.284 116.505 -141.340 1.00 37.26  ? 272  ASP C CB    1 
ATOM   9019  C CG    . ASP C  1 272 ? 187.197 115.723 -142.037 1.00 39.83  ? 272  ASP C CG    1 
ATOM   9020  O OD1   . ASP C  1 272 ? 187.431 115.299 -143.193 1.00 42.84  ? 272  ASP C OD1   1 
ATOM   9021  O OD2   . ASP C  1 272 ? 186.128 115.504 -141.429 1.00 40.20  ? 272  ASP C OD2   1 
ATOM   9022  N N     . VAL C  1 273 ? 190.406 116.278 -138.899 1.00 33.70  ? 273  VAL C N     1 
ATOM   9023  C CA    . VAL C  1 273 ? 191.325 116.952 -138.006 1.00 32.72  ? 273  VAL C CA    1 
ATOM   9024  C C     . VAL C  1 273 ? 191.707 116.048 -136.834 1.00 31.89  ? 273  VAL C C     1 
ATOM   9025  O O     . VAL C  1 273 ? 190.849 115.419 -136.210 1.00 31.91  ? 273  VAL C O     1 
ATOM   9026  C CB    . VAL C  1 273 ? 190.692 118.264 -137.484 1.00 32.83  ? 273  VAL C CB    1 
ATOM   9027  C CG1   . VAL C  1 273 ? 191.512 118.838 -136.343 1.00 32.78  ? 273  VAL C CG1   1 
ATOM   9028  C CG2   . VAL C  1 273 ? 190.583 119.266 -138.622 1.00 32.24  ? 273  VAL C CG2   1 
ATOM   9029  N N     . LEU C  1 274 ? 193.007 115.959 -136.580 1.00 30.97  ? 274  LEU C N     1 
ATOM   9030  C CA    . LEU C  1 274 ? 193.536 115.183 -135.469 1.00 30.52  ? 274  LEU C CA    1 
ATOM   9031  C C     . LEU C  1 274 ? 194.099 116.188 -134.448 1.00 30.07  ? 274  LEU C C     1 
ATOM   9032  O O     . LEU C  1 274 ? 194.915 117.037 -134.789 1.00 28.51  ? 274  LEU C O     1 
ATOM   9033  C CB    . LEU C  1 274 ? 194.643 114.236 -135.948 1.00 31.05  ? 274  LEU C CB    1 
ATOM   9034  C CG    . LEU C  1 274 ? 195.293 113.385 -134.859 1.00 33.50  ? 274  LEU C CG    1 
ATOM   9035  C CD1   . LEU C  1 274 ? 194.243 112.416 -134.256 1.00 31.79  ? 274  LEU C CD1   1 
ATOM   9036  C CD2   . LEU C  1 274 ? 196.485 112.645 -135.429 1.00 32.42  ? 274  LEU C CD2   1 
ATOM   9037  N N     . LEU C  1 275 ? 193.620 116.115 -133.205 1.00 30.74  ? 275  LEU C N     1 
ATOM   9038  C CA    . LEU C  1 275 ? 194.098 116.997 -132.135 1.00 27.21  ? 275  LEU C CA    1 
ATOM   9039  C C     . LEU C  1 275 ? 194.876 116.116 -131.179 1.00 28.40  ? 275  LEU C C     1 
ATOM   9040  O O     . LEU C  1 275 ? 194.344 115.139 -130.649 1.00 27.95  ? 275  LEU C O     1 
ATOM   9041  C CB    . LEU C  1 275 ? 192.920 117.644 -131.403 1.00 26.70  ? 275  LEU C CB    1 
ATOM   9042  C CG    . LEU C  1 275 ? 193.221 118.159 -129.984 1.00 27.44  ? 275  LEU C CG    1 
ATOM   9043  C CD1   . LEU C  1 275 ? 194.346 119.195 -130.009 1.00 22.63  ? 275  LEU C CD1   1 
ATOM   9044  C CD2   . LEU C  1 275 ? 191.936 118.733 -129.394 1.00 24.94  ? 275  LEU C CD2   1 
ATOM   9045  N N     . VAL C  1 276 ? 196.145 116.453 -130.990 1.00 28.95  ? 276  VAL C N     1 
ATOM   9046  C CA    . VAL C  1 276 ? 197.025 115.719 -130.102 1.00 29.78  ? 276  VAL C CA    1 
ATOM   9047  C C     . VAL C  1 276 ? 197.167 116.488 -128.790 1.00 30.44  ? 276  VAL C C     1 
ATOM   9048  O O     . VAL C  1 276 ? 197.724 117.600 -128.772 1.00 30.82  ? 276  VAL C O     1 
ATOM   9049  C CB    . VAL C  1 276 ? 198.426 115.569 -130.712 1.00 29.86  ? 276  VAL C CB    1 
ATOM   9050  C CG1   . VAL C  1 276 ? 199.302 114.755 -129.784 1.00 31.41  ? 276  VAL C CG1   1 
ATOM   9051  C CG2   . VAL C  1 276 ? 198.330 114.900 -132.073 1.00 29.38  ? 276  VAL C CG2   1 
ATOM   9052  N N     . CYS C  1 277 ? 196.653 115.903 -127.707 1.00 30.36  ? 277  CYS C N     1 
ATOM   9053  C CA    . CYS C  1 277 ? 196.726 116.518 -126.385 1.00 31.53  ? 277  CYS C CA    1 
ATOM   9054  C C     . CYS C  1 277 ? 196.944 115.462 -125.295 1.00 30.90  ? 277  CYS C C     1 
ATOM   9055  O O     . CYS C  1 277 ? 196.060 115.145 -124.494 1.00 31.03  ? 277  CYS C O     1 
ATOM   9056  C CB    . CYS C  1 277 ? 195.467 117.373 -126.118 1.00 31.46  ? 277  CYS C CB    1 
ATOM   9057  S SG    . CYS C  1 277 ? 193.916 116.595 -126.557 1.00 32.88  ? 277  CYS C SG    1 
ATOM   9058  N N     . ILE C  1 278 ? 198.148 114.910 -125.275 1.00 29.93  ? 278  ILE C N     1 
ATOM   9059  C CA    . ILE C  1 278 ? 198.474 113.897 -124.301 1.00 30.13  ? 278  ILE C CA    1 
ATOM   9060  C C     . ILE C  1 278 ? 199.268 114.501 -123.159 1.00 30.32  ? 278  ILE C C     1 
ATOM   9061  O O     . ILE C  1 278 ? 199.932 113.794 -122.433 1.00 31.73  ? 278  ILE C O     1 
ATOM   9062  C CB    . ILE C  1 278 ? 199.285 112.760 -124.934 1.00 31.34  ? 278  ILE C CB    1 
ATOM   9063  C CG1   . ILE C  1 278 ? 200.599 113.305 -125.496 1.00 32.39  ? 278  ILE C CG1   1 
ATOM   9064  C CG2   . ILE C  1 278 ? 198.452 112.073 -126.011 1.00 28.99  ? 278  ILE C CG2   1 
ATOM   9065  C CD1   . ILE C  1 278 ? 201.611 112.228 -125.918 1.00 32.25  ? 278  ILE C CD1   1 
ATOM   9066  N N     . GLY C  1 279 ? 199.197 115.815 -123.001 1.00 31.22  ? 279  GLY C N     1 
ATOM   9067  C CA    . GLY C  1 279 ? 199.945 116.462 -121.933 1.00 32.77  ? 279  GLY C CA    1 
ATOM   9068  C C     . GLY C  1 279 ? 200.878 117.589 -122.378 1.00 33.16  ? 279  GLY C C     1 
ATOM   9069  O O     . GLY C  1 279 ? 201.005 117.892 -123.576 1.00 32.50  ? 279  GLY C O     1 
ATOM   9070  N N     . ARG C  1 280 ? 201.498 118.234 -121.395 1.00 33.67  ? 280  ARG C N     1 
ATOM   9071  C CA    . ARG C  1 280 ? 202.449 119.311 -121.634 1.00 34.42  ? 280  ARG C CA    1 
ATOM   9072  C C     . ARG C  1 280 ? 203.659 118.992 -120.779 1.00 35.75  ? 280  ARG C C     1 
ATOM   9073  O O     . ARG C  1 280 ? 203.578 118.168 -119.855 1.00 35.44  ? 280  ARG C O     1 
ATOM   9074  C CB    . ARG C  1 280 ? 201.855 120.672 -121.267 1.00 33.78  ? 280  ARG C CB    1 
ATOM   9075  C CG    . ARG C  1 280 ? 200.702 121.082 -122.181 1.00 35.93  ? 280  ARG C CG    1 
ATOM   9076  C CD    . ARG C  1 280 ? 200.190 122.485 -121.854 1.00 36.85  ? 280  ARG C CD    1 
ATOM   9077  N NE    . ARG C  1 280 ? 201.226 123.503 -122.064 1.00 37.74  ? 280  ARG C NE    1 
ATOM   9078  C CZ    . ARG C  1 280 ? 201.554 124.014 -123.249 1.00 38.54  ? 280  ARG C CZ    1 
ATOM   9079  N NH1   . ARG C  1 280 ? 200.930 123.621 -124.356 1.00 38.26  ? 280  ARG C NH1   1 
ATOM   9080  N NH2   . ARG C  1 280 ? 202.516 124.924 -123.336 1.00 38.33  ? 280  ARG C NH2   1 
ATOM   9081  N N     . ARG C  1 281 ? 204.792 119.617 -121.100 1.00 36.25  ? 281  ARG C N     1 
ATOM   9082  C CA    . ARG C  1 281 ? 206.021 119.353 -120.365 1.00 36.85  ? 281  ARG C CA    1 
ATOM   9083  C C     . ARG C  1 281 ? 206.886 120.615 -120.200 1.00 37.13  ? 281  ARG C C     1 
ATOM   9084  O O     . ARG C  1 281 ? 206.792 121.556 -120.991 1.00 36.12  ? 281  ARG C O     1 
ATOM   9085  C CB    . ARG C  1 281 ? 206.802 118.255 -121.085 1.00 37.45  ? 281  ARG C CB    1 
ATOM   9086  C CG    . ARG C  1 281 ? 207.209 118.655 -122.488 1.00 38.71  ? 281  ARG C CG    1 
ATOM   9087  C CD    . ARG C  1 281 ? 207.805 117.499 -123.262 1.00 39.38  ? 281  ARG C CD    1 
ATOM   9088  N NE    . ARG C  1 281 ? 208.369 117.963 -124.526 1.00 42.26  ? 281  ARG C NE    1 
ATOM   9089  C CZ    . ARG C  1 281 ? 209.041 117.194 -125.383 1.00 41.44  ? 281  ARG C CZ    1 
ATOM   9090  N NH1   . ARG C  1 281 ? 209.238 115.908 -125.126 1.00 40.34  ? 281  ARG C NH1   1 
ATOM   9091  N NH2   . ARG C  1 281 ? 209.545 117.727 -126.488 1.00 39.97  ? 281  ARG C NH2   1 
ATOM   9092  N N     . PRO C  1 282 ? 207.756 120.632 -119.174 1.00 38.36  ? 282  PRO C N     1 
ATOM   9093  C CA    . PRO C  1 282 ? 208.653 121.745 -118.852 1.00 39.66  ? 282  PRO C CA    1 
ATOM   9094  C C     . PRO C  1 282 ? 209.483 122.218 -120.034 1.00 40.91  ? 282  PRO C C     1 
ATOM   9095  O O     . PRO C  1 282 ? 210.050 121.407 -120.762 1.00 40.39  ? 282  PRO C O     1 
ATOM   9096  C CB    . PRO C  1 282 ? 209.546 121.169 -117.763 1.00 39.10  ? 282  PRO C CB    1 
ATOM   9097  C CG    . PRO C  1 282 ? 208.749 120.101 -117.180 1.00 40.40  ? 282  PRO C CG    1 
ATOM   9098  C CD    . PRO C  1 282 ? 208.095 119.461 -118.351 1.00 38.74  ? 282  PRO C CD    1 
ATOM   9099  N N     . PHE C  1 283 ? 209.556 123.529 -120.215 1.00 43.21  ? 283  PHE C N     1 
ATOM   9100  C CA    . PHE C  1 283 ? 210.358 124.082 -121.290 1.00 45.19  ? 283  PHE C CA    1 
