data_1ZNJ
# 
_entry.id   1ZNJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZNJ         
WWPDB D_1000177496 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZNJ 
_pdbx_database_status.recvd_initial_deposition_date   1997-09-23 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Turkenburg, M.G.W.' 1 
'Whittingham, J.L.'  2 
'Turkenburg, J.P.'   3 
'Dodson, G.G.'       4 
'Derewenda, U.'      5 
'Smith, G.D.'        6 
'Dodson, E.J.'       7 
'Derewenda, Z.S.'    8 
'Xiao, B.'           9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure Determination and Refinement of Two Crystal Forms of Native Insulins' 'To be Published'              ?   ?   ? 
?    ?      ?  ?         0353 ? ? ? 
1       'The Structure of a Rhombohedral R6 Insulin Hexamer that Binds Phenol' Biopolymers                    32  441 ? 1992 
BIPMAA US 0006-3525 0161 ? ? ? 
2       'Phenol Stabilizes More Helix in a New Symmetrical Zinc Insulin Hexamer' Nature                         338 594 ? 1989 
NATUAS UK 0028-0836 0006 ? ? ? 
3       
;Molecular Replacement: The Method and its Problems (in: Molecular Replacement. Proceedings of the Daresbury Study Weekend, 15-16 February, 1985. Compiled by P.A.Machin)
;
'Daresbury Lab.[Rep.]Dl/Sci/R' 23  33  ? 1985 DLRSDG UK 0144-5677 0784 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Turkenburg, J.P.'  1  
primary 'Whittingham, J.L.' 2  
primary 'Derewenda, U.'     3  
primary 'Derewenda, Z.S.'   4  
primary 'Dodson, E.J.'      5  
primary 'Dodson, G.G.'      6  
primary 'Smith, G.D.'       7  
primary 'Xiao, B.'          8  
1       'Smith, G.D.'       9  
1       'Dodson, G.G.'      10 
2       'Derewenda, U.'     11 
2       'Derewenda, Z.'     12 
2       'Dodson, E.J.'      13 
2       'Dodson, G.G.'      14 
2       'Reynolds, C.D.'    15 
2       'Smith, G.D.'       16 
2       'Sparks, C.'        17 
2       'Swenson, D.'       18 
3       'Dodson, E.J.'      19 
# 
_cell.entry_id           1ZNJ 
_cell.length_a           61.230 
_cell.length_b           61.650 
_cell.length_c           48.050 
_cell.angle_alpha        90.00 
_cell.angle_beta         110.50 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZNJ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man INSULIN        2383.698 6   ? ? ? 'HEXAMER IN ASYMMETRIC UNIT, MONOCLINIC CRYSTAL FORM' 
2 polymer     man INSULIN        3433.953 6   ? ? ? 'HEXAMER IN ASYMMETRIC UNIT, MONOCLINIC CRYSTAL FORM' 
3 non-polymer syn PHENOL         94.111   7   ? ? ? ?                                                     
4 non-polymer syn 'ZINC ION'     65.409   2   ? ? ? ?                                                     
5 non-polymer syn 'CHLORIDE ION' 35.453   2   ? ? ? ?                                                     
6 water       nat water          18.015   331 ? ? ? ?                                                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN          GIVEQCCTSICSLYQLENYCN          A,C,E,G,I,K ? 
2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFFYTPKT B,D,F,H,J,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  THR n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 PRO n 
2 29 LYS n 
2 30 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP INS_HUMAN P01308 1 90 ? ? 
2 UNP INS_HUMAN P01308 2 25 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1ZNJ A 1 ? 21 ? P01308 90 ? 110 ? 1 21 
2  2 1ZNJ B 1 ? 30 ? P01308 25 ? 54  ? 1 30 
3  1 1ZNJ C 1 ? 21 ? P01308 90 ? 110 ? 1 21 
4  2 1ZNJ D 1 ? 30 ? P01308 25 ? 54  ? 1 30 
5  1 1ZNJ E 1 ? 21 ? P01308 90 ? 110 ? 1 21 
6  2 1ZNJ F 1 ? 30 ? P01308 25 ? 54  ? 1 30 
7  1 1ZNJ G 1 ? 21 ? P01308 90 ? 110 ? 1 21 
8  2 1ZNJ H 1 ? 30 ? P01308 25 ? 54  ? 1 30 
9  1 1ZNJ I 1 ? 21 ? P01308 90 ? 110 ? 1 21 
10 2 1ZNJ J 1 ? 30 ? P01308 25 ? 54  ? 1 30 
11 1 1ZNJ K 1 ? 21 ? P01308 90 ? 110 ? 1 21 
12 2 1ZNJ L 1 ? 30 ? P01308 25 ? 54  ? 1 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
IPH non-polymer         . PHENOL          ? 'C6 H6 O'        94.111  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1ZNJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.density_percent_sol   49.45 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'batch method' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.44 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'BATCH, 1.7MG/ML INSULIN, 0.02 ZINC ACETATE, 0.7% (V/V) PHENOL, 0.34M SODIUM CHLORIDE, pH 7.44, batch method' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1992-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ZNJ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   22429 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.1 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   90.1 
_reflns_shell.Rmerge_I_obs           0.227 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        2.5 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1ZNJ 
_refine.ls_number_reflns_obs                     22051 
_refine.ls_number_reflns_all                     22429 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    98.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.178 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      '2ZINC INSULIN DIMER (PDB ENTRY 4INS)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2331 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         53 
_refine_hist.number_atoms_solvent             331 
_refine_hist.number_atoms_total               2715 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.019 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.048 0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.053 0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.013 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.180 0.150 ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.177 0.500 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.245 0.500 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.286 0.500 ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        2.3   3.0   ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     17.9  20.0  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    15.4  25.0  ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1ZNJ 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.178 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1ZNJ 
_struct.title                     'INSULIN, MONOCLINIC CRYSTAL FORM' 
_struct.pdbx_descriptor           'INSULIN, PHENOL' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZNJ 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            'HORMONE, METABOLIC ROLE, CHEMICAL ACTIVITY, INSULIN GLUCOSE METABOLISM, DIABETES' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 1 ? 
J  N N 2 ? 
K  N N 1 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 5 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 5 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 6 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 6 ? 
CA N N 6 ? 
DA N N 6 ? 
EA N N 6 ? 
FA N N 6 ? 
GA N N 6 ? 
HA N N 6 ? 
IA N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 2  ? CYS A 6  ? ILE A 2  CYS A 6  1 ? 5  
HELX_P HELX_P2  2  LEU A 13 ? TYR A 19 ? LEU A 13 TYR A 19 1 ? 7  
HELX_P HELX_P3  3  VAL B 2  ? ARG B 22 ? VAL B 2  ARG B 22 1 ? 21 
HELX_P HELX_P4  4  ILE C 2  ? CYS C 6  ? ILE C 2  CYS C 6  1 ? 5  
HELX_P HELX_P5  5  LEU C 13 ? TYR C 19 ? LEU C 13 TYR C 19 1 ? 7  
HELX_P HELX_P6  6  VAL D 2  ? ARG D 22 ? VAL D 2  ARG D 22 1 ? 21 
HELX_P HELX_P7  7  ILE E 2  ? THR E 8  ? ILE E 2  THR E 8  1 ? 7  
HELX_P HELX_P8  8  LEU E 13 ? TYR E 19 ? LEU E 13 TYR E 19 1 ? 7  
HELX_P HELX_P9  9  ASN F 3  ? ARG F 22 ? ASN F 3  ARG F 22 1 ? 20 
HELX_P HELX_P10 10 ILE G 2  ? CYS G 6  ? ILE G 2  CYS G 6  1 ? 5  
HELX_P HELX_P11 11 LEU G 13 ? TYR G 19 ? LEU G 13 TYR G 19 1 ? 7  
HELX_P HELX_P12 12 VAL H 2  ? ARG H 22 ? VAL H 2  ARG H 22 1 ? 21 
HELX_P HELX_P13 13 ILE I 2  ? CYS I 6  ? ILE I 2  CYS I 6  1 ? 5  
HELX_P HELX_P14 14 LEU I 13 ? TYR I 19 ? LEU I 13 TYR I 19 1 ? 7  
HELX_P HELX_P15 15 ASN J 3  ? ARG J 22 ? ASN J 3  ARG J 22 1 ? 20 
HELX_P HELX_P16 16 ILE K 2  ? CYS K 6  ? ILE K 2  CYS K 6  1 ? 5  
HELX_P HELX_P17 17 LEU K 13 ? TYR K 19 ? LEU K 13 TYR K 19 1 ? 7  
HELX_P HELX_P18 18 VAL L 2  ? ARG L 22 ? VAL L 2  ARG L 22 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 11 SG  ? ? A CYS 6  A CYS 11 1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf2  disulf ? ? A CYS 7  SG ? ? ? 1_555 B CYS 7  SG  ? ? A CYS 7  B CYS 7  1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf3  disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG  ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 1.989 ? 
disulf4  disulf ? ? C CYS 6  SG ? ? ? 1_555 C CYS 11 SG  ? ? C CYS 6  C CYS 11 1_555 ? ? ? ? ? ? ? 1.952 ? 
disulf5  disulf ? ? C CYS 7  SG ? ? ? 1_555 D CYS 7  SG  ? ? C CYS 7  D CYS 7  1_555 ? ? ? ? ? ? ? 2.008 ? 
disulf6  disulf ? ? C CYS 20 SG ? ? ? 1_555 D CYS 19 SG  ? ? C CYS 20 D CYS 19 1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf7  disulf ? ? E CYS 6  SG ? ? ? 1_555 E CYS 11 SG  ? ? E CYS 6  E CYS 11 1_555 ? ? ? ? ? ? ? 1.879 ? 
disulf8  disulf ? ? E CYS 7  SG ? ? ? 1_555 F CYS 7  SG  ? ? E CYS 7  F CYS 7  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf9  disulf ? ? E CYS 20 SG ? ? ? 1_555 F CYS 19 SG  ? ? E CYS 20 F CYS 19 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf10 disulf ? ? G CYS 6  SG ? ? ? 1_555 G CYS 11 SG  ? ? G CYS 6  G CYS 11 1_555 ? ? ? ? ? ? ? 1.984 ? 
disulf11 disulf ? ? G CYS 7  SG ? ? ? 1_555 H CYS 7  SG  ? ? G CYS 7  H CYS 7  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf12 disulf ? ? G CYS 20 SG ? ? ? 1_555 H CYS 19 SG  ? ? G CYS 20 H CYS 19 1_555 ? ? ? ? ? ? ? 1.951 ? 
disulf13 disulf ? ? I CYS 6  SG ? ? ? 1_555 I CYS 11 SG  ? ? I CYS 6  I CYS 11 1_555 ? ? ? ? ? ? ? 2.002 ? 
disulf14 disulf ? ? I CYS 7  SG ? ? ? 1_555 J CYS 7  SG  ? ? I CYS 7  J CYS 7  1_555 ? ? ? ? ? ? ? 1.926 ? 
disulf15 disulf ? ? I CYS 20 SG ? ? ? 1_555 J CYS 19 SG  ? ? I CYS 20 J CYS 19 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf16 disulf ? ? K CYS 6  SG ? ? ? 1_555 K CYS 11 SG  ? ? K CYS 6  K CYS 11 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf17 disulf ? ? K CYS 7  SG ? ? ? 1_555 L CYS 7  SG  ? ? K CYS 7  L CYS 7  1_555 ? ? ? ? ? ? ? 1.960 ? 
disulf18 disulf ? ? K CYS 20 SG ? ? ? 1_555 L CYS 19 SG  ? ? K CYS 20 L CYS 19 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc1  metalc ? ? N ZN  .  ZN ? ? ? 1_555 B HIS 10 NE2 ? ? B ZN  31 B HIS 10 1_555 ? ? ? ? ? ? ? 1.756 ? 
metalc2  metalc ? ? N ZN  .  ZN ? ? ? 1_555 F HIS 10 NE2 ? ? B ZN  31 F HIS 10 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc3  metalc ? ? N ZN  .  ZN ? ? ? 1_555 J HIS 10 NE2 ? ? B ZN  31 J HIS 10 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc4  metalc ? ? N ZN  .  ZN ? ? ? 1_555 O CL  .  CL  ? ? B ZN  31 B CL  32 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc5  metalc ? ? R ZN  .  ZN ? ? ? 1_555 D HIS 10 NE2 ? ? D ZN  31 D HIS 10 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc6  metalc ? ? R ZN  .  ZN ? ? ? 1_555 H HIS 10 NE2 ? ? D ZN  31 H HIS 10 1_555 ? ? ? ? ? ? ? 1.818 ? 
metalc7  metalc ? ? R ZN  .  ZN ? ? ? 1_555 L HIS 10 NE2 ? ? D ZN  31 L HIS 10 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc8  metalc ? ? R ZN  .  ZN ? ? ? 1_555 U CL  .  CL  ? ? D ZN  31 H CL  31 1_555 ? ? ? ? ? ? ? 2.300 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE B 24 ? TYR B 26 ? PHE B 24 TYR B 26 
A 2 PHE D 24 ? TYR D 26 ? PHE D 24 TYR D 26 
B 1 PHE F 24 ? TYR F 26 ? PHE F 24 TYR F 26 
B 2 PHE H 24 ? TYR H 26 ? PHE H 24 TYR H 26 
C 1 PHE J 24 ? TYR J 26 ? PHE J 24 TYR J 26 
C 2 PHE L 24 ? TYR L 26 ? PHE L 24 TYR L 26 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR B 26 ? N TYR B 26 O PHE D 24 ? O PHE D 24 
B 1 2 N TYR F 26 ? N TYR F 26 O PHE H 24 ? O PHE H 24 
C 1 2 N TYR J 26 ? N TYR J 26 O PHE L 24 ? O PHE L 24 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 31'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 31'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 32'  
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL H 31'  
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE IPH A 22' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE IPH C 22' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE IPH E 22' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IPH G 22' 
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE IPH I 22' 
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IPH K 22' 
BC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE IPH B 33' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS B  10 ? HIS B 10 . ? 1_555 ? 
2  AC1 4 CL  O  .  ? CL  B 32 . ? 1_555 ? 
3  AC1 4 HIS F  10 ? HIS F 10 . ? 1_555 ? 
4  AC1 4 HIS J  10 ? HIS J 10 . ? 1_555 ? 
5  AC2 4 HIS D  10 ? HIS D 10 . ? 1_555 ? 
6  AC2 4 HIS H  10 ? HIS H 10 . ? 1_555 ? 
7  AC2 4 CL  U  .  ? CL  H 31 . ? 1_555 ? 
8  AC2 4 HIS L  10 ? HIS L 10 . ? 1_555 ? 
9  AC3 4 HIS B  10 ? HIS B 10 . ? 1_555 ? 
10 AC3 4 ZN  N  .  ? ZN  B 31 . ? 1_555 ? 
11 AC3 4 IPH P  .  ? IPH B 33 . ? 1_555 ? 
12 AC3 4 HIS J  10 ? HIS J 10 . ? 1_555 ? 
13 AC4 3 ZN  R  .  ? ZN  D 31 . ? 1_555 ? 
14 AC4 3 HIS H  10 ? HIS H 10 . ? 1_555 ? 
15 AC4 3 HIS L  10 ? HIS L 10 . ? 1_555 ? 
16 AC5 6 CYS A  6  ? CYS A 6  . ? 1_555 ? 
17 AC5 6 SER A  9  ? SER A 9  . ? 1_555 ? 
18 AC5 6 ILE A  10 ? ILE A 10 . ? 1_555 ? 
19 AC5 6 CYS A  11 ? CYS A 11 . ? 1_555 ? 
20 AC5 6 LEU B  11 ? LEU B 11 . ? 1_555 ? 
21 AC5 6 HIS F  5  ? HIS F 5  . ? 1_555 ? 
22 AC6 5 CYS C  6  ? CYS C 6  . ? 1_555 ? 
23 AC6 5 ILE C  10 ? ILE C 10 . ? 1_555 ? 
24 AC6 5 CYS C  11 ? CYS C 11 . ? 1_555 ? 
25 AC6 5 LEU D  11 ? LEU D 11 . ? 1_555 ? 
26 AC6 5 HIS L  5  ? HIS L 5  . ? 1_555 ? 
27 AC7 6 CYS E  6  ? CYS E 6  . ? 1_555 ? 
28 AC7 6 SER E  9  ? SER E 9  . ? 1_555 ? 
29 AC7 6 ILE E  10 ? ILE E 10 . ? 1_555 ? 
30 AC7 6 CYS E  11 ? CYS E 11 . ? 1_555 ? 
31 AC7 6 LEU F  11 ? LEU F 11 . ? 1_555 ? 
32 AC7 6 HIS J  5  ? HIS J 5  . ? 1_555 ? 
33 AC8 4 CYS G  6  ? CYS G 6  . ? 1_555 ? 
34 AC8 4 SER G  9  ? SER G 9  . ? 1_555 ? 
35 AC8 4 ILE G  10 ? ILE G 10 . ? 1_555 ? 
36 AC8 4 CYS G  11 ? CYS G 11 . ? 1_555 ? 
37 AC9 5 HIS B  5  ? HIS B 5  . ? 1_555 ? 
38 AC9 5 CYS I  6  ? CYS I 6  . ? 1_555 ? 
39 AC9 5 ILE I  10 ? ILE I 10 . ? 1_555 ? 
40 AC9 5 CYS I  11 ? CYS I 11 . ? 1_555 ? 
41 AC9 5 LEU J  11 ? LEU J 11 . ? 1_555 ? 
42 BC1 4 CYS K  6  ? CYS K 6  . ? 1_555 ? 
43 BC1 4 ILE K  10 ? ILE K 10 . ? 1_555 ? 
44 BC1 4 CYS K  11 ? CYS K 11 . ? 1_555 ? 
45 BC1 4 HOH HA .  ? HOH K 24 . ? 1_555 ? 
46 BC2 5 LEU B  6  ? LEU B 6  . ? 1_555 ? 
47 BC2 5 CL  O  .  ? CL  B 32 . ? 1_555 ? 
48 BC2 5 LEU F  6  ? LEU F 6  . ? 1_555 ? 
49 BC2 5 ASN J  3  ? ASN J 3  . ? 1_555 ? 
50 BC2 5 LEU J  6  ? LEU J 6  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZNJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZNJ 
_atom_sites.fract_transf_matrix[1][1]   0.016332 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006106 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016221 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022219 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A  1 1  ? 35.874  -3.513  13.120  1.00 43.92 ? 1   GLY A N   1 
ATOM   2    C  CA  . GLY A  1 1  ? 34.756  -2.544  13.241  1.00 43.33 ? 1   GLY A CA  1 
ATOM   3    C  C   . GLY A  1 1  ? 33.325  -3.127  13.274  1.00 42.03 ? 1   GLY A C   1 
ATOM   4    O  O   . GLY A  1 1  ? 33.017  -4.295  13.630  1.00 41.99 ? 1   GLY A O   1 
ATOM   5    N  N   . ILE A  1 2  ? 32.382  -2.238  12.927  1.00 39.55 ? 2   ILE A N   1 
ATOM   6    C  CA  . ILE A  1 2  ? 30.970  -2.619  12.861  1.00 36.92 ? 2   ILE A CA  1 
ATOM   7    C  C   . ILE A  1 2  ? 30.808  -3.632  11.726  1.00 35.74 ? 2   ILE A C   1 
ATOM   8    O  O   . ILE A  1 2  ? 29.990  -4.512  11.964  1.00 35.07 ? 2   ILE A O   1 
ATOM   9    C  CB  . ILE A  1 2  ? 30.030  -1.383  12.643  1.00 36.29 ? 2   ILE A CB  1 
ATOM   10   C  CG1 . ILE A  1 2  ? 28.586  -1.881  12.750  1.00 34.60 ? 2   ILE A CG1 1 
ATOM   11   C  CG2 . ILE A  1 2  ? 30.335  -0.627  11.314  1.00 36.51 ? 2   ILE A CG2 1 
ATOM   12   C  CD1 . ILE A  1 2  ? 27.611  -0.672  12.704  1.00 35.78 ? 2   ILE A CD1 1 
ATOM   13   N  N   . VAL A  1 3  ? 31.532  -3.500  10.626  1.00 35.63 ? 3   VAL A N   1 
ATOM   14   C  CA  . VAL A  1 3  ? 31.406  -4.444  9.509   1.00 37.22 ? 3   VAL A CA  1 
ATOM   15   C  C   . VAL A  1 3  ? 31.853  -5.883  9.861   1.00 38.15 ? 3   VAL A C   1 
ATOM   16   O  O   . VAL A  1 3  ? 31.212  -6.904  9.604   1.00 37.33 ? 3   VAL A O   1 
ATOM   17   C  CB  . VAL A  1 3  ? 32.156  -3.996  8.245   1.00 37.63 ? 3   VAL A CB  1 
ATOM   18   C  CG1 . VAL A  1 3  ? 32.109  -5.089  7.170   1.00 36.78 ? 3   VAL A CG1 1 
ATOM   19   C  CG2 . VAL A  1 3  ? 31.754  -2.668  7.684   1.00 38.18 ? 3   VAL A CG2 1 
ATOM   20   N  N   . GLU A  1 4  ? 33.037  -5.952  10.469  1.00 40.45 ? 4   GLU A N   1 
ATOM   21   C  CA  . GLU A  1 4  ? 33.629  -7.247  10.859  1.00 42.29 ? 4   GLU A CA  1 
ATOM   22   C  C   . GLU A  1 4  ? 32.721  -7.845  11.909  1.00 42.36 ? 4   GLU A C   1 
ATOM   23   O  O   . GLU A  1 4  ? 32.470  -9.061  11.856  1.00 44.47 ? 4   GLU A O   1 
ATOM   24   C  CB  . GLU A  1 4  ? 35.029  -7.100  11.439  1.00 44.15 ? 4   GLU A CB  1 
ATOM   25   C  CG  . GLU A  1 4  ? 36.081  -6.452  10.545  1.00 46.30 ? 4   GLU A CG  1 
ATOM   26   C  CD  . GLU A  1 4  ? 35.906  -5.028  10.096  1.00 47.68 ? 4   GLU A CD  1 
ATOM   27   O  OE1 . GLU A  1 4  ? 35.591  -4.102  10.842  1.00 47.94 ? 4   GLU A OE1 1 
ATOM   28   O  OE2 . GLU A  1 4  ? 36.158  -4.867  8.851   1.00 48.73 ? 4   GLU A OE2 1 
ATOM   29   N  N   . GLN A  1 5  ? 32.239  -6.986  12.787  1.00 41.26 ? 5   GLN A N   1 
ATOM   30   C  CA  . GLN A  1 5  ? 31.357  -7.419  13.856  1.00 40.53 ? 5   GLN A CA  1 
ATOM   31   C  C   . GLN A  1 5  ? 29.895  -7.639  13.501  1.00 38.46 ? 5   GLN A C   1 
ATOM   32   O  O   . GLN A  1 5  ? 29.319  -8.550  14.121  1.00 37.49 ? 5   GLN A O   1 
ATOM   33   C  CB  . GLN A  1 5  ? 31.401  -6.351  14.988  1.00 43.12 ? 5   GLN A CB  1 
ATOM   34   C  CG  . GLN A  1 5  ? 30.267  -6.701  15.916  1.00 47.28 ? 5   GLN A CG  1 
ATOM   35   C  CD  . GLN A  1 5  ? 30.150  -5.991  17.230  1.00 50.03 ? 5   GLN A CD  1 
ATOM   36   O  OE1 . GLN A  1 5  ? 30.243  -4.756  17.338  1.00 51.58 ? 5   GLN A OE1 1 
ATOM   37   N  NE2 . GLN A  1 5  ? 29.921  -6.813  18.275  1.00 51.46 ? 5   GLN A NE2 1 
ATOM   38   N  N   . CYS A  1 6  ? 29.287  -6.847  12.605  1.00 35.41 ? 6   CYS A N   1 
ATOM   39   C  CA  . CYS A  1 6  ? 27.832  -7.041  12.341  1.00 32.34 ? 6   CYS A CA  1 
ATOM   40   C  C   . CYS A  1 6  ? 27.524  -7.632  10.983  1.00 29.92 ? 6   CYS A C   1 
ATOM   41   O  O   . CYS A  1 6  ? 26.298  -7.831  10.722  1.00 29.37 ? 6   CYS A O   1 
ATOM   42   C  CB  . CYS A  1 6  ? 27.056  -5.728  12.593  1.00 32.93 ? 6   CYS A CB  1 
ATOM   43   S  SG  . CYS A  1 6  ? 27.178  -5.220  14.311  1.00 33.27 ? 6   CYS A SG  1 
ATOM   44   N  N   . CYS A  1 7  ? 28.593  -7.852  10.217  1.00 26.27 ? 7   CYS A N   1 
ATOM   45   C  CA  . CYS A  1 7  ? 28.427  -8.475  8.917   1.00 26.24 ? 7   CYS A CA  1 
ATOM   46   C  C   . CYS A  1 7  ? 28.804  -9.965  8.936   1.00 27.40 ? 7   CYS A C   1 
ATOM   47   O  O   . CYS A  1 7  ? 28.471  -10.658 8.001   1.00 26.02 ? 7   CYS A O   1 
ATOM   48   C  CB  . CYS A  1 7  ? 29.081  -7.759  7.778   1.00 25.48 ? 7   CYS A CB  1 
ATOM   49   S  SG  . CYS A  1 7  ? 28.262  -6.150  7.545   1.00 25.10 ? 7   CYS A SG  1 
ATOM   50   N  N   . THR A  1 8  ? 29.400  -10.408 10.001  1.00 30.14 ? 8   THR A N   1 
ATOM   51   C  CA  . THR A  1 8  ? 29.824  -11.850 10.113  1.00 32.64 ? 8   THR A CA  1 
ATOM   52   C  C   . THR A  1 8  ? 28.808  -12.514 10.980  1.00 34.21 ? 8   THR A C   1 
ATOM   53   O  O   . THR A  1 8  ? 28.586  -13.723 10.804  1.00 37.69 ? 8   THR A O   1 
ATOM   54   C  CB  . THR A  1 8  ? 31.370  -11.925 10.453  1.00 31.22 ? 8   THR A CB  1 
ATOM   55   O  OG1 . THR A  1 8  ? 31.453  -11.369 11.785  1.00 30.46 ? 8   THR A OG1 1 
ATOM   56   C  CG2 . THR A  1 8  ? 32.182  -11.111 9.425   1.00 31.75 ? 8   THR A CG2 1 
ATOM   57   N  N   . SER A  1 9  ? 28.160  -11.789 11.851  1.00 34.91 ? 9   SER A N   1 
ATOM   58   C  CA  . SER A  1 9  ? 27.086  -12.293 12.707  1.00 35.73 ? 9   SER A CA  1 
ATOM   59   C  C   . SER A  1 9  ? 26.077  -11.138 12.875  1.00 35.79 ? 9   SER A C   1 
ATOM   60   O  O   . SER A  1 9  ? 26.407  -9.971  12.669  1.00 35.24 ? 9   SER A O   1 
ATOM   61   C  CB  . SER A  1 9  ? 27.454  -12.940 14.006  1.00 36.13 ? 9   SER A CB  1 
ATOM   62   O  OG  . SER A  1 9  ? 27.775  -11.980 14.961  1.00 37.96 ? 9   SER A OG  1 
ATOM   63   N  N   . ILE A  1 10 ? 24.861  -11.530 13.211  1.00 36.21 ? 10  ILE A N   1 
ATOM   64   C  CA  . ILE A  1 10 ? 23.759  -10.595 13.396  1.00 35.22 ? 10  ILE A CA  1 
ATOM   65   C  C   . ILE A  1 10 ? 23.872  -9.853  14.720  1.00 34.23 ? 10  ILE A C   1 
ATOM   66   O  O   . ILE A  1 10 ? 24.031  -10.509 15.740  1.00 34.00 ? 10  ILE A O   1 
ATOM   67   C  CB  . ILE A  1 10 ? 22.353  -11.271 13.310  1.00 35.67 ? 10  ILE A CB  1 
ATOM   68   C  CG1 . ILE A  1 10 ? 22.190  -12.002 11.964  1.00 35.70 ? 10  ILE A CG1 1 
ATOM   69   C  CG2 . ILE A  1 10 ? 21.252  -10.183 13.548  1.00 35.19 ? 10  ILE A CG2 1 
ATOM   70   C  CD1 . ILE A  1 10 ? 21.321  -13.288 12.141  1.00 35.27 ? 10  ILE A CD1 1 
ATOM   71   N  N   . CYS A  1 11 ? 23.798  -8.547  14.668  1.00 32.89 ? 11  CYS A N   1 
ATOM   72   C  CA  . CYS A  1 11 ? 23.888  -7.688  15.852  1.00 33.09 ? 11  CYS A CA  1 
ATOM   73   C  C   . CYS A  1 11 ? 22.481  -7.366  16.325  1.00 34.45 ? 11  CYS A C   1 
ATOM   74   O  O   . CYS A  1 11 ? 21.620  -7.008  15.499  1.00 34.56 ? 11  CYS A O   1 
ATOM   75   C  CB  . CYS A  1 11 ? 24.623  -6.424  15.441  1.00 33.52 ? 11  CYS A CB  1 
ATOM   76   S  SG  . CYS A  1 11 ? 26.412  -6.677  15.472  1.00 33.39 ? 11  CYS A SG  1 
ATOM   77   N  N   . SER A  1 12 ? 22.253  -7.467  17.624  1.00 35.15 ? 12  SER A N   1 
ATOM   78   C  CA  . SER A  1 12 ? 20.869  -7.150  18.064  1.00 37.27 ? 12  SER A CA  1 
ATOM   79   C  C   . SER A  1 12 ? 20.855  -5.609  18.128  1.00 38.86 ? 12  SER A C   1 
ATOM   80   O  O   . SER A  1 12 ? 21.941  -4.995  18.069  1.00 37.34 ? 12  SER A O   1 
ATOM   81   C  CB  . SER A  1 12 ? 20.733  -7.797  19.412  1.00 38.00 ? 12  SER A CB  1 
ATOM   82   O  OG  . SER A  1 12 ? 21.820  -7.236  20.182  1.00 39.25 ? 12  SER A OG  1 
ATOM   83   N  N   . LEU A  1 13 ? 19.665  -5.029  18.257  1.00 39.81 ? 13  LEU A N   1 
ATOM   84   C  CA  . LEU A  1 13 ? 19.595  -3.544  18.312  1.00 41.22 ? 13  LEU A CA  1 
ATOM   85   C  C   . LEU A  1 13 ? 20.360  -3.094  19.545  1.00 40.61 ? 13  LEU A C   1 
ATOM   86   O  O   . LEU A  1 13 ? 20.798  -1.938  19.543  1.00 40.68 ? 13  LEU A O   1 
ATOM   87   C  CB  . LEU A  1 13 ? 18.180  -3.023  18.070  1.00 42.17 ? 13  LEU A CB  1 
ATOM   88   C  CG  . LEU A  1 13 ? 17.415  -3.394  16.818  1.00 42.25 ? 13  LEU A CG  1 
ATOM   89   C  CD1 . LEU A  1 13 ? 16.002  -2.794  16.799  1.00 42.58 ? 13  LEU A CD1 1 
ATOM   90   C  CD2 . LEU A  1 13 ? 18.129  -2.946  15.562  1.00 42.00 ? 13  LEU A CD2 1 
ATOM   91   N  N   . TYR A  1 14 ? 20.590  -3.918  20.549  1.00 41.52 ? 14  TYR A N   1 
ATOM   92   C  CA  . TYR A  1 14 ? 21.397  -3.471  21.725  1.00 41.29 ? 14  TYR A CA  1 
ATOM   93   C  C   . TYR A  1 14 ? 22.863  -3.366  21.370  1.00 40.27 ? 14  TYR A C   1 
ATOM   94   O  O   . TYR A  1 14 ? 23.582  -2.509  21.905  1.00 41.63 ? 14  TYR A O   1 
ATOM   95   C  CB  . TYR A  1 14 ? 21.085  -4.275  22.990  1.00 42.46 ? 14  TYR A CB  1 
ATOM   96   N  N   . GLN A  1 15 ? 23.404  -4.116  20.460  1.00 39.62 ? 15  GLN A N   1 
ATOM   97   C  CA  . GLN A  1 15 ? 24.809  -4.032  20.042  1.00 39.82 ? 15  GLN A CA  1 
ATOM   98   C  C   . GLN A  1 15 ? 24.999  -2.825  19.126  1.00 39.99 ? 15  GLN A C   1 
ATOM   99   O  O   . GLN A  1 15 ? 26.077  -2.198  19.092  1.00 39.77 ? 15  GLN A O   1 
ATOM   100  C  CB  . GLN A  1 15 ? 25.257  -5.293  19.297  1.00 41.05 ? 15  GLN A CB  1 
ATOM   101  C  CG  . GLN A  1 15 ? 25.241  -6.522  20.219  1.00 42.56 ? 15  GLN A CG  1 
ATOM   102  C  CD  . GLN A  1 15 ? 25.459  -7.785  19.444  1.00 44.24 ? 15  GLN A CD  1 
ATOM   103  O  OE1 . GLN A  1 15 ? 24.493  -8.433  19.015  1.00 45.53 ? 15  GLN A OE1 1 
ATOM   104  N  NE2 . GLN A  1 15 ? 26.725  -8.143  19.250  1.00 45.58 ? 15  GLN A NE2 1 
ATOM   105  N  N   . LEU A  1 16 ? 23.907  -2.536  18.403  1.00 38.57 ? 16  LEU A N   1 
ATOM   106  C  CA  . LEU A  1 16 ? 23.920  -1.417  17.441  1.00 38.21 ? 16  LEU A CA  1 
ATOM   107  C  C   . LEU A  1 16 ? 23.952  -0.049  18.122  1.00 39.20 ? 16  LEU A C   1 
ATOM   108  O  O   . LEU A  1 16 ? 24.604  0.895   17.650  1.00 37.23 ? 16  LEU A O   1 
ATOM   109  C  CB  . LEU A  1 16 ? 22.735  -1.666  16.483  1.00 36.62 ? 16  LEU A CB  1 
ATOM   110  C  CG  . LEU A  1 16 ? 22.947  -2.636  15.329  1.00 35.93 ? 16  LEU A CG  1 
ATOM   111  C  CD1 . LEU A  1 16 ? 21.887  -2.359  14.261  1.00 37.03 ? 16  LEU A CD1 1 
ATOM   112  C  CD2 . LEU A  1 16 ? 24.278  -2.433  14.650  1.00 34.31 ? 16  LEU A CD2 1 
ATOM   113  N  N   . GLU A  1 17 ? 23.257  0.092   19.226  1.00 40.97 ? 17  GLU A N   1 
ATOM   114  C  CA  . GLU A  1 17 ? 23.156  1.305   20.012  1.00 44.64 ? 17  GLU A CA  1 
ATOM   115  C  C   . GLU A  1 17 ? 24.511  1.842   20.461  1.00 45.70 ? 17  GLU A C   1 
ATOM   116  O  O   . GLU A  1 17 ? 24.636  3.013   20.846  1.00 45.49 ? 17  GLU A O   1 
ATOM   117  C  CB  . GLU A  1 17 ? 22.261  1.076   21.227  1.00 46.29 ? 17  GLU A CB  1 
ATOM   118  C  CG  . GLU A  1 17 ? 21.478  2.287   21.723  1.00 50.23 ? 17  GLU A CG  1 
ATOM   119  C  CD  . GLU A  1 17 ? 20.691  2.022   22.972  1.00 52.68 ? 17  GLU A CD  1 
ATOM   120  O  OE1 . GLU A  1 17 ? 21.116  1.235   23.809  1.00 54.74 ? 17  GLU A OE1 1 
ATOM   121  O  OE2 . GLU A  1 17 ? 19.603  2.629   23.085  1.00 54.39 ? 17  GLU A OE2 1 
ATOM   122  N  N   . ASN A  1 18 ? 25.558  1.050   20.411  1.00 47.26 ? 18  ASN A N   1 
ATOM   123  C  CA  . ASN A  1 18 ? 26.912  1.414   20.805  1.00 48.26 ? 18  ASN A CA  1 
ATOM   124  C  C   . ASN A  1 18 ? 27.568  2.376   19.812  1.00 48.74 ? 18  ASN A C   1 
ATOM   125  O  O   . ASN A  1 18 ? 28.525  3.086   20.183  1.00 49.36 ? 18  ASN A O   1 
ATOM   126  C  CB  . ASN A  1 18 ? 27.792  0.154   20.921  1.00 49.74 ? 18  ASN A CB  1 
ATOM   127  C  CG  . ASN A  1 18 ? 27.557  -0.501  22.271  1.00 50.91 ? 18  ASN A CG  1 
ATOM   128  O  OD1 . ASN A  1 18 ? 26.513  -0.252  22.907  1.00 52.09 ? 18  ASN A OD1 1 
ATOM   129  N  ND2 . ASN A  1 18 ? 28.513  -1.311  22.716  1.00 52.01 ? 18  ASN A ND2 1 
ATOM   130  N  N   . TYR A  1 19 ? 27.060  2.348   18.594  1.00 47.12 ? 19  TYR A N   1 
ATOM   131  C  CA  . TYR A  1 19 ? 27.666  3.206   17.567  1.00 46.41 ? 19  TYR A CA  1 
ATOM   132  C  C   . TYR A  1 19 ? 26.895  4.502   17.446  1.00 45.79 ? 19  TYR A C   1 
ATOM   133  O  O   . TYR A  1 19 ? 27.203  5.363   16.608  1.00 46.54 ? 19  TYR A O   1 
ATOM   134  C  CB  . TYR A  1 19 ? 27.782  2.340   16.313  1.00 46.33 ? 19  TYR A CB  1 
ATOM   135  C  CG  . TYR A  1 19 ? 28.548  1.054   16.390  1.00 46.96 ? 19  TYR A CG  1 
ATOM   136  C  CD1 . TYR A  1 19 ? 27.964  -0.165  16.755  1.00 46.99 ? 19  TYR A CD1 1 
ATOM   137  C  CD2 . TYR A  1 19 ? 29.916  1.019   16.056  1.00 47.28 ? 19  TYR A CD2 1 
ATOM   138  C  CE1 . TYR A  1 19 ? 28.662  -1.372  16.787  1.00 47.40 ? 19  TYR A CE1 1 
ATOM   139  C  CE2 . TYR A  1 19 ? 30.651  -0.169  16.067  1.00 47.28 ? 19  TYR A CE2 1 
ATOM   140  C  CZ  . TYR A  1 19 ? 30.014  -1.351  16.445  1.00 47.83 ? 19  TYR A CZ  1 
ATOM   141  O  OH  . TYR A  1 19 ? 30.717  -2.523  16.484  1.00 48.45 ? 19  TYR A OH  1 
ATOM   142  N  N   . CYS A  1 20 ? 25.861  4.652   18.250  1.00 45.44 ? 20  CYS A N   1 
ATOM   143  C  CA  . CYS A  1 20 ? 25.034  5.880   18.240  1.00 45.18 ? 20  CYS A CA  1 
ATOM   144  C  C   . CYS A  1 20 ? 25.931  6.963   18.855  1.00 47.00 ? 20  CYS A C   1 
ATOM   145  O  O   . CYS A  1 20 ? 26.770  6.585   19.697  1.00 47.40 ? 20  CYS A O   1 
ATOM   146  C  CB  . CYS A  1 20 ? 23.779  5.751   19.081  1.00 42.18 ? 20  CYS A CB  1 
ATOM   147  S  SG  . CYS A  1 20 ? 22.569  4.544   18.538  1.00 39.45 ? 20  CYS A SG  1 
ATOM   148  N  N   . ASN A  1 21 ? 25.792  8.217   18.482  1.00 49.51 ? 21  ASN A N   1 
ATOM   149  C  CA  . ASN A  1 21 ? 26.725  9.173   19.163  1.00 52.10 ? 21  ASN A CA  1 
ATOM   150  C  C   . ASN A  1 21 ? 25.887  9.785   20.288  1.00 53.17 ? 21  ASN A C   1 
ATOM   151  O  O   . ASN A  1 21 ? 26.055  10.993  20.496  1.00 54.55 ? 21  ASN A O   1 
ATOM   152  C  CB  . ASN A  1 21 ? 27.598  9.992   18.276  1.00 52.43 ? 21  ASN A CB  1 
ATOM   153  C  CG  . ASN A  1 21 ? 26.968  10.977  17.345  1.00 53.55 ? 21  ASN A CG  1 
ATOM   154  O  OD1 . ASN A  1 21 ? 27.509  11.229  16.255  1.00 54.34 ? 21  ASN A OD1 1 
ATOM   155  N  ND2 . ASN A  1 21 ? 25.852  11.506  17.848  1.00 53.84 ? 21  ASN A ND2 1 
ATOM   156  O  OXT . ASN A  1 21 ? 25.148  8.949   20.857  1.00 54.80 ? 21  ASN A OXT 1 
ATOM   157  N  N   . PHE B  2 1  ? 34.398  -5.755  -2.026  1.00 22.94 ? 1   PHE B N   1 
ATOM   158  C  CA  . PHE B  2 1  ? 33.562  -6.933  -1.739  1.00 22.49 ? 1   PHE B CA  1 
ATOM   159  C  C   . PHE B  2 1  ? 32.107  -6.368  -1.753  1.00 20.00 ? 1   PHE B C   1 
ATOM   160  O  O   . PHE B  2 1  ? 31.865  -5.607  -0.830  1.00 20.56 ? 1   PHE B O   1 
ATOM   161  C  CB  . PHE B  2 1  ? 33.925  -7.619  -0.417  1.00 23.36 ? 1   PHE B CB  1 
ATOM   162  C  CG  . PHE B  2 1  ? 35.374  -8.134  -0.432  1.00 25.02 ? 1   PHE B CG  1 
ATOM   163  C  CD1 . PHE B  2 1  ? 35.722  -9.259  -1.190  1.00 25.14 ? 1   PHE B CD1 1 
ATOM   164  C  CD2 . PHE B  2 1  ? 36.336  -7.484  0.358   1.00 26.03 ? 1   PHE B CD2 1 
ATOM   165  C  CE1 . PHE B  2 1  ? 37.054  -9.688  -1.246  1.00 25.96 ? 1   PHE B CE1 1 
ATOM   166  C  CE2 . PHE B  2 1  ? 37.687  -7.943  0.324   1.00 27.44 ? 1   PHE B CE2 1 
ATOM   167  C  CZ  . PHE B  2 1  ? 38.016  -9.038  -0.476  1.00 24.67 ? 1   PHE B CZ  1 
ATOM   168  N  N   . VAL B  2 2  ? 31.367  -6.828  -2.689  1.00 20.71 ? 2   VAL B N   1 
ATOM   169  C  CA  . VAL B  2 2  ? 29.931  -6.368  -2.785  1.00 19.85 ? 2   VAL B CA  1 
ATOM   170  C  C   . VAL B  2 2  ? 29.146  -6.840  -1.595  1.00 20.45 ? 2   VAL B C   1 
ATOM   171  O  O   . VAL B  2 2  ? 28.266  -6.111  -1.129  1.00 18.44 ? 2   VAL B O   1 
ATOM   172  C  CB  . VAL B  2 2  ? 29.344  -6.730  -4.128  1.00 18.14 ? 2   VAL B CB  1 
ATOM   173  C  CG1 . VAL B  2 2  ? 27.801  -6.729  -4.169  1.00 19.27 ? 2   VAL B CG1 1 
ATOM   174  C  CG2 . VAL B  2 2  ? 29.938  -5.928  -5.252  1.00 20.57 ? 2   VAL B CG2 1 
ATOM   175  N  N   . ASN B  2 3  ? 29.417  -8.069  -1.077  1.00 17.65 ? 3   ASN B N   1 
ATOM   176  C  CA  . ASN B  2 3  ? 28.693  -8.548  0.086   1.00 16.60 ? 3   ASN B CA  1 
ATOM   177  C  C   . ASN B  2 3  ? 28.707  -7.606  1.263   1.00 18.07 ? 3   ASN B C   1 
ATOM   178  O  O   . ASN B  2 3  ? 27.750  -7.333  2.071   1.00 17.83 ? 3   ASN B O   1 
ATOM   179  C  CB  . ASN B  2 3  ? 29.111  -9.972  0.492   1.00 18.87 ? 3   ASN B CB  1 
ATOM   180  C  CG  . ASN B  2 3  ? 30.547  -10.200 0.942   1.00 17.75 ? 3   ASN B CG  1 
ATOM   181  O  OD1 . ASN B  2 3  ? 31.506  -9.433  0.825   1.00 17.20 ? 3   ASN B OD1 1 
ATOM   182  N  ND2 . ASN B  2 3  ? 30.781  -11.411 1.521   1.00 17.64 ? 3   ASN B ND2 1 
ATOM   183  N  N   . GLN B  2 4  ? 29.909  -7.084  1.564   1.00 17.07 ? 4   GLN B N   1 
ATOM   184  C  CA  . GLN B  2 4  ? 30.152  -6.123  2.648   1.00 19.12 ? 4   GLN B CA  1 
ATOM   185  C  C   . GLN B  2 4  ? 29.462  -4.783  2.271   1.00 16.78 ? 4   GLN B C   1 
ATOM   186  O  O   . GLN B  2 4  ? 28.958  -4.086  3.145   1.00 17.46 ? 4   GLN B O   1 
ATOM   187  C  CB  . GLN B  2 4  ? 31.697  -5.902  2.870   1.00 22.81 ? 4   GLN B CB  1 
ATOM   188  C  CG  . GLN B  2 4  ? 32.379  -6.958  3.705   1.00 30.07 ? 4   GLN B CG  1 
ATOM   189  C  CD  . GLN B  2 4  ? 33.869  -7.125  3.899   1.00 32.22 ? 4   GLN B CD  1 
ATOM   190  O  OE1 . GLN B  2 4  ? 34.506  -7.413  4.934   1.00 35.84 ? 4   GLN B OE1 1 
ATOM   191  N  NE2 . GLN B  2 4  ? 34.724  -7.011  2.905   1.00 33.63 ? 4   GLN B NE2 1 
ATOM   192  N  N   . HIS B  2 5  ? 29.462  -4.380  1.072   1.00 15.97 ? 5   HIS B N   1 
ATOM   193  C  CA  . HIS B  2 5  ? 28.871  -3.189  0.479   1.00 17.68 ? 5   HIS B CA  1 
ATOM   194  C  C   . HIS B  2 5  ? 27.338  -3.226  0.747   1.00 19.16 ? 5   HIS B C   1 
ATOM   195  O  O   . HIS B  2 5  ? 26.801  -2.256  1.280   1.00 16.35 ? 5   HIS B O   1 
ATOM   196  C  CB  . HIS B  2 5  ? 29.115  -3.119  -1.018  1.00 18.98 ? 5   HIS B CB  1 
ATOM   197  C  CG  . HIS B  2 5  ? 28.747  -1.763  -1.558  1.00 24.08 ? 5   HIS B CG  1 
ATOM   198  N  ND1 . HIS B  2 5  ? 29.119  -0.574  -1.005  1.00 23.85 ? 5   HIS B ND1 1 
ATOM   199  C  CD2 . HIS B  2 5  ? 28.045  -1.490  -2.669  1.00 25.33 ? 5   HIS B CD2 1 
ATOM   200  C  CE1 . HIS B  2 5  ? 28.625  0.405   -1.726  1.00 25.51 ? 5   HIS B CE1 1 
ATOM   201  N  NE2 . HIS B  2 5  ? 28.009  -0.104  -2.752  1.00 27.30 ? 5   HIS B NE2 1 
ATOM   202  N  N   . LEU B  2 6  ? 26.711  -4.369  0.477   1.00 17.30 ? 6   LEU B N   1 
ATOM   203  C  CA  . LEU B  2 6  ? 25.294  -4.627  0.741   1.00 17.35 ? 6   LEU B CA  1 
ATOM   204  C  C   . LEU B  2 6  ? 24.934  -4.615  2.157   1.00 17.13 ? 6   LEU B C   1 
ATOM   205  O  O   . LEU B  2 6  ? 23.917  -3.985  2.612   1.00 18.16 ? 6   LEU B O   1 
ATOM   206  C  CB  . LEU B  2 6  ? 24.880  -5.880  -0.057  1.00 18.00 ? 6   LEU B CB  1 
ATOM   207  C  CG  . LEU B  2 6  ? 25.083  -5.870  -1.514  1.00 19.55 ? 6   LEU B CG  1 
ATOM   208  C  CD1 . LEU B  2 6  ? 24.429  -7.089  -2.205  1.00 21.21 ? 6   LEU B CD1 1 
ATOM   209  C  CD2 . LEU B  2 6  ? 24.633  -4.687  -2.372  1.00 22.70 ? 6   LEU B CD2 1 
ATOM   210  N  N   . CYS B  2 7  ? 25.683  -5.319  3.007   1.00 16.14 ? 7   CYS B N   1 
ATOM   211  C  CA  . CYS B  2 7  ? 25.456  -5.342  4.429   1.00 17.34 ? 7   CYS B CA  1 
ATOM   212  C  C   . CYS B  2 7  ? 25.513  -3.918  5.059   1.00 18.04 ? 7   CYS B C   1 
ATOM   213  O  O   . CYS B  2 7  ? 24.710  -3.601  5.964   1.00 17.66 ? 7   CYS B O   1 
ATOM   214  C  CB  . CYS B  2 7  ? 26.554  -6.209  5.156   1.00 16.79 ? 7   CYS B CB  1 
ATOM   215  S  SG  . CYS B  2 7  ? 26.373  -6.423  6.892   1.00 20.56 ? 7   CYS B SG  1 
ATOM   216  N  N   . GLY B  2 8  ? 26.527  -3.164  4.683   1.00 17.13 ? 8   GLY B N   1 
ATOM   217  C  CA  . GLY B  2 8  ? 26.703  -1.819  5.263   1.00 16.26 ? 8   GLY B CA  1 
ATOM   218  C  C   . GLY B  2 8  ? 25.462  -0.992  4.883   1.00 13.06 ? 8   GLY B C   1 
ATOM   219  O  O   . GLY B  2 8  ? 25.149  -0.354  5.856   1.00 18.21 ? 8   GLY B O   1 
ATOM   220  N  N   . SER B  2 9  ? 24.875  -1.097  3.751   1.00 16.74 ? 9   SER B N   1 
ATOM   221  C  CA  . SER B  2 9  ? 23.667  -0.410  3.315   1.00 18.93 ? 9   SER B CA  1 
ATOM   222  C  C   . SER B  2 9  ? 22.556  -0.584  4.356   1.00 19.60 ? 9   SER B C   1 
ATOM   223  O  O   . SER B  2 9  ? 21.770  0.237   4.861   1.00 18.28 ? 9   SER B O   1 
ATOM   224  C  CB  . SER B  2 9  ? 23.114  -1.114  2.090   1.00 20.66 ? 9   SER B CB  1 
ATOM   225  O  OG  A SER B  2 9  ? 22.098  -0.197  1.717   0.50 22.66 ? 9   SER B OG  1 
ATOM   226  O  OG  B SER B  2 9  ? 23.749  -0.681  0.920   0.50 22.53 ? 9   SER B OG  1 
ATOM   227  N  N   . HIS B  2 10 ? 22.394  -1.877  4.771   1.00 17.59 ? 10  HIS B N   1 
ATOM   228  C  CA  . HIS B  2 10 ? 21.428  -2.412  5.737   1.00 15.80 ? 10  HIS B CA  1 
ATOM   229  C  C   . HIS B  2 10 ? 21.843  -1.957  7.104   1.00 16.85 ? 10  HIS B C   1 
ATOM   230  O  O   . HIS B  2 10 ? 20.972  -1.594  7.931   1.00 16.21 ? 10  HIS B O   1 
ATOM   231  C  CB  . HIS B  2 10 ? 21.288  -3.997  5.742   1.00 14.33 ? 10  HIS B CB  1 
ATOM   232  C  CG  . HIS B  2 10 ? 20.583  -4.404  4.463   1.00 12.16 ? 10  HIS B CG  1 
ATOM   233  N  ND1 . HIS B  2 10 ? 19.171  -4.319  4.321   1.00 13.06 ? 10  HIS B ND1 1 
ATOM   234  C  CD2 . HIS B  2 10 ? 20.928  -4.812  3.306   1.00 10.08 ? 10  HIS B CD2 1 
ATOM   235  C  CE1 . HIS B  2 10 ? 18.838  -4.587  3.084   1.00 12.00 ? 10  HIS B CE1 1 
ATOM   236  N  NE2 . HIS B  2 10 ? 19.927  -5.082  2.379   1.00 7.57  ? 10  HIS B NE2 1 
ATOM   237  N  N   . LEU B  2 11 ? 23.181  -1.940  7.434   1.00 16.82 ? 11  LEU B N   1 
ATOM   238  C  CA  . LEU B  2 11 ? 23.522  -1.493  8.778   1.00 17.56 ? 11  LEU B CA  1 
ATOM   239  C  C   . LEU B  2 11 ? 23.256  0.054   8.931   1.00 16.14 ? 11  LEU B C   1 
ATOM   240  O  O   . LEU B  2 11 ? 22.951  0.314   10.080  1.00 17.09 ? 11  LEU B O   1 
ATOM   241  C  CB  . LEU B  2 11 ? 25.031  -1.610  9.052   1.00 20.76 ? 11  LEU B CB  1 
ATOM   242  C  CG  . LEU B  2 11 ? 25.644  -2.947  9.299   1.00 22.66 ? 11  LEU B CG  1 
ATOM   243  C  CD1 . LEU B  2 11 ? 27.159  -2.796  9.281   1.00 25.44 ? 11  LEU B CD1 1 
ATOM   244  C  CD2 . LEU B  2 11 ? 25.153  -3.330  10.687  1.00 23.27 ? 11  LEU B CD2 1 
ATOM   245  N  N   . VAL B  2 12 ? 23.444  0.838   7.917   1.00 17.61 ? 12  VAL B N   1 
ATOM   246  C  CA  . VAL B  2 12 ? 23.200  2.317   8.117   1.00 20.11 ? 12  VAL B CA  1 
ATOM   247  C  C   . VAL B  2 12 ? 21.690  2.546   8.392   1.00 20.68 ? 12  VAL B C   1 
ATOM   248  O  O   . VAL B  2 12 ? 21.360  3.430   9.195   1.00 21.15 ? 12  VAL B O   1 
ATOM   249  C  CB  . VAL B  2 12 ? 23.739  3.161   6.973   1.00 18.86 ? 12  VAL B CB  1 
ATOM   250  C  CG1 . VAL B  2 12 ? 25.300  3.113   7.008   1.00 19.80 ? 12  VAL B CG1 1 
ATOM   251  C  CG2 . VAL B  2 12 ? 23.209  2.972   5.591   1.00 18.43 ? 12  VAL B CG2 1 
ATOM   252  N  N   . GLU B  2 13 ? 20.846  1.747   7.731   1.00 21.74 ? 13  GLU B N   1 
ATOM   253  C  CA  . GLU B  2 13 ? 19.371  1.829   7.937   1.00 23.37 ? 13  GLU B CA  1 
ATOM   254  C  C   . GLU B  2 13 ? 19.021  1.426   9.295   1.00 20.85 ? 13  GLU B C   1 
ATOM   255  O  O   . GLU B  2 13 ? 18.217  2.150   9.891   1.00 20.77 ? 13  GLU B O   1 
ATOM   256  C  CB  . GLU B  2 13 ? 18.644  1.096   6.815   1.00 28.09 ? 13  GLU B CB  1 
ATOM   257  C  CG  . GLU B  2 13 ? 18.804  1.872   5.465   1.00 36.34 ? 13  GLU B CG  1 
ATOM   258  C  CD  . GLU B  2 13 ? 18.410  3.330   5.382   1.00 40.68 ? 13  GLU B CD  1 
ATOM   259  O  OE1 . GLU B  2 13 ? 17.496  3.882   6.017   1.00 43.67 ? 13  GLU B OE1 1 
ATOM   260  O  OE2 . GLU B  2 13 ? 19.116  4.046   4.601   1.00 43.40 ? 13  GLU B OE2 1 
ATOM   261  N  N   . ALA B  2 14 ? 19.543  0.372   9.930   1.00 20.43 ? 14  ALA B N   1 
ATOM   262  C  CA  . ALA B  2 14 ? 19.307  0.001   11.306  1.00 19.57 ? 14  ALA B CA  1 
ATOM   263  C  C   . ALA B  2 14 ? 19.860  1.081   12.270  1.00 21.21 ? 14  ALA B C   1 
ATOM   264  O  O   . ALA B  2 14 ? 19.213  1.404   13.322  1.00 21.85 ? 14  ALA B O   1 
ATOM   265  C  CB  . ALA B  2 14 ? 19.984  -1.348  11.670  1.00 19.97 ? 14  ALA B CB  1 
ATOM   266  N  N   . LEU B  2 15 ? 21.033  1.652   12.038  1.00 19.01 ? 15  LEU B N   1 
ATOM   267  C  CA  . LEU B  2 15 ? 21.562  2.680   12.941  1.00 20.65 ? 15  LEU B CA  1 
ATOM   268  C  C   . LEU B  2 15 ? 20.631  3.908   12.982  1.00 19.75 ? 15  LEU B C   1 
ATOM   269  O  O   . LEU B  2 15 ? 20.408  4.468   14.059  1.00 22.77 ? 15  LEU B O   1 
ATOM   270  C  CB  . LEU B  2 15 ? 23.004  3.034   12.503  1.00 21.32 ? 15  LEU B CB  1 
ATOM   271  C  CG  . LEU B  2 15 ? 24.129  2.052   12.839  1.00 20.77 ? 15  LEU B CG  1 
ATOM   272  C  CD1 . LEU B  2 15 ? 25.477  2.545   12.315  1.00 22.97 ? 15  LEU B CD1 1 
ATOM   273  C  CD2 . LEU B  2 15 ? 24.281  1.797   14.318  1.00 22.44 ? 15  LEU B CD2 1 
ATOM   274  N  N   . TYR B  2 16 ? 20.152  4.283   11.828  1.00 21.03 ? 16  TYR B N   1 
ATOM   275  C  CA  . TYR B  2 16 ? 19.224  5.424   11.686  1.00 22.45 ? 16  TYR B CA  1 
ATOM   276  C  C   . TYR B  2 16 ? 18.064  5.308   12.669  1.00 25.07 ? 16  TYR B C   1 
ATOM   277  O  O   . TYR B  2 16 ? 17.680  6.185   13.478  1.00 23.93 ? 16  TYR B O   1 
ATOM   278  C  CB  . TYR B  2 16 ? 18.788  5.541   10.238  1.00 21.62 ? 16  TYR B CB  1 
ATOM   279  C  CG  . TYR B  2 16 ? 17.724  6.629   10.072  1.00 22.61 ? 16  TYR B CG  1 
ATOM   280  C  CD1 . TYR B  2 16 ? 18.157  7.978   10.067  1.00 22.65 ? 16  TYR B CD1 1 
ATOM   281  C  CD2 . TYR B  2 16 ? 16.373  6.386   9.928   1.00 23.31 ? 16  TYR B CD2 1 
ATOM   282  C  CE1 . TYR B  2 16 ? 17.234  9.019   9.925   1.00 23.01 ? 16  TYR B CE1 1 
ATOM   283  C  CE2 . TYR B  2 16 ? 15.421  7.396   9.758   1.00 21.77 ? 16  TYR B CE2 1 
ATOM   284  C  CZ  . TYR B  2 16 ? 15.884  8.710   9.759   1.00 23.10 ? 16  TYR B CZ  1 
ATOM   285  O  OH  . TYR B  2 16 ? 14.983  9.746   9.640   1.00 23.25 ? 16  TYR B OH  1 
ATOM   286  N  N   . LEU B  2 17 ? 17.412  4.149   12.639  1.00 25.07 ? 17  LEU B N   1 
ATOM   287  C  CA  . LEU B  2 17 ? 16.293  3.713   13.455  1.00 27.25 ? 17  LEU B CA  1 
ATOM   288  C  C   . LEU B  2 17 ? 16.654  3.552   14.899  1.00 28.00 ? 17  LEU B C   1 
ATOM   289  O  O   . LEU B  2 17 ? 15.931  4.121   15.751  1.00 26.83 ? 17  LEU B O   1 
ATOM   290  C  CB  . LEU B  2 17 ? 15.701  2.536   12.690  1.00 29.61 ? 17  LEU B CB  1 
ATOM   291  C  CG  . LEU B  2 17 ? 14.261  2.783   12.261  1.00 33.87 ? 17  LEU B CG  1 
ATOM   292  C  CD1 . LEU B  2 17 ? 13.432  3.185   13.499  1.00 35.61 ? 17  LEU B CD1 1 
ATOM   293  C  CD2 . LEU B  2 17 ? 14.093  3.830   11.177  1.00 34.47 ? 17  LEU B CD2 1 
ATOM   294  N  N   . VAL B  2 18 ? 17.739  2.890   15.243  1.00 28.89 ? 18  VAL B N   1 
ATOM   295  C  CA  . VAL B  2 18 ? 18.120  2.707   16.645  1.00 31.12 ? 18  VAL B CA  1 
ATOM   296  C  C   . VAL B  2 18 ? 18.579  4.004   17.343  1.00 33.11 ? 18  VAL B C   1 
ATOM   297  O  O   . VAL B  2 18 ? 18.235  4.239   18.530  1.00 33.26 ? 18  VAL B O   1 
ATOM   298  C  CB  . VAL B  2 18 ? 19.117  1.536   16.755  1.00 31.56 ? 18  VAL B CB  1 
ATOM   299  C  CG1 . VAL B  2 18 ? 19.900  1.503   18.052  1.00 33.15 ? 18  VAL B CG1 1 
ATOM   300  C  CG2 . VAL B  2 18 ? 18.423  0.178   16.627  1.00 33.30 ? 18  VAL B CG2 1 
ATOM   301  N  N   . CYS B  2 19 ? 19.364  4.804   16.673  1.00 33.65 ? 19  CYS B N   1 
ATOM   302  C  CA  . CYS B  2 19 ? 19.944  6.031   17.225  1.00 35.59 ? 19  CYS B CA  1 
ATOM   303  C  C   . CYS B  2 19 ? 18.981  7.208   17.304  1.00 37.53 ? 19  CYS B C   1 
ATOM   304  O  O   . CYS B  2 19 ? 19.181  8.059   18.179  1.00 38.24 ? 19  CYS B O   1 
ATOM   305  C  CB  . CYS B  2 19 ? 21.205  6.298   16.409  1.00 35.69 ? 19  CYS B CB  1 
ATOM   306  S  SG  . CYS B  2 19 ? 22.369  4.893   16.590  1.00 35.21 ? 19  CYS B SG  1 
ATOM   307  N  N   . GLY B  2 20 ? 17.982  7.274   16.474  1.00 38.80 ? 20  GLY B N   1 
ATOM   308  C  CA  . GLY B  2 20 ? 16.980  8.343   16.478  1.00 41.96 ? 20  GLY B CA  1 
ATOM   309  C  C   . GLY B  2 20 ? 17.678  9.702   16.516  1.00 42.48 ? 20  GLY B C   1 
ATOM   310  O  O   . GLY B  2 20 ? 18.613  9.945   15.771  1.00 41.56 ? 20  GLY B O   1 
ATOM   311  N  N   . GLU B  2 21 ? 17.189  10.538  17.410  1.00 44.58 ? 21  GLU B N   1 
ATOM   312  C  CA  . GLU B  2 21 ? 17.628  11.896  17.689  1.00 46.04 ? 21  GLU B CA  1 
ATOM   313  C  C   . GLU B  2 21 ? 19.135  12.104  17.771  1.00 45.20 ? 21  GLU B C   1 
ATOM   314  O  O   . GLU B  2 21 ? 19.649  13.093  17.226  1.00 45.41 ? 21  GLU B O   1 
ATOM   315  C  CB  . GLU B  2 21 ? 16.968  12.263  19.029  1.00 48.41 ? 21  GLU B CB  1 
ATOM   316  C  CG  . GLU B  2 21 ? 17.713  13.089  20.076  1.00 52.37 ? 21  GLU B CG  1 
ATOM   317  C  CD  . GLU B  2 21 ? 16.807  14.117  20.745  1.00 54.08 ? 21  GLU B CD  1 
ATOM   318  O  OE1 . GLU B  2 21 ? 16.243  15.016  20.117  1.00 55.31 ? 21  GLU B OE1 1 
ATOM   319  O  OE2 . GLU B  2 21 ? 16.673  13.910  21.974  1.00 55.22 ? 21  GLU B OE2 1 
ATOM   320  N  N   . ARG B  2 22 ? 19.860  11.247  18.442  1.00 43.75 ? 22  ARG B N   1 
ATOM   321  C  CA  . ARG B  2 22 ? 21.285  11.278  18.610  1.00 43.27 ? 22  ARG B CA  1 
ATOM   322  C  C   . ARG B  2 22 ? 22.099  11.140  17.343  1.00 41.89 ? 22  ARG B C   1 
ATOM   323  O  O   . ARG B  2 22 ? 23.216  11.692  17.392  1.00 42.19 ? 22  ARG B O   1 
ATOM   324  C  CB  . ARG B  2 22 ? 21.784  10.095  19.436  1.00 45.15 ? 22  ARG B CB  1 
ATOM   325  C  CG  . ARG B  2 22 ? 20.950  9.938   20.717  1.00 47.95 ? 22  ARG B CG  1 
ATOM   326  C  CD  . ARG B  2 22 ? 21.537  8.745   21.446  1.00 48.30 ? 22  ARG B CD  1 
ATOM   327  N  NE  . ARG B  2 22 ? 20.523  7.684   21.303  1.00 48.82 ? 22  ARG B NE  1 
ATOM   328  C  CZ  . ARG B  2 22 ? 20.801  6.466   21.806  1.00 48.95 ? 22  ARG B CZ  1 
ATOM   329  N  NH1 . ARG B  2 22 ? 21.940  6.209   22.437  1.00 49.05 ? 22  ARG B NH1 1 
ATOM   330  N  NH2 . ARG B  2 22 ? 19.848  5.562   21.596  1.00 48.86 ? 22  ARG B NH2 1 
ATOM   331  N  N   . GLY B  2 23 ? 21.646  10.435  16.319  1.00 39.87 ? 23  GLY B N   1 
ATOM   332  C  CA  . GLY B  2 23 ? 22.480  10.289  15.109  1.00 37.32 ? 23  GLY B CA  1 
ATOM   333  C  C   . GLY B  2 23 ? 23.592  9.260   15.446  1.00 35.62 ? 23  GLY B C   1 
ATOM   334  O  O   . GLY B  2 23 ? 23.693  8.663   16.522  1.00 35.13 ? 23  GLY B O   1 
ATOM   335  N  N   . PHE B  2 24 ? 24.462  9.056   14.496  1.00 34.29 ? 24  PHE B N   1 
ATOM   336  C  CA  . PHE B  2 24 ? 25.555  8.104   14.557  1.00 32.89 ? 24  PHE B CA  1 
ATOM   337  C  C   . PHE B  2 24 ? 26.620  8.539   13.579  1.00 33.29 ? 24  PHE B C   1 
ATOM   338  O  O   . PHE B  2 24 ? 26.554  9.421   12.705  1.00 33.70 ? 24  PHE B O   1 
ATOM   339  C  CB  . PHE B  2 24 ? 24.992  6.696   14.199  1.00 30.46 ? 24  PHE B CB  1 
ATOM   340  C  CG  . PHE B  2 24 ? 24.441  6.635   12.793  1.00 28.06 ? 24  PHE B CG  1 
ATOM   341  C  CD1 . PHE B  2 24 ? 25.226  6.304   11.709  1.00 26.80 ? 24  PHE B CD1 1 
ATOM   342  C  CD2 . PHE B  2 24 ? 23.107  6.939   12.532  1.00 27.27 ? 24  PHE B CD2 1 
ATOM   343  C  CE1 . PHE B  2 24 ? 24.690  6.240   10.425  1.00 25.48 ? 24  PHE B CE1 1 
ATOM   344  C  CE2 . PHE B  2 24 ? 22.546  6.902   11.249  1.00 26.01 ? 24  PHE B CE2 1 
ATOM   345  C  CZ  . PHE B  2 24 ? 23.364  6.577   10.171  1.00 25.07 ? 24  PHE B CZ  1 
ATOM   346  N  N   . PHE B  2 25 ? 27.712  7.775   13.701  1.00 36.42 ? 25  PHE B N   1 
ATOM   347  C  CA  . PHE B  2 25 ? 28.890  7.936   12.860  1.00 37.68 ? 25  PHE B CA  1 
ATOM   348  C  C   . PHE B  2 25 ? 29.135  6.679   12.043  1.00 36.96 ? 25  PHE B C   1 
ATOM   349  O  O   . PHE B  2 25 ? 29.096  5.629   12.705  1.00 38.82 ? 25  PHE B O   1 
ATOM   350  C  CB  . PHE B  2 25 ? 30.134  8.193   13.742  1.00 38.99 ? 25  PHE B CB  1 
ATOM   351  C  CG  A PHE B  2 25 ? 30.349  7.053   14.709  0.67 39.63 ? 25  PHE B CG  1 
ATOM   352  C  CG  B PHE B  2 25 ? 30.745  9.469   13.205  0.33 39.60 ? 25  PHE B CG  1 
ATOM   353  C  CD1 A PHE B  2 25 ? 29.711  7.038   15.953  0.67 38.81 ? 25  PHE B CD1 1 
ATOM   354  C  CD1 B PHE B  2 25 ? 31.243  9.495   11.909  0.33 40.10 ? 25  PHE B CD1 1 
ATOM   355  C  CD2 A PHE B  2 25 ? 31.208  6.002   14.352  0.67 39.90 ? 25  PHE B CD2 1 
ATOM   356  C  CD2 B PHE B  2 25 ? 30.738  10.620  13.986  0.33 39.98 ? 25  PHE B CD2 1 
ATOM   357  C  CE1 A PHE B  2 25 ? 29.972  6.012   16.821  0.67 39.15 ? 25  PHE B CE1 1 
ATOM   358  C  CE1 B PHE B  2 25 ? 31.775  10.681  11.395  0.33 40.71 ? 25  PHE B CE1 1 
ATOM   359  C  CE2 A PHE B  2 25 ? 31.445  4.939   15.225  0.67 39.34 ? 25  PHE B CE2 1 
ATOM   360  C  CE2 B PHE B  2 25 ? 31.268  11.802  13.504  0.33 40.37 ? 25  PHE B CE2 1 
ATOM   361  C  CZ  A PHE B  2 25 ? 30.818  4.962   16.466  0.67 38.77 ? 25  PHE B CZ  1 
ATOM   362  C  CZ  B PHE B  2 25 ? 31.793  11.831  12.209  0.33 40.93 ? 25  PHE B CZ  1 
ATOM   363  N  N   . TYR B  2 26 ? 29.361  6.834   10.770  1.00 36.95 ? 26  TYR B N   1 
ATOM   364  C  CA  . TYR B  2 26 ? 29.610  5.578   10.039  1.00 37.39 ? 26  TYR B CA  1 
ATOM   365  C  C   . TYR B  2 26 ? 31.004  5.666   9.423   1.00 38.58 ? 26  TYR B C   1 
ATOM   366  O  O   . TYR B  2 26 ? 31.230  6.323   8.418   1.00 38.04 ? 26  TYR B O   1 
ATOM   367  C  CB  . TYR B  2 26 ? 28.544  5.151   9.067   1.00 36.01 ? 26  TYR B CB  1 
ATOM   368  C  CG  . TYR B  2 26 ? 28.785  3.790   8.459   1.00 35.21 ? 26  TYR B CG  1 
ATOM   369  C  CD1 . TYR B  2 26 ? 28.420  2.612   9.137   1.00 34.94 ? 26  TYR B CD1 1 
ATOM   370  C  CD2 . TYR B  2 26 ? 29.416  3.684   7.217   1.00 34.71 ? 26  TYR B CD2 1 
ATOM   371  C  CE1 . TYR B  2 26 ? 28.631  1.357   8.563   1.00 35.49 ? 26  TYR B CE1 1 
ATOM   372  C  CE2 . TYR B  2 26 ? 29.630  2.457   6.612   1.00 35.06 ? 26  TYR B CE2 1 
ATOM   373  C  CZ  . TYR B  2 26 ? 29.227  1.303   7.317   1.00 35.52 ? 26  TYR B CZ  1 
ATOM   374  O  OH  . TYR B  2 26 ? 29.447  0.089   6.699   1.00 37.70 ? 26  TYR B OH  1 
ATOM   375  N  N   . THR B  2 27 ? 31.824  4.896   10.100  1.00 41.84 ? 27  THR B N   1 
ATOM   376  C  CA  . THR B  2 27 ? 33.265  4.690   9.865   1.00 47.30 ? 27  THR B CA  1 
ATOM   377  C  C   . THR B  2 27 ? 33.654  3.218   9.638   1.00 49.05 ? 27  THR B C   1 
ATOM   378  O  O   . THR B  2 27 ? 34.063  2.422   10.521  1.00 49.67 ? 27  THR B O   1 
ATOM   379  C  CB  . THR B  2 27 ? 34.081  5.496   10.953  1.00 48.02 ? 27  THR B CB  1 
ATOM   380  O  OG1 . THR B  2 27 ? 33.768  5.155   12.343  1.00 48.88 ? 27  THR B OG1 1 
ATOM   381  C  CG2 . THR B  2 27 ? 33.783  7.018   10.783  1.00 48.76 ? 27  THR B CG2 1 
ATOM   382  N  N   . PRO B  2 28 ? 33.480  2.835   8.366   1.00 49.98 ? 28  PRO B N   1 
ATOM   383  C  CA  . PRO B  2 28 ? 33.774  1.484   7.919   1.00 51.42 ? 28  PRO B CA  1 
ATOM   384  C  C   . PRO B  2 28 ? 35.274  1.270   8.090   1.00 54.52 ? 28  PRO B C   1 
ATOM   385  O  O   . PRO B  2 28 ? 35.648  0.371   8.863   1.00 56.08 ? 28  PRO B O   1 
ATOM   386  C  CB  . PRO B  2 28 ? 33.348  1.430   6.461   1.00 50.31 ? 28  PRO B CB  1 
ATOM   387  C  CG  . PRO B  2 28 ? 33.338  2.851   6.016   1.00 49.90 ? 28  PRO B CG  1 
ATOM   388  C  CD  . PRO B  2 28 ? 33.027  3.677   7.251   1.00 49.64 ? 28  PRO B CD  1 
ATOM   389  N  N   . LYS B  2 29 ? 36.064  2.084   7.386   1.00 56.70 ? 29  LYS B N   1 
ATOM   390  C  CA  . LYS B  2 29 ? 37.538  2.018   7.402   1.00 58.13 ? 29  LYS B CA  1 
ATOM   391  C  C   . LYS B  2 29 ? 38.022  1.973   8.848   1.00 59.29 ? 29  LYS B C   1 
ATOM   392  O  O   . LYS B  2 29 ? 38.499  2.994   9.374   1.00 61.10 ? 29  LYS B O   1 
ATOM   393  C  CB  . LYS B  2 29 ? 38.207  3.166   6.669   1.00 58.46 ? 29  LYS B CB  1 
ATOM   394  N  N   . THR B  2 30 ? 37.841  0.803   9.433   1.00 59.78 ? 30  THR B N   1 
ATOM   395  C  CA  . THR B  2 30 ? 38.179  0.445   10.814  1.00 59.70 ? 30  THR B CA  1 
ATOM   396  N  N   . GLY C  1 1  ? 21.365  22.146  9.049   1.00 39.07 ? 1   GLY C N   1 
ATOM   397  C  CA  . GLY C  1 1  ? 21.539  20.679  9.305   1.00 37.35 ? 1   GLY C CA  1 
ATOM   398  C  C   . GLY C  1 1  ? 21.140  20.063  7.949   1.00 36.50 ? 1   GLY C C   1 
ATOM   399  O  O   . GLY C  1 1  ? 20.397  20.751  7.197   1.00 37.17 ? 1   GLY C O   1 
ATOM   400  N  N   . ILE C  1 2  ? 21.641  18.847  7.700   1.00 33.66 ? 2   ILE C N   1 
ATOM   401  C  CA  . ILE C  1 2  ? 21.285  18.205  6.416   1.00 31.43 ? 2   ILE C CA  1 
ATOM   402  C  C   . ILE C  1 2  ? 19.766  18.062  6.228   1.00 29.50 ? 2   ILE C C   1 
ATOM   403  O  O   . ILE C  1 2  ? 19.307  18.218  5.096   1.00 28.36 ? 2   ILE C O   1 
ATOM   404  C  CB  . ILE C  1 2  ? 21.984  16.789  6.387   1.00 31.15 ? 2   ILE C CB  1 
ATOM   405  C  CG1 . ILE C  1 2  ? 21.711  16.151  4.994   1.00 31.06 ? 2   ILE C CG1 1 
ATOM   406  C  CG2 . ILE C  1 2  ? 21.581  15.877  7.569   1.00 30.13 ? 2   ILE C CG2 1 
ATOM   407  C  CD1 . ILE C  1 2  ? 22.781  15.046  4.766   1.00 32.34 ? 2   ILE C CD1 1 
ATOM   408  N  N   . VAL C  1 3  ? 19.038  17.752  7.266   1.00 29.12 ? 3   VAL C N   1 
ATOM   409  C  CA  . VAL C  1 3  ? 17.560  17.559  7.215   1.00 31.85 ? 3   VAL C CA  1 
ATOM   410  C  C   . VAL C  1 3  ? 16.853  18.757  6.609   1.00 32.13 ? 3   VAL C C   1 
ATOM   411  O  O   . VAL C  1 3  ? 16.127  18.735  5.594   1.00 32.32 ? 3   VAL C O   1 
ATOM   412  C  CB  . VAL C  1 3  ? 17.156  16.996  8.593   1.00 31.35 ? 3   VAL C CB  1 
ATOM   413  C  CG1 . VAL C  1 3  ? 15.657  16.770  8.707   1.00 32.95 ? 3   VAL C CG1 1 
ATOM   414  C  CG2 . VAL C  1 3  ? 17.843  15.664  8.891   1.00 32.36 ? 3   VAL C CG2 1 
ATOM   415  N  N   . GLU C  1 4  ? 17.154  19.935  7.157   1.00 35.14 ? 4   GLU C N   1 
ATOM   416  C  CA  . GLU C  1 4  ? 16.610  21.226  6.683   1.00 36.95 ? 4   GLU C CA  1 
ATOM   417  C  C   . GLU C  1 4  ? 16.971  21.539  5.264   1.00 35.61 ? 4   GLU C C   1 
ATOM   418  O  O   . GLU C  1 4  ? 16.145  22.020  4.448   1.00 37.33 ? 4   GLU C O   1 
ATOM   419  C  CB  . GLU C  1 4  ? 17.170  22.327  7.605   1.00 41.00 ? 4   GLU C CB  1 
ATOM   420  C  CG  . GLU C  1 4  ? 16.848  22.010  9.084   1.00 45.36 ? 4   GLU C CG  1 
ATOM   421  C  CD  . GLU C  1 4  ? 17.863  21.064  9.688   1.00 48.36 ? 4   GLU C CD  1 
ATOM   422  O  OE1 . GLU C  1 4  ? 19.017  21.042  9.262   1.00 50.73 ? 4   GLU C OE1 1 
ATOM   423  O  OE2 . GLU C  1 4  ? 17.439  20.333  10.621  1.00 49.96 ? 4   GLU C OE2 1 
ATOM   424  N  N   . GLN C  1 5  ? 18.237  21.272  4.907   1.00 34.32 ? 5   GLN C N   1 
ATOM   425  C  CA  . GLN C  1 5  ? 18.711  21.498  3.554   1.00 33.25 ? 5   GLN C CA  1 
ATOM   426  C  C   . GLN C  1 5  ? 18.252  20.491  2.507   1.00 32.50 ? 5   GLN C C   1 
ATOM   427  O  O   . GLN C  1 5  ? 17.994  20.984  1.390   1.00 33.49 ? 5   GLN C O   1 
ATOM   428  C  CB  . GLN C  1 5  ? 20.253  21.422  3.389   1.00 35.03 ? 5   GLN C CB  1 
ATOM   429  C  CG  . GLN C  1 5  ? 21.036  22.438  4.183   1.00 36.89 ? 5   GLN C CG  1 
ATOM   430  C  CD  . GLN C  1 5  ? 20.785  23.806  3.576   1.00 38.20 ? 5   GLN C CD  1 
ATOM   431  O  OE1 . GLN C  1 5  ? 21.211  24.813  4.125   1.00 41.11 ? 5   GLN C OE1 1 
ATOM   432  N  NE2 . GLN C  1 5  ? 20.112  23.947  2.438   1.00 38.81 ? 5   GLN C NE2 1 
ATOM   433  N  N   . CYS C  1 6  ? 18.257  19.205  2.896   1.00 29.65 ? 6   CYS C N   1 
ATOM   434  C  CA  . CYS C  1 6  ? 17.978  18.174  1.826   1.00 27.58 ? 6   CYS C CA  1 
ATOM   435  C  C   . CYS C  1 6  ? 16.614  17.515  1.841   1.00 27.26 ? 6   CYS C C   1 
ATOM   436  O  O   . CYS C  1 6  ? 16.325  16.728  0.878   1.00 26.50 ? 6   CYS C O   1 
ATOM   437  C  CB  . CYS C  1 6  ? 19.202  17.229  1.921   1.00 26.28 ? 6   CYS C CB  1 
ATOM   438  S  SG  . CYS C  1 6  ? 20.832  18.054  1.555   1.00 25.08 ? 6   CYS C SG  1 
ATOM   439  N  N   . CYS C  1 7  ? 15.845  17.878  2.844   1.00 27.36 ? 7   CYS C N   1 
ATOM   440  C  CA  . CYS C  1 7  ? 14.445  17.391  3.012   1.00 29.25 ? 7   CYS C CA  1 
ATOM   441  C  C   . CYS C  1 7  ? 13.493  18.477  2.483   1.00 32.22 ? 7   CYS C C   1 
ATOM   442  O  O   . CYS C  1 7  ? 12.359  18.187  2.004   1.00 33.48 ? 7   CYS C O   1 
ATOM   443  C  CB  . CYS C  1 7  ? 14.222  16.863  4.395   1.00 27.63 ? 7   CYS C CB  1 
ATOM   444  S  SG  . CYS C  1 7  ? 15.188  15.303  4.654   1.00 28.05 ? 7   CYS C SG  1 
ATOM   445  N  N   . THR C  1 8  ? 13.974  19.694  2.452   1.00 32.30 ? 8   THR C N   1 
ATOM   446  C  CA  . THR C  1 8  ? 13.200  20.807  1.882   1.00 35.66 ? 8   THR C CA  1 
ATOM   447  C  C   . THR C  1 8  ? 13.260  20.759  0.372   1.00 35.53 ? 8   THR C C   1 
ATOM   448  O  O   . THR C  1 8  ? 12.250  20.806  -0.364  1.00 35.98 ? 8   THR C O   1 
ATOM   449  C  CB  . THR C  1 8  ? 13.759  22.195  2.411   1.00 37.29 ? 8   THR C CB  1 
ATOM   450  O  OG1 . THR C  1 8  ? 13.683  22.150  3.867   1.00 38.96 ? 8   THR C OG1 1 
ATOM   451  C  CG2 . THR C  1 8  ? 12.909  23.322  1.806   1.00 39.77 ? 8   THR C CG2 1 
ATOM   452  N  N   . SER C  1 9  ? 14.498  20.701  -0.135  1.00 35.22 ? 9   SER C N   1 
ATOM   453  C  CA  . SER C  1 9  ? 14.757  20.637  -1.582  1.00 36.20 ? 9   SER C CA  1 
ATOM   454  C  C   . SER C  1 9  ? 15.696  19.461  -1.855  1.00 34.03 ? 9   SER C C   1 
ATOM   455  O  O   . SER C  1 9  ? 16.276  19.017  -0.857  1.00 34.78 ? 9   SER C O   1 
ATOM   456  C  CB  . SER C  1 9  ? 15.390  21.923  -2.113  1.00 38.36 ? 9   SER C CB  1 
ATOM   457  O  OG  . SER C  1 9  ? 16.268  22.420  -1.094  1.00 43.00 ? 9   SER C OG  1 
ATOM   458  N  N   . ILE C  1 10 ? 15.846  19.015  -3.048  1.00 33.12 ? 10  ILE C N   1 
ATOM   459  C  CA  . ILE C  1 10 ? 16.730  17.862  -3.340  1.00 33.75 ? 10  ILE C CA  1 
ATOM   460  C  C   . ILE C  1 10 ? 18.208  18.208  -3.398  1.00 31.86 ? 10  ILE C C   1 
ATOM   461  O  O   . ILE C  1 10 ? 18.575  19.123  -4.146  1.00 31.94 ? 10  ILE C O   1 
ATOM   462  C  CB  . ILE C  1 10 ? 16.209  17.120  -4.618  1.00 35.51 ? 10  ILE C CB  1 
ATOM   463  C  CG1 . ILE C  1 10 ? 14.691  16.848  -4.418  1.00 37.03 ? 10  ILE C CG1 1 
ATOM   464  C  CG2 . ILE C  1 10 ? 16.897  15.765  -4.900  1.00 35.66 ? 10  ILE C CG2 1 
ATOM   465  C  CD1 . ILE C  1 10 ? 14.291  16.534  -2.928  1.00 38.89 ? 10  ILE C CD1 1 
ATOM   466  N  N   . CYS C  1 11 ? 19.035  17.512  -2.643  1.00 30.24 ? 11  CYS C N   1 
ATOM   467  C  CA  . CYS C  1 11 ? 20.497  17.790  -2.683  1.00 27.36 ? 11  CYS C CA  1 
ATOM   468  C  C   . CYS C  1 11 ? 21.114  17.026  -3.822  1.00 26.66 ? 11  CYS C C   1 
ATOM   469  O  O   . CYS C  1 11 ? 20.707  15.877  -4.014  1.00 28.31 ? 11  CYS C O   1 
ATOM   470  C  CB  . CYS C  1 11 ? 21.131  17.528  -1.372  1.00 26.70 ? 11  CYS C CB  1 
ATOM   471  S  SG  . CYS C  1 11 ? 20.605  18.800  -0.235  1.00 24.52 ? 11  CYS C SG  1 
ATOM   472  N  N   . SER C  1 12 ? 22.055  17.574  -4.575  1.00 23.96 ? 12  SER C N   1 
ATOM   473  C  CA  . SER C  1 12 ? 22.643  16.864  -5.665  1.00 22.70 ? 12  SER C CA  1 
ATOM   474  C  C   . SER C  1 12 ? 23.634  15.951  -4.964  1.00 21.38 ? 12  SER C C   1 
ATOM   475  O  O   . SER C  1 12 ? 23.745  16.059  -3.754  1.00 21.44 ? 12  SER C O   1 
ATOM   476  C  CB  . SER C  1 12 ? 23.327  17.859  -6.639  1.00 24.38 ? 12  SER C CB  1 
ATOM   477  O  OG  . SER C  1 12 ? 24.312  18.527  -5.836  1.00 26.66 ? 12  SER C OG  1 
ATOM   478  N  N   . LEU C  1 13 ? 24.364  15.123  -5.658  1.00 23.48 ? 13  LEU C N   1 
ATOM   479  C  CA  . LEU C  1 13 ? 25.373  14.219  -5.037  1.00 24.38 ? 13  LEU C CA  1 
ATOM   480  C  C   . LEU C  1 13 ? 26.539  15.060  -4.522  1.00 23.00 ? 13  LEU C C   1 
ATOM   481  O  O   . LEU C  1 13 ? 27.130  14.765  -3.517  1.00 20.12 ? 13  LEU C O   1 
ATOM   482  C  CB  . LEU C  1 13 ? 25.730  13.098  -6.043  1.00 26.20 ? 13  LEU C CB  1 
ATOM   483  C  CG  . LEU C  1 13 ? 24.566  12.129  -6.420  1.00 27.69 ? 13  LEU C CG  1 
ATOM   484  C  CD1 . LEU C  1 13 ? 25.151  10.862  -6.972  1.00 27.88 ? 13  LEU C CD1 1 
ATOM   485  C  CD2 . LEU C  1 13 ? 23.668  11.774  -5.235  1.00 26.63 ? 13  LEU C CD2 1 
ATOM   486  N  N   . TYR C  1 14 ? 26.830  16.125  -5.278  1.00 25.73 ? 14  TYR C N   1 
ATOM   487  C  CA  . TYR C  1 14 ? 27.915  17.075  -4.859  1.00 25.85 ? 14  TYR C CA  1 
ATOM   488  C  C   . TYR C  1 14 ? 27.526  17.660  -3.532  1.00 23.21 ? 14  TYR C C   1 
ATOM   489  O  O   . TYR C  1 14 ? 28.322  17.673  -2.576  1.00 25.77 ? 14  TYR C O   1 
ATOM   490  C  CB  . TYR C  1 14 ? 28.129  18.189  -5.928  1.00 28.49 ? 14  TYR C CB  1 
ATOM   491  C  CG  . TYR C  1 14 ? 29.236  19.164  -5.536  1.00 29.75 ? 14  TYR C CG  1 
ATOM   492  C  CD1 . TYR C  1 14 ? 30.535  18.761  -5.171  1.00 29.44 ? 14  TYR C CD1 1 
ATOM   493  C  CD2 . TYR C  1 14 ? 28.926  20.539  -5.566  1.00 31.22 ? 14  TYR C CD2 1 
ATOM   494  C  CE1 . TYR C  1 14 ? 31.495  19.703  -4.827  1.00 30.23 ? 14  TYR C CE1 1 
ATOM   495  C  CE2 . TYR C  1 14 ? 29.897  21.492  -5.234  1.00 30.99 ? 14  TYR C CE2 1 
ATOM   496  C  CZ  . TYR C  1 14 ? 31.155  21.072  -4.862  1.00 30.93 ? 14  TYR C CZ  1 
ATOM   497  O  OH  . TYR C  1 14 ? 32.072  22.051  -4.524  1.00 32.50 ? 14  TYR C OH  1 
ATOM   498  N  N   . GLN C  1 15 ? 26.307  18.114  -3.314  1.00 22.70 ? 15  GLN C N   1 
ATOM   499  C  CA  . GLN C  1 15 ? 25.835  18.676  -2.040  1.00 21.59 ? 15  GLN C CA  1 
ATOM   500  C  C   . GLN C  1 15 ? 25.920  17.727  -0.871  1.00 21.31 ? 15  GLN C C   1 
ATOM   501  O  O   . GLN C  1 15 ? 26.302  18.059  0.250   1.00 17.37 ? 15  GLN C O   1 
ATOM   502  C  CB  . GLN C  1 15 ? 24.423  19.277  -2.238  1.00 24.70 ? 15  GLN C CB  1 
ATOM   503  C  CG  . GLN C  1 15 ? 24.545  20.592  -3.052  1.00 26.73 ? 15  GLN C CG  1 
ATOM   504  C  CD  . GLN C  1 15 ? 23.238  21.106  -3.576  1.00 30.01 ? 15  GLN C CD  1 
ATOM   505  O  OE1 . GLN C  1 15 ? 22.276  20.369  -3.873  1.00 29.58 ? 15  GLN C OE1 1 
ATOM   506  N  NE2 . GLN C  1 15 ? 23.154  22.441  -3.771  1.00 30.47 ? 15  GLN C NE2 1 
ATOM   507  N  N   . LEU C  1 16 ? 25.500  16.448  -1.170  1.00 20.68 ? 16  LEU C N   1 
ATOM   508  C  CA  . LEU C  1 16 ? 25.576  15.413  -0.072  1.00 20.67 ? 16  LEU C CA  1 
ATOM   509  C  C   . LEU C  1 16 ? 27.004  15.138  0.327   1.00 17.22 ? 16  LEU C C   1 
ATOM   510  O  O   . LEU C  1 16 ? 27.264  14.867  1.500   1.00 16.77 ? 16  LEU C O   1 
ATOM   511  C  CB  . LEU C  1 16 ? 24.856  14.157  -0.678  1.00 21.68 ? 16  LEU C CB  1 
ATOM   512  C  CG  . LEU C  1 16 ? 23.403  13.811  -0.357  1.00 24.88 ? 16  LEU C CG  1 
ATOM   513  C  CD1 . LEU C  1 16 ? 22.682  14.709  0.625   1.00 25.21 ? 16  LEU C CD1 1 
ATOM   514  C  CD2 . LEU C  1 16 ? 22.647  13.561  -1.648  1.00 26.07 ? 16  LEU C CD2 1 
ATOM   515  N  N   . GLU C  1 17 ? 27.922  15.172  -0.596  1.00 20.46 ? 17  GLU C N   1 
ATOM   516  C  CA  . GLU C  1 17 ? 29.380  14.954  -0.344  1.00 23.34 ? 17  GLU C CA  1 
ATOM   517  C  C   . GLU C  1 17 ? 29.916  15.854  0.747   1.00 22.44 ? 17  GLU C C   1 
ATOM   518  O  O   . GLU C  1 17 ? 30.808  15.547  1.556   1.00 21.79 ? 17  GLU C O   1 
ATOM   519  C  CB  . GLU C  1 17 ? 30.223  15.077  -1.614  1.00 26.79 ? 17  GLU C CB  1 
ATOM   520  C  CG  . GLU C  1 17 ? 31.728  14.864  -1.664  1.00 30.96 ? 17  GLU C CG  1 
ATOM   521  C  CD  . GLU C  1 17 ? 32.646  16.027  -1.244  1.00 36.20 ? 17  GLU C CD  1 
ATOM   522  O  OE1 . GLU C  1 17 ? 32.458  17.238  -1.504  1.00 37.02 ? 17  GLU C OE1 1 
ATOM   523  O  OE2 . GLU C  1 17 ? 33.666  15.723  -0.532  1.00 37.63 ? 17  GLU C OE2 1 
ATOM   524  N  N   . ASN C  1 18 ? 29.276  17.015  0.923   1.00 22.10 ? 18  ASN C N   1 
ATOM   525  C  CA  . ASN C  1 18 ? 29.588  18.034  1.918   1.00 21.72 ? 18  ASN C CA  1 
ATOM   526  C  C   . ASN C  1 18 ? 29.536  17.392  3.245   1.00 22.27 ? 18  ASN C C   1 
ATOM   527  O  O   . ASN C  1 18 ? 30.217  17.811  4.200   1.00 23.46 ? 18  ASN C O   1 
ATOM   528  C  CB  . ASN C  1 18 ? 28.639  19.294  1.734   1.00 21.21 ? 18  ASN C CB  1 
ATOM   529  C  CG  . ASN C  1 18 ? 28.985  20.277  2.854   1.00 22.51 ? 18  ASN C CG  1 
ATOM   530  O  OD1 . ASN C  1 18 ? 30.134  20.776  2.847   1.00 22.03 ? 18  ASN C OD1 1 
ATOM   531  N  ND2 . ASN C  1 18 ? 28.215  20.573  3.887   1.00 22.54 ? 18  ASN C ND2 1 
ATOM   532  N  N   . TYR C  1 19 ? 28.669  16.356  3.405   1.00 22.17 ? 19  TYR C N   1 
ATOM   533  C  CA  . TYR C  1 19 ? 28.540  15.711  4.721   1.00 22.04 ? 19  TYR C CA  1 
ATOM   534  C  C   . TYR C  1 19 ? 29.365  14.467  4.946   1.00 21.93 ? 19  TYR C C   1 
ATOM   535  O  O   . TYR C  1 19 ? 29.262  13.778  5.947   1.00 24.28 ? 19  TYR C O   1 
ATOM   536  C  CB  . TYR C  1 19 ? 27.043  15.470  5.111   1.00 24.19 ? 19  TYR C CB  1 
ATOM   537  C  CG  . TYR C  1 19 ? 26.235  16.765  5.050   1.00 24.76 ? 19  TYR C CG  1 
ATOM   538  C  CD1 . TYR C  1 19 ? 25.627  17.171  3.885   1.00 25.42 ? 19  TYR C CD1 1 
ATOM   539  C  CD2 . TYR C  1 19 ? 26.160  17.553  6.203   1.00 27.05 ? 19  TYR C CD2 1 
ATOM   540  C  CE1 . TYR C  1 19 ? 24.917  18.383  3.832   1.00 26.71 ? 19  TYR C CE1 1 
ATOM   541  C  CE2 . TYR C  1 19 ? 25.464  18.787  6.177   1.00 27.15 ? 19  TYR C CE2 1 
ATOM   542  C  CZ  . TYR C  1 19 ? 24.862  19.157  4.998   1.00 28.09 ? 19  TYR C CZ  1 
ATOM   543  O  OH  . TYR C  1 19 ? 24.167  20.340  4.963   1.00 30.87 ? 19  TYR C OH  1 
ATOM   544  N  N   . CYS C  1 20 ? 30.216  14.110  4.065   1.00 25.12 ? 20  CYS C N   1 
ATOM   545  C  CA  . CYS C  1 20 ? 31.070  12.906  4.255   1.00 26.81 ? 20  CYS C CA  1 
ATOM   546  C  C   . CYS C  1 20 ? 32.204  13.321  5.187   1.00 31.61 ? 20  CYS C C   1 
ATOM   547  O  O   . CYS C  1 20 ? 32.550  14.524  5.309   1.00 31.90 ? 20  CYS C O   1 
ATOM   548  C  CB  . CYS C  1 20 ? 31.595  12.467  2.929   1.00 23.55 ? 20  CYS C CB  1 
ATOM   549  S  SG  . CYS C  1 20 ? 30.553  12.054  1.552   1.00 24.84 ? 20  CYS C SG  1 
ATOM   550  N  N   . ASN C  1 21 ? 32.767  12.320  5.792   1.00 35.23 ? 21  ASN C N   1 
ATOM   551  C  CA  . ASN C  1 21 ? 33.917  12.373  6.680   1.00 40.06 ? 21  ASN C CA  1 
ATOM   552  C  C   . ASN C  1 21 ? 35.190  12.662  5.845   1.00 40.97 ? 21  ASN C C   1 
ATOM   553  O  O   . ASN C  1 21 ? 35.242  12.795  4.604   1.00 42.95 ? 21  ASN C O   1 
ATOM   554  C  CB  . ASN C  1 21 ? 34.169  11.050  7.394   1.00 41.24 ? 21  ASN C CB  1 
ATOM   555  C  CG  . ASN C  1 21 ? 33.448  10.880  8.699   1.00 43.55 ? 21  ASN C CG  1 
ATOM   556  O  OD1 . ASN C  1 21 ? 33.458  11.855  9.503   1.00 47.14 ? 21  ASN C OD1 1 
ATOM   557  N  ND2 . ASN C  1 21 ? 32.851  9.717   8.944   1.00 43.01 ? 21  ASN C ND2 1 
ATOM   558  O  OXT . ASN C  1 21 ? 36.216  12.733  6.541   1.00 43.61 ? 21  ASN C OXT 1 
ATOM   559  N  N   . PHE D  2 1  ? 8.088   14.376  13.527  1.00 45.78 ? 1   PHE D N   1 
ATOM   560  C  CA  . PHE D  2 1  ? 7.709   14.841  12.168  1.00 44.81 ? 1   PHE D CA  1 
ATOM   561  C  C   . PHE D  2 1  ? 7.982   13.655  11.224  1.00 43.44 ? 1   PHE D C   1 
ATOM   562  O  O   . PHE D  2 1  ? 9.193   13.487  10.983  1.00 41.96 ? 1   PHE D O   1 
ATOM   563  C  CB  . PHE D  2 1  ? 8.562   16.052  11.767  1.00 45.66 ? 1   PHE D CB  1 
ATOM   564  N  N   . VAL D  2 2  ? 6.922   12.972  10.793  1.00 41.22 ? 2   VAL D N   1 
ATOM   565  C  CA  . VAL D  2 2  ? 7.127   11.802  9.922   1.00 36.57 ? 2   VAL D CA  1 
ATOM   566  C  C   . VAL D  2 2  ? 7.617   12.104  8.546   1.00 34.67 ? 2   VAL D C   1 
ATOM   567  O  O   . VAL D  2 2  ? 8.407   11.217  8.161   1.00 32.71 ? 2   VAL D O   1 
ATOM   568  C  CB  . VAL D  2 2  ? 5.920   10.864  10.034  1.00 38.23 ? 2   VAL D CB  1 
ATOM   569  C  CG1 . VAL D  2 2  ? 5.999   9.611   9.185   1.00 36.55 ? 2   VAL D CG1 1 
ATOM   570  C  CG2 . VAL D  2 2  ? 5.708   10.510  11.530  1.00 37.94 ? 2   VAL D CG2 1 
ATOM   571  N  N   . ASN D  2 3  ? 7.320   13.149  7.793   1.00 32.15 ? 3   ASN D N   1 
ATOM   572  C  CA  . ASN D  2 3  ? 7.922   13.356  6.476   1.00 30.81 ? 3   ASN D CA  1 
ATOM   573  C  C   . ASN D  2 3  ? 9.465   13.463  6.621   1.00 28.79 ? 3   ASN D C   1 
ATOM   574  O  O   . ASN D  2 3  ? 10.218  12.932  5.770   1.00 25.54 ? 3   ASN D O   1 
ATOM   575  C  CB  . ASN D  2 3  ? 7.272   14.498  5.724   1.00 35.12 ? 3   ASN D CB  1 
ATOM   576  C  CG  . ASN D  2 3  ? 5.829   14.067  5.360   1.00 37.37 ? 3   ASN D CG  1 
ATOM   577  O  OD1 . ASN D  2 3  ? 5.513   13.425  4.344   1.00 39.13 ? 3   ASN D OD1 1 
ATOM   578  N  ND2 . ASN D  2 3  ? 4.965   14.408  6.320   1.00 39.85 ? 3   ASN D ND2 1 
ATOM   579  N  N   . GLN D  2 4  ? 9.872   14.130  7.678   1.00 26.90 ? 4   GLN D N   1 
ATOM   580  C  CA  . GLN D  2 4  ? 11.297  14.289  7.940   1.00 29.07 ? 4   GLN D CA  1 
ATOM   581  C  C   . GLN D  2 4  ? 11.963  12.977  8.340   1.00 26.73 ? 4   GLN D C   1 
ATOM   582  O  O   . GLN D  2 4  ? 13.116  12.836  7.962   1.00 26.28 ? 4   GLN D O   1 
ATOM   583  C  CB  . GLN D  2 4  ? 11.559  15.388  8.983   1.00 32.07 ? 4   GLN D CB  1 
ATOM   584  C  CG  . GLN D  2 4  ? 10.971  16.597  8.175   1.00 37.07 ? 4   GLN D CG  1 
ATOM   585  C  CD  . GLN D  2 4  ? 11.979  17.720  8.197   1.00 39.46 ? 4   GLN D CD  1 
ATOM   586  O  OE1 . GLN D  2 4  ? 12.380  18.173  7.114   1.00 42.27 ? 4   GLN D OE1 1 
ATOM   587  N  NE2 . GLN D  2 4  ? 12.306  18.093  9.437   1.00 40.62 ? 4   GLN D NE2 1 
ATOM   588  N  N   . HIS D  2 5  ? 11.228  12.231  9.098   1.00 24.92 ? 5   HIS D N   1 
ATOM   589  C  CA  . HIS D  2 5  ? 11.615  10.887  9.549   1.00 25.76 ? 5   HIS D CA  1 
ATOM   590  C  C   . HIS D  2 5  ? 11.852  10.010  8.298   1.00 22.75 ? 5   HIS D C   1 
ATOM   591  O  O   . HIS D  2 5  ? 12.883  9.321   8.269   1.00 23.04 ? 5   HIS D O   1 
ATOM   592  C  CB  . HIS D  2 5  ? 10.524  10.157  10.402  1.00 27.35 ? 5   HIS D CB  1 
ATOM   593  C  CG  . HIS D  2 5  ? 11.162  8.994   11.076  1.00 30.44 ? 5   HIS D CG  1 
ATOM   594  N  ND1 . HIS D  2 5  ? 12.224  9.080   11.926  1.00 31.41 ? 5   HIS D ND1 1 
ATOM   595  C  CD2 . HIS D  2 5  ? 10.870  7.677   10.962  1.00 31.26 ? 5   HIS D CD2 1 
ATOM   596  C  CE1 . HIS D  2 5  ? 12.561  7.894   12.365  1.00 32.22 ? 5   HIS D CE1 1 
ATOM   597  N  NE2 . HIS D  2 5  ? 11.751  7.043   11.783  1.00 33.69 ? 5   HIS D NE2 1 
ATOM   598  N  N   . LEU D  2 6  ? 10.973  9.990   7.340   1.00 21.30 ? 6   LEU D N   1 
ATOM   599  C  CA  . LEU D  2 6  ? 11.006  9.248   6.104   1.00 22.93 ? 6   LEU D CA  1 
ATOM   600  C  C   . LEU D  2 6  ? 12.132  9.744   5.195   1.00 22.93 ? 6   LEU D C   1 
ATOM   601  O  O   . LEU D  2 6  ? 12.883  8.942   4.620   1.00 20.30 ? 6   LEU D O   1 
ATOM   602  C  CB  . LEU D  2 6  ? 9.654   9.311   5.380   1.00 24.53 ? 6   LEU D CB  1 
ATOM   603  C  CG  . LEU D  2 6  ? 8.638   8.226   5.770   1.00 26.17 ? 6   LEU D CG  1 
ATOM   604  C  CD1 . LEU D  2 6  ? 8.852   7.630   7.112   1.00 27.11 ? 6   LEU D CD1 1 
ATOM   605  C  CD2 . LEU D  2 6  ? 7.268   8.796   5.484   1.00 26.15 ? 6   LEU D CD2 1 
ATOM   606  N  N   . CYS D  2 7  ? 12.189  11.077  5.060   1.00 20.13 ? 7   CYS D N   1 
ATOM   607  C  CA  . CYS D  2 7  ? 13.272  11.653  4.217   1.00 19.03 ? 7   CYS D CA  1 
ATOM   608  C  C   . CYS D  2 7  ? 14.653  11.254  4.784   1.00 18.65 ? 7   CYS D C   1 
ATOM   609  O  O   . CYS D  2 7  ? 15.584  10.942  4.043   1.00 19.29 ? 7   CYS D O   1 
ATOM   610  C  CB  . CYS D  2 7  ? 13.106  13.184  4.256   1.00 21.41 ? 7   CYS D CB  1 
ATOM   611  S  SG  . CYS D  2 7  ? 14.418  14.006  3.328   1.00 24.58 ? 7   CYS D SG  1 
ATOM   612  N  N   . GLY D  2 8  ? 14.903  11.310  6.040   1.00 16.01 ? 8   GLY D N   1 
ATOM   613  C  CA  . GLY D  2 8  ? 16.127  11.009  6.721   1.00 20.38 ? 8   GLY D CA  1 
ATOM   614  C  C   . GLY D  2 8  ? 16.593  9.561   6.460   1.00 20.64 ? 8   GLY D C   1 
ATOM   615  O  O   . GLY D  2 8  ? 17.819  9.385   6.353   1.00 20.48 ? 8   GLY D O   1 
ATOM   616  N  N   . SER D  2 9  ? 15.710  8.623   6.291   1.00 20.33 ? 9   SER D N   1 
ATOM   617  C  CA  . SER D  2 9  ? 16.066  7.203   6.026   1.00 20.49 ? 9   SER D CA  1 
ATOM   618  C  C   . SER D  2 9  ? 16.705  7.131   4.662   1.00 20.03 ? 9   SER D C   1 
ATOM   619  O  O   . SER D  2 9  ? 17.729  6.466   4.372   1.00 20.60 ? 9   SER D O   1 
ATOM   620  C  CB  . SER D  2 9  ? 14.781  6.368   6.190   1.00 23.51 ? 9   SER D CB  1 
ATOM   621  O  OG  . SER D  2 9  ? 15.078  5.133   5.608   1.00 28.70 ? 9   SER D OG  1 
ATOM   622  N  N   . HIS D  2 10 ? 16.192  7.889   3.717   1.00 17.37 ? 10  HIS D N   1 
ATOM   623  C  CA  . HIS D  2 10 ? 16.696  7.990   2.383   1.00 15.87 ? 10  HIS D CA  1 
ATOM   624  C  C   . HIS D  2 10 ? 18.023  8.780   2.312   1.00 15.99 ? 10  HIS D C   1 
ATOM   625  O  O   . HIS D  2 10 ? 18.865  8.435   1.465   1.00 15.10 ? 10  HIS D O   1 
ATOM   626  C  CB  . HIS D  2 10 ? 15.739  8.566   1.379   1.00 16.61 ? 10  HIS D CB  1 
ATOM   627  C  CG  . HIS D  2 10 ? 14.604  7.646   1.079   1.00 18.37 ? 10  HIS D CG  1 
ATOM   628  N  ND1 . HIS D  2 10 ? 14.608  6.809   0.048   1.00 17.50 ? 10  HIS D ND1 1 
ATOM   629  C  CD2 . HIS D  2 10 ? 13.397  7.503   1.739   1.00 17.09 ? 10  HIS D CD2 1 
ATOM   630  C  CE1 . HIS D  2 10 ? 13.475  6.114   0.053   1.00 18.01 ? 10  HIS D CE1 1 
ATOM   631  N  NE2 . HIS D  2 10 ? 12.781  6.522   1.022   1.00 17.85 ? 10  HIS D NE2 1 
ATOM   632  N  N   . LEU D  2 11 ? 18.150  9.816   3.096   1.00 16.80 ? 11  LEU D N   1 
ATOM   633  C  CA  . LEU D  2 11 ? 19.392  10.599  3.124   1.00 19.47 ? 11  LEU D CA  1 
ATOM   634  C  C   . LEU D  2 11 ? 20.591  9.722   3.620   1.00 18.17 ? 11  LEU D C   1 
ATOM   635  O  O   . LEU D  2 11 ? 21.674  9.879   3.053   1.00 19.55 ? 11  LEU D O   1 
ATOM   636  C  CB  . LEU D  2 11 ? 19.301  11.748  4.145   1.00 21.77 ? 11  LEU D CB  1 
ATOM   637  C  CG  . LEU D  2 11 ? 18.768  13.091  3.629   1.00 24.67 ? 11  LEU D CG  1 
ATOM   638  C  CD1 . LEU D  2 11 ? 18.677  14.016  4.832   1.00 23.42 ? 11  LEU D CD1 1 
ATOM   639  C  CD2 . LEU D  2 11 ? 19.700  13.614  2.526   1.00 23.55 ? 11  LEU D CD2 1 
ATOM   640  N  N   . VAL D  2 12 ? 20.440  8.916   4.602   1.00 16.95 ? 12  VAL D N   1 
ATOM   641  C  CA  . VAL D  2 12 ? 21.535  8.071   5.096   1.00 20.44 ? 12  VAL D CA  1 
ATOM   642  C  C   . VAL D  2 12 ? 21.930  7.027   4.046   1.00 19.62 ? 12  VAL D C   1 
ATOM   643  O  O   . VAL D  2 12 ? 23.125  6.711   3.978   1.00 18.57 ? 12  VAL D O   1 
ATOM   644  C  CB  . VAL D  2 12 ? 21.343  7.531   6.504   1.00 21.97 ? 12  VAL D CB  1 
ATOM   645  C  CG1 . VAL D  2 12 ? 21.230  8.770   7.416   1.00 24.46 ? 12  VAL D CG1 1 
ATOM   646  C  CG2 . VAL D  2 12 ? 20.204  6.569   6.606   1.00 23.43 ? 12  VAL D CG2 1 
ATOM   647  N  N   . GLU D  2 13 ? 20.993  6.536   3.300   1.00 19.29 ? 13  GLU D N   1 
ATOM   648  C  CA  . GLU D  2 13 ? 21.305  5.587   2.242   1.00 21.68 ? 13  GLU D CA  1 