ATOM   9101  C C     . PHE C  1 283 ? 211.550 124.826 -120.699 1.00 46.38  ? 283  PHE C C     1 
ATOM   9102  O O     . PHE C  1 283 ? 211.362 125.823 -119.993 1.00 46.62  ? 283  PHE C O     1 
ATOM   9103  C CB    . PHE C  1 283 ? 209.542 125.052 -122.130 1.00 46.42  ? 283  PHE C CB    1 
ATOM   9104  C CG    . PHE C  1 283 ? 210.280 125.567 -123.327 1.00 47.60  ? 283  PHE C CG    1 
ATOM   9105  C CD1   . PHE C  1 283 ? 210.362 124.804 -124.490 1.00 48.26  ? 283  PHE C CD1   1 
ATOM   9106  C CD2   . PHE C  1 283 ? 210.911 126.803 -123.287 1.00 47.92  ? 283  PHE C CD2   1 
ATOM   9107  C CE1   . PHE C  1 283 ? 211.064 125.269 -125.601 1.00 49.38  ? 283  PHE C CE1   1 
ATOM   9108  C CE2   . PHE C  1 283 ? 211.616 127.277 -124.394 1.00 49.40  ? 283  PHE C CE2   1 
ATOM   9109  C CZ    . PHE C  1 283 ? 211.691 126.508 -125.552 1.00 48.89  ? 283  PHE C CZ    1 
ATOM   9110  N N     . THR C  1 284 ? 212.758 124.331 -120.988 1.00 47.71  ? 284  THR C N     1 
ATOM   9111  C CA    . THR C  1 284 ? 214.011 124.924 -120.506 1.00 49.29  ? 284  THR C CA    1 
ATOM   9112  C C     . THR C  1 284 ? 215.094 124.952 -121.597 1.00 51.66  ? 284  THR C C     1 
ATOM   9113  O O     . THR C  1 284 ? 216.281 125.069 -121.286 1.00 51.29  ? 284  THR C O     1 
ATOM   9114  C CB    . THR C  1 284 ? 214.603 124.134 -119.308 1.00 48.10  ? 284  THR C CB    1 
ATOM   9115  O OG1   . THR C  1 284 ? 214.815 122.770 -119.692 1.00 47.17  ? 284  THR C OG1   1 
ATOM   9116  C CG2   . THR C  1 284 ? 213.685 124.188 -118.105 1.00 46.93  ? 284  THR C CG2   1 
ATOM   9117  N N     . LYS C  1 285 ? 214.689 124.847 -122.863 1.00 54.01  ? 285  LYS C N     1 
ATOM   9118  C CA    . LYS C  1 285 ? 215.635 124.842 -123.986 1.00 56.55  ? 285  LYS C CA    1 
ATOM   9119  C C     . LYS C  1 285 ? 216.496 126.113 -124.080 1.00 57.86  ? 285  LYS C C     1 
ATOM   9120  O O     . LYS C  1 285 ? 215.978 127.232 -124.072 1.00 57.28  ? 285  LYS C O     1 
ATOM   9121  C CB    . LYS C  1 285 ? 214.882 124.638 -125.309 1.00 56.65  ? 285  LYS C CB    1 
ATOM   9122  C CG    . LYS C  1 285 ? 215.743 124.170 -126.481 1.00 58.02  ? 285  LYS C CG    1 
ATOM   9123  C CD    . LYS C  1 285 ? 214.933 124.156 -127.782 1.00 59.77  ? 285  LYS C CD    1 
ATOM   9124  C CE    . LYS C  1 285 ? 215.678 123.472 -128.939 1.00 60.18  ? 285  LYS C CE    1 
ATOM   9125  N NZ    . LYS C  1 285 ? 215.717 121.980 -128.788 1.00 61.58  ? 285  LYS C NZ    1 
ATOM   9126  N N     . ASN C  1 286 ? 217.811 125.915 -124.169 1.00 60.08  ? 286  ASN C N     1 
ATOM   9127  C CA    . ASN C  1 286 ? 218.793 126.996 -124.290 1.00 61.97  ? 286  ASN C CA    1 
ATOM   9128  C C     . ASN C  1 286 ? 218.742 128.061 -123.209 1.00 62.50  ? 286  ASN C C     1 
ATOM   9129  O O     . ASN C  1 286 ? 218.959 129.244 -123.472 1.00 62.23  ? 286  ASN C O     1 
ATOM   9130  C CB    . ASN C  1 286 ? 218.669 127.654 -125.660 1.00 63.72  ? 286  ASN C CB    1 
ATOM   9131  C CG    . ASN C  1 286 ? 218.953 126.685 -126.781 1.00 65.41  ? 286  ASN C CG    1 
ATOM   9132  O OD1   . ASN C  1 286 ? 219.920 125.926 -126.722 1.00 67.05  ? 286  ASN C OD1   1 
ATOM   9133  N ND2   . ASN C  1 286 ? 218.116 126.701 -127.810 1.00 66.16  ? 286  ASN C ND2   1 
ATOM   9134  N N     . LEU C  1 287 ? 218.472 127.626 -121.984 1.00 63.09  ? 287  LEU C N     1 
ATOM   9135  C CA    . LEU C  1 287 ? 218.395 128.526 -120.847 1.00 63.44  ? 287  LEU C CA    1 
ATOM   9136  C C     . LEU C  1 287 ? 219.777 128.628 -120.195 1.00 63.74  ? 287  LEU C C     1 
ATOM   9137  O O     . LEU C  1 287 ? 220.079 129.601 -119.502 1.00 64.20  ? 287  LEU C O     1 
ATOM   9138  C CB    . LEU C  1 287 ? 217.369 127.987 -119.847 1.00 62.94  ? 287  LEU C CB    1 
ATOM   9139  C CG    . LEU C  1 287 ? 216.957 128.853 -118.656 1.00 62.44  ? 287  LEU C CG    1 
ATOM   9140  C CD1   . LEU C  1 287 ? 216.264 130.135 -119.135 1.00 61.91  ? 287  LEU C CD1   1 
ATOM   9141  C CD2   . LEU C  1 287 ? 216.034 128.030 -117.764 1.00 62.69  ? 287  LEU C CD2   1 
ATOM   9142  N N     . GLY C  1 288 ? 220.608 127.615 -120.425 1.00 63.98  ? 288  GLY C N     1 
ATOM   9143  C CA    . GLY C  1 288 ? 221.946 127.597 -119.863 1.00 64.61  ? 288  GLY C CA    1 
ATOM   9144  C C     . GLY C  1 288 ? 222.074 126.727 -118.628 1.00 65.15  ? 288  GLY C C     1 
ATOM   9145  O O     . GLY C  1 288 ? 223.077 126.798 -117.920 1.00 65.48  ? 288  GLY C O     1 
ATOM   9146  N N     . LEU C  1 289 ? 221.071 125.893 -118.370 1.00 64.94  ? 289  LEU C N     1 
ATOM   9147  C CA    . LEU C  1 289 ? 221.090 125.031 -117.197 1.00 65.30  ? 289  LEU C CA    1 
ATOM   9148  C C     . LEU C  1 289 ? 222.182 123.975 -117.213 1.00 66.09  ? 289  LEU C C     1 
ATOM   9149  O O     . LEU C  1 289 ? 222.729 123.637 -116.166 1.00 65.68  ? 289  LEU C O     1 
ATOM   9150  C CB    . LEU C  1 289 ? 219.727 124.360 -117.016 1.00 64.32  ? 289  LEU C CB    1 
ATOM   9151  C CG    . LEU C  1 289 ? 218.564 125.321 -116.753 1.00 64.67  ? 289  LEU C CG    1 
ATOM   9152  C CD1   . LEU C  1 289 ? 217.282 124.529 -116.550 1.00 64.10  ? 289  LEU C CD1   1 
ATOM   9153  C CD2   . LEU C  1 289 ? 218.868 126.171 -115.524 1.00 64.47  ? 289  LEU C CD2   1 
ATOM   9154  N N     . GLU C  1 290 ? 222.495 123.434 -118.384 1.00 68.00  ? 290  GLU C N     1 
ATOM   9155  C CA    . GLU C  1 290 ? 223.539 122.421 -118.447 1.00 70.28  ? 290  GLU C CA    1 
ATOM   9156  C C     . GLU C  1 290 ? 224.842 123.092 -118.047 1.00 70.86  ? 290  GLU C C     1 
ATOM   9157  O O     . GLU C  1 290 ? 225.683 122.494 -117.377 1.00 70.91  ? 290  GLU C O     1 
ATOM   9158  C CB    . GLU C  1 290 ? 223.664 121.827 -119.851 1.00 71.96  ? 290  GLU C CB    1 
ATOM   9159  C CG    . GLU C  1 290 ? 224.696 120.693 -119.921 1.00 75.28  ? 290  GLU C CG    1 
ATOM   9160  C CD    . GLU C  1 290 ? 224.794 120.035 -121.297 1.00 76.61  ? 290  GLU C CD    1 
ATOM   9161  O OE1   . GLU C  1 290 ? 225.113 120.731 -122.286 1.00 77.76  ? 290  GLU C OE1   1 
ATOM   9162  O OE2   . GLU C  1 290 ? 224.561 118.812 -121.387 1.00 77.30  ? 290  GLU C OE2   1 
ATOM   9163  N N     . GLU C  1 291 ? 224.986 124.352 -118.442 1.00 71.39  ? 291  GLU C N     1 
ATOM   9164  C CA    . GLU C  1 291 ? 226.178 125.123 -118.120 1.00 72.17  ? 291  GLU C CA    1 
ATOM   9165  C C     . GLU C  1 291 ? 226.317 125.362 -116.626 1.00 71.20  ? 291  GLU C C     1 
ATOM   9166  O O     . GLU C  1 291 ? 227.402 125.207 -116.063 1.00 71.12  ? 291  GLU C O     1 
ATOM   9167  C CB    . GLU C  1 291 ? 226.147 126.470 -118.845 1.00 74.57  ? 291  GLU C CB    1 
ATOM   9168  C CG    . GLU C  1 291 ? 226.232 126.342 -120.352 1.00 78.33  ? 291  GLU C CG    1 
ATOM   9169  C CD    . GLU C  1 291 ? 227.427 125.508 -120.781 1.00 80.86  ? 291  GLU C CD    1 
ATOM   9170  O OE1   . GLU C  1 291 ? 228.579 125.928 -120.501 1.00 82.14  ? 291  GLU C OE1   1 
ATOM   9171  O OE2   . GLU C  1 291 ? 227.212 124.428 -121.388 1.00 82.03  ? 291  GLU C OE2   1 
ATOM   9172  N N     . LEU C  1 292 ? 225.211 125.739 -115.992 1.00 69.60  ? 292  LEU C N     1 
ATOM   9173  C CA    . LEU C  1 292 ? 225.193 126.026 -114.566 1.00 68.40  ? 292  LEU C CA    1 
ATOM   9174  C C     . LEU C  1 292 ? 225.353 124.819 -113.655 1.00 67.29  ? 292  LEU C C     1 
ATOM   9175  O O     . LEU C  1 292 ? 225.761 124.963 -112.500 1.00 67.78  ? 292  LEU C O     1 
ATOM   9176  C CB    . LEU C  1 292 ? 223.898 126.745 -114.191 1.00 68.66  ? 292  LEU C CB    1 
ATOM   9177  C CG    . LEU C  1 292 ? 223.781 128.239 -114.476 1.00 69.36  ? 292  LEU C CG    1 
ATOM   9178  C CD1   . LEU C  1 292 ? 222.380 128.697 -114.097 1.00 69.43  ? 292  LEU C CD1   1 
ATOM   9179  C CD2   . LEU C  1 292 ? 224.842 129.013 -113.686 1.00 69.14  ? 292  LEU C CD2   1 
ATOM   9180  N N     . GLY C  1 293 ? 225.030 123.635 -114.155 1.00 65.63  ? 293  GLY C N     1 
ATOM   9181  C CA    . GLY C  1 293 ? 225.140 122.455 -113.319 1.00 64.34  ? 293  GLY C CA    1 
ATOM   9182  C C     . GLY C  1 293 ? 223.785 122.126 -112.725 1.00 63.56  ? 293  GLY C C     1 
ATOM   9183  O O     . GLY C  1 293 ? 223.659 121.274 -111.838 1.00 62.99  ? 293  GLY C O     1 
ATOM   9184  N N     . ILE C  1 294 ? 222.770 122.830 -113.216 1.00 62.50  ? 294  ILE C N     1 
ATOM   9185  C CA    . ILE C  1 294 ? 221.396 122.619 -112.790 1.00 61.56  ? 294  ILE C CA    1 
ATOM   9186  C C     . ILE C  1 294 ? 220.839 121.505 -113.674 1.00 61.03  ? 294  ILE C C     1 
ATOM   9187  O O     . ILE C  1 294 ? 220.469 121.733 -114.827 1.00 60.30  ? 294  ILE C O     1 
ATOM   9188  C CB    . ILE C  1 294 ? 220.550 123.900 -112.980 1.00 61.37  ? 294  ILE C CB    1 
ATOM   9189  C CG1   . ILE C  1 294 ? 221.063 125.006 -112.053 1.00 61.08  ? 294  ILE C CG1   1 
ATOM   9190  C CG2   . ILE C  1 294 ? 219.092 123.607 -112.690 1.00 60.77  ? 294  ILE C CG2   1 
ATOM   9191  C CD1   . ILE C  1 294 ? 220.347 126.342 -112.224 1.00 61.63  ? 294  ILE C CD1   1 
ATOM   9192  N N     . GLU C  1 295 ? 220.800 120.293 -113.134 1.00 61.17  ? 295  GLU C N     1 
ATOM   9193  C CA    . GLU C  1 295 ? 220.298 119.147 -113.883 1.00 61.57  ? 295  GLU C CA    1 
ATOM   9194  C C     . GLU C  1 295 ? 218.811 118.931 -113.601 1.00 59.85  ? 295  GLU C C     1 
ATOM   9195  O O     . GLU C  1 295 ? 218.342 119.135 -112.478 1.00 59.06  ? 295  GLU C O     1 
ATOM   9196  C CB    . GLU C  1 295 ? 221.087 117.887 -113.519 1.00 64.03  ? 295  GLU C CB    1 
ATOM   9197  C CG    . GLU C  1 295 ? 220.737 117.287 -112.162 1.00 67.88  ? 295  GLU C CG    1 
ATOM   9198  C CD    . GLU C  1 295 ? 221.848 116.398 -111.611 1.00 70.49  ? 295  GLU C CD    1 
ATOM   9199  O OE1   . GLU C  1 295 ? 222.342 115.520 -112.357 1.00 70.90  ? 295  GLU C OE1   1 
ATOM   9200  O OE2   . GLU C  1 295 ? 222.225 116.584 -110.427 1.00 72.00  ? 295  GLU C OE2   1 
ATOM   9201  N N     . LEU C  1 296 ? 218.089 118.503 -114.631 1.00 57.82  ? 296  LEU C N     1 
ATOM   9202  C CA    . LEU C  1 296 ? 216.655 118.269 -114.551 1.00 56.09  ? 296  LEU C CA    1 
ATOM   9203  C C     . LEU C  1 296 ? 216.314 116.881 -114.026 1.00 55.53  ? 296  LEU C C     1 
ATOM   9204  O O     . LEU C  1 296 ? 217.172 115.992 -114.013 1.00 55.60  ? 296  LEU C O     1 
ATOM   9205  C CB    . LEU C  1 296 ? 216.055 118.439 -115.938 1.00 55.21  ? 296  LEU C CB    1 
ATOM   9206  C CG    . LEU C  1 296 ? 216.434 119.754 -116.609 1.00 54.38  ? 296  LEU C CG    1 
ATOM   9207  C CD1   . LEU C  1 296 ? 216.006 119.720 -118.069 1.00 53.70  ? 296  LEU C CD1   1 
ATOM   9208  C CD2   . LEU C  1 296 ? 215.803 120.914 -115.856 1.00 53.28  ? 296  LEU C CD2   1 
ATOM   9209  N N     . ASP C  1 297 ? 215.069 116.697 -113.579 1.00 54.16  ? 297  ASP C N     1 
ATOM   9210  C CA    . ASP C  1 297 ? 214.650 115.386 -113.107 1.00 51.98  ? 297  ASP C CA    1 
ATOM   9211  C C     . ASP C  1 297 ? 214.318 114.609 -114.376 1.00 51.11  ? 297  ASP C C     1 
ATOM   9212  O O     . ASP C  1 297 ? 214.351 115.169 -115.470 1.00 49.21  ? 297  ASP C O     1 
ATOM   9213  C CB    . ASP C  1 297 ? 213.434 115.475 -112.159 1.00 51.66  ? 297  ASP C CB    1 
ATOM   9214  C CG    . ASP C  1 297 ? 212.131 115.859 -112.863 1.00 52.32  ? 297  ASP C CG    1 
ATOM   9215  O OD1   . ASP C  1 297 ? 212.096 116.029 -114.101 1.00 51.17  ? 297  ASP C OD1   1 
ATOM   9216  O OD2   . ASP C  1 297 ? 211.115 115.993 -112.151 1.00 51.80  ? 297  ASP C OD2   1 
ATOM   9217  N N     . PRO C  1 298 ? 214.003 113.310 -114.253 1.00 51.35  ? 298  PRO C N     1 
ATOM   9218  C CA    . PRO C  1 298 ? 213.680 112.519 -115.448 1.00 51.02  ? 298  PRO C CA    1 
ATOM   9219  C C     . PRO C  1 298 ? 212.588 113.096 -116.360 1.00 50.87  ? 298  PRO C C     1 
ATOM   9220  O O     . PRO C  1 298 ? 212.617 112.888 -117.574 1.00 51.34  ? 298  PRO C O     1 
ATOM   9221  C CB    . PRO C  1 298 ? 213.296 111.162 -114.861 1.00 51.42  ? 298  PRO C CB    1 
ATOM   9222  C CG    . PRO C  1 298 ? 214.214 111.063 -113.665 1.00 50.88  ? 298  PRO C CG    1 
ATOM   9223  C CD    . PRO C  1 298 ? 214.067 112.449 -113.057 1.00 51.05  ? 298  PRO C CD    1 
ATOM   9224  N N     . ARG C  1 299 ? 211.633 113.824 -115.783 1.00 50.12  ? 299  ARG C N     1 
ATOM   9225  C CA    . ARG C  1 299 ? 210.540 114.397 -116.564 1.00 48.29  ? 299  ARG C CA    1 
ATOM   9226  C C     . ARG C  1 299 ? 210.824 115.797 -117.108 1.00 46.31  ? 299  ARG C C     1 
ATOM   9227  O O     . ARG C  1 299 ? 209.933 116.479 -117.608 1.00 45.51  ? 299  ARG C O     1 
ATOM   9228  C CB    . ARG C  1 299 ? 209.261 114.372 -115.724 1.00 49.70  ? 299  ARG C CB    1 
ATOM   9229  C CG    . ARG C  1 299 ? 208.742 112.945 -115.516 1.00 52.42  ? 299  ARG C CG    1 
ATOM   9230  C CD    . ARG C  1 299 ? 207.911 112.782 -114.246 1.00 54.06  ? 299  ARG C CD    1 
ATOM   9231  N NE    . ARG C  1 299 ? 206.669 113.546 -114.289 1.00 54.56  ? 299  ARG C NE    1 
ATOM   9232  C CZ    . ARG C  1 299 ? 205.797 113.607 -113.288 1.00 55.54  ? 299  ARG C CZ    1 
ATOM   9233  N NH1   . ARG C  1 299 ? 206.028 112.944 -112.159 1.00 54.38  ? 299  ARG C NH1   1 
ATOM   9234  N NH2   . ARG C  1 299 ? 204.697 114.341 -113.416 1.00 56.33  ? 299  ARG C NH2   1 
ATOM   9235  N N     . GLY C  1 300 ? 212.084 116.209 -117.019 1.00 44.61  ? 300  GLY C N     1 
ATOM   9236  C CA    . GLY C  1 300 ? 212.485 117.508 -117.530 1.00 42.88  ? 300  GLY C CA    1 
ATOM   9237  C C     . GLY C  1 300 ? 212.249 118.704 -116.627 1.00 43.17  ? 300  GLY C C     1 
ATOM   9238  O O     . GLY C  1 300 ? 212.380 119.848 -117.063 1.00 42.27  ? 300  GLY C O     1 
ATOM   9239  N N     . ARG C  1 301 ? 211.923 118.462 -115.366 1.00 42.90  ? 301  ARG C N     1 
ATOM   9240  C CA    . ARG C  1 301 ? 211.663 119.574 -114.465 1.00 44.02  ? 301  ARG C CA    1 
ATOM   9241  C C     . ARG C  1 301 ? 212.870 120.025 -113.657 1.00 43.15  ? 301  ARG C C     1 
ATOM   9242  O O     . ARG C  1 301 ? 213.778 119.245 -113.390 1.00 43.27  ? 301  ARG C O     1 
ATOM   9243  C CB    . ARG C  1 301 ? 210.492 119.209 -113.557 1.00 44.30  ? 301  ARG C CB    1 
ATOM   9244  C CG    . ARG C  1 301 ? 209.299 118.822 -114.403 1.00 46.31  ? 301  ARG C CG    1 
ATOM   9245  C CD    . ARG C  1 301 ? 208.210 118.227 -113.617 1.00 47.08  ? 301  ARG C CD    1 
ATOM   9246  N NE    . ARG C  1 301 ? 208.671 117.099 -112.830 1.00 47.06  ? 301  ARG C NE    1 
ATOM   9247  C CZ    . ARG C  1 301 ? 207.862 116.389 -112.061 1.00 47.53  ? 301  ARG C CZ    1 
ATOM   9248  N NH1   . ARG C  1 301 ? 206.576 116.708 -112.015 1.00 46.72  ? 301  ARG C NH1   1 
ATOM   9249  N NH2   . ARG C  1 301 ? 208.333 115.392 -111.320 1.00 48.51  ? 301  ARG C NH2   1 
ATOM   9250  N N     . ILE C  1 302 ? 212.875 121.311 -113.309 1.00 43.65  ? 302  ILE C N     1 
ATOM   9251  C CA    . ILE C  1 302 ? 213.948 121.907 -112.520 1.00 43.70  ? 302  ILE C CA    1 
ATOM   9252  C C     . ILE C  1 302 ? 213.712 121.615 -111.047 1.00 44.63  ? 302  ILE C C     1 
ATOM   9253  O O     . ILE C  1 302 ? 212.742 122.098 -110.462 1.00 44.68  ? 302  ILE C O     1 
ATOM   9254  C CB    . ILE C  1 302 ? 213.982 123.435 -112.662 1.00 42.00  ? 302  ILE C CB    1 
ATOM   9255  C CG1   . ILE C  1 302 ? 214.251 123.837 -114.110 1.00 41.47  ? 302  ILE C CG1   1 
ATOM   9256  C CG2   . ILE C  1 302 ? 215.031 123.992 -111.734 1.00 42.92  ? 302  ILE C CG2   1 
ATOM   9257  C CD1   . ILE C  1 302 ? 214.200 125.324 -114.346 1.00 39.01  ? 302  ILE C CD1   1 
ATOM   9258  N N     . PRO C  1 303 ? 214.603 120.833 -110.419 1.00 45.56  ? 303  PRO C N     1 
ATOM   9259  C CA    . PRO C  1 303 ? 214.417 120.530 -108.998 1.00 46.01  ? 303  PRO C CA    1 
ATOM   9260  C C     . PRO C  1 303 ? 214.579 121.800 -108.160 1.00 46.62  ? 303  PRO C C     1 
ATOM   9261  O O     . PRO C  1 303 ? 215.466 122.613 -108.425 1.00 45.99  ? 303  PRO C O     1 
ATOM   9262  C CB    . PRO C  1 303 ? 215.537 119.515 -108.703 1.00 46.54  ? 303  PRO C CB    1 
ATOM   9263  C CG    . PRO C  1 303 ? 215.847 118.914 -110.058 1.00 45.94  ? 303  PRO C CG    1 
ATOM   9264  C CD    . PRO C  1 303 ? 215.775 120.122 -110.962 1.00 44.76  ? 303  PRO C CD    1 