ATOM   649  C  C   . GLU D  2 13 ? 22.082  6.276   1.146   1.00 20.57 ? 13  GLU D C   1 
ATOM   650  O  O   . GLU D  2 13 ? 23.022  5.698   0.511   1.00 16.90 ? 13  GLU D O   1 
ATOM   651  C  CB  . GLU D  2 13 ? 19.992  4.939   1.738   1.00 24.76 ? 13  GLU D CB  1 
ATOM   652  C  CG  . GLU D  2 13 ? 20.282  3.865   0.641   1.00 30.73 ? 13  GLU D CG  1 
ATOM   653  C  CD  . GLU D  2 13 ? 21.364  2.875   1.140   1.00 32.47 ? 13  GLU D CD  1 
ATOM   654  O  OE1 . GLU D  2 13 ? 21.352  2.542   2.336   1.00 34.98 ? 13  GLU D OE1 1 
ATOM   655  O  OE2 . GLU D  2 13 ? 22.212  2.652   0.242   1.00 32.54 ? 13  GLU D OE2 1 
ATOM   656  N  N   . ALA D  2 14 ? 21.707  7.550   0.847   1.00 17.98 ? 14  ALA D N   1 
ATOM   657  C  CA  . ALA D  2 14 ? 22.419  8.323   -0.180  1.00 17.94 ? 14  ALA D CA  1 
ATOM   658  C  C   . ALA D  2 14 ? 23.825  8.690   0.347   1.00 16.63 ? 14  ALA D C   1 
ATOM   659  O  O   . ALA D  2 14 ? 24.751  8.653   -0.494  1.00 18.33 ? 14  ALA D O   1 
ATOM   660  C  CB  . ALA D  2 14 ? 21.674  9.618   -0.626  1.00 16.84 ? 14  ALA D CB  1 
ATOM   661  N  N   . LEU D  2 15 ? 23.924  8.998   1.632   1.00 16.75 ? 15  LEU D N   1 
ATOM   662  C  CA  . LEU D  2 15 ? 25.242  9.376   2.224   1.00 17.45 ? 15  LEU D CA  1 
ATOM   663  C  C   . LEU D  2 15 ? 26.201  8.174   2.166   1.00 18.38 ? 15  LEU D C   1 
ATOM   664  O  O   . LEU D  2 15 ? 27.418  8.228   1.840   1.00 17.13 ? 15  LEU D O   1 
ATOM   665  C  CB  . LEU D  2 15 ? 25.040  9.927   3.601   1.00 16.11 ? 15  LEU D CB  1 
ATOM   666  C  CG  . LEU D  2 15 ? 24.527  11.398  3.691   1.00 17.75 ? 15  LEU D CG  1 
ATOM   667  C  CD1 . LEU D  2 15 ? 24.362  11.705  5.161   1.00 16.19 ? 15  LEU D CD1 1 
ATOM   668  C  CD2 . LEU D  2 15 ? 25.541  12.332  2.980   1.00 17.51 ? 15  LEU D CD2 1 
ATOM   669  N  N   . TYR D  2 16 ? 25.604  7.022   2.457   1.00 16.78 ? 16  TYR D N   1 
ATOM   670  C  CA  . TYR D  2 16 ? 26.408  5.743   2.384   1.00 16.78 ? 16  TYR D CA  1 
ATOM   671  C  C   . TYR D  2 16 ? 26.920  5.574   1.032   1.00 16.20 ? 16  TYR D C   1 
ATOM   672  O  O   . TYR D  2 16 ? 28.143  5.177   0.881   1.00 20.11 ? 16  TYR D O   1 
ATOM   673  C  CB  . TYR D  2 16 ? 25.478  4.536   2.782   1.00 18.58 ? 16  TYR D CB  1 
ATOM   674  C  CG  . TYR D  2 16 ? 26.244  3.194   2.717   1.00 16.01 ? 16  TYR D CG  1 
ATOM   675  C  CD1 . TYR D  2 16 ? 27.053  2.822   3.753   1.00 16.33 ? 16  TYR D CD1 1 
ATOM   676  C  CD2 . TYR D  2 16 ? 26.048  2.415   1.596   1.00 18.74 ? 16  TYR D CD2 1 
ATOM   677  C  CE1 . TYR D  2 16 ? 27.736  1.557   3.747   1.00 19.11 ? 16  TYR D CE1 1 
ATOM   678  C  CE2 . TYR D  2 16 ? 26.719  1.132   1.566   1.00 19.42 ? 16  TYR D CE2 1 
ATOM   679  C  CZ  . TYR D  2 16 ? 27.540  0.772   2.597   1.00 17.84 ? 16  TYR D CZ  1 
ATOM   680  O  OH  . TYR D  2 16 ? 28.158  -0.462  2.497   1.00 21.39 ? 16  TYR D OH  1 
ATOM   681  N  N   . LEU D  2 17 ? 26.205  5.693   -0.055  1.00 15.89 ? 17  LEU D N   1 
ATOM   682  C  CA  . LEU D  2 17 ? 26.626  5.539   -1.403  1.00 17.01 ? 17  LEU D CA  1 
ATOM   683  C  C   . LEU D  2 17 ? 27.706  6.581   -1.783  1.00 19.84 ? 17  LEU D C   1 
ATOM   684  O  O   . LEU D  2 17 ? 28.800  6.282   -2.335  1.00 18.65 ? 17  LEU D O   1 
ATOM   685  C  CB  . LEU D  2 17 ? 25.518  5.563   -2.456  1.00 15.78 ? 17  LEU D CB  1 
ATOM   686  C  CG  A LEU D  2 17 ? 24.662  4.253   -2.305  0.50 16.26 ? 17  LEU D CG  1 
ATOM   687  C  CG  B LEU D  2 17 ? 25.679  5.798   -3.913  0.50 16.99 ? 17  LEU D CG  1 
ATOM   688  C  CD1 A LEU D  2 17 ? 23.403  4.312   -3.156  0.50 14.43 ? 17  LEU D CD1 1 
ATOM   689  C  CD1 B LEU D  2 17 ? 26.214  4.590   -4.701  0.50 18.03 ? 17  LEU D CD1 1 
ATOM   690  C  CD2 A LEU D  2 17 ? 25.576  3.061   -2.578  0.50 14.13 ? 17  LEU D CD2 1 
ATOM   691  C  CD2 B LEU D  2 17 ? 24.352  6.119   -4.646  0.50 17.57 ? 17  LEU D CD2 1 
ATOM   692  N  N   . VAL D  2 18 ? 27.285  7.837   -1.566  1.00 20.09 ? 18  VAL D N   1 
ATOM   693  C  CA  . VAL D  2 18 ? 28.186  8.952   -1.920  1.00 20.53 ? 18  VAL D CA  1 
ATOM   694  C  C   . VAL D  2 18 ? 29.507  8.927   -1.144  1.00 20.82 ? 18  VAL D C   1 
ATOM   695  O  O   . VAL D  2 18 ? 30.519  9.146   -1.798  1.00 23.92 ? 18  VAL D O   1 
ATOM   696  C  CB  . VAL D  2 18 ? 27.486  10.346  -1.695  1.00 20.68 ? 18  VAL D CB  1 
ATOM   697  C  CG1 . VAL D  2 18 ? 28.477  11.480  -2.009  1.00 21.46 ? 18  VAL D CG1 1 
ATOM   698  C  CG2 . VAL D  2 18 ? 26.399  10.492  -2.767  1.00 19.84 ? 18  VAL D CG2 1 
ATOM   699  N  N   . CYS D  2 19 ? 29.571  8.748   0.108   1.00 22.25 ? 19  CYS D N   1 
ATOM   700  C  CA  . CYS D  2 19 ? 30.714  8.846   0.964   1.00 24.79 ? 19  CYS D CA  1 
ATOM   701  C  C   . CYS D  2 19 ? 31.685  7.669   0.805   1.00 28.57 ? 19  CYS D C   1 
ATOM   702  O  O   . CYS D  2 19 ? 32.888  7.924   0.955   1.00 29.34 ? 19  CYS D O   1 
ATOM   703  C  CB  . CYS D  2 19 ? 30.291  9.116   2.383   1.00 24.28 ? 19  CYS D CB  1 
ATOM   704  S  SG  . CYS D  2 19 ? 29.380  10.699  2.570   1.00 24.38 ? 19  CYS D SG  1 
ATOM   705  N  N   . GLY D  2 20 ? 31.170  6.474   0.538   1.00 28.79 ? 20  GLY D N   1 
ATOM   706  C  CA  . GLY D  2 20 ? 32.031  5.315   0.398   1.00 27.56 ? 20  GLY D CA  1 
ATOM   707  C  C   . GLY D  2 20 ? 32.860  5.106   1.662   1.00 26.35 ? 20  GLY D C   1 
ATOM   708  O  O   . GLY D  2 20 ? 32.499  5.088   2.828   1.00 26.78 ? 20  GLY D O   1 
ATOM   709  N  N   . GLU D  2 21 ? 34.127  4.957   1.355   1.00 29.74 ? 21  GLU D N   1 
ATOM   710  C  CA  . GLU D  2 21 ? 35.212  4.676   2.313   1.00 33.13 ? 21  GLU D CA  1 
ATOM   711  C  C   . GLU D  2 21 ? 35.386  5.678   3.404   1.00 32.40 ? 21  GLU D C   1 
ATOM   712  O  O   . GLU D  2 21 ? 35.730  5.284   4.539   1.00 32.21 ? 21  GLU D O   1 
ATOM   713  C  CB  . GLU D  2 21 ? 36.454  4.506   1.404   1.00 38.19 ? 21  GLU D CB  1 
ATOM   714  C  CG  . GLU D  2 21 ? 37.482  3.433   1.685   1.00 43.12 ? 21  GLU D CG  1 
ATOM   715  C  CD  . GLU D  2 21 ? 37.630  2.211   0.823   1.00 45.47 ? 21  GLU D CD  1 
ATOM   716  O  OE1 . GLU D  2 21 ? 37.906  2.250   -0.376  1.00 46.75 ? 21  GLU D OE1 1 
ATOM   717  O  OE2 . GLU D  2 21 ? 37.460  1.147   1.484   1.00 47.05 ? 21  GLU D OE2 1 
ATOM   718  N  N   . ARG D  2 22 ? 35.139  6.958   3.107   1.00 31.73 ? 22  ARG D N   1 
ATOM   719  C  CA  . ARG D  2 22 ? 35.235  8.105   4.020   1.00 30.31 ? 22  ARG D CA  1 
ATOM   720  C  C   . ARG D  2 22 ? 34.260  7.959   5.142   1.00 29.78 ? 22  ARG D C   1 
ATOM   721  O  O   . ARG D  2 22 ? 34.547  8.254   6.335   1.00 30.08 ? 22  ARG D O   1 
ATOM   722  C  CB  . ARG D  2 22 ? 34.951  9.434   3.277   1.00 29.99 ? 22  ARG D CB  1 
ATOM   723  C  CG  . ARG D  2 22 ? 35.745  9.561   1.997   1.00 30.07 ? 22  ARG D CG  1 
ATOM   724  C  CD  . ARG D  2 22 ? 35.256  10.670  1.109   1.00 30.40 ? 22  ARG D CD  1 
ATOM   725  N  NE  . ARG D  2 22 ? 35.253  11.859  1.990   1.00 30.89 ? 22  ARG D NE  1 
ATOM   726  C  CZ  . ARG D  2 22 ? 34.964  13.096  1.553   1.00 30.18 ? 22  ARG D CZ  1 
ATOM   727  N  NH1 . ARG D  2 22 ? 34.623  13.386  0.325   1.00 29.89 ? 22  ARG D NH1 1 
ATOM   728  N  NH2 . ARG D  2 22 ? 34.965  14.017  2.512   1.00 30.87 ? 22  ARG D NH2 1 
ATOM   729  N  N   . GLY D  2 23 ? 33.015  7.499   4.818   1.00 29.25 ? 23  GLY D N   1 
ATOM   730  C  CA  . GLY D  2 23 ? 32.084  7.372   5.990   1.00 27.82 ? 23  GLY D CA  1 
ATOM   731  C  C   . GLY D  2 23 ? 31.475  8.789   6.073   1.00 28.45 ? 23  GLY D C   1 
ATOM   732  O  O   . GLY D  2 23 ? 31.733  9.637   5.197   1.00 28.48 ? 23  GLY D O   1 
ATOM   733  N  N   . PHE D  2 24 ? 30.638  8.942   7.067   1.00 29.39 ? 24  PHE D N   1 
ATOM   734  C  CA  . PHE D  2 24 ? 29.840  10.149  7.304   1.00 28.20 ? 24  PHE D CA  1 
ATOM   735  C  C   . PHE D  2 24 ? 29.336  10.029  8.710   1.00 29.93 ? 24  PHE D C   1 
ATOM   736  O  O   . PHE D  2 24 ? 29.289  9.016   9.421   1.00 30.73 ? 24  PHE D O   1 
ATOM   737  C  CB  . PHE D  2 24 ? 28.698  10.202  6.244   1.00 27.41 ? 24  PHE D CB  1 
ATOM   738  C  CG  . PHE D  2 24 ? 27.617  9.148   6.401   1.00 23.99 ? 24  PHE D CG  1 
ATOM   739  C  CD1 . PHE D  2 24 ? 26.557  9.312   7.276   1.00 23.19 ? 24  PHE D CD1 1 
ATOM   740  C  CD2 . PHE D  2 24 ? 27.752  7.933   5.727   1.00 24.80 ? 24  PHE D CD2 1 
ATOM   741  C  CE1 . PHE D  2 24 ? 25.584  8.341   7.472   1.00 22.97 ? 24  PHE D CE1 1 
ATOM   742  C  CE2 . PHE D  2 24 ? 26.796  6.900   5.894   1.00 22.66 ? 24  PHE D CE2 1 
ATOM   743  C  CZ  . PHE D  2 24 ? 25.725  7.119   6.764   1.00 21.53 ? 24  PHE D CZ  1 
ATOM   744  N  N   . PHE D  2 25 ? 28.923  11.190  9.199   1.00 31.49 ? 25  PHE D N   1 
ATOM   745  C  CA  . PHE D  2 25 ? 28.357  11.345  10.531  1.00 34.86 ? 25  PHE D CA  1 
ATOM   746  C  C   . PHE D  2 25 ? 26.923  11.810  10.242  1.00 34.07 ? 25  PHE D C   1 
ATOM   747  O  O   . PHE D  2 25 ? 26.751  12.601  9.293   1.00 35.87 ? 25  PHE D O   1 
ATOM   748  C  CB  . PHE D  2 25 ? 29.085  12.453  11.335  1.00 36.98 ? 25  PHE D CB  1 
ATOM   749  C  CG  A PHE D  2 25 ? 29.501  13.473  10.289  0.67 38.10 ? 25  PHE D CG  1 
ATOM   750  C  CG  B PHE D  2 25 ? 29.772  11.886  12.543  0.33 36.43 ? 25  PHE D CG  1 
ATOM   751  C  CD1 A PHE D  2 25 ? 30.645  13.241  9.518   0.67 38.74 ? 25  PHE D CD1 1 
ATOM   752  C  CD1 B PHE D  2 25 ? 29.079  11.718  13.738  0.33 36.77 ? 25  PHE D CD1 1 
ATOM   753  C  CD2 A PHE D  2 25 ? 28.738  14.610  10.062  0.67 38.81 ? 25  PHE D CD2 1 
ATOM   754  C  CD2 B PHE D  2 25 ? 31.111  11.513  12.472  0.33 36.95 ? 25  PHE D CD2 1 
ATOM   755  C  CE1 A PHE D  2 25 ? 31.063  14.133  8.553   0.67 38.82 ? 25  PHE D CE1 1 
ATOM   756  C  CE1 B PHE D  2 25 ? 29.727  11.193  14.851  0.33 37.13 ? 25  PHE D CE1 1 
ATOM   757  C  CE2 A PHE D  2 25 ? 29.124  15.535  9.082   0.67 39.43 ? 25  PHE D CE2 1 
ATOM   758  C  CE2 B PHE D  2 25 ? 31.789  10.992  13.576  0.33 36.66 ? 25  PHE D CE2 1 
ATOM   759  C  CZ  A PHE D  2 25 ? 30.289  15.274  8.338   0.67 39.91 ? 25  PHE D CZ  1 
ATOM   760  C  CZ  B PHE D  2 25 ? 31.077  10.836  14.777  0.33 36.79 ? 25  PHE D CZ  1 
ATOM   761  N  N   . TYR D  2 26 ? 25.970  11.325  10.966  1.00 35.16 ? 26  TYR D N   1 
ATOM   762  C  CA  . TYR D  2 26 ? 24.617  11.846  10.639  1.00 36.18 ? 26  TYR D CA  1 
ATOM   763  C  C   . TYR D  2 26 ? 24.212  12.381  12.008  1.00 38.41 ? 26  TYR D C   1 
ATOM   764  O  O   . TYR D  2 26 ? 24.245  11.636  12.997  1.00 37.85 ? 26  TYR D O   1 
ATOM   765  C  CB  . TYR D  2 26 ? 23.738  10.857  9.890   1.00 35.26 ? 26  TYR D CB  1 
ATOM   766  C  CG  . TYR D  2 26 ? 22.276  11.290  9.795   1.00 34.35 ? 26  TYR D CG  1 
ATOM   767  C  CD1 . TYR D  2 26 ? 21.316  10.945  10.742  1.00 33.60 ? 26  TYR D CD1 1 
ATOM   768  C  CD2 . TYR D  2 26 ? 21.897  12.045  8.677   1.00 34.44 ? 26  TYR D CD2 1 
ATOM   769  C  CE1 . TYR D  2 26 ? 19.991  11.376  10.570  1.00 34.95 ? 26  TYR D CE1 1 
ATOM   770  C  CE2 . TYR D  2 26 ? 20.587  12.461  8.496   1.00 34.28 ? 26  TYR D CE2 1 
ATOM   771  C  CZ  . TYR D  2 26 ? 19.651  12.138  9.470   1.00 34.10 ? 26  TYR D CZ  1 
ATOM   772  O  OH  . TYR D  2 26 ? 18.375  12.559  9.285   1.00 36.28 ? 26  TYR D OH  1 
ATOM   773  N  N   . THR D  2 27 ? 23.918  13.684  11.959  1.00 42.53 ? 27  THR D N   1 
ATOM   774  C  CA  . THR D  2 27 ? 23.473  14.445  13.155  1.00 46.52 ? 27  THR D CA  1 
ATOM   775  C  C   . THR D  2 27 ? 22.226  15.233  12.737  1.00 48.19 ? 27  THR D C   1 
ATOM   776  O  O   . THR D  2 27 ? 22.299  16.289  12.094  1.00 49.08 ? 27  THR D O   1 
ATOM   777  C  CB  . THR D  2 27 ? 24.579  15.339  13.830  1.00 47.06 ? 27  THR D CB  1 
ATOM   778  O  OG1 . THR D  2 27 ? 24.593  16.633  13.152  1.00 48.44 ? 27  THR D OG1 1 
ATOM   779  C  CG2 . THR D  2 27 ? 26.010  14.757  13.803  1.00 47.53 ? 27  THR D CG2 1 
ATOM   780  N  N   . PRO D  2 28 ? 21.088  14.644  13.057  1.00 49.91 ? 28  PRO D N   1 
ATOM   781  C  CA  . PRO D  2 28 ? 19.797  15.281  12.720  1.00 51.66 ? 28  PRO D CA  1 
ATOM   782  C  C   . PRO D  2 28 ? 19.739  16.624  13.457  1.00 53.06 ? 28  PRO D C   1 
ATOM   783  O  O   . PRO D  2 28 ? 19.706  17.739  12.948  1.00 53.67 ? 28  PRO D O   1 
ATOM   784  C  CB  . PRO D  2 28 ? 18.736  14.249  13.109  1.00 50.79 ? 28  PRO D CB  1 
ATOM   785  C  CG  . PRO D  2 28 ? 19.443  13.012  13.601  1.00 50.58 ? 28  PRO D CG  1 
ATOM   786  C  CD  . PRO D  2 28 ? 20.911  13.376  13.781  1.00 50.02 ? 28  PRO D CD  1 
ATOM   787  N  N   . LYS D  2 29 ? 19.775  16.498  14.752  1.00 55.33 ? 29  LYS D N   1 
ATOM   788  C  CA  . LYS D  2 29 ? 19.740  17.454  15.828  1.00 57.52 ? 29  LYS D CA  1 
ATOM   789  C  C   . LYS D  2 29 ? 20.940  17.191  16.767  1.00 58.69 ? 29  LYS D C   1 
ATOM   790  O  O   . LYS D  2 29 ? 21.759  18.168  16.740  1.00 60.08 ? 29  LYS D O   1 
ATOM   791  C  CB  . LYS D  2 29 ? 18.452  17.392  16.663  1.00 57.59 ? 29  LYS D CB  1 
ATOM   792  C  CG  . LYS D  2 29 ? 17.300  18.208  16.045  1.00 57.64 ? 29  LYS D CG  1 
ATOM   793  N  N   . GLY E  1 1  ? 10.280  -22.815 6.219   1.00 36.47 ? 1   GLY E N   1 
ATOM   794  C  CA  . GLY E  1 1  ? 9.534   -21.546 6.543   1.00 36.41 ? 1   GLY E CA  1 
ATOM   795  C  C   . GLY E  1 1  ? 9.638   -20.615 5.332   1.00 35.38 ? 1   GLY E C   1 
ATOM   796  O  O   . GLY E  1 1  ? 9.970   -21.009 4.213   1.00 34.56 ? 1   GLY E O   1 
ATOM   797  N  N   . ILE E  1 2  ? 9.314   -19.322 5.511   1.00 35.04 ? 2   ILE E N   1 
ATOM   798  C  CA  . ILE E  1 2  ? 9.414   -18.436 4.302   1.00 33.90 ? 2   ILE E CA  1 
ATOM   799  C  C   . ILE E  1 2  ? 10.850  -18.158 3.874   1.00 32.47 ? 2   ILE E C   1 
ATOM   800  O  O   . ILE E  1 2  ? 11.228  -18.073 2.693   1.00 30.13 ? 2   ILE E O   1 
ATOM   801  C  CB  . ILE E  1 2  ? 8.608   -17.094 4.589   1.00 34.41 ? 2   ILE E CB  1 
ATOM   802  C  CG1 . ILE E  1 2  ? 8.722   -16.322 3.230   1.00 35.39 ? 2   ILE E CG1 1 
ATOM   803  C  CG2 . ILE E  1 2  ? 9.046   -16.436 5.898   1.00 32.90 ? 2   ILE E CG2 1 
ATOM   804  C  CD1 . ILE E  1 2  ? 7.594   -15.245 3.006   1.00 35.17 ? 2   ILE E CD1 1 
ATOM   805  N  N   . VAL E  1 3  ? 11.692  -17.980 4.922   1.00 33.01 ? 3   VAL E N   1 
ATOM   806  C  CA  . VAL E  1 3  ? 13.116  -17.695 4.551   1.00 35.03 ? 3   VAL E CA  1 
ATOM   807  C  C   . VAL E  1 3  ? 13.750  -18.911 3.884   1.00 36.14 ? 3   VAL E C   1 
ATOM   808  O  O   . VAL E  1 3  ? 14.524  -18.759 2.916   1.00 36.45 ? 3   VAL E O   1 
ATOM   809  C  CB  . VAL E  1 3  ? 13.838  -17.115 5.758   1.00 35.02 ? 3   VAL E CB  1 
ATOM   810  C  CG1 . VAL E  1 3  ? 13.010  -16.233 6.662   1.00 35.30 ? 3   VAL E CG1 1 
ATOM   811  C  CG2 . VAL E  1 3  ? 14.413  -18.300 6.502   1.00 37.30 ? 3   VAL E CG2 1 
ATOM   812  N  N   . GLU E  1 4  ? 13.403  -20.108 4.345   1.00 37.82 ? 4   GLU E N   1 
ATOM   813  C  CA  . GLU E  1 4  ? 13.973  -21.332 3.696   1.00 39.78 ? 4   GLU E CA  1 
ATOM   814  C  C   . GLU E  1 4  ? 13.414  -21.379 2.290   1.00 39.66 ? 4   GLU E C   1 
ATOM   815  O  O   . GLU E  1 4  ? 14.091  -21.591 1.235   1.00 41.54 ? 4   GLU E O   1 
ATOM   816  C  CB  . GLU E  1 4  ? 13.771  -22.534 4.597   1.00 41.45 ? 4   GLU E CB  1 
ATOM   817  C  CG  . GLU E  1 4  ? 14.249  -22.510 6.061   1.00 43.68 ? 4   GLU E CG  1 
ATOM   818  C  CD  . GLU E  1 4  ? 13.461  -21.629 7.010   1.00 45.53 ? 4   GLU E CD  1 
ATOM   819  O  OE1 . GLU E  1 4  ? 12.308  -21.282 6.726   1.00 45.72 ? 4   GLU E OE1 1 
ATOM   820  O  OE2 . GLU E  1 4  ? 14.025  -21.256 8.096   1.00 45.87 ? 4   GLU E OE2 1 
ATOM   821  N  N   . GLN E  1 5  ? 12.124  -21.106 2.116   1.00 38.41 ? 5   GLN E N   1 
ATOM   822  C  CA  . GLN E  1 5  ? 11.649  -21.143 0.733   1.00 38.92 ? 5   GLN E CA  1 
ATOM   823  C  C   . GLN E  1 5  ? 12.192  -20.027 -0.148  1.00 37.79 ? 5   GLN E C   1 
ATOM   824  O  O   . GLN E  1 5  ? 12.730  -20.304 -1.223  1.00 38.07 ? 5   GLN E O   1 
ATOM   825  C  CB  . GLN E  1 5  ? 10.118  -21.179 0.651   1.00 43.10 ? 5   GLN E CB  1 
ATOM   826  C  CG  . GLN E  1 5  ? 9.538   -22.580 0.527   1.00 47.22 ? 5   GLN E CG  1 
ATOM   827  C  CD  . GLN E  1 5  ? 8.754   -22.981 1.759   1.00 50.04 ? 5   GLN E CD  1 
ATOM   828  O  OE1 . GLN E  1 5  ? 7.514   -22.744 1.821   1.00 51.08 ? 5   GLN E OE1 1 
ATOM   829  N  NE2 . GLN E  1 5  ? 9.526   -23.574 2.694   1.00 51.02 ? 5   GLN E NE2 1 
ATOM   830  N  N   . CYS E  1 6  ? 12.068  -18.766 0.266   1.00 34.67 ? 6   CYS E N   1 
ATOM   831  C  CA  . CYS E  1 6  ? 12.443  -17.621 -0.604  1.00 31.81 ? 6   CYS E CA  1 
ATOM   832  C  C   . CYS E  1 6  ? 13.837  -17.017 -0.606  1.00 30.50 ? 6   CYS E C   1 
ATOM   833  O  O   . CYS E  1 6  ? 14.088  -16.211 -1.538  1.00 28.66 ? 6   CYS E O   1 
ATOM   834  C  CB  . CYS E  1 6  ? 11.267  -16.615 -0.358  1.00 30.63 ? 6   CYS E CB  1 
ATOM   835  S  SG  . CYS E  1 6  ? 9.687   -17.470 -0.821  1.00 28.14 ? 6   CYS E SG  1 
ATOM   836  N  N   . CYS E  1 7  ? 14.719  -17.457 0.275   1.00 30.92 ? 7   CYS E N   1 
ATOM   837  C  CA  . CYS E  1 7  ? 16.124  -16.981 0.325   1.00 31.41 ? 7   CYS E CA  1 
ATOM   838  C  C   . CYS E  1 7  ? 17.143  -17.898 -0.328  1.00 33.09 ? 7   CYS E C   1 
ATOM   839  O  O   . CYS E  1 7  ? 18.283  -17.512 -0.544  1.00 32.30 ? 7   CYS E O   1 
ATOM   840  C  CB  . CYS E  1 7  ? 16.525  -16.658 1.737   1.00 29.98 ? 7   CYS E CB  1 
ATOM   841  S  SG  . CYS E  1 7  ? 15.532  -15.272 2.335   1.00 30.05 ? 7   CYS E SG  1 
ATOM   842  N  N   . THR E  1 8  ? 16.720  -19.129 -0.688  1.00 34.93 ? 8   THR E N   1 
ATOM   843  C  CA  . THR E  1 8  ? 17.598  -20.097 -1.334  1.00 35.26 ? 8   THR E CA  1 
ATOM   844  C  C   . THR E  1 8  ? 17.447  -19.885 -2.815  1.00 36.20 ? 8   THR E C   1 
ATOM   845  O  O   . THR E  1 8  ? 18.368  -19.856 -3.651  1.00 36.65 ? 8   THR E O   1 
ATOM   846  C  CB  . THR E  1 8  ? 17.270  -21.584 -0.879  1.00 36.62 ? 8   THR E CB  1 
ATOM   847  O  OG1 A THR E  1 8  ? 17.273  -21.636 0.579   0.67 36.46 ? 8   THR E OG1 1 
ATOM   848  O  OG1 B THR E  1 8  ? 15.811  -21.737 -0.748  0.33 35.03 ? 8   THR E OG1 1 
ATOM   849  C  CG2 A THR E  1 8  ? 18.236  -22.579 -1.550  0.67 36.94 ? 8   THR E CG2 1 
ATOM   850  C  CG2 B THR E  1 8  ? 17.989  -21.961 0.425   0.33 35.71 ? 8   THR E CG2 1 
ATOM   851  N  N   . SER E  1 9  ? 16.172  -19.694 -3.153  1.00 36.04 ? 9   SER E N   1 
ATOM   852  C  CA  . SER E  1 9  ? 15.836  -19.464 -4.563  1.00 37.24 ? 9   SER E CA  1 
ATOM   853  C  C   . SER E  1 9  ? 14.857  -18.303 -4.646  1.00 35.56 ? 9   SER E C   1 
ATOM   854  O  O   . SER E  1 9  ? 14.240  -18.096 -3.597  1.00 37.03 ? 9   SER E O   1 
ATOM   855  C  CB  . SER E  1 9  ? 15.181  -20.699 -5.208  1.00 38.60 ? 9   SER E CB  1 
ATOM   856  O  OG  . SER E  1 9  ? 15.523  -20.557 -6.604  1.00 40.02 ? 9   SER E OG  1 
ATOM   857  N  N   . ILE E  1 10 ? 14.769  -17.675 -5.802  1.00 35.57 ? 10  ILE E N   1 
ATOM   858  C  CA  . ILE E  1 10 ? 13.831  -16.559 -5.879  1.00 35.60 ? 10  ILE E CA  1 
ATOM   859  C  C   . ILE E  1 10 ? 12.356  -16.994 -6.043  1.00 34.57 ? 10  ILE E C   1 
ATOM   860  O  O   . ILE E  1 10 ? 12.039  -17.690 -7.031  1.00 34.90 ? 10  ILE E O   1 
ATOM   861  C  CB  . ILE E  1 10 ? 14.192  -15.464 -6.936  1.00 36.20 ? 10  ILE E CB  1 
ATOM   862  C  CG1 . ILE E  1 10 ? 13.108  -14.360 -6.723  1.00 37.29 ? 10  ILE E CG1 1 
ATOM   863  C  CG2 . ILE E  1 10 ? 14.171  -15.961 -8.392  1.00 37.02 ? 10  ILE E CG2 1 
ATOM   864  C  CD1 . ILE E  1 10 ? 13.262  -13.115 -7.633  1.00 39.24 ? 10  ILE E CD1 1 
ATOM   865  N  N   . CYS E  1 11 ? 11.519  -16.492 -5.141  1.00 32.56 ? 11  CYS E N   1 
ATOM   866  C  CA  . CYS E  1 11 ? 10.068  -16.807 -5.206  1.00 31.90 ? 11  CYS E CA  1 
ATOM   867  C  C   . CYS E  1 11 ? 9.329   -15.925 -6.178  1.00 32.32 ? 11  CYS E C   1 
ATOM   868  O  O   . CYS E  1 11 ? 9.693   -14.745 -6.338  1.00 34.40 ? 11  CYS E O   1 
ATOM   869  C  CB  . CYS E  1 11 ? 9.475   -16.761 -3.829  1.00 29.97 ? 11  CYS E CB  1 
ATOM   870  S  SG  . CYS E  1 11 ? 9.865   -17.987 -2.619  1.00 26.55 ? 11  CYS E SG  1 
ATOM   871  N  N   . SER E  1 12 ? 8.335   -16.403 -6.885  1.00 31.85 ? 12  SER E N   1 
ATOM   872  C  CA  . SER E  1 12 ? 7.512   -15.659 -7.833  1.00 31.92 ? 12  SER E CA  1 
ATOM   873  C  C   . SER E  1 12 ? 6.477   -14.845 -7.040  1.00 32.03 ? 12  SER E C   1 
ATOM   874  O  O   . SER E  1 12 ? 6.342   -15.008 -5.798  1.00 31.63 ? 12  SER E O   1 
ATOM   875  C  CB  . SER E  1 12 ? 6.700   -16.659 -8.694  1.00 33.67 ? 12  SER E CB  1 
ATOM   876  O  OG  . SER E  1 12 ? 5.960   -17.547 -7.766  1.00 34.25 ? 12  SER E OG  1 
ATOM   877  N  N   . LEU E  1 13 ? 5.688   -14.012 -7.757  1.00 33.70 ? 13  LEU E N   1 
ATOM   878  C  CA  . LEU E  1 13 ? 4.646   -13.215 -7.036  1.00 34.26 ? 13  LEU E CA  1 
ATOM   879  C  C   . LEU E  1 13 ? 3.562   -14.135 -6.445  1.00 33.03 ? 13  LEU E C   1 
ATOM   880  O  O   . LEU E  1 13 ? 3.053   -13.919 -5.325  1.00 30.76 ? 13  LEU E O   1 
ATOM   881  C  CB  . LEU E  1 13 ? 4.297   -12.053 -8.006  1.00 37.02 ? 13  LEU E CB  1 
ATOM   882  C  CG  . LEU E  1 13 ? 5.554   -11.196 -8.315  1.00 38.73 ? 13  LEU E CG  1 
ATOM   883  C  CD1 . LEU E  1 13 ? 5.570   -10.430 -9.617  1.00 39.96 ? 13  LEU E CD1 1 
ATOM   884  C  CD2 . LEU E  1 13 ? 5.684   -10.192 -7.169  1.00 40.20 ? 13  LEU E CD2 1 
ATOM   885  N  N   . TYR E  1 14 ? 3.271   -15.226 -7.149  1.00 34.25 ? 14  TYR E N   1 
ATOM   886  C  CA  . TYR E  1 14 ? 2.290   -16.271 -6.702  1.00 35.03 ? 14  TYR E CA  1 
ATOM   887  C  C   . TYR E  1 14 ? 2.647   -16.932 -5.386  1.00 33.86 ? 14  TYR E C   1 
ATOM   888  O  O   . TYR E  1 14 ? 1.861   -17.236 -4.462  1.00 34.60 ? 14  TYR E O   1 
ATOM   889  C  CB  . TYR E  1 14 ? 2.222   -17.375 -7.788  1.00 38.04 ? 14  TYR E CB  1 
ATOM   890  C  CG  . TYR E  1 14 ? 1.311   -18.515 -7.372  1.00 40.59 ? 14  TYR E CG  1 
ATOM   891  C  CD1 . TYR E  1 14 ? -0.085  -18.329 -7.278  1.00 41.43 ? 14  TYR E CD1 1 
ATOM   892  C  CD2 . TYR E  1 14 ? 1.847   -19.771 -7.055  1.00 42.22 ? 14  TYR E CD2 1 
ATOM   893  C  CE1 . TYR E  1 14 ? -0.935  -19.369 -6.889  1.00 41.91 ? 14  TYR E CE1 1 
ATOM   894  C  CE2 . TYR E  1 14 ? 0.994   -20.830 -6.671  1.00 42.75 ? 14  TYR E CE2 1 
ATOM   895  C  CZ  . TYR E  1 14 ? -0.384  -20.631 -6.590  1.00 42.60 ? 14  TYR E CZ  1 
ATOM   896  O  OH  . TYR E  1 14 ? -1.162  -21.692 -6.206  1.00 41.33 ? 14  TYR E OH  1 
ATOM   897  N  N   . GLN E  1 15 ? 3.944   -17.221 -5.209  1.00 34.26 ? 15  GLN E N   1 
ATOM   898  C  CA  . GLN E  1 15 ? 4.430   -17.827 -3.960  1.00 33.00 ? 15  GLN E CA  1 
ATOM   899  C  C   . GLN E  1 15 ? 4.474   -16.786 -2.862  1.00 31.56 ? 15  GLN E C   1 
ATOM   900  O  O   . GLN E  1 15 ? 4.204   -17.227 -1.741  1.00 31.29 ? 15  GLN E O   1 
ATOM   901  C  CB  . GLN E  1 15 ? 5.727   -18.567 -4.115  1.00 35.87 ? 15  GLN E CB  1 
ATOM   902  C  CG  . GLN E  1 15 ? 5.783   -19.316 -5.424  1.00 37.24 ? 15  GLN E CG  1 
ATOM   903  C  CD  . GLN E  1 15 ? 7.204   -19.694 -5.792  1.00 39.60 ? 15  GLN E CD  1 
ATOM   904  O  OE1 . GLN E  1 15 ? 8.049   -19.059 -6.447  1.00 39.54 ? 15  GLN E OE1 1 
ATOM   905  N  NE2 . GLN E  1 15 ? 7.440   -20.950 -5.366  1.00 41.22 ? 15  GLN E NE2 1 
ATOM   906  N  N   . LEU E  1 16 ? 4.770   -15.509 -3.164  1.00 29.88 ? 16  LEU E N   1 
ATOM   907  C  CA  . LEU E  1 16 ? 4.782   -14.499 -2.070  1.00 27.66 ? 16  LEU E CA  1 
ATOM   908  C  C   . LEU E  1 16 ? 3.345   -14.250 -1.654  1.00 25.92 ? 16  LEU E C   1 
ATOM   909  O  O   . LEU E  1 16 ? 3.003   -14.024 -0.490  1.00 25.11 ? 16  LEU E O   1 
ATOM   910  C  CB  . LEU E  1 16 ? 5.510   -13.257 -2.603  1.00 27.67 ? 16  LEU E CB  1 
ATOM   911  C  CG  . LEU E  1 16 ? 6.994   -13.377 -2.958  1.00 29.75 ? 16  LEU E CG  1 
ATOM   912  C  CD1 . LEU E  1 16 ? 7.524   -12.114 -3.631  1.00 29.66 ? 16  LEU E CD1 1 
ATOM   913  C  CD2 . LEU E  1 16 ? 7.780   -13.745 -1.703  1.00 28.47 ? 16  LEU E CD2 1 
ATOM   914  N  N   . GLU E  1 17 ? 2.419   -14.260 -2.588  1.00 28.41 ? 17  GLU E N   1 
ATOM   915  C  CA  . GLU E  1 17 ? 0.973   -14.036 -2.234  1.00 31.91 ? 17  GLU E CA  1 
ATOM   916  C  C   . GLU E  1 17 ? 0.390   -14.940 -1.172  1.00 31.81 ? 17  GLU E C   1 
ATOM   917  O  O   . GLU E  1 17 ? -0.561  -14.672 -0.392  1.00 31.63 ? 17  GLU E O   1 
ATOM   918  C  CB  . GLU E  1 17 ? 0.172   -14.340 -3.473  1.00 35.36 ? 17  GLU E CB  1 
ATOM   919  C  CG  . GLU E  1 17 ? 0.114   -13.272 -4.563  1.00 41.56 ? 17  GLU E CG  1 
ATOM   920  C  CD  . GLU E  1 17 ? -1.276  -13.379 -5.214  1.00 44.31 ? 17  GLU E CD  1 
ATOM   921  O  OE1 . GLU E  1 17 ? -2.219  -13.830 -4.551  1.00 46.38 ? 17  GLU E OE1 1 
ATOM   922  O  OE2 . GLU E  1 17 ? -1.292  -12.982 -6.399  1.00 45.96 ? 17  GLU E OE2 1 
ATOM   923  N  N   . ASN E  1 18 ? 1.034   -16.109 -1.095  1.00 30.89 ? 18  ASN E N   1 
ATOM   924  C  CA  . ASN E  1 18 ? 0.676   -17.158 -0.127  1.00 31.27 ? 18  ASN E CA  1 
ATOM   925  C  C   . ASN E  1 18 ? 0.739   -16.572 1.248   1.00 31.42 ? 18  ASN E C   1 
ATOM   926  O  O   . ASN E  1 18 ? 0.048   -17.139 2.072   1.00 30.01 ? 18  ASN E O   1 
ATOM   927  C  CB  . ASN E  1 18 ? 1.541   -18.440 -0.213  1.00 31.81 ? 18  ASN E CB  1 
ATOM   928  C  CG  . ASN E  1 18 ? 1.241   -19.340 0.960   1.00 33.45 ? 18  ASN E CG  1 
ATOM   929  O  OD1 . ASN E  1 18 ? 0.249   -20.093 0.975   1.00 32.68 ? 18  ASN E OD1 1 
ATOM   930  N  ND2 . ASN E  1 18 ? 2.020   -19.406 2.037   1.00 34.03 ? 18  ASN E ND2 1 
ATOM   931  N  N   . TYR E  1 19 ? 1.583   -15.516 1.492   1.00 32.14 ? 19  TYR E N   1 
ATOM   932  C  CA  . TYR E  1 19 ? 1.699   -14.969 2.838   1.00 30.06 ? 19  TYR E CA  1 
ATOM   933  C  C   . TYR E  1 19 ? 0.805   -13.798 3.105   1.00 31.54 ? 19  TYR E C   1 
ATOM   934  O  O   . TYR E  1 19 ? 0.882   -13.406 4.277   1.00 31.78 ? 19  TYR E O   1 
ATOM   935  C  CB  . TYR E  1 19 ? 3.168   -14.604 3.184   1.00 29.98 ? 19  TYR E CB  1 
ATOM   936  C  CG  . TYR E  1 19 ? 3.976   -15.920 3.175   1.00 30.15 ? 19  TYR E CG  1 
ATOM   937  C  CD1 . TYR E  1 19 ? 4.064   -16.756 4.271   1.00 30.36 ? 19  TYR E CD1 1 
ATOM   938  C  CD2 . TYR E  1 19 ? 4.602   -16.307 2.003   1.00 29.33 ? 19  TYR E CD2 1 
ATOM   939  C  CE1 . TYR E  1 19 ? 4.790   -17.964 4.172   1.00 31.10 ? 19  TYR E CE1 1 
ATOM   940  C  CE2 . TYR E  1 19 ? 5.326   -17.517 1.902   1.00 30.70 ? 19  TYR E CE2 1 
ATOM   941  C  CZ  . TYR E  1 19 ? 5.417   -18.333 3.006   1.00 30.40 ? 19  TYR E CZ  1 
ATOM   942  O  OH  . TYR E  1 19 ? 6.175   -19.459 2.887   1.00 32.21 ? 19  TYR E OH  1 
ATOM   943  N  N   . CYS E  1 20 ? 0.059   -13.389 2.114   1.00 34.70 ? 20  CYS E N   1 
ATOM   944  C  CA  . CYS E  1 20 ? -0.908  -12.255 2.283   1.00 38.44 ? 20  CYS E CA  1 
ATOM   945  C  C   . CYS E  1 20 ? -2.070  -12.656 3.200   1.00 41.40 ? 20  CYS E C   1 
ATOM   946  O  O   . CYS E  1 20 ? -2.509  -13.829 3.281   1.00 41.71 ? 20  CYS E O   1 
ATOM   947  C  CB  . CYS E  1 20 ? -1.429  -11.733 0.944   1.00 35.52 ? 20  CYS E CB  1 
ATOM   948  S  SG  . CYS E  1 20 ? -0.190  -11.189 -0.264  1.00 36.01 ? 20  CYS E SG  1 
ATOM   949  N  N   . ASN E  1 21 ? -2.623  -11.696 3.933   1.00 44.02 ? 21  ASN E N   1 
ATOM   950  C  CA  . ASN E  1 21 ? -3.720  -11.988 4.868   1.00 45.43 ? 21  ASN E CA  1 
ATOM   951  C  C   . ASN E  1 21 ? -5.106  -12.075 4.228   1.00 45.89 ? 21  ASN E C   1 
ATOM   952  O  O   . ASN E  1 21 ? -5.222  -12.160 3.008   1.00 45.58 ? 21  ASN E O   1 
ATOM   953  C  CB  . ASN E  1 21 ? -3.730  -11.094 6.089   1.00 47.02 ? 21  ASN E CB  1 
ATOM   954  C  CG  . ASN E  1 21 ? -2.888  -11.556 7.256   1.00 48.08 ? 21  ASN E CG  1 
ATOM   955  O  OD1 . ASN E  1 21 ? -2.445  -10.711 8.064   1.00 49.66 ? 21  ASN E OD1 1 
ATOM   956  N  ND2 . ASN E  1 21 ? -2.634  -12.841 7.410   1.00 49.04 ? 21  ASN E ND2 1 
ATOM   957  O  OXT . ASN E  1 21 ? -5.992  -12.131 5.108   1.00 46.84 ? 21  ASN E OXT 1 
ATOM   958  C  CA  . PHE F  2 1  ? 26.856  -15.297 7.812   1.00 44.66 ? 1   PHE F CA  1 
ATOM   959  C  C   . PHE F  2 1  ? 25.514  -14.660 8.204   1.00 43.74 ? 1   PHE F C   1 
ATOM   960  O  O   . PHE F  2 1  ? 24.746  -15.222 9.033   1.00 45.49 ? 1   PHE F O   1 
ATOM   961  N  N   . VAL F  2 2  ? 25.290  -13.488 7.580   1.00 40.40 ? 2   VAL F N   1 
ATOM   962  C  CA  . VAL F  2 2  ? 24.025  -12.771 7.858   1.00 34.40 ? 2   VAL F CA  1 
ATOM   963  C  C   . VAL F  2 2  ? 23.191  -12.794 6.614   1.00 31.68 ? 2   VAL F C   1 
ATOM   964  O  O   . VAL F  2 2  ? 22.307  -11.929 6.542   1.00 30.96 ? 2   VAL F O   1 
ATOM   965  C  CB  . VAL F  2 2  ? 24.397  -11.342 8.332   1.00 33.83 ? 2   VAL F CB  1 
ATOM   966  C  CG1 . VAL F  2 2  ? 25.190  -11.360 9.618   1.00 32.22 ? 2   VAL F CG1 1 
ATOM   967  C  CG2 . VAL F  2 2  ? 24.997  -10.524 7.195   1.00 32.78 ? 2   VAL F CG2 1 
ATOM   968  N  N   . ASN F  2 3  ? 23.378  -13.651 5.666   1.00 30.02 ? 3   ASN F N   1 
ATOM   969  C  CA  . ASN F  2 3  ? 22.652  -13.778 4.405   1.00 29.82 ? 3   ASN F CA  1 
ATOM   970  C  C   . ASN F  2 3  ? 21.111  -13.832 4.511   1.00 28.62 ? 3   ASN F C   1 
ATOM   971  O  O   . ASN F  2 3  ? 20.435  -13.213 3.694   1.00 26.96 ? 3   ASN F O   1 
ATOM   972  C  CB  . ASN F  2 3  ? 23.175  -14.967 3.567   1.00 33.27 ? 3   ASN F CB  1 
ATOM   973  C  CG  . ASN F  2 3  ? 24.558  -14.704 3.006   1.00 34.35 ? 3   ASN F CG  1 
ATOM   974  O  OD1 . ASN F  2 3  ? 25.313  -13.877 3.546   1.00 36.92 ? 3   ASN F OD1 1 
ATOM   975  N  ND2 . ASN F  2 3  ? 24.900  -15.309 1.907   1.00 35.77 ? 3   ASN F ND2 1 
ATOM   976  N  N   . GLN F  2 4  ? 20.637  -14.618 5.446   1.00 28.21 ? 4   GLN F N   1 
ATOM   977  C  CA  . GLN F  2 4  ? 19.255  -14.877 5.810   1.00 28.68 ? 4   GLN F CA  1 
ATOM   978  C  C   . GLN F  2 4  ? 18.615  -13.555 6.357   1.00 26.19 ? 4   GLN F C   1 
ATOM   979  O  O   . GLN F  2 4  ? 17.456  -13.197 6.021   1.00 27.55 ? 4   GLN F O   1 
ATOM   980  C  CB  . GLN F  2 4  ? 19.117  -15.991 6.853   1.00 28.58 ? 4   GLN F CB  1 
ATOM   981  C  CG  A GLN F  2 4  ? 18.868  -17.354 6.228   0.50 30.39 ? 4   GLN F CG  1 
ATOM   982  C  CG  B GLN F  2 4  ? 20.017  -17.186 6.659   0.50 30.02 ? 4   GLN F CG  1 
ATOM   983  C  CD  A GLN F  2 4  ? 19.456  -17.691 4.904   0.50 30.57 ? 4   GLN F CD  1 
ATOM   984  C  CD  B GLN F  2 4  ? 21.472  -17.073 7.010   0.50 29.89 ? 4   GLN F CD  1 
ATOM   985  O  OE1 A GLN F  2 4  ? 18.760  -17.983 3.912   0.50 32.41 ? 4   GLN F OE1 1 
ATOM   986  O  OE1 B GLN F  2 4  ? 22.326  -17.142 6.130   0.50 31.05 ? 4   GLN F OE1 1 
ATOM   987  N  NE2 A GLN F  2 4  ? 20.781  -17.718 4.782   0.50 31.07 ? 4   GLN F NE2 1 
ATOM   988  N  NE2 B GLN F  2 4  ? 21.886  -16.922 8.260   0.50 30.10 ? 4   GLN F NE2 1 
ATOM   989  N  N   . HIS F  2 5  ? 19.356  -12.943 7.228   1.00 23.56 ? 5   HIS F N   1 
ATOM   990  C  CA  . HIS F  2 5  ? 18.996  -11.667 7.848   1.00 23.70 ? 5   HIS F CA  1 
ATOM   991  C  C   . HIS F  2 5  ? 18.795  -10.562 6.807   1.00 19.91 ? 5   HIS F C   1 
ATOM   992  O  O   . HIS F  2 5  ? 17.734  -9.853  6.832   1.00 16.89 ? 5   HIS F O   1 
ATOM   993  C  CB  . HIS F  2 5  ? 19.976  -11.299 8.953   1.00 24.72 ? 5   HIS F CB  1 
ATOM   994  C  CG  . HIS F  2 5  ? 19.602  -10.063 9.710   1.00 29.26 ? 5   HIS F CG  1 
ATOM   995  N  ND1 . HIS F  2 5  ? 18.554  -9.916  10.592  1.00 30.18 ? 5   HIS F ND1 1 
ATOM   996  C  CD2 . HIS F  2 5  ? 20.211  -8.856  9.773   1.00 30.92 ? 5   HIS F CD2 1 
ATOM   997  C  CE1 . HIS F  2 5  ? 18.521  -8.764  11.169  1.00 31.00 ? 5   HIS F CE1 1 
ATOM   998  N  NE2 . HIS F  2 5  ? 19.530  -8.088  10.688  1.00 32.43 ? 5   HIS F NE2 1 
ATOM   999  N  N   . LEU F  2 6  ? 19.638  -10.407 5.817   1.00 19.93 ? 6   LEU F N   1 
ATOM   1000 C  CA  . LEU F  2 6  ? 19.658  -9.447  4.678   1.00 19.52 ? 6   LEU F CA  1 
ATOM   1001 C  C   . LEU F  2 6  ? 18.520  -9.792  3.696   1.00 20.58 ? 6   LEU F C   1 
ATOM   1002 O  O   . LEU F  2 6  ? 17.669  -8.983  3.260   1.00 17.49 ? 6   LEU F O   1 
ATOM   1003 C  CB  . LEU F  2 6  ? 21.031  -9.350  4.017   1.00 20.10 ? 6   LEU F CB  1 
ATOM   1004 C  CG  . LEU F  2 6  ? 22.286  -8.956  4.846   1.00 20.34 ? 6   LEU F CG  1 
ATOM   1005 C  CD1 . LEU F  2 6  ? 23.432  -8.757  3.853   1.00 20.88 ? 6   LEU F CD1 1 
ATOM   1006 C  CD2 . LEU F  2 6  ? 22.126  -7.659  5.659   1.00 22.17 ? 6   LEU F CD2 1 
ATOM   1007 N  N   . CYS F  2 7  ? 18.438  -11.096 3.357   1.00 17.22 ? 7   CYS F N   1 
ATOM   1008 C  CA  . CYS F  2 7  ? 17.361  -11.561 2.534   1.00 20.91 ? 7   CYS F CA  1 
ATOM   1009 C  C   . CYS F  2 7  ? 15.982  -11.251 3.214   1.00 19.25 ? 7   CYS F C   1 
ATOM   1010 O  O   . CYS F  2 7  ? 15.157  -10.828 2.404   1.00 19.13 ? 7   CYS F O   1 
ATOM   1011 C  CB  . CYS F  2 7  ? 17.393  -13.086 2.268   1.00 23.12 ? 7   CYS F CB  1 
ATOM   1012 S  SG  . CYS F  2 7  ? 16.101  -13.729 1.134   1.00 27.33 ? 7   CYS F SG  1 
ATOM   1013 N  N   . GLY F  2 8  ? 15.801  -11.526 4.473   1.00 19.82 ? 8   GLY F N   1 
ATOM   1014 C  CA  . GLY F  2 8  ? 14.489  -11.283 5.115   1.00 20.50 ? 8   GLY F CA  1 
ATOM   1015 C  C   . GLY F  2 8  ? 14.058  -9.813  4.989   1.00 21.26 ? 8   GLY F C   1 
ATOM   1016 O  O   . GLY F  2 8  ? 12.857  -9.598  4.829   1.00 20.63 ? 8   GLY F O   1 
ATOM   1017 N  N   . SER F  2 9  ? 14.973  -8.837  5.104   1.00 20.13 ? 9   SER F N   1 
ATOM   1018 C  CA  . SER F  2 9  ? 14.601  -7.434  4.959   1.00 20.74 ? 9   SER F CA  1 
ATOM   1019 C  C   . SER F  2 9  ? 13.995  -7.223  3.603   1.00 19.38 ? 9   SER F C   1 
ATOM   1020 O  O   . SER F  2 9  ? 12.962  -6.526  3.535   1.00 18.78 ? 9   SER F O   1 
ATOM   1021 C  CB  . SER F  2 9  ? 15.871  -6.532  5.228   1.00 23.81 ? 9   SER F CB  1 
ATOM   1022 O  OG  . SER F  2 9  ? 15.395  -5.287  4.721   1.00 28.93 ? 9   SER F OG  1 
ATOM   1023 N  N   . HIS F  2 10 ? 14.494  -7.777  2.508   1.00 15.72 ? 10  HIS F N   1 
ATOM   1024 C  CA  . HIS F  2 10 ? 14.011  -7.653  1.160   1.00 17.50 ? 10  HIS F CA  1 
ATOM   1025 C  C   . HIS F  2 10 ? 12.658  -8.375  1.011   1.00 18.49 ? 10  HIS F C   1 
ATOM   1026 O  O   . HIS F  2 10 ? 11.829  -7.870  0.245   1.00 17.37 ? 10  HIS F O   1 
ATOM   1027 C  CB  . HIS F  2 10 ? 14.934  -8.188  0.059   1.00 17.18 ? 10  HIS F CB  1 
ATOM   1028 C  CG  . HIS F  2 10 ? 16.099  -7.222  0.035   1.00 21.38 ? 10  HIS F CG  1 
ATOM   1029 N  ND1 . HIS F  2 10 ? 16.118  -6.172  -0.871  1.00 21.03 ? 10  HIS F ND1 1 
ATOM   1030 C  CD2 . HIS F  2 10 ? 17.287  -7.213  0.679   1.00 19.53 ? 10  HIS F CD2 1 
ATOM   1031 C  CE1 . HIS F  2 10 ? 17.218  -5.452  -0.721  1.00 21.53 ? 10  HIS F CE1 1 
ATOM   1032 N  NE2 . HIS F  2 10 ? 17.911  -6.137  0.148   1.00 21.81 ? 10  HIS F NE2 1 
ATOM   1033 N  N   . LEU F  2 11 ? 12.507  -9.541  1.650   1.00 19.42 ? 11  LEU F N   1 
ATOM   1034 C  CA  . LEU F  2 11 ? 11.229  -10.292 1.577   1.00 20.46 ? 11  LEU F CA  1 
ATOM   1035 C  C   . LEU F  2 11 ? 10.030  -9.492  2.247   1.00 18.80 ? 11  LEU F C   1 
ATOM   1036 O  O   . LEU F  2 11 ? 9.009   -9.577  1.591   1.00 20.09 ? 11  LEU F O   1 
ATOM   1037 C  CB  . LEU F  2 11 ? 11.227  -11.599 2.340   1.00 22.19 ? 11  LEU F CB  1 
ATOM   1038 C  CG  . LEU F  2 11 ? 11.755  -12.954 1.861   1.00 23.29 ? 11  LEU F CG  1 
ATOM   1039 C  CD1 . LEU F  2 11 ? 11.559  -13.781 3.158   1.00 24.28 ? 11  LEU F CD1 1 
ATOM   1040 C  CD2 . LEU F  2 11 ? 10.983  -13.467 0.695   1.00 23.81 ? 11  LEU F CD2 1 
ATOM   1041 N  N   . VAL F  2 12 ? 10.142  -8.902  3.375   1.00 19.15 ? 12  VAL F N   1 
ATOM   1042 C  CA  . VAL F  2 12 ? 9.109   -8.125  4.025   1.00 22.62 ? 12  VAL F CA  1 
ATOM   1043 C  C   . VAL F  2 12 ? 8.678   -6.981  3.101   1.00 22.67 ? 12  VAL F C   1 
ATOM   1044 O  O   . VAL F  2 12 ? 7.496   -6.613  2.998   1.00 21.03 ? 12  VAL F O   1 
ATOM   1045 C  CB  . VAL F  2 12 ? 9.337   -7.730  5.474   1.00 25.23 ? 12  VAL F CB  1 
ATOM   1046 C  CG1 . VAL F  2 12 ? 9.452   -8.931  6.424   1.00 25.11 ? 12  VAL F CG1 1 
ATOM   1047 C  CG2 . VAL F  2 12 ? 10.421  -6.681  5.783   1.00 27.70 ? 12  VAL F CG2 1 
ATOM   1048 N  N   . GLU F  2 13 ? 9.622   -6.398  2.390   1.00 21.94 ? 13  GLU F N   1 
ATOM   1049 C  CA  . GLU F  2 13 ? 9.404   -5.314  1.445   1.00 24.26 ? 13  GLU F CA  1 
ATOM   1050 C  C   . GLU F  2 13 ? 8.621   -5.757  0.246   1.00 23.17 ? 13  GLU F C   1 
ATOM   1051 O  O   . GLU F  2 13 ? 7.752   -5.108  -0.372  1.00 18.10 ? 13  GLU F O   1 
ATOM   1052 C  CB  . GLU F  2 13 ? 10.784  -4.775  1.025   1.00 28.26 ? 13  GLU F CB  1 
ATOM   1053 C  CG  . GLU F  2 13 ? 10.624  -3.670  0.010   1.00 35.29 ? 13  GLU F CG  1 
ATOM   1054 C  CD  . GLU F  2 13 ? 11.862  -2.766  -0.054  1.00 40.27 ? 13  GLU F CD  1 
ATOM   1055 O  OE1 . GLU F  2 13 ? 12.854  -3.001  0.665   1.00 41.87 ? 13  GLU F OE1 1 
ATOM   1056 O  OE2 . GLU F  2 13 ? 11.592  -1.859  -0.934  1.00 42.28 ? 13  GLU F OE2 1 