ATOM   9265  N N     . VAL C  1 304 ? 213.719 121.977 -107.160 1.00 47.40  ? 304  VAL C N     1 
ATOM   9266  C CA    . VAL C  1 304 ? 213.798 123.137 -106.267 1.00 46.83  ? 304  VAL C CA    1 
ATOM   9267  C C     . VAL C  1 304 ? 213.337 122.726 -104.878 1.00 47.46  ? 304  VAL C C     1 
ATOM   9268  O O     . VAL C  1 304 ? 212.639 121.720 -104.720 1.00 46.02  ? 304  VAL C O     1 
ATOM   9269  C CB    . VAL C  1 304 ? 212.898 124.310 -106.729 1.00 47.49  ? 304  VAL C CB    1 
ATOM   9270  C CG1   . VAL C  1 304 ? 213.363 124.837 -108.071 1.00 46.80  ? 304  VAL C CG1   1 
ATOM   9271  C CG2   . VAL C  1 304 ? 211.436 123.861 -106.791 1.00 47.48  ? 304  VAL C CG2   1 
ATOM   9272  N N     . ASN C  1 305 ? 213.724 123.504 -103.873 1.00 47.37  ? 305  ASN C N     1 
ATOM   9273  C CA    . ASN C  1 305 ? 213.313 123.204 -102.513 1.00 48.54  ? 305  ASN C CA    1 
ATOM   9274  C C     . ASN C  1 305 ? 212.015 123.948 -102.139 1.00 48.90  ? 305  ASN C C     1 
ATOM   9275  O O     . ASN C  1 305 ? 211.294 124.466 -103.009 1.00 49.67  ? 305  ASN C O     1 
ATOM   9276  C CB    . ASN C  1 305 ? 214.431 123.563 -101.529 1.00 49.03  ? 305  ASN C CB    1 
ATOM   9277  C CG    . ASN C  1 305 ? 214.758 125.051 -101.525 1.00 49.39  ? 305  ASN C CG    1 
ATOM   9278  O OD1   . ASN C  1 305 ? 213.905 125.905 -101.791 1.00 47.27  ? 305  ASN C OD1   1 
ATOM   9279  N ND2   . ASN C  1 305 ? 216.000 125.367 -101.197 1.00 50.80  ? 305  ASN C ND2   1 
ATOM   9280  N N     . THR C  1 306 ? 211.731 124.008 -100.842 1.00 48.47  ? 306  THR C N     1 
ATOM   9281  C CA    . THR C  1 306 ? 210.525 124.658 -100.332 1.00 48.17  ? 306  THR C CA    1 
ATOM   9282  C C     . THR C  1 306 ? 210.414 126.152 -100.606 1.00 47.05  ? 306  THR C C     1 
ATOM   9283  O O     . THR C  1 306 ? 209.316 126.703 -100.604 1.00 46.37  ? 306  THR C O     1 
ATOM   9284  C CB    . THR C  1 306 ? 210.398 124.454 -98.818  1.00 48.93  ? 306  THR C CB    1 
ATOM   9285  O OG1   . THR C  1 306 ? 211.652 124.769 -98.194  1.00 51.52  ? 306  THR C OG1   1 
ATOM   9286  C CG2   . THR C  1 306 ? 210.012 123.022 -98.507  1.00 49.41  ? 306  THR C CG2   1 
ATOM   9287  N N     . ARG C  1 307 ? 211.548 126.808 -100.826 1.00 46.01  ? 307  ARG C N     1 
ATOM   9288  C CA    . ARG C  1 307 ? 211.551 128.237 -101.095 1.00 44.59  ? 307  ARG C CA    1 
ATOM   9289  C C     . ARG C  1 307 ? 211.643 128.486 -102.602 1.00 44.46  ? 307  ARG C C     1 
ATOM   9290  O O     . ARG C  1 307 ? 211.770 129.629 -103.055 1.00 43.24  ? 307  ARG C O     1 
ATOM   9291  C CB    . ARG C  1 307 ? 212.729 128.892 -100.365 1.00 44.11  ? 307  ARG C CB    1 
ATOM   9292  C CG    . ARG C  1 307 ? 212.723 128.646 -98.860  1.00 43.68  ? 307  ARG C CG    1 
ATOM   9293  C CD    . ARG C  1 307 ? 213.874 129.365 -98.172  1.00 44.46  ? 307  ARG C CD    1 
ATOM   9294  N NE    . ARG C  1 307 ? 213.736 130.818 -98.298  1.00 43.95  ? 307  ARG C NE    1 
ATOM   9295  C CZ    . ARG C  1 307 ? 212.877 131.546 -97.593  1.00 44.79  ? 307  ARG C CZ    1 
ATOM   9296  N NH1   . ARG C  1 307 ? 212.081 130.954 -96.699  1.00 45.04  ? 307  ARG C NH1   1 
ATOM   9297  N NH2   . ARG C  1 307 ? 212.789 132.857 -97.796  1.00 44.13  ? 307  ARG C NH2   1 
ATOM   9298  N N     . PHE C  1 308 ? 211.571 127.399 -103.368 1.00 44.68  ? 308  PHE C N     1 
ATOM   9299  C CA    . PHE C  1 308 ? 211.650 127.444 -104.827 1.00 45.57  ? 308  PHE C CA    1 
ATOM   9300  C C     . PHE C  1 308 ? 213.056 127.771 -105.366 1.00 46.44  ? 308  PHE C C     1 
ATOM   9301  O O     . PHE C  1 308 ? 213.230 128.263 -106.491 1.00 45.12  ? 308  PHE C O     1 
ATOM   9302  C CB    . PHE C  1 308 ? 210.586 128.401 -105.368 1.00 44.13  ? 308  PHE C CB    1 
ATOM   9303  C CG    . PHE C  1 308 ? 209.195 127.887 -105.177 1.00 44.22  ? 308  PHE C CG    1 
ATOM   9304  C CD1   . PHE C  1 308 ? 208.698 126.867 -106.000 1.00 43.42  ? 308  PHE C CD1   1 
ATOM   9305  C CD2   . PHE C  1 308 ? 208.410 128.344 -104.121 1.00 43.63  ? 308  PHE C CD2   1 
ATOM   9306  C CE1   . PHE C  1 308 ? 207.443 126.304 -105.774 1.00 43.20  ? 308  PHE C CE1   1 
ATOM   9307  C CE2   . PHE C  1 308 ? 207.141 127.786 -103.879 1.00 43.06  ? 308  PHE C CE2   1 
ATOM   9308  C CZ    . PHE C  1 308 ? 206.659 126.763 -104.706 1.00 43.70  ? 308  PHE C CZ    1 
ATOM   9309  N N     . GLN C  1 309 ? 214.057 127.446 -104.552 1.00 48.14  ? 309  GLN C N     1 
ATOM   9310  C CA    . GLN C  1 309 ? 215.458 127.653 -104.904 1.00 49.90  ? 309  GLN C CA    1 
ATOM   9311  C C     . GLN C  1 309 ? 215.987 126.433 -105.653 1.00 49.96  ? 309  GLN C C     1 
ATOM   9312  O O     . GLN C  1 309 ? 215.641 125.300 -105.320 1.00 49.70  ? 309  GLN C O     1 
ATOM   9313  C CB    . GLN C  1 309 ? 216.310 127.833 -103.638 1.00 50.31  ? 309  GLN C CB    1 
ATOM   9314  C CG    . GLN C  1 309 ? 216.181 129.164 -102.919 1.00 51.69  ? 309  GLN C CG    1 
ATOM   9315  C CD    . GLN C  1 309 ? 217.056 129.226 -101.671 1.00 53.19  ? 309  GLN C CD    1 
ATOM   9316  O OE1   . GLN C  1 309 ? 216.818 128.504 -100.698 1.00 52.60  ? 309  GLN C OE1   1 
ATOM   9317  N NE2   . GLN C  1 309 ? 218.078 130.081 -101.699 1.00 52.88  ? 309  GLN C NE2   1 
ATOM   9318  N N     . THR C  1 310 ? 216.830 126.664 -106.653 1.00 51.02  ? 310  THR C N     1 
ATOM   9319  C CA    . THR C  1 310 ? 217.434 125.559 -107.387 1.00 52.93  ? 310  THR C CA    1 
ATOM   9320  C C     . THR C  1 310 ? 218.716 125.125 -106.655 1.00 54.57  ? 310  THR C C     1 
ATOM   9321  O O     . THR C  1 310 ? 218.878 125.388 -105.458 1.00 54.25  ? 310  THR C O     1 
ATOM   9322  C CB    . THR C  1 310 ? 217.815 125.968 -108.809 1.00 52.30  ? 310  THR C CB    1 
ATOM   9323  O OG1   . THR C  1 310 ? 218.915 126.880 -108.759 1.00 52.52  ? 310  THR C OG1   1 
ATOM   9324  C CG2   . THR C  1 310 ? 216.641 126.638 -109.498 1.00 52.72  ? 310  THR C CG2   1 
ATOM   9325  N N     . LYS C  1 311 ? 219.622 124.463 -107.369 1.00 55.95  ? 311  LYS C N     1 
ATOM   9326  C CA    . LYS C  1 311 ? 220.869 124.022 -106.759 1.00 57.46  ? 311  LYS C CA    1 
ATOM   9327  C C     . LYS C  1 311 ? 221.677 125.277 -106.433 1.00 57.39  ? 311  LYS C C     1 
ATOM   9328  O O     . LYS C  1 311 ? 222.413 125.312 -105.453 1.00 57.64  ? 311  LYS C O     1 
ATOM   9329  C CB    . LYS C  1 311 ? 221.652 123.120 -107.722 1.00 58.72  ? 311  LYS C CB    1 
ATOM   9330  C CG    . LYS C  1 311 ? 222.564 122.132 -107.009 1.00 60.99  ? 311  LYS C CG    1 
ATOM   9331  C CD    . LYS C  1 311 ? 223.244 121.185 -107.983 1.00 63.01  ? 311  LYS C CD    1 
ATOM   9332  C CE    . LYS C  1 311 ? 223.940 120.035 -107.243 1.00 64.25  ? 311  LYS C CE    1 
ATOM   9333  N NZ    . LYS C  1 311 ? 224.494 118.974 -108.160 1.00 64.54  ? 311  LYS C NZ    1 
ATOM   9334  N N     . ILE C  1 312 ? 221.507 126.310 -107.254 1.00 57.39  ? 312  ILE C N     1 
ATOM   9335  C CA    . ILE C  1 312 ? 222.200 127.590 -107.087 1.00 57.10  ? 312  ILE C CA    1 
ATOM   9336  C C     . ILE C  1 312 ? 221.275 128.531 -106.296 1.00 56.66  ? 312  ILE C C     1 
ATOM   9337  O O     . ILE C  1 312 ? 220.298 129.053 -106.834 1.00 56.69  ? 312  ILE C O     1 
ATOM   9338  C CB    . ILE C  1 312 ? 222.535 128.178 -108.478 1.00 57.12  ? 312  ILE C CB    1 
ATOM   9339  C CG1   . ILE C  1 312 ? 223.229 127.103 -109.318 1.00 57.19  ? 312  ILE C CG1   1 
ATOM   9340  C CG2   . ILE C  1 312 ? 223.429 129.404 -108.346 1.00 57.35  ? 312  ILE C CG2   1 
ATOM   9341  C CD1   . ILE C  1 312 ? 223.446 127.493 -110.765 1.00 59.00  ? 312  ILE C CD1   1 
ATOM   9342  N N     . PRO C  1 313 ? 221.595 128.775 -105.008 1.00 56.34  ? 313  PRO C N     1 
ATOM   9343  C CA    . PRO C  1 313 ? 220.878 129.613 -104.033 1.00 55.46  ? 313  PRO C CA    1 
ATOM   9344  C C     . PRO C  1 313 ? 220.142 130.882 -104.473 1.00 54.33  ? 313  PRO C C     1 
ATOM   9345  O O     . PRO C  1 313 ? 219.115 131.236 -103.878 1.00 53.92  ? 313  PRO C O     1 
ATOM   9346  C CB    . PRO C  1 313 ? 221.953 129.912 -102.985 1.00 56.86  ? 313  PRO C CB    1 
ATOM   9347  C CG    . PRO C  1 313 ? 222.762 128.667 -102.992 1.00 56.66  ? 313  PRO C CG    1 
ATOM   9348  C CD    . PRO C  1 313 ? 222.930 128.430 -104.479 1.00 56.75  ? 313  PRO C CD    1 
ATOM   9349  N N     . ASN C  1 314 ? 220.649 131.569 -105.491 1.00 52.60  ? 314  ASN C N     1 
ATOM   9350  C CA    . ASN C  1 314 ? 220.011 132.805 -105.940 1.00 51.94  ? 314  ASN C CA    1 
ATOM   9351  C C     . ASN C  1 314 ? 219.207 132.618 -107.223 1.00 51.04  ? 314  ASN C C     1 
ATOM   9352  O O     . ASN C  1 314 ? 218.699 133.591 -107.788 1.00 50.14  ? 314  ASN C O     1 
ATOM   9353  C CB    . ASN C  1 314 ? 221.064 133.876 -106.179 1.00 52.61  ? 314  ASN C CB    1 
ATOM   9354  C CG    . ASN C  1 314 ? 221.932 133.563 -107.381 1.00 53.44  ? 314  ASN C CG    1 
ATOM   9355  O OD1   . ASN C  1 314 ? 222.394 132.429 -107.541 1.00 53.97  ? 314  ASN C OD1   1 
ATOM   9356  N ND2   . ASN C  1 314 ? 222.160 134.564 -108.234 1.00 52.17  ? 314  ASN C ND2   1 
ATOM   9357  N N     . ILE C  1 315 ? 219.117 131.378 -107.693 1.00 50.80  ? 315  ILE C N     1 
ATOM   9358  C CA    . ILE C  1 315 ? 218.368 131.080 -108.915 1.00 51.05  ? 315  ILE C CA    1 
ATOM   9359  C C     . ILE C  1 315 ? 217.143 130.229 -108.538 1.00 50.21  ? 315  ILE C C     1 
ATOM   9360  O O     . ILE C  1 315 ? 217.266 129.155 -107.936 1.00 49.64  ? 315  ILE C O     1 
ATOM   9361  C CB    . ILE C  1 315 ? 219.276 130.355 -109.966 1.00 51.18  ? 315  ILE C CB    1 
ATOM   9362  C CG1   . ILE C  1 315 ? 220.482 131.249 -110.296 1.00 51.62  ? 315  ILE C CG1   1 
ATOM   9363  C CG2   . ILE C  1 315 ? 218.503 130.071 -111.255 1.00 50.68  ? 315  ILE C CG2   1 
ATOM   9364  C CD1   . ILE C  1 315 ? 221.339 130.751 -111.447 1.00 50.92  ? 315  ILE C CD1   1 
ATOM   9365  N N     . TYR C  1 316 ? 215.961 130.735 -108.882 1.00 49.20  ? 316  TYR C N     1 
ATOM   9366  C CA    . TYR C  1 316 ? 214.706 130.060 -108.558 1.00 47.74  ? 316  TYR C CA    1 
ATOM   9367  C C     . TYR C  1 316 ? 213.940 129.625 -109.803 1.00 46.01  ? 316  TYR C C     1 
ATOM   9368  O O     . TYR C  1 316 ? 214.223 130.083 -110.914 1.00 45.03  ? 316  TYR C O     1 
ATOM   9369  C CB    . TYR C  1 316 ? 213.788 130.985 -107.749 1.00 47.55  ? 316  TYR C CB    1 
ATOM   9370  C CG    . TYR C  1 316 ? 214.371 131.560 -106.481 1.00 49.05  ? 316  TYR C CG    1 
ATOM   9371  C CD1   . TYR C  1 316 ? 215.390 132.530 -106.522 1.00 49.17  ? 316  TYR C CD1   1 
ATOM   9372  C CD2   . TYR C  1 316 ? 213.867 131.183 -105.235 1.00 48.49  ? 316  TYR C CD2   1 
ATOM   9373  C CE1   . TYR C  1 316 ? 215.887 133.108 -105.341 1.00 49.67  ? 316  TYR C CE1   1 
ATOM   9374  C CE2   . TYR C  1 316 ? 214.349 131.754 -104.057 1.00 48.56  ? 316  TYR C CE2   1 
ATOM   9375  C CZ    . TYR C  1 316 ? 215.357 132.714 -104.112 1.00 49.25  ? 316  TYR C CZ    1 
ATOM   9376  O OH    . TYR C  1 316 ? 215.839 133.266 -102.944 1.00 49.35  ? 316  TYR C OH    1 
ATOM   9377  N N     . ALA C  1 317 ? 212.964 128.744 -109.593 1.00 43.57  ? 317  ALA C N     1 
ATOM   9378  C CA    . ALA C  1 317 ? 212.098 128.239 -110.665 1.00 41.67  ? 317  ALA C CA    1 
ATOM   9379  C C     . ALA C  1 317 ? 210.699 128.009 -110.105 1.00 41.08  ? 317  ALA C C     1 
ATOM   9380  O O     . ALA C  1 317 ? 210.534 127.476 -109.007 1.00 41.37  ? 317  ALA C O     1 
ATOM   9381  C CB    . ALA C  1 317 ? 212.642 126.939 -111.226 1.00 40.86  ? 317  ALA C CB    1 
ATOM   9382  N N     . ILE C  1 318 ? 209.688 128.412 -110.864 1.00 40.29  ? 318  ILE C N     1 
ATOM   9383  C CA    . ILE C  1 318 ? 208.309 128.244 -110.439 1.00 38.40  ? 318  ILE C CA    1 
ATOM   9384  C C     . ILE C  1 318 ? 207.453 127.926 -111.663 1.00 37.33  ? 318  ILE C C     1 
ATOM   9385  O O     . ILE C  1 318 ? 207.895 128.108 -112.810 1.00 36.80  ? 318  ILE C O     1 
ATOM   9386  C CB    . ILE C  1 318 ? 207.743 129.549 -109.844 1.00 38.87  ? 318  ILE C CB    1 
ATOM   9387  C CG1   . ILE C  1 318 ? 207.818 130.641 -110.917 1.00 39.30  ? 318  ILE C CG1   1 
ATOM   9388  C CG2   . ILE C  1 318 ? 208.506 129.957 -108.603 1.00 37.66  ? 318  ILE C CG2   1 
ATOM   9389  C CD1   . ILE C  1 318 ? 207.064 131.878 -110.593 1.00 41.73  ? 318  ILE C CD1   1 
ATOM   9390  N N     . GLY C  1 319 ? 206.224 127.480 -111.399 1.00 34.82  ? 319  GLY C N     1 
ATOM   9391  C CA    . GLY C  1 319 ? 205.267 127.198 -112.459 1.00 33.13  ? 319  GLY C CA    1 
ATOM   9392  C C     . GLY C  1 319 ? 205.388 125.863 -113.154 1.00 31.04  ? 319  GLY C C     1 
ATOM   9393  O O     . GLY C  1 319 ? 205.797 124.873 -112.550 1.00 28.80  ? 319  GLY C O     1 
ATOM   9394  N N     . ASP C  1 320 ? 205.040 125.861 -114.437 1.00 31.20  ? 320  ASP C N     1 
ATOM   9395  C CA    . ASP C  1 320 ? 205.078 124.655 -115.248 1.00 33.03  ? 320  ASP C CA    1 
ATOM   9396  C C     . ASP C  1 320 ? 206.445 124.058 -115.406 1.00 33.71  ? 320  ASP C C     1 
ATOM   9397  O O     . ASP C  1 320 ? 206.557 122.928 -115.865 1.00 34.80  ? 320  ASP C O     1 
ATOM   9398  C CB    . ASP C  1 320 ? 204.498 124.921 -116.642 1.00 32.49  ? 320  ASP C CB    1 
ATOM   9399  C CG    . ASP C  1 320 ? 202.964 124.933 -116.654 1.00 32.08  ? 320  ASP C CG    1 
ATOM   9400  O OD1   . ASP C  1 320 ? 202.343 124.925 -115.571 1.00 30.10  ? 320  ASP C OD1   1 
ATOM   9401  O OD2   . ASP C  1 320 ? 202.378 124.973 -117.761 1.00 31.18  ? 320  ASP C OD2   1 
ATOM   9402  N N     . VAL C  1 321 ? 207.486 124.803 -115.037 1.00 35.15  ? 321  VAL C N     1 
ATOM   9403  C CA    . VAL C  1 321 ? 208.854 124.291 -115.165 1.00 35.95  ? 321  VAL C CA    1 
ATOM   9404  C C     . VAL C  1 321 ? 209.266 123.426 -113.974 1.00 35.15  ? 321  VAL C C     1 
ATOM   9405  O O     . VAL C  1 321 ? 210.237 122.692 -114.021 1.00 35.91  ? 321  VAL C O     1 
ATOM   9406  C CB    . VAL C  1 321 ? 209.859 125.454 -115.370 1.00 37.83  ? 321  VAL C CB    1 
ATOM   9407  C CG1   . VAL C  1 321 ? 210.581 125.780 -114.069 1.00 37.29  ? 321  VAL C CG1   1 
ATOM   9408  C CG2   . VAL C  1 321 ? 210.827 125.095 -116.497 1.00 37.49  ? 321  VAL C CG2   1 
ATOM   9409  N N     . VAL C  1 322 ? 208.508 123.505 -112.895 1.00 36.39  ? 322  VAL C N     1 
ATOM   9410  C CA    . VAL C  1 322 ? 208.800 122.681 -111.736 1.00 36.35  ? 322  VAL C CA    1 
ATOM   9411  C C     . VAL C  1 322 ? 207.675 121.653 -111.538 1.00 37.10  ? 322  VAL C C     1 
ATOM   9412  O O     . VAL C  1 322 ? 206.738 121.588 -112.336 1.00 36.56  ? 322  VAL C O     1 
ATOM   9413  C CB    . VAL C  1 322 ? 208.955 123.551 -110.483 1.00 37.21  ? 322  VAL C CB    1 
ATOM   9414  C CG1   . VAL C  1 322 ? 210.193 124.437 -110.643 1.00 37.13  ? 322  VAL C CG1   1 
ATOM   9415  C CG2   . VAL C  1 322 ? 207.714 124.433 -110.291 1.00 35.59  ? 322  VAL C CG2   1 
ATOM   9416  N N     . ALA C  1 323 ? 207.778 120.854 -110.480 1.00 37.40  ? 323  ALA C N     1 
ATOM   9417  C CA    . ALA C  1 323 ? 206.794 119.823 -110.170 1.00 37.64  ? 323  ALA C CA    1 
ATOM   9418  C C     . ALA C  1 323 ? 205.473 120.407 -109.636 1.00 37.40  ? 323  ALA C C     1 
ATOM   9419  O O     . ALA C  1 323 ? 205.393 121.590 -109.317 1.00 37.06  ? 323  ALA C O     1 
ATOM   9420  C CB    . ALA C  1 323 ? 207.391 118.846 -109.153 1.00 37.12  ? 323  ALA C CB    1 
ATOM   9421  N N     . GLY C  1 324 ? 204.446 119.560 -109.548 1.00 37.33  ? 324  GLY C N     1 
ATOM   9422  C CA    . GLY C  1 324 ? 203.153 119.990 -109.043 1.00 35.75  ? 324  GLY C CA    1 
ATOM   9423  C C     . GLY C  1 324 ? 202.192 120.143 -110.195 1.00 35.47  ? 324  GLY C C     1 
ATOM   9424  O O     . GLY C  1 324 ? 202.617 120.073 -111.342 1.00 36.03  ? 324  GLY C O     1 
ATOM   9425  N N     . PRO C  1 325 ? 200.897 120.372 -109.936 1.00 34.84  ? 325  PRO C N     1 
ATOM   9426  C CA    . PRO C  1 325 ? 199.958 120.520 -111.048 1.00 33.93  ? 325  PRO C CA    1 
ATOM   9427  C C     . PRO C  1 325 ? 200.315 121.675 -111.978 1.00 33.12  ? 325  PRO C C     1 
ATOM   9428  O O     . PRO C  1 325 ? 200.618 122.784 -111.530 1.00 30.39  ? 325  PRO C O     1 