ATOM   1057 N  N   . ALA F  2 14 ? 8.985   -6.981  -0.262  1.00 19.76 ? 14  ALA F N   1 
ATOM   1058 C  CA  . ALA F  2 14 ? 8.271   -7.548  -1.418  1.00 19.34 ? 14  ALA F CA  1 
ATOM   1059 C  C   . ALA F  2 14 ? 6.882   -7.974  -0.902  1.00 18.54 ? 14  ALA F C   1 
ATOM   1060 O  O   . ALA F  2 14 ? 5.982   -7.738  -1.710  1.00 21.45 ? 14  ALA F O   1 
ATOM   1061 C  CB  . ALA F  2 14 ? 8.992   -8.686  -2.116  1.00 19.17 ? 14  ALA F CB  1 
ATOM   1062 N  N   . LEU F  2 15 ? 6.664   -8.468  0.265   1.00 19.49 ? 15  LEU F N   1 
ATOM   1063 C  CA  . LEU F  2 15 ? 5.336   -8.883  0.747   1.00 20.44 ? 15  LEU F CA  1 
ATOM   1064 C  C   . LEU F  2 15 ? 4.395   -7.672  0.892   1.00 22.77 ? 15  LEU F C   1 
ATOM   1065 O  O   . LEU F  2 15 ? 3.158   -7.660  0.726   1.00 20.33 ? 15  LEU F O   1 
ATOM   1066 C  CB  . LEU F  2 15 ? 5.505   -9.598  2.064   1.00 19.84 ? 15  LEU F CB  1 
ATOM   1067 C  CG  . LEU F  2 15 ? 6.111   -10.972 2.238   1.00 20.77 ? 15  LEU F CG  1 
ATOM   1068 C  CD1 . LEU F  2 15 ? 6.028   -11.361 3.696   1.00 21.94 ? 15  LEU F CD1 1 
ATOM   1069 C  CD2 . LEU F  2 15 ? 5.352   -11.979 1.376   1.00 22.43 ? 15  LEU F CD2 1 
ATOM   1070 N  N   . TYR F  2 16 ? 4.990   -6.588  1.317   1.00 22.50 ? 16  TYR F N   1 
ATOM   1071 C  CA  . TYR F  2 16 ? 4.279   -5.301  1.539   1.00 23.30 ? 16  TYR F CA  1 
ATOM   1072 C  C   . TYR F  2 16 ? 3.707   -4.871  0.216   1.00 21.82 ? 16  TYR F C   1 
ATOM   1073 O  O   . TYR F  2 16 ? 2.515   -4.497  0.194   1.00 23.83 ? 16  TYR F O   1 
ATOM   1074 C  CB  . TYR F  2 16 ? 5.224   -4.222  2.179   1.00 23.17 ? 16  TYR F CB  1 
ATOM   1075 C  CG  . TYR F  2 16 ? 4.522   -2.846  2.239   1.00 22.69 ? 16  TYR F CG  1 
ATOM   1076 C  CD1 . TYR F  2 16 ? 3.707   -2.622  3.316   1.00 20.98 ? 16  TYR F CD1 1 
ATOM   1077 C  CD2 . TYR F  2 16 ? 4.677   -1.847  1.256   1.00 23.60 ? 16  TYR F CD2 1 
ATOM   1078 C  CE1 . TYR F  2 16 ? 3.011   -1.420  3.449   1.00 22.09 ? 16  TYR F CE1 1 
ATOM   1079 C  CE2 . TYR F  2 16 ? 3.995   -0.597  1.396   1.00 22.87 ? 16  TYR F CE2 1 
ATOM   1080 C  CZ  . TYR F  2 16 ? 3.151   -0.434  2.467   1.00 22.10 ? 16  TYR F CZ  1 
ATOM   1081 O  OH  . TYR F  2 16 ? 2.477   0.761   2.702   1.00 23.84 ? 16  TYR F OH  1 
ATOM   1082 N  N   . LEU F  2 17 ? 4.425   -4.930  -0.861  1.00 21.23 ? 17  LEU F N   1 
ATOM   1083 C  CA  . LEU F  2 17 ? 4.018   -4.498  -2.140  1.00 24.57 ? 17  LEU F CA  1 
ATOM   1084 C  C   . LEU F  2 17 ? 3.003   -5.510  -2.743  1.00 26.99 ? 17  LEU F C   1 
ATOM   1085 O  O   . LEU F  2 17 ? 2.046   -5.061  -3.387  1.00 26.34 ? 17  LEU F O   1 
ATOM   1086 C  CB  . LEU F  2 17 ? 5.210   -4.250  -3.060  1.00 25.24 ? 17  LEU F CB  1 
ATOM   1087 C  CG  . LEU F  2 17 ? 6.195   -3.111  -2.678  1.00 28.68 ? 17  LEU F CG  1 
ATOM   1088 C  CD1 . LEU F  2 17 ? 7.323   -2.965  -3.678  1.00 27.03 ? 17  LEU F CD1 1 
ATOM   1089 C  CD2 . LEU F  2 17 ? 5.329   -1.852  -2.645  1.00 28.51 ? 17  LEU F CD2 1 
ATOM   1090 N  N   . VAL F  2 18 ? 3.292   -6.785  -2.575  1.00 26.07 ? 18  VAL F N   1 
ATOM   1091 C  CA  . VAL F  2 18 ? 2.405   -7.818  -3.142  1.00 29.12 ? 18  VAL F CA  1 
ATOM   1092 C  C   . VAL F  2 18 ? 1.015   -7.862  -2.490  1.00 28.71 ? 18  VAL F C   1 
ATOM   1093 O  O   . VAL F  2 18 ? 0.006   -7.945  -3.223  1.00 31.96 ? 18  VAL F O   1 
ATOM   1094 C  CB  . VAL F  2 18 ? 3.160   -9.201  -3.172  1.00 28.15 ? 18  VAL F CB  1 
ATOM   1095 C  CG1 . VAL F  2 18 ? 2.204   -10.362 -3.523  1.00 28.63 ? 18  VAL F CG1 1 
ATOM   1096 C  CG2 . VAL F  2 18 ? 4.303   -9.209  -4.132  1.00 27.01 ? 18  VAL F CG2 1 
ATOM   1097 N  N   . CYS F  2 19 ? 0.849   -7.822  -1.226  1.00 30.65 ? 19  CYS F N   1 
ATOM   1098 C  CA  . CYS F  2 19 ? -0.301  -7.928  -0.358  1.00 33.19 ? 19  CYS F CA  1 
ATOM   1099 C  C   . CYS F  2 19 ? -1.200  -6.674  -0.218  1.00 35.57 ? 19  CYS F C   1 
ATOM   1100 O  O   . CYS F  2 19 ? -2.384  -6.786  0.113   1.00 33.88 ? 19  CYS F O   1 
ATOM   1101 C  CB  . CYS F  2 19 ? 0.158   -8.468  1.011   1.00 33.69 ? 19  CYS F CB  1 
ATOM   1102 S  SG  . CYS F  2 19 ? 0.978   -10.116 1.009   1.00 31.94 ? 19  CYS F SG  1 
ATOM   1103 N  N   . GLY F  2 20 ? -0.694  -5.484  -0.495  1.00 37.03 ? 20  GLY F N   1 
ATOM   1104 C  CA  . GLY F  2 20 ? -1.434  -4.237  -0.450  1.00 39.66 ? 20  GLY F CA  1 
ATOM   1105 C  C   . GLY F  2 20 ? -2.188  -4.026  0.825   1.00 41.72 ? 20  GLY F C   1 
ATOM   1106 O  O   . GLY F  2 20 ? -1.556  -4.125  1.895   1.00 42.79 ? 20  GLY F O   1 
ATOM   1107 N  N   . GLU F  2 21 ? -3.488  -3.733  0.741   1.00 44.16 ? 21  GLU F N   1 
ATOM   1108 C  CA  . GLU F  2 21 ? -4.307  -3.489  1.947   1.00 44.88 ? 21  GLU F CA  1 
ATOM   1109 C  C   . GLU F  2 21 ? -4.569  -4.738  2.756   1.00 43.41 ? 21  GLU F C   1 
ATOM   1110 O  O   . GLU F  2 21 ? -4.853  -4.578  3.947   1.00 43.69 ? 21  GLU F O   1 
ATOM   1111 C  CB  . GLU F  2 21 ? -5.665  -2.875  1.656   1.00 48.62 ? 21  GLU F CB  1 
ATOM   1112 C  CG  . GLU F  2 21 ? -6.058  -2.489  0.238   1.00 52.36 ? 21  GLU F CG  1 
ATOM   1113 C  CD  . GLU F  2 21 ? -6.247  -3.653  -0.693  1.00 55.14 ? 21  GLU F CD  1 
ATOM   1114 O  OE1 . GLU F  2 21 ? -7.271  -4.284  -0.905  1.00 57.21 ? 21  GLU F OE1 1 
ATOM   1115 O  OE2 . GLU F  2 21 ? -5.156  -3.911  -1.264  1.00 57.76 ? 21  GLU F OE2 1 
ATOM   1116 N  N   . ARG F  2 22 ? -4.424  -5.907  2.146   1.00 42.87 ? 22  ARG F N   1 
ATOM   1117 C  CA  . ARG F  2 22 ? -4.615  -7.204  2.833   1.00 40.86 ? 22  ARG F CA  1 
ATOM   1118 C  C   . ARG F  2 22 ? -3.707  -7.291  4.043   1.00 39.92 ? 22  ARG F C   1 
ATOM   1119 O  O   . ARG F  2 22 ? -4.190  -7.702  5.136   1.00 42.11 ? 22  ARG F O   1 
ATOM   1120 C  CB  . ARG F  2 22 ? -4.452  -8.423  1.927   1.00 40.85 ? 22  ARG F CB  1 
ATOM   1121 C  CG  . ARG F  2 22 ? -5.214  -8.358  0.616   1.00 41.93 ? 22  ARG F CG  1 
ATOM   1122 C  CD  . ARG F  2 22 ? -4.694  -9.277  -0.418  1.00 44.00 ? 22  ARG F CD  1 
ATOM   1123 N  NE  . ARG F  2 22 ? -4.846  -10.685 -0.038  1.00 46.31 ? 22  ARG F NE  1 
ATOM   1124 C  CZ  . ARG F  2 22 ? -4.722  -11.717 -0.913  1.00 47.63 ? 22  ARG F CZ  1 
ATOM   1125 N  NH1 . ARG F  2 22 ? -4.396  -11.604 -2.200  1.00 47.27 ? 22  ARG F NH1 1 
ATOM   1126 N  NH2 . ARG F  2 22 ? -4.992  -12.964 -0.474  1.00 48.82 ? 22  ARG F NH2 1 
ATOM   1127 N  N   . GLY F  2 23 ? -2.452  -6.897  3.918   1.00 38.40 ? 23  GLY F N   1 
ATOM   1128 C  CA  . GLY F  2 23 ? -1.530  -6.973  5.109   1.00 35.36 ? 23  GLY F CA  1 
ATOM   1129 C  C   . GLY F  2 23 ? -0.897  -8.345  4.885   1.00 33.99 ? 23  GLY F C   1 
ATOM   1130 O  O   . GLY F  2 23 ? -1.183  -8.967  3.850   1.00 33.32 ? 23  GLY F O   1 
ATOM   1131 N  N   . PHE F  2 24 ? -0.086  -8.754  5.828   1.00 33.29 ? 24  PHE F N   1 
ATOM   1132 C  CA  . PHE F  2 24 ? 0.592   -10.065 5.653   1.00 32.27 ? 24  PHE F CA  1 
ATOM   1133 C  C   . PHE F  2 24 ? 1.079   -10.494 7.007   1.00 31.57 ? 24  PHE F C   1 
ATOM   1134 O  O   . PHE F  2 24 ? 1.034   -9.812  8.018   1.00 31.43 ? 24  PHE F O   1 
ATOM   1135 C  CB  . PHE F  2 24 ? 1.764   -10.033 4.674   1.00 32.57 ? 24  PHE F CB  1 
ATOM   1136 C  CG  . PHE F  2 24 ? 2.895   -9.074  5.029   1.00 30.93 ? 24  PHE F CG  1 
ATOM   1137 C  CD1 . PHE F  2 24 ? 3.899   -9.465  5.934   1.00 31.45 ? 24  PHE F CD1 1 
ATOM   1138 C  CD2 . PHE F  2 24 ? 2.905   -7.783  4.492   1.00 31.31 ? 24  PHE F CD2 1 
ATOM   1139 C  CE1 . PHE F  2 24 ? 4.920   -8.619  6.293   1.00 30.16 ? 24  PHE F CE1 1 
ATOM   1140 C  CE2 . PHE F  2 24 ? 3.952   -6.897  4.839   1.00 30.19 ? 24  PHE F CE2 1 
ATOM   1141 C  CZ  . PHE F  2 24 ? 4.937   -7.324  5.724   1.00 30.48 ? 24  PHE F CZ  1 
ATOM   1142 N  N   . PHE F  2 25 ? 1.580   -11.743 6.937   1.00 33.74 ? 25  PHE F N   1 
ATOM   1143 C  CA  . PHE F  2 25 ? 2.129   -12.321 8.193   1.00 33.60 ? 25  PHE F CA  1 
ATOM   1144 C  C   . PHE F  2 25 ? 3.604   -12.623 7.938   1.00 34.48 ? 25  PHE F C   1 
ATOM   1145 O  O   . PHE F  2 25 ? 3.908   -13.194 6.852   1.00 33.01 ? 25  PHE F O   1 
ATOM   1146 C  CB  . PHE F  2 25 ? 1.290   -13.570 8.601   1.00 35.14 ? 25  PHE F CB  1 
ATOM   1147 C  CG  . PHE F  2 25 ? 1.097   -13.533 10.091  0.25 34.01 ? 25  PHE F CG  1 
ATOM   1148 C  CD1 . PHE F  2 25 ? 2.083   -14.043 10.926  0.25 34.02 ? 25  PHE F CD1 1 
ATOM   1149 C  CD2 . PHE F  2 25 ? -0.049  -12.948 10.621  0.25 34.23 ? 25  PHE F CD2 1 
ATOM   1150 C  CE1 . PHE F  2 25 ? 1.933   -14.000 12.299  0.25 33.87 ? 25  PHE F CE1 1 
ATOM   1151 C  CE2 . PHE F  2 25 ? -0.218  -12.893 12.008  0.25 34.25 ? 25  PHE F CE2 1 
ATOM   1152 C  CZ  . PHE F  2 25 ? 0.784   -13.429 12.839  0.25 34.13 ? 25  PHE F CZ  1 
ATOM   1153 N  N   . TYR F  2 26 ? 4.391   -12.172 8.922   1.00 36.23 ? 26  TYR F N   1 
ATOM   1154 C  CA  . TYR F  2 26 ? 5.829   -12.453 8.778   1.00 37.45 ? 26  TYR F CA  1 
ATOM   1155 C  C   . TYR F  2 26 ? 6.147   -13.322 9.996   1.00 37.88 ? 26  TYR F C   1 
ATOM   1156 O  O   . TYR F  2 26 ? 6.135   -12.836 11.106  1.00 37.79 ? 26  TYR F O   1 
ATOM   1157 C  CB  . TYR F  2 26 ? 6.815   -11.283 8.692   1.00 36.49 ? 26  TYR F CB  1 
ATOM   1158 C  CG  . TYR F  2 26 ? 8.253   -11.746 8.464   1.00 35.13 ? 26  TYR F CG  1 
ATOM   1159 C  CD1 . TYR F  2 26 ? 8.559   -12.302 7.191   1.00 35.01 ? 26  TYR F CD1 1 
ATOM   1160 C  CD2 . TYR F  2 26 ? 9.244   -11.627 9.397   1.00 34.24 ? 26  TYR F CD2 1 
ATOM   1161 C  CE1 . TYR F  2 26 ? 9.835   -12.751 6.905   1.00 36.11 ? 26  TYR F CE1 1 
ATOM   1162 C  CE2 . TYR F  2 26 ? 10.560  -12.078 9.140   1.00 35.86 ? 26  TYR F CE2 1 
ATOM   1163 C  CZ  . TYR F  2 26 ? 10.830  -12.617 7.892   1.00 36.00 ? 26  TYR F CZ  1 
ATOM   1164 O  OH  . TYR F  2 26 ? 12.101  -13.064 7.622   1.00 37.87 ? 26  TYR F OH  1 
ATOM   1165 N  N   . THR F  2 27 ? 6.381   -14.579 9.674   1.00 42.31 ? 27  THR F N   1 
ATOM   1166 C  CA  . THR F  2 27 ? 6.702   -15.560 10.742  1.00 45.99 ? 27  THR F CA  1 
ATOM   1167 C  C   . THR F  2 27 ? 7.827   -16.473 10.262  1.00 48.22 ? 27  THR F C   1 
ATOM   1168 O  O   . THR F  2 27 ? 7.539   -17.450 9.548   1.00 49.23 ? 27  THR F O   1 
ATOM   1169 C  CB  . THR F  2 27 ? 5.486   -16.365 11.323  1.00 46.88 ? 27  THR F CB  1 
ATOM   1170 O  OG1 . THR F  2 27 ? 4.744   -16.878 10.165  1.00 47.52 ? 27  THR F OG1 1 
ATOM   1171 C  CG2 . THR F  2 27 ? 4.630   -15.510 12.283  1.00 46.73 ? 27  THR F CG2 1 
ATOM   1172 N  N   . PRO F  2 28 ? 9.031   -16.072 10.672  1.00 49.12 ? 28  PRO F N   1 
ATOM   1173 C  CA  . PRO F  2 28 ? 10.250  -16.785 10.313  1.00 51.05 ? 28  PRO F CA  1 
ATOM   1174 C  C   . PRO F  2 28 ? 10.482  -18.123 11.031  1.00 53.06 ? 28  PRO F C   1 
ATOM   1175 O  O   . PRO F  2 28 ? 10.578  -19.171 10.336  1.00 54.18 ? 28  PRO F O   1 
ATOM   1176 C  CB  . PRO F  2 28 ? 11.347  -15.777 10.615  1.00 49.97 ? 28  PRO F CB  1 
ATOM   1177 C  CG  . PRO F  2 28 ? 10.797  -14.842 11.658  1.00 49.36 ? 28  PRO F CG  1 
ATOM   1178 C  CD  . PRO F  2 28 ? 9.309   -14.895 11.500  1.00 49.10 ? 28  PRO F CD  1 
ATOM   1179 N  N   . LYS F  2 29 ? 10.577  -18.083 12.356  1.00 54.76 ? 29  LYS F N   1 
ATOM   1180 C  CA  . LYS F  2 29 ? 10.808  -19.279 13.185  1.00 55.93 ? 29  LYS F CA  1 
ATOM   1181 C  C   . LYS F  2 29 ? 9.777   -20.354 12.784  1.00 56.79 ? 29  LYS F C   1 
ATOM   1182 O  O   . LYS F  2 29 ? 8.559   -20.049 12.887  1.00 57.84 ? 29  LYS F O   1 
ATOM   1183 C  CB  . LYS F  2 29 ? 10.714  -19.068 14.689  1.00 55.56 ? 29  LYS F CB  1 
ATOM   1184 N  N   . GLY G  1 1  ? -4.502  2.014   12.145  1.00 50.91 ? 1   GLY G N   1 
ATOM   1185 C  CA  . GLY G  1 1  ? -4.055  1.339   13.408  1.00 49.68 ? 1   GLY G CA  1 
ATOM   1186 C  C   . GLY G  1 1  ? -2.575  1.722   13.615  1.00 48.07 ? 1   GLY G C   1 
ATOM   1187 O  O   . GLY G  1 1  ? -2.247  2.764   14.180  1.00 48.16 ? 1   GLY G O   1 
ATOM   1188 N  N   . ILE G  1 2  ? -1.704  0.811   13.171  1.00 46.82 ? 2   ILE G N   1 
ATOM   1189 C  CA  . ILE G  1 2  ? -0.239  1.010   13.225  1.00 43.89 ? 2   ILE G CA  1 
ATOM   1190 C  C   . ILE G  1 2  ? -0.067  2.285   12.377  1.00 41.84 ? 2   ILE G C   1 
ATOM   1191 O  O   . ILE G  1 2  ? 0.661   3.200   12.759  1.00 41.85 ? 2   ILE G O   1 
ATOM   1192 C  CB  . ILE G  1 2  ? 0.629   -0.201  12.709  1.00 42.93 ? 2   ILE G CB  1 
ATOM   1193 C  CG1 . ILE G  1 2  ? 2.085   0.094   13.154  1.00 42.46 ? 2   ILE G CG1 1 
ATOM   1194 C  CG2 . ILE G  1 2  ? 0.484   -0.583  11.199  1.00 41.68 ? 2   ILE G CG2 1 
ATOM   1195 C  CD1 . ILE G  1 2  ? 3.141   -1.030  12.976  1.00 41.85 ? 2   ILE G CD1 1 
ATOM   1196 N  N   . VAL G  1 3  ? -0.816  2.275   11.299  1.00 40.61 ? 3   VAL G N   1 
ATOM   1197 C  CA  . VAL G  1 3  ? -0.778  3.406   10.357  1.00 42.51 ? 3   VAL G CA  1 
ATOM   1198 C  C   . VAL G  1 3  ? -1.202  4.750   10.892  1.00 43.52 ? 3   VAL G C   1 
ATOM   1199 O  O   . VAL G  1 3  ? -0.494  5.747   10.668  1.00 43.82 ? 3   VAL G O   1 
ATOM   1200 C  CB  . VAL G  1 3  ? -1.529  2.928   9.116   1.00 42.31 ? 3   VAL G CB  1 
ATOM   1201 C  CG1 . VAL G  1 3  ? -1.666  4.023   8.102   1.00 42.52 ? 3   VAL G CG1 1 
ATOM   1202 C  CG2 . VAL G  1 3  ? -0.782  1.684   8.640   1.00 43.03 ? 3   VAL G CG2 1 
ATOM   1203 N  N   . GLU G  1 4  ? -2.312  4.791   11.596  1.00 44.98 ? 4   GLU G N   1 
ATOM   1204 C  CA  . GLU G  1 4  ? -2.913  5.979   12.210  1.00 44.93 ? 4   GLU G CA  1 
ATOM   1205 C  C   . GLU G  1 4  ? -2.003  6.425   13.342  1.00 43.83 ? 4   GLU G C   1 
ATOM   1206 O  O   . GLU G  1 4  ? -1.813  7.608   13.639  1.00 44.78 ? 4   GLU G O   1 
ATOM   1207 C  CB  . GLU G  1 4  ? -4.302  5.677   12.790  1.00 47.20 ? 4   GLU G CB  1 
ATOM   1208 C  CG  . GLU G  1 4  ? -5.578  5.470   11.996  1.00 49.22 ? 4   GLU G CG  1 
ATOM   1209 C  CD  A GLU G  1 4  ? -6.917  6.028   12.432  0.67 50.45 ? 4   GLU G CD  1 
ATOM   1210 C  CD  B GLU G  1 4  ? -5.483  4.539   10.819  0.33 48.76 ? 4   GLU G CD  1 
ATOM   1211 O  OE1 A GLU G  1 4  ? -7.355  6.310   13.553  0.67 50.58 ? 4   GLU G OE1 1 
ATOM   1212 O  OE1 B GLU G  1 4  ? -4.653  4.926   9.970   0.33 49.24 ? 4   GLU G OE1 1 
ATOM   1213 O  OE2 A GLU G  1 4  ? -7.688  6.223   11.432  0.67 50.92 ? 4   GLU G OE2 1 
ATOM   1214 O  OE2 B GLU G  1 4  ? -6.120  3.518   10.653  0.33 48.99 ? 4   GLU G OE2 1 
ATOM   1215 N  N   . GLN G  1 5  ? -1.400  5.423   13.986  1.00 42.15 ? 5   GLN G N   1 
ATOM   1216 C  CA  . GLN G  1 5  ? -0.481  5.669   15.101  1.00 39.54 ? 5   GLN G CA  1 
ATOM   1217 C  C   . GLN G  1 5  ? 0.932   6.083   14.721  1.00 37.62 ? 5   GLN G C   1 
ATOM   1218 O  O   . GLN G  1 5  ? 1.498   6.974   15.379  1.00 37.16 ? 5   GLN G O   1 
ATOM   1219 C  CB  . GLN G  1 5  ? -0.402  4.383   15.950  1.00 40.66 ? 5   GLN G CB  1 
ATOM   1220 C  CG  . GLN G  1 5  ? 0.490   4.427   17.154  1.00 43.31 ? 5   GLN G CG  1 
ATOM   1221 C  CD  . GLN G  1 5  ? 0.630   3.247   18.092  1.00 44.77 ? 5   GLN G CD  1 
ATOM   1222 O  OE1 . GLN G  1 5  ? -0.088  2.216   18.094  1.00 45.72 ? 5   GLN G OE1 1 
ATOM   1223 N  NE2 . GLN G  1 5  ? 1.632   3.309   19.015  1.00 44.79 ? 5   GLN G NE2 1 
ATOM   1224 N  N   . CYS G  1 6  ? 1.526   5.468   13.726  1.00 34.89 ? 6   CYS G N   1 
ATOM   1225 C  CA  . CYS G  1 6  ? 2.953   5.713   13.418  1.00 33.18 ? 6   CYS G CA  1 
ATOM   1226 C  C   . CYS G  1 6  ? 3.334   6.491   12.192  1.00 32.04 ? 6   CYS G C   1 
ATOM   1227 O  O   . CYS G  1 6  ? 4.527   6.711   11.930  1.00 29.64 ? 6   CYS G O   1 
ATOM   1228 C  CB  . CYS G  1 6  ? 3.606   4.281   13.432  1.00 31.68 ? 6   CYS G CB  1 
ATOM   1229 S  SG  . CYS G  1 6  ? 3.501   3.573   15.089  1.00 33.41 ? 6   CYS G SG  1 
ATOM   1230 N  N   . CYS G  1 7  ? 2.311   6.856   11.436  1.00 32.19 ? 7   CYS G N   1 
ATOM   1231 C  CA  . CYS G  1 7  ? 2.507   7.629   10.202  1.00 32.09 ? 7   CYS G CA  1 
ATOM   1232 C  C   . CYS G  1 7  ? 2.087   9.077   10.495  1.00 35.12 ? 7   CYS G C   1 
ATOM   1233 O  O   . CYS G  1 7  ? 2.374   9.936   9.676   1.00 34.92 ? 7   CYS G O   1 
ATOM   1234 C  CB  . CYS G  1 7  ? 1.697   7.040   9.094   1.00 30.93 ? 7   CYS G CB  1 
ATOM   1235 S  SG  . CYS G  1 7  ? 2.355   5.457   8.523   1.00 30.97 ? 7   CYS G SG  1 
ATOM   1236 N  N   . THR G  1 8  ? 1.457   9.272   11.633  1.00 36.16 ? 8   THR G N   1 
ATOM   1237 C  CA  . THR G  1 8  ? 0.937   10.520  12.203  1.00 39.09 ? 8   THR G CA  1 
ATOM   1238 C  C   . THR G  1 8  ? 2.050   11.159  13.010  1.00 39.84 ? 8   THR G C   1 
ATOM   1239 O  O   . THR G  1 8  ? 2.456   12.341  12.985  1.00 40.67 ? 8   THR G O   1 
ATOM   1240 C  CB  . THR G  1 8  ? -0.376  10.073  12.996  1.00 39.15 ? 8   THR G CB  1 
ATOM   1241 O  OG1 . THR G  1 8  ? -1.424  10.045  11.963  1.00 40.72 ? 8   THR G OG1 1 
ATOM   1242 C  CG2 . THR G  1 8  ? -0.783  10.784  14.258  1.00 39.86 ? 8   THR G CG2 1 
ATOM   1243 N  N   . SER G  1 9  ? 2.659   10.288  13.812  1.00 40.07 ? 9   SER G N   1 
ATOM   1244 C  CA  . SER G  1 9  ? 3.781   10.715  14.671  1.00 40.95 ? 9   SER G CA  1 
ATOM   1245 C  C   . SER G  1 9  ? 4.810   9.574   14.576  1.00 39.35 ? 9   SER G C   1 
ATOM   1246 O  O   . SER G  1 9  ? 4.406   8.478   14.192  1.00 39.41 ? 9   SER G O   1 
ATOM   1247 C  CB  . SER G  1 9  ? 3.259   10.899  16.105  1.00 41.61 ? 9   SER G CB  1 
ATOM   1248 O  OG  . SER G  1 9  ? 2.721   9.588   16.372  1.00 44.11 ? 9   SER G OG  1 
ATOM   1249 N  N   . ILE G  1 10 ? 6.025   9.878   14.925  1.00 37.61 ? 10  ILE G N   1 
ATOM   1250 C  CA  . ILE G  1 10 ? 7.129   8.956   14.903  1.00 35.56 ? 10  ILE G CA  1 
ATOM   1251 C  C   . ILE G  1 10 ? 6.991   7.961   16.042  1.00 34.58 ? 10  ILE G C   1 
ATOM   1252 O  O   . ILE G  1 10 ? 6.895   8.397   17.191  1.00 34.86 ? 10  ILE G O   1 
ATOM   1253 C  CB  . ILE G  1 10 ? 8.501   9.711   14.946  1.00 35.82 ? 10  ILE G CB  1 
ATOM   1254 C  CG1 . ILE G  1 10 ? 8.698   10.421  13.558  1.00 35.92 ? 10  ILE G CG1 1 
ATOM   1255 C  CG2 . ILE G  1 10 ? 9.707   8.766   15.206  1.00 35.17 ? 10  ILE G CG2 1 
ATOM   1256 C  CD1 . ILE G  1 10 ? 9.468   11.765  13.756  1.00 36.13 ? 10  ILE G CD1 1 
ATOM   1257 N  N   . CYS G  1 11 ? 6.957   6.685   15.730  1.00 32.14 ? 11  CYS G N   1 
ATOM   1258 C  CA  . CYS G  1 11 ? 6.895   5.682   16.808  1.00 31.09 ? 11  CYS G CA  1 
ATOM   1259 C  C   . CYS G  1 11 ? 8.295   5.280   17.236  1.00 29.58 ? 11  CYS G C   1 
ATOM   1260 O  O   . CYS G  1 11 ? 9.169   5.075   16.374  1.00 30.56 ? 11  CYS G O   1 
ATOM   1261 C  CB  . CYS G  1 11 ? 6.141   4.457   16.333  1.00 32.05 ? 11  CYS G CB  1 
ATOM   1262 S  SG  . CYS G  1 11 ? 4.374   4.744   16.431  1.00 33.04 ? 11  CYS G SG  1 
ATOM   1263 N  N   . SER G  1 12 ? 8.509   5.148   18.505  1.00 27.39 ? 12  SER G N   1 
ATOM   1264 C  CA  . SER G  1 12 ? 9.771   4.726   19.077  1.00 27.53 ? 12  SER G CA  1 
ATOM   1265 C  C   . SER G  1 12 ? 9.915   3.202   18.851  1.00 28.53 ? 12  SER G C   1 
ATOM   1266 O  O   . SER G  1 12 ? 8.922   2.563   18.467  1.00 29.30 ? 12  SER G O   1 
ATOM   1267 C  CB  . SER G  1 12 ? 9.896   4.940   20.577  1.00 26.65 ? 12  SER G CB  1 
ATOM   1268 O  OG  . SER G  1 12 ? 9.013   3.996   21.220  1.00 25.95 ? 12  SER G OG  1 
ATOM   1269 N  N   . LEU G  1 13 ? 11.099  2.673   19.162  1.00 28.97 ? 13  LEU G N   1 
ATOM   1270 C  CA  . LEU G  1 13 ? 11.287  1.202   18.996  1.00 30.94 ? 13  LEU G CA  1 
ATOM   1271 C  C   . LEU G  1 13 ? 10.384  0.468   19.956  1.00 29.31 ? 13  LEU G C   1 
ATOM   1272 O  O   . LEU G  1 13 ? 9.899   -0.613  19.678  1.00 29.65 ? 13  LEU G O   1 
ATOM   1273 C  CB  . LEU G  1 13 ? 12.781  0.911   19.128  1.00 33.21 ? 13  LEU G CB  1 
ATOM   1274 C  CG  . LEU G  1 13 ? 13.835  1.256   18.088  1.00 34.22 ? 13  LEU G CG  1 
ATOM   1275 C  CD1 . LEU G  1 13 ? 15.177  0.632   18.518  1.00 34.32 ? 13  LEU G CD1 1 
ATOM   1276 C  CD2 . LEU G  1 13 ? 13.420  0.845   16.681  1.00 34.40 ? 13  LEU G CD2 1 
ATOM   1277 N  N   . TYR G  1 14 ? 10.130  0.985   21.112  1.00 31.04 ? 14  TYR G N   1 
ATOM   1278 C  CA  . TYR G  1 14 ? 9.226   0.475   22.169  1.00 31.18 ? 14  TYR G CA  1 
ATOM   1279 C  C   . TYR G  1 14 ? 7.773   0.361   21.781  1.00 31.26 ? 14  TYR G C   1 
ATOM   1280 O  O   . TYR G  1 14 ? 7.078   -0.641  22.080  1.00 29.60 ? 14  TYR G O   1 
ATOM   1281 C  CB  . TYR G  1 14 ? 9.328   1.457   23.344  1.00 33.04 ? 14  TYR G CB  1 
ATOM   1282 C  CG  . TYR G  1 14 ? 10.720  1.297   23.867  1.00 34.10 ? 14  TYR G CG  1 
ATOM   1283 C  CD1 . TYR G  1 14 ? 10.971  0.207   24.708  1.00 35.05 ? 14  TYR G CD1 1 
ATOM   1284 C  CD2 . TYR G  1 14 ? 11.731  2.173   23.464  1.00 35.13 ? 14  TYR G CD2 1 
ATOM   1285 C  CE1 . TYR G  1 14 ? 12.256  0.009   25.195  1.00 35.45 ? 14  TYR G CE1 1 
ATOM   1286 C  CE2 . TYR G  1 14 ? 13.011  1.961   23.968  1.00 36.09 ? 14  TYR G CE2 1 
ATOM   1287 C  CZ  . TYR G  1 14 ? 13.242  0.883   24.810  1.00 35.88 ? 14  TYR G CZ  1 
ATOM   1288 O  OH  . TYR G  1 14 ? 14.528  0.712   25.258  1.00 38.74 ? 14  TYR G OH  1 
ATOM   1289 N  N   . GLN G  1 15 ? 7.284   1.398   21.077  1.00 31.32 ? 15  GLN G N   1 
ATOM   1290 C  CA  . GLN G  1 15 ? 5.899   1.427   20.560  1.00 31.49 ? 15  GLN G CA  1 
ATOM   1291 C  C   . GLN G  1 15 ? 5.713   0.403   19.446  1.00 30.50 ? 15  GLN G C   1 
ATOM   1292 O  O   . GLN G  1 15 ? 4.658   -0.223  19.345  1.00 29.85 ? 15  GLN G O   1 
ATOM   1293 C  CB  . GLN G  1 15 ? 5.508   2.811   20.043  1.00 32.43 ? 15  GLN G CB  1 
ATOM   1294 C  CG  . GLN G  1 15 ? 5.497   3.888   21.114  1.00 35.70 ? 15  GLN G CG  1 
ATOM   1295 C  CD  . GLN G  1 15 ? 5.461   5.287   20.570  1.00 36.52 ? 15  GLN G CD  1 
ATOM   1296 O  OE1 . GLN G  1 15 ? 6.366   5.961   20.119  1.00 36.18 ? 15  GLN G OE1 1 
ATOM   1297 N  NE2 . GLN G  1 15 ? 4.249   5.860   20.615  1.00 39.48 ? 15  GLN G NE2 1 
ATOM   1298 N  N   . LEU G  1 16 ? 6.690   0.258   18.541  1.00 29.81 ? 16  LEU G N   1 
ATOM   1299 C  CA  . LEU G  1 16 ? 6.602   -0.683  17.420  1.00 31.46 ? 16  LEU G CA  1 
ATOM   1300 C  C   . LEU G  1 16 ? 6.549   -2.138  17.927  1.00 31.84 ? 16  LEU G C   1 
ATOM   1301 O  O   . LEU G  1 16 ? 5.884   -2.968  17.274  1.00 31.89 ? 16  LEU G O   1 
ATOM   1302 C  CB  . LEU G  1 16 ? 7.779   -0.511  16.435  1.00 31.82 ? 16  LEU G CB  1 
ATOM   1303 C  CG  . LEU G  1 16 ? 7.962   0.830   15.765  1.00 33.53 ? 16  LEU G CG  1 
ATOM   1304 C  CD1 . LEU G  1 16 ? 9.307   1.010   15.066  1.00 34.78 ? 16  LEU G CD1 1 
ATOM   1305 C  CD2 . LEU G  1 16 ? 6.875   1.012   14.709  1.00 33.63 ? 16  LEU G CD2 1 
ATOM   1306 N  N   . GLU G  1 17 ? 7.247   -2.402  19.026  1.00 33.00 ? 17  GLU G N   1 
ATOM   1307 C  CA  . GLU G  1 17 ? 7.251   -3.780  19.551  1.00 35.15 ? 17  GLU G CA  1 
ATOM   1308 C  C   . GLU G  1 17 ? 5.889   -4.232  20.001  1.00 36.77 ? 17  GLU G C   1 
ATOM   1309 O  O   . GLU G  1 17 ? 5.718   -5.437  20.185  1.00 36.61 ? 17  GLU G O   1 
ATOM   1310 C  CB  . GLU G  1 17 ? 8.274   -3.940  20.624  1.00 37.36 ? 17  GLU G CB  1 
ATOM   1311 C  CG  . GLU G  1 17 ? 8.524   -5.189  21.400  1.00 39.15 ? 17  GLU G CG  1 
ATOM   1312 C  CD  . GLU G  1 17 ? 9.399   -4.905  22.591  1.00 42.12 ? 17  GLU G CD  1 
ATOM   1313 O  OE1 . GLU G  1 17 ? 9.495   -3.822  23.186  1.00 42.87 ? 17  GLU G OE1 1 
ATOM   1314 O  OE2 . GLU G  1 17 ? 10.069  -5.936  22.909  1.00 43.03 ? 17  GLU G OE2 1 
ATOM   1315 N  N   . ASN G  1 18 ? 4.895   -3.364  20.138  1.00 38.46 ? 18  ASN G N   1 
ATOM   1316 C  CA  . ASN G  1 18 ? 3.543   -3.783  20.525  1.00 40.29 ? 18  ASN G CA  1 
ATOM   1317 C  C   . ASN G  1 18 ? 2.909   -4.449  19.287  1.00 40.76 ? 18  ASN G C   1 
ATOM   1318 O  O   . ASN G  1 18 ? 1.799   -4.968  19.418  1.00 40.75 ? 18  ASN G O   1 
ATOM   1319 C  CB  . ASN G  1 18 ? 2.602   -2.639  20.885  1.00 42.29 ? 18  ASN G CB  1 
ATOM   1320 C  CG  . ASN G  1 18 ? 3.038   -1.832  22.063  1.00 42.82 ? 18  ASN G CG  1 
ATOM   1321 O  OD1 . ASN G  1 18 ? 3.851   -2.269  22.883  1.00 45.12 ? 18  ASN G OD1 1 
ATOM   1322 N  ND2 . ASN G  1 18 ? 2.500   -0.619  22.127  1.00 45.53 ? 18  ASN G ND2 1 
ATOM   1323 N  N   . TYR G  1 19 ? 3.614   -4.367  18.164  1.00 39.18 ? 19  TYR G N   1 
ATOM   1324 C  CA  . TYR G  1 19 ? 3.047   -4.951  16.946  1.00 39.06 ? 19  TYR G CA  1 
ATOM   1325 C  C   . TYR G  1 19 ? 3.565   -6.313  16.579  1.00 37.42 ? 19  TYR G C   1 
ATOM   1326 O  O   . TYR G  1 19 ? 3.049   -6.964  15.677  1.00 37.36 ? 19  TYR G O   1 
ATOM   1327 C  CB  . TYR G  1 19 ? 3.242   -3.914  15.818  1.00 40.01 ? 19  TYR G CB  1 
ATOM   1328 C  CG  . TYR G  1 19 ? 2.413   -2.676  16.090  1.00 41.70 ? 19  TYR G CG  1 
ATOM   1329 C  CD1 . TYR G  1 19 ? 1.007   -2.772  16.011  1.00 42.96 ? 19  TYR G CD1 1 
ATOM   1330 C  CD2 . TYR G  1 19 ? 2.967   -1.440  16.381  1.00 42.54 ? 19  TYR G CD2 1 
ATOM   1331 C  CE1 . TYR G  1 19 ? 0.179   -1.689  16.237  1.00 43.50 ? 19  TYR G CE1 1 
ATOM   1332 C  CE2 . TYR G  1 19 ? 2.158   -0.326  16.573  1.00 43.86 ? 19  TYR G CE2 1 
ATOM   1333 C  CZ  . TYR G  1 19 ? 0.774   -0.457  16.528  1.00 44.28 ? 19  TYR G CZ  1 
ATOM   1334 O  OH  . TYR G  1 19 ? -0.020  0.662   16.716  1.00 45.11 ? 19  TYR G OH  1 
ATOM   1335 N  N   . CYS G  1 20 ? 4.573   -6.737  17.255  1.00 36.84 ? 20  CYS G N   1 
ATOM   1336 C  CA  . CYS G  1 20 ? 5.261   -8.012  17.064  1.00 37.77 ? 20  CYS G CA  1 
ATOM   1337 C  C   . CYS G  1 20 ? 4.401   -9.170  17.567  1.00 40.36 ? 20  CYS G C   1 
ATOM   1338 O  O   . CYS G  1 20 ? 3.657   -8.904  18.519  1.00 40.57 ? 20  CYS G O   1 
ATOM   1339 C  CB  . CYS G  1 20 ? 6.537   -7.958  17.919  1.00 35.45 ? 20  CYS G CB  1 
ATOM   1340 S  SG  . CYS G  1 20 ? 7.842   -6.798  17.449  1.00 31.40 ? 20  CYS G SG  1 
ATOM   1341 N  N   . ASN G  1 21 ? 4.543   -10.330 16.996  1.00 43.52 ? 21  ASN G N   1 
ATOM   1342 C  CA  . ASN G  1 21 ? 3.742   -11.471 17.536  1.00 47.85 ? 21  ASN G CA  1 
ATOM   1343 C  C   . ASN G  1 21 ? 4.309   -11.738 18.939  1.00 49.55 ? 21  ASN G C   1 
ATOM   1344 O  O   . ASN G  1 21 ? 3.525   -12.160 19.853  1.00 51.38 ? 21  ASN G O   1 
ATOM   1345 C  CB  . ASN G  1 21 ? 3.715   -12.627 16.570  1.00 49.42 ? 21  ASN G CB  1 
ATOM   1346 C  CG  . ASN G  1 21 ? 2.682   -12.376 15.480  1.00 52.06 ? 21  ASN G CG  1 
ATOM   1347 O  OD1 . ASN G  1 21 ? 2.926   -12.583 14.274  1.00 53.45 ? 21  ASN G OD1 1 
ATOM   1348 N  ND2 . ASN G  1 21 ? 1.471   -11.917 15.847  1.00 53.27 ? 21  ASN G ND2 1 
ATOM   1349 O  OXT . ASN G  1 21 ? 5.511   -11.451 19.088  1.00 50.30 ? 21  ASN G OXT 1 
ATOM   1350 N  N   . PHE H  2 1  ? -3.827  6.691   -0.934  1.00 28.45 ? 1   PHE H N   1 
ATOM   1351 C  CA  . PHE H  2 1  ? -2.981  7.789   -0.446  1.00 26.30 ? 1   PHE H CA  1 
ATOM   1352 C  C   . PHE H  2 1  ? -1.489  7.311   -0.474  1.00 25.30 ? 1   PHE H C   1 
ATOM   1353 O  O   . PHE H  2 1  ? -1.099  6.599   0.455   1.00 23.65 ? 1   PHE H O   1 
ATOM   1354 C  CB  . PHE H  2 1  ? -3.288  8.185   0.996   1.00 27.85 ? 1   PHE H CB  1 
ATOM   1355 C  CG  . PHE H  2 1  ? -4.674  8.744   1.296   1.00 30.07 ? 1   PHE H CG  1 
ATOM   1356 C  CD1 . PHE H  2 1  ? -5.041  9.974   0.685   1.00 29.80 ? 1   PHE H CD1 1 
ATOM   1357 C  CD2 . PHE H  2 1  ? -5.552  8.055   2.126   1.00 29.68 ? 1   PHE H CD2 1 
ATOM   1358 C  CE1 . PHE H  2 1  ? -6.284  10.506  0.923   1.00 29.56 ? 1   PHE H CE1 1 
ATOM   1359 C  CE2 . PHE H  2 1  ? -6.832  8.587   2.360   1.00 31.62 ? 1   PHE H CE2 1 
ATOM   1360 C  CZ  . PHE H  2 1  ? -7.156  9.809   1.742   1.00 29.35 ? 1   PHE H CZ  1 
ATOM   1361 N  N   . VAL H  2 2  ? -0.749  7.787   -1.417  1.00 25.55 ? 2   VAL H N   1 
ATOM   1362 C  CA  . VAL H  2 2  ? 0.696   7.478   -1.541  1.00 24.37 ? 2   VAL H CA  1 
ATOM   1363 C  C   . VAL H  2 2  ? 1.455   7.803   -0.318  1.00 24.44 ? 2   VAL H C   1 
ATOM   1364 O  O   . VAL H  2 2  ? 2.303   6.929   0.004   1.00 24.49 ? 2   VAL H O   1 
ATOM   1365 C  CB  . VAL H  2 2  ? 1.224   8.034   -2.857  1.00 25.23 ? 2   VAL H CB  1 
ATOM   1366 C  CG1 . VAL H  2 2  ? 2.769   7.911   -3.003  1.00 25.87 ? 2   VAL H CG1 1 
ATOM   1367 C  CG2 . VAL H  2 2  ? 0.616   7.277   -4.043  1.00 26.38 ? 2   VAL H CG2 1 
ATOM   1368 N  N   . ASN H  2 3  ? 1.276   8.841   0.480   1.00 24.02 ? 3   ASN H N   1 
ATOM   1369 C  CA  . ASN H  2 3  ? 2.078   9.140   1.672   1.00 24.60 ? 3   ASN H CA  1 
ATOM   1370 C  C   . ASN H  2 3  ? 2.002   8.013   2.718   1.00 25.38 ? 3   ASN H C   1 
ATOM   1371 O  O   . ASN H  2 3  ? 3.051   7.650   3.311   1.00 22.26 ? 3   ASN H O   1 
ATOM   1372 C  CB  . ASN H  2 3  ? 1.880   10.546  2.284   1.00 27.23 ? 3   ASN H CB  1 
ATOM   1373 C  CG  . ASN H  2 3  ? 0.439   10.853  2.761   1.00 28.52 ? 3   ASN H CG  1 
ATOM   1374 O  OD1 . ASN H  2 3  ? -0.576  10.150  2.461   1.00 28.99 ? 3   ASN H OD1 1 
ATOM   1375 N  ND2 . ASN H  2 3  ? 0.224   11.929  3.517   1.00 29.81 ? 3   ASN H ND2 1 
ATOM   1376 N  N   . GLN H  2 4  ? 0.806   7.530   2.950   1.00 23.32 ? 4   GLN H N   1 
ATOM   1377 C  CA  . GLN H  2 4  ? 0.609   6.434   3.923   1.00 26.09 ? 4   GLN H CA  1 
ATOM   1378 C  C   . GLN H  2 4  ? 1.247   5.137   3.374   1.00 22.58 ? 4   GLN H C   1 
ATOM   1379 O  O   . GLN H  2 4  ? 1.732   4.378   4.215   1.00 23.85 ? 4   GLN H O   1 
ATOM   1380 C  CB  . GLN H  2 4  ? -0.899  6.203   4.200   1.00 28.16 ? 4   GLN H CB  1 
ATOM   1381 C  CG  . GLN H  2 4  ? -1.448  7.012   5.339   1.00 35.70 ? 4   GLN H CG  1 
ATOM   1382 C  CD  . GLN H  2 4  ? -2.991  7.052   5.255   1.00 39.99 ? 4   GLN H CD  1 
ATOM   1383 O  OE1 . GLN H  2 4  ? -3.606  5.983   5.012   1.00 42.88 ? 4   GLN H OE1 1 
ATOM   1384 N  NE2 . GLN H  2 4  ? -3.617  8.225   5.398   1.00 41.07 ? 4   GLN H NE2 1 
ATOM   1385 N  N   . HIS H  2 5  ? 1.136   4.928   2.124   1.00 23.46 ? 5   HIS H N   1 
ATOM   1386 C  CA  . HIS H  2 5  ? 1.686   3.816   1.357   1.00 24.79 ? 5   HIS H CA  1 
ATOM   1387 C  C   . HIS H  2 5  ? 3.238   3.754   1.535   1.00 25.06 ? 5   HIS H C   1 
ATOM   1388 O  O   . HIS H  2 5  ? 3.737   2.631   1.769   1.00 22.37 ? 5   HIS H O   1 
ATOM   1389 C  CB  . HIS H  2 5  ? 1.389   3.856   -0.126  1.00 26.98 ? 5   HIS H CB  1 
ATOM   1390 C  CG  . HIS H  2 5  ? 1.771   2.583   -0.828  1.00 30.53 ? 5   HIS H CG  1 
ATOM   1391 N  ND1 . HIS H  2 5  ? 1.209   1.353   -0.605  1.00 31.52 ? 5   HIS H ND1 1 
ATOM   1392 C  CD2 . HIS H  2 5  ? 2.733   2.393   -1.780  1.00 30.66 ? 5   HIS H CD2 1 
ATOM   1393 C  CE1 . HIS H  2 5  ? 1.781   0.472   -1.417  1.00 31.62 ? 5   HIS H CE1 1 
ATOM   1394 N  NE2 . HIS H  2 5  ? 2.699   1.073   -2.144  1.00 32.00 ? 5   HIS H NE2 1 
ATOM   1395 N  N   . LEU H  2 6  ? 3.943   4.861   1.420   1.00 22.31 ? 6   LEU H N   1 
ATOM   1396 C  CA  . LEU H  2 6  ? 5.386   5.093   1.559   1.00 22.68 ? 6   LEU H CA  1 
ATOM   1397 C  C   . LEU H  2 6  ? 5.750   4.890   3.008   1.00 21.52 ? 6   LEU H C   1 
ATOM   1398 O  O   . LEU H  2 6  ? 6.697   4.153   3.320   1.00 19.46 ? 6   LEU H O   1 
ATOM   1399 C  CB  . LEU H  2 6  ? 5.790   6.456   0.987   1.00 22.43 ? 6   LEU H CB  1 
ATOM   1400 C  CG  . LEU H  2 6  ? 5.489   6.671   -0.485  1.00 23.35 ? 6   LEU H CG  1 
ATOM   1401 C  CD1 . LEU H  2 6  ? 6.149   7.905   -1.140  1.00 21.93 ? 6   LEU H CD1 1 
ATOM   1402 C  CD2 . LEU H  2 6  ? 5.854   5.475   -1.346  1.00 23.55 ? 6   LEU H CD2 1 
ATOM   1403 N  N   . CYS H  2 7  ? 5.039   5.485   3.939   1.00 18.24 ? 7   CYS H N   1 
ATOM   1404 C  CA  . CYS H  2 7  ? 5.260   5.264   5.350   1.00 20.53 ? 7   CYS H CA  1 
ATOM   1405 C  C   . CYS H  2 7  ? 5.159   3.748   5.770   1.00 20.37 ? 7   CYS H C   1 
ATOM   1406 O  O   . CYS H  2 7  ? 5.958   3.341   6.644   1.00 19.91 ? 7   CYS H O   1 
ATOM   1407 C  CB  . CYS H  2 7  ? 4.222   6.028   6.169   1.00 22.11 ? 7   CYS H CB  1 
ATOM   1408 S  SG  . CYS H  2 7  ? 4.254   5.907   7.922   1.00 25.09 ? 7   CYS H SG  1 
ATOM   1409 N  N   . GLY H  2 8  ? 4.147   3.016   5.365   1.00 19.84 ? 8   GLY H N   1 
ATOM   1410 C  CA  . GLY H  2 8  ? 4.051   1.568   5.803   1.00 18.86 ? 8   GLY H CA  1 
ATOM   1411 C  C   . GLY H  2 8  ? 5.190   0.778   5.175   1.00 18.01 ? 8   GLY H C   1 
ATOM   1412 O  O   . GLY H  2 8  ? 5.506   -0.238  5.773   1.00 20.49 ? 8   GLY H O   1 
ATOM   1413 N  N   . SER H  2 9  ? 5.776   1.141   4.031   1.00 18.94 ? 9   SER H N   1 
ATOM   1414 C  CA  . SER H  2 9  ? 6.925   0.382   3.543   1.00 21.16 ? 9   SER H CA  1 
ATOM   1415 C  C   . SER H  2 9  ? 8.050   0.517   4.583   1.00 20.92 ? 9   SER H C   1 
ATOM   1416 O  O   . SER H  2 9  ? 8.790   -0.443  4.945   1.00 19.43 ? 9   SER H O   1 
ATOM   1417 C  CB  . SER H  2 9  ? 7.253   0.854   2.171   1.00 23.65 ? 9   SER H CB  1 
ATOM   1418 O  OG  . SER H  2 9  ? 8.590   0.617   1.753   1.00 28.98 ? 9   SER H OG  1 
ATOM   1419 N  N   . HIS H  2 10 ? 8.237   1.699   5.188   1.00 17.62 ? 10  HIS H N   1 
ATOM   1420 C  CA  . HIS H  2 10 ? 9.233   1.986   6.174   1.00 16.10 ? 10  HIS H CA  1 
ATOM   1421 C  C   . HIS H  2 10 ? 8.853   1.326   7.473   1.00 16.55 ? 10  HIS H C   1 
ATOM   1422 O  O   . HIS H  2 10 ? 9.699   0.808   8.244   1.00 15.69 ? 10  HIS H O   1 
ATOM   1423 C  CB  . HIS H  2 10 ? 9.569   3.525   6.436   1.00 15.92 ? 10  HIS H CB  1 
ATOM   1424 C  CG  . HIS H  2 10 ? 10.303  4.131   5.255   1.00 16.06 ? 10  HIS H CG  1 
ATOM   1425 N  ND1 . HIS H  2 10 ? 11.602  4.043   4.947   1.00 16.87 ? 10  HIS H ND1 1 
ATOM   1426 C  CD2 . HIS H  2 10 ? 9.784   4.775   4.155   1.00 15.23 ? 10  HIS H CD2 1 
ATOM   1427 C  CE1 . HIS H  2 10 ? 11.867  4.629   3.766   1.00 16.37 ? 10  HIS H CE1 1 
ATOM   1428 N  NE2 . HIS H  2 10 ? 10.762  5.182   3.277   1.00 14.17 ? 10  HIS H NE2 1 
ATOM   1429 N  N   . LEU H  2 11 ? 7.533   1.343   7.813   1.00 17.40 ? 11  LEU H N   1 
ATOM   1430 C  CA  . LEU H  2 11 ? 7.150   0.684   9.084   1.00 19.19 ? 11  LEU H CA  1 
ATOM   1431 C  C   . LEU H  2 11 ? 7.426   -0.877  9.083   1.00 16.39 ? 11  LEU H C   1 
ATOM   1432 O  O   . LEU H  2 11 ? 7.846   -1.289  10.150  1.00 19.91 ? 11  LEU H O   1 
ATOM   1433 C  CB  . LEU H  2 11 ? 5.653   0.966   9.246   1.00 19.01 ? 11  LEU H CB  1 
ATOM   1434 C  CG  . LEU H  2 11 ? 5.216   2.224   9.929   1.00 20.65 ? 11  LEU H CG  1 
ATOM   1435 C  CD1 . LEU H  2 11 ? 3.659   2.277   9.870   1.00 22.10 ? 11  LEU H CD1 1 
ATOM   1436 C  CD2 . LEU H  2 11 ? 5.651   2.107   11.362  1.00 21.48 ? 11  LEU H CD2 1 
ATOM   1437 N  N   . VAL H  2 12 ? 7.173   -1.558  8.044   1.00 18.59 ? 12  VAL H N   1 
ATOM   1438 C  CA  . VAL H  2 12 ? 7.407   -2.996  7.887   1.00 21.52 ? 12  VAL H CA  1 
ATOM   1439 C  C   . VAL H  2 12 ? 8.922   -3.269  7.975   1.00 22.08 ? 12  VAL H C   1 
ATOM   1440 O  O   . VAL H  2 12 ? 9.289   -4.280  8.645   1.00 21.31 ? 12  VAL H O   1 
ATOM   1441 C  CB  . VAL H  2 12 ? 6.766   -3.662  6.680   1.00 23.34 ? 12  VAL H CB  1 
ATOM   1442 C  CG1 . VAL H  2 12 ? 5.215   -3.589  6.774   1.00 23.95 ? 12  VAL H CG1 1 
ATOM   1443 C  CG2 . VAL H  2 12 ? 7.222   -3.289  5.295   1.00 23.47 ? 12  VAL H CG2 1 
ATOM   1444 N  N   . GLU H  2 13 ? 9.755   -2.397  7.406   1.00 20.84 ? 13  GLU H N   1 
ATOM   1445 C  CA  . GLU H  2 13 ? 11.204  -2.626  7.584   1.00 22.33 ? 13  GLU H CA  1 
ATOM   1446 C  C   . GLU H  2 13 ? 11.574  -2.444  9.020   1.00 19.95 ? 13  GLU H C   1 
ATOM   1447 O  O   . GLU H  2 13 ? 12.481  -3.127  9.545   1.00 21.93 ? 13  GLU H O   1 
ATOM   1448 C  CB  . GLU H  2 13 ? 12.043  -1.680  6.727   1.00 23.57 ? 13  GLU H CB  1 
ATOM   1449 C  CG  . GLU H  2 13 ? 11.796  -1.876  5.239   1.00 31.06 ? 13  GLU H CG  1 
ATOM   1450 C  CD  . GLU H  2 13 ? 12.954  -1.270  4.460   1.00 36.31 ? 13  GLU H CD  1 
ATOM   1451 O  OE1 . GLU H  2 13 ? 13.907  -0.779  5.075   1.00 39.12 ? 13  GLU H OE1 1 
ATOM   1452 O  OE2 . GLU H  2 13 ? 12.752  -1.279  3.229   1.00 39.48 ? 13  GLU H OE2 1 
ATOM   1453 N  N   . ALA H  2 14 ? 11.001  -1.535  9.812   1.00 19.67 ? 14  ALA H N   1 
ATOM   1454 C  CA  . ALA H  2 14 ? 11.260  -1.264  11.185  1.00 18.53 ? 14  ALA H CA  1 
ATOM   1455 C  C   . ALA H  2 14 ? 10.737  -2.474  12.047  1.00 19.73 ? 14  ALA H C   1 
ATOM   1456 O  O   . ALA H  2 14 ? 11.434  -2.803  13.021  1.00 19.57 ? 14  ALA H O   1 
ATOM   1457 C  CB  . ALA H  2 14 ? 10.631  -0.008  11.800  1.00 18.57 ? 14  ALA H CB  1 
ATOM   1458 N  N   . LEU H  2 15 ? 9.568   -2.927  11.636  1.00 18.64 ? 15  LEU H N   1 
ATOM   1459 C  CA  . LEU H  2 15 ? 9.001   -4.061  12.391  1.00 21.77 ? 15  LEU H CA  1 
ATOM   1460 C  C   . LEU H  2 15 ? 9.957   -5.299  12.232  1.00 21.00 ? 15  LEU H C   1 
ATOM   1461 O  O   . LEU H  2 15 ? 10.150  -5.991  13.228  1.00 21.95 ? 15  LEU H O   1 
ATOM   1462 C  CB  . LEU H  2 15 ? 7.594   -4.360  11.877  1.00 22.55 ? 15  LEU H CB  1 
ATOM   1463 C  CG  . LEU H  2 15 ? 6.475   -3.387  12.346  1.00 22.36 ? 15  LEU H CG  1 
ATOM   1464 C  CD1 . LEU H  2 15 ? 5.193   -3.708  11.601  1.00 23.10 ? 15  LEU H CD1 1 
ATOM   1465 C  CD2 . LEU H  2 15 ? 6.350   -3.491  13.845  1.00 22.57 ? 15  LEU H CD2 1 