ATOM   9429  C CB    . PRO C  1 325 ? 198.613 120.726 -110.345 1.00 35.51  ? 325  PRO C CB    1 
ATOM   9430  C CG    . PRO C  1 325 ? 198.998 121.432 -109.086 1.00 36.36  ? 325  PRO C CG    1 
ATOM   9431  C CD    . PRO C  1 325 ? 200.238 120.657 -108.648 1.00 35.51  ? 325  PRO C CD    1 
ATOM   9432  N N     . MET C  1 326 ? 200.264 121.403 -113.280 1.00 31.54  ? 326  MET C N     1 
ATOM   9433  C CA    . MET C  1 326 ? 200.575 122.403 -114.292 1.00 31.10  ? 326  MET C CA    1 
ATOM   9434  C C     . MET C  1 326 ? 199.342 123.230 -114.579 1.00 31.48  ? 326  MET C C     1 
ATOM   9435  O O     . MET C  1 326 ? 198.667 123.055 -115.591 1.00 32.94  ? 326  MET C O     1 
ATOM   9436  C CB    . MET C  1 326 ? 201.081 121.712 -115.546 1.00 31.38  ? 326  MET C CB    1 
ATOM   9437  C CG    . MET C  1 326 ? 202.367 120.929 -115.299 1.00 32.69  ? 326  MET C CG    1 
ATOM   9438  S SD    . MET C  1 326 ? 202.969 120.014 -116.784 1.00 36.82  ? 326  MET C SD    1 
ATOM   9439  C CE    . MET C  1 326 ? 203.646 121.431 -117.715 1.00 31.43  ? 326  MET C CE    1 
ATOM   9440  N N     . LEU C  1 327 ? 199.062 124.142 -113.658 1.00 32.21  ? 327  LEU C N     1 
ATOM   9441  C CA    . LEU C  1 327 ? 197.900 125.017 -113.709 1.00 32.23  ? 327  LEU C CA    1 
ATOM   9442  C C     . LEU C  1 327 ? 198.368 126.464 -113.554 1.00 32.97  ? 327  LEU C C     1 
ATOM   9443  O O     . LEU C  1 327 ? 199.390 126.728 -112.907 1.00 33.81  ? 327  LEU C O     1 
ATOM   9444  C CB    . LEU C  1 327 ? 196.931 124.643 -112.573 1.00 30.27  ? 327  LEU C CB    1 
ATOM   9445  C CG    . LEU C  1 327 ? 196.395 123.210 -112.657 1.00 31.47  ? 327  LEU C CG    1 
ATOM   9446  C CD1   . LEU C  1 327 ? 195.576 122.840 -111.409 1.00 29.75  ? 327  LEU C CD1   1 
ATOM   9447  C CD2   . LEU C  1 327 ? 195.539 123.105 -113.924 1.00 29.10  ? 327  LEU C CD2   1 
ATOM   9448  N N     . ALA C  1 328 ? 197.617 127.390 -114.141 1.00 32.94  ? 328  ALA C N     1 
ATOM   9449  C CA    . ALA C  1 328 ? 197.972 128.806 -114.084 1.00 33.04  ? 328  ALA C CA    1 
ATOM   9450  C C     . ALA C  1 328 ? 197.931 129.371 -112.660 1.00 33.09  ? 328  ALA C C     1 
ATOM   9451  O O     . ALA C  1 328 ? 198.881 130.051 -112.236 1.00 32.27  ? 328  ALA C O     1 
ATOM   9452  C CB    . ALA C  1 328 ? 197.049 129.615 -114.993 1.00 32.35  ? 328  ALA C CB    1 
ATOM   9453  N N     . HIS C  1 329 ? 196.848 129.092 -111.926 1.00 31.07  ? 329  HIS C N     1 
ATOM   9454  C CA    . HIS C  1 329 ? 196.724 129.596 -110.565 1.00 30.72  ? 329  HIS C CA    1 
ATOM   9455  C C     . HIS C  1 329 ? 197.813 129.045 -109.662 1.00 30.83  ? 329  HIS C C     1 
ATOM   9456  O O     . HIS C  1 329 ? 198.211 129.693 -108.682 1.00 32.02  ? 329  HIS C O     1 
ATOM   9457  C CB    . HIS C  1 329 ? 195.312 129.341 -109.955 1.00 31.15  ? 329  HIS C CB    1 
ATOM   9458  C CG    . HIS C  1 329 ? 194.754 127.965 -110.192 1.00 31.70  ? 329  HIS C CG    1 
ATOM   9459  N ND1   . HIS C  1 329 ? 194.225 127.570 -111.404 1.00 31.43  ? 329  HIS C ND1   1 
ATOM   9460  C CD2   . HIS C  1 329 ? 194.561 126.922 -109.343 1.00 30.74  ? 329  HIS C CD2   1 
ATOM   9461  C CE1   . HIS C  1 329 ? 193.721 126.353 -111.293 1.00 30.96  ? 329  HIS C CE1   1 
ATOM   9462  N NE2   . HIS C  1 329 ? 193.911 125.940 -110.051 1.00 30.50  ? 329  HIS C NE2   1 
ATOM   9463  N N     . LYS C  1 330 ? 198.321 127.865 -110.000 1.00 29.19  ? 330  LYS C N     1 
ATOM   9464  C CA    . LYS C  1 330 ? 199.389 127.273 -109.210 1.00 29.28  ? 330  LYS C CA    1 
ATOM   9465  C C     . LYS C  1 330 ? 200.722 127.992 -109.483 1.00 30.18  ? 330  LYS C C     1 
ATOM   9466  O O     . LYS C  1 330 ? 201.524 128.185 -108.562 1.00 29.36  ? 330  LYS C O     1 
ATOM   9467  C CB    . LYS C  1 330 ? 199.498 125.779 -109.524 1.00 29.17  ? 330  LYS C CB    1 
ATOM   9468  C CG    . LYS C  1 330 ? 200.639 125.018 -108.845 1.00 31.17  ? 330  LYS C CG    1 
ATOM   9469  C CD    . LYS C  1 330 ? 201.951 125.129 -109.602 1.00 29.14  ? 330  LYS C CD    1 
ATOM   9470  C CE    . LYS C  1 330 ? 202.810 123.947 -109.280 1.00 31.23  ? 330  LYS C CE    1 
ATOM   9471  N NZ    . LYS C  1 330 ? 203.971 123.861 -110.207 1.00 30.25  ? 330  LYS C NZ    1 
ATOM   9472  N N     . ALA C  1 331 ? 200.951 128.385 -110.737 1.00 30.23  ? 331  ALA C N     1 
ATOM   9473  C CA    . ALA C  1 331 ? 202.183 129.094 -111.123 1.00 32.56  ? 331  ALA C CA    1 
ATOM   9474  C C     . ALA C  1 331 ? 202.231 130.482 -110.476 1.00 33.80  ? 331  ALA C C     1 
ATOM   9475  O O     . ALA C  1 331 ? 203.257 130.882 -109.932 1.00 33.10  ? 331  ALA C O     1 
ATOM   9476  C CB    . ALA C  1 331 ? 202.268 129.227 -112.644 1.00 32.01  ? 331  ALA C CB    1 
ATOM   9477  N N     . GLU C  1 332 ? 201.116 131.206 -110.538 1.00 33.94  ? 332  GLU C N     1 
ATOM   9478  C CA    . GLU C  1 332 ? 201.041 132.530 -109.937 1.00 36.26  ? 332  GLU C CA    1 
ATOM   9479  C C     . GLU C  1 332 ? 201.298 132.484 -108.430 1.00 36.45  ? 332  GLU C C     1 
ATOM   9480  O O     . GLU C  1 332 ? 202.124 133.236 -107.922 1.00 35.97  ? 332  GLU C O     1 
ATOM   9481  C CB    . GLU C  1 332 ? 199.671 133.160 -110.191 1.00 37.29  ? 332  GLU C CB    1 
ATOM   9482  C CG    . GLU C  1 332 ? 199.230 133.087 -111.632 1.00 42.42  ? 332  GLU C CG    1 
ATOM   9483  C CD    . GLU C  1 332 ? 197.967 133.888 -111.900 1.00 45.36  ? 332  GLU C CD    1 
ATOM   9484  O OE1   . GLU C  1 332 ? 197.229 134.194 -110.934 1.00 45.99  ? 332  GLU C OE1   1 
ATOM   9485  O OE2   . GLU C  1 332 ? 197.713 134.203 -113.087 1.00 47.09  ? 332  GLU C OE2   1 
ATOM   9486  N N     . ASP C  1 333 ? 200.587 131.610 -107.719 1.00 35.59  ? 333  ASP C N     1 
ATOM   9487  C CA    . ASP C  1 333 ? 200.777 131.505 -106.284 1.00 36.58  ? 333  ASP C CA    1 
ATOM   9488  C C     . ASP C  1 333 ? 202.252 131.276 -105.990 1.00 36.25  ? 333  ASP C C     1 
ATOM   9489  O O     . ASP C  1 333 ? 202.826 131.903 -105.098 1.00 35.26  ? 333  ASP C O     1 
ATOM   9490  C CB    . ASP C  1 333 ? 199.950 130.349 -105.702 1.00 38.48  ? 333  ASP C CB    1 
ATOM   9491  C CG    . ASP C  1 333 ? 198.527 130.759 -105.351 1.00 41.02  ? 333  ASP C CG    1 
ATOM   9492  O OD1   . ASP C  1 333 ? 197.918 131.547 -106.113 1.00 42.77  ? 333  ASP C OD1   1 
ATOM   9493  O OD2   . ASP C  1 333 ? 198.009 130.274 -104.323 1.00 41.34  ? 333  ASP C OD2   1 
ATOM   9494  N N     . GLU C  1 334 ? 202.862 130.375 -106.749 1.00 35.93  ? 334  GLU C N     1 
ATOM   9495  C CA    . GLU C  1 334 ? 204.265 130.070 -106.552 1.00 36.10  ? 334  GLU C CA    1 
ATOM   9496  C C     . GLU C  1 334 ? 205.108 131.314 -106.806 1.00 37.08  ? 334  GLU C C     1 
ATOM   9497  O O     . GLU C  1 334 ? 206.065 131.582 -106.088 1.00 35.42  ? 334  GLU C O     1 
ATOM   9498  C CB    . GLU C  1 334 ? 204.695 128.915 -107.463 1.00 34.49  ? 334  GLU C CB    1 
ATOM   9499  C CG    . GLU C  1 334 ? 204.072 127.582 -107.048 1.00 32.97  ? 334  GLU C CG    1 
ATOM   9500  C CD    . GLU C  1 334 ? 204.564 126.403 -107.861 1.00 32.19  ? 334  GLU C CD    1 
ATOM   9501  O OE1   . GLU C  1 334 ? 204.819 126.584 -109.069 1.00 32.64  ? 334  GLU C OE1   1 
ATOM   9502  O OE2   . GLU C  1 334 ? 204.679 125.289 -107.310 1.00 31.22  ? 334  GLU C OE2   1 
ATOM   9503  N N     . GLY C  1 335 ? 204.731 132.079 -107.821 1.00 37.57  ? 335  GLY C N     1 
ATOM   9504  C CA    . GLY C  1 335 ? 205.475 133.277 -108.130 1.00 39.01  ? 335  GLY C CA    1 
ATOM   9505  C C     . GLY C  1 335 ? 205.416 134.249 -106.968 1.00 40.13  ? 335  GLY C C     1 
ATOM   9506  O O     . GLY C  1 335 ? 206.428 134.803 -106.557 1.00 39.21  ? 335  GLY C O     1 
ATOM   9507  N N     . ILE C  1 336 ? 204.221 134.446 -106.431 1.00 40.14  ? 336  ILE C N     1 
ATOM   9508  C CA    . ILE C  1 336 ? 204.045 135.371 -105.335 1.00 41.22  ? 336  ILE C CA    1 
ATOM   9509  C C     . ILE C  1 336 ? 204.843 135.000 -104.104 1.00 41.51  ? 336  ILE C C     1 
ATOM   9510  O O     . ILE C  1 336 ? 205.592 135.827 -103.577 1.00 41.89  ? 336  ILE C O     1 
ATOM   9511  C CB    . ILE C  1 336 ? 202.562 135.481 -104.944 1.00 42.24  ? 336  ILE C CB    1 
ATOM   9512  C CG1   . ILE C  1 336 ? 201.793 136.142 -106.075 1.00 41.35  ? 336  ILE C CG1   1 
ATOM   9513  C CG2   . ILE C  1 336 ? 202.401 136.275 -103.624 1.00 41.64  ? 336  ILE C CG2   1 
ATOM   9514  C CD1   . ILE C  1 336 ? 200.323 136.192 -105.825 1.00 43.22  ? 336  ILE C CD1   1 
ATOM   9515  N N     . ILE C  1 337 ? 204.694 133.762 -103.642 1.00 41.02  ? 337  ILE C N     1 
ATOM   9516  C CA    . ILE C  1 337 ? 205.393 133.342 -102.436 1.00 41.74  ? 337  ILE C CA    1 
ATOM   9517  C C     . ILE C  1 337 ? 206.889 133.151 -102.625 1.00 41.53  ? 337  ILE C C     1 
ATOM   9518  O O     . ILE C  1 337 ? 207.649 133.276 -101.668 1.00 41.40  ? 337  ILE C O     1 
ATOM   9519  C CB    . ILE C  1 337 ? 204.750 132.066 -101.809 1.00 42.31  ? 337  ILE C CB    1 
ATOM   9520  C CG1   . ILE C  1 337 ? 204.886 130.864 -102.743 1.00 42.05  ? 337  ILE C CG1   1 
ATOM   9521  C CG2   . ILE C  1 337 ? 203.264 132.331 -101.514 1.00 42.28  ? 337  ILE C CG2   1 
ATOM   9522  C CD1   . ILE C  1 337 ? 204.169 129.611 -102.216 1.00 41.95  ? 337  ILE C CD1   1 
ATOM   9523  N N     . CYS C  1 338 ? 207.324 132.856 -103.845 1.00 41.59  ? 338  CYS C N     1 
ATOM   9524  C CA    . CYS C  1 338 ? 208.756 132.710 -104.087 1.00 42.60  ? 338  CYS C CA    1 
ATOM   9525  C C     . CYS C  1 338 ? 209.397 134.104 -103.905 1.00 42.89  ? 338  CYS C C     1 
ATOM   9526  O O     . CYS C  1 338 ? 210.424 134.256 -103.236 1.00 41.54  ? 338  CYS C O     1 
ATOM   9527  C CB    . CYS C  1 338 ? 209.022 132.190 -105.501 1.00 43.59  ? 338  CYS C CB    1 
ATOM   9528  S SG    . CYS C  1 338 ? 210.764 132.320 -106.009 1.00 43.04  ? 338  CYS C SG    1 
ATOM   9529  N N     . VAL C  1 339 ? 208.763 135.109 -104.496 1.00 42.98  ? 339  VAL C N     1 
ATOM   9530  C CA    . VAL C  1 339 ? 209.228 136.486 -104.403 1.00 45.26  ? 339  VAL C CA    1 
ATOM   9531  C C     . VAL C  1 339 ? 209.153 137.020 -102.964 1.00 45.32  ? 339  VAL C C     1 
ATOM   9532  O O     . VAL C  1 339 ? 209.996 137.829 -102.563 1.00 44.87  ? 339  VAL C O     1 
ATOM   9533  C CB    . VAL C  1 339 ? 208.422 137.392 -105.370 1.00 45.06  ? 339  VAL C CB    1 
ATOM   9534  C CG1   . VAL C  1 339 ? 208.313 138.799 -104.837 1.00 47.35  ? 339  VAL C CG1   1 
ATOM   9535  C CG2   . VAL C  1 339 ? 209.111 137.409 -106.709 1.00 45.17  ? 339  VAL C CG2   1 
ATOM   9536  N N     . GLU C  1 340 ? 208.150 136.567 -102.199 1.00 45.16  ? 340  GLU C N     1 
ATOM   9537  C CA    . GLU C  1 340 ? 207.992 136.980 -100.800 1.00 44.02  ? 340  GLU C CA    1 
ATOM   9538  C C     . GLU C  1 340 ? 209.116 136.353 -99.977  1.00 44.16  ? 340  GLU C C     1 
ATOM   9539  O O     . GLU C  1 340 ? 209.565 136.924 -98.972  1.00 43.87  ? 340  GLU C O     1 
ATOM   9540  C CB    . GLU C  1 340 ? 206.629 136.547 -100.225 1.00 42.31  ? 340  GLU C CB    1 
ATOM   9541  C CG    . GLU C  1 340 ? 205.443 137.371 -100.730 1.00 40.10  ? 340  GLU C CG    1 
ATOM   9542  C CD    . GLU C  1 340 ? 204.089 136.869 -100.206 1.00 40.42  ? 340  GLU C CD    1 
ATOM   9543  O OE1   . GLU C  1 340 ? 203.987 135.660 -99.861  1.00 38.10  ? 340  GLU C OE1   1 
ATOM   9544  O OE2   . GLU C  1 340 ? 203.132 137.683 -100.156 1.00 37.38  ? 340  GLU C OE2   1 
ATOM   9545  N N     . GLY C  1 341 ? 209.554 135.170 -100.408 1.00 44.37  ? 341  GLY C N     1 
ATOM   9546  C CA    . GLY C  1 341 ? 210.643 134.472 -99.744  1.00 44.27  ? 341  GLY C CA    1 
ATOM   9547  C C     . GLY C  1 341 ? 211.924 135.253 -99.971  1.00 44.72  ? 341  GLY C C     1 
ATOM   9548  O O     . GLY C  1 341 ? 212.723 135.436 -99.047  1.00 44.26  ? 341  GLY C O     1 
ATOM   9549  N N     . MET C  1 342 ? 212.115 135.728 -101.201 1.00 44.66  ? 342  MET C N     1 
ATOM   9550  C CA    . MET C  1 342 ? 213.294 136.521 -101.534 1.00 46.42  ? 342  MET C CA    1 
ATOM   9551  C C     . MET C  1 342 ? 213.353 137.785 -100.661 1.00 47.33  ? 342  MET C C     1 
ATOM   9552  O O     . MET C  1 342 ? 214.423 138.351 -100.448 1.00 48.14  ? 342  MET C O     1 
ATOM   9553  C CB    . MET C  1 342 ? 213.277 136.931 -103.008 1.00 47.25  ? 342  MET C CB    1 
ATOM   9554  C CG    . MET C  1 342 ? 213.280 135.781 -104.002 1.00 47.23  ? 342  MET C CG    1 
ATOM   9555  S SD    . MET C  1 342 ? 213.569 136.377 -105.700 1.00 47.60  ? 342  MET C SD    1 
ATOM   9556  C CE    . MET C  1 342 ? 212.466 137.661 -105.843 1.00 47.68  ? 342  MET C CE    1 
ATOM   9557  N N     . ALA C  1 343 ? 212.203 138.234 -100.167 1.00 47.68  ? 343  ALA C N     1 
ATOM   9558  C CA    . ALA C  1 343 ? 212.166 139.413 -99.314  1.00 48.07  ? 343  ALA C CA    1 
ATOM   9559  C C     . ALA C  1 343 ? 212.250 139.005 -97.841  1.00 48.51  ? 343  ALA C C     1 
ATOM   9560  O O     . ALA C  1 343 ? 212.130 139.841 -96.946  1.00 49.11  ? 343  ALA C O     1 
ATOM   9561  C CB    . ALA C  1 343 ? 210.898 140.210 -99.572  1.00 46.71  ? 343  ALA C CB    1 
ATOM   9562  N N     . GLY C  1 344 ? 212.464 137.717 -97.597  1.00 49.45  ? 344  GLY C N     1 
ATOM   9563  C CA    . GLY C  1 344 ? 212.575 137.229 -96.231  1.00 50.96  ? 344  GLY C CA    1 
ATOM   9564  C C     . GLY C  1 344 ? 211.300 136.641 -95.638  1.00 52.16  ? 344  GLY C C     1 
ATOM   9565  O O     . GLY C  1 344 ? 211.296 136.181 -94.486  1.00 51.93  ? 344  GLY C O     1 
ATOM   9566  N N     . GLY C  1 345 ? 210.222 136.640 -96.418  1.00 51.70  ? 345  GLY C N     1 
ATOM   9567  C CA    . GLY C  1 345 ? 208.972 136.109 -95.923  1.00 51.96  ? 345  GLY C CA    1 
ATOM   9568  C C     . GLY C  1 345 ? 209.006 134.600 -95.845  1.00 52.34  ? 345  GLY C C     1 
ATOM   9569  O O     . GLY C  1 345 ? 209.941 133.957 -96.327  1.00 50.33  ? 345  GLY C O     1 
ATOM   9570  N N     . ALA C  1 346 ? 207.987 134.036 -95.206  1.00 53.07  ? 346  ALA C N     1 
ATOM   9571  C CA    . ALA C  1 346 ? 207.868 132.588 -95.094  1.00 54.11  ? 346  ALA C CA    1 
ATOM   9572  C C     . ALA C  1 346 ? 207.410 132.074 -96.470  1.00 54.12  ? 346  ALA C C     1 
ATOM   9573  O O     . ALA C  1 346 ? 206.724 132.785 -97.214  1.00 54.64  ? 346  ALA C O     1 
ATOM   9574  C CB    . ALA C  1 346 ? 206.828 132.234 -94.021  1.00 55.40  ? 346  ALA C CB    1 
ATOM   9575  N N     . VAL C  1 347 ? 207.782 130.853 -96.824  1.00 53.21  ? 347  VAL C N     1 
ATOM   9576  C CA    . VAL C  1 347 ? 207.369 130.332 -98.123  1.00 53.08  ? 347  VAL C CA    1 
ATOM   9577  C C     . VAL C  1 347 ? 206.693 128.986 -97.963  1.00 52.79  ? 347  VAL C C     1 
ATOM   9578  O O     . VAL C  1 347 ? 207.320 128.013 -97.532  1.00 53.39  ? 347  VAL C O     1 
ATOM   9579  C CB    . VAL C  1 347 ? 208.571 130.186 -99.075  1.00 52.67  ? 347  VAL C CB    1 
ATOM   9580  C CG1   . VAL C  1 347 ? 208.106 129.640 -100.411 1.00 53.04  ? 347  VAL C CG1   1 
ATOM   9581  C CG2   . VAL C  1 347 ? 209.258 131.539 -99.254  1.00 52.12  ? 347  VAL C CG2   1 
ATOM   9582  N N     . HIS C  1 348 ? 205.413 128.923 -98.312  1.00 51.79  ? 348  HIS C N     1 
ATOM   9583  C CA    . HIS C  1 348 ? 204.693 127.674 -98.171  1.00 51.56  ? 348  HIS C CA    1 
ATOM   9584  C C     . HIS C  1 348 ? 203.440 127.498 -99.025  1.00 49.55  ? 348  HIS C C     1 
ATOM   9585  O O     . HIS C  1 348 ? 202.564 128.369 -99.080  1.00 47.05  ? 348  HIS C O     1 
ATOM   9586  C CB    . HIS C  1 348 ? 204.331 127.464 -96.696  1.00 55.26  ? 348  HIS C CB    1 
ATOM   9587  C CG    . HIS C  1 348 ? 203.563 126.205 -96.431  1.00 58.98  ? 348  HIS C CG    1 
ATOM   9588  N ND1   . HIS C  1 348 ? 202.304 126.204 -95.864  1.00 60.89  ? 348  HIS C ND1   1 
ATOM   9589  C CD2   . HIS C  1 348 ? 203.859 124.906 -96.689  1.00 60.20  ? 348  HIS C CD2   1 
ATOM   9590  C CE1   . HIS C  1 348 ? 201.857 124.963 -95.787  1.00 61.67  ? 348  HIS C CE1   1 
ATOM   9591  N NE2   . HIS C  1 348 ? 202.782 124.156 -96.281  1.00 61.86  ? 348  HIS C NE2   1 
ATOM   9592  N N     . ILE C  1 349 ? 203.376 126.355 -99.701  1.00 48.02  ? 349  ILE C N     1 