ATOM   1466 N  N   . TYR H  2 16 ? 10.443  -5.408  11.024  1.00 21.36 ? 16  TYR H N   1 
ATOM   1467 C  CA  . TYR H  2 16 ? 11.396  -6.486  10.736  1.00 23.18 ? 16  TYR H CA  1 
ATOM   1468 C  C   . TYR H  2 16 ? 12.562  -6.423  11.692  1.00 23.61 ? 16  TYR H C   1 
ATOM   1469 O  O   . TYR H  2 16 ? 12.857  -7.457  12.341  1.00 22.05 ? 16  TYR H O   1 
ATOM   1470 C  CB  . TYR H  2 16 ? 11.710  -6.517  9.258   1.00 22.88 ? 16  TYR H CB  1 
ATOM   1471 C  CG  . TYR H  2 16 ? 12.745  -7.603  8.986   1.00 21.76 ? 16  TYR H CG  1 
ATOM   1472 C  CD1 . TYR H  2 16 ? 12.363  -8.913  8.802   1.00 23.71 ? 16  TYR H CD1 1 
ATOM   1473 C  CD2 . TYR H  2 16 ? 14.092  -7.229  8.945   1.00 22.05 ? 16  TYR H CD2 1 
ATOM   1474 C  CE1 . TYR H  2 16 ? 13.306  -9.962  8.569   1.00 22.42 ? 16  TYR H CE1 1 
ATOM   1475 C  CE2 . TYR H  2 16 ? 15.052  -8.211  8.662   1.00 21.96 ? 16  TYR H CE2 1 
ATOM   1476 C  CZ  . TYR H  2 16 ? 14.655  -9.567  8.494   1.00 23.38 ? 16  TYR H CZ  1 
ATOM   1477 O  OH  . TYR H  2 16 ? 15.643  -10.463 8.159   1.00 19.81 ? 16  TYR H OH  1 
ATOM   1478 N  N   . LEU H  2 17 ? 13.225  -5.314  11.878  1.00 23.39 ? 17  LEU H N   1 
ATOM   1479 C  CA  . LEU H  2 17 ? 14.319  -5.171  12.813  1.00 27.19 ? 17  LEU H CA  1 
ATOM   1480 C  C   . LEU H  2 17 ? 13.918  -5.338  14.286  1.00 27.64 ? 17  LEU H C   1 
ATOM   1481 O  O   . LEU H  2 17 ? 14.593  -6.060  15.051  1.00 27.30 ? 17  LEU H O   1 
ATOM   1482 C  CB  . LEU H  2 17 ? 15.098  -3.891  12.488  1.00 30.25 ? 17  LEU H CB  1 
ATOM   1483 C  CG  . LEU H  2 17 ? 16.314  -3.898  11.557  1.00 33.34 ? 17  LEU H CG  1 
ATOM   1484 C  CD1 . LEU H  2 17 ? 16.601  -5.175  10.764  1.00 33.71 ? 17  LEU H CD1 1 
ATOM   1485 C  CD2 . LEU H  2 17 ? 16.214  -2.768  10.491  1.00 33.26 ? 17  LEU H CD2 1 
ATOM   1486 N  N   . VAL H  2 18 ? 12.816  -4.769  14.753  1.00 27.13 ? 18  VAL H N   1 
ATOM   1487 C  CA  . VAL H  2 18 ? 12.378  -4.849  16.143  1.00 29.00 ? 18  VAL H CA  1 
ATOM   1488 C  C   . VAL H  2 18 ? 11.897  -6.228  16.615  1.00 29.03 ? 18  VAL H C   1 
ATOM   1489 O  O   . VAL H  2 18 ? 12.234  -6.672  17.753  1.00 28.69 ? 18  VAL H O   1 
ATOM   1490 C  CB  . VAL H  2 18 ? 11.407  -3.676  16.402  1.00 28.90 ? 18  VAL H CB  1 
ATOM   1491 C  CG1 . VAL H  2 18 ? 10.766  -3.592  17.768  1.00 32.17 ? 18  VAL H CG1 1 
ATOM   1492 C  CG2 . VAL H  2 18 ? 12.167  -2.323  16.272  1.00 32.40 ? 18  VAL H CG2 1 
ATOM   1493 N  N   . CYS H  2 19 ? 11.106  -6.886  15.814  1.00 30.18 ? 19  CYS H N   1 
ATOM   1494 C  CA  . CYS H  2 19 ? 10.456  -8.185  16.099  1.00 31.26 ? 19  CYS H CA  1 
ATOM   1495 C  C   . CYS H  2 19 ? 11.380  -9.406  16.067  1.00 33.45 ? 19  CYS H C   1 
ATOM   1496 O  O   . CYS H  2 19 ? 11.285  -10.311 16.930  1.00 32.68 ? 19  CYS H O   1 
ATOM   1497 C  CB  . CYS H  2 19 ? 9.211   -8.330  15.222  1.00 30.01 ? 19  CYS H CB  1 
ATOM   1498 S  SG  . CYS H  2 19 ? 8.025   -6.950  15.513  1.00 30.76 ? 19  CYS H SG  1 
ATOM   1499 N  N   . GLY H  2 20 ? 12.255  -9.446  15.064  1.00 33.94 ? 20  GLY H N   1 
ATOM   1500 C  CA  . GLY H  2 20 ? 13.215  -10.528 14.885  1.00 35.59 ? 20  GLY H CA  1 
ATOM   1501 C  C   . GLY H  2 20 ? 12.503  -11.859 14.620  1.00 37.32 ? 20  GLY H C   1 
ATOM   1502 O  O   . GLY H  2 20 ? 11.748  -11.914 13.644  1.00 36.17 ? 20  GLY H O   1 
ATOM   1503 N  N   . GLU H  2 21 ? 12.811  -12.832 15.471  1.00 39.23 ? 21  GLU H N   1 
ATOM   1504 C  CA  . GLU H  2 21 ? 12.275  -14.180 15.445  1.00 41.95 ? 21  GLU H CA  1 
ATOM   1505 C  C   . GLU H  2 21 ? 10.790  -14.288 15.771  1.00 41.33 ? 21  GLU H C   1 
ATOM   1506 O  O   . GLU H  2 21 ? 10.159  -15.312 15.432  1.00 42.61 ? 21  GLU H O   1 
ATOM   1507 C  CB  . GLU H  2 21 ? 12.894  -15.109 16.494  1.00 45.20 ? 21  GLU H CB  1 
ATOM   1508 C  CG  . GLU H  2 21 ? 14.391  -15.203 16.665  1.00 49.75 ? 21  GLU H CG  1 
ATOM   1509 C  CD  . GLU H  2 21 ? 14.941  -16.568 17.013  1.00 52.05 ? 21  GLU H CD  1 
ATOM   1510 O  OE1 . GLU H  2 21 ? 14.751  -17.547 16.286  1.00 53.61 ? 21  GLU H OE1 1 
ATOM   1511 O  OE2 . GLU H  2 21 ? 15.580  -16.610 18.092  1.00 53.88 ? 21  GLU H OE2 1 
ATOM   1512 N  N   . ARG H  2 22 ? 10.225  -13.288 16.408  1.00 40.72 ? 22  ARG H N   1 
ATOM   1513 C  CA  . ARG H  2 22 ? 8.804   -13.260 16.748  1.00 40.22 ? 22  ARG H CA  1 
ATOM   1514 C  C   . ARG H  2 22 ? 7.967   -13.122 15.491  1.00 39.55 ? 22  ARG H C   1 
ATOM   1515 O  O   . ARG H  2 22 ? 6.844   -13.658 15.410  1.00 40.36 ? 22  ARG H O   1 
ATOM   1516 C  CB  . ARG H  2 22 ? 8.516   -12.076 17.701  1.00 42.19 ? 22  ARG H CB  1 
ATOM   1517 C  CG  . ARG H  2 22 ? 9.218   -12.022 19.050  1.00 44.29 ? 22  ARG H CG  1 
ATOM   1518 C  CD  . ARG H  2 22 ? 9.252   -10.743 19.818  1.00 45.57 ? 22  ARG H CD  1 
ATOM   1519 N  NE  . ARG H  2 22 ? 7.935   -10.269 20.230  1.00 47.91 ? 22  ARG H NE  1 
ATOM   1520 C  CZ  . ARG H  2 22 ? 7.559   -9.467  21.234  1.00 47.64 ? 22  ARG H CZ  1 
ATOM   1521 N  NH1 . ARG H  2 22 ? 8.403   -8.897  22.089  1.00 47.44 ? 22  ARG H NH1 1 
ATOM   1522 N  NH2 . ARG H  2 22 ? 6.243   -9.232  21.417  1.00 47.58 ? 22  ARG H NH2 1 
ATOM   1523 N  N   . GLY H  2 23 ? 8.482   -12.324 14.531  1.00 38.10 ? 23  GLY H N   1 
ATOM   1524 C  CA  . GLY H  2 23 ? 7.741   -12.024 13.299  1.00 36.01 ? 23  GLY H CA  1 
ATOM   1525 C  C   . GLY H  2 23 ? 6.625   -11.020 13.711  1.00 34.43 ? 23  GLY H C   1 
ATOM   1526 O  O   . GLY H  2 23 ? 6.496   -10.521 14.846  1.00 34.09 ? 23  GLY H O   1 
ATOM   1527 N  N   . PHE H  2 24 ? 5.743   -10.741 12.781  1.00 34.70 ? 24  PHE H N   1 
ATOM   1528 C  CA  . PHE H  2 24 ? 4.636   -9.792  12.972  1.00 33.39 ? 24  PHE H CA  1 
ATOM   1529 C  C   . PHE H  2 24 ? 3.609   -10.059 11.894  1.00 34.15 ? 24  PHE H C   1 
ATOM   1530 O  O   . PHE H  2 24 ? 3.880   -10.690 10.856  1.00 34.81 ? 24  PHE H O   1 
ATOM   1531 C  CB  . PHE H  2 24 ? 5.156   -8.308  12.935  1.00 30.48 ? 24  PHE H CB  1 
ATOM   1532 C  CG  . PHE H  2 24 ? 5.915   -8.009  11.673  1.00 28.56 ? 24  PHE H CG  1 
ATOM   1533 C  CD1 . PHE H  2 24 ? 7.260   -8.285  11.519  1.00 27.29 ? 24  PHE H CD1 1 
ATOM   1534 C  CD2 . PHE H  2 24 ? 5.228   -7.506  10.565  1.00 28.37 ? 24  PHE H CD2 1 
ATOM   1535 C  CE1 . PHE H  2 24 ? 7.947   -8.056  10.323  1.00 26.22 ? 24  PHE H CE1 1 
ATOM   1536 C  CE2 . PHE H  2 24 ? 5.894   -7.220  9.355   1.00 28.09 ? 24  PHE H CE2 1 
ATOM   1537 C  CZ  . PHE H  2 24 ? 7.274   -7.546  9.239   1.00 26.51 ? 24  PHE H CZ  1 
ATOM   1538 N  N   . PHE H  2 25 ? 2.408   -9.528  12.213  1.00 37.12 ? 25  PHE H N   1 
ATOM   1539 C  CA  . PHE H  2 25 ? 1.243   -9.558  11.332  1.00 38.71 ? 25  PHE H CA  1 
ATOM   1540 C  C   . PHE H  2 25 ? 1.164   -8.084  10.865  1.00 38.16 ? 25  PHE H C   1 
ATOM   1541 O  O   . PHE H  2 25 ? 1.132   -7.272  11.805  1.00 40.66 ? 25  PHE H O   1 
ATOM   1542 C  CB  . PHE H  2 25 ? -0.210  -9.778  11.815  1.00 40.53 ? 25  PHE H CB  1 
ATOM   1543 C  CG  . PHE H  2 25 ? -0.447  -11.263 11.787  0.75 42.11 ? 25  PHE H CG  1 
ATOM   1544 C  CD1 . PHE H  2 25 ? -0.771  -11.884 10.580  0.75 42.48 ? 25  PHE H CD1 1 
ATOM   1545 C  CD2 . PHE H  2 25 ? -0.278  -12.007 12.958  0.75 43.07 ? 25  PHE H CD2 1 
ATOM   1546 C  CE1 . PHE H  2 25 ? -0.939  -13.252 10.527  0.75 42.45 ? 25  PHE H CE1 1 
ATOM   1547 C  CE2 . PHE H  2 25 ? -0.460  -13.407 12.913  0.75 43.69 ? 25  PHE H CE2 1 
ATOM   1548 C  CZ  . PHE H  2 25 ? -0.774  -14.015 11.686  0.75 43.12 ? 25  PHE H CZ  1 
ATOM   1549 N  N   . TYR H  2 26 ? 1.125   -7.894  9.581   1.00 38.22 ? 26  TYR H N   1 
ATOM   1550 C  CA  . TYR H  2 26 ? 1.000   -6.480  9.160   1.00 38.66 ? 26  TYR H CA  1 
ATOM   1551 C  C   . TYR H  2 26 ? -0.417  -6.329  8.571   1.00 39.10 ? 26  TYR H C   1 
ATOM   1552 O  O   . TYR H  2 26 ? -0.742  -6.834  7.497   1.00 38.04 ? 26  TYR H O   1 
ATOM   1553 C  CB  . TYR H  2 26 ? 2.071   -5.919  8.230   1.00 36.63 ? 26  TYR H CB  1 
ATOM   1554 C  CG  . TYR H  2 26 ? 1.808   -4.486  7.790   1.00 35.66 ? 26  TYR H CG  1 
ATOM   1555 C  CD1 . TYR H  2 26 ? 2.005   -3.430  8.657   1.00 35.93 ? 26  TYR H CD1 1 
ATOM   1556 C  CD2 . TYR H  2 26 ? 1.359   -4.217  6.505   1.00 35.64 ? 26  TYR H CD2 1 
ATOM   1557 C  CE1 . TYR H  2 26 ? 1.778   -2.097  8.263   1.00 36.75 ? 26  TYR H CE1 1 
ATOM   1558 C  CE2 . TYR H  2 26 ? 1.094   -2.922  6.084   1.00 35.70 ? 26  TYR H CE2 1 
ATOM   1559 C  CZ  . TYR H  2 26 ? 1.306   -1.883  6.973   1.00 36.54 ? 26  TYR H CZ  1 
ATOM   1560 O  OH  . TYR H  2 26 ? 1.098   -0.614  6.540   1.00 36.97 ? 26  TYR H OH  1 
ATOM   1561 N  N   . THR H  2 27 ? -1.161  -5.574  9.380   1.00 42.88 ? 27  THR H N   1 
ATOM   1562 C  CA  . THR H  2 27 ? -2.549  -5.288  8.937   1.00 46.09 ? 27  THR H CA  1 
ATOM   1563 C  C   . THR H  2 27 ? -2.794  -3.770  8.955   1.00 47.22 ? 27  THR H C   1 
ATOM   1564 O  O   . THR H  2 27 ? -2.843  -3.111  10.001  1.00 47.18 ? 27  THR H O   1 
ATOM   1565 C  CB  . THR H  2 27 ? -3.664  -6.154  9.626   1.00 46.84 ? 27  THR H CB  1 
ATOM   1566 O  OG1 . THR H  2 27 ? -3.574  -5.986  11.070  1.00 46.35 ? 27  THR H OG1 1 
ATOM   1567 C  CG2 . THR H  2 27 ? -3.585  -7.643  9.196   1.00 47.08 ? 27  THR H CG2 1 
ATOM   1568 N  N   . PRO H  2 28 ? -2.882  -3.277  7.730   1.00 47.87 ? 28  PRO H N   1 
ATOM   1569 C  CA  . PRO H  2 28 ? -3.143  -1.866  7.500   1.00 49.84 ? 28  PRO H CA  1 
ATOM   1570 C  C   . PRO H  2 28 ? -4.593  -1.560  7.949   1.00 51.70 ? 28  PRO H C   1 
ATOM   1571 O  O   . PRO H  2 28 ? -4.934  -0.440  8.402   1.00 52.49 ? 28  PRO H O   1 
ATOM   1572 C  CB  . PRO H  2 28 ? -2.890  -1.682  6.019   1.00 49.66 ? 28  PRO H CB  1 
ATOM   1573 C  CG  . PRO H  2 28 ? -2.801  -3.017  5.362   1.00 49.25 ? 28  PRO H CG  1 
ATOM   1574 C  CD  . PRO H  2 28 ? -2.802  -4.036  6.475   1.00 49.05 ? 28  PRO H CD  1 
ATOM   1575 N  N   . LYS H  2 29 ? -5.382  -2.631  8.096   1.00 52.19 ? 29  LYS H N   1 
ATOM   1576 N  N   . GLY I  1 1  ? 27.358  -6.781  -18.944 1.00 33.47 ? 1   GLY I N   1 
ATOM   1577 C  CA  . GLY I  1 1  ? 26.120  -6.142  -18.406 1.00 33.43 ? 1   GLY I CA  1 
ATOM   1578 C  C   . GLY I  1 1  ? 26.280  -5.690  -16.953 1.00 32.57 ? 1   GLY I C   1 
ATOM   1579 O  O   . GLY I  1 1  ? 27.151  -6.201  -16.216 1.00 31.94 ? 1   GLY I O   1 
ATOM   1580 N  N   . ILE I  1 2  ? 25.362  -4.799  -16.532 1.00 31.83 ? 2   ILE I N   1 
ATOM   1581 C  CA  . ILE I  1 2  ? 25.402  -4.242  -15.166 1.00 31.44 ? 2   ILE I CA  1 
ATOM   1582 C  C   . ILE I  1 2  ? 25.639  -5.269  -14.067 1.00 30.38 ? 2   ILE I C   1 
ATOM   1583 O  O   . ILE I  1 2  ? 26.464  -5.092  -13.159 1.00 27.83 ? 2   ILE I O   1 
ATOM   1584 C  CB  . ILE I  1 2  ? 24.163  -3.322  -14.778 1.00 30.80 ? 2   ILE I CB  1 
ATOM   1585 C  CG1 . ILE I  1 2  ? 24.594  -2.560  -13.476 1.00 30.99 ? 2   ILE I CG1 1 
ATOM   1586 C  CG2 . ILE I  1 2  ? 22.842  -4.048  -14.536 1.00 31.20 ? 2   ILE I CG2 1 
ATOM   1587 C  CD1 . ILE I  1 2  ? 23.777  -1.328  -13.088 1.00 30.18 ? 2   ILE I CD1 1 
ATOM   1588 N  N   . VAL I  1 3  ? 24.856  -6.352  -14.179 1.00 30.80 ? 3   VAL I N   1 
ATOM   1589 C  CA  . VAL I  1 3  ? 24.980  -7.392  -13.113 1.00 31.51 ? 3   VAL I CA  1 
ATOM   1590 C  C   . VAL I  1 3  ? 26.384  -7.986  -13.083 1.00 31.88 ? 3   VAL I C   1 
ATOM   1591 O  O   . VAL I  1 3  ? 27.007  -8.201  -12.050 1.00 28.70 ? 3   VAL I O   1 
ATOM   1592 C  CB  . VAL I  1 3  ? 23.822  -8.394  -13.232 1.00 32.27 ? 3   VAL I CB  1 
ATOM   1593 C  CG1 . VAL I  1 3  ? 24.046  -9.620  -12.357 1.00 30.81 ? 3   VAL I CG1 1 
ATOM   1594 C  CG2 . VAL I  1 3  ? 22.459  -7.758  -12.908 1.00 31.54 ? 3   VAL I CG2 1 
ATOM   1595 N  N   . GLU I  1 4  ? 26.910  -8.256  -14.266 1.00 35.06 ? 4   GLU I N   1 
ATOM   1596 C  CA  . GLU I  1 4  ? 28.272  -8.825  -14.429 1.00 37.53 ? 4   GLU I CA  1 
ATOM   1597 C  C   . GLU I  1 4  ? 29.319  -7.843  -13.928 1.00 35.84 ? 4   GLU I C   1 
ATOM   1598 O  O   . GLU I  1 4  ? 30.218  -8.173  -13.130 1.00 35.39 ? 4   GLU I O   1 
ATOM   1599 C  CB  . GLU I  1 4  ? 28.474  -9.150  -15.911 1.00 40.87 ? 4   GLU I CB  1 
ATOM   1600 C  CG  . GLU I  1 4  ? 27.393  -10.101 -16.451 1.00 46.42 ? 4   GLU I CG  1 
ATOM   1601 C  CD  . GLU I  1 4  ? 26.013  -9.593  -16.770 1.00 48.84 ? 4   GLU I CD  1 
ATOM   1602 O  OE1 . GLU I  1 4  ? 25.753  -8.596  -17.450 1.00 51.37 ? 4   GLU I OE1 1 
ATOM   1603 O  OE2 . GLU I  1 4  ? 25.063  -10.289 -16.305 1.00 50.18 ? 4   GLU I OE2 1 
ATOM   1604 N  N   . GLN I  1 5  ? 29.159  -6.597  -14.360 1.00 34.53 ? 5   GLN I N   1 
ATOM   1605 C  CA  . GLN I  1 5  ? 30.089  -5.549  -13.909 1.00 33.32 ? 5   GLN I CA  1 
ATOM   1606 C  C   . GLN I  1 5  ? 30.069  -5.177  -12.447 1.00 29.99 ? 5   GLN I C   1 
ATOM   1607 O  O   . GLN I  1 5  ? 31.119  -4.846  -11.849 1.00 27.53 ? 5   GLN I O   1 
ATOM   1608 C  CB  . GLN I  1 5  ? 29.871  -4.244  -14.740 1.00 36.97 ? 5   GLN I CB  1 
ATOM   1609 C  CG  . GLN I  1 5  ? 30.207  -4.394  -16.199 1.00 42.62 ? 5   GLN I CG  1 
ATOM   1610 C  CD  . GLN I  1 5  ? 31.606  -5.010  -16.317 1.00 45.90 ? 5   GLN I CD  1 
ATOM   1611 O  OE1 . GLN I  1 5  ? 32.682  -4.422  -16.137 1.00 47.91 ? 5   GLN I OE1 1 
ATOM   1612 N  NE2 . GLN I  1 5  ? 31.615  -6.324  -16.630 1.00 48.05 ? 5   GLN I NE2 1 
ATOM   1613 N  N   . CYS I  1 6  ? 28.915  -5.135  -11.758 1.00 27.03 ? 6   CYS I N   1 
ATOM   1614 C  CA  . CYS I  1 6  ? 28.869  -4.670  -10.380 1.00 25.63 ? 6   CYS I CA  1 
ATOM   1615 C  C   . CYS I  1 6  ? 28.444  -5.532  -9.221  1.00 24.84 ? 6   CYS I C   1 
ATOM   1616 O  O   . CYS I  1 6  ? 28.318  -5.031  -8.105  1.00 23.11 ? 6   CYS I O   1 
ATOM   1617 C  CB  . CYS I  1 6  ? 27.914  -3.443  -10.475 1.00 25.29 ? 6   CYS I CB  1 
ATOM   1618 S  SG  . CYS I  1 6  ? 28.451  -2.308  -11.801 1.00 26.26 ? 6   CYS I SG  1 
ATOM   1619 N  N   . CYS I  1 7  ? 28.250  -6.835  -9.415  1.00 26.01 ? 7   CYS I N   1 
ATOM   1620 C  CA  . CYS I  1 7  ? 27.794  -7.721  -8.300  1.00 24.68 ? 7   CYS I CA  1 
ATOM   1621 C  C   . CYS I  1 7  ? 28.901  -8.504  -7.623  1.00 25.09 ? 7   CYS I C   1 
ATOM   1622 O  O   . CYS I  1 7  ? 28.632  -9.188  -6.598  1.00 23.29 ? 7   CYS I O   1 
ATOM   1623 C  CB  . CYS I  1 7  ? 26.535  -8.489  -8.737  1.00 23.41 ? 7   CYS I CB  1 
ATOM   1624 S  SG  . CYS I  1 7  ? 25.073  -7.339  -8.931  1.00 23.64 ? 7   CYS I SG  1 
ATOM   1625 N  N   . THR I  1 8  ? 30.142  -8.344  -8.105  1.00 27.90 ? 8   THR I N   1 
ATOM   1626 C  CA  . THR I  1 8  ? 31.265  -9.026  -7.391  1.00 29.48 ? 8   THR I CA  1 
ATOM   1627 C  C   . THR I  1 8  ? 32.251  -7.961  -6.865  1.00 29.23 ? 8   THR I C   1 
ATOM   1628 O  O   . THR I  1 8  ? 32.696  -7.974  -5.689  1.00 28.65 ? 8   THR I O   1 
ATOM   1629 C  CB  . THR I  1 8  ? 31.988  -10.189 -8.150  1.00 31.43 ? 8   THR I CB  1 
ATOM   1630 O  OG1 . THR I  1 8  ? 30.946  -11.057 -8.735  1.00 34.04 ? 8   THR I OG1 1 
ATOM   1631 C  CG2 . THR I  1 8  ? 32.851  -11.011 -7.178  1.00 32.09 ? 8   THR I CG2 1 
ATOM   1632 N  N   . SER I  1 9  ? 32.529  -7.032  -7.769  1.00 28.50 ? 9   SER I N   1 
ATOM   1633 C  CA  . SER I  1 9  ? 33.412  -5.884  -7.409  1.00 29.34 ? 9   SER I CA  1 
ATOM   1634 C  C   . SER I  1 9  ? 32.541  -4.636  -7.250  1.00 26.83 ? 9   SER I C   1 
ATOM   1635 O  O   . SER I  1 9  ? 31.653  -4.545  -8.127  1.00 27.49 ? 9   SER I O   1 
ATOM   1636 C  CB  . SER I  1 9  ? 34.475  -5.618  -8.506  1.00 29.79 ? 9   SER I CB  1 
ATOM   1637 O  OG  . SER I  1 9  ? 35.647  -6.336  -8.053  1.00 34.65 ? 9   SER I OG  1 
ATOM   1638 N  N   . ILE I  1 10 ? 32.730  -3.789  -6.298  1.00 26.47 ? 10  ILE I N   1 
ATOM   1639 C  CA  . ILE I  1 10 ? 31.849  -2.581  -6.174  1.00 26.43 ? 10  ILE I CA  1 
ATOM   1640 C  C   . ILE I  1 10 ? 32.076  -1.623  -7.346  1.00 26.69 ? 10  ILE I C   1 
ATOM   1641 O  O   . ILE I  1 10 ? 33.193  -1.225  -7.719  1.00 26.95 ? 10  ILE I O   1 
ATOM   1642 C  CB  . ILE I  1 10 ? 32.056  -1.835  -4.835  1.00 27.12 ? 10  ILE I CB  1 
ATOM   1643 C  CG1 . ILE I  1 10 ? 31.811  -2.735  -3.606  1.00 26.80 ? 10  ILE I CG1 1 
ATOM   1644 C  CG2 . ILE I  1 10 ? 31.346  -0.445  -4.599  1.00 26.14 ? 10  ILE I CG2 1 
ATOM   1645 C  CD1 . ILE I  1 10 ? 32.462  -2.243  -2.285  1.00 26.40 ? 10  ILE I CD1 1 
ATOM   1646 N  N   . CYS I  1 11 ? 31.003  -1.201  -7.978  1.00 25.68 ? 11  CYS I N   1 
ATOM   1647 C  CA  . CYS I  1 11 ? 31.124  -0.204  -9.062  1.00 26.87 ? 11  CYS I CA  1 
ATOM   1648 C  C   . CYS I  1 11 ? 31.087  1.198   -8.426  1.00 27.02 ? 11  CYS I C   1 
ATOM   1649 O  O   . CYS I  1 11 ? 30.196  1.411   -7.585  1.00 27.34 ? 11  CYS I O   1 
ATOM   1650 C  CB  . CYS I  1 11 ? 29.996  -0.331  -10.036 1.00 25.29 ? 11  CYS I CB  1 
ATOM   1651 S  SG  . CYS I  1 11 ? 30.241  -1.692  -11.149 1.00 25.40 ? 11  CYS I SG  1 
ATOM   1652 N  N   . SER I  1 12 ? 31.933  2.109   -8.891  1.00 28.85 ? 12  SER I N   1 
ATOM   1653 C  CA  . SER I  1 12 ? 31.909  3.475   -8.338  1.00 29.28 ? 12  SER I CA  1 
ATOM   1654 C  C   . SER I  1 12 ? 30.729  4.211   -8.990  1.00 29.90 ? 12  SER I C   1 
ATOM   1655 O  O   . SER I  1 12 ? 30.084  3.711   -9.901  1.00 26.18 ? 12  SER I O   1 
ATOM   1656 C  CB  . SER I  1 12 ? 33.204  4.259   -8.706  1.00 28.79 ? 12  SER I CB  1 
ATOM   1657 O  OG  . SER I  1 12 ? 33.183  4.242   -10.133 1.00 30.31 ? 12  SER I OG  1 
ATOM   1658 N  N   . LEU I  1 13 ? 30.590  5.462   -8.530  1.00 31.45 ? 13  LEU I N   1 
ATOM   1659 C  CA  . LEU I  1 13 ? 29.561  6.386   -9.021  1.00 32.52 ? 13  LEU I CA  1 
ATOM   1660 C  C   . LEU I  1 13 ? 29.687  6.638   -10.499 1.00 32.09 ? 13  LEU I C   1 
ATOM   1661 O  O   . LEU I  1 13 ? 28.669  6.699   -11.207 1.00 29.80 ? 13  LEU I O   1 
ATOM   1662 C  CB  . LEU I  1 13 ? 29.702  7.699   -8.205  1.00 35.98 ? 13  LEU I CB  1 
ATOM   1663 C  CG  . LEU I  1 13 ? 29.263  7.497   -6.761  1.00 37.08 ? 13  LEU I CG  1 
ATOM   1664 C  CD1 . LEU I  1 13 ? 29.456  8.770   -5.944  1.00 39.08 ? 13  LEU I CD1 1 
ATOM   1665 C  CD2 . LEU I  1 13 ? 27.787  7.082   -6.815  1.00 37.06 ? 13  LEU I CD2 1 
ATOM   1666 N  N   . TYR I  1 14 ? 30.918  6.759   -10.961 1.00 33.92 ? 14  TYR I N   1 
ATOM   1667 C  CA  . TYR I  1 14 ? 31.243  6.984   -12.375 1.00 36.06 ? 14  TYR I CA  1 
ATOM   1668 C  C   . TYR I  1 14 ? 30.960  5.782   -13.225 1.00 33.70 ? 14  TYR I C   1 
ATOM   1669 O  O   . TYR I  1 14 ? 30.625  6.030   -14.383 1.00 34.19 ? 14  TYR I O   1 
ATOM   1670 C  CB  . TYR I  1 14 ? 32.746  7.283   -12.638 1.00 42.49 ? 14  TYR I CB  1 
ATOM   1671 C  CG  . TYR I  1 14 ? 33.140  8.330   -11.610 1.00 49.13 ? 14  TYR I CG  1 
ATOM   1672 C  CD1 . TYR I  1 14 ? 32.777  9.680   -11.818 1.00 51.55 ? 14  TYR I CD1 1 
ATOM   1673 C  CD2 . TYR I  1 14 ? 33.801  7.955   -10.438 1.00 51.36 ? 14  TYR I CD2 1 
ATOM   1674 C  CE1 . TYR I  1 14 ? 33.120  10.645  -10.871 1.00 54.04 ? 14  TYR I CE1 1 
ATOM   1675 C  CE2 . TYR I  1 14 ? 34.143  8.915   -9.481  1.00 54.47 ? 14  TYR I CE2 1 
ATOM   1676 C  CZ  . TYR I  1 14 ? 33.803  10.259  -9.708  1.00 55.48 ? 14  TYR I CZ  1 
ATOM   1677 O  OH  . TYR I  1 14 ? 34.177  11.174  -8.752  1.00 56.87 ? 14  TYR I OH  1 
ATOM   1678 N  N   . GLN I  1 15 ? 31.126  4.576   -12.701 1.00 31.18 ? 15  GLN I N   1 
ATOM   1679 C  CA  . GLN I  1 15 ? 30.792  3.396   -13.527 1.00 30.49 ? 15  GLN I CA  1 
ATOM   1680 C  C   . GLN I  1 15 ? 29.256  3.280   -13.616 1.00 28.49 ? 15  GLN I C   1 
ATOM   1681 O  O   . GLN I  1 15 ? 28.805  2.869   -14.677 1.00 28.52 ? 15  GLN I O   1 
ATOM   1682 C  CB  . GLN I  1 15 ? 31.318  2.109   -12.923 1.00 31.47 ? 15  GLN I CB  1 
ATOM   1683 C  CG  . GLN I  1 15 ? 32.809  2.023   -13.057 1.00 35.64 ? 15  GLN I CG  1 
ATOM   1684 C  CD  . GLN I  1 15 ? 33.284  0.896   -12.155 1.00 38.18 ? 15  GLN I CD  1 
ATOM   1685 O  OE1 . GLN I  1 15 ? 33.389  1.115   -10.923 1.00 40.12 ? 15  GLN I OE1 1 
ATOM   1686 N  NE2 . GLN I  1 15 ? 33.529  -0.219  -12.843 1.00 38.76 ? 15  GLN I NE2 1 
ATOM   1687 N  N   . LEU I  1 16 ? 28.545  3.569   -12.517 1.00 26.55 ? 16  LEU I N   1 
ATOM   1688 C  CA  . LEU I  1 16 ? 27.058  3.487   -12.516 1.00 26.19 ? 16  LEU I CA  1 
ATOM   1689 C  C   . LEU I  1 16 ? 26.453  4.401   -13.576 1.00 26.57 ? 16  LEU I C   1 
ATOM   1690 O  O   . LEU I  1 16 ? 25.460  4.045   -14.234 1.00 25.37 ? 16  LEU I O   1 
ATOM   1691 C  CB  . LEU I  1 16 ? 26.555  3.743   -11.098 1.00 25.47 ? 16  LEU I CB  1 
ATOM   1692 C  CG  . LEU I  1 16 ? 27.028  2.721   -10.044 1.00 26.66 ? 16  LEU I CG  1 
ATOM   1693 C  CD1 . LEU I  1 16 ? 26.525  3.058   -8.645  1.00 26.47 ? 16  LEU I CD1 1 
ATOM   1694 C  CD2 . LEU I  1 16 ? 26.422  1.338   -10.326 1.00 26.35 ? 16  LEU I CD2 1 
ATOM   1695 N  N   . GLU I  1 17 ? 27.050  5.601   -13.713 1.00 27.58 ? 17  GLU I N   1 
ATOM   1696 C  CA  . GLU I  1 17 ? 26.532  6.547   -14.682 1.00 28.88 ? 17  GLU I CA  1 
ATOM   1697 C  C   . GLU I  1 17 ? 26.512  6.026   -16.108 1.00 27.70 ? 17  GLU I C   1 
ATOM   1698 O  O   . GLU I  1 17 ? 25.767  6.673   -16.871 1.00 25.65 ? 17  GLU I O   1 
ATOM   1699 C  CB  . GLU I  1 17 ? 27.264  7.884   -14.746 1.00 31.60 ? 17  GLU I CB  1 
ATOM   1700 C  CG  . GLU I  1 17 ? 27.570  8.524   -13.443 1.00 36.15 ? 17  GLU I CG  1 
ATOM   1701 C  CD  . GLU I  1 17 ? 27.854  10.019  -13.562 1.00 38.94 ? 17  GLU I CD  1 
ATOM   1702 O  OE1 . GLU I  1 17 ? 27.509  10.589  -14.584 1.00 39.38 ? 17  GLU I OE1 1 
ATOM   1703 O  OE2 . GLU I  1 17 ? 28.392  10.296  -12.462 1.00 42.09 ? 17  GLU I OE2 1 
ATOM   1704 N  N   . ASN I  1 18 ? 27.218  4.971   -16.448 1.00 28.19 ? 18  ASN I N   1 
ATOM   1705 C  CA  . ASN I  1 18 ? 27.215  4.389   -17.824 1.00 29.67 ? 18  ASN I CA  1 
ATOM   1706 C  C   . ASN I  1 18 ? 25.862  3.821   -18.239 1.00 28.69 ? 18  ASN I C   1 
ATOM   1707 O  O   . ASN I  1 18 ? 25.556  3.594   -19.409 1.00 26.79 ? 18  ASN I O   1 
ATOM   1708 C  CB  . ASN I  1 18 ? 28.334  3.299   -17.876 1.00 32.59 ? 18  ASN I CB  1 
ATOM   1709 C  CG  . ASN I  1 18 ? 29.713  3.944   -17.966 1.00 32.74 ? 18  ASN I CG  1 
ATOM   1710 O  OD1 . ASN I  1 18 ? 29.813  4.862   -18.779 1.00 35.73 ? 18  ASN I OD1 1 
ATOM   1711 N  ND2 . ASN I  1 18 ? 30.767  3.595   -17.281 1.00 33.50 ? 18  ASN I ND2 1 
ATOM   1712 N  N   . TYR I  1 19 ? 25.072  3.573   -17.184 1.00 29.03 ? 19  TYR I N   1 
ATOM   1713 C  CA  . TYR I  1 19 ? 23.721  3.045   -17.329 1.00 29.19 ? 19  TYR I CA  1 
ATOM   1714 C  C   . TYR I  1 19 ? 22.607  4.069   -17.241 1.00 29.40 ? 19  TYR I C   1 
ATOM   1715 O  O   . TYR I  1 19 ? 21.438  3.586   -17.280 1.00 29.14 ? 19  TYR I O   1 
ATOM   1716 C  CB  . TYR I  1 19 ? 23.460  1.905   -16.328 1.00 31.27 ? 19  TYR I CB  1 
ATOM   1717 C  CG  . TYR I  1 19 ? 24.592  0.898   -16.511 1.00 31.69 ? 19  TYR I CG  1 
ATOM   1718 C  CD1 . TYR I  1 19 ? 24.488  -0.048  -17.560 1.00 33.17 ? 19  TYR I CD1 1 
ATOM   1719 C  CD2 . TYR I  1 19 ? 25.693  0.873   -15.658 1.00 32.13 ? 19  TYR I CD2 1 
ATOM   1720 C  CE1 . TYR I  1 19 ? 25.511  -0.998  -17.772 1.00 33.10 ? 19  TYR I CE1 1 
ATOM   1721 C  CE2 . TYR I  1 19 ? 26.712  -0.048  -15.840 1.00 31.48 ? 19  TYR I CE2 1 
ATOM   1722 C  CZ  . TYR I  1 19 ? 26.590  -0.956  -16.887 1.00 33.39 ? 19  TYR I CZ  1 
ATOM   1723 O  OH  . TYR I  1 19 ? 27.608  -1.887  -17.011 1.00 34.79 ? 19  TYR I OH  1 
ATOM   1724 N  N   . CYS I  1 20 ? 22.962  5.341   -17.198 1.00 27.90 ? 20  CYS I N   1 
ATOM   1725 C  CA  . CYS I  1 20 ? 21.958  6.412   -17.197 1.00 29.71 ? 20  CYS I CA  1 
ATOM   1726 C  C   . CYS I  1 20 ? 21.472  6.569   -18.638 1.00 32.29 ? 20  CYS I C   1 
ATOM   1727 O  O   . CYS I  1 20 ? 22.202  6.172   -19.576 1.00 33.59 ? 20  CYS I O   1 
ATOM   1728 C  CB  . CYS I  1 20 ? 22.377  7.774   -16.660 1.00 25.74 ? 20  CYS I CB  1 
ATOM   1729 S  SG  . CYS I  1 20 ? 23.097  7.638   -15.012 1.00 24.80 ? 20  CYS I SG  1 
ATOM   1730 N  N   . ASN I  1 21 ? 20.281  7.112   -18.757 1.00 35.45 ? 21  ASN I N   1 
ATOM   1731 C  CA  . ASN I  1 21 ? 19.705  7.362   -20.110 1.00 37.07 ? 21  ASN I CA  1 
ATOM   1732 C  C   . ASN I  1 21 ? 20.355  8.630   -20.694 1.00 38.97 ? 21  ASN I C   1 
ATOM   1733 O  O   . ASN I  1 21 ? 20.886  9.480   -19.922 1.00 40.18 ? 21  ASN I O   1 
ATOM   1734 C  CB  . ASN I  1 21 ? 18.201  7.530   -20.011 1.00 37.66 ? 21  ASN I CB  1 
ATOM   1735 C  CG  . ASN I  1 21 ? 17.287  6.352   -19.901 1.00 37.48 ? 21  ASN I CG  1 
ATOM   1736 O  OD1 . ASN I  1 21 ? 17.679  5.270   -20.374 1.00 38.89 ? 21  ASN I OD1 1 
ATOM   1737 N  ND2 . ASN I  1 21 ? 16.108  6.547   -19.304 1.00 37.23 ? 21  ASN I ND2 1 
ATOM   1738 O  OXT . ASN I  1 21 ? 20.308  8.805   -21.923 1.00 41.54 ? 21  ASN I OXT 1 
ATOM   1739 N  N   . PHE J  2 1  ? 21.460  -19.283 -3.062  1.00 37.52 ? 1   PHE J N   1 
ATOM   1740 C  CA  . PHE J  2 1  ? 21.223  -18.026 -2.311  1.00 36.25 ? 1   PHE J CA  1 
ATOM   1741 C  C   . PHE J  2 1  ? 20.903  -17.002 -3.437  1.00 35.57 ? 1   PHE J C   1 
ATOM   1742 O  O   . PHE J  2 1  ? 21.535  -17.110 -4.520  1.00 35.82 ? 1   PHE J O   1 
ATOM   1743 C  CB  . PHE J  2 1  ? 22.255  -17.669 -1.285  1.00 36.87 ? 1   PHE J CB  1 
ATOM   1744 C  CG  . PHE J  2 1  ? 22.023  -16.395 -0.538  1.00 38.15 ? 1   PHE J CG  1 
ATOM   1745 C  CD1 . PHE J  2 1  ? 21.016  -16.327 0.443   1.00 37.88 ? 1   PHE J CD1 1 
ATOM   1746 C  CD2 . PHE J  2 1  ? 22.813  -15.252 -0.820  1.00 38.18 ? 1   PHE J CD2 1 
ATOM   1747 C  CE1 . PHE J  2 1  ? 20.787  -15.146 1.150   1.00 38.15 ? 1   PHE J CE1 1 
ATOM   1748 C  CE2 . PHE J  2 1  ? 22.569  -14.069 -0.090  1.00 38.48 ? 1   PHE J CE2 1 
ATOM   1749 C  CZ  . PHE J  2 1  ? 21.551  -14.012 0.893   1.00 37.90 ? 1   PHE J CZ  1 
ATOM   1750 N  N   . VAL J  2 2  ? 19.910  -16.144 -3.137  1.00 32.45 ? 2   VAL J N   1 
ATOM   1751 C  CA  . VAL J  2 2  ? 19.487  -15.168 -4.175  1.00 30.35 ? 2   VAL J CA  1 
ATOM   1752 C  C   . VAL J  2 2  ? 20.421  -13.955 -4.261  1.00 29.29 ? 2   VAL J C   1 
ATOM   1753 O  O   . VAL J  2 2  ? 19.893  -12.840 -4.460  1.00 27.13 ? 2   VAL J O   1 
ATOM   1754 C  CB  . VAL J  2 2  ? 17.998  -14.855 -3.802  1.00 30.25 ? 2   VAL J CB  1 
ATOM   1755 C  CG1 . VAL J  2 2  ? 17.011  -16.011 -4.000  1.00 30.55 ? 2   VAL J CG1 1 
ATOM   1756 C  CG2 . VAL J  2 2  ? 17.940  -14.445 -2.337  1.00 29.35 ? 2   VAL J CG2 1 
ATOM   1757 N  N   . ASN J  2 3  ? 21.714  -14.083 -4.129  1.00 27.09 ? 3   ASN J N   1 
ATOM   1758 C  CA  . ASN J  2 3  ? 22.698  -13.001 -4.153  1.00 28.34 ? 3   ASN J CA  1 
ATOM   1759 C  C   . ASN J  2 3  ? 22.546  -11.978 -5.268  1.00 26.67 ? 3   ASN J C   1 
ATOM   1760 O  O   . ASN J  2 3  ? 22.635  -10.765 -4.996  1.00 25.60 ? 3   ASN J O   1 
ATOM   1761 C  CB  . ASN J  2 3  ? 24.163  -13.477 -3.984  1.00 30.22 ? 3   ASN J CB  1 
ATOM   1762 C  CG  . ASN J  2 3  ? 24.444  -14.679 -4.846  1.00 32.45 ? 3   ASN J CG  1 
ATOM   1763 O  OD1 . ASN J  2 3  ? 25.181  -14.540 -5.848  1.00 34.94 ? 3   ASN J OD1 1 
ATOM   1764 N  ND2 . ASN J  2 3  ? 23.825  -15.837 -4.525  1.00 34.63 ? 3   ASN J ND2 1 
ATOM   1765 N  N   . GLN J  2 4  ? 22.348  -12.379 -6.463  1.00 26.08 ? 4   GLN J N   1 
ATOM   1766 C  CA  . GLN J  2 4  ? 22.193  -11.614 -7.654  1.00 27.83 ? 4   GLN J CA  1 
ATOM   1767 C  C   . GLN J  2 4  ? 20.941  -10.693 -7.630  1.00 26.71 ? 4   GLN J C   1 
ATOM   1768 O  O   . GLN J  2 4  ? 20.947  -9.555  -8.133  1.00 26.04 ? 4   GLN J O   1 
ATOM   1769 C  CB  . GLN J  2 4  ? 21.922  -12.577 -8.775  1.00 29.90 ? 4   GLN J CB  1 
ATOM   1770 C  CG  . GLN J  2 4  ? 22.445  -12.067 -10.110 1.00 36.63 ? 4   GLN J CG  1 
ATOM   1771 C  CD  . GLN J  2 4  ? 23.582  -13.061 -10.450 1.00 39.95 ? 4   GLN J CD  1 
ATOM   1772 O  OE1 . GLN J  2 4  ? 24.401  -13.136 -9.521  1.00 43.48 ? 4   GLN J OE1 1 
ATOM   1773 N  NE2 . GLN J  2 4  ? 23.546  -13.704 -11.615 1.00 41.03 ? 4   GLN J NE2 1 
ATOM   1774 N  N   . HIS J  2 5  ? 19.873  -11.299 -7.156  1.00 24.57 ? 5   HIS J N   1 
ATOM   1775 C  CA  . HIS J  2 5  ? 18.573  -10.657 -7.057  1.00 23.41 ? 5   HIS J CA  1 
ATOM   1776 C  C   . HIS J  2 5  ? 18.764  -9.580  -5.996  1.00 21.19 ? 5   HIS J C   1 
ATOM   1777 O  O   . HIS J  2 5  ? 18.276  -8.493  -6.331  1.00 21.64 ? 5   HIS J O   1 
ATOM   1778 C  CB  . HIS J  2 5  ? 17.493  -11.685 -6.675  1.00 25.49 ? 5   HIS J CB  1 
ATOM   1779 C  CG  . HIS J  2 5  ? 16.130  -11.093 -6.422  1.00 27.86 ? 5   HIS J CG  1 
ATOM   1780 N  ND1 . HIS J  2 5  ? 15.286  -10.689 -7.429  1.00 28.63 ? 5   HIS J ND1 1 
ATOM   1781 C  CD2 . HIS J  2 5  ? 15.494  -10.853 -5.241  1.00 28.61 ? 5   HIS J CD2 1 
ATOM   1782 C  CE1 . HIS J  2 5  ? 14.177  -10.204 -6.891  1.00 28.97 ? 5   HIS J CE1 1 
ATOM   1783 N  NE2 . HIS J  2 5  ? 14.267  -10.270 -5.590  1.00 29.57 ? 5   HIS J NE2 1 
ATOM   1784 N  N   . LEU J  2 6  ? 19.394  -9.852  -4.880  1.00 19.85 ? 6   LEU J N   1 
ATOM   1785 C  CA  . LEU J  2 6  ? 19.659  -8.918  -3.796  1.00 23.18 ? 6   LEU J CA  1 
ATOM   1786 C  C   . LEU J  2 6  ? 20.567  -7.748  -4.294  1.00 22.82 ? 6   LEU J C   1 
ATOM   1787 O  O   . LEU J  2 6  ? 20.321  -6.603  -3.913  1.00 23.43 ? 6   LEU J O   1 
ATOM   1788 C  CB  . LEU J  2 6  ? 20.217  -9.509  -2.505  1.00 23.40 ? 6   LEU J CB  1 
ATOM   1789 C  CG  . LEU J  2 6  ? 19.449  -10.640 -1.837  1.00 24.15 ? 6   LEU J CG  1 
ATOM   1790 C  CD1 . LEU J  2 6  ? 20.031  -10.953 -0.457  1.00 25.71 ? 6   LEU J CD1 1 
ATOM   1791 C  CD2 . LEU J  2 6  ? 17.985  -10.236 -1.768  1.00 25.03 ? 6   LEU J CD2 1 
ATOM   1792 N  N   . CYS J  2 7  ? 21.584  -8.083  -5.056  1.00 20.64 ? 7   CYS J N   1 
ATOM   1793 C  CA  . CYS J  2 7  ? 22.507  -7.132  -5.606  1.00 20.46 ? 7   CYS J CA  1 
ATOM   1794 C  C   . CYS J  2 7  ? 21.722  -6.124  -6.502  1.00 21.26 ? 7   CYS J C   1 
ATOM   1795 O  O   . CYS J  2 7  ? 21.896  -4.909  -6.459  1.00 17.42 ? 7   CYS J O   1 
ATOM   1796 C  CB  . CYS J  2 7  ? 23.604  -7.812  -6.409  1.00 20.89 ? 7   CYS J CB  1 
ATOM   1797 S  SG  . CYS J  2 7  ? 24.794  -6.626  -7.164  1.00 21.13 ? 7   CYS J SG  1 
ATOM   1798 N  N   . GLY J  2 8  ? 20.894  -6.693  -7.391  1.00 19.34 ? 8   GLY J N   1 
ATOM   1799 C  CA  . GLY J  2 8  ? 20.045  -6.038  -8.360  1.00 19.21 ? 8   GLY J CA  1 
ATOM   1800 C  C   . GLY J  2 8  ? 19.172  -4.930  -7.738  1.00 18.59 ? 8   GLY J C   1 
ATOM   1801 O  O   . GLY J  2 8  ? 19.100  -3.809  -8.261  1.00 20.09 ? 8   GLY J O   1 
ATOM   1802 N  N   . SER J  2 9  ? 18.554  -5.217  -6.668  1.00 17.83 ? 9   SER J N   1 
ATOM   1803 C  CA  . SER J  2 9  ? 17.704  -4.436  -5.803  1.00 20.09 ? 9   SER J CA  1 
ATOM   1804 C  C   . SER J  2 9  ? 18.473  -3.121  -5.385  1.00 21.36 ? 9   SER J C   1 
ATOM   1805 O  O   . SER J  2 9  ? 18.002  -1.977  -5.478  1.00 20.08 ? 9   SER J O   1 
ATOM   1806 C  CB  . SER J  2 9  ? 17.353  -5.310  -4.657  1.00 19.97 ? 9   SER J CB  1 
ATOM   1807 O  OG  . SER J  2 9  ? 16.511  -4.483  -3.876  1.00 22.47 ? 9   SER J OG  1 
ATOM   1808 N  N   . HIS J  2 10 ? 19.669  -3.285  -4.913  1.00 18.89 ? 10  HIS J N   1 
ATOM   1809 C  CA  . HIS J  2 10 ? 20.573  -2.226  -4.487  1.00 19.84 ? 10  HIS J CA  1 
ATOM   1810 C  C   . HIS J  2 10 ? 21.069  -1.456  -5.708  1.00 18.39 ? 10  HIS J C   1 
ATOM   1811 O  O   . HIS J  2 10 ? 21.144  -0.211  -5.562  1.00 18.79 ? 10  HIS J O   1 
ATOM   1812 C  CB  . HIS J  2 10 ? 21.814  -2.673  -3.641  1.00 17.76 ? 10  HIS J CB  1 
ATOM   1813 C  CG  . HIS J  2 10 ? 21.330  -3.118  -2.318  1.00 16.87 ? 10  HIS J CG  1 
ATOM   1814 N  ND1 . HIS J  2 10 ? 21.150  -2.462  -1.159  1.00 16.31 ? 10  HIS J ND1 1 
ATOM   1815 C  CD2 . HIS J  2 10 ? 20.971  -4.414  -2.119  1.00 16.74 ? 10  HIS J CD2 1 
ATOM   1816 C  CE1 . HIS J  2 10 ? 20.640  -3.272  -0.222  1.00 14.44 ? 10  HIS J CE1 1 
ATOM   1817 N  NE2 . HIS J  2 10 ? 20.543  -4.500  -0.814  1.00 15.54 ? 10  HIS J NE2 1 
ATOM   1818 N  N   . LEU J  2 11 ? 21.344  -2.097  -6.811  1.00 17.63 ? 11  LEU J N   1 
ATOM   1819 C  CA  . LEU J  2 11 ? 21.805  -1.424  -8.002  1.00 18.63 ? 11  LEU J CA  1 
ATOM   1820 C  C   . LEU J  2 11 ? 20.746  -0.435  -8.536  1.00 19.73 ? 11  LEU J C   1 
ATOM   1821 O  O   . LEU J  2 11 ? 21.192  0.637   -9.022  1.00 17.10 ? 11  LEU J O   1 
ATOM   1822 C  CB  . LEU J  2 11 ? 22.105  -2.393  -9.155  1.00 19.59 ? 11  LEU J CB  1 
ATOM   1823 C  CG  . LEU J  2 11 ? 23.417  -3.155  -9.094  1.00 20.48 ? 11  LEU J CG  1 
ATOM   1824 C  CD1 . LEU J  2 11 ? 23.420  -4.124  -10.295 1.00 20.29 ? 11  LEU J CD1 1 
ATOM   1825 C  CD2 . LEU J  2 11 ? 24.573  -2.149  -9.217  1.00 19.55 ? 11  LEU J CD2 1 
ATOM   1826 N  N   . VAL J  2 12 ? 19.493  -0.851  -8.535  1.00 19.86 ? 12  VAL J N   1 
ATOM   1827 C  CA  . VAL J  2 12 ? 18.453  0.067   -9.068  1.00 20.99 ? 12  VAL J CA  1 
ATOM   1828 C  C   . VAL J  2 12 ? 18.271  1.297   -8.140  1.00 19.46 ? 12  VAL J C   1 
ATOM   1829 O  O   . VAL J  2 12 ? 17.966  2.318   -8.783  1.00 20.11 ? 12  VAL J O   1 
ATOM   1830 C  CB  . VAL J  2 12 ? 17.164  -0.642  -9.536  1.00 21.01 ? 12  VAL J CB  1 
ATOM   1831 C  CG1 . VAL J  2 12 ? 17.425  -1.814  -10.464 1.00 20.44 ? 12  VAL J CG1 1 
ATOM   1832 C  CG2 . VAL J  2 12 ? 16.322  -0.925  -8.334  1.00 20.49 ? 12  VAL J CG2 1 
ATOM   1833 N  N   . GLU J  2 13 ? 18.473  1.192   -6.887  1.00 19.74 ? 13  GLU J N   1 
ATOM   1834 C  CA  . GLU J  2 13 ? 18.404  2.264   -5.913  1.00 22.82 ? 13  GLU J CA  1 
ATOM   1835 C  C   . GLU J  2 13 ? 19.591  3.239   -6.135  1.00 22.65 ? 13  GLU J C   1 
ATOM   1836 O  O   . GLU J  2 13 ? 19.335  4.475   -6.032  1.00 20.18 ? 13  GLU J O   1 
ATOM   1837 C  CB  . GLU J  2 13 ? 18.251  1.945   -4.448  1.00 24.50 ? 13  GLU J CB  1 
ATOM   1838 C  CG  . GLU J  2 13 ? 19.392  1.295   -3.690  1.00 33.05 ? 13  GLU J CG  1 
ATOM   1839 C  CD  . GLU J  2 13 ? 19.184  0.698   -2.315  1.00 35.84 ? 13  GLU J CD  1 
ATOM   1840 O  OE1 . GLU J  2 13 ? 18.050  0.469   -1.885  1.00 37.38 ? 13  GLU J OE1 1 
ATOM   1841 O  OE2 . GLU J  2 13 ? 20.293  0.518   -1.704  1.00 38.29 ? 13  GLU J OE2 1 
ATOM   1842 N  N   . ALA J  2 14 ? 20.763  2.708   -6.427  1.00 19.19 ? 14  ALA J N   1 
ATOM   1843 C  CA  . ALA J  2 14 ? 22.010  3.424   -6.725  1.00 18.42 ? 14  ALA J CA  1 
ATOM   1844 C  C   . ALA J  2 14 ? 21.876  4.133   -8.050  1.00 18.49 ? 14  ALA J C   1 
ATOM   1845 O  O   . ALA J  2 14 ? 22.260  5.329   -8.089  1.00 19.55 ? 14  ALA J O   1 
ATOM   1846 C  CB  . ALA J  2 14 ? 23.247  2.512   -6.718  1.00 18.63 ? 14  ALA J CB  1 
ATOM   1847 N  N   . LEU J  2 15 ? 21.295  3.547   -9.064  1.00 14.96 ? 15  LEU J N   1 
ATOM   1848 C  CA  . LEU J  2 15 ? 21.078  4.116   -10.361 1.00 18.77 ? 15  LEU J CA  1 
ATOM   1849 C  C   . LEU J  2 15 ? 20.043  5.304   -10.304 1.00 18.82 ? 15  LEU J C   1 
ATOM   1850 O  O   . LEU J  2 15 ? 20.204  6.240   -11.046 1.00 18.22 ? 15  LEU J O   1 
ATOM   1851 C  CB  . LEU J  2 15 ? 20.660  3.065   -11.406 1.00 19.52 ? 15  LEU J CB  1 
ATOM   1852 C  CG  . LEU J  2 15 ? 21.658  2.045   -11.935 1.00 20.86 ? 15  LEU J CG  1 
ATOM   1853 C  CD1 . LEU J  2 15 ? 21.010  1.246   -13.054 1.00 22.19 ? 15  LEU J CD1 1 
ATOM   1854 C  CD2 . LEU J  2 15 ? 22.785  2.808   -12.618 1.00 17.31 ? 15  LEU J CD2 1 
ATOM   1855 N  N   . TYR J  2 16 ? 19.031  5.156   -9.496  1.00 19.56 ? 16  TYR J N   1 
ATOM   1856 C  CA  . TYR J  2 16 ? 17.998  6.180   -9.293  1.00 20.89 ? 16  TYR J CA  1 
ATOM   1857 C  C   . TYR J  2 16 ? 18.697  7.411   -8.679  1.00 22.76 ? 16  TYR J C   1 
ATOM   1858 O  O   . TYR J  2 16 ? 18.432  8.528   -9.181  1.00 23.62 ? 16  TYR J O   1 
ATOM   1859 C  CB  . TYR J  2 16 ? 16.959  5.635   -8.332  1.00 19.54 ? 16  TYR J CB  1 
ATOM   1860 C  CG  . TYR J  2 16 ? 15.917  6.704   -8.013  1.00 19.49 ? 16  TYR J CG  1 
ATOM   1861 C  CD1 . TYR J  2 16 ? 14.958  6.996   -8.979  1.00 20.32 ? 16  TYR J CD1 1 
ATOM   1862 C  CD2 . TYR J  2 16 ? 15.941  7.392   -6.822  1.00 21.08 ? 16  TYR J CD2 1 
ATOM   1863 C  CE1 . TYR J  2 16 ? 14.007  7.973   -8.723  1.00 21.11 ? 16  TYR J CE1 1 
ATOM   1864 C  CE2 . TYR J  2 16 ? 14.995  8.380   -6.525  1.00 21.44 ? 16  TYR J CE2 1 
ATOM   1865 C  CZ  . TYR J  2 16 ? 14.044  8.648   -7.512  1.00 22.19 ? 16  TYR J CZ  1 
ATOM   1866 O  OH  . TYR J  2 16 ? 13.096  9.595   -7.212  1.00 24.26 ? 16  TYR J OH  1 
ATOM   1867 N  N   . LEU J  2 17 ? 19.561  7.251   -7.679  1.00 24.18 ? 17  LEU J N   1 
ATOM   1868 C  CA  . LEU J  2 17 ? 20.267  8.410   -7.065  1.00 24.80 ? 17  LEU J CA  1 
ATOM   1869 C  C   . LEU J  2 17 ? 21.240  9.019   -8.077  1.00 25.98 ? 17  LEU J C   1 
ATOM   1870 O  O   . LEU J  2 17 ? 21.270  10.238  -8.298  1.00 25.21 ? 17  LEU J O   1 
ATOM   1871 C  CB  . LEU J  2 17 ? 21.066  8.060   -5.820  1.00 25.83 ? 17  LEU J CB  1 
ATOM   1872 C  CG  . LEU J  2 17 ? 20.220  7.676   -4.639  1.00 29.48 ? 17  LEU J CG  1 
ATOM   1873 C  CD1 . LEU J  2 17 ? 21.015  7.357   -3.356  1.00 32.44 ? 17  LEU J CD1 1 