ATOM   9593  C CA    . ILE C  1 349 ? 202.217 126.009 -100.504 1.00 46.51  ? 349  ILE C CA    1 
ATOM   9594  C C     . ILE C  1 349 ? 201.902 124.532 -100.295 1.00 45.76  ? 349  ILE C C     1 
ATOM   9595  O O     . ILE C  1 349 ? 202.803 123.704 -100.123 1.00 46.30  ? 349  ILE C O     1 
ATOM   9596  C CB    . ILE C  1 349 ? 202.418 126.281 -102.004 1.00 45.50  ? 349  ILE C CB    1 
ATOM   9597  C CG1   . ILE C  1 349 ? 201.112 125.962 -102.739 1.00 45.92  ? 349  ILE C CG1   1 
ATOM   9598  C CG2   . ILE C  1 349 ? 203.573 125.461 -102.540 1.00 44.30  ? 349  ILE C CG2   1 
ATOM   9599  C CD1   . ILE C  1 349 ? 201.099 126.352 -104.189 1.00 45.88  ? 349  ILE C CD1   1 
ATOM   9600  N N     . ASP C  1 350 ? 200.611 124.224 -100.290 1.00 44.87  ? 350  ASP C N     1 
ATOM   9601  C CA    . ASP C  1 350 ? 200.102 122.865 -100.095 1.00 44.93  ? 350  ASP C CA    1 
ATOM   9602  C C     . ASP C  1 350 ? 199.301 122.479 -101.351 1.00 43.38  ? 350  ASP C C     1 
ATOM   9603  O O     . ASP C  1 350 ? 198.187 122.954 -101.552 1.00 40.77  ? 350  ASP C O     1 
ATOM   9604  C CB    . ASP C  1 350 ? 199.204 122.857 -98.846  1.00 47.01  ? 350  ASP C CB    1 
ATOM   9605  C CG    . ASP C  1 350 ? 198.625 121.487 -98.528  1.00 48.96  ? 350  ASP C CG    1 
ATOM   9606  O OD1   . ASP C  1 350 ? 198.983 120.499 -99.219  1.00 48.73  ? 350  ASP C OD1   1 
ATOM   9607  O OD2   . ASP C  1 350 ? 197.811 121.414 -97.571  1.00 50.53  ? 350  ASP C OD2   1 
ATOM   9608  N N     . TYR C  1 351 ? 199.866 121.625 -102.199 1.00 42.41  ? 351  TYR C N     1 
ATOM   9609  C CA    . TYR C  1 351 ? 199.168 121.259 -103.416 1.00 42.44  ? 351  TYR C CA    1 
ATOM   9610  C C     . TYR C  1 351 ? 197.826 120.558 -103.206 1.00 40.54  ? 351  TYR C C     1 
ATOM   9611  O O     . TYR C  1 351 ? 197.005 120.512 -104.118 1.00 37.03  ? 351  TYR C O     1 
ATOM   9612  C CB    . TYR C  1 351 ? 200.096 120.445 -104.320 1.00 45.25  ? 351  TYR C CB    1 
ATOM   9613  C CG    . TYR C  1 351 ? 201.310 121.252 -104.722 1.00 48.58  ? 351  TYR C CG    1 
ATOM   9614  C CD1   . TYR C  1 351 ? 201.175 122.419 -105.480 1.00 48.43  ? 351  TYR C CD1   1 
ATOM   9615  C CD2   . TYR C  1 351 ? 202.580 120.910 -104.260 1.00 50.92  ? 351  TYR C CD2   1 
ATOM   9616  C CE1   . TYR C  1 351 ? 202.268 123.233 -105.759 1.00 50.04  ? 351  TYR C CE1   1 
ATOM   9617  C CE2   . TYR C  1 351 ? 203.693 121.723 -104.531 1.00 52.62  ? 351  TYR C CE2   1 
ATOM   9618  C CZ    . TYR C  1 351 ? 203.529 122.883 -105.282 1.00 52.30  ? 351  TYR C CZ    1 
ATOM   9619  O OH    . TYR C  1 351 ? 204.623 123.690 -105.540 1.00 52.47  ? 351  TYR C OH    1 
ATOM   9620  N N     . ASN C  1 352 ? 197.591 120.036 -102.004 1.00 38.93  ? 352  ASN C N     1 
ATOM   9621  C CA    . ASN C  1 352 ? 196.321 119.374 -101.704 1.00 37.09  ? 352  ASN C CA    1 
ATOM   9622  C C     . ASN C  1 352 ? 195.218 120.442 -101.687 1.00 35.80  ? 352  ASN C C     1 
ATOM   9623  O O     . ASN C  1 352 ? 194.035 120.145 -101.839 1.00 35.36  ? 352  ASN C O     1 
ATOM   9624  C CB    . ASN C  1 352 ? 196.378 118.677 -100.333 1.00 36.72  ? 352  ASN C CB    1 
ATOM   9625  C CG    . ASN C  1 352 ? 195.076 117.947 -99.989  1.00 38.52  ? 352  ASN C CG    1 
ATOM   9626  O OD1   . ASN C  1 352 ? 194.587 117.126 -100.778 1.00 35.44  ? 352  ASN C OD1   1 
ATOM   9627  N ND2   . ASN C  1 352 ? 194.509 118.241 -98.809  1.00 36.98  ? 352  ASN C ND2   1 
ATOM   9628  N N     . CYS C  1 353 ? 195.614 121.695 -101.503 1.00 33.79  ? 353  CYS C N     1 
ATOM   9629  C CA    . CYS C  1 353 ? 194.649 122.778 -101.461 1.00 33.61  ? 353  CYS C CA    1 
ATOM   9630  C C     . CYS C  1 353 ? 194.482 123.547 -102.797 1.00 32.83  ? 353  CYS C C     1 
ATOM   9631  O O     . CYS C  1 353 ? 193.720 124.518 -102.860 1.00 31.43  ? 353  CYS C O     1 
ATOM   9632  C CB    . CYS C  1 353 ? 194.996 123.720 -100.291 1.00 36.39  ? 353  CYS C CB    1 
ATOM   9633  S SG    . CYS C  1 353 ? 194.701 122.996 -98.593  1.00 41.25  ? 353  CYS C SG    1 
ATOM   9634  N N     . VAL C  1 354 ? 195.169 123.138 -103.868 1.00 29.89  ? 354  VAL C N     1 
ATOM   9635  C CA    . VAL C  1 354 ? 194.941 123.856 -105.135 1.00 29.15  ? 354  VAL C CA    1 
ATOM   9636  C C     . VAL C  1 354 ? 193.837 123.157 -105.950 1.00 27.56  ? 354  VAL C C     1 
ATOM   9637  O O     . VAL C  1 354 ? 193.883 121.963 -106.251 1.00 24.85  ? 354  VAL C O     1 
ATOM   9638  C CB    . VAL C  1 354 ? 196.244 124.110 -105.999 1.00 31.32  ? 354  VAL C CB    1 
ATOM   9639  C CG1   . VAL C  1 354 ? 197.473 123.650 -105.282 1.00 30.85  ? 354  VAL C CG1   1 
ATOM   9640  C CG2   . VAL C  1 354 ? 196.099 123.513 -107.380 1.00 29.56  ? 354  VAL C CG2   1 
ATOM   9641  N N     . PRO C  1 355 ? 192.802 123.916 -106.288 1.00 26.14  ? 355  PRO C N     1 
ATOM   9642  C CA    . PRO C  1 355 ? 191.692 123.353 -107.041 1.00 26.68  ? 355  PRO C CA    1 
ATOM   9643  C C     . PRO C  1 355 ? 191.956 123.096 -108.522 1.00 25.78  ? 355  PRO C C     1 
ATOM   9644  O O     . PRO C  1 355 ? 192.891 123.629 -109.086 1.00 25.01  ? 355  PRO C O     1 
ATOM   9645  C CB    . PRO C  1 355 ? 190.587 124.371 -106.803 1.00 23.95  ? 355  PRO C CB    1 
ATOM   9646  C CG    . PRO C  1 355 ? 191.359 125.678 -106.816 1.00 26.41  ? 355  PRO C CG    1 
ATOM   9647  C CD    . PRO C  1 355 ? 192.638 125.364 -106.061 1.00 25.42  ? 355  PRO C CD    1 
ATOM   9648  N N     . SER C  1 356 ? 191.124 122.232 -109.106 1.00 24.79  ? 356  SER C N     1 
ATOM   9649  C CA    . SER C  1 356 ? 191.155 121.886 -110.531 1.00 23.59  ? 356  SER C CA    1 
ATOM   9650  C C     . SER C  1 356 ? 189.771 122.195 -111.090 1.00 24.32  ? 356  SER C C     1 
ATOM   9651  O O     . SER C  1 356 ? 188.758 121.929 -110.425 1.00 24.32  ? 356  SER C O     1 
ATOM   9652  C CB    . SER C  1 356 ? 191.406 120.389 -110.753 1.00 21.32  ? 356  SER C CB    1 
ATOM   9653  O OG    . SER C  1 356 ? 192.746 120.029 -110.507 1.00 21.91  ? 356  SER C OG    1 
ATOM   9654  N N     . VAL C  1 357 ? 189.708 122.755 -112.298 1.00 22.25  ? 357  VAL C N     1 
ATOM   9655  C CA    . VAL C  1 357 ? 188.418 123.024 -112.905 1.00 22.41  ? 357  VAL C CA    1 
ATOM   9656  C C     . VAL C  1 357 ? 188.479 122.578 -114.375 1.00 23.00  ? 357  VAL C C     1 
ATOM   9657  O O     . VAL C  1 357 ? 189.523 122.695 -115.023 1.00 22.31  ? 357  VAL C O     1 
ATOM   9658  C CB    . VAL C  1 357 ? 188.029 124.549 -112.830 1.00 23.28  ? 357  VAL C CB    1 
ATOM   9659  C CG1   . VAL C  1 357 ? 186.636 124.780 -113.426 1.00 21.59  ? 357  VAL C CG1   1 
ATOM   9660  C CG2   . VAL C  1 357 ? 188.049 125.038 -111.389 1.00 22.78  ? 357  VAL C CG2   1 
ATOM   9661  N N     . ILE C  1 358 ? 187.379 122.016 -114.861 1.00 21.86  ? 358  ILE C N     1 
ATOM   9662  C CA    . ILE C  1 358 ? 187.251 121.628 -116.265 1.00 22.69  ? 358  ILE C CA    1 
ATOM   9663  C C     . ILE C  1 358 ? 186.080 122.505 -116.701 1.00 22.82  ? 358  ILE C C     1 
ATOM   9664  O O     . ILE C  1 358 ? 184.994 122.427 -116.112 1.00 22.80  ? 358  ILE C O     1 
ATOM   9665  C CB    . ILE C  1 358 ? 186.910 120.142 -116.446 1.00 24.18  ? 358  ILE C CB    1 
ATOM   9666  C CG1   . ILE C  1 358 ? 188.029 119.293 -115.827 1.00 22.80  ? 358  ILE C CG1   1 
ATOM   9667  C CG2   . ILE C  1 358 ? 186.684 119.850 -117.970 1.00 20.68  ? 358  ILE C CG2   1 
ATOM   9668  C CD1   . ILE C  1 358 ? 187.916 117.742 -115.980 1.00 22.83  ? 358  ILE C CD1   1 
ATOM   9669  N N     . TYR C  1 359 ? 186.308 123.367 -117.695 1.00 21.97  ? 359  TYR C N     1 
ATOM   9670  C CA    . TYR C  1 359 ? 185.272 124.309 -118.129 1.00 22.95  ? 359  TYR C CA    1 
ATOM   9671  C C     . TYR C  1 359 ? 184.298 123.875 -119.221 1.00 23.85  ? 359  TYR C C     1 
ATOM   9672  O O     . TYR C  1 359 ? 183.874 124.688 -120.046 1.00 24.72  ? 359  TYR C O     1 
ATOM   9673  C CB    . TYR C  1 359 ? 185.912 125.653 -118.511 1.00 23.30  ? 359  TYR C CB    1 
ATOM   9674  C CG    . TYR C  1 359 ? 186.624 126.346 -117.366 1.00 23.21  ? 359  TYR C CG    1 
ATOM   9675  C CD1   . TYR C  1 359 ? 187.943 126.030