ATOM   1874 C  CD2 . LEU J  2 17 ? 19.231  8.810   -4.301  1.00 32.75 ? 17  LEU J CD2 1 
ATOM   1875 N  N   . VAL J  2 18 ? 22.077  8.188   -8.660  1.00 22.97 ? 18  VAL J N   1 
ATOM   1876 C  CA  . VAL J  2 18 ? 23.053  8.662   -9.620  1.00 25.10 ? 18  VAL J CA  1 
ATOM   1877 C  C   . VAL J  2 18 ? 22.524  9.374   -10.854 1.00 25.62 ? 18  VAL J C   1 
ATOM   1878 O  O   . VAL J  2 18 ? 23.132  10.416  -11.238 1.00 26.44 ? 18  VAL J O   1 
ATOM   1879 C  CB  . VAL J  2 18 ? 24.020  7.523   -10.071 1.00 24.01 ? 18  VAL J CB  1 
ATOM   1880 C  CG1 . VAL J  2 18 ? 24.854  7.846   -11.295 1.00 25.65 ? 18  VAL J CG1 1 
ATOM   1881 C  CG2 . VAL J  2 18 ? 24.926  7.147   -8.901  1.00 26.47 ? 18  VAL J CG2 1 
ATOM   1882 N  N   . CYS J  2 19 ? 21.550  8.805   -11.526 1.00 24.91 ? 19  CYS J N   1 
ATOM   1883 C  CA  . CYS J  2 19 ? 21.076  9.310   -12.791 1.00 24.38 ? 19  CYS J CA  1 
ATOM   1884 C  C   . CYS J  2 19 ? 20.110  10.510  -12.706 1.00 25.45 ? 19  CYS J C   1 
ATOM   1885 O  O   . CYS J  2 19 ? 19.987  11.171  -13.737 1.00 25.18 ? 19  CYS J O   1 
ATOM   1886 C  CB  . CYS J  2 19 ? 20.512  8.175   -13.639 1.00 24.13 ? 19  CYS J CB  1 
ATOM   1887 S  SG  . CYS J  2 19 ? 21.647  6.749   -13.917 1.00 23.68 ? 19  CYS J SG  1 
ATOM   1888 N  N   . GLY J  2 20 ? 19.436  10.669  -11.629 1.00 26.24 ? 20  GLY J N   1 
ATOM   1889 C  CA  . GLY J  2 20 ? 18.448  11.708  -11.383 1.00 29.38 ? 20  GLY J CA  1 
ATOM   1890 C  C   . GLY J  2 20 ? 17.402  11.741  -12.491 1.00 31.14 ? 20  GLY J C   1 
ATOM   1891 O  O   . GLY J  2 20 ? 16.770  10.772  -12.935 1.00 30.49 ? 20  GLY J O   1 
ATOM   1892 N  N   . GLU J  2 21 ? 17.193  12.958  -13.011 1.00 34.55 ? 21  GLU J N   1 
ATOM   1893 C  CA  . GLU J  2 21 ? 16.199  13.285  -14.032 1.00 37.39 ? 21  GLU J CA  1 
ATOM   1894 C  C   . GLU J  2 21 ? 16.308  12.560  -15.349 1.00 36.31 ? 21  GLU J C   1 
ATOM   1895 O  O   . GLU J  2 21 ? 15.300  12.354  -16.049 1.00 37.80 ? 21  GLU J O   1 
ATOM   1896 C  CB  . GLU J  2 21 ? 16.151  14.780  -14.362 1.00 41.09 ? 21  GLU J CB  1 
ATOM   1897 C  CG  . GLU J  2 21 ? 17.253  15.225  -15.311 1.00 46.33 ? 21  GLU J CG  1 
ATOM   1898 C  CD  . GLU J  2 21 ? 18.571  15.644  -14.708 1.00 49.57 ? 21  GLU J CD  1 
ATOM   1899 O  OE1 . GLU J  2 21 ? 18.895  15.348  -13.549 1.00 51.94 ? 21  GLU J OE1 1 
ATOM   1900 O  OE2 . GLU J  2 21 ? 19.262  16.326  -15.515 1.00 51.11 ? 21  GLU J OE2 1 
ATOM   1901 N  N   . ARG J  2 22 ? 17.524  12.186  -15.684 1.00 35.81 ? 22  ARG J N   1 
ATOM   1902 C  CA  . ARG J  2 22 ? 17.882  11.423  -16.873 1.00 33.88 ? 22  ARG J CA  1 
ATOM   1903 C  C   . ARG J  2 22 ? 17.200  10.061  -16.764 1.00 33.00 ? 22  ARG J C   1 
ATOM   1904 O  O   . ARG J  2 22 ? 16.809  9.605   -17.835 1.00 35.14 ? 22  ARG J O   1 
ATOM   1905 C  CB  . ARG J  2 22 ? 19.391  11.138  -17.009 1.00 34.27 ? 22  ARG J CB  1 
ATOM   1906 C  CG  A ARG J  2 22 ? 20.338  12.187  -16.451 0.50 34.15 ? 22  ARG J CG  1 
ATOM   1907 C  CG  B ARG J  2 22 ? 20.240  12.336  -17.423 0.50 33.77 ? 22  ARG J CG  1 
ATOM   1908 C  CD  A ARG J  2 22 ? 21.765  11.795  -16.296 0.50 34.30 ? 22  ARG J CD  1 
ATOM   1909 C  CD  B ARG J  2 22 ? 21.687  12.004  -17.298 0.50 33.37 ? 22  ARG J CD  1 
ATOM   1910 N  NE  A ARG J  2 22 ? 22.373  11.148  -17.420 0.50 33.93 ? 22  ARG J NE  1 
ATOM   1911 N  NE  B ARG J  2 22 ? 22.163  11.961  -15.928 0.50 33.20 ? 22  ARG J NE  1 
ATOM   1912 C  CZ  A ARG J  2 22 ? 23.587  10.668  -17.654 0.50 33.73 ? 22  ARG J CZ  1 
ATOM   1913 C  CZ  B ARG J  2 22 ? 23.439  11.762  -15.620 0.50 32.51 ? 22  ARG J CZ  1 
ATOM   1914 N  NH1 A ARG J  2 22 ? 24.556  10.722  -16.753 0.50 33.73 ? 22  ARG J NH1 1 
ATOM   1915 N  NH1 B ARG J  2 22 ? 24.290  11.586  -16.630 0.50 33.06 ? 22  ARG J NH1 1 
ATOM   1916 N  NH2 A ARG J  2 22 ? 23.863  10.103  -18.840 0.50 33.16 ? 22  ARG J NH2 1 
ATOM   1917 N  NH2 B ARG J  2 22 ? 23.846  11.786  -14.364 0.50 32.30 ? 22  ARG J NH2 1 
ATOM   1918 N  N   . GLY J  2 23 ? 17.076  9.424   -15.613 1.00 31.10 ? 23  GLY J N   1 
ATOM   1919 C  CA  . GLY J  2 23 ? 16.472  8.042   -15.609 1.00 29.52 ? 23  GLY J CA  1 
ATOM   1920 C  C   . GLY J  2 23 ? 17.603  7.093   -16.044 1.00 28.36 ? 23  GLY J C   1 
ATOM   1921 O  O   . GLY J  2 23 ? 18.758  7.474   -16.281 1.00 26.88 ? 23  GLY J O   1 
ATOM   1922 N  N   . PHE J  2 24 ? 17.244  5.822   -16.180 1.00 28.06 ? 24  PHE J N   1 
ATOM   1923 C  CA  . PHE J  2 24 ? 18.216  4.759   -16.545 1.00 26.64 ? 24  PHE J CA  1 
ATOM   1924 C  C   . PHE J  2 24 ? 17.547  3.533   -17.097 1.00 26.77 ? 24  PHE J C   1 
ATOM   1925 O  O   . PHE J  2 24 ? 16.291  3.465   -17.063 1.00 26.04 ? 24  PHE J O   1 
ATOM   1926 C  CB  . PHE J  2 24 ? 18.920  4.329   -15.224 1.00 25.02 ? 24  PHE J CB  1 
ATOM   1927 C  CG  . PHE J  2 24 ? 18.031  3.852   -14.108 1.00 23.90 ? 24  PHE J CG  1 
ATOM   1928 C  CD1 . PHE J  2 24 ? 17.476  4.731   -13.183 1.00 22.81 ? 24  PHE J CD1 1 
ATOM   1929 C  CD2 . PHE J  2 24 ? 17.743  2.495   -13.974 1.00 23.54 ? 24  PHE J CD2 1 
ATOM   1930 C  CE1 . PHE J  2 24 ? 16.678  4.304   -12.148 1.00 22.80 ? 24  PHE J CE1 1 
ATOM   1931 C  CE2 . PHE J  2 24 ? 16.966  2.042   -12.905 1.00 22.60 ? 24  PHE J CE2 1 
ATOM   1932 C  CZ  . PHE J  2 24 ? 16.405  2.926   -11.999 1.00 24.17 ? 24  PHE J CZ  1 
ATOM   1933 N  N   . PHE J  2 25 ? 18.348  2.576   -17.555 1.00 26.97 ? 25  PHE J N   1 
ATOM   1934 C  CA  . PHE J  2 25 ? 17.728  1.308   -18.038 1.00 27.84 ? 25  PHE J CA  1 
ATOM   1935 C  C   . PHE J  2 25 ? 18.380  0.231   -17.163 1.00 28.32 ? 25  PHE J C   1 
ATOM   1936 O  O   . PHE J  2 25 ? 19.558  0.297   -16.740 1.00 27.65 ? 25  PHE J O   1 
ATOM   1937 C  CB  . PHE J  2 25 ? 17.850  1.048   -19.530 1.00 29.27 ? 25  PHE J CB  1 
ATOM   1938 C  CG  . PHE J  2 25 ? 19.277  1.277   -19.890 1.00 31.23 ? 25  PHE J CG  1 
ATOM   1939 C  CD1 . PHE J  2 25 ? 19.745  2.607   -19.961 1.00 31.37 ? 25  PHE J CD1 1 
ATOM   1940 C  CD2 . PHE J  2 25 ? 20.136  0.190   -20.094 1.00 32.00 ? 25  PHE J CD2 1 
ATOM   1941 C  CE1 . PHE J  2 25 ? 21.063  2.893   -20.252 1.00 32.08 ? 25  PHE J CE1 1 
ATOM   1942 C  CE2 . PHE J  2 25 ? 21.478  0.478   -20.417 1.00 32.50 ? 25  PHE J CE2 1 
ATOM   1943 C  CZ  . PHE J  2 25 ? 21.930  1.802   -20.485 1.00 31.61 ? 25  PHE J CZ  1 
ATOM   1944 N  N   . TYR J  2 26 ? 17.521  -0.731  -16.887 1.00 29.09 ? 26  TYR J N   1 
ATOM   1945 C  CA  . TYR J  2 26 ? 17.892  -1.887  -16.073 1.00 30.89 ? 26  TYR J CA  1 
ATOM   1946 C  C   . TYR J  2 26 ? 17.525  -3.144  -16.863 1.00 31.50 ? 26  TYR J C   1 
ATOM   1947 O  O   . TYR J  2 26 ? 16.354  -3.460  -16.974 1.00 30.55 ? 26  TYR J O   1 
ATOM   1948 C  CB  . TYR J  2 26 ? 17.264  -1.945  -14.656 1.00 30.01 ? 26  TYR J CB  1 
ATOM   1949 C  CG  . TYR J  2 26 ? 17.848  -3.119  -13.849 1.00 30.20 ? 26  TYR J CG  1 
ATOM   1950 C  CD1 . TYR J  2 26 ? 19.100  -2.984  -13.233 1.00 29.71 ? 26  TYR J CD1 1 
ATOM   1951 C  CD2 . TYR J  2 26 ? 17.182  -4.343  -13.723 1.00 29.22 ? 26  TYR J CD2 1 
ATOM   1952 C  CE1 . TYR J  2 26 ? 19.663  -4.025  -12.495 1.00 30.11 ? 26  TYR J CE1 1 
ATOM   1953 C  CE2 . TYR J  2 26 ? 17.739  -5.401  -13.002 1.00 30.38 ? 26  TYR J CE2 1 
ATOM   1954 C  CZ  . TYR J  2 26 ? 18.960  -5.242  -12.392 1.00 30.19 ? 26  TYR J CZ  1 
ATOM   1955 O  OH  . TYR J  2 26 ? 19.523  -6.267  -11.684 1.00 32.15 ? 26  TYR J OH  1 
ATOM   1956 N  N   . THR J  2 27 ? 18.488  -3.848  -17.318 1.00 34.65 ? 27  THR J N   1 
ATOM   1957 C  CA  . THR J  2 27 ? 18.435  -5.106  -18.073 1.00 39.08 ? 27  THR J CA  1 
ATOM   1958 C  C   . THR J  2 27 ? 19.314  -6.153  -17.361 1.00 41.11 ? 27  THR J C   1 
ATOM   1959 O  O   . THR J  2 27 ? 20.544  -6.044  -17.478 1.00 40.96 ? 27  THR J O   1 
ATOM   1960 C  CB  . THR J  2 27 ? 19.142  -4.986  -19.466 1.00 39.94 ? 27  THR J CB  1 
ATOM   1961 O  OG1 . THR J  2 27 ? 18.359  -3.955  -20.141 1.00 41.66 ? 27  THR J OG1 1 
ATOM   1962 C  CG2 . THR J  2 27 ? 19.243  -6.355  -20.120 1.00 41.47 ? 27  THR J CG2 1 
ATOM   1963 N  N   . PRO J  2 28 ? 18.651  -7.055  -16.689 1.00 43.48 ? 28  PRO J N   1 
ATOM   1964 C  CA  . PRO J  2 28 ? 19.280  -8.095  -15.912 1.00 45.67 ? 28  PRO J CA  1 
ATOM   1965 C  C   . PRO J  2 28 ? 20.048  -9.144  -16.687 1.00 48.90 ? 28  PRO J C   1 
ATOM   1966 O  O   . PRO J  2 28 ? 20.697  -9.992  -16.012 1.00 48.74 ? 28  PRO J O   1 
ATOM   1967 C  CB  . PRO J  2 28 ? 18.112  -8.574  -15.045 1.00 45.66 ? 28  PRO J CB  1 
ATOM   1968 C  CG  . PRO J  2 28 ? 16.928  -8.468  -15.977 1.00 44.32 ? 28  PRO J CG  1 
ATOM   1969 C  CD  . PRO J  2 28 ? 17.176  -7.129  -16.621 1.00 44.29 ? 28  PRO J CD  1 
ATOM   1970 N  N   . LYS J  2 29 ? 20.035  -9.064  -18.003 1.00 51.26 ? 29  LYS J N   1 
ATOM   1971 C  CA  . LYS J  2 29 ? 20.800  -9.958  -18.870 1.00 54.74 ? 29  LYS J CA  1 
ATOM   1972 C  C   . LYS J  2 29 ? 22.173  -9.344  -19.212 1.00 56.97 ? 29  LYS J C   1 
ATOM   1973 O  O   . LYS J  2 29 ? 23.260  -9.861  -18.835 1.00 58.92 ? 29  LYS J O   1 
ATOM   1974 C  CB  . LYS J  2 29 ? 20.136  -10.284 -20.197 1.00 54.94 ? 29  LYS J CB  1 
ATOM   1975 N  N   . THR J  2 30 ? 22.146  -8.253  -19.971 1.00 58.33 ? 30  THR J N   1 
ATOM   1976 C  CA  . THR J  2 30 ? 23.340  -7.508  -20.425 1.00 58.45 ? 30  THR J CA  1 
ATOM   1977 N  N   . GLY K  1 1  ? 3.701   10.752  -17.170 1.00 42.18 ? 1   GLY K N   1 
ATOM   1978 C  CA  . GLY K  1 1  ? 4.699   9.665   -16.999 1.00 41.05 ? 1   GLY K CA  1 
ATOM   1979 C  C   . GLY K  1 1  ? 4.333   8.869   -15.752 1.00 39.49 ? 1   GLY K C   1 
ATOM   1980 O  O   . GLY K  1 1  ? 3.302   9.086   -15.108 1.00 39.82 ? 1   GLY K O   1 
ATOM   1981 N  N   . ILE K  1 2  ? 5.257   7.983   -15.377 1.00 38.16 ? 2   ILE K N   1 
ATOM   1982 C  CA  . ILE K  1 2  ? 5.034   7.129   -14.202 1.00 35.19 ? 2   ILE K CA  1 
ATOM   1983 C  C   . ILE K  1 2  ? 4.799   7.878   -12.924 1.00 32.76 ? 2   ILE K C   1 
ATOM   1984 O  O   . ILE K  1 2  ? 3.951   7.447   -12.142 1.00 31.15 ? 2   ILE K O   1 
ATOM   1985 C  CB  . ILE K  1 2  ? 6.287   6.127   -14.044 1.00 35.58 ? 2   ILE K CB  1 
ATOM   1986 C  CG1 . ILE K  1 2  ? 5.773   5.041   -13.053 1.00 35.24 ? 2   ILE K CG1 1 
ATOM   1987 C  CG2 . ILE K  1 2  ? 7.617   6.799   -13.621 1.00 34.32 ? 2   ILE K CG2 1 
ATOM   1988 C  CD1 . ILE K  1 2  ? 6.599   3.701   -13.135 1.00 35.48 ? 2   ILE K CD1 1 
ATOM   1989 N  N   . VAL K  1 3  ? 5.605   8.918   -12.730 1.00 32.15 ? 3   VAL K N   1 
ATOM   1990 C  CA  . VAL K  1 3  ? 5.601   9.750   -11.524 1.00 32.85 ? 3   VAL K CA  1 
ATOM   1991 C  C   . VAL K  1 3  ? 4.238   10.425  -11.386 1.00 32.99 ? 3   VAL K C   1 
ATOM   1992 O  O   . VAL K  1 3  ? 3.709   10.452  -10.287 1.00 30.52 ? 3   VAL K O   1 
ATOM   1993 C  CB  . VAL K  1 3  ? 6.766   10.751  -11.386 1.00 33.08 ? 3   VAL K CB  1 
ATOM   1994 C  CG1 . VAL K  1 3  ? 6.595   11.717  -10.203 1.00 33.05 ? 3   VAL K CG1 1 
ATOM   1995 C  CG2 . VAL K  1 3  ? 8.135   10.088  -11.247 1.00 33.65 ? 3   VAL K CG2 1 
ATOM   1996 N  N   . GLU K  1 4  ? 3.785   10.885  -12.528 1.00 35.82 ? 4   GLU K N   1 
ATOM   1997 C  CA  . GLU K  1 4  ? 2.467   11.546  -12.586 1.00 39.19 ? 4   GLU K CA  1 
ATOM   1998 C  C   . GLU K  1 4  ? 1.388   10.543  -12.245 1.00 39.80 ? 4   GLU K C   1 
ATOM   1999 O  O   . GLU K  1 4  ? 0.493   10.942  -11.473 1.00 41.39 ? 4   GLU K O   1 
ATOM   2000 C  CB  . GLU K  1 4  ? 2.200   12.252  -13.909 1.00 40.71 ? 4   GLU K CB  1 
ATOM   2001 C  CG  . GLU K  1 4  ? 3.137   13.462  -14.078 1.00 41.72 ? 4   GLU K CG  1 
ATOM   2002 C  CD  . GLU K  1 4  ? 4.445   12.967  -14.641 1.00 44.02 ? 4   GLU K CD  1 
ATOM   2003 O  OE1 . GLU K  1 4  ? 4.494   12.163  -15.564 1.00 45.39 ? 4   GLU K OE1 1 
ATOM   2004 O  OE2 . GLU K  1 4  ? 5.416   13.512  -14.061 1.00 44.95 ? 4   GLU K OE2 1 
ATOM   2005 N  N   . GLN K  1 5  ? 1.486   9.313   -12.726 1.00 39.61 ? 5   GLN K N   1 
ATOM   2006 C  CA  . GLN K  1 5  ? 0.400   8.407   -12.290 1.00 39.49 ? 5   GLN K CA  1 
ATOM   2007 C  C   . GLN K  1 5  ? 0.609   7.682   -10.970 1.00 38.28 ? 5   GLN K C   1 
ATOM   2008 O  O   . GLN K  1 5  ? -0.433  7.375   -10.365 1.00 39.11 ? 5   GLN K O   1 
ATOM   2009 C  CB  . GLN K  1 5  ? 0.163   7.190   -13.196 1.00 41.57 ? 5   GLN K CB  1 
ATOM   2010 C  CG  . GLN K  1 5  ? 0.583   7.382   -14.622 1.00 45.69 ? 5   GLN K CG  1 
ATOM   2011 C  CD  . GLN K  1 5  ? -0.553  7.932   -15.465 1.00 48.15 ? 5   GLN K CD  1 
ATOM   2012 O  OE1 . GLN K  1 5  ? -0.295  8.434   -16.565 1.00 50.53 ? 5   GLN K OE1 1 
ATOM   2013 N  NE2 . GLN K  1 5  ? -1.773  7.821   -14.920 1.00 49.40 ? 5   GLN K NE2 1 
ATOM   2014 N  N   . CYS K  1 6  ? 1.828   7.385   -10.574 1.00 35.60 ? 6   CYS K N   1 
ATOM   2015 C  CA  . CYS K  1 6  ? 2.024   6.548   -9.379  1.00 33.96 ? 6   CYS K CA  1 
ATOM   2016 C  C   . CYS K  1 6  ? 2.451   7.245   -8.126  1.00 32.84 ? 6   CYS K C   1 
ATOM   2017 O  O   . CYS K  1 6  ? 2.540   6.613   -7.056  1.00 30.71 ? 6   CYS K O   1 
ATOM   2018 C  CB  . CYS K  1 6  ? 2.839   5.367   -9.933  1.00 34.57 ? 6   CYS K CB  1 
ATOM   2019 S  SG  . CYS K  1 6  ? 2.148   4.378   -11.336 1.00 34.92 ? 6   CYS K SG  1 
ATOM   2020 N  N   . CYS K  1 7  ? 2.613   8.573   -8.211  1.00 31.09 ? 7   CYS K N   1 
ATOM   2021 C  CA  . CYS K  1 7  ? 2.995   9.335   -7.013  1.00 31.34 ? 7   CYS K CA  1 
ATOM   2022 C  C   . CYS K  1 7  ? 1.898   10.111  -6.325  1.00 33.97 ? 7   CYS K C   1 
ATOM   2023 O  O   . CYS K  1 7  ? 2.158   10.829  -5.341  1.00 33.82 ? 7   CYS K O   1 
ATOM   2024 C  CB  . CYS K  1 7  ? 4.275   10.148  -7.284  1.00 30.20 ? 7   CYS K CB  1 
ATOM   2025 S  SG  . CYS K  1 7  ? 5.681   8.951   -7.554  1.00 28.19 ? 7   CYS K SG  1 
ATOM   2026 N  N   . THR K  1 8  ? 0.650   9.948   -6.761  1.00 37.06 ? 8   THR K N   1 
ATOM   2027 C  CA  . THR K  1 8  ? -0.536  10.585  -6.099  1.00 39.38 ? 8   THR K CA  1 
ATOM   2028 C  C   . THR K  1 8  ? -1.495  9.499   -5.561  1.00 39.31 ? 8   THR K C   1 
ATOM   2029 O  O   . THR K  1 8  ? -1.964  9.494   -4.375  1.00 40.12 ? 8   THR K O   1 
ATOM   2030 C  CB  . THR K  1 8  ? -1.273  11.605  -7.028  1.00 39.91 ? 8   THR K CB  1 
ATOM   2031 O  OG1 A THR K  1 8  ? -0.977  11.284  -8.437  0.67 41.25 ? 8   THR K OG1 1 
ATOM   2032 O  OG1 B THR K  1 8  ? -2.675  11.233  -6.796  0.33 39.45 ? 8   THR K OG1 1 
ATOM   2033 C  CG2 A THR K  1 8  ? -0.828  13.033  -6.621  0.67 40.12 ? 8   THR K CG2 1 
ATOM   2034 C  CG2 B THR K  1 8  ? -0.897  11.525  -8.516  0.33 40.10 ? 8   THR K CG2 1 
ATOM   2035 N  N   . SER K  1 9  ? -1.762  8.563   -6.496  1.00 37.78 ? 9   SER K N   1 
ATOM   2036 C  CA  . SER K  1 9  ? -2.577  7.446   -6.016  1.00 37.63 ? 9   SER K CA  1 
ATOM   2037 C  C   . SER K  1 9  ? -1.699  6.210   -6.280  1.00 35.61 ? 9   SER K C   1 
ATOM   2038 O  O   . SER K  1 9  ? -0.952  6.161   -7.219  1.00 35.27 ? 9   SER K O   1 
ATOM   2039 C  CB  . SER K  1 9  ? -4.020  7.212   -6.374  1.00 39.02 ? 9   SER K CB  1 
ATOM   2040 O  OG  A SER K  1 9  ? -4.565  6.519   -5.205  0.50 39.59 ? 9   SER K OG  1 
ATOM   2041 O  OG  B SER K  1 9  ? -4.376  7.592   -7.681  0.50 37.26 ? 9   SER K OG  1 
ATOM   2042 N  N   . ILE K  1 10 ? -1.839  5.294   -5.376  1.00 34.63 ? 10  ILE K N   1 
ATOM   2043 C  CA  . ILE K  1 10 ? -1.114  4.036   -5.418  1.00 34.36 ? 10  ILE K CA  1 
ATOM   2044 C  C   . ILE K  1 10 ? -1.291  3.298   -6.708  1.00 35.63 ? 10  ILE K C   1 
ATOM   2045 O  O   . ILE K  1 10 ? -2.481  3.115   -7.085  1.00 36.86 ? 10  ILE K O   1 
ATOM   2046 C  CB  . ILE K  1 10 ? -1.715  3.235   -4.197  1.00 33.85 ? 10  ILE K CB  1 
ATOM   2047 C  CG1 . ILE K  1 10 ? -1.344  4.025   -2.931  1.00 31.86 ? 10  ILE K CG1 1 
ATOM   2048 C  CG2 . ILE K  1 10 ? -1.236  1.746   -4.149  1.00 34.71 ? 10  ILE K CG2 1 
ATOM   2049 C  CD1 . ILE K  1 10 ? -1.996  3.498   -1.620  1.00 32.44 ? 10  ILE K CD1 1 
ATOM   2050 N  N   . CYS K  1 11 ? -0.238  2.877   -7.399  1.00 35.81 ? 11  CYS K N   1 
ATOM   2051 C  CA  . CYS K  1 11 ? -0.389  2.087   -8.609  1.00 35.61 ? 11  CYS K CA  1 
ATOM   2052 C  C   . CYS K  1 11 ? -0.236  0.626   -8.131  1.00 37.07 ? 11  CYS K C   1 
ATOM   2053 O  O   . CYS K  1 11 ? 0.577   0.347   -7.252  1.00 36.49 ? 11  CYS K O   1 
ATOM   2054 C  CB  . CYS K  1 11 ? 0.650   2.351   -9.648  1.00 36.72 ? 11  CYS K CB  1 
ATOM   2055 S  SG  . CYS K  1 11 ? 0.368   3.890   -10.493 1.00 36.11 ? 11  CYS K SG  1 
ATOM   2056 N  N   . SER K  1 12 ? -1.036  -0.273  -8.667  1.00 39.09 ? 12  SER K N   1 
ATOM   2057 C  CA  . SER K  1 12 ? -0.975  -1.689  -8.333  1.00 40.62 ? 12  SER K CA  1 
ATOM   2058 C  C   . SER K  1 12 ? 0.117   -2.292  -9.245  1.00 41.28 ? 12  SER K C   1 
ATOM   2059 O  O   . SER K  1 12 ? 0.573   -1.693  -10.235 1.00 40.61 ? 12  SER K O   1 
ATOM   2060 C  CB  . SER K  1 12 ? -2.266  -2.433  -8.662  1.00 41.31 ? 12  SER K CB  1 
ATOM   2061 O  OG  . SER K  1 12 ? -2.347  -2.184  -10.078 1.00 43.18 ? 12  SER K OG  1 
ATOM   2062 N  N   . LEU K  1 13 ? 0.488   -3.486  -8.785  1.00 43.38 ? 13  LEU K N   1 
ATOM   2063 C  CA  . LEU K  1 13 ? 1.502   -4.280  -9.470  1.00 45.45 ? 13  LEU K CA  1 
ATOM   2064 C  C   . LEU K  1 13 ? 1.057   -4.497  -10.912 1.00 46.03 ? 13  LEU K C   1 
ATOM   2065 O  O   . LEU K  1 13 ? 1.971   -4.612  -11.740 1.00 45.67 ? 13  LEU K O   1 
ATOM   2066 C  CB  . LEU K  1 13 ? 1.828   -5.572  -8.721  1.00 46.65 ? 13  LEU K CB  1 
ATOM   2067 C  CG  . LEU K  1 13 ? 2.473   -5.510  -7.362  1.00 48.04 ? 13  LEU K CG  1 
ATOM   2068 C  CD1 . LEU K  1 13 ? 2.783   -6.908  -6.797  1.00 47.97 ? 13  LEU K CD1 1 
ATOM   2069 C  CD2 . LEU K  1 13 ? 3.779   -4.706  -7.366  1.00 48.92 ? 13  LEU K CD2 1 
ATOM   2070 N  N   . TYR K  1 14 ? -0.242  -4.497  -11.186 1.00 47.96 ? 14  TYR K N   1 
ATOM   2071 C  CA  . TYR K  1 14 ? -0.649  -4.709  -12.602 1.00 49.68 ? 14  TYR K CA  1 
ATOM   2072 C  C   . TYR K  1 14 ? -0.355  -3.514  -13.491 1.00 48.37 ? 14  TYR K C   1 
ATOM   2073 O  O   . TYR K  1 14 ? 0.027   -3.700  -14.666 1.00 48.17 ? 14  TYR K O   1 
ATOM   2074 C  CB  . TYR K  1 14 ? -2.123  -5.157  -12.692 1.00 53.81 ? 14  TYR K CB  1 
ATOM   2075 C  CG  . TYR K  1 14 ? -2.548  -5.858  -11.417 1.00 57.24 ? 14  TYR K CG  1 
ATOM   2076 C  CD1 . TYR K  1 14 ? -2.289  -7.209  -11.188 1.00 59.04 ? 14  TYR K CD1 1 
ATOM   2077 C  CD2 . TYR K  1 14 ? -3.216  -5.120  -10.424 1.00 58.69 ? 14  TYR K CD2 1 
ATOM   2078 C  CE1 . TYR K  1 14 ? -2.687  -7.814  -9.982  1.00 60.36 ? 14  TYR K CE1 1 
ATOM   2079 C  CE2 . TYR K  1 14 ? -3.620  -5.701  -9.232  1.00 59.67 ? 14  TYR K CE2 1 
ATOM   2080 C  CZ  . TYR K  1 14 ? -3.351  -7.052  -9.015  1.00 60.71 ? 14  TYR K CZ  1 
ATOM   2081 O  OH  . TYR K  1 14 ? -3.742  -7.655  -7.839  1.00 61.43 ? 14  TYR K OH  1 
ATOM   2082 N  N   . GLN K  1 15 ? -0.566  -2.332  -12.926 1.00 46.64 ? 15  GLN K N   1 
ATOM   2083 C  CA  . GLN K  1 15 ? -0.336  -1.048  -13.598 1.00 45.28 ? 15  GLN K CA  1 
ATOM   2084 C  C   . GLN K  1 15 ? 1.171   -0.803  -13.753 1.00 44.99 ? 15  GLN K C   1 
ATOM   2085 O  O   . GLN K  1 15 ? 1.567   -0.260  -14.805 1.00 44.64 ? 15  GLN K O   1 
ATOM   2086 C  CB  . GLN K  1 15 ? -0.897  0.145   -12.820 1.00 45.16 ? 15  GLN K CB  1 
ATOM   2087 C  CG  . GLN K  1 15 ? -2.190  -0.141  -12.094 1.00 46.55 ? 15  GLN K CG  1 
ATOM   2088 C  CD  . GLN K  1 15 ? -2.895  1.005   -11.405 1.00 46.21 ? 15  GLN K CD  1 
ATOM   2089 O  OE1 . GLN K  1 15 ? -3.257  0.967   -10.214 1.00 45.00 ? 15  GLN K OE1 1 
ATOM   2090 N  NE2 . GLN K  1 15 ? -3.096  2.068   -12.195 1.00 47.29 ? 15  GLN K NE2 1 
ATOM   2091 N  N   . LEU K  1 16 ? 1.930   -1.173  -12.699 1.00 43.31 ? 16  LEU K N   1 
ATOM   2092 C  CA  . LEU K  1 16 ? 3.411   -0.963  -12.786 1.00 42.45 ? 16  LEU K CA  1 
ATOM   2093 C  C   . LEU K  1 16 ? 3.998   -1.759  -13.941 1.00 41.78 ? 16  LEU K C   1 
ATOM   2094 O  O   . LEU K  1 16 ? 4.856   -1.391  -14.741 1.00 40.17 ? 16  LEU K O   1 
ATOM   2095 C  CB  . LEU K  1 16 ? 4.028   -1.180  -11.404 1.00 41.82 ? 16  LEU K CB  1 
ATOM   2096 C  CG  . LEU K  1 16 ? 3.753   -0.195  -10.278 1.00 41.28 ? 16  LEU K CG  1 
ATOM   2097 C  CD1 . LEU K  1 16 ? 4.378   -0.657  -8.965  1.00 40.93 ? 16  LEU K CD1 1 
ATOM   2098 C  CD2 . LEU K  1 16 ? 4.314   1.196   -10.592 1.00 40.50 ? 16  LEU K CD2 1 
ATOM   2099 N  N   . GLU K  1 17 ? 3.441   -2.941  -14.123 1.00 44.12 ? 17  GLU K N   1 
ATOM   2100 C  CA  . GLU K  1 17 ? 3.813   -3.900  -15.167 1.00 45.38 ? 17  GLU K CA  1 
ATOM   2101 C  C   . GLU K  1 17 ? 3.747   -3.368  -16.573 1.00 44.91 ? 17  GLU K C   1 
ATOM   2102 O  O   . GLU K  1 17 ? 4.484   -3.872  -17.444 1.00 45.02 ? 17  GLU K O   1 
ATOM   2103 C  CB  . GLU K  1 17 ? 2.995   -5.165  -14.984 1.00 46.93 ? 17  GLU K CB  1 
ATOM   2104 C  CG  . GLU K  1 17 ? 3.522   -6.375  -15.762 1.00 49.59 ? 17  GLU K CG  1 
ATOM   2105 C  CD  . GLU K  1 17 ? 2.931   -7.640  -15.176 1.00 51.54 ? 17  GLU K CD  1 
ATOM   2106 O  OE1 . GLU K  1 17 ? 1.988   -7.650  -14.391 1.00 52.10 ? 17  GLU K OE1 1 
ATOM   2107 O  OE2 . GLU K  1 17 ? 3.588   -8.602  -15.624 1.00 52.88 ? 17  GLU K OE2 1 
ATOM   2108 N  N   . ASN K  1 18 ? 2.998   -2.324  -16.858 1.00 46.36 ? 18  ASN K N   1 
ATOM   2109 C  CA  . ASN K  1 18 ? 2.954   -1.808  -18.234 1.00 47.44 ? 18  ASN K CA  1 
ATOM   2110 C  C   . ASN K  1 18 ? 4.209   -0.987  -18.471 1.00 47.49 ? 18  ASN K C   1 
ATOM   2111 O  O   . ASN K  1 18 ? 4.305   -0.396  -19.556 1.00 48.04 ? 18  ASN K O   1 
ATOM   2112 C  CB  . ASN K  1 18 ? 1.709   -1.052  -18.642 1.00 49.88 ? 18  ASN K CB  1 
ATOM   2113 C  CG  . ASN K  1 18 ? 0.386   -1.596  -18.118 1.00 50.88 ? 18  ASN K CG  1 
ATOM   2114 O  OD1 . ASN K  1 18 ? 0.061   -2.803  -18.126 1.00 51.00 ? 18  ASN K OD1 1 
ATOM   2115 N  ND2 . ASN K  1 18 ? -0.340  -0.565  -17.622 1.00 51.70 ? 18  ASN K ND2 1 
ATOM   2116 N  N   . TYR K  1 19 ? 5.075   -0.978  -17.481 1.00 46.58 ? 19  TYR K N   1 
ATOM   2117 C  CA  . TYR K  1 19 ? 6.324   -0.207  -17.619 1.00 45.62 ? 19  TYR K CA  1 
ATOM   2118 C  C   . TYR K  1 19 ? 7.547   -1.088  -17.832 1.00 44.88 ? 19  TYR K C   1 
ATOM   2119 O  O   . TYR K  1 19 ? 8.669   -0.570  -18.089 1.00 45.16 ? 19  TYR K O   1 
ATOM   2120 C  CB  . TYR K  1 19 ? 6.436   0.715   -16.387 1.00 47.64 ? 19  TYR K CB  1 
ATOM   2121 C  CG  . TYR K  1 19 ? 5.342   1.769   -16.300 1.00 48.34 ? 19  TYR K CG  1 
ATOM   2122 C  CD1 . TYR K  1 19 ? 5.363   2.919   -17.090 1.00 48.47 ? 19  TYR K CD1 1 
ATOM   2123 C  CD2 . TYR K  1 19 ? 4.289   1.591   -15.415 1.00 48.82 ? 19  TYR K CD2 1 
ATOM   2124 C  CE1 . TYR K  1 19 ? 4.354   3.875   -16.992 1.00 49.34 ? 19  TYR K CE1 1 
ATOM   2125 C  CE2 . TYR K  1 19 ? 3.258   2.526   -15.313 1.00 49.84 ? 19  TYR K CE2 1 
ATOM   2126 C  CZ  . TYR K  1 19 ? 3.302   3.663   -16.104 1.00 50.11 ? 19  TYR K CZ  1 
ATOM   2127 O  OH  . TYR K  1 19 ? 2.279   4.564   -15.948 1.00 51.86 ? 19  TYR K OH  1 
ATOM   2128 N  N   . CYS K  1 20 ? 7.347   -2.392  -17.714 1.00 42.80 ? 20  CYS K N   1 
ATOM   2129 C  CA  . CYS K  1 20 ? 8.458   -3.333  -17.896 1.00 41.91 ? 20  CYS K CA  1 
ATOM   2130 C  C   . CYS K  1 20 ? 8.871   -3.417  -19.363 1.00 43.41 ? 20  CYS K C   1 
ATOM   2131 O  O   . CYS K  1 20 ? 8.066   -3.036  -20.229 1.00 44.99 ? 20  CYS K O   1 
ATOM   2132 C  CB  . CYS K  1 20 ? 8.123   -4.718  -17.418 1.00 37.49 ? 20  CYS K CB  1 
ATOM   2133 S  SG  . CYS K  1 20 ? 7.425   -4.685  -15.768 1.00 36.59 ? 20  CYS K SG  1 
ATOM   2134 N  N   . ASN K  1 21 ? 10.078  -3.904  -19.604 1.00 44.13 ? 21  ASN K N   1 
ATOM   2135 C  CA  . ASN K  1 21 ? 10.567  -4.062  -20.981 1.00 44.93 ? 21  ASN K CA  1 
ATOM   2136 C  C   . ASN K  1 21 ? 9.778   -5.229  -21.608 1.00 46.42 ? 21  ASN K C   1 
ATOM   2137 O  O   . ASN K  1 21 ? 10.134  -5.429  -22.781 1.00 47.65 ? 21  ASN K O   1 
ATOM   2138 C  CB  . ASN K  1 21 ? 12.030  -4.420  -21.109 1.00 44.05 ? 21  ASN K CB  1 
ATOM   2139 C  CG  . ASN K  1 21 ? 13.042  -3.328  -20.868 1.00 43.94 ? 21  ASN K CG  1 
ATOM   2140 O  OD1 . ASN K  1 21 ? 14.174  -3.650  -20.440 1.00 43.40 ? 21  ASN K OD1 1 
ATOM   2141 N  ND2 . ASN K  1 21 ? 12.725  -2.081  -21.172 1.00 42.97 ? 21  ASN K ND2 1 
ATOM   2142 O  OXT . ASN K  1 21 ? 8.950   -5.891  -20.958 1.00 48.11 ? 21  ASN K OXT 1 
ATOM   2143 N  N   . PHE L  2 1  ? 9.058   18.415  -4.662  1.00 43.67 ? 1   PHE L N   1 
ATOM   2144 C  CA  . PHE L  2 1  ? 10.313  17.981  -5.312  1.00 41.62 ? 1   PHE L CA  1 
ATOM   2145 C  C   . PHE L  2 1  ? 10.766  16.689  -4.605  1.00 39.67 ? 1   PHE L C   1 
ATOM   2146 O  O   . PHE L  2 1  ? 11.003  15.705  -5.255  1.00 38.50 ? 1   PHE L O   1 
ATOM   2147 N  N   . VAL L  2 2  ? 10.892  16.792  -3.307  1.00 39.54 ? 2   VAL L N   1 
ATOM   2148 C  CA  . VAL L  2 2  ? 11.307  15.821  -2.305  1.00 38.08 ? 2   VAL L CA  1 
ATOM   2149 C  C   . VAL L  2 2  ? 10.280  14.683  -2.287  1.00 35.81 ? 2   VAL L C   1 
ATOM   2150 O  O   . VAL L  2 2  ? 10.748  13.596  -2.518  1.00 34.57 ? 2   VAL L O   1 
ATOM   2151 C  CB  . VAL L  2 2  ? 11.374  16.526  -0.940  1.00 39.02 ? 2   VAL L CB  1 
ATOM   2152 C  CG1 . VAL L  2 2  ? 9.939   17.015  -0.715  1.00 39.80 ? 2   VAL L CG1 1 
ATOM   2153 C  CG2 . VAL L  2 2  ? 11.986  15.705  0.167   1.00 40.05 ? 2   VAL L CG2 1 
ATOM   2154 N  N   . ASN L  2 3  ? 9.017   14.977  -2.087  1.00 34.63 ? 3   ASN L N   1 
ATOM   2155 C  CA  . ASN L  2 3  ? 7.928   14.006  -2.105  1.00 32.57 ? 3   ASN L CA  1 
ATOM   2156 C  C   . ASN L  2 3  ? 8.007   13.199  -3.417  1.00 30.89 ? 3   ASN L C   1 
ATOM   2157 O  O   . ASN L  2 3  ? 7.940   11.955  -3.205  1.00 28.16 ? 3   ASN L O   1 
ATOM   2158 C  CB  . ASN L  2 3  ? 6.520   14.462  -1.839  1.00 34.68 ? 3   ASN L CB  1 
ATOM   2159 C  CG  A ASN L  2 3  ? 5.881   15.576  -2.640  0.50 35.35 ? 3   ASN L CG  1 
ATOM   2160 C  CG  B ASN L  2 3  ? 6.097   14.567  -0.402  0.50 35.91 ? 3   ASN L CG  1 
ATOM   2161 O  OD1 A ASN L  2 3  ? 4.835   15.390  -3.325  0.50 35.52 ? 3   ASN L OD1 1 
ATOM   2162 O  OD1 B ASN L  2 3  ? 6.899   14.541  0.555   0.50 36.95 ? 3   ASN L OD1 1 
ATOM   2163 N  ND2 A ASN L  2 3  ? 6.441   16.789  -2.593  0.50 35.03 ? 3   ASN L ND2 1 
ATOM   2164 N  ND2 B ASN L  2 3  ? 4.767   14.710  -0.230  0.50 37.19 ? 3   ASN L ND2 1 
ATOM   2165 N  N   . GLN L  2 4  ? 8.145   13.786  -4.566  1.00 28.48 ? 4   GLN L N   1 
ATOM   2166 C  CA  . GLN L  2 4  ? 8.211   12.980  -5.781  1.00 30.04 ? 4   GLN L CA  1 
ATOM   2167 C  C   . GLN L  2 4  ? 9.579   12.253  -5.852  1.00 28.18 ? 4   GLN L C   1 
ATOM   2168 O  O   . GLN L  2 4  ? 9.618   11.220  -6.535  1.00 27.12 ? 4   GLN L O   1 
ATOM   2169 C  CB  . GLN L  2 4  ? 7.947   13.680  -7.086  1.00 33.10 ? 4   GLN L CB  1 
ATOM   2170 C  CG  . GLN L  2 4  ? 6.684   14.526  -6.920  1.00 38.38 ? 4   GLN L CG  1 
ATOM   2171 C  CD  . GLN L  2 4  ? 7.060   15.972  -6.587  1.00 41.53 ? 4   GLN L CD  1 
ATOM   2172 O  OE1 . GLN L  2 4  ? 7.248   16.380  -5.429  1.00 41.47 ? 4   GLN L OE1 1 
ATOM   2173 N  NE2 . GLN L  2 4  ? 7.142   16.660  -7.770  1.00 42.64 ? 4   GLN L NE2 1 
ATOM   2174 N  N   . HIS L  2 5  ? 10.534  12.829  -5.188  1.00 26.13 ? 5   HIS L N   1 
ATOM   2175 C  CA  . HIS L  2 5  ? 11.902  12.225  -5.161  1.00 26.96 ? 5   HIS L CA  1 
ATOM   2176 C  C   . HIS L  2 5  ? 11.846  10.888  -4.381  1.00 24.66 ? 5   HIS L C   1 
ATOM   2177 O  O   . HIS L  2 5  ? 12.268  9.832   -4.908  1.00 23.36 ? 5   HIS L O   1 
ATOM   2178 C  CB  . HIS L  2 5  ? 12.837  13.247  -4.484  1.00 27.23 ? 5   HIS L CB  1 
ATOM   2179 C  CG  . HIS L  2 5  ? 14.218  12.690  -4.521  1.00 30.60 ? 5   HIS L CG  1 
ATOM   2180 N  ND1 . HIS L  2 5  ? 14.938  12.458  -5.670  1.00 31.76 ? 5   HIS L ND1 1 
ATOM   2181 C  CD2 . HIS L  2 5  ? 15.017  12.320  -3.466  1.00 32.12 ? 5   HIS L CD2 1 
ATOM   2182 C  CE1 . HIS L  2 5  ? 16.123  11.960  -5.327  1.00 32.95 ? 5   HIS L CE1 1 
ATOM   2183 N  NE2 . HIS L  2 5  ? 16.176  11.852  -4.025  1.00 33.15 ? 5   HIS L NE2 1 
ATOM   2184 N  N   . LEU L  2 6  ? 11.238  10.977  -3.186  1.00 22.10 ? 6   LEU L N   1 
ATOM   2185 C  CA  . LEU L  2 6  ? 11.008  9.857   -2.300  1.00 23.29 ? 6   LEU L CA  1 
ATOM   2186 C  C   . LEU L  2 6  ? 10.104  8.804   -2.915  1.00 23.35 ? 6   LEU L C   1 
ATOM   2187 O  O   . LEU L  2 6  ? 10.435  7.598   -2.756  1.00 24.09 ? 6   LEU L O   1 
ATOM   2188 C  CB  . LEU L  2 6  ? 10.567  10.243  -0.892  1.00 23.90 ? 6   LEU L CB  1 
ATOM   2189 C  CG  . LEU L  2 6  ? 11.365  11.310  -0.153  1.00 23.84 ? 6   LEU L CG  1 
ATOM   2190 C  CD1 . LEU L  2 6  ? 10.797  11.498  1.247   1.00 24.85 ? 6   LEU L CD1 1 
ATOM   2191 C  CD2 . LEU L  2 6  ? 12.833  11.017  0.023   1.00 23.84 ? 6   LEU L CD2 1 
ATOM   2192 N  N   . CYS L  2 7  ? 9.040   9.212   -3.568  1.00 22.89 ? 7   CYS L N   1 
ATOM   2193 C  CA  . CYS L  2 7  ? 8.152   8.242   -4.229  1.00 22.89 ? 7   CYS L CA  1 
ATOM   2194 C  C   . CYS L  2 7  ? 8.865   7.529   -5.374  1.00 21.92 ? 7   CYS L C   1 
ATOM   2195 O  O   . CYS L  2 7  ? 8.590   6.317   -5.509  1.00 22.62 ? 7   CYS L O   1 
ATOM   2196 C  CB  . CYS L  2 7  ? 6.872   8.903   -4.685  1.00 24.07 ? 7   CYS L CB  1 
ATOM   2197 S  SG  . CYS L  2 7  ? 5.854   8.030   -5.832  1.00 23.75 ? 7   CYS L SG  1 
ATOM   2198 N  N   . GLY L  2 8  ? 9.660   8.156   -6.192  1.00 18.60 ? 8   GLY L N   1 
ATOM   2199 C  CA  . GLY L  2 8  ? 10.392  7.555   -7.302  1.00 18.57 ? 8   GLY L CA  1 
ATOM   2200 C  C   . GLY L  2 8  ? 11.325  6.435   -6.787  1.00 18.32 ? 8   GLY L C   1 
ATOM   2201 O  O   . GLY L  2 8  ? 11.486  5.396   -7.454  1.00 18.42 ? 8   GLY L O   1 
ATOM   2202 N  N   . SER L  2 9  ? 11.919  6.611   -5.655  1.00 19.07 ? 9   SER L N   1 
ATOM   2203 C  CA  . SER L  2 9  ? 12.813  5.638   -5.019  1.00 21.12 ? 9   SER L CA  1 
ATOM   2204 C  C   . SER L  2 9  ? 12.115  4.288   -4.783  1.00 20.62 ? 9   SER L C   1 
ATOM   2205 O  O   . SER L  2 9  ? 12.663  3.202   -5.080  1.00 20.05 ? 9   SER L O   1 
ATOM   2206 C  CB  . SER L  2 9  ? 13.079  6.338   -3.713  1.00 23.10 ? 9   SER L CB  1 
ATOM   2207 O  OG  . SER L  2 9  ? 14.135  5.584   -3.185  1.00 28.35 ? 9   SER L OG  1 
ATOM   2208 N  N   . HIS L  2 10 ? 10.919  4.322   -4.222  1.00 17.44 ? 10  HIS L N   1 
ATOM   2209 C  CA  . HIS L  2 10 ? 9.987   3.268   -3.922  1.00 17.92 ? 10  HIS L CA  1 
ATOM   2210 C  C   . HIS L  2 10 ? 9.451   2.726   -5.228  1.00 19.75 ? 10  HIS L C   1 
ATOM   2211 O  O   . HIS L  2 10 ? 9.363   1.493   -5.370  1.00 20.56 ? 10  HIS L O   1 
ATOM   2212 C  CB  . HIS L  2 10 ? 8.826   3.538   -2.961  1.00 17.54 ? 10  HIS L CB  1 
ATOM   2213 C  CG  . HIS L  2 10 ? 9.380   3.824   -1.620  1.00 16.28 ? 10  HIS L CG  1 
ATOM   2214 N  ND1 . HIS L  2 10 ? 9.595   2.984   -0.588  1.00 15.64 ? 10  HIS L ND1 1 
ATOM   2215 C  CD2 . HIS L  2 10 ? 9.780   5.068   -1.233  1.00 14.21 ? 10  HIS L CD2 1 
ATOM   2216 C  CE1 . HIS L  2 10 ? 10.154  3.657   0.472   1.00 15.58 ? 10  HIS L CE1 1 
ATOM   2217 N  NE2 . HIS L  2 10 ? 10.220  4.981   0.086   1.00 13.20 ? 10  HIS L NE2 1 
ATOM   2218 N  N   . LEU L  2 11 ? 9.158   3.542   -6.238  1.00 20.53 ? 11  LEU L N   1 
ATOM   2219 C  CA  . LEU L  2 11 ? 8.728   3.159   -7.519  1.00 20.77 ? 11  LEU L CA  1 
ATOM   2220 C  C   . LEU L  2 11 ? 9.758   2.256   -8.243  1.00 22.17 ? 11  LEU L C   1 
ATOM   2221 O  O   . LEU L  2 11 ? 9.254   1.316   -8.940  1.00 19.60 ? 11  LEU L O   1 
ATOM   2222 C  CB  . LEU L  2 11 ? 8.535   4.318   -8.578  1.00 23.49 ? 11  LEU L CB  1 
ATOM   2223 C  CG  . LEU L  2 11 ? 7.150   4.956   -8.590  1.00 26.34 ? 11  LEU L CG  1 
ATOM   2224 C  CD1 . LEU L  2 11 ? 7.137   6.190   -9.539  1.00 26.73 ? 11  LEU L CD1 1 
ATOM   2225 C  CD2 . LEU L  2 11 ? 6.151   3.868   -9.076  1.00 25.59 ? 11  LEU L CD2 1 
ATOM   2226 N  N   . VAL L  2 12 ? 11.041  2.602   -8.217  1.00 20.13 ? 12  VAL L N   1 
ATOM   2227 C  CA  . VAL L  2 12 ? 11.985  1.749   -8.962  1.00 21.88 ? 12  VAL L CA  1 
ATOM   2228 C  C   . VAL L  2 12 ? 12.113  0.356   -8.290  1.00 19.66 ? 12  VAL L C   1 
ATOM   2229 O  O   . VAL L  2 12 ? 12.444  -0.544  -9.078  1.00 20.40 ? 12  VAL L O   1 
ATOM   2230 C  CB  . VAL L  2 12 ? 13.345  2.457   -9.267  1.00 22.63 ? 12  VAL L CB  1 
ATOM   2231 C  CG1 . VAL L  2 12 ? 13.039  3.690   -10.181 1.00 24.97 ? 12  VAL L CG1 1 
ATOM   2232 C  CG2 . VAL L  2 12 ? 14.219  2.838   -8.138  1.00 23.72 ? 12  VAL L CG2 1 
ATOM   2233 N  N   . GLU L  2 13 ? 11.956  0.334   -6.991  1.00 18.00 ? 13  GLU L N   1 
ATOM   2234 C  CA  . GLU L  2 13 ? 12.062  -0.932  -6.305  1.00 21.57 ? 13  GLU L CA  1 
ATOM   2235 C  C   . GLU L  2 13 ? 10.851  -1.818  -6.667  1.00 22.57 ? 13  GLU L C   1 
ATOM   2236 O  O   . GLU L  2 13 ? 11.038  -3.005  -6.720  1.00 21.31 ? 13  GLU L O   1 
ATOM   2237 C  CB  . GLU L  2 13 ? 12.076  -0.751  -4.836  1.00 22.43 ? 13  GLU L CB  1 
ATOM   2238 C  CG  . GLU L  2 13 ? 13.434  -0.380  -4.184  1.00 26.47 ? 13  GLU L CG  1 
ATOM   2239 C  CD  A GLU L  2 13 ? 14.473  -1.480  -4.509  0.50 25.90 ? 13  GLU L CD  1 
ATOM   2240 C  CD  B GLU L  2 13 ? 13.214  -0.256  -2.691  0.50 26.50 ? 13  GLU L CD  1 
ATOM   2241 O  OE1 A GLU L  2 13 ? 14.191  -2.690  -4.532  0.50 24.83 ? 13  GLU L OE1 1 
ATOM   2242 O  OE1 B GLU L  2 13 ? 12.287  0.498   -2.319  0.50 27.23 ? 13  GLU L OE1 1 
ATOM   2243 O  OE2 A GLU L  2 13 ? 15.622  -1.036  -4.746  0.50 25.63 ? 13  GLU L OE2 1 
ATOM   2244 O  OE2 B GLU L  2 13 ? 13.881  -0.931  -1.924  0.50 28.48 ? 13  GLU L OE2 1 
ATOM   2245 N  N   . ALA L  2 14 ? 9.679   -1.272  -6.895  1.00 21.75 ? 14  ALA L N   1 
ATOM   2246 C  CA  . ALA L  2 14 ? 8.448   -1.985  -7.258  1.00 22.99 ? 14  ALA L CA  1 
ATOM   2247 C  C   . ALA L  2 14 ? 8.616   -2.439  -8.690  1.00 23.08 ? 14  ALA L C   1 
ATOM   2248 O  O   . ALA L  2 14 ? 8.288   -3.616  -8.968  1.00 25.18 ? 14  ALA L O   1 
ATOM   2249 C  CB  . ALA L  2 14 ? 7.197   -1.118  -6.982  1.00 24.89 ? 14  ALA L CB  1 
ATOM   2250 N  N   . LEU L  2 15 ? 9.179   -1.657  -9.589  1.00 20.11 ? 15  LEU L N   1 
ATOM   2251 C  CA  . LEU L  2 15 ? 9.424   -2.042  -10.952 1.00 22.00 ? 15  LEU L CA  1 
ATOM   2252 C  C   . LEU L  2 15 ? 10.420  -3.222  -11.005 1.00 22.39 ? 15  LEU L C   1 
ATOM   2253 O  O   . LEU L  2 15 ? 10.278  -4.094  -11.858 1.00 23.40 ? 15  LEU L O   1 
ATOM   2254 C  CB  . LEU L  2 15 ? 9.909   -0.883  -11.800 1.00 22.80 ? 15  LEU L CB  1 
ATOM   2255 C  CG  . LEU L  2 15 ? 8.858   0.191   -12.183 1.00 25.18 ? 15  LEU L CG  1 
ATOM   2256 C  CD1 . LEU L  2 15 ? 9.528   1.353   -12.860 1.00 24.66 ? 15  LEU L CD1 1 
ATOM   2257 C  CD2 . LEU L  2 15 ? 7.855   -0.494  -13.100 1.00 24.29 ? 15  LEU L CD2 1 
ATOM   2258 N  N   . TYR L  2 16 ? 11.407  -3.137  -10.144 1.00 22.24 ? 16  TYR L N   1 
ATOM   2259 C  CA  . TYR L  2 16 ? 12.459  -4.184  -10.078 1.00 22.35 ? 16  TYR L CA  1 
ATOM   2260 C  C   . TYR L  2 16 ? 11.746  -5.521  -9.707  1.00 22.51 ? 16  TYR L C   1 
ATOM   2261 O  O   . TYR L  2 16 ? 12.068  -6.501  -10.347 1.00 21.12 ? 16  TYR L O   1 
ATOM   2262 C  CB  . TYR L  2 16 ? 13.521  -3.812  -9.002  1.00 20.31 ? 16  TYR L CB  1 
ATOM   2263 C  CG  . TYR L  2 16 ? 14.537  -4.916  -8.837  1.00 19.40 ? 16  TYR L CG  1 
ATOM   2264 C  CD1 . TYR L  2 16 ? 15.346  -5.142  -9.927  1.00 20.93 ? 16  TYR L CD1 1 
ATOM   2265 C  CD2 . TYR L  2 16 ? 14.591  -5.668  -7.667  1.00 20.15 ? 16  TYR L CD2 1 
ATOM   2266 C  CE1 . TYR L  2 16 ? 16.326  -6.190  -9.901  1.00 23.13 ? 16  TYR L CE1 1 
ATOM   2267 C  CE2 . TYR L  2 16 ? 15.558  -6.664  -7.608  1.00 21.13 ? 16  TYR L CE2 1 
ATOM   2268 C  CZ  . TYR L  2 16 ? 16.383  -6.920  -8.696  1.00 21.83 ? 16  TYR L CZ  1 
ATOM   2269 O  OH  . TYR L  2 16 ? 17.327  -7.918  -8.575  1.00 22.55 ? 16  TYR L OH  1 
ATOM   2270 N  N   . LEU L  2 17 ? 10.896  -5.521  -8.727  1.00 24.68 ? 17  LEU L N   1 
ATOM   2271 C  CA  . LEU L  2 17 ? 10.189  -6.745  -8.295  1.00 28.04 ? 17  LEU L CA  1 
ATOM   2272 C  C   . LEU L  2 17 ? 9.229   -7.196  -9.406  1.00 29.62 ? 17  LEU L C   1 
ATOM   2273 O  O   . LEU L  2 17 ? 9.299   -8.367  -9.823  1.00 28.51 ? 17  LEU L O   1 
ATOM   2274 C  CB  . LEU L  2 17 ? 9.588   -6.526  -6.937  1.00 29.17 ? 17  LEU L CB  1 
ATOM   2275 C  CG  . LEU L  2 17 ? 8.632   -7.592  -6.445  1.00 31.89 ? 17  LEU L CG  1 
ATOM   2276 C  CD1 . LEU L  2 17 ? 9.326   -8.887  -5.989  1.00 31.93 ? 17  LEU L CD1 1 
ATOM   2277 C  CD2 . LEU L  2 17 ? 7.789   -6.975  -5.309  1.00 31.36 ? 17  LEU L CD2 1 
ATOM   2278 N  N   . VAL L  2 18 ? 8.413   -6.289  -9.914  1.00 29.22 ? 18  VAL L N   1 
ATOM   2279 C  CA  . VAL L  2 18 ? 7.469   -6.642  -10.963 1.00 30.80 ? 18  VAL L CA  1 
ATOM   2280 C  C   . VAL L  2 18 ? 8.015   -7.088  -12.300 1.00 31.50 ? 18  VAL L C   1 
ATOM   2281 O  O   . VAL L  2 18 ? 7.448   -8.031  -12.913 1.00 32.73 ? 18  VAL L O   1 
ATOM   2282 C  CB  . VAL L  2 18 ? 6.511   -5.414  -11.171 1.00 30.34 ? 18  VAL L CB  1 
ATOM   2283 C  CG1 . VAL L  2 18 ? 5.638   -5.616  -12.368 1.00 31.88 ? 18  VAL L CG1 1 
ATOM   2284 C  CG2 . VAL L  2 18 ? 5.700   -5.209  -9.906  1.00 32.56 ? 18  VAL L CG2 1 
ATOM   2285 N  N   . CYS L  2 19 ? 8.999   -6.441  -12.851 1.00 31.21 ? 19  CYS L N   1 
ATOM   2286 C  CA  . CYS L  2 19 ? 9.536   -6.692  -14.170 1.00 32.91 ? 19  CYS L CA  1 
ATOM   2287 C  C   . CYS L  2 19 ? 10.506  -7.865  -14.277 1.00 34.19 ? 19  CYS L C   1 
ATOM   2288 O  O   . CYS L  2 19 ? 10.706  -8.415  -15.372 1.00 34.20 ? 19  CYS L O   1 
ATOM   2289 C  CB  . CYS L  2 19 ? 10.178  -5.412  -14.713 1.00 33.39 ? 19  CYS L CB  1 
ATOM   2290 S  SG  . CYS L  2 19 ? 9.044   -4.000  -14.747 1.00 32.79 ? 19  CYS L SG  1 
ATOM   2291 N  N   . GLY L  2 20 ? 11.066  -8.176  -13.161 1.00 35.45 ? 20  GLY L N   1 
ATOM   2292 C  CA  . GLY L  2 20 ? 12.022  -9.293  -13.033 1.00 38.43 ? 20  GLY L CA  1 
ATOM   2293 C  C   . GLY L  2 20 ? 13.007  -9.265  -14.198 1.00 39.36 ? 20  GLY L C   1 
ATOM   2294 O  O   . GLY L  2 20 ? 13.642  -8.243  -14.520 1.00 39.15 ? 20  GLY L O   1 
ATOM   2295 N  N   . GLU L  2 21 ? 13.082  -10.455 -14.814 1.00 40.03 ? 21  GLU L N   1 
ATOM   2296 C  CA  . GLU L  2 21 ? 14.007  -10.692 -15.933 1.00 40.33 ? 21  GLU L CA  1 
ATOM   2297 C  C   . GLU L  2 21 ? 13.818  -9.842  -17.157 1.00 39.39 ? 21  GLU L C   1 
ATOM   2298 O  O   . GLU L  2 21 ? 14.793  -9.733  -17.939 1.00 39.77 ? 21  GLU L O   1 
ATOM   2299 C  CB  . GLU L  2 21 ? 14.040  -12.186 -16.335 1.00 41.47 ? 21  GLU L CB  1 
ATOM   2300 N  N   . ARG L  2 22 ? 12.659  -9.219  -17.348 1.00 39.48 ? 22  ARG L N   1 
ATOM   2301 C  CA  . ARG L  2 22 ? 12.510  -8.369  -18.535 1.00 38.38 ? 22  ARG L CA  1 
ATOM   2302 C  C   . ARG L  2 22 ? 13.330  -7.091  -18.352 1.00 35.89 ? 22  ARG L C   1 
ATOM   2303 O  O   . ARG L  2 22 ? 13.805  -6.597  -19.382 1.00 37.92 ? 22  ARG L O   1 
ATOM   2304 C  CB  . ARG L  2 22 ? 11.095  -7.905  -18.906 1.00 40.63 ? 22  ARG L CB  1 
ATOM   2305 C  CG  . ARG L  2 22 ? 10.000  -8.978  -19.002 1.00 43.54 ? 22  ARG L CG  1 
ATOM   2306 C  CD  . ARG L  2 22 ? 9.115   -8.757  -17.871 1.00 44.84 ? 22  ARG L CD  1 
ATOM   2307 N  NE  . ARG L  2 22 ? 7.819   -9.236  -17.704 1.00 47.17 ? 22  ARG L NE  1 
ATOM   2308 C  CZ  . ARG L  2 22 ? 7.164   -9.131  -16.543 1.00 49.42 ? 22  ARG L CZ  1 
ATOM   2309 N  NH1 . ARG L  2 22 ? 7.518   -8.708  -15.337 1.00 50.38 ? 22  ARG L NH1 1 
ATOM   2310 N  NH2 . ARG L  2 22 ? 5.832   -9.345  -16.566 1.00 51.60 ? 22  ARG L NH2 1 
ATOM   2311 N  N   . GLY L  2 23 ? 13.459  -6.587  -17.151 1.00 33.57 ? 23  GLY L N   1 
ATOM   2312 C  CA  . GLY L  2 23 ? 14.180  -5.289  -17.041 1.00 32.17 ? 23  GLY L CA  1 
ATOM   2313 C  C   . GLY L  2 23 ? 13.117  -4.183  -17.213 1.00 31.67 ? 23  GLY L C   1 
ATOM   2314 O  O   . GLY L  2 23 ? 11.904  -4.411  -17.321 1.00 30.91 ? 23  GLY L O   1 
ATOM   2315 N  N   . PHE L  2 24 ? 13.570  -2.950  -17.274 1.00 31.00 ? 24  PHE L N   1 
ATOM   2316 C  CA  . PHE L  2 24 ? 12.756  -1.730  -17.378 1.00 29.43 ? 24  PHE L CA  1 
ATOM   2317 C  C   . PHE L  2 24 ? 13.624  -0.499  -17.609 1.00 29.63 ? 24  PHE L C   1 
ATOM   2318 O  O   . PHE L  2 24 ? 14.845  -0.456  -17.412 1.00 29.44 ? 24  PHE L O   1 
ATOM   2319 C  CB  . PHE L  2 24 ? 11.895  -1.570  -16.118 1.00 27.21 ? 24  PHE L CB  1 
ATOM   2320 C  CG  . PHE L  2 24 ? 12.600  -1.253  -14.841 1.00 24.94 ? 24  PHE L CG  1 
ATOM   2321 C  CD1 . PHE L  2 24 ? 12.865  0.065   -14.488 1.00 24.50 ? 24  PHE L CD1 1 
ATOM   2322 C  CD2 . PHE L  2 24 ? 13.027  -2.294  -14.010 1.00 23.50 ? 24  PHE L CD2 1 
ATOM   2323 C  CE1 . PHE L  2 24 ? 13.538  0.388   -13.283 1.00 22.57 ? 24  PHE L CE1 1 
ATOM   2324 C  CE2 . PHE L  2 24 ? 13.707  -2.009  -12.818 1.00 23.20 ? 24  PHE L CE2 1 
ATOM   2325 C  CZ  . PHE L  2 24 ? 13.957  -0.665  -12.490 1.00 23.11 ? 24  PHE L CZ  1 
ATOM   2326 N  N   . PHE L  2 25 ? 12.963  0.515   -18.091 1.00 30.54 ? 25  PHE L N   1 
ATOM   2327 C  CA  . PHE L  2 25 ? 13.396  1.865   -18.424 1.00 32.39 ? 25  PHE L CA  1 
ATOM   2328 C  C   . PHE L  2 25 ? 12.654  2.773   -17.444 1.00 31.39 ? 25  PHE L C   1 
ATOM   2329 O  O   . PHE L  2 25 ? 11.424  2.600   -17.343 1.00 30.86 ? 25  PHE L O   1 
ATOM   2330 C  CB  . PHE L  2 25 ? 13.052  2.288   -19.849 1.00 34.61 ? 25  PHE L CB  1 
ATOM   2331 C  CG  . PHE L  2 25 ? 14.154  1.982   -20.800 1.00 37.60 ? 25  PHE L CG  1 
ATOM   2332 C  CD1 . PHE L  2 25 ? 14.295  0.676   -21.305 1.00 38.67 ? 25  PHE L CD1 1 
ATOM   2333 C  CD2 . PHE L  2 25 ? 15.064  2.977   -21.170 1.00 38.52 ? 25  PHE L CD2 1 
ATOM   2334 C  CE1 . PHE L  2 25 ? 15.342  0.338   -22.153 1.00 38.75 ? 25  PHE L CE1 1 
ATOM   2335 C  CE2 . PHE L  2 25 ? 16.104  2.635   -22.074 1.00 39.81 ? 25  PHE L CE2 1 
ATOM   2336 C  CZ  . PHE L  2 25 ? 16.234  1.324   -22.561 1.00 39.21 ? 25  PHE L CZ  1 
ATOM   2337 N  N   . TYR L  2 26 ? 13.357  3.600   -16.737 1.00 30.74 ? 26  TYR L N   1 
ATOM   2338 C  CA  . TYR L  2 26 ? 12.775  4.530   -15.784 1.00 32.62 ? 26  TYR L CA  1 
ATOM   2339 C  C   . TYR L  2 26 ? 13.058  5.906   -16.410 1.00 34.88 ? 26  TYR L C   1 
ATOM   2340 O  O   . TYR L  2 26 ? 14.245  6.243   -16.564 1.00 33.17 ? 26  TYR L O   1 
ATOM   2341 C  CB  . TYR L  2 26 ? 13.383  4.409   -14.391 1.00 30.74 ? 26  TYR L CB  1 
ATOM   2342 C  CG  . TYR L  2 26 ? 12.840  5.458   -13.457 1.00 31.74 ? 26  TYR L CG  1 
ATOM   2343 C  CD1 . TYR L  2 26 ? 11.516  5.298   -13.021 1.00 32.53 ? 26  TYR L CD1 1 
ATOM   2344 C  CD2 . TYR L  2 26 ? 13.522  6.579   -13.008 1.00 30.22 ? 26  TYR L CD2 1 
ATOM   2345 C  CE1 . TYR L  2 26 ? 10.912  6.207   -12.148 1.00 33.12 ? 26  TYR L CE1 1 
ATOM   2346 C  CE2 . TYR L  2 26 ? 12.936  7.529   -12.185 1.00 31.13 ? 26  TYR L CE2 1 
ATOM   2347 C  CZ  . TYR L  2 26 ? 11.638  7.338   -11.761 1.00 32.81 ? 26  TYR L CZ  1 
ATOM   2348 O  OH  . TYR L  2 26 ? 11.023  8.211   -10.906 1.00 33.70 ? 26  TYR L OH  1 
ATOM   2349 N  N   . THR L  2 27 ? 12.041  6.628   -16.822 1.00 38.02 ? 27  THR L N   1 
ATOM   2350 C  CA  . THR L  2 27 ? 12.251  7.973   -17.445 1.00 42.36 ? 27  THR L CA  1 
ATOM   2351 C  C   . THR L  2 27 ? 11.182  8.846   -16.789 1.00 44.52 ? 27  THR L C   1 
ATOM   2352 O  O   . THR L  2 27 ? 9.966   8.801   -17.100 1.00 44.52 ? 27  THR L O   1 
ATOM   2353 C  CB  . THR L  2 27 ? 12.264  7.788   -18.993 1.00 44.36 ? 27  THR L CB  1 
ATOM   2354 O  OG1 . THR L  2 27 ? 10.939  7.238   -19.385 1.00 46.12 ? 27  THR L OG1 1 
ATOM   2355 C  CG2 . THR L  2 27 ? 13.346  6.888   -19.626 1.00 44.15 ? 27  THR L CG2 1 
ATOM   2356 N  N   . PRO L  2 28 ? 11.595  9.602   -15.788 1.00 46.31 ? 28  PRO L N   1 
ATOM   2357 C  CA  . PRO L  2 28 ? 10.690  10.430  -14.974 1.00 49.18 ? 28  PRO L CA  1 
ATOM   2358 C  C   . PRO L  2 28 ? 9.832   11.423  -15.741 1.00 52.19 ? 28  PRO L C   1 
ATOM   2359 O  O   . PRO L  2 28 ? 8.578   11.484  -15.530 1.00 54.47 ? 28  PRO L O   1 
ATOM   2360 C  CB  . PRO L  2 28 ? 11.576  10.926  -13.843 1.00 48.10 ? 28  PRO L CB  1 
ATOM   2361 C  CG  . PRO L  2 28 ? 12.976  10.894  -14.337 1.00 46.97 ? 28  PRO L CG  1 
ATOM   2362 C  CD  . PRO L  2 28 ? 12.978  9.734   -15.319 1.00 47.29 ? 28  PRO L CD  1 
ATOM   2363 N  N   . LYS L  2 29 ? 10.423  12.141  -16.666 1.00 54.78 ? 29  LYS L N   1 
ATOM   2364 C  CA  . LYS L  2 29 ? 9.795   13.140  -17.546 1.00 56.65 ? 29  LYS L CA  1 
ATOM   2365 C  C   . LYS L  2 29 ? 9.717   12.609  -18.979 1.00 57.87 ? 29  LYS L C   1 
ATOM   2366 O  O   . LYS L  2 29 ? 10.714  12.768  -19.709 1.00 58.13 ? 29  LYS L O   1 
ATOM   2367 C  CB  . LYS L  2 29 ? 10.665  14.405  -17.603 1.00 56.27 ? 29  LYS L CB  1 
ATOM   2368 C  CG  . LYS L  2 29 ? 12.162  14.056  -17.516 1.00 55.78 ? 29  LYS L CG  1 
ATOM   2369 C  CD  . LYS L  2 29 ? 12.928  14.808  -18.594 1.00 55.39 ? 29  LYS L CD  1 
ATOM   2370 N  N   . THR L  2 30 ? 8.600   11.991  -19.352 1.00 59.02 ? 30  THR L N   1 
ATOM   2371 C  CA  . THR L  2 30 ? 8.436   11.432  -20.717 1.00 58.91 ? 30  THR L CA  1 
HETATM 2372 C  C1  . IPH M  3 .  ? 23.306  -6.688  11.222  1.00 22.88 ? 22  IPH A C1  1 
HETATM 2373 C  C2  . IPH M  3 .  ? 23.560  -6.550  9.885   1.00 21.12 ? 22  IPH A C2  1 
HETATM 2374 C  C3  . IPH M  3 .  ? 22.669  -5.762  9.127   1.00 23.14 ? 22  IPH A C3  1 
HETATM 2375 C  C4  . IPH M  3 .  ? 21.543  -5.160  9.735   1.00 21.89 ? 22  IPH A C4  1 
HETATM 2376 C  C5  . IPH M  3 .  ? 21.330  -5.301  11.074  1.00 22.42 ? 22  IPH A C5  1 
HETATM 2377 C  C6  . IPH M  3 .  ? 22.228  -6.042  11.836  1.00 23.68 ? 22  IPH A C6  1 
HETATM 2378 O  O1  . IPH M  3 .  ? 24.134  -7.356  12.068  1.00 23.27 ? 22  IPH A O1  1 
HETATM 2379 ZN ZN  . ZN  N  4 .  ? 19.962  -5.658  0.720   1.00 18.01 ? 31  ZN  B ZN  1 
HETATM 2380 CL CL  . CL  O  5 .  ? 21.377  -7.508  0.609   1.00 21.22 ? 32  CL  B CL  1 
HETATM 2381 C  C1  . IPH P  3 .  ? 25.281  -10.786 -1.504  1.00 55.93 ? 33  IPH B C1  1 
HETATM 2382 C  C2  . IPH P  3 .  ? 24.035  -10.233 -1.807  1.00 55.79 ? 33  IPH B C2  1 
HETATM 2383 C  C3  . IPH P  3 .  ? 23.126  -10.008 -0.780  1.00 55.91 ? 33  IPH B C3  1 
HETATM 2384 C  C4  . IPH P  3 .  ? 23.425  -10.275 0.561   1.00 55.90 ? 33  IPH B C4  1 
HETATM 2385 C  C5  . IPH P  3 .  ? 24.689  -10.816 0.825   1.00 56.41 ? 33  IPH B C5  1 
HETATM 2386 C  C6  . IPH P  3 .  ? 25.604  -11.087 -0.187  1.00 56.16 ? 33  IPH B C6  1 
HETATM 2387 O  O1  . IPH P  3 .  ? 26.220  -11.042 -2.462  1.00 56.46 ? 33  IPH B O1  1 
HETATM 2388 C  C1  . IPH Q  3 .  ? 17.768  14.182  -0.802  1.00 24.92 ? 22  IPH C C1  1 
HETATM 2389 C  C2  . IPH Q  3 .  ? 16.894  13.594  0.122   1.00 23.93 ? 22  IPH C C2  1 
HETATM 2390 C  C3  . IPH Q  3 .  ? 16.940  12.197  0.270   1.00 23.45 ? 22  IPH C C3  1 
HETATM 2391 C  C4  . IPH Q  3 .  ? 17.799  11.449  -0.527  1.00 23.19 ? 22  IPH C C4  1 
HETATM 2392 C  C5  . IPH Q  3 .  ? 18.621  12.060  -1.450  1.00 24.65 ? 22  IPH C C5  1 
HETATM 2393 C  C6  . IPH Q  3 .  ? 18.601  13.456  -1.639  1.00 24.67 ? 22  IPH C C6  1 
HETATM 2394 O  O1  . IPH Q  3 .  ? 17.743  15.531  -0.982  1.00 27.45 ? 22  IPH C O1  1 
HETATM 2395 ZN ZN  . ZN  R  4 .  ? 10.726  5.992   1.650   1.00 19.80 ? 31  ZN  D ZN  1 
HETATM 2396 C  C1  . IPH S  3 .  ? 12.808  -13.443 -2.690  1.00 28.49 ? 22  IPH E C1  1 
HETATM 2397 C  C2  . IPH S  3 .  ? 13.644  -12.829 -1.746  1.00 28.41 ? 22  IPH E C2  1 
HETATM 2398 C  C3  . IPH S  3 .  ? 13.499  -11.435 -1.536  1.00 28.73 ? 22  IPH E C3  1 
HETATM 2399 C  C4  . IPH S  3 .  ? 12.555  -10.676 -2.265  1.00 28.82 ? 22  IPH E C4  1 
HETATM 2400 C  C5  . IPH S  3 .  ? 11.772  -11.339 -3.245  1.00 30.23 ? 22  IPH E C5  1 
HETATM 2401 C  C6  . IPH S  3 .  ? 11.922  -12.713 -3.461  1.00 28.30 ? 22  IPH E C6  1 
HETATM 2402 O  O1  . IPH S  3 .  ? 12.911  -14.787 -2.939  1.00 27.08 ? 22  IPH E O1  1 
HETATM 2403 C  C1  . IPH T  3 .  ? 7.517   5.519   12.024  1.00 25.31 ? 22  IPH G C1  1 
HETATM 2404 C  C2  . IPH T  3 .  ? 7.264   5.443   10.648  1.00 23.43 ? 22  IPH G C2  1 
HETATM 2405 C  C3  . IPH T  3 .  ? 8.096   4.624   9.841   1.00 22.30 ? 22  IPH G C3  1 
HETATM 2406 C  C4  . IPH T  3 .  ? 9.111   3.878   10.423  1.00 20.57 ? 22  IPH G C4  1 
HETATM 2407 C  C5  . IPH T  3 .  ? 9.363   3.941   11.819  1.00 23.36 ? 22  IPH G C5  1 
HETATM 2408 C  C6  . IPH T  3 .  ? 8.570   4.784   12.652  1.00 24.49 ? 22  IPH G C6  1 
HETATM 2409 O  O1  . IPH T  3 .  ? 6.790   6.331   12.855  1.00 25.89 ? 22  IPH G O1  1 
HETATM 2410 CL CL  . CL  U  5 .  ? 9.378   7.854   1.736   1.00 21.11 ? 31  CL  H CL  1 
HETATM 2411 C  C1  . IPH V  3 .  ? 27.328  -2.093  -6.575  1.00 23.10 ? 22  IPH I C1  1 
HETATM 2412 C  C2  . IPH V  3 .  ? 26.366  -2.989  -6.151  1.00 23.00 ? 22  IPH I C2  1 
HETATM 2413 C  C3  . IPH V  3 .  ? 25.208  -2.485  -5.524  1.00 23.13 ? 22  IPH I C3  1 
HETATM 2414 C  C4  . IPH V  3 .  ? 25.011  -1.110  -5.336  1.00 22.84 ? 22  IPH I C4  1 
HETATM 2415 C  C5  . IPH V  3 .  ? 25.998  -0.216  -5.809  1.00 22.93 ? 22  IPH I C5  1 
HETATM 2416 C  C6  . IPH V  3 .  ? 27.184  -0.697  -6.409  1.00 22.61 ? 22  IPH I C6  1 
HETATM 2417 O  O1  . IPH V  3 .  ? 28.453  -2.505  -7.246  1.00 24.27 ? 22  IPH I O1  1 
HETATM 2418 C  C1  . IPH W  3 .  ? 3.350   3.489   -6.094  1.00 32.11 ? 22  IPH K C1  1 
HETATM 2419 C  C2  . IPH W  3 .  ? 4.347   4.295   -5.512  1.00 30.91 ? 22  IPH K C2  1 
HETATM 2420 C  C3  . IPH W  3 .  ? 5.441   3.685   -4.895  1.00 30.47 ? 22  IPH K C3  1 
HETATM 2421 C  C4  . IPH W  3 .  ? 5.563   2.306   -4.880  1.00 30.80 ? 22  IPH K C4  1 
HETATM 2422 C  C5  . IPH W  3 .  ? 4.598   1.510   -5.504  1.00 30.69 ? 22  IPH K C5  1 
HETATM 2423 C  C6  . IPH W  3 .  ? 3.476   2.101   -6.093  1.00 31.22 ? 22  IPH K C6  1 
HETATM 2424 O  O1  . IPH W  3 .  ? 2.252   4.049   -6.714  1.00 31.82 ? 22  IPH K O1  1 
HETATM 2425 O  O   . HOH X  6 .  ? 25.164  3.954   24.334  0.50 44.22 ? 23  HOH A O   1 
HETATM 2426 O  O   . HOH X  6 .  ? 25.486  4.816   22.645  0.50 29.79 ? 24  HOH A O   1 
HETATM 2427 O  O   . HOH X  6 .  ? 22.492  -8.533  22.551  1.00 53.65 ? 25  HOH A O   1 
HETATM 2428 O  O   . HOH X  6 .  ? 25.267  -1.526  24.165  1.00 53.77 ? 26  HOH A O   1 
HETATM 2429 O  O   . HOH X  6 .  ? 38.203  -9.220  12.396  1.00 53.60 ? 27  HOH A O   1 
HETATM 2430 O  O   . HOH X  6 .  ? 21.808  -10.964 18.038  1.00 59.25 ? 28  HOH A O   1 
HETATM 2431 O  O   . HOH X  6 .  ? 17.485  -9.977  16.379  1.00 51.88 ? 29  HOH A O   1 
HETATM 2432 O  O   . HOH X  6 .  ? 17.263  -7.407  18.127  1.00 57.44 ? 30  HOH A O   1 
HETATM 2433 O  O   . HOH X  6 .  ? 18.161  -0.163  21.697  1.00 46.30 ? 31  HOH A O   1 
HETATM 2434 O  O   . HOH X  6 .  ? 21.688  -13.847 16.475  1.00 64.22 ? 32  HOH A O   1 
HETATM 2435 O  O   . HOH X  6 .  ? 29.380  11.835  20.737  1.00 77.64 ? 33  HOH A O   1 
HETATM 2436 O  O   . HOH X  6 .  ? 20.333  -11.165 20.950  1.00 66.74 ? 34  HOH A O   1 
HETATM 2437 O  O   . HOH X  6 .  ? 25.378  6.804   27.043  1.00 87.11 ? 35  HOH A O   1 
HETATM 2438 O  O   . HOH X  6 .  ? 37.049  0.394   15.834  1.00 80.91 ? 36  HOH A O   1 
HETATM 2439 O  O   . HOH X  6 .  ? 38.305  0.481   18.846  1.00 79.91 ? 37  HOH A O   1 
HETATM 2440 O  O   . HOH X  6 .  ? 32.315  -8.455  19.724  1.00 60.11 ? 38  HOH A O   1 
HETATM 2441 O  O   . HOH X  6 .  ? 25.092  -8.164  22.905  1.00 79.76 ? 39  HOH A O   1 
HETATM 2442 O  O   . HOH X  6 .  ? 28.120  -3.611  20.217  1.00 57.39 ? 40  HOH A O   1 
HETATM 2443 O  O   . HOH X  6 .  ? 27.643  -1.384  30.619  1.00 57.82 ? 41  HOH A O   1 
HETATM 2444 O  O   . HOH X  6 .  ? 21.579  0.871   27.442  1.00 60.14 ? 42  HOH A O   1 
HETATM 2445 O  O   . HOH X  6 .  ? 31.235  -13.866 14.285  1.00 55.95 ? 43  HOH A O   1 
HETATM 2446 O  O   . HOH X  6 .  ? 22.066  -18.197 15.359  1.00 72.82 ? 44  HOH A O   1 
HETATM 2447 O  O   . HOH X  6 .  ? 24.798  1.357   28.003  1.00 79.77 ? 45  HOH A O   1 
HETATM 2448 O  O   . HOH X  6 .  ? 37.802  -4.352  17.352  1.00 67.00 ? 46  HOH A O   1 
HETATM 2449 O  O   . HOH X  6 .  ? 43.524  1.146   18.410  1.00 56.89 ? 47  HOH A O   1 
HETATM 2450 O  O   . HOH X  6 .  ? 22.294  -1.819  30.458  1.00 74.47 ? 48  HOH A O   1 
HETATM 2451 O  O   . HOH X  6 .  ? 30.571  -10.640 17.040  1.00 71.65 ? 49  HOH A O   1 
HETATM 2452 O  O   . HOH X  6 .  ? 22.324  11.372  24.861  1.00 68.61 ? 50  HOH A O   1 
HETATM 2453 O  O   . HOH X  6 .  ? 35.364  -11.843 9.654   1.00 67.42 ? 51  HOH A O   1 
HETATM 2454 O  O   . HOH X  6 .  ? 24.587  11.495  22.842  1.00 73.95 ? 52  HOH A O   1 
HETATM 2455 O  O   . HOH X  6 .  ? 32.847  -0.025  26.105  1.00 85.60 ? 53  HOH A O   1 
HETATM 2456 O  O   . HOH Y  6 .  ? 24.130  -0.731  -1.411  0.50 24.30 ? 34  HOH B O   1 
HETATM 2457 O  O   . HOH Y  6 .  ? 13.156  7.364   16.992  0.50 58.10 ? 35  HOH B O   1 
HETATM 2458 O  O   . HOH Y  6 .  ? 35.674  -7.802  6.627   1.00 42.44 ? 36  HOH B O   1 
HETATM 2459 O  O   . HOH Y  6 .  ? 27.033  -9.636  3.380   1.00 28.76 ? 37  HOH B O   1 
HETATM 2460 O  O   . HOH Y  6 .  ? 18.132  -2.949  7.567   1.00 40.85 ? 38  HOH B O   1 
HETATM 2461 O  O   . HOH Y  6 .  ? 18.287  -5.560  7.633   1.00 53.12 ? 39  HOH B O   1 
HETATM 2462 O  O   . HOH Y  6 .  ? 31.059  -0.320  0.496   1.00 45.11 ? 40  HOH B O   1 
HETATM 2463 O  O   . HOH Y  6 .  ? 34.875  -4.328  -4.399  1.00 32.40 ? 41  HOH B O   1 
HETATM 2464 O  O   . HOH Y  6 .  ? 30.533  2.718   12.752  1.00 39.97 ? 42  HOH B O   1 
HETATM 2465 O  O   . HOH Y  6 .  ? 14.206  6.306   14.992  1.00 53.04 ? 43  HOH B O   1 
HETATM 2466 O  O   . HOH Y  6 .  ? 15.401  12.463  10.304  1.00 40.75 ? 44  HOH B O   1 
HETATM 2467 O  O   . HOH Y  6 .  ? 19.680  8.466   13.510  1.00 37.45 ? 45  HOH B O   1 
HETATM 2468 O  O   . HOH Y  6 .  ? 33.464  1.071   0.983   1.00 56.01 ? 46  HOH B O   1 
HETATM 2469 O  O   . HOH Y  6 .  ? 33.165  0.923   13.067  1.00 55.62 ? 47  HOH B O   1 
HETATM 2470 O  O   . HOH Y  6 .  ? 15.995  2.878   20.449  1.00 71.21 ? 48  HOH B O   1 
HETATM 2471 O  O   . HOH Y  6 .  ? 16.164  -1.242  7.906   1.00 81.12 ? 49  HOH B O   1 
HETATM 2472 O  O   . HOH Y  6 .  ? 19.536  -0.864  2.429   1.00 40.49 ? 50  HOH B O   1 
HETATM 2473 O  O   . HOH Y  6 .  ? 15.750  3.083   8.515   1.00 36.17 ? 51  HOH B O   1 
HETATM 2474 O  O   . HOH Y  6 .  ? 15.209  0.551   9.348   1.00 53.11 ? 52  HOH B O   1 
HETATM 2475 O  O   . HOH Y  6 .  ? 36.892  -4.960  2.931   1.00 63.14 ? 53  HOH B O   1 
HETATM 2476 O  O   . HOH Y  6 .  ? 36.789  -2.061  -2.976  1.00 76.83 ? 54  HOH B O   1 
HETATM 2477 O  O   . HOH Y  6 .  ? 16.751  10.656  13.030  1.00 62.73 ? 55  HOH B O   1 
HETATM 2478 O  O   . HOH Y  6 .  ? 40.861  6.229   10.186  1.00 60.62 ? 56  HOH B O   1 
HETATM 2479 O  O   . HOH Y  6 .  ? 13.826  10.384  21.789  1.00 64.00 ? 57  HOH B O   1 
HETATM 2480 O  O   . HOH Y  6 .  ? 43.067  3.062   17.244  1.00 70.04 ? 58  HOH B O   1 
HETATM 2481 O  O   . HOH Y  6 .  ? 41.207  1.543   9.654   1.00 61.61 ? 59  HOH B O   1 
HETATM 2482 O  O   . HOH Y  6 .  ? 42.277  0.427   7.372   1.00 70.57 ? 60  HOH B O   1 
HETATM 2483 O  O   . HOH Y  6 .  ? 40.602  4.299   5.653   1.00 59.35 ? 61  HOH B O   1 
HETATM 2484 O  O   . HOH Y  6 .  ? 20.882  14.774  19.431  1.00 61.39 ? 62  HOH B O   1 
HETATM 2485 O  O   . HOH Z  6 .  ? 24.995  20.814  -7.318  1.00 35.53 ? 23  HOH C O   1 
HETATM 2486 O  O   . HOH Z  6 .  ? 26.113  16.471  -8.156  1.00 47.06 ? 24  HOH C O   1 
HETATM 2487 O  O   . HOH Z  6 .  ? 32.177  17.379  6.351   1.00 55.07 ? 25  HOH C O   1 
HETATM 2488 O  O   . HOH Z  6 .  ? 23.046  14.701  -8.475  1.00 45.79 ? 26  HOH C O   1 
HETATM 2489 O  O   . HOH Z  6 .  ? 20.182  12.994  -4.551  1.00 77.75 ? 27  HOH C O   1 
HETATM 2490 O  O   . HOH Z  6 .  ? 23.498  17.865  9.839   1.00 52.72 ? 28  HOH C O   1 
HETATM 2491 O  O   . HOH Z  6 .  ? 19.478  18.613  10.402  1.00 42.60 ? 29  HOH C O   1 
HETATM 2492 O  O   . HOH Z  6 .  ? 35.132  10.855  15.604  1.00 67.13 ? 30  HOH C O   1 
HETATM 2493 O  O   . HOH Z  6 .  ? 21.005  24.251  7.155   1.00 62.47 ? 31  HOH C O   1 
HETATM 2494 O  O   . HOH Z  6 .  ? 9.319   21.887  -0.824  1.00 61.80 ? 32  HOH C O   1 
HETATM 2495 O  O   . HOH Z  6 .  ? 36.340  10.520  11.093  1.00 65.66 ? 33  HOH C O   1 
HETATM 2496 O  O   . HOH Z  6 .  ? 32.943  10.061  18.474  1.00 83.38 ? 34  HOH C O   1 
HETATM 2497 O  O   . HOH Z  6 .  ? 23.616  22.071  11.962  1.00 66.56 ? 35  HOH C O   1 
HETATM 2498 O  O   . HOH Z  6 .  ? 9.191   18.760  0.786   1.00 52.82 ? 36  HOH C O   1 
HETATM 2499 O  O   . HOH Z  6 .  ? 19.867  27.908  0.887   1.00 73.90 ? 37  HOH C O   1 
HETATM 2500 O  O   . HOH Z  6 .  ? 20.619  24.478  -2.364  1.00 70.52 ? 38  HOH C O   1 
HETATM 2501 O  O   . HOH Z  6 .  ? 19.246  22.663  -0.480  1.00 59.52 ? 39  HOH C O   1 
HETATM 2502 O  O   . HOH Z  6 .  ? 14.279  26.183  -0.959  1.00 59.35 ? 40  HOH C O   1 
HETATM 2503 O  O   . HOH Z  6 .  ? 21.076  21.280  -7.762  1.00 66.50 ? 41  HOH C O   1 
HETATM 2504 O  O   . HOH Z  6 .  ? 14.947  24.931  -5.447  1.00 89.15 ? 42  HOH C O   1 
HETATM 2505 O  O   . HOH Z  6 .  ? 16.778  29.199  -2.823  1.00 72.05 ? 43  HOH C O   1 
HETATM 2506 O  O   . HOH Z  6 .  ? 10.584  21.283  4.060   1.00 58.69 ? 44  HOH C O   1 
HETATM 2507 O  O   . HOH Z  6 .  ? 32.493  19.734  3.747   1.00 44.47 ? 45  HOH C O   1 
HETATM 2508 O  O   . HOH Z  6 .  ? 30.751  13.814  -5.205  1.00 65.49 ? 46  HOH C O   1 
HETATM 2509 O  O   . HOH AA 6 .  ? 24.333  1.142   -2.373  0.50 18.38 ? 32  HOH D O   1 
HETATM 2510 O  O   . HOH AA 6 .  ? 15.382  3.986   3.345   1.00 39.32 ? 33  HOH D O   1 
HETATM 2511 O  O   . HOH AA 6 .  ? 18.794  7.379   -1.028  1.00 39.91 ? 34  HOH D O   1 
HETATM 2512 O  O   . HOH AA 6 .  ? 16.943  4.172   1.461   1.00 37.75 ? 35  HOH D O   1 
HETATM 2513 O  O   . HOH AA 6 .  ? 16.428  8.170   -2.629  1.00 45.85 ? 36  HOH D O   1 
HETATM 2514 O  O   . HOH AA 6 .  ? 3.505   12.870  2.132   1.00 59.22 ? 37  HOH D O   1 
HETATM 2515 O  O   . HOH AA 6 .  ? 29.583  2.944   -0.132  1.00 30.40 ? 38  HOH D O   1 
HETATM 2516 O  O   . HOH AA 6 .  ? 29.758  5.486   3.695   1.00 32.59 ? 39  HOH D O   1 
HETATM 2517 O  O   . HOH AA 6 .  ? 31.691  1.992   3.318   1.00 48.12 ? 40  HOH D O   1 
HETATM 2518 O  O   . HOH AA 6 .  ? 24.726  14.980  9.328   1.00 51.62 ? 41  HOH D O   1 
HETATM 2519 O  O   . HOH AA 6 .  ? 33.465  16.658  2.571   1.00 54.46 ? 42  HOH D O   1 
HETATM 2520 O  O   . HOH AA 6 .  ? 13.987  10.614  12.709  1.00 48.50 ? 43  HOH D O   1 
HETATM 2521 O  O   . HOH AA 6 .  ? 14.768  14.314  11.303  1.00 57.37 ? 44  HOH D O   1 
HETATM 2522 O  O   . HOH AA 6 .  ? 16.958  5.023   -1.025  1.00 60.07 ? 45  HOH D O   1 
HETATM 2523 O  O   . HOH AA 6 .  ? 33.109  11.358  -2.395  1.00 57.63 ? 46  HOH D O   1 
HETATM 2524 O  O   . HOH AA 6 .  ? 29.481  3.431   -2.387  1.00 44.13 ? 47  HOH D O   1 
HETATM 2525 O  O   . HOH AA 6 .  ? 30.334  -1.007  3.570   1.00 48.95 ? 48  HOH D O   1 
HETATM 2526 O  O   . HOH AA 6 .  ? 35.803  0.072   -0.426  1.00 69.38 ? 49  HOH D O   1 
HETATM 2527 O  O   . HOH AA 6 .  ? 8.749   20.624  8.836   1.00 62.74 ? 50  HOH D O   1 
HETATM 2528 O  O   . HOH AA 6 .  ? 14.188  18.970  11.535  1.00 77.98 ? 51  HOH D O   1 
HETATM 2529 O  O   . HOH AA 6 .  ? 5.473   15.364  8.284   1.00 48.51 ? 52  HOH D O   1 
HETATM 2530 O  O   . HOH AA 6 .  ? 23.894  20.285  19.387  1.00 75.05 ? 53  HOH D O   1 
HETATM 2531 O  O   . HOH AA 6 .  ? 24.186  16.231  17.993  1.00 83.76 ? 54  HOH D O   1 
HETATM 2532 O  O   . HOH AA 6 .  ? 20.386  19.371  19.895  1.00 66.86 ? 55  HOH D O   1 
HETATM 2533 O  O   . HOH AA 6 .  ? 35.546  5.666   -1.075  1.00 64.27 ? 56  HOH D O   1 
HETATM 2534 O  O   . HOH AA 6 .  ? 34.723  0.557   -3.598  1.00 58.11 ? 57  HOH D O   1 
HETATM 2535 O  O   . HOH AA 6 .  ? 34.189  0.749   3.718   1.00 55.37 ? 58  HOH D O   1 
HETATM 2536 O  O   . HOH AA 6 .  ? 9.244   22.597  18.391  1.00 60.74 ? 59  HOH D O   1 
HETATM 2537 O  O   . HOH AA 6 .  ? 13.016  23.430  11.362  1.00 57.11 ? 60  HOH D O   1 
HETATM 2538 O  O   . HOH AA 6 .  ? 39.008  8.942   5.409   1.00 59.74 ? 61  HOH D O   1 
HETATM 2539 O  O   . HOH AA 6 .  ? 7.819   20.261  14.944  1.00 89.00 ? 62  HOH D O   1 
HETATM 2540 O  O   . HOH AA 6 .  ? 7.516   20.593  12.277  1.00 90.54 ? 63  HOH D O   1 
HETATM 2541 O  O   . HOH AA 6 .  ? 25.506  18.162  20.864  1.00 72.58 ? 64  HOH D O   1 
HETATM 2542 O  O   . HOH AA 6 .  ? 34.377  8.535   -0.978  1.00 59.88 ? 65  HOH D O   1 
HETATM 2543 O  O   . HOH AA 6 .  ? 15.732  15.063  14.148  1.00 78.35 ? 66  HOH D O   1 
HETATM 2544 O  O   . HOH BA 6 .  ? 13.786  -19.566 -9.046  0.50 30.74 ? 23  HOH E O   1 
HETATM 2545 O  O   . HOH BA 6 .  ? 13.023  -21.656 -8.631  0.50 38.65 ? 24  HOH E O   1 
HETATM 2546 O  O   . HOH BA 6 .  ? 10.553  -25.309 7.442   1.00 68.43 ? 25  HOH E O   1 
HETATM 2547 O  O   . HOH BA 6 .  ? 8.103   -20.075 -9.987  1.00 77.61 ? 26  HOH E O   1 
HETATM 2548 O  O   . HOH BA 6 .  ? 4.403   -19.586 -9.092  1.00 73.05 ? 27  HOH E O   1 
HETATM 2549 O  O   . HOH BA 6 .  ? 3.263   -15.929 -10.722 1.00 60.97 ? 28  HOH E O   1 
HETATM 2550 O  O   . HOH BA 6 .  ? -2.386  -12.868 -9.479  1.00 74.78 ? 29  HOH E O   1 
HETATM 2551 O  O   . HOH BA 6 .  ? 6.546   -13.237 -10.978 1.00 67.92 ? 30  HOH E O   1 
HETATM 2552 O  O   . HOH BA 6 .  ? -3.106  -16.049 7.114   1.00 64.90 ? 31  HOH E O   1 
HETATM 2553 O  O   . HOH BA 6 .  ? -2.047  -19.062 2.217   1.00 53.90 ? 32  HOH E O   1 
HETATM 2554 O  O   . HOH BA 6 .  ? 19.608  -26.058 5.626   1.00 72.56 ? 33  HOH E O   1 
HETATM 2555 O  O   . HOH BA 6 .  ? 18.227  -21.286 -9.420  1.00 65.74 ? 34  HOH E O   1 
HETATM 2556 O  O   . HOH BA 6 .  ? -4.522  -12.752 11.187  1.00 76.82 ? 35  HOH E O   1 
HETATM 2557 O  O   . HOH BA 6 .  ? 17.483  -22.840 11.745  1.00 95.53 ? 36  HOH E O   1 
HETATM 2558 O  O   . HOH BA 6 .  ? 16.269  -28.515 -1.992  1.00 73.11 ? 37  HOH E O   1 
HETATM 2559 O  O   . HOH BA 6 .  ? 0.379   -9.514  -8.554  1.00 92.86 ? 38  HOH E O   1 
HETATM 2560 O  O   . HOH BA 6 .  ? 18.323  -26.066 -2.827  1.00 83.04 ? 39  HOH E O   1 
HETATM 2561 O  O   . HOH CA 6 .  ? 17.881  -16.121 12.491  0.50 44.05 ? 31  HOH F O   1 
HETATM 2562 O  O   . HOH CA 6 .  ? 18.434  -14.901 10.462  0.50 37.38 ? 32  HOH F O   1 
HETATM 2563 O  O   . HOH CA 6 .  ? 27.251  -12.450 3.186   1.00 37.52 ? 33  HOH F O   1 
HETATM 2564 O  O   . HOH CA 6 .  ? 21.498  -14.644 8.586   1.00 33.93 ? 34  HOH F O   1 
HETATM 2565 O  O   . HOH CA 6 .  ? 15.571  -4.118  2.575   1.00 35.45 ? 35  HOH F O   1 
HETATM 2566 O  O   . HOH CA 6 .  ? 14.793  -3.744  7.293   1.00 34.54 ? 36  HOH F O   1 
HETATM 2567 O  O   . HOH CA 6 .  ? 12.723  -5.111  5.156   1.00 60.92 ? 37  HOH F O   1 
HETATM 2568 O  O   . HOH CA 6 .  ? 0.990   -2.088  -2.845  1.00 54.16 ? 38  HOH F O   1 
HETATM 2569 O  O   . HOH CA 6 .  ? 0.786   -5.048  2.708   1.00 34.33 ? 39  HOH F O   1 
HETATM 2570 O  O   . HOH CA 6 .  ? 11.264  -19.153 7.999   1.00 49.52 ? 40  HOH F O   1 
HETATM 2571 O  O   . HOH CA 6 .  ? 18.016  -20.938 5.818   1.00 73.28 ? 41  HOH F O   1 
HETATM 2572 O  O   . HOH CA 6 .  ? 16.597  -11.718 11.060  1.00 51.11 ? 42  HOH F O   1 
HETATM 2573 O  O   . HOH CA 6 .  ? 5.672   -15.752 6.611   1.00 42.37 ? 43  HOH F O   1 
HETATM 2574 O  O   . HOH CA 6 .  ? 5.678   -21.058 9.939   1.00 58.63 ? 44  HOH F O   1 
HETATM 2575 O  O   . HOH CA 6 .  ? 8.110   -2.222  -0.130  1.00 28.04 ? 45  HOH F O   1 
HETATM 2576 O  O   . HOH CA 6 .  ? 9.769   -0.209  -1.401  1.00 42.33 ? 46  HOH F O   1 
HETATM 2577 O  O   . HOH CA 6 .  ? 12.526  -6.674  -2.094  1.00 49.41 ? 47  HOH F O   1 
HETATM 2578 O  O   . HOH CA 6 .  ? 13.783  -4.745  -1.541  1.00 55.73 ? 48  HOH F O   1 
HETATM 2579 O  O   . HOH CA 6 .  ? 16.745  -16.899 9.298   1.00 80.58 ? 49  HOH F O   1 
HETATM 2580 O  O   . HOH CA 6 .  ? 15.762  -12.592 13.290  1.00 65.02 ? 50  HOH F O   1 
HETATM 2581 O  O   . HOH CA 6 .  ? 23.103  -17.792 12.336  1.00 54.72 ? 51  HOH F O   1 
HETATM 2582 O  O   . HOH CA 6 .  ? 5.745   -20.670 13.452  1.00 71.01 ? 52  HOH F O   1 
HETATM 2583 O  O   . HOH CA 6 .  ? 6.382   -18.099 14.634  1.00 61.05 ? 53  HOH F O   1 
HETATM 2584 O  O   . HOH CA 6 .  ? -6.956  -8.331  5.081   1.00 61.32 ? 54  HOH F O   1 
HETATM 2585 O  O   . HOH CA 6 .  ? 6.534   -24.749 21.097  1.00 73.57 ? 55  HOH F O   1 
HETATM 2586 O  O   . HOH CA 6 .  ? 20.041  -16.518 9.862   1.00 64.17 ? 56  HOH F O   1 
HETATM 2587 O  O   . HOH CA 6 .  ? -8.432  -5.667  1.324   1.00 49.65 ? 57  HOH F O   1 
HETATM 2588 O  O   . HOH CA 6 .  ? -4.930  0.451   -1.739  1.00 59.98 ? 58  HOH F O   1 
HETATM 2589 O  O   . HOH CA 6 .  ? -3.791  -3.737  -3.181  1.00 65.31 ? 59  HOH F O   1 
HETATM 2590 O  O   . HOH DA 6 .  ? 13.179  7.157   18.864  0.50 49.15 ? 23  HOH G O   1 
HETATM 2591 O  O   . HOH DA 6 .  ? 3.568   7.976   18.605  1.00 44.86 ? 24  HOH G O   1 
HETATM 2592 O  O   . HOH DA 6 .  ? 7.803   -2.036  24.381  1.00 40.94 ? 25  HOH G O   1 
HETATM 2593 O  O   . HOH DA 6 .  ? 0.381   14.189  11.014  1.00 66.60 ? 26  HOH G O   1 
HETATM 2594 O  O   . HOH DA 6 .  ? -2.755  11.141  18.060  1.00 60.18 ? 27  HOH G O   1 
HETATM 2595 O  O   . HOH DA 6 .  ? 13.873  4.711   19.482  1.00 61.33 ? 28  HOH G O   1 
HETATM 2596 O  O   . HOH DA 6 .  ? 10.287  8.684   19.268  1.00 52.30 ? 29  HOH G O   1 
HETATM 2597 O  O   . HOH DA 6 .  ? 14.868  -1.394  21.902  1.00 57.37 ? 30  HOH G O   1 
HETATM 2598 O  O   . HOH DA 6 .  ? -1.492  6.630   19.349  1.00 80.57 ? 31  HOH G O   1 
HETATM 2599 O  O   . HOH DA 6 .  ? 8.043   8.746   21.521  1.00 80.45 ? 32  HOH G O   1 
HETATM 2600 O  O   . HOH DA 6 .  ? 11.400  4.862   15.038  1.00 55.73 ? 33  HOH G O   1 
HETATM 2601 O  O   . HOH DA 6 .  ? -0.588  -2.571  20.635  1.00 63.44 ? 34  HOH G O   1 
HETATM 2602 O  O   . HOH DA 6 .  ? -2.105  -0.295  19.036  1.00 67.33 ? 35  HOH G O   1 
HETATM 2603 O  O   . HOH DA 6 .  ? 1.535   -11.305 21.045  1.00 71.47 ? 36  HOH G O   1 
HETATM 2604 O  O   . HOH DA 6 .  ? 3.183   -8.166  20.793  1.00 52.07 ? 37  HOH G O   1 
HETATM 2605 O  O   . HOH DA 6 .  ? 4.796   -20.758 23.548  1.00 71.23 ? 38  HOH G O   1 
HETATM 2606 O  O   . HOH DA 6 .  ? -7.683  1.996   13.431  1.00 69.88 ? 39  HOH G O   1 
HETATM 2607 O  O   . HOH DA 6 .  ? 0.836   10.576  19.678  1.00 72.03 ? 40  HOH G O   1 
HETATM 2608 O  O   . HOH DA 6 .  ? 11.909  -3.297  21.433  1.00 56.20 ? 41  HOH G O   1 
HETATM 2609 O  O   . HOH DA 6 .  ? -9.122  -1.942  15.335  1.00 65.27 ? 42  HOH G O   1 
HETATM 2610 O  O   . HOH DA 6 .  ? -13.622 0.588   14.197  1.00 81.91 ? 43  HOH G O   1 
HETATM 2611 O  O   . HOH DA 6 .  ? 0.168   -6.817  15.518  1.00 61.87 ? 44  HOH G O   1 
HETATM 2612 O  O   . HOH DA 6 .  ? -10.582 -5.452  13.658  1.00 74.72 ? 45  HOH G O   1 
HETATM 2613 O  O   . HOH DA 6 .  ? 3.413   15.934  12.998  1.00 80.31 ? 46  HOH G O   1 
HETATM 2614 O  O   . HOH EA 6 .  ? 10.499  -9.881  12.278  1.00 35.96 ? 32  HOH H O   1 
HETATM 2615 O  O   . HOH EA 6 .  ? 11.077  1.181   2.446   1.00 25.89 ? 33  HOH H O   1 
HETATM 2616 O  O   . HOH EA 6 .  ? 0.285   0.596   4.647   1.00 54.53 ? 34  HOH H O   1 
HETATM 2617 O  O   . HOH EA 6 .  ? 16.481  -8.084  13.958  1.00 39.63 ? 35  HOH H O   1 
HETATM 2618 O  O   . HOH EA 6 .  ? 15.696  -13.834 9.053   1.00 56.73 ? 36  HOH H O   1 
HETATM 2619 O  O   . HOH EA 6 .  ? -3.970  8.675   8.649   1.00 65.17 ? 37  HOH H O   1 
HETATM 2620 O  O   . HOH EA 6 .  ? 3.494   9.748   5.647   1.00 53.80 ? 38  HOH H O   1 
HETATM 2621 O  O   . HOH EA 6 .  ? 15.176  -9.077  12.575  1.00 42.51 ? 39  HOH H O   1 
HETATM 2622 O  O   . HOH EA 6 .  ? 0.417   -4.561  12.682  1.00 51.98 ? 40  HOH H O   1 
HETATM 2623 O  O   . HOH EA 6 .  ? -7.424  4.110   -1.965  1.00 73.56 ? 41  HOH H O   1 
HETATM 2624 O  O   . HOH EA 6 .  ? 13.424  -10.233 18.931  1.00 58.20 ? 42  HOH H O   1 
HETATM 2625 O  O   . HOH EA 6 .  ? 15.137  0.559   3.100   1.00 48.67 ? 43  HOH H O   1 
HETATM 2626 O  O   . HOH EA 6 .  ? 17.074  -1.059  4.800   1.00 52.71 ? 44  HOH H O   1 
HETATM 2627 O  O   . HOH EA 6 .  ? 12.709  4.147   8.230   1.00 50.67 ? 45  HOH H O   1 
HETATM 2628 O  O   . HOH EA 6 .  ? 13.315  2.303   6.110   1.00 42.94 ? 46  HOH H O   1 
HETATM 2629 O  O   . HOH EA 6 .  ? 12.261  2.023   8.432   1.00 46.82 ? 47  HOH H O   1 
HETATM 2630 O  O   . HOH EA 6 .  ? 9.948   -2.462  2.928   1.00 51.40 ? 48  HOH H O   1 
HETATM 2631 O  O   . HOH EA 6 .  ? -1.744  2.862   1.405   1.00 60.39 ? 49  HOH H O   1 
HETATM 2632 O  O   . HOH EA 6 .  ? 12.923  -22.617 17.435  1.00 62.37 ? 50  HOH H O   1 
HETATM 2633 O  O   . HOH EA 6 .  ? 18.950  -22.597 15.465  1.00 61.50 ? 51  HOH H O   1 
HETATM 2634 O  O   . HOH EA 6 .  ? 13.535  -12.469 11.093  1.00 49.98 ? 52  HOH H O   1 
HETATM 2635 O  O   . HOH EA 6 .  ? 4.514   9.203   3.894   1.00 55.12 ? 53  HOH H O   1 
HETATM 2636 O  O   . HOH EA 6 .  ? 10.430  -16.100 19.344  1.00 68.58 ? 54  HOH H O   1 
HETATM 2637 O  O   . HOH EA 6 .  ? -4.152  4.753   1.114   1.00 53.54 ? 55  HOH H O   1 
HETATM 2638 O  O   . HOH EA 6 .  ? -8.977  0.530   -2.324  1.00 74.73 ? 56  HOH H O   1 
HETATM 2639 O  O   . HOH EA 6 .  ? -10.083 -0.300  -5.818  1.00 81.15 ? 57  HOH H O   1 
HETATM 2640 O  O   . HOH EA 6 .  ? -3.940  3.413   6.268   1.00 71.57 ? 58  HOH H O   1 
HETATM 2641 O  O   . HOH FA 6 .  ? 35.769  -8.120  -5.125  1.00 50.13 ? 48  HOH I O   1 
HETATM 2642 O  O   . HOH FA 6 .  ? 22.881  -4.197  -18.057 1.00 52.32 ? 60  HOH I O   1 
HETATM 2643 O  O   . HOH FA 6 .  ? 25.579  5.186   -21.514 1.00 49.10 ? 100 HOH I O   1 
HETATM 2644 O  O   . HOH FA 6 .  ? 31.594  -7.352  -10.588 1.00 37.08 ? 106 HOH I O   1 
HETATM 2645 O  O   . HOH FA 6 .  ? 34.939  0.938   -7.286  1.00 49.30 ? 107 HOH I O   1 
HETATM 2646 O  O   . HOH FA 6 .  ? 26.189  -10.474 -5.584  1.00 55.34 ? 140 HOH I O   1 
HETATM 2647 O  O   . HOH FA 6 .  ? 28.605  2.359   -5.549  1.00 48.07 ? 143 HOH I O   1 
HETATM 2648 O  O   . HOH FA 6 .  ? 34.529  -4.847  -14.517 1.00 77.73 ? 145 HOH I O   1 
HETATM 2649 O  O   . HOH FA 6 .  ? 33.858  -3.454  -11.654 1.00 61.43 ? 146 HOH I O   1 
HETATM 2650 O  O   . HOH FA 6 .  ? 29.896  9.052   -20.660 1.00 63.96 ? 153 HOH I O   1 
HETATM 2651 O  O   . HOH FA 6 .  ? 31.824  6.148   -5.900  1.00 53.87 ? 157 HOH I O   1 
HETATM 2652 O  O   . HOH FA 6 .  ? 35.483  5.656   -5.616  1.00 61.09 ? 158 HOH I O   1 
HETATM 2653 O  O   . HOH FA 6 .  ? 37.743  -3.176  -6.825  1.00 74.15 ? 164 HOH I O   1 
HETATM 2654 O  O   . HOH FA 6 .  ? 28.093  5.995   -21.022 1.00 47.45 ? 182 HOH I O   1 
HETATM 2655 O  O   . HOH FA 6 .  ? 34.465  -8.077  -11.777 1.00 61.99 ? 210 HOH I O   1 
HETATM 2656 O  O   . HOH FA 6 .  ? 37.380  -4.496  -10.170 1.00 53.98 ? 213 HOH I O   1 
HETATM 2657 O  O   . HOH FA 6 .  ? 38.415  0.170   -10.505 1.00 77.38 ? 218 HOH I O   1 
HETATM 2658 O  O   . HOH FA 6 .  ? 36.986  2.481   -9.012  1.00 62.28 ? 219 HOH I O   1 
HETATM 2659 O  O   . HOH FA 6 .  ? 38.780  0.829   -6.350  1.00 60.27 ? 220 HOH I O   1 
HETATM 2660 O  O   . HOH FA 6 .  ? 35.488  5.125   -11.845 1.00 57.37 ? 221 HOH I O   1 
HETATM 2661 O  O   . HOH FA 6 .  ? 34.164  10.074  -14.170 1.00 76.45 ? 222 HOH I O   1 
HETATM 2662 O  O   . HOH FA 6 .  ? 36.869  6.084   -17.289 1.00 60.91 ? 223 HOH I O   1 
HETATM 2663 O  O   . HOH FA 6 .  ? 30.214  11.500  -16.785 1.00 80.88 ? 224 HOH I O   1 
HETATM 2664 O  O   . HOH FA 6 .  ? 36.539  2.736   -14.714 1.00 65.05 ? 225 HOH I O   1 
HETATM 2665 O  O   . HOH FA 6 .  ? 34.283  0.443   -16.908 1.00 62.12 ? 226 HOH I O   1 
HETATM 2666 O  O   . HOH FA 6 .  ? 29.709  -10.048 -11.010 1.00 62.24 ? 248 HOH I O   1 
HETATM 2667 O  O   . HOH FA 6 .  ? 18.777  4.940   -22.586 1.00 63.95 ? 266 HOH I O   1 
HETATM 2668 O  O   . HOH FA 6 .  ? 33.856  2.465   -5.786  1.00 51.76 ? 269 HOH I O   1 
HETATM 2669 O  O   . HOH FA 6 .  ? 37.652  0.536   -15.445 1.00 56.08 ? 276 HOH I O   1 
HETATM 2670 O  O   . HOH FA 6 .  ? 35.522  -1.924  -10.025 1.00 59.40 ? 316 HOH I O   1 
HETATM 2671 O  O   . HOH FA 6 .  ? 31.901  -1.091  -15.267 1.00 74.21 ? 328 HOH I O   1 
HETATM 2672 O  O   . HOH FA 6 .  ? 29.714  11.023  -9.339  1.00 75.79 ? 329 HOH I O   1 
HETATM 2673 O  O   . HOH GA 6 .  ? 21.615  -21.735 -1.888  0.50 33.03 ? 31  HOH J O   1 
HETATM 2674 O  O   . HOH GA 6 .  ? 21.785  -21.103 -0.319  0.50 33.78 ? 32  HOH J O   1 
HETATM 2675 O  O   . HOH GA 6 .  ? 22.311  1.034   -3.097  0.50 33.44 ? 33  HOH J O   1 
HETATM 2676 O  O   . HOH GA 6 .  ? 17.484  5.667   -4.286  1.00 32.26 ? 34  HOH J O   1 
HETATM 2677 O  O   . HOH GA 6 .  ? 20.010  -14.709 -7.441  1.00 45.06 ? 35  HOH J O   1 
HETATM 2678 O  O   . HOH GA 6 .  ? 22.493  -18.027 -6.878  1.00 53.17 ? 36  HOH J O   1 
HETATM 2679 O  O   . HOH GA 6 .  ? 16.813  8.217   -11.923 1.00 30.92 ? 37  HOH J O   1 
HETATM 2680 O  O   . HOH GA 6 .  ? 21.256  -1.981  -16.882 1.00 43.64 ? 38  HOH J O   1 
HETATM 2681 O  O   . HOH GA 6 .  ? 26.886  -11.843 -7.698  1.00 61.06 ? 39  HOH J O   1 
HETATM 2682 O  O   . HOH GA 6 .  ? 14.474  -7.027  -3.651  1.00 48.15 ? 40  HOH J O   1 
HETATM 2683 O  O   . HOH GA 6 .  ? 16.989  10.966  -8.720  1.00 33.74 ? 41  HOH J O   1 
HETATM 2684 O  O   . HOH GA 6 .  ? 16.882  0.867   0.551   1.00 51.87 ? 42  HOH J O   1 
HETATM 2685 O  O   . HOH GA 6 .  ? 17.186  -2.393  -1.879  1.00 42.98 ? 43  HOH J O   1 
HETATM 2686 O  O   . HOH GA 6 .  ? 19.393  -10.732 -12.456 1.00 53.22 ? 44  HOH J O   1 
HETATM 2687 O  O   . HOH GA 6 .  ? 17.394  -13.061 -12.971 1.00 65.62 ? 45  HOH J O   1 
HETATM 2688 O  O   . HOH GA 6 .  ? 15.679  -10.518 -9.687  1.00 43.05 ? 46  HOH J O   1 
HETATM 2689 O  O   . HOH GA 6 .  ? 19.953  -18.305 -19.461 1.00 72.71 ? 47  HOH J O   1 
HETATM 2690 O  O   . HOH GA 6 .  ? 13.832  -11.607 -11.184 1.00 62.10 ? 48  HOH J O   1 
HETATM 2691 O  O   . HOH GA 6 .  ? 12.233  -13.494 -12.276 1.00 57.06 ? 49  HOH J O   1 
HETATM 2692 O  O   . HOH GA 6 .  ? 17.619  -19.573 -14.638 1.00 58.75 ? 50  HOH J O   1 
HETATM 2693 O  O   . HOH GA 6 .  ? 21.376  -17.496 -12.130 1.00 55.45 ? 51  HOH J O   1 
HETATM 2694 O  O   . HOH GA 6 .  ? 21.734  13.285  -10.228 1.00 51.66 ? 52  HOH J O   1 
HETATM 2695 O  O   . HOH GA 6 .  ? 12.744  -7.617  -4.975  1.00 58.71 ? 53  HOH J O   1 
HETATM 2696 O  O   . HOH GA 6 .  ? 18.654  19.319  -20.175 1.00 73.80 ? 54  HOH J O   1 
HETATM 2697 O  O   . HOH GA 6 .  ? 18.787  20.796  -16.792 1.00 61.50 ? 55  HOH J O   1 
HETATM 2698 O  O   . HOH GA 6 .  ? 27.821  -13.575 -11.264 1.00 88.05 ? 56  HOH J O   1 
HETATM 2699 O  O   . HOH HA 6 .  ? -3.969  6.216   -3.455  0.50 33.11 ? 23  HOH K O   1 
HETATM 2700 O  O   . HOH HA 6 .  ? 2.449   -0.671  -5.215  1.00 46.57 ? 24  HOH K O   1 
HETATM 2701 O  O   . HOH HA 6 .  ? -5.436  9.258   -4.220  1.00 63.53 ? 25  HOH K O   1 
HETATM 2702 O  O   . HOH HA 6 .  ? -3.487  4.396   -10.297 1.00 77.04 ? 26  HOH K O   1 
HETATM 2703 O  O   . HOH HA 6 .  ? 10.960  -4.444  -25.071 1.00 66.20 ? 27  HOH K O   1 
HETATM 2704 O  O   . HOH HA 6 .  ? -3.220  3.676   -15.898 1.00 80.39 ? 28  HOH K O   1 
HETATM 2705 O  O   . HOH HA 6 .  ? -4.107  0.666   -5.942  1.00 48.12 ? 29  HOH K O   1 
HETATM 2706 O  O   . HOH HA 6 .  ? -5.192  -2.591  -11.120 1.00 59.65 ? 30  HOH K O   1 
HETATM 2707 O  O   . HOH HA 6 .  ? 9.964   -8.757  -23.396 1.00 67.18 ? 31  HOH K O   1 
HETATM 2708 O  O   . HOH HA 6 .  ? 4.739   11.020  -3.292  1.00 54.64 ? 32  HOH K O   1 
HETATM 2709 O  O   . HOH HA 6 .  ? 0.818   12.429  -16.850 1.00 90.57 ? 33  HOH K O   1 
HETATM 2710 O  O   . HOH HA 6 .  ? -7.075  -1.512  -21.366 1.00 74.19 ? 34  HOH K O   1 
HETATM 2711 O  O   . HOH HA 6 .  ? 9.006   1.793   -17.930 1.00 58.53 ? 35  HOH K O   1 
HETATM 2712 O  O   . HOH HA 6 .  ? -7.102  2.262   -7.479  1.00 62.00 ? 36  HOH K O   1 
HETATM 2713 O  O   . HOH HA 6 .  ? -5.156  10.736  -7.572  1.00 57.99 ? 37  HOH K O   1 
HETATM 2714 O  O   . HOH HA 6 .  ? -9.025  -2.195  -13.877 1.00 89.08 ? 38  HOH K O   1 
HETATM 2715 O  O   . HOH HA 6 .  ? -8.394  -4.132  -9.785  1.00 91.74 ? 39  HOH K O   1 
HETATM 2716 O  O   . HOH HA 6 .  ? -5.782  -0.480  -8.226  1.00 66.14 ? 40  HOH K O   1 
HETATM 2717 O  O   . HOH HA 6 .  ? 4.806   -4.208  -20.426 1.00 49.16 ? 41  HOH K O   1 
HETATM 2718 O  O   . HOH HA 6 .  ? -7.388  2.515   -19.327 1.00 74.84 ? 42  HOH K O   1 
HETATM 2719 O  O   . HOH HA 6 .  ? 4.085   -3.678  -25.727 1.00 76.80 ? 43  HOH K O   1 
HETATM 2720 O  O   . HOH HA 6 .  ? 0.323   -5.105  -24.318 1.00 70.02 ? 44  HOH K O   1 
HETATM 2721 O  O   . HOH HA 6 .  ? 2.038   -1.240  -25.802 1.00 67.31 ? 45  HOH K O   1 
HETATM 2722 O  O   . HOH HA 6 .  ? 4.878   -7.726  -23.360 1.00 68.14 ? 46  HOH K O   1 
HETATM 2723 O  O   . HOH HA 6 .  ? 1.576   11.941  -22.684 1.00 81.96 ? 47  HOH K O   1 
HETATM 2724 O  O   . HOH IA 6 .  ? 12.615  -4.333  -4.899  0.50 21.47 ? 31  HOH L O   1 
HETATM 2725 O  O   . HOH IA 6 .  ? 13.143  2.819   -1.331  1.00 38.14 ? 32  HOH L O   1 
HETATM 2726 O  O   . HOH IA 6 .  ? 8.816   13.950  2.773   1.00 69.31 ? 33  HOH L O   1 
HETATM 2727 O  O   . HOH IA 6 .  ? 13.685  -8.923  -10.281 1.00 44.23 ? 34  HOH L O   1 
HETATM 2728 O  O   . HOH IA 6 .  ? 11.117  -10.609 -9.732  1.00 48.51 ? 35  HOH L O   1 
HETATM 2729 O  O   . HOH IA 6 .  ? 9.161   4.921   -16.812 1.00 44.80 ? 36  HOH L O   1 
HETATM 2730 O  O   . HOH IA 6 .  ? 13.653  -5.952  -13.202 1.00 31.53 ? 37  HOH L O   1 
HETATM 2731 O  O   . HOH IA 6 .  ? 5.528   -9.471  -12.646 1.00 51.85 ? 38  HOH L O   1 
HETATM 2732 O  O   . HOH IA 6 .  ? 7.309   19.958  -7.772  1.00 74.68 ? 39  HOH L O   1 
HETATM 2733 O  O   . HOH IA 6 .  ? 15.151  2.194   -5.020  1.00 37.27 ? 40  HOH L O   1 
HETATM 2734 O  O   . HOH IA 6 .  ? 12.431  10.458  -10.628 1.00 54.27 ? 41  HOH L O   1 
HETATM 2735 O  O   . HOH IA 6 .  ? 15.567  12.888  -9.030  1.00 56.10 ? 42  HOH L O   1 
HETATM 2736 O  O   . HOH IA 6 .  ? 11.656  14.229  -8.241  1.00 46.66 ? 43  HOH L O   1 
HETATM 2737 O  O   . HOH IA 6 .  ? 8.532   0.010   -3.161  1.00 40.33 ? 44  HOH L O   1 
HETATM 2738 O  O   . HOH IA 6 .  ? 10.375  -5.967  -4.039  1.00 69.80 ? 45  HOH L O   1 
HETATM 2739 O  O   . HOH IA 6 .  ? 7.058   11.250  1.661   1.00 73.10 ? 46  HOH L O   1 
HETATM 2740 O  O   . HOH IA 6 .  ? 7.434   7.389   -17.383 1.00 48.42 ? 47  HOH L O   1 
HETATM 2741 O  O   . HOH IA 6 .  ? 15.300  -12.104 -20.190 1.00 55.81 ? 48  HOH L O   1 
HETATM 2742 O  O   . HOH IA 6 .  ? 12.239  -15.732 -17.321 1.00 56.43 ? 49  HOH L O   1 
HETATM 2743 O  O   . HOH IA 6 .  ? 5.669   11.284  -26.292 1.00 79.07 ? 50  HOH L O   1 
HETATM 2744 O  O   . HOH IA 6 .  ? 10.084  -13.382 -17.689 1.00 60.27 ? 51  HOH L O   1 
HETATM 2745 O  O   . HOH IA 6 .  ? 7.188   16.485  -19.968 1.00 62.71 ? 52  HOH L O   1 
HETATM 2746 O  O   . HOH IA 6 .  ? 17.336  15.516  -8.942  1.00 92.61 ? 53  HOH L O   1 
HETATM 2747 O  O   . HOH IA 6 .  ? 11.034  -12.736 -15.830 1.00 67.48 ? 54  HOH L O   1 
HETATM 2748 O  O   . HOH IA 6 .  ? 10.220  9.181   -25.207 1.00 65.81 ? 55  HOH L O   1 
HETATM 2749 O  O   . HOH IA 6 .  ? 12.928  11.034  -22.925 1.00 83.95 ? 56  HOH L O   1 
HETATM 2750 O  O   . HOH IA 6 .  ? 14.374  15.006  -23.785 1.00 71.12 ? 57  HOH L O   1 
HETATM 2751 O  O   . HOH IA 6 .  ? 18.351  15.906  -22.387 1.00 67.17 ? 58  HOH L O   1 
HETATM 2752 O  O   . HOH IA 6 .  ? 12.428  -11.408 -21.457 1.00 74.21 ? 59  HOH L O   1 
HETATM 2753 O  O   . HOH IA 6 .  ? 8.055   6.056   -22.282 1.00 60.05 ? 60  HOH L O   1 
HETATM 2754 O  O   . HOH IA 6 .  ? 10.099  -12.397 -19.862 1.00 53.63 ? 61  HOH L O   1 
HETATM 2755 O  O   . HOH IA 6 .  ? 7.032   13.339  -23.363 1.00 64.45 ? 62  HOH L O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
B 2 1  PHE 1  1  1  PHE PHE B . n 
B 2 2  VAL 2  2  2  VAL VAL B . n 
B 2 3  ASN 3  3  3  ASN ASN B . n 
B 2 4  GLN 4  4  4  GLN GLN B . n 
B 2 5  HIS 5  5  5  HIS HIS B . n 
B 2 6  LEU 6  6  6  LEU LEU B . n 
B 2 7  CYS 7  7  7  CYS CYS B . n 
B 2 8  GLY 8  8  8  GLY GLY B . n 
B 2 9  SER 9  9  9  SER SER B . n 
B 2 10 HIS 10 10 10 HIS HIS B . n 
B 2 11 LEU 11 11 11 LEU LEU B . n 
B 2 12 VAL 12 12 12 VAL VAL B . n 
B 2 13 GLU 13 13 13 GLU GLU B . n 
B 2 14 ALA 14 14 14 ALA ALA B . n 
B 2 15 LEU 15 15 15 LEU LEU B . n 
B 2 16 TYR 16 16 16 TYR TYR B . n 
B 2 17 LEU 17 17 17 LEU LEU B . n 
B 2 18 VAL 18 18 18 VAL VAL B . n 
B 2 19 CYS 19 19 19 CYS CYS B . n 
B 2 20 GLY 20 20 20 GLY GLY B . n 
B 2 21 GLU 21 21 21 GLU GLU B . n 
B 2 22 ARG 22 22 22 ARG ARG B . n 
B 2 23 GLY 23 23 23 GLY GLY B . n 
B 2 24 PHE 24 24 24 PHE PHE B . n 
B 2 25 PHE 25 25 25 PHE PHE B . n 
B 2 26 TYR 26 26 26 TYR TYR B . n 
B 2 27 THR 27 27 27 THR THR B . n 
B 2 28 PRO 28 28 28 PRO PRO B . n 
B 2 29 LYS 29 29 29 LYS LYS B . n 
B 2 30 THR 30 30 30 THR THR B . n 
C 1 1  GLY 1  1  1  GLY GLY C . n 
C 1 2  ILE 2  2  2  ILE ILE C . n 
C 1 3  VAL 3  3  3  VAL VAL C . n 
C 1 4  GLU 4  4  4  GLU GLU C . n 
C 1 5  GLN 5  5  5  GLN GLN C . n 
C 1 6  CYS 6  6  6  CYS CYS C . n 
C 1 7  CYS 7  7  7  CYS CYS C . n 
C 1 8  THR 8  8  8  THR THR C . n 
C 1 9  SER 9  9  9  SER SER C . n 
C 1 10 ILE 10 10 10 ILE ILE C . n 
C 1 11 CYS 11 11 11 CYS CYS C . n 
C 1 12 SER 12 12 12 SER SER C . n 
C 1 13 LEU 13 13 13 LEU LEU C . n 
C 1 14 TYR 14 14 14 TYR TYR C . n 
C 1 15 GLN 15 15 15 GLN GLN C . n 
C 1 16 LEU 16 16 16 LEU LEU C . n 
C 1 17 GLU 17 17 17 GLU GLU C . n 
C 1 18 ASN 18 18 18 ASN ASN C . n 
C 1 19 TYR 19 19 19 TYR TYR C . n 
C 1 20 CYS 20 20 20 CYS CYS C . n 
C 1 21 ASN 21 21 21 ASN ASN C . n 
D 2 1  PHE 1  1  1  PHE PHE D . n 
D 2 2  VAL 2  2  2  VAL VAL D . n 
D 2 3  ASN 3  3  3  ASN ASN D . n 
D 2 4  GLN 4  4  4  GLN GLN D . n 
D 2 5  HIS 5  5  5  HIS HIS D . n 
D 2 6  LEU 6  6  6  LEU LEU D . n 
D 2 7  CYS 7  7  7  CYS CYS D . n 
D 2 8  GLY 8  8  8  GLY GLY D . n 
D 2 9  SER 9  9  9  SER SER D . n 
D 2 10 HIS 10 10 10 HIS HIS D . n 
D 2 11 LEU 11 11 11 LEU LEU D . n 
D 2 12 VAL 12 12 12 VAL VAL D . n 
D 2 13 GLU 13 13 13 GLU GLU D . n 
D 2 14 ALA 14 14 14 ALA ALA D . n 
D 2 15 LEU 15 15 15 LEU LEU D . n 
D 2 16 TYR 16 16 16 TYR TYR D . n 
D 2 17 LEU 17 17 17 LEU LEU D . n 
D 2 18 VAL 18 18 18 VAL VAL D . n 
D 2 19 CYS 19 19 19 CYS CYS D . n 
D 2 20 GLY 20 20 20 GLY GLY D . n 
D 2 21 GLU 21 21 21 GLU GLU D . n 
D 2 22 ARG 22 22 22 ARG ARG D . n 
D 2 23 GLY 23 23 23 GLY GLY D . n 
D 2 24 PHE 24 24 24 PHE PHE D . n 
D 2 25 PHE 25 25 25 PHE PHE D . n 
D 2 26 TYR 26 26 26 TYR TYR D . n 
D 2 27 THR 27 27 27 THR THR D . n 
D 2 28 PRO 28 28 28 PRO PRO D . n 
D 2 29 LYS 29 29 29 LYS LYS D . n 
D 2 30 THR 30 30 ?  ?   ?   D . n 
E 1 1  GLY 1  1  1  GLY GLY E . n 
E 1 2  ILE 2  2  2  ILE ILE E . n 
E 1 3  VAL 3  3  3  VAL VAL E . n 
E 1 4  GLU 4  4  4  GLU GLU E . n 
E 1 5  GLN 5  5  5  GLN GLN E . n 
E 1 6  CYS 6  6  6  CYS CYS E . n 
E 1 7  CYS 7  7  7  CYS CYS E . n 
E 1 8  THR 8  8  8  THR THR E . n 
E 1 9  SER 9  9  9  SER SER E . n 
E 1 10 ILE 10 10 10 ILE ILE E . n 
E 1 11 CYS 11 11 11 CYS CYS E . n 
E 1 12 SER 12 12 12 SER SER E . n 
E 1 13 LEU 13 13 13 LEU LEU E . n 
E 1 14 TYR 14 14 14 TYR TYR E . n 
E 1 15 GLN 15 15 15 GLN GLN E . n 
E 1 16 LEU 16 16 16 LEU LEU E . n 
E 1 17 GLU 17 17 17 GLU GLU E . n 
E 1 18 ASN 18 18 18 ASN ASN E . n 
E 1 19 TYR 19 19 19 TYR TYR E . n 
E 1 20 CYS 20 20 20 CYS CYS E . n 
E 1 21 ASN 21 21 21 ASN ASN E . n 
F 2 1  PHE 1  1  1  PHE PHE F . n 
F 2 2  VAL 2  2  2  VAL VAL F . n 
F 2 3  ASN 3  3  3  ASN ASN F . n 
F 2 4  GLN 4  4  4  GLN GLN F . n 
F 2 5  HIS 5  5  5  HIS HIS F . n 
F 2 6  LEU 6  6  6  LEU LEU F . n 
F 2 7  CYS 7  7  7  CYS CYS F . n 
F 2 8  GLY 8  8  8  GLY GLY F . n 
F 2 9  SER 9  9  9  SER SER F . n 
F 2 10 HIS 10 10 10 HIS HIS F . n 
F 2 11 LEU 11 11 11 LEU LEU F . n 
F 2 12 VAL 12 12 12 VAL VAL F . n 
F 2 13 GLU 13 13 13 GLU GLU F . n 
F 2 14 ALA 14 14 14 ALA ALA F . n 
F 2 15 LEU 15 15 15 LEU LEU F . n 
F 2 16 TYR 16 16 16 TYR TYR F . n 
F 2 17 LEU 17 17 17 LEU LEU F . n 
F 2 18 VAL 18 18 18 VAL VAL F . n 
F 2 19 CYS 19 19 19 CYS CYS F . n 
F 2 20 GLY 20 20 20 GLY GLY F . n 
F 2 21 GLU 21 21 21 GLU GLU F . n 
F 2 22 ARG 22 22 22 ARG ARG F . n 
F 2 23 GLY 23 23 23 GLY GLY F . n 
F 2 24 PHE 24 24 24 PHE PHE F . n 
F 2 25 PHE 25 25 25 PHE PHE F . n 
F 2 26 TYR 26 26 26 TYR TYR F . n 
F 2 27 THR 27 27 27 THR THR F . n 
F 2 28 PRO 28 28 28 PRO PRO F . n 
F 2 29 LYS 29 29 29 LYS LYS F . n 
F 2 30 THR 30 30 ?  ?   ?   F . n 
G 1 1  GLY 1  1  1  GLY GLY G . n 
G 1 2  ILE 2  2  2  ILE ILE G . n 
G 1 3  VAL 3  3  3  VAL VAL G . n 
G 1 4  GLU 4  4  4  GLU GLU G . n 
G 1 5  GLN 5  5  5  GLN GLN G . n 
G 1 6  CYS 6  6  6  CYS CYS G . n 
G 1 7  CYS 7  7  7  CYS CYS G . n 
G 1 8  THR 8  8  8  THR THR G . n 
G 1 9  SER 9  9  9  SER SER G . n 
G 1 10 ILE 10 10 10 ILE ILE G . n 
G 1 11 CYS 11 11 11 CYS CYS G . n 
G 1 12 SER 12 12 12 SER SER G . n 
G 1 13 LEU 13 13 13 LEU LEU G . n 
G 1 14 TYR 14 14 14 TYR TYR G . n 
G 1 15 GLN 15 15 15 GLN GLN G . n 
G 1 16 LEU 16 16 16 LEU LEU G . n 
G 1 17 GLU 17 17 17 GLU GLU G . n 
G 1 18 ASN 18 18 18 ASN ASN G . n 
G 1 19 TYR 19 19 19 TYR TYR G . n 
G 1 20 CYS 20 20 20 CYS CYS G . n 
G 1 21 ASN 21 21 21 ASN ASN G . n 
H 2 1  PHE 1  1  1  PHE PHE H . n 
H 2 2  VAL 2  2  2  VAL VAL H . n 
H 2 3  ASN 3  3  3  ASN ASN H . n 
H 2 4  GLN 4  4  4  GLN GLN H . n 
H 2 5  HIS 5  5  5  HIS HIS H . n 
H 2 6  LEU 6  6  6  LEU LEU H . n 
H 2 7  CYS 7  7  7  CYS CYS H . n 
H 2 8  GLY 8  8  8  GLY GLY H . n 
H 2 9  SER 9  9  9  SER SER H . n 
H 2 10 HIS 10 10 10 HIS HIS H . n 
H 2 11 LEU 11 11 11 LEU LEU H . n 
H 2 12 VAL 12 12 12 VAL VAL H . n 
H 2 13 GLU 13 13 13 GLU GLU H . n 
H 2 14 ALA 14 14 14 ALA ALA H . n 
H 2 15 LEU 15 15 15 LEU LEU H . n 
H 2 16 TYR 16 16 16 TYR TYR H . n 
H 2 17 LEU 17 17 17 LEU LEU H . n 
H 2 18 VAL 18 18 18 VAL VAL H . n 
H 2 19 CYS 19 19 19 CYS CYS H . n 
H 2 20 GLY 20 20 20 GLY GLY H . n 
H 2 21 GLU 21 21 21 GLU GLU H . n 
H 2 22 ARG 22 22 22 ARG ARG H . n 
H 2 23 GLY 23 23 23 GLY GLY H . n 
H 2 24 PHE 24 24 24 PHE PHE H . n 
H 2 25 PHE 25 25 25 PHE PHE H . n 
H 2 26 TYR 26 26 26 TYR TYR H . n 
H 2 27 THR 27 27 27 THR THR H . n 
H 2 28 PRO 28 28 28 PRO PRO H . n 
H 2 29 LYS 29 29 29 LYS LYS H . n 
H 2 30 THR 30 30 ?  ?   ?   H . n 
I 1 1  GLY 1  1  1  GLY GLY I . n 
I 1 2  ILE 2  2  2  ILE ILE I . n 
I 1 3  VAL 3  3  3  VAL VAL I . n 
I 1 4  GLU 4  4  4  GLU GLU I . n 
I 1 5  GLN 5  5  5  GLN GLN I . n 
I 1 6  CYS 6  6  6  CYS CYS I . n 
I 1 7  CYS 7  7  7  CYS CYS I . n 
I 1 8  THR 8  8  8  THR THR I . n 
I 1 9  SER 9  9  9  SER SER I . n 
I 1 10 ILE 10 10 10 ILE ILE I . n 
I 1 11 CYS 11 11 11 CYS CYS I . n 
I 1 12 SER 12 12 12 SER SER I . n 
I 1 13 LEU 13 13 13 LEU LEU I . n 
I 1 14 TYR 14 14 14 TYR TYR I . n 
I 1 15 GLN 15 15 15 GLN GLN I . n 
I 1 16 LEU 16 16 16 LEU LEU I . n 
I 1 17 GLU 17 17 17 GLU GLU I . n 
I 1 18 ASN 18 18 18 ASN ASN I . n 
I 1 19 TYR 19 19 19 TYR TYR I . n 
I 1 20 CYS 20 20 20 CYS CYS I . n 
I 1 21 ASN 21 21 21 ASN ASN I . n 
J 2 1  PHE 1  1  1  PHE PHE J . n 
J 2 2  VAL 2  2  2  VAL VAL J . n 
J 2 3  ASN 3  3  3  ASN ASN J . n 
J 2 4  GLN 4  4  4  GLN GLN J . n 
J 2 5  HIS 5  5  5  HIS HIS J . n 
J 2 6  LEU 6  6  6  LEU LEU J . n 
J 2 7  CYS 7  7  7  CYS CYS J . n 
J 2 8  GLY 8  8  8  GLY GLY J . n 
J 2 9  SER 9  9  9  SER SER J . n 
J 2 10 HIS 10 10 10 HIS HIS J . n 
J 2 11 LEU 11 11 11 LEU LEU J . n 
J 2 12 VAL 12 12 12 VAL VAL J . n 
J 2 13 GLU 13 13 13 GLU GLU J . n 
J 2 14 ALA 14 14 14 ALA ALA J . n 
J 2 15 LEU 15 15 15 LEU LEU J . n 
J 2 16 TYR 16 16 16 TYR TYR J . n 
J 2 17 LEU 17 17 17 LEU LEU J . n 
J 2 18 VAL 18 18 18 VAL VAL J . n 
J 2 19 CYS 19 19 19 CYS CYS J . n 
J 2 20 GLY 20 20 20 GLY GLY J . n 
J 2 21 GLU 21 21 21 GLU GLU J . n 
J 2 22 ARG 22 22 22 ARG ARG J . n 
J 2 23 GLY 23 23 23 GLY GLY J . n 
J 2 24 PHE 24 24 24 PHE PHE J . n 
J 2 25 PHE 25 25 25 PHE PHE J . n 
J 2 26 TYR 26 26 26 TYR TYR J . n 
J 2 27 THR 27 27 27 THR THR J . n 
J 2 28 PRO 28 28 28 PRO PRO J . n 
J 2 29 LYS 29 29 29 LYS LYS J . n 
J 2 30 THR 30 30 30 THR THR J . n 
K 1 1  GLY 1  1  1  GLY GLY K . n 
K 1 2  ILE 2  2  2  ILE ILE K . n 
K 1 3  VAL 3  3  3  VAL VAL K . n 
K 1 4  GLU 4  4  4  GLU GLU K . n 
K 1 5  GLN 5  5  5  GLN GLN K . n 
K 1 6  CYS 6  6  6  CYS CYS K . n 
K 1 7  CYS 7  7  7  CYS CYS K . n 
K 1 8  THR 8  8  8  THR THR K . n 
K 1 9  SER 9  9  9  SER SER K . n 
K 1 10 ILE 10 10 10 ILE ILE K . n 
K 1 11 CYS 11 11 11 CYS CYS K . n 
K 1 12 SER 12 12 12 SER SER K . n 
K 1 13 LEU 13 13 13 LEU LEU K . n 
K 1 14 TYR 14 14 14 TYR TYR K . n 
K 1 15 GLN 15 15 15 GLN GLN K . n 
K 1 16 LEU 16 16 16 LEU LEU K . n 
K 1 17 GLU 17 17 17 GLU GLU K . n 
K 1 18 ASN 18 18 18 ASN ASN K . n 
K 1 19 TYR 19 19 19 TYR TYR K . n 
K 1 20 CYS 20 20 20 CYS CYS K . n 
K 1 21 ASN 21 21 21 ASN ASN K . n 
L 2 1  PHE 1  1  1  PHE PHE L . n 
L 2 2  VAL 2  2  2  VAL VAL L . n 
L 2 3  ASN 3  3  3  ASN ASN L . n 
L 2 4  GLN 4  4  4  GLN GLN L . n 
L 2 5  HIS 5  5  5  HIS HIS L . n 
L 2 6  LEU 6  6  6  LEU LEU L . n 
L 2 7  CYS 7  7  7  CYS CYS L . n 
L 2 8  GLY 8  8  8  GLY GLY L . n 
L 2 9  SER 9  9  9  SER SER L . n 
L 2 10 HIS 10 10 10 HIS HIS L . n 
L 2 11 LEU 11 11 11 LEU LEU L . n 
L 2 12 VAL 12 12 12 VAL VAL L . n 
L 2 13 GLU 13 13 13 GLU GLU L . n 
L 2 14 ALA 14 14 14 ALA ALA L . n 
L 2 15 LEU 15 15 15 LEU LEU L . n 
L 2 16 TYR 16 16 16 TYR TYR L . n 
L 2 17 LEU 17 17 17 LEU LEU L . n 
L 2 18 VAL 18 18 18 VAL VAL L . n 
L 2 19 CYS 19 19 19 CYS CYS L . n 
L 2 20 GLY 20 20 20 GLY GLY L . n 
L 2 21 GLU 21 21 21 GLU GLU L . n 
L 2 22 ARG 22 22 22 ARG ARG L . n 
L 2 23 GLY 23 23 23 GLY GLY L . n 
L 2 24 PHE 24 24 24 PHE PHE L . n 
L 2 25 PHE 25 25 25 PHE PHE L . n 
L 2 26 TYR 26 26 26 TYR TYR L . n 
L 2 27 THR 27 27 27 THR THR L . n 
L 2 28 PRO 28 28 28 PRO PRO L . n 
L 2 29 LYS 29 29 29 LYS LYS L . n 
L 2 30 THR 30 30 30 THR THR L . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  dodecameric 12 
2 software_defined_assembly            PISA dodecameric 12 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA 
2 1 A,B,E,F,I,J,M,N,O,P,S,V,X,Y,BA,CA,FA,GA                                        
2 2 C,D,G,H,K,L,Q,R,T,U,W,Z,AA,DA,EA,HA,IA                                         
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 12630 ? 
2 MORE         -207  ? 
2 'SSA (A^2)'  19790 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_645 -x+1,y-1/2,-z -1.0000000000 0.0000000000 0.0000000000 61.2300000000 0.0000000000 1.0000000000 
0.0000000000 -30.8250000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? N ZN . ? B ZN 31 ? 1_555 NE2 ? F HIS 10 ? F HIS 10 ? 1_555 107.5 ? 
2  NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? N ZN . ? B ZN 31 ? 1_555 NE2 ? J HIS 10 ? J HIS 10 ? 1_555 122.6 ? 
3  NE2 ? F HIS 10 ? F HIS 10 ? 1_555 ZN ? N ZN . ? B ZN 31 ? 1_555 NE2 ? J HIS 10 ? J HIS 10 ? 1_555 101.4 ? 
4  NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? N ZN . ? B ZN 31 ? 1_555 CL  ? O CL  .  ? B CL  32 ? 1_555 108.5 ? 
5  NE2 ? F HIS 10 ? F HIS 10 ? 1_555 ZN ? N ZN . ? B ZN 31 ? 1_555 CL  ? O CL  .  ? B CL  32 ? 1_555 112.6 ? 
6  NE2 ? J HIS 10 ? J HIS 10 ? 1_555 ZN ? N ZN . ? B ZN 31 ? 1_555 CL  ? O CL  .  ? B CL  32 ? 1_555 104.2 ? 
7  NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? R ZN . ? D ZN 31 ? 1_555 NE2 ? H HIS 10 ? H HIS 10 ? 1_555 110.0 ? 
8  NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? R ZN . ? D ZN 31 ? 1_555 NE2 ? L HIS 10 ? L HIS 10 ? 1_555 98.0  ? 
9  NE2 ? H HIS 10 ? H HIS 10 ? 1_555 ZN ? R ZN . ? D ZN 31 ? 1_555 NE2 ? L HIS 10 ? L HIS 10 ? 1_555 119.8 ? 
10 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? R ZN . ? D ZN 31 ? 1_555 CL  ? U CL  .  ? H CL  31 ? 1_555 111.2 ? 
11 NE2 ? H HIS 10 ? H HIS 10 ? 1_555 ZN ? R ZN . ? D ZN 31 ? 1_555 CL  ? U CL  .  ? H CL  31 ? 1_555 109.8 ? 
12 NE2 ? L HIS 10 ? L HIS 10 ? 1_555 ZN ? R ZN . ? D ZN 31 ? 1_555 CL  ? U CL  .  ? H CL  31 ? 1_555 107.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-01-28 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO  'data reduction' .     ? 1 
CCP4   'data reduction' .     ? 2 
CCP4   'model building' SUITE ? 3 
PROLSQ refinement       .     ? 4 
CCP4   'data scaling'   .     ? 5 
CCP4   phasing          .     ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 G GLN 5  ? ? OH G TYR 19 ? ? 2.08 
2 1 OE1 B GLN 4  ? ? O  B HOH 36 ? ? 2.09 
3 1 O   H HOH 38 ? ? O  H HOH 53 ? ? 2.10 
4 1 O   H HOH 35 ? ? O  H HOH 39 ? ? 2.15 
5 1 O   F HOH 46 ? ? O  L HOH 44 ? ? 2.16 
6 1 O   F SER 9  ? ? O  F HOH 37 ? ? 2.16 
7 1 O   H HOH 45 ? ? O  H HOH 47 ? ? 2.18 
8 1 OD1 A ASN 18 ? ? O  A HOH 26 ? ? 2.18 
9 1 O   L HOH 51 ? ? O  L HOH 54 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A ASN 21 ? ? CA  A ASN 21 ? ? C   A ASN 21 ? ? 122.59 110.40 12.19  2.00 N 
2  1 CB  B LEU 6  ? ? CG  B LEU 6  ? ? CD2 B LEU 6  ? ? 121.36 111.00 10.36  1.70 N 
3  1 CA  B GLY 8  ? ? C   B GLY 8  ? ? O   B GLY 8  ? ? 107.14 120.60 -13.46 1.80 N 
4  1 CA  B VAL 12 ? ? CB  B VAL 12 ? ? CG2 B VAL 12 ? ? 120.04 110.90 9.14   1.50 N 
5  1 NE  B ARG 22 ? ? CZ  B ARG 22 ? ? NH2 B ARG 22 ? ? 114.06 120.30 -6.24  0.50 N 
6  1 CB  C TYR 14 ? ? CG  C TYR 14 ? ? CD2 C TYR 14 ? ? 117.26 121.00 -3.74  0.60 N 
7  1 CA  C CYS 20 ? ? CB  C CYS 20 ? ? SG  C CYS 20 ? ? 123.44 114.20 9.24   1.10 N 
8  1 CA  D GLN 4  ? ? CB  D GLN 4  ? ? CG  D GLN 4  ? ? 97.91  113.40 -15.49 2.20 N 
9  1 CB  D TYR 16 ? ? CG  D TYR 16 ? ? CD2 D TYR 16 ? ? 116.99 121.00 -4.01  0.60 N 
10 1 NE  D ARG 22 ? ? CZ  D ARG 22 ? ? NH1 D ARG 22 ? ? 124.48 120.30 4.18   0.50 N 
11 1 NE  D ARG 22 ? ? CZ  D ARG 22 ? ? NH2 D ARG 22 ? ? 113.77 120.30 -6.53  0.50 N 
12 1 CA  E CYS 11 ? ? CB  E CYS 11 ? ? SG  E CYS 11 ? ? 121.36 114.20 7.16   1.10 N 
13 1 CB  E LEU 13 ? ? CA  E LEU 13 ? ? C   E LEU 13 ? ? 121.90 110.20 11.70  1.90 N 
14 1 CE1 F HIS 10 ? ? NE2 F HIS 10 ? ? CD2 F HIS 10 ? ? 115.71 109.00 6.71   0.70 N 
15 1 CB  F LEU 11 ? ? CG  F LEU 11 ? ? CD1 F LEU 11 ? ? 99.60  111.00 -11.40 1.70 N 
16 1 OE1 F GLU 13 ? ? CD  F GLU 13 ? ? OE2 F GLU 13 ? ? 133.70 123.30 10.40  1.20 N 
17 1 CG  F GLU 13 ? ? CD  F GLU 13 ? ? OE2 F GLU 13 ? ? 105.86 118.30 -12.44 2.00 N 
18 1 CB  F TYR 16 ? ? CG  F TYR 16 ? ? CD1 F TYR 16 ? ? 116.52 121.00 -4.48  0.60 N 
19 1 NE  F ARG 22 ? ? CZ  F ARG 22 ? ? NH1 F ARG 22 ? ? 125.45 120.30 5.15   0.50 N 
20 1 CB  F TYR 26 ? ? CG  F TYR 26 ? ? CD1 F TYR 26 ? ? 117.03 121.00 -3.97  0.60 N 
21 1 CG  G GLU 4  ? ? CD  G GLU 4  ? A OE1 G GLU 4  ? A 131.17 118.30 12.87  2.00 N 
22 1 NE  H ARG 22 ? ? CZ  H ARG 22 ? ? NH1 H ARG 22 ? ? 124.10 120.30 3.80   0.50 N 
23 1 N   H PHE 25 ? ? CA  H PHE 25 ? ? CB  H PHE 25 ? ? 124.31 110.60 13.71  1.80 N 
24 1 OE1 I GLU 17 ? ? CD  I GLU 17 ? ? OE2 I GLU 17 ? ? 138.77 123.30 15.47  1.20 N 
25 1 CG  I GLU 17 ? ? CD  I GLU 17 ? ? OE2 I GLU 17 ? ? 103.15 118.30 -15.15 2.00 N 
26 1 CD  J ARG 22 ? A NE  J ARG 22 ? A CZ  J ARG 22 ? A 133.67 123.60 10.07  1.40 N 
27 1 NE  J ARG 22 ? B CZ  J ARG 22 ? B NH1 J ARG 22 ? B 117.25 120.30 -3.05  0.50 N 
28 1 CB  K CYS 6  ? ? CA  K CYS 6  ? ? C   K CYS 6  ? ? 120.54 111.50 9.04   1.20 N 
29 1 N   K SER 9  ? ? CA  K SER 9  ? ? CB  K SER 9  ? ? 125.07 110.50 14.57  1.50 N 
30 1 N   L SER 9  ? ? CA  L SER 9  ? ? CB  L SER 9  ? ? 100.10 110.50 -10.40 1.50 N 
31 1 CB  L TYR 16 ? ? CG  L TYR 16 ? ? CD1 L TYR 16 ? ? 115.42 121.00 -5.58  0.60 N 
32 1 CG  L ARG 22 ? ? CD  L ARG 22 ? ? NE  L ARG 22 ? ? 127.46 111.80 15.66  2.10 N 
33 1 NH1 L ARG 22 ? ? CZ  L ARG 22 ? ? NH2 L ARG 22 ? ? 109.25 119.40 -10.15 1.10 N 
34 1 NE  L ARG 22 ? ? CZ  L ARG 22 ? ? NH1 L ARG 22 ? ? 133.15 120.30 12.85  0.50 N 
35 1 NE  L ARG 22 ? ? CZ  L ARG 22 ? ? NH2 L ARG 22 ? ? 117.15 120.30 -3.15  0.50 N 
36 1 CB  L TYR 26 ? ? CG  L TYR 26 ? ? CD2 L TYR 26 ? ? 125.91 121.00 4.91   0.60 N 
37 1 CB  L TYR 26 ? ? CG  L TYR 26 ? ? CD1 L TYR 26 ? ? 116.97 121.00 -4.03  0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS B 29 ? ? -49.07 74.93  
2 1 VAL J 2  ? ? -80.10 38.49  
3 1 LYS J 29 ? ? -93.09 -67.07 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TYR 14 ? CG  ? A TYR 14 CG  
2  1 Y 1 A TYR 14 ? CD1 ? A TYR 14 CD1 
3  1 Y 1 A TYR 14 ? CD2 ? A TYR 14 CD2 
4  1 Y 1 A TYR 14 ? CE1 ? A TYR 14 CE1 
5  1 Y 1 A TYR 14 ? CE2 ? A TYR 14 CE2 
6  1 Y 1 A TYR 14 ? CZ  ? A TYR 14 CZ  
7  1 Y 1 A TYR 14 ? OH  ? A TYR 14 OH  
8  1 Y 1 B LYS 29 ? CG  ? B LYS 29 CG  
9  1 Y 1 B LYS 29 ? CD  ? B LYS 29 CD  
10 1 Y 1 B LYS 29 ? CE  ? B LYS 29 CE  
11 1 Y 1 B LYS 29 ? NZ  ? B LYS 29 NZ  
12 1 Y 1 B THR 30 ? C   ? B THR 30 C   
13 1 Y 1 B THR 30 ? O   ? B THR 30 O   
14 1 Y 1 B THR 30 ? CB  ? B THR 30 CB  
15 1 Y 1 B THR 30 ? OG1 ? B THR 30 OG1 
16 1 Y 1 B THR 30 ? CG2 ? B THR 30 CG2 
17 1 Y 1 D PHE 1  ? CG  ? D PHE 1  CG  
18 1 Y 1 D PHE 1  ? CD1 ? D PHE 1  CD1 
19 1 Y 1 D PHE 1  ? CD2 ? D PHE 1  CD2 
20 1 Y 1 D PHE 1  ? CE1 ? D PHE 1  CE1 
21 1 Y 1 D PHE 1  ? CE2 ? D PHE 1  CE2 
22 1 Y 1 D PHE 1  ? CZ  ? D PHE 1  CZ  
23 1 Y 1 D LYS 29 ? CD  ? D LYS 29 CD  
24 1 Y 1 D LYS 29 ? CE  ? D LYS 29 CE  
25 1 Y 1 D LYS 29 ? NZ  ? D LYS 29 NZ  
26 1 Y 1 F PHE 1  ? N   ? F PHE 1  N   
27 1 Y 1 F PHE 1  ? CB  ? F PHE 1  CB  
28 1 Y 1 F PHE 1  ? CG  ? F PHE 1  CG  
29 1 Y 1 F PHE 1  ? CD1 ? F PHE 1  CD1 
30 1 Y 1 F PHE 1  ? CD2 ? F PHE 1  CD2 
31 1 Y 1 F PHE 1  ? CE1 ? F PHE 1  CE1 
32 1 Y 1 F PHE 1  ? CE2 ? F PHE 1  CE2 
33 1 Y 1 F PHE 1  ? CZ  ? F PHE 1  CZ  
34 1 Y 1 F LYS 29 ? CG  ? F LYS 29 CG  
35 1 Y 1 F LYS 29 ? CD  ? F LYS 29 CD  
36 1 Y 1 F LYS 29 ? CE  ? F LYS 29 CE  
37 1 Y 1 F LYS 29 ? NZ  ? F LYS 29 NZ  
38 1 Y 1 H LYS 29 ? CA  ? H LYS 29 CA  
39 1 Y 1 H LYS 29 ? C   ? H LYS 29 C   
40 1 Y 1 H LYS 29 ? O   ? H LYS 29 O   
41 1 Y 1 H LYS 29 ? CB  ? H LYS 29 CB  
42 1 Y 1 H LYS 29 ? CG  ? H LYS 29 CG  
43 1 Y 1 H LYS 29 ? CD  ? H LYS 29 CD  
44 1 Y 1 H LYS 29 ? CE  ? H LYS 29 CE  
45 1 Y 1 H LYS 29 ? NZ  ? H LYS 29 NZ  
46 1 Y 1 J LYS 29 ? CG  ? J LYS 29 CG  
47 1 Y 1 J LYS 29 ? CD  ? J LYS 29 CD  
48 1 Y 1 J LYS 29 ? CE  ? J LYS 29 CE  
49 1 Y 1 J LYS 29 ? NZ  ? J LYS 29 NZ  
50 1 Y 1 J THR 30 ? C   ? J THR 30 C   
51 1 Y 1 J THR 30 ? O   ? J THR 30 O   
52 1 Y 1 J THR 30 ? CB  ? J THR 30 CB  
53 1 Y 1 J THR 30 ? OG1 ? J THR 30 OG1 
54 1 Y 1 J THR 30 ? CG2 ? J THR 30 CG2 
55 1 Y 1 L PHE 1  ? CB  ? L PHE 1  CB  
56 1 Y 1 L PHE 1  ? CG  ? L PHE 1  CG  
57 1 Y 1 L PHE 1  ? CD1 ? L PHE 1  CD1 
58 1 Y 1 L PHE 1  ? CD2 ? L PHE 1  CD2 
59 1 Y 1 L PHE 1  ? CE1 ? L PHE 1  CE1 
60 1 Y 1 L PHE 1  ? CE2 ? L PHE 1  CE2 
61 1 Y 1 L PHE 1  ? CZ  ? L PHE 1  CZ  
62 1 Y 1 L GLU 21 ? CG  ? L GLU 21 CG  
63 1 Y 1 L GLU 21 ? CD  ? L GLU 21 CD  
64 1 Y 1 L GLU 21 ? OE1 ? L GLU 21 OE1 
65 1 Y 1 L GLU 21 ? OE2 ? L GLU 21 OE2 
66 1 Y 1 L LYS 29 ? CE  ? L LYS 29 CE  
67 1 Y 1 L LYS 29 ? NZ  ? L LYS 29 NZ  
68 1 Y 1 L THR 30 ? C   ? L THR 30 C   
69 1 Y 1 L THR 30 ? O   ? L THR 30 O   
70 1 Y 1 L THR 30 ? CB  ? L THR 30 CB  
71 1 Y 1 L THR 30 ? OG1 ? L THR 30 OG1 
72 1 Y 1 L THR 30 ? CG2 ? L THR 30 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 D THR 30 ? D THR 30 
2 1 Y 1 F THR 30 ? F THR 30 
3 1 Y 1 H THR 30 ? H THR 30 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 PHENOL         IPH 
4 'ZINC ION'     ZN  
5 'CHLORIDE ION' CL  
6 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
M  3 IPH 1  22  11  IPH IPH A . 
N  4 ZN  1  31  1   ZN  ZN  B . 
O  5 CL  1  32  3   CL  CL  B . 
P  3 IPH 1  33  17  IPH IPH B . 
Q  3 IPH 1  22  12  IPH IPH C . 
R  4 ZN  1  31  2   ZN  ZN  D . 
S  3 IPH 1  22  13  IPH IPH E . 
T  3 IPH 1  22  14  IPH IPH G . 
U  5 CL  1  31  4   CL  CL  H . 
V  3 IPH 1  22  15  IPH IPH I . 
W  3 IPH 1  22  16  IPH IPH K . 
X  6 HOH 1  23  5   HOH HOH A . 
X  6 HOH 2  24  6   HOH HOH A . 
X  6 HOH 3  25  62  HOH HOH A . 
X  6 HOH 4  26  69  HOH HOH A . 
X  6 HOH 5  27  70  HOH HOH A . 
X  6 HOH 6  28  71  HOH HOH A . 
X  6 HOH 7  29  72  HOH HOH A . 
X  6 HOH 8  30  104 HOH HOH A . 
X  6 HOH 9  31  129 HOH HOH A . 
X  6 HOH 10 32  151 HOH HOH A . 
X  6 HOH 11 33  193 HOH HOH A . 
X  6 HOH 12 34  195 HOH HOH A . 
X  6 HOH 13 35  198 HOH HOH A . 
X  6 HOH 14 36  203 HOH HOH A . 
X  6 HOH 15 37  204 HOH HOH A . 
X  6 HOH 16 38  206 HOH HOH A . 
X  6 HOH 17 39  207 HOH HOH A . 
X  6 HOH 18 40  208 HOH HOH A . 
X  6 HOH 19 41  212 HOH HOH A . 
X  6 HOH 20 42  249 HOH HOH A . 
X  6 HOH 21 43  250 HOH HOH A . 
X  6 HOH 22 44  274 HOH HOH A . 
X  6 HOH 23 45  275 HOH HOH A . 
X  6 HOH 24 46  279 HOH HOH A . 
X  6 HOH 25 47  289 HOH HOH A . 
X  6 HOH 26 48  305 HOH HOH A . 
X  6 HOH 27 49  307 HOH HOH A . 
X  6 HOH 28 50  310 HOH HOH A . 
X  6 HOH 29 51  320 HOH HOH A . 
X  6 HOH 30 52  322 HOH HOH A . 
X  6 HOH 31 53  323 HOH HOH A . 
Y  6 HOH 1  34  9   HOH HOH B . 
Y  6 HOH 2  35  14  HOH HOH B . 
Y  6 HOH 3  36  16  HOH HOH B . 
Y  6 HOH 4  37  18  HOH HOH B . 
Y  6 HOH 5  38  36  HOH HOH B . 
Y  6 HOH 6  39  37  HOH HOH B . 
Y  6 HOH 7  40  43  HOH HOH B . 
Y  6 HOH 8  41  47  HOH HOH B . 
Y  6 HOH 9  42  49  HOH HOH B . 
Y  6 HOH 10 43  52  HOH HOH B . 
Y  6 HOH 11 44  53  HOH HOH B . 
Y  6 HOH 12 45  63  HOH HOH B . 
Y  6 HOH 13 46  77  HOH HOH B . 
Y  6 HOH 14 47  127 HOH HOH B . 
Y  6 HOH 15 48  131 HOH HOH B . 
Y  6 HOH 16 49  136 HOH HOH B . 
Y  6 HOH 17 50  139 HOH HOH B . 
Y  6 HOH 18 51  159 HOH HOH B . 
Y  6 HOH 19 52  160 HOH HOH B . 
Y  6 HOH 20 53  214 HOH HOH B . 
Y  6 HOH 21 54  215 HOH HOH B . 
Y  6 HOH 22 55  227 HOH HOH B . 
Y  6 HOH 23 56  236 HOH HOH B . 
Y  6 HOH 24 57  267 HOH HOH B . 
Y  6 HOH 25 58  280 HOH HOH B . 
Y  6 HOH 26 59  291 HOH HOH B . 
Y  6 HOH 27 60  292 HOH HOH B . 
Y  6 HOH 28 61  293 HOH HOH B . 
Y  6 HOH 29 62  304 HOH HOH B . 
Z  6 HOH 1  23  17  HOH HOH C . 
Z  6 HOH 2  24  19  HOH HOH C . 
Z  6 HOH 3  25  67  HOH HOH C . 
Z  6 HOH 4  26  75  HOH HOH C . 
Z  6 HOH 5  27  76  HOH HOH C . 
Z  6 HOH 6  28  78  HOH HOH C . 
Z  6 HOH 7  29  141 HOH HOH C . 
Z  6 HOH 8  30  144 HOH HOH C . 
Z  6 HOH 9  31  163 HOH HOH C . 
Z  6 HOH 10 32  167 HOH HOH C . 
Z  6 HOH 11 33  173 HOH HOH C . 
Z  6 HOH 12 34  192 HOH HOH C . 
Z  6 HOH 13 35  211 HOH HOH C . 
Z  6 HOH 14 36  228 HOH HOH C . 
Z  6 HOH 15 37  239 HOH HOH C . 
Z  6 HOH 16 38  242 HOH HOH C . 
Z  6 HOH 17 39  243 HOH HOH C . 
Z  6 HOH 18 40  244 HOH HOH C . 
Z  6 HOH 19 41  251 HOH HOH C . 
Z  6 HOH 20 42  258 HOH HOH C . 
Z  6 HOH 21 43  259 HOH HOH C . 
Z  6 HOH 22 44  260 HOH HOH C . 
Z  6 HOH 23 45  311 HOH HOH C . 
Z  6 HOH 24 46  318 HOH HOH C . 
AA 6 HOH 1  32  2   HOH HOH D . 
AA 6 HOH 2  33  27  HOH HOH D . 
AA 6 HOH 3  34  28  HOH HOH D . 
AA 6 HOH 4  35  29  HOH HOH D . 
AA 6 HOH 5  36  33  HOH HOH D . 
AA 6 HOH 6  37  39  HOH HOH D . 
AA 6 HOH 7  38  44  HOH HOH D . 
AA 6 HOH 8  39  45  HOH HOH D . 
AA 6 HOH 9  40  46  HOH HOH D . 
AA 6 HOH 10 41  64  HOH HOH D . 
AA 6 HOH 11 42  66  HOH HOH D . 
AA 6 HOH 12 43  73  HOH HOH D . 
AA 6 HOH 13 44  74  HOH HOH D . 
AA 6 HOH 14 45  124 HOH HOH D . 
AA 6 HOH 15 46  125 HOH HOH D . 
AA 6 HOH 16 47  142 HOH HOH D . 
AA 6 HOH 17 48  161 HOH HOH D . 
AA 6 HOH 18 49  166 HOH HOH D . 
AA 6 HOH 19 50  168 HOH HOH D . 
AA 6 HOH 20 51  180 HOH HOH D . 
AA 6 HOH 21 52  181 HOH HOH D . 
AA 6 HOH 22 53  196 HOH HOH D . 
AA 6 HOH 23 54  197 HOH HOH D . 
AA 6 HOH 24 55  209 HOH HOH D . 
AA 6 HOH 25 56  216 HOH HOH D . 
AA 6 HOH 26 57  240 HOH HOH D . 
AA 6 HOH 27 58  241 HOH HOH D . 
AA 6 HOH 28 59  281 HOH HOH D . 
AA 6 HOH 29 60  290 HOH HOH D . 
AA 6 HOH 30 61  296 HOH HOH D . 
AA 6 HOH 31 62  302 HOH HOH D . 
AA 6 HOH 32 63  303 HOH HOH D . 
AA 6 HOH 33 64  314 HOH HOH D . 
AA 6 HOH 34 65  317 HOH HOH D . 
AA 6 HOH 35 66  330 HOH HOH D . 
BA 6 HOH 1  23  11  HOH HOH E . 
BA 6 HOH 2  24  12  HOH HOH E . 
BA 6 HOH 3  25  79  HOH HOH E . 
BA 6 HOH 4  26  82  HOH HOH E . 
BA 6 HOH 5  27  83  HOH HOH E . 
BA 6 HOH 6  28  84  HOH HOH E . 
BA 6 HOH 7  29  87  HOH HOH E . 
BA 6 HOH 8  30  88  HOH HOH E . 
BA 6 HOH 9  31  92  HOH HOH E . 
BA 6 HOH 10 32  184 HOH HOH E . 
BA 6 HOH 11 33  217 HOH HOH E . 
BA 6 HOH 12 34  237 HOH HOH E . 
BA 6 HOH 13 35  256 HOH HOH E . 
BA 6 HOH 14 36  277 HOH HOH E . 
BA 6 HOH 15 37  294 HOH HOH E . 
BA 6 HOH 16 38  297 HOH HOH E . 
BA 6 HOH 17 39  331 HOH HOH E . 
CA 6 HOH 1  31  3   HOH HOH F . 
CA 6 HOH 2  32  4   HOH HOH F . 
CA 6 HOH 3  33  20  HOH HOH F . 
CA 6 HOH 4  34  21  HOH HOH F . 
CA 6 HOH 5  35  22  HOH HOH F . 
CA 6 HOH 6  36  23  HOH HOH F . 
CA 6 HOH 7  37  30  HOH HOH F . 
CA 6 HOH 8  38  55  HOH HOH F . 
CA 6 HOH 9  39  68  HOH HOH F . 
CA 6 HOH 10 40  80  HOH HOH F . 
CA 6 HOH 11 41  81  HOH HOH F . 
CA 6 HOH 12 42  95  HOH HOH F . 
CA 6 HOH 13 43  97  HOH HOH F . 
CA 6 HOH 14 44  113 HOH HOH F . 
CA 6 HOH 15 45  116 HOH HOH F . 
CA 6 HOH 16 46  117 HOH HOH F . 
CA 6 HOH 17 47  120 HOH HOH F . 
CA 6 HOH 18 48  121 HOH HOH F . 
CA 6 HOH 19 49  126 HOH HOH F . 
CA 6 HOH 20 50  128 HOH HOH F . 
CA 6 HOH 21 51  147 HOH HOH F . 
CA 6 HOH 22 52  155 HOH HOH F . 
CA 6 HOH 23 53  156 HOH HOH F . 
CA 6 HOH 24 54  183 HOH HOH F . 
CA 6 HOH 25 55  200 HOH HOH F . 
CA 6 HOH 26 56  232 HOH HOH F . 
CA 6 HOH 27 57  257 HOH HOH F . 
CA 6 HOH 28 58  295 HOH HOH F . 
CA 6 HOH 29 59  326 HOH HOH F . 
DA 6 HOH 1  23  13  HOH HOH G . 
DA 6 HOH 2  24  51  HOH HOH G . 
DA 6 HOH 3  25  61  HOH HOH G . 
DA 6 HOH 4  26  86  HOH HOH G . 
DA 6 HOH 5  27  99  HOH HOH G . 
DA 6 HOH 6  28  101 HOH HOH G . 
DA 6 HOH 7  29  102 HOH HOH G . 
DA 6 HOH 8  30  130 HOH HOH G . 
DA 6 HOH 9  31  152 HOH HOH G . 
DA 6 HOH 10 32  154 HOH HOH G . 
DA 6 HOH 11 33  162 HOH HOH G . 
DA 6 HOH 12 34  188 HOH HOH G . 
DA 6 HOH 13 35  189 HOH HOH G . 
DA 6 HOH 14 36  190 HOH HOH G . 
DA 6 HOH 15 37  191 HOH HOH G . 
DA 6 HOH 16 38  201 HOH HOH G . 
DA 6 HOH 17 39  230 HOH HOH G . 
DA 6 HOH 18 40  231 HOH HOH G . 
DA 6 HOH 19 41  268 HOH HOH G . 
DA 6 HOH 20 42  284 HOH HOH G . 
DA 6 HOH 21 43  285 HOH HOH G . 
DA 6 HOH 22 44  298 HOH HOH G . 
DA 6 HOH 23 45  319 HOH HOH G . 
DA 6 HOH 24 46  321 HOH HOH G . 
EA 6 HOH 1  32  24  HOH HOH H . 
EA 6 HOH 2  33  25  HOH HOH H . 
EA 6 HOH 3  34  34  HOH HOH H . 
EA 6 HOH 4  35  35  HOH HOH H . 
EA 6 HOH 5  36  38  HOH HOH H . 
EA 6 HOH 6  37  85  HOH HOH H . 
EA 6 HOH 7  38  90  HOH HOH H . 
EA 6 HOH 8  39  96  HOH HOH H . 
EA 6 HOH 9  40  98  HOH HOH H . 
EA 6 HOH 10 41  103 HOH HOH H . 
EA 6 HOH 11 42  105 HOH HOH H . 
EA 6 HOH 12 43  122 HOH HOH H . 
EA 6 HOH 13 44  132 HOH HOH H . 
EA 6 HOH 14 45  133 HOH HOH H . 
EA 6 HOH 15 46  134 HOH HOH H . 
EA 6 HOH 16 47  135 HOH HOH H . 
EA 6 HOH 17 48  138 HOH HOH H . 
EA 6 HOH 18 49  187 HOH HOH H . 
EA 6 HOH 19 50  194 HOH HOH H . 
EA 6 HOH 20 51  199 HOH HOH H . 
EA 6 HOH 21 52  229 HOH HOH H . 
EA 6 HOH 22 53  254 HOH HOH H . 
EA 6 HOH 23 54  306 HOH HOH H . 
EA 6 HOH 24 55  309 HOH HOH H . 
EA 6 HOH 25 56  313 HOH HOH H . 
EA 6 HOH 26 57  325 HOH HOH H . 
EA 6 HOH 27 58  327 HOH HOH H . 
FA 6 HOH 1  48  48  HOH HOH I . 
FA 6 HOH 2  60  60  HOH HOH I . 
FA 6 HOH 3  100 100 HOH HOH I . 
FA 6 HOH 4  106 106 HOH HOH I . 
FA 6 HOH 5  107 107 HOH HOH I . 
FA 6 HOH 6  140 140 HOH HOH I . 
FA 6 HOH 7  143 143 HOH HOH I . 
FA 6 HOH 8  145 145 HOH HOH I . 
FA 6 HOH 9  146 146 HOH HOH I . 
FA 6 HOH 10 153 153 HOH HOH I . 
FA 6 HOH 11 157 157 HOH HOH I . 
FA 6 HOH 12 158 158 HOH HOH I . 
FA 6 HOH 13 164 164 HOH HOH I . 
FA 6 HOH 14 182 182 HOH HOH I . 
FA 6 HOH 15 210 210 HOH HOH I . 
FA 6 HOH 16 213 213 HOH HOH I . 
FA 6 HOH 17 218 218 HOH HOH I . 
FA 6 HOH 18 219 219 HOH HOH I . 
FA 6 HOH 19 220 220 HOH HOH I . 
FA 6 HOH 20 221 221 HOH HOH I . 
FA 6 HOH 21 222 222 HOH HOH I . 
FA 6 HOH 22 223 223 HOH HOH I . 
FA 6 HOH 23 224 224 HOH HOH I . 
FA 6 HOH 24 225 225 HOH HOH I . 
FA 6 HOH 25 226 226 HOH HOH I . 
FA 6 HOH 26 248 248 HOH HOH I . 
FA 6 HOH 27 266 266 HOH HOH I . 
FA 6 HOH 28 269 269 HOH HOH I . 
FA 6 HOH 29 276 276 HOH HOH I . 
FA 6 HOH 30 316 316 HOH HOH I . 
FA 6 HOH 31 328 328 HOH HOH I . 
FA 6 HOH 32 329 329 HOH HOH I . 
GA 6 HOH 1  31  7   HOH HOH J . 
GA 6 HOH 2  32  8   HOH HOH J . 
GA 6 HOH 3  33  10  HOH HOH J . 
GA 6 HOH 4  34  31  HOH HOH J . 
GA 6 HOH 5  35  40  HOH HOH J . 
GA 6 HOH 6  36  41  HOH HOH J . 
GA 6 HOH 7  37  56  HOH HOH J . 
GA 6 HOH 8  38  59  HOH HOH J . 
GA 6 HOH 9  39  65  HOH HOH J . 
GA 6 HOH 10 40  94  HOH HOH J . 
GA 6 HOH 11 41  109 HOH HOH J . 
GA 6 HOH 12 42  123 HOH HOH J . 
GA 6 HOH 13 43  137 HOH HOH J . 
GA 6 HOH 14 44  170 HOH HOH J . 
GA 6 HOH 15 45  171 HOH HOH J . 
GA 6 HOH 16 46  172 HOH HOH J . 
GA 6 HOH 17 47  202 HOH HOH J . 
GA 6 HOH 18 48  233 HOH HOH J . 
GA 6 HOH 19 49  234 HOH HOH J . 
GA 6 HOH 20 50  235 HOH HOH J . 
GA 6 HOH 21 51  238 HOH HOH J . 
GA 6 HOH 22 52  246 HOH HOH J . 
GA 6 HOH 23 53  261 HOH HOH J . 
GA 6 HOH 24 54  282 HOH HOH J . 
GA 6 HOH 25 55  308 HOH HOH J . 
GA 6 HOH 26 56  312 HOH HOH J . 
HA 6 HOH 1  23  15  HOH HOH K . 
HA 6 HOH 2  24  54  HOH HOH K . 
HA 6 HOH 3  25  91  HOH HOH K . 
HA 6 HOH 4  26  114 HOH HOH K . 
HA 6 HOH 5  27  115 HOH HOH K . 
HA 6 HOH 6  28  148 HOH HOH K . 
HA 6 HOH 7  29  149 HOH HOH K . 
HA 6 HOH 8  30  169 HOH HOH K . 
HA 6 HOH 9  31  178 HOH HOH K . 
HA 6 HOH 10 32  185 HOH HOH K . 
HA 6 HOH 11 33  186 HOH HOH K . 
HA 6 HOH 12 34  205 HOH HOH K . 
HA 6 HOH 13 35  247 HOH HOH K . 
HA 6 HOH 14 36  252 HOH HOH K . 
HA 6 HOH 15 37  253 HOH HOH K . 
HA 6 HOH 16 38  270 HOH HOH K . 
HA 6 HOH 17 39  271 HOH HOH K . 
HA 6 HOH 18 40  272 HOH HOH K . 
HA 6 HOH 19 41  273 HOH HOH K . 
HA 6 HOH 20 42  278 HOH HOH K . 
HA 6 HOH 21 43  283 HOH HOH K . 
HA 6 HOH 22 44  286 HOH HOH K . 
HA 6 HOH 23 45  287 HOH HOH K . 
HA 6 HOH 24 46  288 HOH HOH K . 
HA 6 HOH 25 47  300 HOH HOH K . 
IA 6 HOH 1  31  1   HOH HOH L . 
IA 6 HOH 2  32  26  HOH HOH L . 
IA 6 HOH 3  33  32  HOH HOH L . 
IA 6 HOH 4  34  42  HOH HOH L . 
IA 6 HOH 5  35  50  HOH HOH L . 
IA 6 HOH 6  36  57  HOH HOH L . 
IA 6 HOH 7  37  58  HOH HOH L . 
IA 6 HOH 8  38  89  HOH HOH L . 
IA 6 HOH 9  39  93  HOH HOH L . 
IA 6 HOH 10 40  108 HOH HOH L . 
IA 6 HOH 11 41  110 HOH HOH L . 
IA 6 HOH 12 42  111 HOH HOH L . 
IA 6 HOH 13 43  112 HOH HOH L . 
IA 6 HOH 14 44  118 HOH HOH L . 
IA 6 HOH 15 45  119 HOH HOH L . 
IA 6 HOH 16 46  150 HOH HOH L . 
IA 6 HOH 17 47  165 HOH HOH L . 
IA 6 HOH 18 48  174 HOH HOH L . 
IA 6 HOH 19 49  175 HOH HOH L . 
IA 6 HOH 20 50  176 HOH HOH L . 
IA 6 HOH 21 51  177 HOH HOH L . 
IA 6 HOH 22 52  179 HOH HOH L . 
IA 6 HOH 23 53  245 HOH HOH L . 
IA 6 HOH 24 54  255 HOH HOH L . 
IA 6 HOH 25 55  262 HOH HOH L . 
IA 6 HOH 26 56  263 HOH HOH L . 
IA 6 HOH 27 57  264 HOH HOH L . 
IA 6 HOH 28 58  265 HOH HOH L . 
IA 6 HOH 29 59  299 HOH HOH L . 
IA 6 HOH 30 60  301 HOH HOH L . 
IA 6 HOH 31 61  315 HOH HOH L . 
IA 6 HOH 32 62  324 HOH HOH L . 
#